4CFUD

Structure-based design of c8-substituted o6-cyclohexylmethoxyguanine cdk1 and 2 inhibitors.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
262
structure length
262
Chain Sequence
b'NENEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 2
publication title 8-Substituted O6-Cyclohexylmethylguanine Cdk2 Inhibitors; Using Structure-Based Inhibitor Design to Optimise an Alternative Binding Mode.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00134 Cyclin_N Cyclin, N-terminal domain
D PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4cfuD01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4cfuD02
2WXVB 2WHBB 1FVVB 3F5XB 2C4GB 3BLRB 3EOCB 1H1RB 1JSTB 2IVXA 3MY1B 4BCKB 1H1QB 4BCOB 4EORB 2CJMB 4F70B 1AD6A 1UNGD 1GY3B 2CCHB 1VOLA 4EOIB 5ICPB 4CRLB 5LMKB 4II5B 2I53A 5ACBA 4EOQB 2W9FA 4EOLB 4CFMB 1OIUB 1QMZB 3TNIB 1H4LD 2X1NB 4EC9B 5HBEB 2UZBB 4ROEA 3DDPB 1JOWA 3EJ1B 2G9XB 2JGZB 4UN0A 2WIHB 1AISB 4TTHA 4BCND 5HBHB 1D3UB 3G33B 2PHGA 2UZEB 3QHWB 4NSTB 2WMBB 2EUFA 3POMA 1H1PB 4I3ZB 3BLHB 4FX3B 4F7NB 1PKDB 3QHRB 3TNHB 5EFQB 2CCIB 1UNHD 4F7LB 4EOKB 5BNJB 4EOSB 5HQ0B 1UNLD 5HVYB 4YOOA 4YOSA 4F7SB 4YOZA 4BCPB 2W99A 2IW6B 3TN8B 1JSUB 4ELLA 2PK9B 1N4MA 2UUEB 3DDQB 4Y72B 4ROCA 1ZP2A 4YC3B 4RODA 4KRDB 4EC8B 3DOGB 4IMYB 4BCHB 2W96A 2R7GA 3BHVB 3TNWB 4BCJB 3MY5B 4EOPB 3BHUB 3MIAB 1JKWA 4EONB 2C5NB 4CFWB 3O0GD 4BCQB 1TFBA 1XO2A 4EOMB 1GH6B 2C5OB 2WFYB 4CXAB 3BLQB 3RGFB 2IW9B 4CFVB 5CEIB 3BHTB 2BKZB 4OR5B 2C6TB 2UZLB 1VYWB 1OL1B 3EIDB 4F6SB 4KRCB 1C9BA 4BCIB 4G6LB 3LQ5B 5L2WB 1O9KB 4CFUB 1OKWB 4BCMB 3MI9B 2WIPB 1H28B 2QDJA 3M03A 5FGKB 5IDPB 1GUXB 1H27B 1P5EB 1VINA 5IDNB 2W2HA 4BCGB 1OL2B 1KXUA 2PMIB 2C5XB 4OGRB 2PK2A 5I5ZB 1H24B 3K7AM 1E9HB 2W9ZA 2BPMB 1GUXA 2I40B 2V22B 5CYIB 4CFXB 4BCQD 1F5QB 5HBJB 1W98B 4ELJA 4F6WB 1G3NC 2WEVB 5HNBB 5IF1B 1H25B 1OI9B 2F2CA 2UZDB 2WPAB 2WMAB 4BCFB 4F6UB 4BCNB 1H1SB 1OGUB 1BU2A 4CFUD 3H4CA 4F7JB 1OIYB 4EOJB 1FINB 4BCMD 1OKVB 1URCB 4EOOB 5LQFB 1O9KA 4CFNB 2IW8B 2B9RA 1H26B 2C5VB
chains in the Genus database with same CATH superfamily
2WXVB 2C4GB 1AD6A 2DXBB 2QF7A 2QDYB 4CFMB 1QMZB 3TNIB 3VKGA 2UZBB 3DDPB 1JOWA 2WIHB 4TTHA 5HBHB 4JX4A 4NSTB 4HNVA 2EUFA 4FX3B 4JX5A 5EFQB 4F7LB 3BG3A 4F7SB 4YOSA 4YOZA 2W99A 3TN8B 3BG9A 2PK9B 4Y72B 4YC3B 4KRDB 2DD4B 2W96A 3TNWB 3MIAB 2ZCFB 2BS3A 2C5OB 2WFYB 3BHTB 2CYZB 1C9BA 3EIDB 3QYEA 4BCIB 4G6LB 1H28B 2QDJA 5FGKB 3HB9A 2KMGA 2W2HA 3QZ5B 1OL2B 2C5XB 5I5ZB 1H24B 2LW4A 2W9ZA 1GUXA 3HZJA 2V22B 1ENWA 1F5QB 2CZ7B 3VYGB 4ELJA 4F6WB 5HNBB 3QZ9B 1H25B 2UZDB 4BBSM 2DD5B 3BG5A 2WMAB 4BCNB 3H4CA 3DL1A 5LQFB 4CFNB 1AHJB 4Z6YA 2ZPEB 1E7PA 1FKMA 1JSTB 3A8GB 4F70B 1UNGD 3A8HB 4FM4B 4MFDA 4EOIB 5ICPB 4CRLB 3A8LB 5ACBA 3A8MB 2BS4A 4HNUA 3QXEB 2X1NB 5HBEB 3KHIA 2G9XB 1D3UB 3POMA 1H1PB 3VYHB 3QHRB 3X28B 5BNJB 3GTMS 1JSUB 4ZGDB 4MFEA 1N4MA 4ROCA 4EC8B 3DOGB 2ZPFB 3TW6A 2QGSA 2ZPIB 3MY5B 3BHUB 4EONB 3O0GD 3QWLA 4BY7X 3DJBA 4CXAB 1IREB 3BLQB 2IW9B 5CEIB 2C6TB 2UZLB 1UGRB 4OB3B 3MI9B 5DQVA 3M03A 5IHYA 1GUXB 1VINA 1KXUA 2PK2A 1E9HB 5CYIB 4BCQD 5HBJB 1G3NC 2F2CA 3X25B 4HL4A 2WPAB 2DPPB 3QYHB 4CFUD 4EOJB 4BCMD 2BS2A 1OKVB 1URCB 3TW7A 4ZGEB 1H26B 2WHBB 4BY1X 3MY1B 3QYBA 4BCOB 4EORB 3HO8A 4II5B 3WVDB 2DMEA 2CZ1B 4EOLB 1OIUB 2ZZDB 1H4LD 4UN0A 2JGZB 4AI6A 3G33B 2PHGA 2WMBB 4I3ZB 3TNHB 4BXXX 4EOSB 5HQ0B 4QSHA 4BCPB 4OB2B 2IW6B 2PJQA 2UUEB 1ZP2A 4RODA 2R7GA 3BHVB 4BCJB 4EOPB 2D0QB 1JKWA 2C5NB 4CFWB 1XO2A 4EOMB 4CFVB 3VKHA 4KRCB 3LQ5B 2G77A 1O9KB 1OKWB 5IDPB 4AKHA 1P5EB 2DXCB 2PMIB 4OGRB 3K7AM 2BPMB 2I40B 3NDQA 1OI9B 3X20B 1UGQB 1UGSB 4F6UB 4BCFB 4AKIA 1BU2A 2KR6A 4F7JB 1OIYB 1O9KA 2CZ0B 2IW8B 2ZPBB 2B9RA 2C5VB 1FVVB 3F5XB 3BLRB 3EOCB 1H1RB 2QFZA 2IVXA 1UGPB 4BCKB 1H1QB 2CJMB 1GY3B 4LOCA 2CCHB 1VOLA 5LMKB 1TD6A 2I53A 4EOQB 2IN3A 2W9FA 4NC6A 4EC9B 2CZ6B 4ROEA 3EJ1B 1AISB 2ZPGB 4BCND 3QHWB 2UZEB 3BLHB 4F7NB 1PKDB 3PO3S 2CCIB 4EOKB 1UNLD 5HVYB 4YOOA 2WJ9A 4ELLA 3DDQB 1V29B 4IMYB 4BCHB 4HNTA 4BCQB 1TFBA 1GH6B 4ZGJB 3WVEB 3RGFB 3B57A 1QLBA 3X26B 2BKZB 4OR5B 4M6VA 4JX6A 1VYWB 2ZPHB 1OL1B 4MIMA 4F6SB 3QYGB 5L2WB 4CFUB 4BCMB 4OB1B 2WIPB 5IDNB 3A8OB 4BCGB 5DQWA 2AHJB 3DTOA 4BBRM 4CFXB 1W98B 2WEVB 5IF1B 3HHTB 3HBLA 5EJCA 4AKGA 1H1SB 1OGUB 3X24B 1FINB 4EOOB 4HLQA 2QQ8A 4OB0B 1UNHD 1H27B
chains in the Genus database with same CATH topology
2WXVB 2WHBB 1FVVB 3F5XB 2C4GB 3BLRB 3EOCB 1H1RB 1JSTB 2IVXA 3MY1B 4BCKB 1H1QB 4BCOB 4EORB 2CJMB 4F70B 1AD6A 1UNGD 1GY3B 2CCHB 1VOLA 4EOIB 5ICPB 4CRLB 5LMKB 4II5B 2I53A 5ACBA 4EOQB 2W9FA 4EOLB 4CFMB 1OIUB 1QMZB 3TNIB 1H4LD 2X1NB 4EC9B 5HBEB 2UZBB 4ROEA 3DDPB 1JOWA 3EJ1B 2G9XB 2JGZB 4UN0A 2WIHB 1AISB 4TTHA 4BCND 5HBHB 1D3UB 3G33B 2PHGA 2UZEB 3QHWB 4NSTB 2WMBB 2EUFA 3POMA 1H1PB 4I3ZB 3BLHB 4FX3B 4F7NB 1PKDB 3QHRB 3TNHB 5EFQB 2CCIB 1UNHD 4F7LB 4EOKB 5BNJB 4EOSB 5HQ0B 1UNLD 5HVYB 4YOOA 4YOSA 4F7SB 4YOZA 4BCPB 2W99A 2IW6B 3TN8B 1JSUB 4ELLA 2PK9B 1N4MA 2UUEB 3DDQB 4Y72B 4ROCA 1ZP2A 4YC3B 4RODA 4KRDB 4EC8B 3DOGB 4IMYB 4BCHB 2W96A 2R7GA 3BHVB 3TNWB 4BCJB 3MY5B 4EOPB 3BHUB 3MIAB 1JKWA 4EONB 2C5NB 4CFWB 3O0GD 4BCQB 1TFBA 1XO2A 4EOMB 1GH6B 2C5OB 2WFYB 4CXAB 3BLQB 3RGFB 2IW9B 4CFVB 5CEIB 3BHTB 2BKZB 4OR5B 2C6TB 2UZLB 1VYWB 1OL1B 3EIDB 4F6SB 4KRCB 1C9BA 4BCIB 4G6LB 3LQ5B 5L2WB 1O9KB 4CFUB 1OKWB 4BCMB 3MI9B 2WIPB 1H28B 2QDJA 3M03A 5FGKB 5IDPB 1GUXB 1H27B 1P5EB 1VINA 5IDNB 2W2HA 4BCGB 1OL2B 1KXUA 2PMIB 2C5XB 4OGRB 2PK2A 5I5ZB 1H24B 3K7AM 1E9HB 2W9ZA 2BPMB 1GUXA 2I40B 2V22B 5CYIB 4CFXB 4BCQD 1F5QB 5HBJB 1W98B 4ELJA 4F6WB 1G3NC 2WEVB 5HNBB 5IF1B 1H25B 1OI9B 2F2CA 2UZDB 2WPAB 2WMAB 4BCFB 4F6UB 4BCNB 1H1SB 1OGUB 1BU2A 4CFUD 3H4CA 4F7JB 1OIYB 4EOJB 1FINB 4BCMD 1OKVB 1URCB 4EOOB 5LQFB 1O9KA 4CFNB 2IW8B 2B9RA 1H26B 2C5VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WXV B;  2WHB B;  1FVV B;  3F5X B;  2C4G B;  3BLR B;  3EOC B;  1H1R B;  1JST B;  2IVX A;  3MY1 B;  4BCK B;  1H1Q B;  4BCO B;  4EOR B;  2CJM B;  4F70 B;  1AD6 A;  1UNG D;  1GY3 B;  2CCH B;  1VOL A;  4EOI B;  5ICP B;  4CRL B;  5LMK B;  4II5 B;  2I53 A;  5ACB A;  4EOQ B;  2W9F A;  4EOL B;  4CFM B;  1OIU B;  1QMZ B;  3TNI B;  1H4L D;  2X1N B;  4EC9 B;  5HBE B;  2UZB B;  4ROE A;  3DDP B;  1JOW A;  3EJ1 B;  2G9X B;  2JGZ B;  4UN0 A;  2WIH B;  1AIS B;  4TTH A;  4BCN D;  5HBH B;  1D3U B;  3G33 B;  2PHG A;  2UZE B;  3QHW B;  4NST B;  2WMB B;  2EUF A;  3POM A;  1H1P B;  4I3Z B;  3BLH B;  4FX3 B;  4F7N B;  1PKD B;  3QHR B;  3TNH B;  5EFQ B;  2CCI B;  1UNH D;  4F7L B;  4EOK B;  5BNJ B;  4EOS B;  5HQ0 B;  1UNL D;  5HVY B;  4YOO A;  4YOS A;  4F7S B;  4YOZ A;  4BCP B;  2W99 A;  2IW6 B;  3TN8 B;  1JSU B;  4ELL A;  2PK9 B;  1N4M A;  2UUE B;  3DDQ B;  4Y72 B;  4ROC A;  1ZP2 A;  4YC3 B;  4ROD A;  4KRD B;  4EC8 B;  3DOG B;  4IMY B;  4BCH B;  2W96 A;  2R7G A;  3BHV B;  3TNW B;  4BCJ B;  3MY5 B;  4EOP B;  3BHU B;  3MIA B;  1JKW A;  4EON B;  2C5N B;  4CFW B;  3O0G D;  4BCQ B;  1TFB A;  1XO2 A;  4EOM B;  1GH6 B;  2C5O B;  2WFY B;  4CXA B;  3BLQ B;  3RGF B;  2IW9 B;  4CFV B;  5CEI B;  3BHT B;  2BKZ B;  4OR5 B;  2C6T B;  2UZL B;  1VYW B;  1OL1 B;  3EID B;  4F6S B;  4KRC B;  1C9B A;  4BCI B;  4G6L B;  3LQ5 B;  5L2W B;  1O9K B;  4CFU B;  1OKW B;  4BCM B;  3MI9 B;  2WIP B;  1H28 B;  2QDJ A;  3M03 A;  5FGK B;  5IDP B;  1GUX B;  1H27 B;  1P5E B;  1VIN A;  5IDN B;  2W2H A;  4BCG B;  1OL2 B;  1KXU A;  2PMI B;  2C5X B;  4OGR B;  2PK2 A;  5I5Z B;  1H24 B;  3K7A M;  1E9H B;  2W9Z A;  2BPM B;  1GUX A;  2I40 B;  2V22 B;  5CYI B;  4CFX B;  4BCQ D;  1F5Q B;  5HBJ B;  1W98 B;  4ELJ A;  4F6W B;  1G3N C;  2WEV B;  5HNB B;  5IF1 B;  1H25 B;  1OI9 B;  2F2C A;  2UZD B;  2WPA B;  2WMA B;  4BCF B;  4F6U B;  4BCN B;  1H1S B;  1OGU B;  1BU2 A;  4CFU D;  3H4C A;  4F7J B;  1OIY B;  4EOJ B;  1FIN B;  4BCM D;  1OKV B;  1URC B;  4EOO B;  5LQF B;  1O9K A;  4CFN B;  2IW8 B;  2B9R A;  1H26 B;  2C5V B; 
#chains in the Genus database with same CATH topology
 2WXV B;  2C4G B;  1AD6 A;  2DXB B;  2QF7 A;  2QDY B;  4CFM B;  1QMZ B;  3TNI B;  3VKG A;  2UZB B;  3DDP B;  1JOW A;  2WIH B;  4TTH A;  5HBH B;  4JX4 A;  4NST B;  4HNV A;  2EUF A;  4FX3 B;  4JX5 A;  5EFQ B;  4F7L B;  3BG3 A;  4F7S B;  4YOS A;  4YOZ A;  2W99 A;  3TN8 B;  3BG9 A;  2PK9 B;  4Y72 B;  4YC3 B;  4KRD B;  2DD4 B;  2W96 A;  3TNW B;  3MIA B;  2ZCF B;  2BS3 A;  2C5O B;  2WFY B;  3BHT B;  2CYZ B;  1C9B A;  3EID B;  3QYE A;  4BCI B;  4G6L B;  1H28 B;  2QDJ A;  5FGK B;  3HB9 A;  2KMG A;  2W2H A;  3QZ5 B;  1OL2 B;  2C5X B;  5I5Z B;  1H24 B;  2LW4 A;  2W9Z A;  1GUX A;  3HZJ A;  2V22 B;  1ENW A;  1F5Q B;  2CZ7 B;  3VYG B;  4ELJ A;  4F6W B;  5HNB B;  3QZ9 B;  1H25 B;  2UZD B;  4BBS M;  2DD5 B;  3BG5 A;  2WMA B;  4BCN B;  3H4C A;  3DL1 A;  5LQF B;  4CFN B;  1AHJ B;  4Z6Y A;  2ZPE B;  1E7P A;  1FKM A;  1JST B;  3A8G B;  4F70 B;  1UNG D;  3A8H B;  4FM4 B;  4MFD A;  4EOI B;  5ICP B;  4CRL B;  3A8L B;  5ACB A;  3A8M B;  2BS4 A;  4HNU A;  3QXE B;  2X1N B;  5HBE B;  3KHI A;  2G9X B;  1D3U B;  3POM A;  1H1P B;  3VYH B;  3QHR B;  3X28 B;  5BNJ B;  3GTM S;  1JSU B;  4ZGD B;  4MFE A;  1N4M A;  4ROC A;  4EC8 B;  3DOG B;  2ZPF B;  3TW6 A;  2QGS A;  2ZPI B;  3MY5 B;  3BHU B;  4EON B;  3O0G D;  3QWL A;  4BY7 X;  3DJB A;  4CXA B;  1IRE B;  3BLQ B;  2IW9 B;  5CEI B;  2C6T B;  2UZL B;  1UGR B;  4OB3 B;  3MI9 B;  5DQV A;  3M03 A;  5IHY A;  1GUX B;  1VIN A;  1KXU A;  2PK2 A;  1E9H B;  5CYI B;  4BCQ D;  5HBJ B;  1G3N C;  2F2C A;  3X25 B;  4HL4 A;  2WPA B;  2DPP B;  3QYH B;  4CFU D;  4EOJ B;  4BCM D;  2BS2 A;  1OKV B;  1URC B;  3TW7 A;  4ZGE B;  1H26 B;  2WHB B;  4BY1 X;  3MY1 B;  3QYB A;  4BCO B;  4EOR B;  3HO8 A;  4II5 B;  3WVD B;  2DME A;  2CZ1 B;  4EOL B;  1OIU B;  2ZZD B;  1H4L D;  4UN0 A;  2JGZ B;  4AI6 A;  3G33 B;  2PHG A;  2WMB B;  4I3Z B;  3TNH B;  4BXX X;  4EOS B;  5HQ0 B;  4QSH A;  4BCP B;  4OB2 B;  2IW6 B;  2PJQ A;  2UUE B;  1ZP2 A;  4ROD A;  2R7G A;  3BHV B;  4BCJ B;  4EOP B;  2D0Q B;  1JKW A;  2C5N B;  4CFW B;  1XO2 A;  4EOM B;  4CFV B;  3VKH A;  4KRC B;  3LQ5 B;  2G77 A;  1O9K B;  1OKW B;  5IDP B;  4AKH A;  1P5E B;  2DXC B;  2PMI B;  4OGR B;  3K7A M;  2BPM B;  2I40 B;  3NDQ A;  1OI9 B;  3X20 B;  1UGQ B;  1UGS B;  4F6U B;  4BCF B;  4AKI A;  1BU2 A;  2KR6 A;  4F7J B;  1OIY B;  1O9K A;  2CZ0 B;  2IW8 B;  2ZPB B;  2B9R A;  2C5V B;  1FVV B;  3F5X B;  3BLR B;  3EOC B;  1H1R B;  2QFZ A;  2IVX A;  1UGP B;  4BCK B;  1H1Q B;  2CJM B;  1GY3 B;  4LOC A;  2CCH B;  1VOL A;  5LMK B;  1TD6 A;  2I53 A;  4EOQ B;  2IN3 A;  2W9F A;  4NC6 A;  4EC9 B;  2CZ6 B;  4ROE A;  3EJ1 B;  1AIS B;  2ZPG B;  4BCN D;  3QHW B;  2UZE B;  3BLH B;  4F7N B;  1PKD B;  3PO3 S;  2CCI B;  4EOK B;  1UNL D;  5HVY B;  4YOO A;  2WJ9 A;  4ELL A;  3DDQ B;  1V29 B;  4IMY B;  4BCH B;  4HNT A;  4BCQ B;  1TFB A;  1GH6 B;  4ZGJ B;  3WVE B;  3RGF B;  3B57 A;  1QLB A;  3X26 B;  2BKZ B;  4OR5 B;  4M6V A;  4JX6 A;  1VYW B;  2ZPH B;  1OL1 B;  4MIM A;  4F6S B;  3QYG B;  5L2W B;  4CFU B;  4BCM B;  4OB1 B;  2WIP B;  5IDN B;  3A8O B;  4BCG B;  5DQW A;  2AHJ B;  3DTO A;  4BBR M;  4CFX B;  1W98 B;  2WEV B;  5IF1 B;  3HHT B;  3HBL A;  5EJC A;  4AKG A;  1H1S B;  1OGU B;  3X24 B;  1FIN B;  4EOO B;  4HLQ A;  2QQ8 A;  4OB0 B;  1UNH D;  1H27 B; 
#chains in the Genus database with same CATH homology
 2WXV B;  2WHB B;  1FVV B;  3F5X B;  2C4G B;  3BLR B;  3EOC B;  1H1R B;  1JST B;  2IVX A;  3MY1 B;  4BCK B;  1H1Q B;  4BCO B;  4EOR B;  2CJM B;  4F70 B;  1AD6 A;  1UNG D;  1GY3 B;  2CCH B;  1VOL A;  4EOI B;  5ICP B;  4CRL B;  5LMK B;  4II5 B;  2I53 A;  5ACB A;  4EOQ B;  2W9F A;  4EOL B;  4CFM B;  1OIU B;  1QMZ B;  3TNI B;  1H4L D;  2X1N B;  4EC9 B;  5HBE B;  2UZB B;  4ROE A;  3DDP B;  1JOW A;  3EJ1 B;  2G9X B;  2JGZ B;  4UN0 A;  2WIH B;  1AIS B;  4TTH A;  4BCN D;  5HBH B;  1D3U B;  3G33 B;  2PHG A;  2UZE B;  3QHW B;  4NST B;  2WMB B;  2EUF A;  3POM A;  1H1P B;  4I3Z B;  3BLH B;  4FX3 B;  4F7N B;  1PKD B;  3QHR B;  3TNH B;  5EFQ B;  2CCI B;  1UNH D;  4F7L B;  4EOK B;  5BNJ B;  4EOS B;  5HQ0 B;  1UNL D;  5HVY B;  4YOO A;  4YOS A;  4F7S B;  4YOZ A;  4BCP B;  2W99 A;  2IW6 B;  3TN8 B;  1JSU B;  4ELL A;  2PK9 B;  1N4M A;  2UUE B;  3DDQ B;  4Y72 B;  4ROC A;  1ZP2 A;  4YC3 B;  4ROD A;  4KRD B;  4EC8 B;  3DOG B;  4IMY B;  4BCH B;  2W96 A;  2R7G A;  3BHV B;  3TNW B;  4BCJ B;  3MY5 B;  4EOP B;  3BHU B;  3MIA B;  1JKW A;  4EON B;  2C5N B;  4CFW B;  3O0G D;  4BCQ B;  1TFB A;  1XO2 A;  4EOM B;  1GH6 B;  2C5O B;  2WFY B;  4CXA B;  3BLQ B;  3RGF B;  2IW9 B;  4CFV B;  5CEI B;  3BHT B;  2BKZ B;  4OR5 B;  2C6T B;  2UZL B;  1VYW B;  1OL1 B;  3EID B;  4F6S B;  4KRC B;  1C9B A;  4BCI B;  4G6L B;  3LQ5 B;  5L2W B;  1O9K B;  4CFU B;  1OKW B;  4BCM B;  3MI9 B;  2WIP B;  1H28 B;  2QDJ A;  3M03 A;  5FGK B;  5IDP B;  1GUX B;  1H27 B;  1P5E B;  1VIN A;  5IDN B;  2W2H A;  4BCG B;  1OL2 B;  1KXU A;  2PMI B;  2C5X B;  4OGR B;  2PK2 A;  5I5Z B;  1H24 B;  3K7A M;  1E9H B;  2W9Z A;  2BPM B;  1GUX A;  2I40 B;  2V22 B;  5CYI B;  4CFX B;  4BCQ D;  1F5Q B;  5HBJ B;  1W98 B;  4ELJ A;  4F6W B;  1G3N C;  2WEV B;  5HNB B;  5IF1 B;  1H25 B;  1OI9 B;  2F2C A;  2UZD B;  2WPA B;  2WMA B;  4BCF B;  4F6U B;  4BCN B;  1H1S B;  1OGU B;  1BU2 A;  4CFU D;  3H4C A;  4F7J B;  1OIY B;  4EOJ B;  1FIN B;  4BCM D;  1OKV B;  1URC B;  4EOO B;  5LQF B;  1O9K A;  4CFN B;  2IW8 B;  2B9R A;  1H26 B;  2C5V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...