4CFXB

Structure-based design of c8-substituted o6-cyclohexylmethoxyguanine cdk1 and 2 inhibitors.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
260
structure length
260
Chain Sequence
NEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 2
publication title 8-Substituted O6-Cyclohexylmethylguanine Cdk2 Inhibitors; Using Structure-Based Inhibitor Design to Optimise an Alternative Binding Mode.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 95
structure length 260
sequence length 260
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4cfxB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4cfxB02
1GUXB 3BLRB 2I40B 4YC3B 1BU2A 1GH6B 4BCPB 3BLQB 4CXAB 1P5EB 2PMIB 2UZEB 1XO2A 4UN0A 3EOCB 4F70B 5ICPB 5HBHB 4EONB 2CCIB 3MY1B 4EOKB 5EFQB 4EORB 4EOSB 5ACBA 1H1SB 1VOLA 1H24B 1AD6A 2B9RA 4F7NB 1JKWA 5I5ZB 4EC8B 1O9KA 1TFBA 3MY5B 4YOZA 1G3NC 4BCQD 4F6SB 1AISB 1JSTB 2C4GB 1D3UB 2PK2A 4FX3B 3DOGB 3BHTB 1H1PB 1UNLD 5HNBB 2WHBB 4I3ZB 4KRDB 3O0GD 3H4CA 1VINA 2F2CA 4BCJB 4KRCB 4CFXB 5L2WB 4BCKB 2WXVB 4BCMD 2X1NB 4NSTB 4F7LB 4CFWB 3F5XB 4CFNB 4EC9B 4EOIB 2C5XB 3TNIB 4BCQB 4EOQB 2C5NB 4BCFB 4OGRB 3EJ1B 3BLHB 1FVVB 1ZP2A 2G9XB 2WMAB 5FGKB 4CFUD 5LQFB 3BHVB 3BHUB 3TNHB 5CYIB 1VYWB 4EOLB 2CCHB 2WFYB 2WPAB 5IDNB 1E9HB 2C5VB 5HQ0B 4BCND 4ROCA 2V22B 4BCMB 2UUEB 2W9ZA 1OKWB 4ROEA 5BNJB 2JGZB 3QHWB 5HBEB 4ELLA 4RODA 2W2HA 1H1QB 1FINB 4EOJB 1OIYB 4F6WB 5IDPB 2BPMB 2W9FA 4CRLB 4BCGB 4IMYB 5IF1B 4CFVB 3MIAB 3DDQB 3M03A 4II5B 1OKVB 1H26B 3DDPB 3LQ5B 1H4LD 2IW6B 1O9KB 1UNGD 2WIPB 1N4MA 1OIUB 3RGFB 4BCIB 2CJMB 4BCOB 1GUXA 1H1RB 4BCNB 4EOOB 4F6UB 4YOOA 2BKZB 2PHGA 3MI9B 2W99A 4CFMB 2IVXA 2UZDB 4BCHB 1OI9B 2WEVB 2UZLB 1H28B 1QMZB 1UNHD 4G6LB 2UZBB 2IW9B 2EUFA 3K7AM 3POMA 1OL2B 3TN8B 3TNWB 2PK9B 5HVYB 1PKDB 3EIDB 4TTHA 4CFUB 1OL1B 4EOMB 3QHRB 2WIHB 5LMKB 1URCB 1W98B 2C6TB 4YOSA 1F5QB 5HBJB 2QDJA 2R7GA 1H27B 1C9BA 1GY3B 1KXUA 2C5OB 2W96A 2IW8B 1OGUB 2I53A 1H25B 4ELJA 1JOWA 4F7JB 4EOPB 2WMBB 4Y72B 4F7SB 4OR5B 1JSUB 5CEIB 3G33B
chains in the Genus database with same CATH superfamily
3VYGB 1AHJB 3PO3S 4CXAB 2PMIB 2UZEB 1UGPB 5HBHB 3MY1B 5ACBA 4F7NB 4YOZA 4BXXX 2PJQA 1G3NC 1UGRB 2PK2A 4FX3B 4KRCB 4BCMD 4AI6A 3F5XB 4EOQB 3EJ1B 3BLHB 3HHTB 2G9XB 2QFZA 3BHUB 3BG5A 3NDQA 3QXEB 4BCND 3BG3A 2JGZB 1FINB 5IDPB 2BPMB 2IN3A 3DDPB 3LQ5B 1UGQB 1O9KB 1UNGD 1N4MA 1OIUB 2CJMB 4F6UB 3MI9B 4CFMB 2IVXA 2UZDB 4MFEA 5DQVA 5IHYA 1IREB 2ZPBB 1TD6A 3K7AM 2DMEA 5HVYB 4TTHA 2WIHB 3A8GB 2W96A 2C5OB 4Y72B 2DD4B 3X24B 3HB9A 3BLRB 2I40B 1BU2A 1GH6B 3X20B 3BLQB 1XO2A 4F70B 5ICPB 4EONB 2ZCFB 4EOKB 4EORB 5EFQB 1VOLA 4EOSB 2ZZDB 1JKWA 3WVDB 1D3UB 3DOGB 4AKHA 3BHTB 1H1PB 5HNBB 4KRDB 3H4CA 2F2CA 4BCJB 5L2WB 2AHJB 2WXVB 2X1NB 3HO8A 1UGSB 4EOIB 4EC9B 2C5XB 4OGRB 2WMAB 3BHVB 5CYIB 2ZPHB 2ZPFB 2CCHB 4BY7X 1ENWA 2UUEB 2W9ZA 5BNJB 3QHWB 4RODA 4LOCA 1H1QB 4EOJB 4CRLB 4BCGB 4IMYB 5IF1B 4CFVB 3MIAB 3M03A 1H26B 2CYZB 2IW6B 2KMGA 4BCIB 2BKZB 4ZGJB 2UZLB 1H28B 1QMZB 1UNHD 4G6LB 4JX6A 4MIMA 1OL2B 3X26B 1OL1B 3QHRB 5HBJB 1KXUA 1OGUB 4BBRM 1JOWA 1V29B 4EOPB 4OR5B 2DPPB 3G33B 1GUXB 2LW4A 3VYHB 4Z6YA 4MFDA 3GTMS 1P5EB 3DL1A 4UN0A 3EOCB 4HLQA 1H1SB 1H24B 1AD6A 3X28B 5I5ZB 1O9KA 1TFBA 2CZ6B 3B57A 1AISB 2BS3A 5EJCA 4OB2B 4I3ZB 3O0GD 4HL4A 4OB3B 4AKIA 3A8MB 4BCKB 3QYHB 4HNTA 3WVEB 2ZPEB 4NSTB 4F7LB 4CFWB 3VKHA 3TNIB 2QF7A 4BCQB 4BBSM 1FVVB 1ZP2A 4OB0B 3DTOA 1VYWB 4EOLB 2WPAB 5IDNB 5HQ0B 2C5VB 2V22B 4ROEA 2W2HA 4OB1B 1OIYB 1QLBA 2W9FA 1OKVB 1H4LD 2CZ1B 4BCOB 1H1RB 3DJBA 2QQ8A 2W99A 3KHIA 4BCHB 4ZGDB 2BS2A 3TN8B 2PK9B 3EIDB 4HNVA 4JX4A 3QYEA 4AKGA 2QDYB 1URCB 2QDJA 4FM4B 3QYBA 1H27B 1GY3B 2IW8B 2I53A 1H25B 4ELJA 2WMBB 4F7SB 2D0QB 2DXCB 4YC3B 1E7PA 4BCPB 4NC6A 3BG9A 3QWLA 2CCIB 2B9RA 4EC8B 2CZ0B 3MY5B 4F6SB 4BCQD 4ZGEB 1JSTB 2C4GB 2KR6A 4HNUA 1UNLD 2WHBB 3HBLA 1VINA 2G77A 4CFXB 4JX5A 5DQWA 4CFNB 4M6VA 2WJ9A 2C5NB 4BCFB 3VKGA 5FGKB 4CFUD 5LQFB 3TNHB 3A8LB 2WFYB 1E9HB 4ROCA 3QYGB 4BCMB 3TW7A 3HZJA 2QGSA 1OKWB 5HBEB 4ELLA 4BY1X 4F6WB 2ZPGB 2DXBB 2ZPIB 4QSHA 3DDQB 4II5B 2WIPB 3RGFB 1GUXA 4BCNB 4EOOB 4YOOA 3QZ5B 2PHGA 3TW6A 1OI9B 2WEVB 2UZBB 2IW9B 2EUFA 3A8HB 3POMA 3TNWB 1PKDB 4CFUB 4EOMB 2BS4A 3X25B 5LMKB 1W98B 2C6TB 4YOSA 1F5QB 2R7GA 1C9BA 2DD5B 4F7JB 3QZ9B 1FKMA 1JSUB 5CEIB 2CZ7B 3A8OB
chains in the Genus database with same CATH topology
1GUXB 3BLRB 2I40B 4YC3B 1BU2A 1GH6B 4BCPB 3BLQB 4CXAB 1P5EB 2PMIB 2UZEB 1XO2A 4UN0A 3EOCB 4F70B 5ICPB 5HBHB 4EONB 2CCIB 3MY1B 4EOKB 5EFQB 4EORB 4EOSB 5ACBA 1H1SB 1VOLA 1H24B 1AD6A 2B9RA 4F7NB 1JKWA 5I5ZB 4EC8B 1O9KA 1TFBA 3MY5B 4YOZA 1G3NC 4BCQD 4F6SB 1AISB 1JSTB 2C4GB 1D3UB 2PK2A 4FX3B 3DOGB 3BHTB 1H1PB 1UNLD 5HNBB 2WHBB 4I3ZB 4KRDB 3O0GD 3H4CA 1VINA 2F2CA 4BCJB 4KRCB 4CFXB 5L2WB 4BCKB 2WXVB 4BCMD 2X1NB 4NSTB 4F7LB 4CFWB 3F5XB 4CFNB 4EC9B 4EOIB 2C5XB 3TNIB 4BCQB 4EOQB 2C5NB 4BCFB 4OGRB 3EJ1B 3BLHB 1FVVB 1ZP2A 2G9XB 2WMAB 5FGKB 4CFUD 5LQFB 3BHVB 3BHUB 3TNHB 5CYIB 1VYWB 4EOLB 2CCHB 2WFYB 2WPAB 5IDNB 1E9HB 2C5VB 5HQ0B 4BCND 4ROCA 2V22B 4BCMB 2UUEB 2W9ZA 1OKWB 4ROEA 5BNJB 2JGZB 3QHWB 5HBEB 4ELLA 4RODA 2W2HA 1H1QB 1FINB 4EOJB 1OIYB 4F6WB 5IDPB 2BPMB 2W9FA 4CRLB 4BCGB 4IMYB 5IF1B 4CFVB 3MIAB 3DDQB 3M03A 4II5B 1OKVB 1H26B 3DDPB 3LQ5B 1H4LD 2IW6B 1O9KB 1UNGD 2WIPB 1N4MA 1OIUB 3RGFB 4BCIB 2CJMB 4BCOB 1GUXA 1H1RB 4BCNB 4EOOB 4F6UB 4YOOA 2BKZB 2PHGA 3MI9B 2W99A 4CFMB 2IVXA 2UZDB 4BCHB 1OI9B 2WEVB 2UZLB 1H28B 1QMZB 1UNHD 4G6LB 2UZBB 2IW9B 2EUFA 3K7AM 3POMA 1OL2B 3TN8B 3TNWB 2PK9B 5HVYB 1PKDB 3EIDB 4TTHA 4CFUB 1OL1B 4EOMB 3QHRB 2WIHB 5LMKB 1URCB 1W98B 2C6TB 4YOSA 1F5QB 5HBJB 2QDJA 2R7GA 1H27B 1C9BA 1GY3B 1KXUA 2C5OB 2W96A 2IW8B 1OGUB 2I53A 1H25B 4ELJA 1JOWA 4F7JB 4EOPB 2WMBB 4Y72B 4F7SB 4OR5B 1JSUB 5CEIB 3G33B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GUX B;  3BLR B;  2I40 B;  4YC3 B;  1BU2 A;  1GH6 B;  4BCP B;  3BLQ B;  4CXA B;  1P5E B;  2PMI B;  2UZE B;  1XO2 A;  4UN0 A;  3EOC B;  4F70 B;  5ICP B;  5HBH B;  4EON B;  2CCI B;  3MY1 B;  4EOK B;  5EFQ B;  4EOR B;  4EOS B;  5ACB A;  1H1S B;  1VOL A;  1H24 B;  1AD6 A;  2B9R A;  4F7N B;  1JKW A;  5I5Z B;  4EC8 B;  1O9K A;  1TFB A;  3MY5 B;  4YOZ A;  1G3N C;  4BCQ D;  4F6S B;  1AIS B;  1JST B;  2C4G B;  1D3U B;  2PK2 A;  4FX3 B;  3DOG B;  3BHT B;  1H1P B;  1UNL D;  5HNB B;  2WHB B;  4I3Z B;  4KRD B;  3O0G D;  3H4C A;  1VIN A;  2F2C A;  4BCJ B;  4KRC B;  4CFX B;  5L2W B;  4BCK B;  2WXV B;  4BCM D;  2X1N B;  4NST B;  4F7L B;  4CFW B;  3F5X B;  4CFN B;  4EC9 B;  4EOI B;  2C5X B;  3TNI B;  4BCQ B;  4EOQ B;  2C5N B;  4BCF B;  4OGR B;  3EJ1 B;  3BLH B;  1FVV B;  1ZP2 A;  2G9X B;  2WMA B;  5FGK B;  4CFU D;  5LQF B;  3BHV B;  3BHU B;  3TNH B;  5CYI B;  1VYW B;  4EOL B;  2CCH B;  2WFY B;  2WPA B;  5IDN B;  1E9H B;  2C5V B;  5HQ0 B;  4BCN D;  4ROC A;  2V22 B;  4BCM B;  2UUE B;  2W9Z A;  1OKW B;  4ROE A;  5BNJ B;  2JGZ B;  3QHW B;  5HBE B;  4ELL A;  4ROD A;  2W2H A;  1H1Q B;  1FIN B;  4EOJ B;  1OIY B;  4F6W B;  5IDP B;  2BPM B;  2W9F A;  4CRL B;  4BCG B;  4IMY B;  5IF1 B;  4CFV B;  3MIA B;  3DDQ B;  3M03 A;  4II5 B;  1OKV B;  1H26 B;  3DDP B;  3LQ5 B;  1H4L D;  2IW6 B;  1O9K B;  1UNG D;  2WIP B;  1N4M A;  1OIU B;  3RGF B;  4BCI B;  2CJM B;  4BCO B;  1GUX A;  1H1R B;  4BCN B;  4EOO B;  4F6U B;  4YOO A;  2BKZ B;  2PHG A;  3MI9 B;  2W99 A;  4CFM B;  2IVX A;  2UZD B;  4BCH B;  1OI9 B;  2WEV B;  2UZL B;  1H28 B;  1QMZ B;  1UNH D;  4G6L B;  2UZB B;  2IW9 B;  2EUF A;  3K7A M;  3POM A;  1OL2 B;  3TN8 B;  3TNW B;  2PK9 B;  5HVY B;  1PKD B;  3EID B;  4TTH A;  4CFU B;  1OL1 B;  4EOM B;  3QHR B;  2WIH B;  5LMK B;  1URC B;  1W98 B;  2C6T B;  4YOS A;  1F5Q B;  5HBJ B;  2QDJ A;  2R7G A;  1H27 B;  1C9B A;  1GY3 B;  1KXU A;  2C5O B;  2W96 A;  2IW8 B;  1OGU B;  2I53 A;  1H25 B;  4ELJ A;  1JOW A;  4F7J B;  4EOP B;  2WMB B;  4Y72 B;  4F7S B;  4OR5 B;  1JSU B;  5CEI B;  3G33 B; 
#chains in the Genus database with same CATH topology
 3VYG B;  1AHJ B;  3PO3 S;  4CXA B;  2PMI B;  2UZE B;  1UGP B;  5HBH B;  3MY1 B;  5ACB A;  4F7N B;  4YOZ A;  4BXX X;  2PJQ A;  1G3N C;  1UGR B;  2PK2 A;  4FX3 B;  4KRC B;  4BCM D;  4AI6 A;  3F5X B;  4EOQ B;  3EJ1 B;  3BLH B;  3HHT B;  2G9X B;  2QFZ A;  3BHU B;  3BG5 A;  3NDQ A;  3QXE B;  4BCN D;  3BG3 A;  2JGZ B;  1FIN B;  5IDP B;  2BPM B;  2IN3 A;  3DDP B;  3LQ5 B;  1UGQ B;  1O9K B;  1UNG D;  1N4M A;  1OIU B;  2CJM B;  4F6U B;  3MI9 B;  4CFM B;  2IVX A;  2UZD B;  4MFE A;  5DQV A;  5IHY A;  1IRE B;  2ZPB B;  1TD6 A;  3K7A M;  2DME A;  5HVY B;  4TTH A;  2WIH B;  3A8G B;  2W96 A;  2C5O B;  4Y72 B;  2DD4 B;  3X24 B;  3HB9 A;  3BLR B;  2I40 B;  1BU2 A;  1GH6 B;  3X20 B;  3BLQ B;  1XO2 A;  4F70 B;  5ICP B;  4EON B;  2ZCF B;  4EOK B;  4EOR B;  5EFQ B;  1VOL A;  4EOS B;  2ZZD B;  1JKW A;  3WVD B;  1D3U B;  3DOG B;  4AKH A;  3BHT B;  1H1P B;  5HNB B;  4KRD B;  3H4C A;  2F2C A;  4BCJ B;  5L2W B;  2AHJ B;  2WXV B;  2X1N B;  3HO8 A;  1UGS B;  4EOI B;  4EC9 B;  2C5X B;  4OGR B;  2WMA B;  3BHV B;  5CYI B;  2ZPH B;  2ZPF B;  2CCH B;  4BY7 X;  1ENW A;  2UUE B;  2W9Z A;  5BNJ B;  3QHW B;  4ROD A;  4LOC A;  1H1Q B;  4EOJ B;  4CRL B;  4BCG B;  4IMY B;  5IF1 B;  4CFV B;  3MIA B;  3M03 A;  1H26 B;  2CYZ B;  2IW6 B;  2KMG A;  4BCI B;  2BKZ B;  4ZGJ B;  2UZL B;  1H28 B;  1QMZ B;  1UNH D;  4G6L B;  4JX6 A;  4MIM A;  1OL2 B;  3X26 B;  1OL1 B;  3QHR B;  5HBJ B;  1KXU A;  1OGU B;  4BBR M;  1JOW A;  1V29 B;  4EOP B;  4OR5 B;  2DPP B;  3G33 B;  1GUX B;  2LW4 A;  3VYH B;  4Z6Y A;  4MFD A;  3GTM S;  1P5E B;  3DL1 A;  4UN0 A;  3EOC B;  4HLQ A;  1H1S B;  1H24 B;  1AD6 A;  3X28 B;  5I5Z B;  1O9K A;  1TFB A;  2CZ6 B;  3B57 A;  1AIS B;  2BS3 A;  5EJC A;  4OB2 B;  4I3Z B;  3O0G D;  4HL4 A;  4OB3 B;  4AKI A;  3A8M B;  4BCK B;  3QYH B;  4HNT A;  3WVE B;  2ZPE B;  4NST B;  4F7L B;  4CFW B;  3VKH A;  3TNI B;  2QF7 A;  4BCQ B;  4BBS M;  1FVV B;  1ZP2 A;  4OB0 B;  3DTO A;  1VYW B;  4EOL B;  2WPA B;  5IDN B;  5HQ0 B;  2C5V B;  2V22 B;  4ROE A;  2W2H A;  4OB1 B;  1OIY B;  1QLB A;  2W9F A;  1OKV B;  1H4L D;  2CZ1 B;  4BCO B;  1H1R B;  3DJB A;  2QQ8 A;  2W99 A;  3KHI A;  4BCH B;  4ZGD B;  2BS2 A;  3TN8 B;  2PK9 B;  3EID B;  4HNV A;  4JX4 A;  3QYE A;  4AKG A;  2QDY B;  1URC B;  2QDJ A;  4FM4 B;  3QYB A;  1H27 B;  1GY3 B;  2IW8 B;  2I53 A;  1H25 B;  4ELJ A;  2WMB B;  4F7S B;  2D0Q B;  2DXC B;  4YC3 B;  1E7P A;  4BCP B;  4NC6 A;  3BG9 A;  3QWL A;  2CCI B;  2B9R A;  4EC8 B;  2CZ0 B;  3MY5 B;  4F6S B;  4BCQ D;  4ZGE B;  1JST B;  2C4G B;  2KR6 A;  4HNU A;  1UNL D;  2WHB B;  3HBL A;  1VIN A;  2G77 A;  4CFX B;  4JX5 A;  5DQW A;  4CFN B;  4M6V A;  2WJ9 A;  2C5N B;  4BCF B;  3VKG A;  5FGK B;  4CFU D;  5LQF B;  3TNH B;  3A8L B;  2WFY B;  1E9H B;  4ROC A;  3QYG B;  4BCM B;  3TW7 A;  3HZJ A;  2QGS A;  1OKW B;  5HBE B;  4ELL A;  4BY1 X;  4F6W B;  2ZPG B;  2DXB B;  2ZPI B;  4QSH A;  3DDQ B;  4II5 B;  2WIP B;  3RGF B;  1GUX A;  4BCN B;  4EOO B;  4YOO A;  3QZ5 B;  2PHG A;  3TW6 A;  1OI9 B;  2WEV B;  2UZB B;  2IW9 B;  2EUF A;  3A8H B;  3POM A;  3TNW B;  1PKD B;  4CFU B;  4EOM B;  2BS4 A;  3X25 B;  5LMK B;  1W98 B;  2C6T B;  4YOS A;  1F5Q B;  2R7G A;  1C9B A;  2DD5 B;  4F7J B;  3QZ9 B;  1FKM A;  1JSU B;  5CEI B;  2CZ7 B;  3A8O B; 
#chains in the Genus database with same CATH homology
 1GUX B;  3BLR B;  2I40 B;  4YC3 B;  1BU2 A;  1GH6 B;  4BCP B;  3BLQ B;  4CXA B;  1P5E B;  2PMI B;  2UZE B;  1XO2 A;  4UN0 A;  3EOC B;  4F70 B;  5ICP B;  5HBH B;  4EON B;  2CCI B;  3MY1 B;  4EOK B;  5EFQ B;  4EOR B;  4EOS B;  5ACB A;  1H1S B;  1VOL A;  1H24 B;  1AD6 A;  2B9R A;  4F7N B;  1JKW A;  5I5Z B;  4EC8 B;  1O9K A;  1TFB A;  3MY5 B;  4YOZ A;  1G3N C;  4BCQ D;  4F6S B;  1AIS B;  1JST B;  2C4G B;  1D3U B;  2PK2 A;  4FX3 B;  3DOG B;  3BHT B;  1H1P B;  1UNL D;  5HNB B;  2WHB B;  4I3Z B;  4KRD B;  3O0G D;  3H4C A;  1VIN A;  2F2C A;  4BCJ B;  4KRC B;  4CFX B;  5L2W B;  4BCK B;  2WXV B;  4BCM D;  2X1N B;  4NST B;  4F7L B;  4CFW B;  3F5X B;  4CFN B;  4EC9 B;  4EOI B;  2C5X B;  3TNI B;  4BCQ B;  4EOQ B;  2C5N B;  4BCF B;  4OGR B;  3EJ1 B;  3BLH B;  1FVV B;  1ZP2 A;  2G9X B;  2WMA B;  5FGK B;  4CFU D;  5LQF B;  3BHV B;  3BHU B;  3TNH B;  5CYI B;  1VYW B;  4EOL B;  2CCH B;  2WFY B;  2WPA B;  5IDN B;  1E9H B;  2C5V B;  5HQ0 B;  4BCN D;  4ROC A;  2V22 B;  4BCM B;  2UUE B;  2W9Z A;  1OKW B;  4ROE A;  5BNJ B;  2JGZ B;  3QHW B;  5HBE B;  4ELL A;  4ROD A;  2W2H A;  1H1Q B;  1FIN B;  4EOJ B;  1OIY B;  4F6W B;  5IDP B;  2BPM B;  2W9F A;  4CRL B;  4BCG B;  4IMY B;  5IF1 B;  4CFV B;  3MIA B;  3DDQ B;  3M03 A;  4II5 B;  1OKV B;  1H26 B;  3DDP B;  3LQ5 B;  1H4L D;  2IW6 B;  1O9K B;  1UNG D;  2WIP B;  1N4M A;  1OIU B;  3RGF B;  4BCI B;  2CJM B;  4BCO B;  1GUX A;  1H1R B;  4BCN B;  4EOO B;  4F6U B;  4YOO A;  2BKZ B;  2PHG A;  3MI9 B;  2W99 A;  4CFM B;  2IVX A;  2UZD B;  4BCH B;  1OI9 B;  2WEV B;  2UZL B;  1H28 B;  1QMZ B;  1UNH D;  4G6L B;  2UZB B;  2IW9 B;  2EUF A;  3K7A M;  3POM A;  1OL2 B;  3TN8 B;  3TNW B;  2PK9 B;  5HVY B;  1PKD B;  3EID B;  4TTH A;  4CFU B;  1OL1 B;  4EOM B;  3QHR B;  2WIH B;  5LMK B;  1URC B;  1W98 B;  2C6T B;  4YOS A;  1F5Q B;  5HBJ B;  2QDJ A;  2R7G A;  1H27 B;  1C9B A;  1GY3 B;  1KXU A;  2C5O B;  2W96 A;  2IW8 B;  1OGU B;  2I53 A;  1H25 B;  4ELJ A;  1JOW A;  4F7J B;  4EOP B;  2WMB B;  4Y72 B;  4F7S B;  4OR5 B;  1JSU B;  5CEI B;  3G33 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...