4CFZA

Savinase crystal structures for combined single crystal diffraction and powder diffraction analysis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of an Industrial Production Suspension of Bacillus Lentus Subtilisin Crystals by Powder Diffraction: A Powerful Quality-Control Tool.
pubmed doi rcsb
source organism Bacillus lentus
molecule tags Hydrolase
molecule keywords SUBTILISIN SAVINASE
total genus 100
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4cfzA00
1GTL1 2DUJA 2ZWPA 3DVRX 1GTJ1 1AQNA 1Y9ZA 2W2MA 3VYVA 4DJ5X 1Y4AE 1C9MA 1OYVA 1WSDA 1SBIA 2HD4A 2ZRQA 3OSZA 3Q5GA 3QTLA 1XF1A 1WVMA 4OMCA 2X8JB 4OMDA 4CG0A 2WV7A 4MZDA 1TM7E 2ID8A 3CO0S 5CW1A 2SBTA 4NE9A 2WUWE 1KE2A 1SPBS 1KE1A 3F49S 2W2QA 3VSBA 5ARBA 2PWAA 4ZARA 4DWWA 3WIUA 2Z2XA 1EA7A 1SIOA 1AV7A 1GCIA 3SICE 1T1IA 1BFUA 3TECE 3GCXA 1THMA 3DE1X 3DE0X 1SIBE 1SIUA 1AF4A 3ZXYA 1SUEA 3WQBA 1NDUA 1Y4DE 3AJ8A 1PTKA 4NMXB 2HPZA 1GA4A 1TM1E 2Z30A 3DE6X 3LPCA 2B6NA 3DE3X 3D43A 1Q5PA 1BH6A 1TM4E 1T1EA 1AK9A 1S2NA 1SUPA 1Y1KE 1ZVKA 2WUVA 2WWTA 2Z2ZA 2Z58A 3PRKE 3H42B 3QMPA 4HVLA 1AU9A 1GT91 1T1GA 4K8RB 5K7SA 4C3UA 1SUAA 1SCBA 1SVNA 2PMWB 4JP8A 4RYDA 4WOCA 1C3LA 1SBNE 3AFGA 4YN3A 1SBTA 4WOBA 4CFYA 2QTWB 3LPDA 5FFNA 3VHQA 4LVOA 5JXGA 3A3NA 3D9QX 1WMFA 4KG7A 2PRKA 1GNSA 5AMXA 1VSBA 1NLUA 1AVTA 1R64A 1SCJA 1SUCA 3DWEX 1R0RE 5JXIA 1SCNE 2PKCA 1TECE 1GNVA 3EDYA 1BE8A 2W2PA 1Y33E 3DW3X 1S01A 3EIFA 3L1KA 1A2QA 2IXTA 4KB5A 2IY9A 3AJ9A 5ARDA 4DZTA 5FAXA 1SN7A 1C9JA 1V6CA 3DDZX 1KDVA 1KDZA 4BWGA 3F7OA 2DQKA 2SICE 4AKSA 1SBHA 1IC6A 2SECE 1IAVA 2X8JA 1CSEE 1LW6E 3TI9A 1SELA 1P8JA 1TK2A 1ZVJA 5ARCA 1SCDA 2V8BA 1GA1A 3CNQS 2ZWOA 2W2OA 3P5BA 2XTJA 3BX1A 4B5LA 1WMEA 1CNMA 2Z2YA 4GI3A 3T41A 1Y3DE 4I0WB 1YJBA 1BJRE 3DE7X 1R6VA 3WIVA 4C3VA 4ZOQI 1C9NA 1SUDA 3F7MA 2DP4E 1P7WA 1TM3E 3BPSA 1Y34E 1Y3FE 1YJCA 1GA6A 2W2NA 2ST1A 1S02A 2PWBA 1BE6A 2G4VA 3DE5X 1SBCA 1ST2A 4H6VA 4HX2A 5FBZA 5AVJA 2P4EA 1V5IA 1TO2E 4CFZA 3A3OA 3I37X 3ZXXA 3VV3A 3LPAA 5AVKA 2ID4A 5JMOA 1Y3CE 3PTLA 1GTG1 3LXUX 2SNIE 1PJ8A 1MPTA 4KPGA 3QFHA 3Q40A 1ST3A 4OV6B 1OT5A 1UBNA 1WMDA 2E1PA 1MEEA 1Y3BE 1YJAA 1TO1E 3GT4A 1NDQA 3I30X 1TM5E 5I9SA 1SUBA 2Z57A 1PEKE 3A3PA 3HJRA 1DBIA 1AH2A 1TMGE 1HT3A 2PYZA 3I34X 5B1DA 2PQ2A 1KDYA 1BFKA 1SCAA 3DW1X 3EE6A 1SH7A 1YU6A 1PFGA 2XRMA 4M1ZA 1JEAA 4NE7A 1P7VA 4J94A 3DVSX 5SICE 5B1EA 2Z56A 4H6WA 2TECE 3DE4X 5JXHA 3I2YX 3SQOA 3TI7A 4Z2AA 3GT3A 3DE2X 1DUIA 2GKOA 3BGOS 4LVNA 1OYOA 4H6XA 3VTAA 5JXJA 4FONA 1EGQA 3DVQX 3GCWA 3VV2A 1Y48E 4AKTA 3DYBA 5AQEA 3WHIA 3UNXA
chains in the Genus database with same CATH superfamily
1ODTC 3IIEA 3RYHB 4OHBA 3DD5A 3UOAB 2JH3A 4EHDA 4IDFA 4E70A 2BFDB 4BMOB 1E6MA 2FMHA 4U39A 3KV1A 3N87A 4RC9A 1AHNA 4IDQA 5E7JA 3V7NA 2W37A 4HX5A 2O48X 3FWYA 3M1LA 4YAUA 4XJVA 5F2OA 3STXA 1HMPA 3ET4A 3CRW1 4OI1A 5KYVA 2QRJA 3JYHA 3ZJ5A 1SKBA 3A28A 3WB2A 4DLSA 1BAPA 2I55A 2WW8A 1CETA 1KHTA 2RIPA 2CN1A 2JZOA 4UUMA 1DX4A 1T5TA 1SGWA 3TECE 4M54A 1KQOA 1NR1A 3OQIB 2RBGA 4DIMA 1FP2A 1PSZA 3GH1A 3WQBA 3ZHYA 4JC4A 2Z30A 3ONEA 4FS3A 1CNFA 2WZDA 3PNLA 1HM5A 2C2XA 3SK0A 1XTJA 1S2NA 3VM6A 1VBKA 3TPZA 4MW9A 3D6FA 4IIFA 3WL8A 3O26A 2PGJA 3PDJA 2XI4A 4H7KA 4UEKA 4DA7A 3OX4A 4EY4A 3VNVA 3EJWA 3ESDA 2X0JA 1KAQA 4B4WA 1EVIA 3REGA 3PKZA 1XHEA 4ALIA 3HUTA 2BRUA 3KEOA 2NZYA 3LQKA 5IAEA 2NUTB 1E2JA 4BNMA 1XKLA 5LOVF 5LMUB 2BGLA 4PONA 4GWLA 3UB2A 1K27A 3PB3A 5F9FA 5BUSA 2FPXA 4HN2A 3WMRA 1ZRSA 2JHAA 4FP9A 2RCYA 4RIGA 1SULA 2PN1A 2RHMA 4EFNA 3HABA 4REOA 2PKQP 4H31A 4U2GA 4G1EB 3PGXA 4FW8A 1KR2A 3CR7A 1BX1A 3QPCA 3PJDA 1FF9A 4P3XA 3VC1A 1AE1A 3LLSA 4HWTA 3HDVA 4FOLA 1J20A 3IQHX 5KSZA 3MN1A 5KTKA 1BDJA 4DQ0A 3OE7A 4LSWA 4DQVA 2VEOA 4OXXA 1E3TA 3VBCA 2PX3A 4F5EA 1ZD8A 4X63A 3VKFA 3GJZA 5AQ1A 5CD9A 1JALA 1ZRHA 3O92A 4J4TA 4ETNA 4FGUA 2BGUA 5ALNA 4PSDA 2Z95A 4FILA 2O05A 3ESZA 3WK5A 2DE0X 4EG7A 2UYCA 3KTOA 2NO4A 3QKWA 3C5HA 1GCUA 3WZLA 3BM5A 2RBEA 1XFAA 4ZHSA 1R5BA 4DC0A 1Y3FE 1GGJA 4TL7A 3NIWA 2W83A 2DUUA 2E6UX 5TJHA 4WK4B 3GEGA 2QTFA 1B8PA 1WP9A 3I37X 4A26A 3OT1A 4DVJA 4G25A 3C48A 1WPXA 4F45A 4JMLA 2Z83A 1T8RA 4K6MA 1N6KA 1WHTB 5FUXA 2OFPA 3KWLA 5FBHA 3FA2A 4ZYYA 5IEJA 1RWBA 4LHZA 2LCFA 4DRXB 1WP4A 1D1TA 1A5AB 1XTUA 3BTOA 4OKSA 4RTQA 1OXSC 4OFBA 3W5HA 3KYBA 1BQ3A 4X7MA 5E7MA 1U7WA 3JSAA 4M83A 4V02A 3RU9A 1ZVVA 2Y1FA 4D6XA 3N76A 3HCCA 4AUKA 2E5WA 3ER6A 3G9ZA 4A5SA 1A1VA 3SOPA 2ADMA 1RYFA 4JI8B 1WG8A 1GYRA 5AP9A 5CDYA 5JD4A 1EFPA 2XOXA 3RRJA 1DC5A 3I2YX 2N46A 1IZ0A 1U0EA 5ALOA 5KMGA 2H1WA 5AFSA 7REQB 3GXOA 3JRXA 4NU8X 4HLQB 3KB2A 3FRHA 4JSRA 5TF4A 1ZS9A 1QDUA 3N7AA 2XJ4A 4AIRA 4KDFA 5BV0A 3IGFA 3FUVA 4RORA 2IOYA 3H1FA 1HKUA 1GTL1 3OFKA 2CL5A 1BOOA 2H5EA 2AF4C 3CLHA 3EGXB 4C0BA 2E2WA 1K88A 2HD4A 4GGPA 1JB1A 4LDRA 5EE1A 4LTMA 1JIIA 2FPRA 3KLBA 3REFA 5CCBA 1S1MA 1DB3A 1TRKA 3UK0A 1YTLA 5BYJA 3QU9A 4DMFA 4E07A 2NV2B 3RU7A 1EX6A 4KQWA 4E2YA 1O6ZA 4Q9HA 5BMVB 2IY8A 2H4WA 2Y77A 5KVQA 1RAFA 3BHJA 1W29A 3GEHA 2QRZA 4QOGA 2VJYA 2YHUA 3TB6A 3TKYA 3BOSA 4LFBB 3RLFA 2FFJA 3DE1X 5M04A 1P1HA 2NU8B 1WW8A 3RUFA 1AS3A 5DT9A 2ODPA 2R6CA 4QPZA 4E1VA 1XLVA 2G1PA 1H05A 5K7SA 2K5UA 2YKGA 4AS1A 2P2DA 3EISA 2CFIA 1UFRA 3HN2A 2EGHA 3IVAA 4IZOA 5C5CA 4JYMA 1T2UA 2TMKA 1AQLA 2XZPA 2NNWB 1X7GA 2QIPA 1UK7A 4QO8A 4EZEA 2MMGA 2ZRJA 2AKAB 4D56A 3HFRA 3HP4A 3HJTA 5B30A 5GVSA 5IYZB 4R2WA 3N6RA 4OBEA 1FFGA 3PNQA 4FX5A 3WMFA 5C52B 4YCSA 4ZQHA 5REQB 2YIJA 1E7SA 1H5UA 1RNLA 2VRCA 1HI9A 2GK6A 1O8BA 1VPDA 2ZRIA 2E7ZA 3OMWA 3R6WA 3R7DA 2YWDA 1NRJB 1HRDA 3SR3A 1YBAA 4WJKB 3VAAA 4BE9A 2A14A 4IQ4A 3C3AA 2J45A 4S1TA 3H19A 4UNNA 3SJ7A 4CTJA 1X7HA 4MEAA 2RGEA 3A04A 1TEXA 2EQAA 2H8KA 2UZAA 4CIAA 3DNPA 3MQ4A 4BO3A 3L6BA 1EFTA 3R23A 2PK3A 4CM4B 4OP2A 5AKLA 5JSZB 2VXCA 1L5QA 3U3DA 2I3ZA 3SQDA 1R6BX 2J5QA 4FYVA 4WBNA 3CZRA 3IIIA 3ZDDA 1CUIA 3T3NA 2ODNA 2OENG 1QIGA 5D3ZA 4MKIA 5TT0A 1YB2A 3WIVA 1NZDA 4G84A 3R5JA 2HHAA 4CYMA 1IQRA 3JCZA 3ILSA 4FIZA 1RJWA 2C9ZA 3LFHA 5KC9A 1Q19A 1H2WA 2JGFA 4Z3DA 3LDFA 4NCXA 5JNRA 1E4OA 4IMIB 1LGYA 2X3FA 4O5OA 2FPIA 1MCZA 4DLZA 3NV7A 5FUWA 3UCFA 5CDUA 4G0WA 3WIEA 4F2DA 1FDVA 1IL0A 3MRXA 2M1XA 1U3DA 2FUG6 1MOQA 3VTZA 3NC4A 3WP1B 2NLOA 3EXHB 2VKTA 3OPMA 5AJWA 3D7SA 4XFKA 1LCIA 2V6BA 4B3DA 3TLJA 1Z7BA 3DW1X 4XWWA 2Q6IA 2EHDA 4Y2XA 1GTSA 1KMHB 2H85A 2HWUA 3H83A 2GJ9A 4QAQA 4A82A 3LTEA 4G1UC 4BE7B 4XZ3A 4CXMA 3EA4A 2EYQA 2BJVA 1GL6A 1FUUA 1HZZA 1NTOA 3BE5A 3BEDA 3C5EA 3RRYA 1UBTS 3ZHXA 2HSEA 4HZIA 3QHPA 3TPCA 3VV2A 4UVGA 4UBMA 3T3MB 4BZZA 1G8KA 4MP8A 2MOKA 2YR0A 1NSTA 3F90A 1K5DA 4F8YA 2WNIA 3MWJA 3D2BA 2TSYB 4RULA 2FR0A 5TQ0A 3LT5A 3NHLA 4AZ3A 1KWKA 4ZVKA 4B3HA 3UBMA 1G98A 3WLTA 1QZUA 4CM3A 1OIWA 3I53A 5AM5A 2DBVO 4Z9YA 3VPHA 3TRKA 4OPMA 2FQYA 1TYEB 1IYZA 1DAEA 2C4VA 3Q3HA 3NVAA 3MCTA 4XRRA 2CDNA 1YZKA 2CUTA 2WAXA 2ZJ7A 1RWPA 4EWLA 1OJLA 1BFDA 2D2IA 1L5SA 4H59A 5T41A 2Q0SA 2W8ZA 3RG2A 1AF4A 3LQYA 1LLQA 2ORYA 1L4MA 3PHCA 3ZVMA 3GNLA 3HLKA 3G2OA 1HQCA 2ZTUA 4RIEA 5AVRA 4YUAA 2I7VA 2ODTX 3G79A 5G4KA 1H93A 3F98A 3R8CA 4LHVA 3RARA 4GSKA 1F2TB 4JP8A 1BMDA 2BUCA 3SM3A 1CIPA 1NZJA 1SBNE 2DRIA 4TWJA 4EHIA 4ZI7A 5KREA 3MB5A 4X8MA 5FWNA 2ZSFA 1U4NA 1M1XB 2AVNA 4YDRA 4YPOA 2KBFA 3T5MA 4KAAA 3DBHA 4OHFA 1YMVA 3M6IA 4JX9A 3DDWA 4LXYA 4L0MA 2MSWA 2P27A 5DHRA 2HXGA 2ZI5A 3HYRA 1ICEA 3BSSA 5F64A 621PA 2A6PA 1I13A 3VGPA 2PIAA 3MYRA 3PXBA 1I7LA 4WXPA 3G17A 2PZLA 3MIIA 1MC1A 2XYVA 1B73A 4GE0A 2C5AA 3Q0IA 1FU4A 3WSVA 2H2FA 1AMOA 4C0HA 3EZ6A 4AXXA 2HIAA 2EBWA 1PWHA 3IE2A 5TQ2A 3GZ4A 1R0SA 1SCDA 2WMDA 4IUCS 2AJTA 1T4CA 4FT2A 2X7HA 2HJ9A 2XDQA 1LW7A 2UYQA 3RM3A 3CMCO 3G2KA 3VTKA 5IXSA 3FDJA 2WG2A 4MEJA 4PYQA 1P74A 3JW8A 3X2EA 1BEEA 4BU0A 3EPJA 3DFMA 4EOGA 1B41A 4NYJR 2QRPA 2ZJFA 4H6VA 2JZCA 4IDAA 4RM3A 4X0EA 3WRVA 1Y37A 1YIOA 1D2RA 4BCCA 3PC3A 4A2PA 4GBMA 1AGYA 3TW6A 1JJBA 3OD5A 1ZRMA 1UKVY 4B32A 1JIVA 2IYAA 1BVYF 2H1HA 2Q5FA 2VBIA 2YCLA 4FEEA 3B6MA 4EEKA 3JAKB 4JROA 4Q1FA 4R2IA 2C2OA 3OZIA 1GV1A 3B2EA 4E03A 1XDDA 3ZV5A 1KEWA 2DWOA 2A0UA 3CM0A 2EFHB 5ALGA 1CUAA 5AOAA 3UUWA 4OHCA 5DRYA 4DJFC 4LNUA 4M1EA 4ZVLA 1CDZA 1XRPA 1V35A 3WTCA 1RJGA 3VSCA 1PEYA 1PKXA 1QH8A 3F5SA 4K88A 4RTSA 3ZBTA 1BOFA 3UT6A 4K3UA 1JWAB 3CR3C 4O59O 3WGHA 2ET6A 4LXXA 2JAXA 4KGZA 1GTMA 3LP8A 1E5VA 5TMBA 3BL6A 3R6DA 5THXA 5KYYA 2QSYA 2ZYGA 2BGTA 1EJ0A 1PZXA 1XJ0A 1GHTA 1BS1A 1P0MA 4E88A 1EMDA 1VYVA 1UP6A 4BB0A 3MRSA 4P4TA 3A0RB 4D41A 2AJBA 4MUXA 4MIOA 3NCHA 4Y2YA 4BEWA 2W22A 3GLSA 4X41A 4EG0A 3D0KA 5CVJA 5JWHA 1HDXA 2R1TA 1SPBS 3VMMA 1A9QA 1DX6A 2VZLA 4ZAXA 2NQ2C 1BRMA 4HH4A 3PXGA 3V42A 1SBZA 4J49A 1QFJA 5C8XA 2I22A 2H7YA 2X9LA 1Z7WA 2BZSA 5JAQA 3SDZA 3WGTA 5JNWA 1P2BA 1DLJA 2AI1A 3VYUB 4WKCA 2IV2X 1MB2A 5KOHA 3FPFA 3ZE0B 5DTEA 2QJWA 2AD1A 2P91A 2XXJA 4KQJA 1G42A 1P9OA 2I6SA 1TM4E 4O29A 5EXDA 3SIPA 2PU7A 1AUOA 4JB8A 4YT4A 3H42B 1UM9B 4C88A 1ZVQA 1IBMB 3QVJA 2UVDA 4JHXA 2YQZA 4ZQEA 4EABA 2ZJ3A 3KOWA 3C1TA 4NESA 5EXEA 5FYQA 4E5UA 2X4GA 1G41A 3M6UA 1MJNA 3QIVA 4ZRNA 3DAGA 1JBEA 1T0BA 1W5AA 1M6VB 3HMKA 3JQ9A 1HFJA 4JUAA 4XYBA 5E2BA 2ID7A 4CV3A 5JZ9A 2ZYIA 1PJSA 5D6OA 3MJHA 3SF0A 5KYGA 2PAFA 4J2TA 1E79A 2H4HA 4NEGA 2FN9A 1RC0A 3I92A 5ESDA 3SYTA 2AWOA 4U3JA 2WIKA 3ZQKA 1KSJA 4UQPA 1V8OA 1TQ4A 2OEPA 3NMUF 1ADJA 3L7NA 1NQVA 3BD9A 1KDVA 1NLYA 1EGAA 5HF5A 1BVHA 5DBOA 2OA0A 1LPPA 1S8OA 2IPNA 4PX3A 4KE6A 5H8WA 2NTVA 1EB9A 1U7XA 3UXYA 2QE7A 5D01A 1ZRNA 1SCUB 3IKMB 1FVHA 3ZCRA 2FZGA 3LIIA 1OR8A 3T9EA 3AHCA 2PUCA 5K0LA 1V8BA 1HNZB 2IYWA 2EZ8A 1OGYA 3T95A 5KQGA 4J2OA 5EJGA 3S7TA 5ADVA 3I0ZA 5CDTA 2R4QA 2Q21A 3P9CA 5AJYA 3KWMA 5BO5A 3TB4A 1SUIA 1XMIA 4X6XA 3VYRB 3PHHA 5F4ZA 3TIXB 4ZYUA 5HRAA 3USZA 5TLSA 2HT1A 3AV0B 1RQLA 1YR6A 2IA5A 3I1YA 4URUR 3U4CA 4JV5B 3F7NA 3UJDA 3WL5A 4LJRA 4GZMA 4PFSA 4L3WA 3TDMA 5DM70 4EMUA 4C0AC 4JJ6A 5AK3A 5C5IA 2IOFA 1D2MA 1X77A 3E9QA 1USWA 4PTLA 5F4BA 5J2TF 3TW4A 2OGWA 5DLYA 4H60A 4RKFA 2C78A 2FP4A 2PQ2A 4KW7A 3ZJUA 3L6OO 3CR8A 1CIVA 3UKDA 4AT1A 3GL9A 4MQFB 5EA2A 2B36A 4PRLA 2KLHA 4U2BA 1JFFA 3H1AA 5A71A 3U4DA 2IHVA 3A1DA 4MVJA 4YRRA 4AS2A 4EYKA 5B3KA 5C7IO 2IU0A 1V0JA 3TOVA 1AHPA 4JKYA 4URHA 3AP2A 1QFXA 4XWKA 4UNPA 1GITA 1Y48E 2HY7A 3BQMB 2WV9A 1NFRA 3FLAA 3O4FA 4YONB 5FLKA 1SZPA 3EGEA 1MZPA 5HUQA 3OX2A 4NICA 1G7TA 4YUVA 4HQRA 5KDLA 4MRAA 4ETIA 2WKWA 1FEZA 1YA8A 3OSZA 1JQBA 2VJOA 2AFIA 4K3VA 5AUQA 2WV7A 4TL8A 3RC9A 1NQTA 3OPVA 1LDNA 1JTEA 1CB0A 2JGIA 3BH0A 3LBHA 1QH8B 1XJCA 4CM9A 2AMJA 5LNK1 1NQAO 4HJXA 1QH1A 5K8CA 2I4LA 5KAPA 4B3FX 1H6DA 1QP8A 3X1DA 4JD5A 3PHLA 3QE3A 1HH4A 3EDMA 1T3LA 1L1RA 3CB4A 4EUFA 5HBRA 1GPAA 2Q45A 3V1MA 1JRLA 5LJIA 4XVQA 4WXYB 2AWNA 1Z0AA 2G3YA 3WYBA 2XEXA 4ZPJA 1BD3A 1TI7A 1LX7A 2H7CA 3IBCA 1VIDA 1ZVKA 4N12A 4RE5A 5EI5A 1ZNQO 5CYFA 3TD9A 1NGSA 2UDPA 2OXEA 1GTVA 2B3DA 2DPYA 3PHJA 4LDNA 2N3ZA 3L6EA 3ND6A 2R7KA 3P9NA 4QD3A 4TYMA 1G5HA 5CB8A 3E2PA 2P90A 4G0NA 4OIMA 1AG9A 3AF3A 2Z5VA 1X8XA 4MKXA 3TMKA 3A70A 4AVYA 4AN1A 3K0BA 4C4PA 3BJIC 1QP0A 3CLSD 4NCHA 2AE1A 2VQDA 5EXPA 5J40A 3EULA 3KUKA 4BLOA 1J25A 1G6KA 2RH5A 2Y1OA 5BW4A 5ED4A 2DBQA 3OE1A 1G8YA 2QPLA 2OGSA 4PWYA 3QA3E 3PWZA 3EEFA 4MJ3A 1QC5B 1QX3A 1Z56C 2JGAA 2RAFA 1XRSB 1G0NA 2Q3HA 1TUBB 4E1AA 3B5EA 2FEMA 4YMWA 5J2UF 2J09A 3OQJA 1C3XA 2ZAMA 1K68A 3CJRA 1YUMA 5ARDA 5E7IA 1MR3F 3H11B 3MWYW 5EYPB 3QF4A 5B2EA 2XH8A 4OHRA 3PLAE 2IDKA 3ZZMA 3EDCA 1RBQA 1ITZA 1DIGA 2CFTA 2MHCA 3S68A 2JKVA 4R9RA 1XXHE 2LIPA 1G3RA 1VIMA 1X13A 2YMMA 4DIKA 4Z9BA 4JOSA 5JW6A 2WDPA 3ED1A 5KNDD 4H7EA 3K0SA 2VJPA 1PWZA 3ETDA 4M46A 5C3MA 2NAPA 3ANLA 1E3JA 2OHXA 4Q6BA 4WLEA 2CZQA 1N7HA 4DLYA 2AFHA 1I9CA 1BO6A 4RL6A 4DYDA 1YUNA 2P3QA 1S8AA 1KFJB 4EYSA 3THXB 2GDZA 3FFXA 1XEWY 3F4KA 3JWHA 3CXUA 4JBXA 5DGHA 5DM2A 1OLXB 3TZBA 3CJQA 2OESA 1P5HA 4PS1A 4CHGA 2ZM6B 1QG0A 4M6WB 2HA5A 1M7GA 1NKSA 1ST3A 1CUVA 2E1PA 4RFSA 3IXLA 3L1IA 1VM6A 4LI3X 1W5TA 2BR5A 3ISJA 3S1LA 4HWPA 1MJHA 1MJGM 2UUOA 4OK6A 4DSTA 3RJTA 2QM0A 4FR5A 2O8FA 4UBNA 1NQOA 4WI1A 3IS3A 3NBMA 2QQEA 2CUKA 2F9MA 2XZTA 2IXEA 5JAIA 2AB0A 1QPZA 1Q1EA 1E2MA 4I19A 3AQIA 1JR4A 1S2LA 4KODA 4UUQA 2Q7OE 3Q2IA 1EKXA 5AKIA 1XPRA 4ND1A 3FZGA 3DBLB 3QELB 4CU2A 1QO0D 3QVSA 4IIEA 1ND5A 1YR3A 4FNOA 5D51S 4EW6A 1AUPA 1QUEA 4WECA 2GD1O 3QW2A 4FHZA 4G07A 5AT1A 2PCLA 1X7XA 5H7XA 1N1GA 3L0BA 4LDZA 5CT5A 4KPUA 2ZIUB 3JZMA 4PC2A 3K5HA 4G0UA 4M99A 1EK6A 1LPSA 3HJAA 4LC1A 1LQTA 1VGQA 1Y5RA 2OHOA 5IHXA 4YCLA 4BPRA 3RKUA 4OJYA 5LP1A 1VPEA 4NG4A 2A9VA 4UTOA 1CR2A 2A0FA 1NYLA 1G8MA 2R87A 3O9VA 4P1ZA 1G17A 5AK6A 2VQ6A 3UT5A 3A6PC 5F7XA 3VNBA 5GP1A 2GPWA 2OCYC 5WRFA 3SBEA 3SZMA 1XPOA 3OH8A 4OQEA 1DUVG 4AICA 5EEGA 4WDRA 4YV7A 3FB1A 3SQNA 2D1SA 4DRZA 2ORWA 4UAVA 2VPIA 2ZWAA 3PE6A 5FV7A 1EDDA 3UAYA 2QBYA 3WG9A 2G5CA 1CR4A 1M2KA 3WYNA 2GCPA 3L5OA 1PJRA 2ZZMA 3AUJB 3GFRA 1O95D 3QW4B 1FDSA 2AJLI 3FETA 4TTSA 4CR7A 3BF7A 4EY3A 4LOAA 3D6TB 4BNXA 2OCPA 5IUKC 3DZJA 1N25A 3SC3A 4BTEA 3DLHA 3D7NA 5FTNA 4M87A 3WO1A 5B53A 5T6BA 3JVUA 2QRUA 3ROQA 2YHBA 3EZLA 3JXEA 4EJSA 1CJTC 3ONFA 4IW3B 2P75A 5KNDA 1CZNA 1ZM4A 2CLFB 3LY5A 2PX5A 1R64A 4G4SP 2WSBA 4JUFA 4BVJA 4Q34A 3LHIA 1SCUA 5KTTA 4ALMA 3A2KA 2WZQA 4R16A 5H70A 4L6IA 1W36B 4IGKA 1I3KA 3IIKA 2CLHB 5J2TB 1RRMA 4TTPA 4ZIRB 2YN0A 1J6UA 1RZ3A 3T3IA 1U5AA 4PG6A 3ZXSA 2OR3A 1GUFA 2QNRA 2QDXA 4N49A 2A9KA 4G1FA 1T35A 1XQVA 4G36A 4CM4A 3R0XA 3R3JA 4WCVA 4ALLA 2XGOA 3GDGA 2JCVA 3D7RA 3BA6A 4YI3A 5JQWA 1RPJA 4M7RA 1T5BA 1UWCA 3I6MA 4MWGA 5IAKA 3SP1A 3VHXB 5K4GA 5JCJA 1ODIA 1WZCA 2H16A 3EUAA 1J09A 2QTHA 2ECOA 2VC2B 2EZUA 4ZFNA 1Y3DE 3ILHA 3ZWDA 1S4QA 2VQSA 3GDFA 5E1OA 2YXDA 4OB6A 4KH0A 4W5NA 3SJCA 1DG1G 2OORA 3KAQA 1AQUA 1XKXA 3FOWA 4A0SA 1U8EA 1YDFA 3G1WA 4TV8F 2WT8A 3VDRA 3B3AA 3UJAA 3GGCA 4DG9A 5AHRA 5JRJA 1NMXA 2FPIB 2I1QA 2YN2A 3OQIA 4HNGA 4MLCA 3X44A 4E08A 4FC6A 2VF7A 3SR0A 1E1QD 3COPA 4REQB 1E3SA 1AT1A 3QHAA 3UGTA 4AI6A 4I2NA 4J8PA 1SUBA 5JY1A 4G37A 1YR7A 3LS2A 2ZUUA 3PD0A 4UEQA 1J8MF 3SQWA 4LGMA 5ANRB 4YUYA 3AILA 1R5NA 4M1YA 3RK0A 1L7EA 1VKNA 2R4UA 4ACBA 3DTVB 4P0QB 5C2JB 1BCSB 3IVCA 4RJ2A 4ND7A 3PVCA 3TZLA 2EARA 4BKQA 1PDWA 4MPDA 4NBTA 4F3TA 2R8OA 3RV3A 2VA8A 2H8GA 1G8PA 3ZJTA 2NNLD 3K4PA 1EGQA 3BL8A 1RXUA 1THGA 3EXEB 1M0TA 1KSFX 3O1HB 5F7ZA 3BIXA 3VU8A 3R9IA 4MDHA 1UWKA 2G4LA 2H1RA 3NHPA 4JIGA 1JL3A 2XAAA 3LWZA 2OE2A 3VPDA 3U4QA 1QG2A 4FFLA 5HKKD 5EP1A 1WUHS 3CF4A 4YJKA 2OBFA 3RC1A 1IRIA 1RAAA 3IB6A 4LZJA 3MG9A 1ZN9A 4BO0A 4LOIA 2VDLB 3AI3A 1CULC 3DEKA 4NNOA 3NHRA 1UDAA 1MC4A 1QVRA 3RYCA 4Z0HO 3O4IA 1UAYA 1CQPA 1Y1QA 5KS2A 4BKUA 1IK4A 2D0OB 2ZRFA 3HB7A 3NHMA 4EH1A 4N40A 1KAGA 2DBZA 2IEZA 4R8LA 5TXGA 3V33A 1R8XA 1UBUS 3UT0A 3NM6B 4Q82A 1UK6A 3B2QA 3AB7A 1QMPA 1Z5WA 3R5HA 2HOQA 4IJQA 5ENZA 1L4FA 1P4AA 1QHHA 1TKAA 1ZUWA 2VDPB 1K9SA 4ND5A 5LCXA 4BVGA 5HUJA 5IABA 1JFSA 1XYVA 4HZGA 2PL5A 1PUXA 4P3KA 4KAJA 1FRQA 3QXSA 1D1PA 1V9CA 1OWPA 1JHAA 3ROZA 3T1YB 5BRJA 2VSYA 4CEJA 1U9CA 1XKQA 4TSRA 5JXWA 4BBPA 4W7IA 4J43A 5DBHX 2EL7A 4ZTBA 5DMXA 4KOAA 2A0YA 4R8MA 4QGBA 3TOXA 3BB3A 1AN0A 2C31A 2X23A 1GYQA 1PR2A 1FMJA 1CJUC 4X1KA 1P4SA 3KM0A 4MW5A 2RONA 2YRXA 4FHGA 4EW1A 1TUGA 1VJ1A 1MV5A 1OGIA 4NYJQ 4N5IX 4DSZA 1Q7RA 3FF1A 5CG2A 2AF3C 4ESOA 1WU7A 2WIDA 2BE9A 3JQFA 4MVWA 4AG5A 3OT5A 1UJCA 1CX9B 3JQCA 4HL6A 4K9QA 2VXOA 3DTVA 2CNNA 3WDKA 2ANCA 3CBQA 1PK9A 3K2EA 5CX4A 3G0GA 1IWBB 1BMFD 2ZSJA 4GNKA 1SBHA 1BQ4A 1Q44A 2ADFA 1TDJA 3MMXA 4IIJF 2DJIA 4DCCA 4ITVA 1AKVA 1I9GA 1UIRA 4NL4H 5A9RA 1FXWF 3FMPB 1C81A 3W3ZB 5LBIA 3ROKA 3TCNA 3OE7D 1RWKA 3ZXIA 3IALA 1NXPA 2QDKA 1U1DA 4X7BA 1DI0A 1C3JA 4FB5A 5LQJA 2XB4A 1JYSA 1U0FA 1U7TA 3WJ1A 2BH2A 3ES9A 2GRAA 4UNSA 2VJKA 1Y3CE 3SHVA 3HN6A 5I4IA 3QVKA 1PJ8A 3BMOA 3EVDA 5JG7A 3JWGA 4Y3UA 1V3TA 2FW6A 3RVMA 4NZNA 3MMSA 3KOUA 2CC2A 3L77A 5K3FA 4DLXA 4UTRA 2JIOA 1KTIA 4TQ9A 1DRWA 2P5YA 4J0CA 4F96A 1M1UA 5K2MA 1G16A 1YZTA 3T3GA 3UQYS 4KQGA 2RD2A 1ZI6A 1DGQA 4IF4A 4JU9A 1XMSA 1QFYA 3LI2A 1SXJB 1ZMOA 3LRPA 5E9QA 3QVOA 5GGXA 2AMVA 3BJEA 3AR6A 5M7EA 1NT4A 2B69A 2YJGA 3F3KA 2R1VB 3IPCA 2AMFA 2CJWA 2EFDB 2WB4A 2HMVA 3N2IA 1CCWA 1UP7A 3AESB 3VH2A 3OCUA 1JYEA 4RADA 3V2UA 1JEYA 1EAYA 1JE0A 2JCGA 4JITA 4QPDA 3WOVA 2TMDA 1NWHA 4BJ5A 4WOJA 4EX6A 2XGJA 1KRXA 3TW8B 2FX5A 2GSDA 2HLNA 1GDHA 2BCJQ 2MSKA 3ICVA 3T9AA 5BNTA 1J2EA 3NZEA 3LCCA 3ZDFA 4F38A 3PCRB 3K6SB 2CYCA 3HADA 4BIIA 1N5DA 2QR5A 1Z36A 1V8PA 2F3TA 2W2TA 5EQFA 3PTZA 3UJ9A 2WFLB 8AT1A 4L5JA 1VA5A 4KQXA 3ICPA 4Q24A 1H1TA 3T3EA 3SC4A 2XLBA 2F48A 4V1CB 3BTUA 2D59A 4Y0AA 2DFVA 2ATVA 4KKXB 4FZRA 5CUQA 5HFJA 2Y2UA 3BUSA 3IOYA 4DDUA 4JOCA 2AG8A 2ZYAA 3O8QB 4JI1B 4H7DA 4AMVA 3OTOB 3NATA 3JWJA 4LDAA 2VHYA 4G5SA 3W78A 4OQXA 3W6OA 4YTEA 4X6YA 2RGAA 4EPYA 5KCMA 3FSEA 3TL6A 5J1SB 3RAEC 3FCEA 4BMPB 4DUGD 3LUFA 3AEKB 4XEHA 1BVUA 1E9RA 2RHRA 3TQFA 1Z0DA 2Q5IA 4B5KA 4GUDA 9LDBA 4XRGA 2E49A 2VTKA 4DQLA 1RW4A 4P3OA 3FPAA 1U1EA 1M10A 1UJNA 3LVQE 2F1KA 2IW1A 4PIPA 3BKXA 3TTXA 4PLVA 1F20A 1Z3CA 3W2EA 2Q5OA 3L4BC 4JEIA 4D4MA 1EBFA 5F76A 3PFBA 1C9JA 2RHJA 1RKBA 3ZYCA 3F8WA 3S1AA 1TIPA 5EJIA 1R3UA 5AI4A 1RACA 2QYOA 4W8GA 3PSHA 1XDWA 3LQRA 4JL6A 4PHTA 2REQB 3MINB 2ZRPA 2B7CA 1M5UA 2LIVA 3EDQA 4XB6B 1NU8A 4DKXA 2A59A 3CT6A 4DCNA 1RMYA 4PSKA 1X87A 2IE0A 3H6HA 3OVMA 1JHOA 1VSQA 2D1RA 2FKAA 2ZT8A 3B89A 4E6EA 4CLEA 3WSWA 4DUYB 5FPQA 2KI5A 5T5QA 3LDHA 1U2ZA 3GJYA 2GXAA 2BFCB 1XZJA 1KK2A 1ESMA 1V1MB 3ENNA 3N1UA 3OAAA 4G2TA 3BXEA 2ZIFA 1L1EA 1CY7A 1O77A 1LNQA 1XZ8A 3CKMA 3BWVA 3E7WA 2X2PA 4ZQBA 1HZZC 4LYGA 3Q3EA 1B3RA 3AJRA 1MPTA 4KPGA 5AD1A 4YR9A 4L8GA 1DAIA 3BQ9A 2JNWA 3L7LA 4U5XA 2J0SA 1L5HB 3V9AA 4B83A 1EZZA 1E5TA 2FSFA 1BMQA 5G41A 5JDCC 2ZI3A 3ND8A 4J76A 4RANA 3VO8A 3E84A 4MPRA 1QRTA 2JLCA 3C6XA 5LWQA 5F3RA 4MV4A 1ZL2A 4UDOA 3DC2A 4W5WA 5GOTA 2DWQA 3Q8XB 4XAQA 1PFGA 1IZZA 1GPKA 1WD7A 1XNHA 1JTVA 1H42A 3I8XA 4LHSA 1PFUA 3AETB 4NSNA 5DCYA 3WYEA 5FLXA 2JFQA 3DT6A 1J22A 3X1XA 1RHUA 2YWHA 4IIBA 3UG6A 5HIKA 1USIA 2JLAA 3SFTA 1JSLA 1PHRA 2QRVA 1MFPA 4DGQA 1YVDA 5DEIA 1DFHA 1FLAA 3DHYA 1UJBA 4B2YA 3BK7A 3WRWA 2A5GA 1I2MA 1FXUA 1HX7A 3TF5A 1P1CA 1IY0A 4M9RA 4BVHA 4RGBA 1Y9ZA 4NJMB 1N8SA 4I55F 1ECBA 2W4MA 3K1ZA 2VDWA 5EAIA 3VDMA 4EARA 1FP7A 4FGZA 4PYJA 2I80A 4RENA 2AQHA 1GT6A 5CW1A 4GP6A 1G8SA 4XM0A 3TLYA 4M1OA 1SXJA 4DSNA 2GSWA 1D6JA 2QPOA 3OJLA 1A7UA 4KXQA 4KXFB 4OHVA 4PBSA 4DQKA 5K05A 3QEAZ 1W47A 1IN8A 3LRTA 3OI7A 3Q3VA 3CRQA 4IGFA 3HYTA 3C4JA 1A8QA 4D8WA 1R16A 4B46A 2WTNA 1E62A 1SUEA 5HE8A 5TJ9A 4YR7A 4D9GA 4RXMA 2O8BB 3FHCB 2Q6LA 2JIDA 4FOTA 1JF8A 5BRNA 1YQTA 2IXGA 4EGFA 3ML1A 5CPFA 2X0RA 4MGEA 1BCRA 3OIWA 1M2JA 1GT91 1HQYE 3GLHB 4LWOA 1TPYA 2AX4A 3DFIA 1Y7TA 1HDZA 4EGQA 1FX0A 1KBZA 3EVBA 3CVXA 2PUBA 3LPDA 4D96A 3WNZA 2ZIAA 1N2IA 4WUTA 4YRAA 1BX0A 1CUDA 2WF8A 3D59A 5K3DA 4EK9A 3N3AC 4DDTA 2FQQA 1L5HA 4F46A 1D6NA 4V3CA 1PT9A 3TE6A 4QVGA 3DTVD 3FLMA 3EGXA 5A6SB 1XZDA 5EZYF 3UXEA 3X43A 4PQYA 5B4UA 3HKBB 1Z68A 3VR4D 2NAFA 2XDWA 3LXRA 1D03A 1O96A 2OCKA 1MB3A 1O58A 2ZYTX 3GBSA 1QZXA 4MRMA 4BQRA 1A97A 5BVHA 4C4XA 3Q9SA 5B12A 1TZKA 3EFOB 4NENA 1IIBA 2IH4A 1M9NA 1ZWKA 2BKEA 4LE0A 3CWCA 3VZRA 1QWSA 4M8SA 2OFWA 5L4LA 1LW6E 1H0RA 1HSOA 4UU1A 1TQ6A 3OQOA 3E3MA 2IWRA 1YQDA 4NNPA 1IHPA 4DRYA 2YJTD 2PSEA 3JAMA 4DKJA 3HG7A 3TM5A 4M9ZA 2XUJA 4ON9A 1ZYUA 4E30A 4HWGA 1GU1A 1L5OA 4PPNA 1GNLA 4ZKDA 4HHEA 4QOIA 5TGTA 5K3SA 2A5DA 1XFDA 2JHPA 3NAGA 4WIAA 5FUYA 1ZJJA 4MW0A 2V7XA 4QEKA 1E2DA 5HR5A 4HLDA 3JYQA 1DCKA 2E85A 1V11B 3GJSA 1EJ2A 4WINA 3UH0A 1XZHA 4AMYA 5JJIA 2E5LB 1V4VA 1T13A 4HQKA 3K71B 2XNCA 1XRNA 5I7WA 1E7QA 1RTKA 3GB9A 1H1DA 2Y27A 4LZWA 4E5NA 4IRMA 1LPBB 1XB2A 1AKWA 3BFJA 5SV2A 1OLOA 4NPAA 2CEAA 2ZB4A 4XGRA 3SHOA 3FOFC 1WNFA 1VE3A 2PO5A 2YXLA 3IJEB 5CH3A 5B7QA 2AZMA 4B3IA 3DP7A 2GCGA 3FI0A 2NQ8A 4PZCA 4Z2AA 3HE3A 4K9OA 1S3IA 4EI8A 1Z0UA 5AKJA 2QQ0A 4NZOA 1E61A 3E3AA 4LYJA 1WA5A 1KJYA 2GEDA 2ILTA 4Q3AA 1FUEA 1W4LA 2AFHE 4IZHA 3AYXB 4M8LA 1KYZA 1R50A 1IONA 1NA5A 2NW6A 4KDRA 4MAAA 1E6UA 1SG6A 1RLJA 4YDQA 3NHSA 4TYQA 1Z34A 5H81A 1QV6A 1JKJA 3H18A 3K8QA 3E8SA 1NM5C 1K6EA 2EHJA 4IJWA 4WFKA 3R3XA 5AW6A 4IUBS 1PV1A 3DTYA 3Q5DA 2O59A 4DILA 5F35A 1II0A 3ANNA 1QAQA 3O1IC 4ZWNA 5LXTA 2DERA 4PFKA 1ZH6A 5BQFA 4HGQA 5DN9A 2NMVA 5JJCA 4RTPA 2VXBA 5ALTA 3G0DA 3KXPA 3E8XA 1JAHA 1SIUA 1EX1A 3B3GA 3IPYA 4ZCPA 4CF4A 4DR3B 2QLMA 3SZGA 1IEWA 2PS9A 3Q11A 3K96A 4PHFA 3UAVA 3AVWA 3IT0A 4B6FA 2EW1A 1GQSA 3ZV6A 2QV7A 5JCOA 5F1YA 3AI7A 3FNBA 3EPRA 3GXBA 3GT7A 3C4VA 2C59A 4NFYA 4YCDA 5IBCA 1EHIA 2YQ4A 4MITA 4ZAFA 5IJ0B 3MHPA 1W8IA 4L4YA 3CX7A 1E7RA 2VAPA 4P81A 5EPEA 1RJDA 4AO6A 1EBUA 1Z5GA 4OFXA 3TTVA 5A4DA 2D5CA 1D07A 3PDUA 1E89A 2O5VA 3KVYA 4FFDA 4HS4A 4O1HA 5CVVA 1YVEI 1JLSA 2JGNA 2OCIA 4L0QA 3K0AB 5H16A 3PGJA 1VRWA 1D2HA 3EQZA 2W2PA 3MTIA 2J6BA 1F48A 3SKVA 1U1IA 1YHYA 5IH7A 4XJTA 4EQZA 1B93A 3H86A 4JYCA 4KE9A 3RTDA 4EMBA 1ZSNA 2NOAA 3J7TA 4HAIA 1PWYE 3O5AA 3T9DA 1HUQA 5EOVA 3SG0A 6ABPA 2EKQA 2C2HA 2XNKA 3A05A 4TRMA 4D4KA 1U63A 2EDCA 5JVDB 5BT8A 4KDEA 5TGDA 2A1UB 1P2DA 4B76A 4FFBB 3TQTA 1YKFA 4XIGS 4G5XA 4Y1FA 3KR0A 4X85A 3VOAA 1KO1A 3VNUA 3COJA 3F5FA 5KHAA 3C6ZA 4E4YA 1KIFA 5H0IA 1R4ZA 5JPCA 3AU8A 5FPHA 5HS6A 3PBKA 3RS8A 3VV3A 3L4BA 3TKLA 1NUSA 5K9ZA 2FUCA 3QFHA 3BDVA 4RV9A 4YA6A 4C22A 3PNMA 2OSVA 4RCZA 5AVSA 1N3YA 1CQWA 5LYJA 5AJXA 1ULUA 3HVRA 2I91A 1HDEA 2H57A 1GKLA 1QYVA 2FKNA 1RU3A 1ZMBA 1C8VB 2QG6A 3R7WB 1T2EA 4EF4A 1A96A 4MHOA 2VDUE 5LBUA 4XA8A 4DLTA 5KNLA 4Z54A 3IAEA 1QHNA 3AHFA 1YU6A 3DG9A 3P9SA 3ENKA 4NE7A 5TPWB 4CG2A 1JHQA 4N5LA 3ZKWB 3SI7A 4QGHA 4PZAA 2ZBUA 3GT3A 3I2FA 2CK3D 5J59A 2BBWA 4ZALA 2NPIA 4M6WA 4JI3B 3RNOA 1GLVA 1JWLA 4Q03A 3ESRA 5JJ5A 2BY4A 2HMTA 4RW0A 1LV7A 4KYIB 3AYZB 3MPOA 5HM6A 1PUIA 3LNTA 1CRWG 1DL5A 3B53X 3BTSA 3C8DA 4FFRA 3QEBZ 6ADHA 2K7ZA 2PG3A 2FSIA 1EFKA 2XDYA 1B6SA 4OXNA 4HNHA 1UL1X 1D3AA 3CO0S 2QYTA 4AF8A 1QOZA 3HB1A 3KOZA 4C43A 4QTTB 3GJ0A 3KOOA 3LBFA 4E2XA 4LZAA 1E60A 2C5HA 4IGEA 3LTNC 1WZIA 3D54D 4LCJA 4U63A 3C5WP 4Y2GA 3T7AA 2WU0A 4MWZA 3FDXA 3LUCA 1Z2CA 4DA8A 3RKSA 4WEQA 1KK3A 3A6JA 1QIHA 3OIDA 1SZJG 4V0LA 1YA6A 1GL9B 4D9CA 5CB0A 1YRWA 2H0QA 3MAGA 2JW5A 3LPCA 1MEJA 3O95A 4CIVA 4C7VA 3BMCA 5L7WA 1OOEA 4G0QA 2PEZA 3RIGA 4TVKA 1QC5A 4JXKA 3EFEA 4RO0A 4AURA 1QRSA 4WT7A 1G5PA 5IANA 2X8BA 2J3KA 2YDXA 1RPTA 4BLWA 3VR1A 4F3CA 3KKMA 4EG3A 1RTTA 3T5BA 2FLKA 1PJQA 5A4KA 2AQKA 3AI1A 2RGWA 4JCCA 2Y76A 3ANXA 5E95A 2XCSB 4U7FA 3DL7A 1XMJA 4TLEA 4B6OA 1IEXA 1P17A 1USKA 3SYRA 3QNMA 4RXTA 5JZSA 3GFOA 3CU5A 1DEXA 4D4JA 3FPCA 3AEXA 1KJWA 4O25A 4EVQA 3GJQA 4B17A 3MCAA 2W2KA 1TC1A 1E7WA 1LZKA 3AF2A 3DBLA 3L7OA 3AR8A 1A2KC 2FMTA 2D54A 4TWAA 3AHJA 1TOAA 2FDCA 1I0ZA 4YBRA 2X8JA 1G8FA 1ZESA 5FBQB 4TTRA 4R2XA 1SHKA 2XUAA 2GBLC 4FOOA 4PZ9A 3I09A 2OXFA 5JIBA 1JKXA 1XGKA 1W0JA 4LZOA 1C2YA 1T10A 2D0IA 4YHBA 2UUCB 1R6VA 3O2JA 5JYDA 1XR3A 3PCTA 5AXCA 2IBTA 1H94A 4O2RA 5DTMA 5DM1A 3UA3A 2Z2JA 2ON6A 5C8ZA 4JJEA 1INLA 2GO1A 3VYVA 3BH6A 1V2HE 2Q4BA 3O7WA 4KO8A 2KW5A 3F9IA 3P96A 2Y99A 3C24A 1E96A 1JDZA 1IZ9A 721PA 2Q1YA 1IXZA 4OV6B 3HACA 1WCWA 5E3HA 2BM0A 1NOKA 3FFAA 3FNIA 4E12A 3NC0C 4V03A 1UMBB 3HDYA 2G9NA 1M7HA 1AO3A 2BV3A 2VF8A 2VJCA 2CNBA 3VJKA 4MUFA 2EDAA 4BXOA 4HAUA 3QWBA 4YQYA 1DT5A 4BMVA 2BW0A 2IHZA 4KV9A 2R62A 3S40A 4A8TA 3CZAA 1XD9A 5ALPA 4LWPA 4YMVA 4YS6A 2BGWA 2FZKA 3ROPA 5EHXA 2UXCB 3THOA 4PG8A 1XQYA 1QRDA 3DE2X 1LY1A 1JJ7A 4MTLA 5EKDA 4Q05A 3F96A 3QHQA 1W581 1O8CA 1VE9A 4IMRA 4KIWA 4NAUA 4OX9B 3ZH9B 2H5JA 1CEEA 2ZYRA 1NY6A 4P58A 1CYEA 1W5FA 4R1LA 4HGNA 4DZRA 2MYNA 4BEBA 1G8JA 5A0TA 1U2GA 1N7IA 3GWZA 3H5OA 2PDAA 2XQKA 4MDYA 1BN7A 4L07A 2HA7A 1K7YA 5DTRA 3VU9B 3WLIA 2H2HA 4XIJA 2ACKA 1POXA 2JF0A 2HQ1A 4AWAA 6YASA 2I1VB 2J8ZA 2CLEB 2HH9A 1NYTA 2WHQA 3NDJA 5FEUA 5DK4A 3UWPA 1ENPA 4N7BA 2X8LA 4A8JC 4FJ0A 2BI4A 3DEIA 3TAXA 4W7SA 3I9LA 4IH4A 1SBYA 2WHPA 2MYPA 3BWEA 3DMTC 3GX1A 4PC7A 4PGAA 5E2AA 5FPTA 3T8YA 2FRVA 2MDTA 2ZTHA 4W9NA 4LF8B 1C50A 4YJHB 3DF7A 4BO4A 2HT6A 4ENVA 1Q5PA 2BGRA 4X95A 4YNBA 1TW2A 2H54A 3JALB 4YROA 4HFJA 5DDIP 1DUSA 3EMKA 5E8RA 3DWIA 1IXRC 5BN3B 3I1FA 1XEAA 3EXFB 5DJ5A 3KQHA 3UCXA 5DV9A 3BH7A 1A5BB 5K4HA 1I51A 5CK4A 3NGXA 1CFJA 5LD2C 4KXYA 4HWRA 2GBIA 1S2GA 3MJDA 3T61A 3G3EA 2A9OA 1VLJA 4U5QA 3FLBA 1ODJA 1J2JA 4X91A 1VCMA 4F5DA 3BMQB 4V0SA 3DXXA 5C8YB 5MFZA 2PJRA 1LPNA 2YUIA 2I4TA 3SR4A 3MCZA 1A4XA 3GU3A 3IQWA 1S01A 3IR7A 1M74A 2VNJA 1IJKA 1NVTA 4KB5A 4F4DA 2QEQA 1ND6A 4LHWA 1RM4A 2P9TA 3F7OA 5AM0A 4EPRA 2ZZKA 4LECA 4KR6A 2E0IA 4Z53A 1JHYA 1GILA 5AJVB 4DEXA 3TKAA 2ZR0A 4M1SA 1MOZA 4HX9A 1H2RS 2G83A 3RRFA 2KPOA 2YJ4A 2P3OA 1E2GA 2DQYA 4HYEA 2ZRGA 3WBKA 3B8EA 2WWIA 3AI2A 4RA6B 4DR6B 4WZ6A 1SC1A 3I83A 5AO9A 5FWYA 4CEHB 3ABZA 1S02A 5MGNA 3LT2A 1G21E 4EG5A 3TLMA 1L8LA 3FMOB 4KQIA 3RTAA 2FDXA 4C0SA 1QKKA 1WL8A 2PXCA 4OOFA 4PX5A 5KIAA 1X1RA 1QU3A 3OUUA 5AICA 1CK4A 2QNBA 3JQBC 1NW6A 3M1IA 1XLTA 4O3MA 3BDAA 5TDHA 1HTWA 1JPVA 1YJAA 1VHDA 2FMUA 4KV7A 4G4IA 4HAWA 4NCKA 3VQTA 1JUDA 3ZD7A 2GZRA 3LK6A 5AYVA 3JYLA 2BHTA 2P9ZA 3U4IA 4K81B 4PTZA 3PGKA 5H4GA 2QK4A 1URPA 5HXAA 1QFMA 1C9DB 3IP3A 4GZ6A 3IH5A 4MWTA 1DNPA 5JJKA 1IATA 2ZJAA 3NM5A 1J5PA 3HZZA 3V97A 2NSDA 2JI8A 5JAOA 3NYIA 4HPXB 3HA2A 3ADBA 1NW7A 1GTZA 2BKLA 3P94A 3NVKI 5F1OA 5I6DA 3OP4A 3TL3A 1DJOA 4GL4A 1C0EA 1ORWA 1YJXA 2AFRA 4QKQA 3RV4A 4P38A 2ZT6A 4Q21A 5C8YA 3PYLA 3DEAA 3AFMA 1IUPA 2AFHB 3W7AA 2GGSA 1VFNA 2Q4OA 4Z3KA 4ZI2A 4JLAA 3TUIC 2QX4A 3WQQA 2WVJA 3WK4A 4YP0A 2ID8A 4WKOA 3V2HA 3C8ZA 3C5CA 4I1RA 2GPBA 4KWIA 4TN5A 4II2A 3SF8A 4URZR 2X4DA 4NFSA 1HT0A 1QO9A 4O3FA 5IWAB 2QUBA 4S3MA 2IS2A 2JGLA 4RAQA 3JATA 2O8EA 1FSSA 4ZYVA 4IIDA 3HXLA 2BMJA 4FLEA 4M7PA 3U4GA 5JMTA 3ITDA 3H87A 3QUQA 3ANTA 3I23A 4Q19A 3DHWC 1NBWB 3CX8A 1YRYE 3OZBA 4DJEC 3VJLA 4NOKA 2JHGA 1XNQB 4LCBA 4QTYA 1T2AA 3D43A 3CUWA 2QRKA 3E1GA 4F6RA 2J67A 2RGGA 1WQ1R 1KP3A 3EQ6A 3VKHA 1EQ2A 1CS4C 4P8RA 4AC9A 1ZCFA 1PGOA 2HB6A 4D4IA 1OXKB 4O4HF 2MCFA 3V5NA 4YCNA 2N75A 3OF5A 4RU1A 5G2OA 4ZHQB 4LCEA 2ZBEA 3EC7A 3L18A 2AOTA 2HWXA 4TLLB 4HN4B 2FW8A 1H8ED 2IIBA 4I8DA 1O89A 2C4HA 2EGUA 1A7KA 2I67A 2OM2A 3NBXX 8ADHA 1AVTA 4DPKA 2IBSA 3EWNA 1A8PA 3FCOA 2I66A 3N5CA 3OCCA 4TMYA 1RQNA 6AT1A 3FMFA 2FXIA 3VTFA 2J0UA 1RXEA 5D1NA 1E99A 2II6A 3AUTA 2QXTA 3D4LA 5C3UA 1CUJA 3U49A 5I47A 1OZAA 1CXZA 1O9BA 3PQ8A 5DNVA 1KZ9A 3DQQA 2YYAA 2CDRA 1A3CA 1FMLA 1UK8A 3B1KA 3GMTA 3CKYA 1K3UB 3H3JA 3FPBA 4Q1VA 3T4EA 4AP6A 5CA0F 5CYGA 2HXSA 1SVMA 2D1YA 1ZCBA 2HCTA 2ZIGA 2R47A 1KI1A 1N0WA 1CLEA 1RBYA 3AF0A 4PVDA 5ALUA 5KNCD 3LFUA 2XXAB 5F7OA 2OD7A 4PO8A 1L5NA 2ZB2A 4QJ5A 2FWPA 2Z1DA 3WK8A 1CJMA 1GPWB 1Q0LA 4I66A 3EEQA 3WQHA 2XMRA 1QO7A 3EAQA 3A4LA 3DE5X 2JAOA 1U0GA 3AMVA 1YRHA 2BGMA 3BIWA 3BRQA 4PX2A 3Q9UA 1PRYA 4KFRA 4LRYA 4CDNA 3KQSA 5DI3B 1YU9A 1KYXA 1Z6XA 1EDOA 2QU7A 3TXAA 1ODKA 2ZCUA 1KK1A 4RV5A 4S0ZA 4KXMA 4DR5B 2ECQA 1UBNA 2IYOA 4Q1EA 5HRUA 2V9PA 1SKYB 2WU8A 3VNAA 1XNRB 3X0DA 4B80A 2BHNA 1HURA 4P7GA 4LXHA 2QL5A 3GOQA 4D97A 5G02A 4ES6A 3PDHA 1X3SA 3R7WA 1CC1S 3FR8A 5D8DA 3KQTA 2HRBA 2I4NA 3OY2A 4BIMA 3CEPB 1VKHA 4PG5A 4LXIA 5D00A 2VK1A 2F64A 4G8CA 1UJ5A 4W5OA 1KQ3A 3NHZA 4MLDA 1F6BA 1RIFA 1NBMA 2CJPA 3HA3A 3QFFA 4N9QA 4AQYB 2Y8EA 5DTIA 3NALA 4L6CA 1LPOA 1OE0A 1PJCA 3QWIA 1AB6A 5E6UB 4BAZA 4YMTA 1FDUA 3UNXA 3WWEA 1ZAYA 16PKA 8MHTA 3SBDA 3W2TA 1B8OA 4KAFA 1N6LA 3UV6A 1B8VA 1VG1A 1G5RA 5EPUA 2CY0A 3PLNA 1YJ5A 2W90A 2OXIA 3USES 1NR7A 4EG1A 2O8DA 3OFNA 2YJ6A 4RKQA 2IS6A 1EAMA 2ZRNA 3PRHA 1R0ZA 5DI9A 2J7KA 4MB2A 2J7PD 1XZLA 2QP4A 3FYUC 4MUIA 1DS6A 3E5MA 1C3OB 3T12A 4TXHA 5DYYA 1E0AA 4I5EA 1XYGA 4F04A 5JH7A 5BNFA 1NQ5A 5JISA 1QE3A 4CM7A 5ERGB 1NN3A 3TFOA 2AH5A 2JA2A 2VS1A 4LE2A 1SBQA 3WI7A 3GCXA 1MFZA 3GP8A 1PDVA 4GOKA 2F1JA 5CIYA 2FHPA 3N05A 4CKWA 4YQEA 1QLHA 3M70A 4LJ9A 2GESA 5IKXA 1YZVA 1WM1A 2GJSA 1AKYA 2QVBA 2UV8A 3FE2A 1MA0A 4HYYA 4QBHA 3H1BA 3TNLA 2Z58A 3CE6A 3P32A 3BG5A 4YCAA 5EZYA 2ZE6A 2FZEA 3WY9A 1PS0A 3RYIA 4CF7A 5FL7D 4RSGA 5ICSA 1C3LA 1E7YA 3CT4A 3ELUA 4BDSA 5SY6A 2CXHA 2E87A 4R0VA 4QELA 2PX2A 5AMXA 3R2JA 2QRHA 3ME5A 1MX9A 4MA0A 4TRNA 3WR5A 3VGJA 1V39A 1RCTE 3FTDA 3PR3A 4BNTA 2IPAB 3WB1A 3MAAC 4OOEA 3RYCB 4N8SA 2RJOA 1PKEA 1Y5NA 3QMWA 1P81A 4UHDA 5CLQA 2HNKA 1SVSA 2DY1A 2NU7B 2FQXA 3RS5A 4MA5A 1AHHA 4U6NA 3V1TC 2DU8A 3D6AA 4UTXA 4QE3A 4R71A 1KDPA 2OZKA 4NV1A 5IUJC 1KRHA 3QE2A 3E81A 3WRXA 1T6ZA 3WGVA 5A62A 4NJEB 1WTAA 1BJRE 3BZUA 3ZZNA 5KPDA 5GJWC 3H9UA 3TK1A 4EGAA 2J5BA 1LI7A 5HOQA 3UYLA 3B9BA 4KLRA 3ZDAA 1Z5UA 4C3OB 1L9XA 2JK1A 3CUSA 3QJ5A 3T4XA 3IVMA 2EQ5A 1VCNA 4RTNA 1KA9H 4DUZB 1BWRA 5IPFA 4GGOA 1WCXA 4GOJA 3CZ9A 4JYPA 3W34A 5KU1A 3A6HA 4OBBA 1NIPA 1BX3A 2Q5JA 4FOSA 3W8FA 3RIMA 2ZATA 3GEMA 2NU8A 1BU5A 1OXUA 5FUMA 5AH0A 5DTQA 3I34X 4CODB 3UPUA 4N0MA 4X1YB 1U2DC 4NBUA 4A1OA 1HO3A 4IIVA 4EA8A 2LWIA 2HSGA 3F5QA 4BC1A 4IDBA 4KYUA 2BKXA 2XTNA 1SVUA 4DV0B 2CLMB 4I4CA 4RY0A 5TS2A 5D3MB 1F8FA 1BS2A 2H2WA 3M0EA 1HG0A 1RDFA 4PGMA 3FZYA 1BEUB 3LY8A 1ADGA 1YS4A 5ER9A 3PC8A 4A0FA 5HQ3B 3B6KA 3FCUB 2IIQA 2OAQ1 2VBGA 2X3UA 3A6FA 3KSUA 3PC4A 3QEMA 3ESQA 3MOGA 4WLOA 1IHYA 3H0EA 3D4OA 1DP4A 2PUHA 2J0QA 2QTTA 1DAKA 2DQ4A 5L6MB 3OCVA 3PQFA 4OU4A 3CC8A 1Q3KA 5ALSA 4WE3A 3SKXA 1JQLB 3HBAA 1JZTA 4AWBA 5BMVF 5LU8A 3DL0A 3WWPA 4EHNA 1OTXA 1SIOA 1X15A 2E1RA 5BQXA 3SYMA 2GI4A 4IDNA 2C8VA 3K2BA 3U17A 5GADl 3WBJA 3C3MA 2C5SA 2H1VA 1JAIA 3S29A 3M5PA 1NDUA 4DXDA 4L5CA 2PKXA 1F06A 1GNTA 3MCWA 4L8YA 1H22A 4HDAA 1Y1LA 4MO2A 3V32A 4HDRA 1IPHA 1I5RA 2IYNA 1Y1KE 3PGMA 1P3Y1 5JALA 2IPMA 2JCXA 4H35A 1TKBA 4AQ7A 3H05A 4NWIA 4L2IB 1GSHA 3F6EX 3HKDB 5HF6A 4I3GA 2W6JD 4B40A 3NM4A 1DPFA 1W6RA 5F5NA 1MXHA 2D2VA 1PFQA 2HBZA 3I1IA 4Y30A 2AJCA 2Q3JA 5LZ8A 1QM5A 3LLMA 2OYRA 1YGYA 3R7LA 3S7ZA 3UXHA 3WDMA 1AGRA 3DV2A 3HBFA 4NI5A 3ZIDA 2XUHA 3BT7A 3OKPA 2ZRAA 4FS8A 1TCUA 1LJUA 1IOZA 3WWDA 3BCHA 4URFA 1KY4A 3D0OA 2Z0MA 2C96A 3ZE9A 5AKHA 1VL1A 5IAGA 1O0CA 4EUHA 2GM5A 2A3RA 1TGYA 1V43A 1ZOSA 3ZX4A 1DIRA 2HJHA 5HILA 1TJ3A 1OASA 4KCGA 2R60A 1OLXA 3PENA 5IBQA 4M21A 3TI9A 1RHKA 1VI5A 4DMLA 1TLFA 1N6RA 3UK6A 4E31A 3OWXA 5CPBA 2KSQA 3LC7O 4GPEA 3IAFA 1T8UA 4FDAA 1I2BA 3KELA 4Y2QA 5DHUA 2M6SA 2IGBA 3HNRA 4LRXA 3NBQA 3S2SA 4U02A 4WH0A 3ZCQA 1YVPA 3DDCA 4E13A 4WXHA 4TWIA 4EKEA 4PTYA 5I9TA 3PEWA 3ULKA 1R8SA 4YRQA 2I1LA 3T7IA 3NBKA 1FFXA 4ARSA 2A94A 2P5SA 3FUUA 4HQ0A 2ZI7A 3OA0A 2ONCA 3SPXA 1O9GA 3MC1A 2RHBA 4JUIA 5HCNA 1OCEA 4D4LA 1CFZA 2QX7A 1NDHA 2WWWA 4GP9A 4JJKA 1JILA 1H5NA 1IJBA 2ZE8A 4BP3A 2KYRA 1E64A 1IHXA 2V6MA 3B1WA 1FIUA 1DWPA 4GOXA 1PK7A 1UBHS 4P32A 1WVGA 4BFCA 1U98A 4FK8A 3H75A 3OG9A 4YEDA 4OQQA 2B9VA 3WL3A 4FDMA 4EB6A 1ZOOA 3V1LA 4R51A 5JVDF 2IYQA 2X42A 3D3WA 1K66A 1JA9A 1GGEA 3NHWA 4QREA 4F4FA 3GEEA 6NULA 2WR8A 3DVQX 1GPNA 3T5CA 1BD4A 2IYEA 3G8BA 4MWOA 1GU0A 2QU8A 5T4FA 3VR4A 4TKMA 1WOYA 1VZ3A 2G9VA 3MMZA 2GD6A 3UWOA 4ARIA 4CL3A 2X7XA 4NDZA 2ZTLA 1YCFA 3P19A 3M1YA 3A6LA 5KCZA 2R68A 4JLMA 3UATA 2Y1CA 5ARBA 2CNOA 1TZCA 4CLDA 1N2CA 3FBTA 4DE5A 1WB6A 2VI5A 3LBAA 1X1SA 2PUWA 4TS4A 1H2YA 5JS8A 2V65A 2RI1A 4O02B 2V7TA 2BHLA 4C87A 4YRIA 1NFFA 1XRMA 3K6JA 3D4NA 4O4LA 5EHGA 5ADUS 5ITWA 2WAMA 4IP0A 4A10A 3I01M 4RSMA 2F2TA 3IVGA 4U0KA 1UKCA 1PTKA 3KDAA 4XM1A 3MTAA 2P0YA 1KXZA 1ZC3A 2VPXA 4K9KA 2JFPA 2WZCA 1H6BA 4RWZA 1X7ZB 1JDTA 3FPLA 1FFXB 4NBVA 5KNBD 1RP1A 2XUDA 4LYFA 3ESYA 3MGAA 1YOVB 4TKUB 1N7JA 4L08A 2J9FB 4LX8A 2P2GA 4EAAA 1ZHOA 1XTTA 2VJAA 3EXIB 2B1RA 2P5TB 3MWFA 3R1IA 4LHYA 1NAIA 1XU9A 1JEQB 3E5NA 4BZWA 1GEGA 1M1NB 2QM8A 4ZOLB 4N0EA 4GR5A 1K89A 3HYCA 3LKDA 4LX0A 2C4KA 5IU6A 2IJGX 2J41A 1OZGA 2CVFA 3PJRA 3K09A 1MW8X 4I1YA 1A76A 2Q46A 2VEDA 3E70C 3KZKA 1MVLA 3MJSA 1ZD5A 1RIIA 2WJAA 2WJ6A 3V8VA 4ZT4A 1V4BA 4FI3F 5IC6A 2DTDA 1VB3A 1NXTA 3TVYA 3O4HA 2PCJA 2W93A 4IG9A 2R97A 4YJFB 3NWBA 1YBHA 4X1KB 3IRUA 4XYGA 3CRZA 1DO8A 1NATA 3D0RA 4KVGA 2NTNA 2PX0A 2OOSA 3ANYB 2ZIWB 3D8UA 3F2VA 4JVNA 1Y6QA 4R40A 3X1ZA 2P9YA 5FTKA 2J9XB 4NNJA 3VDQA 2VCEA 4TMVA 5AXAA 1H6AA 3U7GA 1Q50A 4XVRA 3UFXA 3PGA1 1QSGA 3J81k 1XRLA 1M2VB 1R4MB 1X92A 5FQNA 4YIKA 3SS9X 3U9SA 4B4VA 3CW2A 4AJHA 2HRDA 1BCSA 3WIOA 1KTVA 4RH1A 3EQ2A 3PIRA 1ID8A 2OCDA 3A1VA 1MAAA 3OZGA 2EFGA 4XQEA 3T7CA 1RP7A 2BOVA 2G1JA 4XARA 3MVEA 2FSVC 1EXVA 1AKNA 4C6TB 1LXCA 2NYRA 3IIJA 4AY4A 5FTLA 2BJHA 4Z86A 2P9CA 3K0AA 4U7JA 3OX3A 4UXIA 5AOVA 4F92B 4JSTA 1O95A 1MT0A 4Z5XA 5T4BA 1RVV1 4TROA 4UM9D 3T99A 4B47A 3H6KA 1EHCA 2WILA 2X5JO 3G68A 3IP5A 4L95C 4JR1A 4TS9A 3GJ5A 4YJDA 2BGIA 4PLFA 4DLRA 3PP8A 3A9UA 4MVJI 1KI4A 2CYBA 3GRVA 4OQ4A 3T35A 1KEKA 4IJ5A 3OPYB 2HU2A 3U44B 1ESDA 2PRYA 4O08A 4RH3A 3KKNA 4N76A 1QWOA 5BT9A 4DIOA 2VTVA 1VPWA 1DQPA 3ZPXA 4BP1A 3ETNA 5GV7A 2F55A 2O8FB 3O4GA 5FOVA 2AZDA 1HFKA 2GEJA 1KNXA 1CRLA 2V3VA 5C34B 4OQZA 3IDZA 3VI3B 4OXRA 1J97A 2OV4A 5EWLA 4DJ5X 5K5EA 3WGMA 2XOEA 3OZVA 1P72A 1XN4A 5CFQA 1QCDA 4N6GA 3UWKA 5YASA 5JWOA 4D5GA 2H59A 1MJ5A 3H13A 1VKZA 1QBGA 3Q3JB 4IO0A 4NRDA 4R1OA 4RVSA 4TTJA 1DBWA 4BYGA 5EZSA 3J81A 3T1OA 4B79A 4DCVA 4IOJA 4RV4A 2A1UA 7GPBA 3HO1A 1TO6A 3N8HA 1E4EB 1POWA 5A5EA 4D25A 1LF0A 3Q3CA 4JENA 4ZVMA 2O0LA 5DM4A 1QIIA 2BLNA 1IMJA 5E38A 5E0OA 3IHLA 3VRHA 1AUQA 4NMXB 3QVMA 3B7WA 3DEHA 3DEFA 1ZY2A 3RODA 1FTYA 4BMYA 4XQ9A 1FFBA 2CE2X 2I34A 3PNBA 4L9WA 2ONJA 3BYZA 3ZGXA 1L4BA 4QQRA 4EFDA 1NVEA 3G8AA 4UCWA 3V8MA 2GZMA 5JNUA 2PMWB 3GWGA 5H9VA 4QGSA 3KFVA 2Y9PB 2OHGA 3H5TA 4TWRA 4YO8A 4BQNA 4EB0A 1MH9A 4Z6KA 3G13A 4Z7OB 3ITEA 3IUQA 3MJVA 3IAM1 4II3A 2WHPB 3O93A 4GKVA 5FUBA 1YI1A 3LU1A 1W2HA 3PC6A 2PKEA 3UMMA 1QOPB 4E5MA 3AVUA 1ONSA 5ISMA 2QZSA 3TEFA 1NZFA 4CDRA 4EB3A 1V71A 1A9XA 1YZGA 4M7WA 3WAGA 3IOEA 3UJHA 4EATA 1B2LA 2HHLA 4IGIA 1E1YA 3QK7A 2PSJA 4IQ8A 2G8NA 4JLUA 3SEAA 1C4KA 3TTSA 4ZHQF 1XAHA 2ZAGA 3ZDBA 4FTWA 1HLDA 4TMZA 2VPTA 4YAKA 1LF5A 1W5SA 5CR9A 3JPWA 2ZI4A 3DL4A 1Z4KA 4YRKA 2B7LA 2ILVA 4IWXA 1ESEA 3QM1A 3V00A 2F90A 5LUAA 2C2YA 1F9EA 2FWBA 2VUSA 2EX0A 2AN9A 2R7MA 3N28A 2V9ZA 1NOJA 3FVQA 4AX8A 1EB8A 5HP4A 1QYRA 2QE6A 3IPRA 3QMVA 1RXVA 4YLEA 3S55A 3ZWXA 3C3WA 4Y6OA 3R6LA 2VHEA 5ALDA 5DNAA 1E8MA 3A25A 4Y98A 4BMXA 4HWOA 2OV6A 1FMTA 4D9HA 3OC6A 3C3EA 4HJRA 1K2WA 5T64A 2IZ1A 3FJOA 3VR2A 2FN3A 1RCFA 3FG9A 3T1TA 1BXGA 1Q20A 2J9ZB 5LR6A 4JVMA 3CVUA 1U0OC 5BQ5A 1PGJA 2ZR8A 3H2SA 2P4UA 1A8IA 3GRPA 1RQ2A 2PPLA 1OTYA 3GH3A 1HF3A 2W6CX 2G5TA 2GBGA 3DVAB 2RDMA 3EVCA 1IB6A 1P0FA 2I54A 3L43A 4WGFA 4U4AA 2PWPA 4GUAA 4OI2A 4EB8A 5DNCA 1T2VA 4MZXA 4I7EA 1V3UA 5BUQA 4LIPD 1BN6A 3JZAA 3L4KA 2VP9A 4Q9LA 1I4OA 2R79A 3SZ3A 4DCSA 2TECE 1XD8A 4OQLA 4WBSA 1HXHA 2ZREA 3WXBA 3HUFA 5EZ5A 2AOUA 2ERCA 2F4VB 1H23A 2OZLB 1PV4A 3CEHA 4ETMA 3RVNA 3FPJA 1GDDA 4G8JA 5SY9A 3UTDA 2C8KA 5JCPA 3SD7A 1G2QA 2FN8A 3NBUA 1DTWA 3DVRX 5KWVA 5KKCA 3CH6A 4JK3A 4OQYA 2BKUA 4QFCA 4Q4HA 2BMDA 5KI6A 3H4VA 3O1LA 4DMUB 2RGXA 1VHLA 2X8JB 4HLUC 2XD9A 3AIIA 3C3PA 2Q0QA 3VOSA 1P7CA 5TEWA 1QHXA 3CLKA 1DFGA 3QF4B 2BL4A 4MR8B 4FYWA 1AGPA 4AECA 1RWOA 1ZU4A 3KT0A 1KO8A 1JEQA 2BHSA 2OQ2A 2DQZA 4LV6A 4M89A 4FN5A 4LJLA 3VYWA 1C9EA 1KARA 2EVWX 4MW6A 5IXJA 1THMA 4O2AA 2A7XA 2V5UA 1KRWA 2W48A 3FKSD 3GPDG 5GIOE 2NUPA 1TD9A 3BMOB 1H3FA 1OSNA 2PZBA 3Q7RA 5IC4A 1X0VA 4GMGA 1DC4A 3UQZA 2W6NA 5TMPA 3U61B 4WASA 3K70B 3ABIA 4MPJA 1SCKA 4IIYA 4GI7A 4JLPA 3RYHA 4F85A 3GJ3A 4TSFD 5EP2A 3LL4A 4NECA 1PFYA 2GWHA 2YW2A 3AHHA 3NRBA 4DLUA 4LGYA 3X1JA 3A4IA 4R8VA 1J5EB 3IUSA 1K1EA 4HPJB 5IJXA 2F1RA 1ECGA 1FFAA 3P9PA 4AJPA 5LQCA 1UBLS 2CXUA 4FR2A 2FG6C 4AXBA 1YRQA 3NOOA 1S2DA 3KT6A 3I4CA 2BCGY 3K6RA 1J8VA 1VHTA 4RX1A 1X42A 3OZ7A 1KORA 3BEOA 3EVGA 1F2VA 3DM9B 8LDHA 3KIPA 5B1HA 2R7AA 1EWVA 4I1OA 4QRIA 4KQFA 1C80A 3WGQA 3JSXA 5IN4A 2WHEA 4D9MA 4HGOA 4Q7LA 5CNJA 4XI9A 4WDQA 5AHKA 1U94A 3AKZA 1D0VA 4UUPA 3ZY2A 3OPYI 3B3JA 1UT6A 3R24A 3IPLA 4G0PA 1DV1A 1UODA 1UZNA 1Q7CA 1DIAA 5A02A 5FWYB 5IVHA 1U28A 1L4YA 2ZJ4A 3K72B 1TMOA 1Q0ZA 3T0GA 4IM7A 1XEXA 2GUWA 2VYND 4MQ5A 3MSCA 3N53A 4UVDA 1GU7A 1TLTA 2Z2YA 3NHAA 4H18A 2FB9A 5BQPA 3T41A 3E3NA 4QRDA 5EIHA 1JG1A 5JFOA 4C5AA 4N18A 3SAJA 5FH9A 1Y8RB 1ZUIA 5BWMA 1WULS 2C2BA 1DAPA 3MIZA 3UVEA 3U6BA 3ISVA 4DV7B 1K5GA 4CFZA 4Y2JA 1KKLA 3K1AB 1PG2A 5DH9A 2NO0A 3FBGA 3SYKA 4RFVA 3Q5EA 4XSVA 3B52X 3KPWA 4K9LA 5CVEA 3R75A 2E9SA 2NIPA 4ZAVA 4ZO4A 5FTMA 1U3UA 3WNCA 2B25A 3P2IA 4NCIA 3R74A 2NZVG 2EW2A 3JQAB 4MI9A 3H0CA 1XVLA 5JS6A 3U44A 1CF9A 3SJZA 3FNRA 3CSDA 2FFBA 3RB8A 1GUYA 1E9CA 3K0FA 2AJ8A 3W5SA 2BTEA 2MSNA 3NIBA 2O07A 4IHAA 5NULA 3C3KA 3I2KA 5EVCA 1JEAA 4L6AA 3AKDA 4PZYA 2ZUWA 4FZJA 4E1BA 1T5HX 2QMOA 3PEVA 1RSZA 2BTQA 1PL0A 3B1JA 1RI4A 4R1SA 1YDEA 4RSHA 5E6RA 4A73A 1R2QA 2AUNA 1SOAA 1AIPA 2V7QD 1UBRS 2DWUA 2VRNA 4RLQA 1ADCA 3DDUA 3FHTA 4Z4GA 1M34A 2ETXA 3F1LA 1P80A 4EL0A 2CXOA 3EEOA 1Y8QA 2WSYB 2O8EB 3M34A 4MQ4A 1K06A 2OAP1 3FJYA 4MUGA 1AQNA 1GARA 1SKUA 4HLNA 5DSTA 4IOLA 1HEUA 2G82A 1K97A 2W6IA 5EIBD 2OCGA 5IK2A 2I33A 3X3HA 3KLNA 3K32A 4UMVA 2O3TA 3FPGA 1TM7E 3BDIA 3W3AH 3T5DA 4BRWA 4ENRA 3KQLA 1ATIA 3TFQA 3VKWA 4BNNA 4BQEA 3OWOA 2N0SA 2XQVA 2HK9A 4BV2A 4I50A 5C1BA 1A27A 1ZH2A 2AMYA 3COSA 5ELMA 3WA6A 4FFOA 1DIHA 4OM7A 3DUWA 1LB1B 4IHQA 3MTJA 5ERXA 1N77A 2BM9A 1ZGCA 4IDGA 3EHEA 2KM1A 4ARVA 3KNZA 3OIFA 1DHTA 1XA4A 2HNAA 4CMJA 1PIWA 1G59A 5U4QA 4YXWD 1KOLA 3V4OA 2ENUA 2NXCA 3UK1A 4C4AA 5JSKA 1KQGA 3CVVA 1G5QA 2I2CA 2QP3A 1USGA 4MHTA 3SEZA 2P35A 4WD3A 4YCMA 5JWRA 3LX5A 4P83A 3RIHA 2ALJA 3DDHA 2F8LA 1AK1A 1ZI9A 2P78A 4MV0A 4NENB 4RGYA 4PO9A 4OUKX 4RIHA 1FYVA 1VG9B 2GN8A 2O1EA 2VVTA 1VG8A 3ED5A 3AUAA 3ZCVA 4AUNA 1VGRA 1X74A 5U9CA 1Q14A 3LGXA 1QBKC 1ZA2A 3PQ6A 4OYRA 3VZQA 5GIPE 3GFSA 1YAHA 1SMKA 1S9DA 5L3QA 1M2VA 2E4WA 1VE1A 3ZE1B 4RESA 4UNRA 1BE8A 3ZS9A 3SSNA 4C0QC 4D26A 5IDXA 3HCDA 3KV3O 3BF8A 2BFNA 3L9WA 1HDGO 2B4YA 2W6ZA 3GAFA 3H2KA 5K0NA 1SQSA 1BXKA 5K3FB 2ERYA 1ZG3A 4QX6A 4IG4A 3DCIA 3LSTA 1YVUA 3R3WA 4ZEVA 2NVWA 4AY3A 2QVCA 3ZLVA 5I7FA 2MMCA 3GG9A 2QVZX 3QJYA 1GRQA 2ETVA 4L27A 1X1TA 3QU2A 3ZC3A 4ZZ0A 4GOMD 5I9LA 2OP1A 1ZI8A 3E7FA 5E8JA 4R31A 4DR2B 2GCIA 1P5RA 3P1JA 3ZH2A 1WAMA 1WMBA 1ZJYA 4C6SA 2IHNA 2TMGA 3E9EA 4ZPXA 4QYIB 4FJ2A 5DWDA 3ZWOA 2D0DA 2AN3A 2QSUA 3HKEB 4UBIA 4ZIRA 2VTBA 1YR2A 5FKJA 3T6KA 4CMIA 1EWQA 2ID4A 1LI4A 4LJ6A 5FLYA 4B8ZA 5DFAA 2VJNA 2IEYA 3D02A 1JFLA 1XOIA 2PR2A 1V48A 3TMAA 4KUGA 5K8VA 5ER6A 3L8GA 3L0YA 3KJFA 4R8SA 3ORFA 1J0BA 4HH0A 5AXDA 4QXPA 1JECA 1T9KA 3EIQA 2D1TA 2XAUA 1RKXA 3RUAA 5JROA 4BMCA 3KO8A 2UZ1A 1ZP6A 4YFYA 5JEEA 1JSCA 4EHFA 5DHFA 1Y8CA 2MJLA 1Z5OA 3IFSA 3PUIA 5CNMA 4R2MA 3HDQA 4C21A 3AW9A 4EB6B 4NIMA 2JHCA 4EO4A 3HM2A 4HEA1 4A27A 4AN0A 2JVKA 2X5KO 3A9RA 1Q1ZA 1KAOA 1MRSA 3RRZA 4JT4A 3ZCUA 2CDBA 3QKSB 4MWDA 1NASA 4HOYA 1KQNA 4E15A 4JKOA 2XCOA 3C14C 3C43A 3NUGA 4M1MA 3T0IA 3TAUA 4MUKA 5HA5A 4EW3A 5A3RA 3H0KA 5A5DA 3H4IA 4V0NA 1OD6A 4H0NA 4DLBA 2B8WA 4PZEA 3TG2A 1E2HA 5KNDH 2JASA 1DDIA 1NC3A 3BWXA 4OMDA 3WDLA 2OB1A 1IDOA 2R6ZA 2QT0A 2QZ4A 4J75A 5GM1A 3GV0A 1CHDA 2SBTA 3A11A 1XUOA 2GTPA 3ABSB 1GP2A 1N4DA 4OHUA 4ZODA 4RWEA 2UZIR 4RY2A 3QX7A 1KJNA 3TMYA 1NXOA 3QU5A 4Y1EA 3OM0A 3OPXA 1I1NA 1N78A 1MMFB 2CMFA 3OFND 3OJXA 4FZVA 2RGNC 2C7GA 1NRWA 2JFGA 2VJLA 1L4NA 4UM9B 4ITUA 1D2NA 1A0OA 1EUCB 2ISCA 3B1YA 3K20A 5AHXA 2FG7C 4E33A 4CGZA 1L5WA 2EWVA 5BNZA 2XR1A 4NYIR 5E4YA 2PKRA 3KHKA 2WWTA 5AR1A 2IUSA 3CPHA 821PA 1V6SA 1XZPA 4FCCA 1TU4A 4PHCA 3GLHA 4ETWA 4YJGA 4XCXA 3DZCA 3GLTA 1LSOA 3DMFA 1YS1X 2IYRA 3KUXA 2OKCA 2QSZA 3FMVA 4I4LA 1NW3A 4ESHA 4G4JA 1GPLA 2O7SA 5COBA 4F8JA 2IH2A 1EFDN 3QSYA 3BSWA 2D7JA 4LA4A 4LQ4A 2CKDA 2AT1A 2Q2NA 2P3SA 3D7KA 1XZMA 5FI0B 1WXFA 1CUFA 1NXSA 3RVSA 1FFEA 3EZ7A 3KDSE 4LPSA 4CI0B 1QB8A 1Y6ZA 4MDFA 1D6MA 4ND2A 1Z08A 3IIMA 2YICA 1TM2A 4Z4EA 3RSFA 3C7CB 2Z04A 3U0VA 5BOSA 4MARA 9GPBA 3F46A 1F0NA 1TEHA 2NU6B 5TPZD 4Z9XA 5IEBA 1ZICA 3ZBQA 2AC7A 4EZBA 2JG3A 3Q41A 4QUHA 4B7UA 4E51A 5SZHB 5A5FA 4RVUA 1L8OA 5AUPB 4EUEA 4A16A 2DCMA 3HCAA 4PW0A 2XMZA 5CM9C 5TNXA 2V58A 2AZXA 4CN9A 5LP6C 3OPQA 3TRIA 5KUTA 1QHIA 3V1KA 3OJFA 3NWOA 4KIFA 3DLCA 3W9BA 1GY8A 2YOFA 1HL3A 1H4VB 1PYDA 3F74A 4PG4A 3EFBA 3SIXA 1UZMA 1QYWA 2YHSA 4YJ3F 4AJJA 4XFDA 1F7VA 2Y0PA 4TMWA 2IGTA 1RJFA 2B5VA 2FPGB 2VJBA 2ZK7A 4QG7A 1OWOA 2X0KA 2I3BA 2AW3A 2EFYA 1KEZA 4FYKA 4K0RA 1FJ2A 3JQDA 1EWYA 3WWZA 1V3QE 3VSAA 4HTFB 3FBWA 3IUBA 2RH9B 3PFCA 2OYSA 4HDCA 4R3NA 2DY0A 5TC4A 4URXR 1FVFA 2N1BA 2WT4A 5EJ4A 1HEIA 4DFDA 5EJ9A 2ROQA 2CNWD 4U6SA 2OV2A 4H7PA 4LJAA 5DB4A 5I9MA 5EHNA 4FONA 4NMHA 1DOZA 2I9KA 4FHDA 3KZNA 1QF7A 2XEDA 2O8CB 2R11A 2Q2OA 1FFWA 4RA9B 3T9FA 5LJLA 1I1QB 3DULA 1GVHA 1E79D 2QXUA 4MIKA 1Z45A 3BE4A 2RC6A 3EIUA 4PZZA 3QPAA 1CJCA 2GJ4A 5AVVA 2H63A 3ASUA 1LSSA 4BL5A 1XF1A 4O33A 1M76A 1X0XA 2L17A 1ENYA 4AS3A 4ENPA 3F97A 5D3QA 4BQIA 5MDHA 3ZUGA 2GNOA 4OJKA 3TW0A 1JJVA 3DFKA 1GAWA 5AW5A 4DHEA 2QPTA 4X24A 1XWWA 3G85A 2PANA 3H16A 3V1UA 4Z4QA 1HA3A 2C3YA 1AQYA 3LUJA 1EWKA 5IMSA 4F0JA 4NCJA 1DHRA 2O2XA 2ZTSA 5I8ZA 4R8RA 4YRLA 5KYYB 1P1KA 3WRXC 4EEXA 1SU4A 3AEUA 1YB4A 4B6EA 5KYWA 3F3SA 1RWVA 1YONA 2P11A 3IKJA 1IRXA 3PHGA 3I6ZA 1T1EA 4IXNA 4WRRA 1SUPA 3QFSA 1WDMA 4W6QA 3WGKA 3SQLA 1DKOA 1P60A 3PJFA 3UUEA 1CUGA 5ALLA 1SM4A 4JJAA 4MCIA 5LVAA