4CGDA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cgdA00
1VK0A 4CJWA 3L8BA 2P5GA 4N47A 2KZZA 3KLHA 1S1XA 4ID1A 4EP5A 3QESA 3D45A 5JS1A 3HK2A 3V9ZA 4E7HA 2VG6A 3OYAA 5HROA 1I3AA 1IKYA 1WSFA 3DRRA 5CZ2A 3KJVA 3L2WA 4BDZA 3G10A 1A5XA 3DOKA 3SUOA 1L3SA 3PX4A 1IO2A 1EKEA 1JXBA 1CXUA 1B9DA 1RT1A 4O55A 4HUFA 1C0UA 3HJFA 1TAUA 4M3ZA 1VSJA 3LPTA 4DWIA 3VQDA 4CESA 2HHSA 4DU3A 4DFKA 3LP3A 2D0BA 4M3RA 1NK5A 3TR8A 1KCFA 3NFAA 1D9DA 3I0SA 3C6UA 2BE2A 4CEAA 1SKSA 1RBRA 4W5OA 2VG5A 4O5BA 2PYJA 5KRTA 1VSLA 1LW0A 1VSHA 3P5JA 5KI6A 3SQ0A 4KB0A 3AVGA 4CHNA 5HRPA 1NK6A 3V1OA 4FLYA 3TAEA 2Y1IA 3S3MA 4FW2A 1LAVA 3OYKA 3LZIA 1WSIA 4DG1A 4RW4A 4NCGA 1ZBLA 3K5MA 4CGIA 1NJXA 1D8YA 1EP4A 3KLIA 2W42A 3V9XA 4QOZB 5HRRA 4CJTA 3AVJA 3DI6A 3TARA 1SV5A 4Y1DA 4PQUA 3TAGA 4Z4HA 4I7FA 1YVUA 4IDKA 1RTIA 3CFPA 3HPHA 1KSPA 3PV8A 2B6AA 2X6SA 3RTVA 1HPZA 4CHYA 1KVAA 3AVCA 3BGRA 4DLGA 2PZSA 3ZSRA 3ZT4A 3KKSA 3NAEA 2LSNA 1Q8IA 2HHQA 4DTRA 4E7JA 4OKEA 2D0CA 3HPOA 4FYDA 4CE9A 3S9HA 4M3UA 3O3GA 4PA1A 4Y1CA 1LV5A 4CJQA 2HNYA 2IDOA 1KFSA 1TKDA 1BHLA 1TKTA 3DLEA 2G8HA 1Q9XA 1C0MA 1RT4A 4BDYA 3CFOA 3LWMA 3V9SA 3V1QA 3DMJA 4IBNA 4DTXA 1U49A 4J2AA 4HVJA 2D0AA 4CJLA 4E7IA 4DTOA 3KTQA 2HHTA 5HRNA 3VQ8A 1VSFA 4OPJA 1BIUA 4DSEA 3TANA 1HRHA 3S3NA 4W5TA 4E0DA 4PUOA 4PY5A 1S5JA 3BDPA 2HHVA 4W5RA 2KTQA 2KW4A 4CJVA 1TL3A 3KK3A 3OS0A 4ELTA 4KHSA 1F21A 3NH2A 3RMCA 4BWMA 3VQ7A 2DFEA 3ZT3A 2QKKA 2WONA 4KTZA 4C8LA 3LALA 1JXEA 4CHQA 4FLZA 1CZBA 3L2RA 3CM6A 1QS4A 3ZCMA 2OPSA 3WNEA 1RILA 4AHUA 4CEOA 3NE6A 3KLGA 3RMAA 4Z4IA 4KREA 3OJSA 3V6DA 3QERA 2HVIA 1RBUA 2X78A 4LSNA 2AJQA 1LAWA 1L3UA 4N5SA 3QEVA 1SKWA 4M41A 4Z4CA 3AV9A 3QNOA 2RF2A 1ZBIA 3O3HA 2XHBA 5CYQA 5C25A 3MEEA 4FZXC 3CQ8A 4M42A 1X9SA 1TV6A 2YNGA 4Z4EA 1NOZA 1UA0A 4M3TA 3KLEA 3V4IA 4FJ5A 1JLFA 3CYMA 1RT3A 4O0JA 3U3GA 4EZ6A 4F3OA 3HP6A 1QSSA 2HW3A 3AA4A 5T7BA 3OYFA 3NHGA 1VSMA 4TSXA 1HYVA 4OVLA 2R7YA 1SKRA 4F3TA 3L2VA 2BDPA 2YV0X 1ZBFA 3ZSVA 3OJUA 3SJJA 1JLCA 3MEDA 3ULDA 1IKWA 1ZBUA 3IG1A 4RW7A 5FDLA 1O1WA 3NF9A 4XIUA 1RTJA 4H4OA 2HB5A 3S3OA 1SUQA 2F8TA 3DLGA 3CM5A 3K5OA 4NYNA 4FJXA 2RKIA 2IAJA 2HMIA 2OZSA 4AH9A 1U04A 3VQAA 4DQQA 2HVHA 5J1EA 5FRMA 2QKBA 3VQ6A 4DTMA 1GOAA 3O3FA 3LP2A 1VSDA 3AO3A 4FLUA 4E89A 4LH5A 3KLFA 1TK5A 4CCHA 1ASUA 4CEZA 1C1AA 4CJ4A 2IGIA 1YTAA 1VRUA 3AVLA 4CGFA 3OYBA 1XC9A 1KVBA 1X9MA 2DFFA 3ALYA 3LANA 3HSTB 4CGGA 1BI4B 3SI6A 4NYFA 1RT5A 3THVA 4F8RA 3SPZA 1RDDA 4DTSA 2ATQA 3ZSZA 4FJJA 3OYLA 1HYZA 1JLBA 3VQ5A 3SZ2A 1QE1A 4FJKA 1LWCA 5DMRA 3EZ5A 3M8SA 2HHUA 4JRQA 2XY5A 3SUNA 1HJRA 1BGXT 4ICLA 3OY9A 1S6PA 5E41A 3SV4A 2KQ2A 3QNNA 1VRTA 3OYNA 3NH1A 4C8KA 2FBXA 4CF1A 1NJZA 3QIPA 4CK2A 1XWLA 3VQQA 1C1CA 5K14A 1UOCA 4DLEA 2G8VA 5D3GA 1RT7A 2I5JA 1WN7A 4CJSA 4CJPA 3LZJA 3U6FA 5HP1A 1W9HA 4K8XA 5CYMA 4DU4A 4L8RB 2ZQBA 3AVBA 3QINA 4OGEA 4CJEA 4O44A 2RPIA 1UWBA 3AO4A 5EU7A 3HXMA 4DU1A 3QEWA 1L5UA 5SWMA 2P5OA 2YNIA 2KFZA 2XO7A 3T3FA 3RR7A 4HCBA 4IG0A 2ZD1A 3LP1A 3NF7A 4E7LA 1R0AA 1BL3A 1T7PA 3K2PA 3OYHA 4E3SA 2VG7A 4CGJA 4E1MA 4FJ8A 4FXDA 3K58A 4OLBA 2BANA 2YNHA 4OJRA 5KGXA 3PY8A 4FJ9A 1YTUA 4FW1A 3O4QA 3HVTA 4KV8A 4OPKA 2A1SA 4RW9A 1J9AA 3K5LA 3F73A 5J2QA 1NK8A 3V1RA 3VN5A 4CEFA 3OYMA 5J2NA 4KHYA 2ITGA 3ASMA 4LH4A 4CHZA 4CFDA 3TAQA 1X1PA 1NK7A 1L3VA 3QO9A 2ETJA 4KO0A 2HNDA 4CJ5A 2IS3A 1BCMA 1TK8A 3RMBA 4CF0A 5DK5A 4AHTA 4KTQA 1RDBA 3M8RA 4B9VA 1J54A 1C1BA 2YKNA 1U45A 4F2SA 4M3WA 2KFNA 3IRXA 4HUGA 4B8CA 4FZYA 1WLJA 4DFPA 4DSJA 3ZSQA 3KK2A 4FLXA 2XY6A 1I39A 1KVCA 3FFIA 3LDSA 1S6QA 2PYLA 2PY5A 4KHUA 1K6YA 3SCXA 2BGGA 3NCIA 1DTQA 2B5JA 3AVFA 3DM2A 4MFBA 3UIQA 2GBZA 2GV9A 1HYSA 2O4IA 1S9GA 2GUIA 4DF4A 3NBPA 5J2PA 1VSEA 3KIOA 3LPUA 3ZT0A 4F4KA 4CERA 1JLAA 4HHTA 3SQ1A 2O4GA 1NK9A 1S1VA 1BQMA 1RCHA 1EX4A 1NOYA 4KI6A 1TGOA 4KFBA 3C95A 3MXIA 2YKMA 1QQCA 1JLQA 1QSYA 3WNGA 3EY1A 4CIEA 4IG3A 3DOLA 4DS4A 3KD1E 2G8FA 4RG8A 4HTUA 1B9FA 3EYZA 2ZE2A 3G0ZA 4ZTFA 3ISNC 3V9WA 2Z1HA 2D5RA 1JKHA 4Z0UA 4BACA 1A5WA 1RT2A 4DQPA 4M3XA 4DF8A 4CJFA 1ZYQA 3DYAA 1NJWA 4CF9A 4FK2A 4IKFA 4K8ZA 1B92A 1RTHA 4BE1A 1IH7A 1J53A 3CG7A 3VQBA 4OLAA 4I2QA 4I2PA 4AILC 4B3OA 1HNVA 2P1JA 3ZSWA 3SQ2A 3NH0A 4KHWA 4OKKA 3OVNA 1QHTA 4OGCA 3PO5A 2JGUA 4J2DA 3PUFA 1TL1A 3JYTA 3U3YA 4ZTJA 1WSEA 3K57A 1X9WA 4KAZA 3L2UA 4DSFA 1EETA 1T8EA 1U4BA 4HUEA 3QIOA 3TI0A 5CY4A 3L2QA 3SV3A 1S1TA 1S9EA 1LW2A 1TAQA 3DRSA 3HP9A 3SQ4A 3ZSYA 4FLWA 1YT3A 3K5NA 4CK3A 1JLGA 4JS4A 3ITHA 2XY7A 1BQNA 4FM0A 3ZSXA 1C6VA 4CEDA 4CIGA 4GVMA 3HM9A 3QEIA 4CJRA 4WE1A 1Z25A 3P83D 3PX6A 1ZBHA 4KKOA 4DTJA 2Z1JA 4FM2A 4I9LA 1HNIA 2Z1IA 1LWFA 3NF8A 4FVMA 4FJIA 4M45A 2WOMA 4DMNA 4DFMA 1D5AA 1BI4A 4AHSA 1CZ9A 5C24A 1NK4A 5I3UA 2EHGA 3T1AA 4BDPA 3OYJA 4KTWA 2OA8A 1BCOA 3VQEA 3AVIA 2RN2A 4MQ3A 3RRHA 4IFVA 5KRSA 4H4MA 3AO1A 3M8QA 4BE2A 4DS5A 3SUQA 3MXMA 4CJUA 4FCYA 1EXQA 5HLFA 2FBYA 2OZMA 3PO4A 2QXFA 4BWJA 4Z4GA 4DTNA 2G8IA 2FBVA 1Z26A 3LAMA 3AVHA 2FC0A 1FKPA 1HMVA 4CFBA 1KLNA 3DLHA 1XHZA 4G1QA 3E01A 3VQCA 3NGIA 2Q3SA 1FK9A 3C6TA 3AVKA 4N41A 4KRFA 1WAFA 1QTMA 1RBTA 2G8UA 4B9UA 2HNZA 4HCCA 3CFRA 1VSKA 4NCBA 2EX3A 1QSLA 5KTQA 3M8PA 3DLBA 5SZTA 1RBSA 3QETA 2YHBA 3NGYA 1FXXA 1WNSA 4FM1A 4DTPA 3SPYA 4B9NA 4CFAA 4R5PA 4JRPA 4KB1A 4O0IA 1RNHA 2DFHA 2DTUA 1ITGA 3HPGA 4FLTA 4FJHA 2YNFA 1LWEA 3LAKA 4C8MA 5C42A 3VQ9A 4B9TA 2XRIA 4DSKA 1WSHA 1TK0A 1REVA 4E7KA 4E1NA 2IOCA 4C8NA 2G8WA 3C94A 4OKJA 4ELUA 4KHNA 1UA1A 3H08A 3OYGA 4W5NA 4B08A 1HQEA 1VSIA 4DSLA 1RT6A 4AHRA 4I9QA 2X6NA 3L3VA 5J2MA 4J2BA 4EP4A 3P1GA 4CIFA 1DLOA 2HHWA 5HRSA 3NDKA 4CGHA 1U48A 3RR8A 1KRPA 4AHCA 4B9LA 1C0TA 4FJLA 3AVAA 2E4LA 3IS9A 3ZSOA 5FRNA 1IKVA 1NJYA 4QCLA 1DTTA 3L3UA 3MXJA 1BISA 2OPRA 4CHOA 4E19A 1FKOA 1SL1A 4DSIA 5FROA 4UQGA 3V9UA 4DQRA 2X74A 2YHAA 4RW8A 3KK1A 3MAQA 4J2EA 2P51A 1WSGA 3I8DA 4FLVA 4QAGA 1A5VA 3D0PA 4CHPA 4O4GA 1TVRA 3TWHA 1TKXA 3AA3A 3IAYA 4CEEA 4KPYA 4DTUA 1L3TA 1HQUA 3VQ4A 4DQSA 4B8AB 3SYZA 3PX0A 1N6QA 4FK4A 4W5QA 2QK9A 2E6MA 4LY7A 1UAXA 2B4JA 3KKRA 3NF6A 4IFYA 3NGZA 1T03A 1NKBA 2G8KA 4ID5A 3TAPA 4LD0A 3MECA 1GOCA 3AO5A 4DQIA 3AO2A 5I42A 4GMJB 4DFJA 3RMDA 1XHXA 3HO1A 3SNNA 1G15A 3K59A 1T05A 4FJGA 4KI4A 4Z4FA 5HBMA 4Q5VA 1W0HA 3TAMA 1JL2A 3B6OA 3DRPA 1JL1A 3LWLA 4C8OA 1XI1A 4N76A 1GOBA 1S1UA 3T19A 1S1WA 3VQPA 1N5YA 2DY4A 2OPQA 3OYIA 1Q9YA 3O4NA 5KGWA 1SL2A 4YFUA 2F8SA 4PWDA 4RW6A 3OYCA 2IC3A 3OS2A 2Z1GA 3AA2A 4YNQA 1Y97A 1NKEA 1NKCA 1WAJA 4M3YA 3AVNA 4CF2A 1IKXA 3TAFA 1NK0A 1J5OA 4GW6A 1BIZA 1IG9A 3RRGA 2XY8A 4EZ9A 4FJ7A 4LSLA 4FK0A 1U47A 5JS2A 1CLQA 2OYQA 2OPPA 1D9FA 3HL8A 4CJKA 3RWUA 3VA3A 4ZHRA 3VA0A 4BE0A 4AHVA 2F96A 2Y1JA 1KLMA 4FZZA 3QLHA 1KTQA 4CEQA 3QEXA 4ELVA 1TKZA 4NCAA 3B6PA 3WNFA 3QEPA 3ZT2A 3TABA 3OS1A 2E6LA 3MEGA 4CEBA 3V81A 4JLHA 2NUBA 4FJMA 4N56A 4CECA 2VWJA 2A1RA 1RDAA 1SL0A 4FJNA 4KHQA 1ASVA 3HVRA 1RBVA 1ASWA 4JS5A 1RTDA 4F2RA 4CGDA 3DLKA 3LP0A 1JLEA 3A2FA 4B9SA 3WNHA 1WSJA 4CK1A 4CJ3A 3OYDA 2VWKA 3OYEA 3DLRA 2FBTA 3JSMA 2HHXA 4CF8A 3I0RA 1RDCA 4CFCA 4Q0BA 1KFDA 2KZMA 1MU2A 3ZT1A 3AVMA 1CXQA 3F9KA 5CZ1A 4B9MA 2JLEA 3SUPA 3HT3A 3KD5E 4H8KA 3AA5X 3HYFA
chains in the Genus database with same CATH superfamily
2ZGZA 1VK0A 3L8BA 2P9LB 3KLHA 2VG6A 4YOWA 3OYAA 1I3AA 1IKYA 3DRRA 3KJVA 3FLCO 3PIOL 3KVGA 4AQYK 4HUFA 4M3ZA 4OPHA 1VSJA 3LPTA 4DFKA 3THYB 1NK5A 3OA9A 4AM6A 5AQHA 3ZX3A 2VG5A 1VSLA 1LW0A 4NLCA 3P5JA 3S3MA 1KQSM 4FW2A 4JK9A 3OYKA 3R6MA 1E4GT 2OTJN 4DB3A 4RW4A 4YOTA 3LDNA 3MWPA 3ENHA 4IEIA 3KLIA 2W42A 3V9XA 4CJTA 1HJOA 3FZHA 5FLXO 5AZJA 4I7FA 1ATSA 1RTIA 2P9UB 1NGJA 4H0YB 3CMEN 2B6AA 3THWA 4JAXA 3CJAA 1WUAA 4CHYA 1MA9B 3KKSA 3EE9A 2HHQA 3TSQA 4OKEA 1WOQA 4CE9A 4M3UA 4JI2K 4Y1CA 4H0PA 4JKGA 2HBMA 4BRLA 1RT4A 3V9SA 2FF3B 3L4QA 2PBDA 3JS6A 3KTQA 2D0AA 2F9WA 5AQYA 4CJLA 4E7IA 2Q97A 3A5NC 1BIUA 4OPJA 4CJVA 4BG8A 2QEXN 3TTCA 3WEEB 4KHSA 1F21A 3RMCA 3VQ7A 2QKKA 2WONA 4KTZA 3LALA 1JXEA 4CHQA 1NGGA 5KQ8A 3WUHA 2OPSA 3NE6A 3KLGA 3R3LA 4I6MA 4KREA 4BVPA 4LF7K 2WUSA 1SKWA 4Z4CA 2XHBA 4M42A 3MEEA 4BC2A 3CQ8A 2YNGA 4Z4EA 1UA0A 4M3TA 1VQNN 3KLEA 3O8MA 3ATUA 4LF8K 1E3MA 4GVEA 3CYMA 2PFUA 3HP6A 1QSSA 5AQLA 4B1YB 1VSMA 3UKUA 2R7YA 1SKRA 4F3TA 1ZBFA 2NRZA 3CPWM 3SJJA 1VAZA 1M1KO 1ZBUA 4DUYK 4RW7A 2O8FB 1O1WA 3D2EA 4MO5A 4H4OA 5AQSA 2GX9A 3J81O 1U04A 3C6HA 3DXKA 2D0PA 3VQ6A 3CCSN 5AQNA 1ATRA 1T3VA 1VSDA 1Q7YO 3EKSA 4IJNA 1C1AA 5JICA 2V7YA 3RSEB 2IGIA 1XC9A 1KVBA 3SBGA 2O8BA 3HI0A 3ALYA 4CGGA 3HTVA 1RDDA 3ZSZA 4LF9K 4CBXA 1JLBA 4FJKA 2IVPA 3N4PA 2F9TA 4DV4K 2QM1A 5DMRA 4DQ8A 2HOEA 4JRQA 5FPDA 4OPAA 4BR2A 3OY9A 3BF1A 3VPZA 1LOTB 5E41A 3SV4A 3OYNA 4C8KA 1RT7A 2J4RA 3U6FA 4MDBA 1W9HA 4DU4A 5GADP 2RPIA 3AO4A 1L5UA 2GUPA 2CH6A 2KFZA 2XO7A 3VMFB 3T3FA 4HCBA 4K41A 4PL7A 3OYHA 4CGJA 4FXDA 3VENA 2BANA 4OJRA 3PLAA 1WBBA 4FW1A 2P9NA 1GLJO 3EL2A 5J2QA 3V1RA 3ZX2A 1L3VA 1X1PA 1X3MA 3QO9A 2HNDA 4CJ5A 2IS3A 5EOYA 1TK8A 3RMBA 4AHTA 4KTQA 3M8RA 5BRFA 1U45A 1YIJN 2W40A 3IRXA 4HUGA 2CGKA 2F4VK 1WLJA 4DFPA 1W2BM 3FFIA 1S6QA 3SCXA 3NCIA 1DTQA 3DM2A 2GV9A 1HYSA 1KAXA 3LDPA 1VSEA 4F4KA 4IJAA 4BRDA 1NOYA 1EX4A 2YHWA 2P9KB 4CIEA 1VQON 3DOLA 4AM7A 2UUBK 4GY2B 2G8FA 5IT9O 3IMXA 3EYZA 4ZTFA 4B3MK 4BRNA 4BACA 4Z0UA 4RTFD 4DF8A 1ZYQA 4CF9A 4IKFA 1NMNA 1QVGM 4BE1A 1J53A 3HRGA 3HBTA 4B3OA 3SQ2A 3ZSWA 4KHWA 4J2DA 3PO5A 3PUFA 1X9JA 1U4BA 3O9QA 3TI0A 3L2QA 3SQ4A 4B9LA 1LW2A 1TAQA 3ITHA 4H5WA 1C6VA 4GVMA 4JK8A 4WE1A 1Z25A 3P83D 3PX6A 1ZBHA 4FM2A 1LWFA 3NF8A 2WOMA 3THYA 1D5AA 4DR6K 2EHGA 3VETA 4YOXA 5AQXA 3AVIA 4M7YA 4MQ3A 3H3OB 3M8QA 1EXQA 2FBYA 1XMOK 1V4TA 1BWFO 2QXFA 4BWJA 4Z4GA 5CR4A 3LAMA 2QWQA 1HMVA 2CGJA 3MN6A 2D1KA 4G1QA 3NGIA 4KRFA 4C23A 2HNZA 2H3GX 1VSKA 5BREA 3ZLJA 4DR1K 5KTQA 2YCHA 1RBSA 2A6AA 1VQ4N 2A3ZA 2ASOA 4B9NA 3E66A 4KB1A 3MCPA 1O13A 5HL7L 2YNFA 4C8MA 3LAKA 5C42A 4A5AA 2NZTA 3MK6A 1REVA 4FVUA 2PAVA 4KHNA 3H08A 1VSIA 1GLFO 3O9RA 4I9QA 3ENOA 2HHWA 5HRSA 3NDKA 3KHYA 3RR8A 3IUCA 3AVAA 3WEEA 4FSVA 3SBTA 1DTTA 3L3UA 5AZJB 1S72N 4CHOA 1SL1A 5FROA 3DJCA 4J2EA 1WSGA 4BRFA 4QAGA 4WFNL 1TVRA 3THWB 3T1YK 3IAYA 3A5MC 4CEEA 2QWNA 1SQKA 4DTUA 3CJ1A 4DQSA 4B8AB 4FK4A 3K9JA 1BG3A 2O8CB 4LY7A 2B4JA 3NF6A 3NGZA 4JKGB 4XH5A 3TAPA 3CJ7A 3TSUA 3MECA 4DFJA 3RMDA 3FZLA 1G15A 4YDUA 4Q5VA 1W0HA 4C8OA 5LMUK 4KBOA 4LF6K 1YXQA 2DY4A 2O8FA 2OPQA 4CZFA 1HKCA 1XMQK 1ESVA 4YFUA 4RW6A 3OS2A 4YNQA 3SMSA 2QWPA 3JXUA 1NKCA 4M3YA 1RGIA 1J5OA 3T69A 4FK0A 2XY8A 4FOIA 3HL8A 4BRQA 3CCRN 3CCLN 3VA0A 4BE0A 1KLMA 1KTQA 3FZFA 3WNFA 3SMPA 3RSEA 3TABA 3MMVA 3GE1A 2E6LA 4CEBA 4JI5K 1IBKK 4QS8A 1DEJA 4CECA 2A1RA 1VQKN 2P9PB 1ASWA 4CGDA 3DLKA 1KXPA 3LP0A 5TKYA 3CC2N 3A2FA 4CK1A 3OYDA 4CJ3A 3OYEA 3DLRA 2FBTA 3UKUB 3JSMA 4L3QA 1RDCA 4CFCA 2E5LK 1MU2A 3ZT1A 3F9KA 1K9MO 5AQKA 2E1ZA 3HT3A 3D2EB 3KD5E 3EKUA 1L3SA 4CJWA 1TYQB 3QESA 2NRWA 1XUPO 3D45A 1IBLK 3BP8A 1K8AO 3WXIA 3L2WA 3J7ZO 1HNWK 1A5XA 3DXKB 4JI8K 1Q18A 4H5RA 3HJFA 1B9DA 4B1XB 5DM7L 1GLBG 1N8RO 1TAUA 4DWIA 4DU3A 4M3RA 1YF5L 3VESA 3TR8A 2NRTA 2BE2A 1Z05A 4FWNA 1RBRA 4CEAA 1SKSA 2UUAK 4DV3K 3D6RA 1QHAA 4CHNA 5HRPA 4B1UB 2KKZA 2Y1IA 2AP1A 1Q86O 1ZBLA 3K5MA 4CGIA 3TARA 1GLEG 4PQUA 4H03B 3CQYA 3CFPA 1KSPA 1DKGD 3PV8A 4KH6A 4DV5K 2ASMA 2X6SA 1W97L 3BGRA 5GAGP 3ZT4A 3VGLA 1Q8IA 4WF9L 4H0XB 4CZIA 4PHTX 4JNEA 4DTRA 3HOTA 4B9QA 2D0CA 3HPOA 3O3GA 4CJQA 1IV0A 2IDOA 1TKDA 1BHLA 1Q9XA 3CFOA 3H6EA 3OBWA 4HVJA 2HHTA 4DTOA 3MX5A 2FSNA 3TANA 3S3NA 2NNWA 4CD1A 2HHVA 3BDPA 4JKAA 2KTQA 4EFHA 3KK3A 1XC3A 4ELTA 1SZ2A 4BWMA 3ZT3A 4JKHA 5M1KA 1HKGA 4C8LA 2BUPA 4FLZA 1CZBA 3OTOK 3D7EO 3WNEA 3LDQA 1RILA 3L0QA 4AHUA 2YX6A 1EQYA 4LSNA 4M7XA 1L3UA 5M1QA 1HUXA 4JK7A 2RF2A 5ADXA 1ZBIA 3O3HA 5C25A 4FZXC 4U7BA 5LJWA 5BN8A 3IKMA 4JEPA 1Q82O 1JLFA 1RT3A 3TU5A 4PKHA 2HW3A 3AA4A 5T7BA 3OYFA 3THXA 4TSXA 4OVLA 4X64K 2HMPA 2BH1A 5TKWA 3ZSVA 2VGNA 3OJUA 3MEDA 1IKWA 5AQQA 4BRKA 3AARA 1YAGA 3O9TA 4ILGB 1BA0A 3NF9A 2UUCK 1VQ6N 2F8TA 3S3OA 1DT9A 2RKIA 5HOOA 4RWTA 3VQAA 5J1EA 5FRMA 1GOAA 3O3FA 3LP2A 3H45C 4H5TA 4BG9A 1OKJA 3F5TA 4E89A 1TK5A 1NGFA 3O08A 4CJ4A 4E1JA 1NJIO 1VQ5N 1YTAA 1VRUA 3AVLA 1J5EK 1NU0A 5BR8K 1X9MA 2HF3A 4M63C 3HSTB 4Z94A 2V51B 3LM9A 3SI6A 3H3NO 4YORA 3THVA 4O8KA 4DTSA 3CCUN 2ATQA 5KPRA 4JN4A 1QE1A 1RDUA 4JV5K 2HHUA 2XY5A 1HJRA 1E4FT 2KQ2A 5GIPA 1VRTA 3QNNA 4JHDB 3HZ6A 3OHRA 3VEWA 1XWLA 3VQQA 2FF6A 1UOCA 4DLEA 3O1BA 4CJPA 3BF3A 1BA1A 5CYMA 4L8RB 2ZQBA 3AVBA 3QINA 4OGEA 3HXMA 4O44A 1UWBA 5EU7A 3QEWA 2P5OA 1KC8O 2YNIA 3RR7A 1C0FA 2GWKA 1S3XA 2ZD1A 3NF7A 1R0AA 4E3SA 4IOAL 3PSFA 2O8CA 4BC3A 1YTUA 3R8EA 1P90A 3DLLL 4OPKA 1NGDA 4CHZA 4WCEL 3TAQA 1NGIA 4CF0A 3TTFA 1Z6RA 3EE8A 5DK5A 1RDBA 4B9VA 3ATVA 1J54A 1TUYA 4FZYA 3G6EN 4DSJA 2HSTA 2XY6A 2PYLA 1I39A 3I55N 4YOVA 1N36K 4FO0A 3AVFA 2B5JA 3UIQA 2GBZA 2O4IA 2GUIA 4JKBA 3KIOA 3LPUA 3HSCA 3ZEUA 1NK9A 1S1VA 1RCHA 5E84A 2QTDA 5F1XA 1TGOA 4KFBA 1JLQA 4IG3A 2E2OA 4DS4A 2UXDK 5JVGL 3BY5A 3KD1E 5LJVA 3G0ZA 3ISNC 3V9WA 2Z1HA 5C12A 1JKHA 4DQPA 4CJFA 2P9PA 3ID6A 1IH7A 4AILC 4R79A 3NH0A 1QHTA 2JGUA 3JYTA 4ZTJA 1X9WA 1WSEA 3K57A 3VERA 2DPNA 4AF1A 3CETA 1EETA 3QIOA 4PL8A 4NXNK 3DRSA 3HP9A 3O1WA 1TYQA 3ZSYA 1YT3A 3NVMA 2XY7A 1BQNA 4DCHA 5AQVA 3ZSXA 1GLLO 4CEDA 4CJRA 4B3SK 3CPEA 3SK3A 2Z1JA 4I9LA 4K43A 4DFMA 1NK4A 1CZ9A 1K73O 5M1PA 5AQJA 3VEVA 1JCGA 1YJ9N 3VQEA 3RRHA 4BE2A 3AO1A 4BRMA 3MXMA 4CJUA 2JWLA 3VF2A 3H1VX 5HLFA 4JI7K 3MWTA 2FBVA 5AQZA 2FC0A 1FKPA 1HPMA 3QFPA 2HHHK 2Q3SA 1FK9A 5E26A 4F9OA 1WAFA 5KQDA 5MLCQ 1QTMA 1RBTA 4JI1K 4HCCA 3J80O 4NCBA 1QSLA 3L4IA 3M8PA 3DLBA 4CFAA 1RNHA 2UXCK 4B1WB 2DTUA 1ITGA 4MDAA 1HNXK 1N34K 4B9TA 2XRIA 1TK0A 5JMVA 2E2NA 2IOCA 2G8WA 4DR2K 1UA1A 3VF4A 3CHWA 4W5NA 4GV9A 3H46O 3MDQA 4EP4A 3P1GA 4CIFA 4BGAA 1U48A 2HBLA 1IKVA 1NJYA 1VQ8N 4BRHA 3MXJA 4H0OA 3P39A 4UQGA 3KK1A 2P51A 4FLVA 4NXMK 4CHPA 4O4GA 3ENBA 2ZGYA 1HQUA 2QXLA 4W5QA 3WXMB 1ZXOA 1UAXA 1Y64A 2YJFA 4IFYA 2G8KA 5FPNA 3T7ZA 1NWKA 4EIAA 4NO7A 5F2RA 4X65K 3C0BA 4GMJB 3CQXA 4Z4FA 4LC9B 3LWLA 3DRPA 2GWJA 5JVHL 1S1UA 3VQPA 1S1WA 1HKBA 1NBWA 3QFUA 3O4NA 3UKRA 1YJNN 3AA2A 1Y97A 3AVNA 5M1OA 4XEIA 1IG9A 5AZIA 1BOTO 4CBUA 2OPPA 4CJKA 4KH5A 2VQEK 2VWBA 4BC4A 4AHVA 2F96A 3A0IX 4CEQA 4ELVA 3B6PA 1OVQA 4FJMA 3QBWA 2VWJA 4DV2K 4WQ5C 4NB4A 3WNHA 1WSJA 3THXB 2VWKA 2HHXA 1CXQA 1K8KA 2JLEA 3SUPA 1YHQN 4HTLA 4JHDA 1S1XA 4EP5A 3KZBA 5JS1A 3P38A 4E7HA 3HK2A 2KZZA 3M5RA 5CZ2A 3F2KA 3G10A 3SUOA 1IO2A 1EKEA 1CXUA 1RT1A 4O55A 4BC5A 3I56N 3VQDA 3LP3A 1KCFA 3DWLA 3I0SA 4A5BA 1N33K 4B1VA 2PYJA 5KRTA 5KI6A 3V1OA 4FLYA 1LAVA 3LZIA 1WSIA 3E9OA 3P4IA 4NCGA 1VQ9N 1D8YA 5HRRA 3DI6A 1SV5A 4Y1DA 4V19S 4Z4HA 5BR9A 3CC7N 1YVUA 4IDKA 2WC9A 2O8DB 1JCEA 3HPHA 3N4QA 1CZAN 3RTVA 3AVCA 1TUUA 2VYPA 4DLGA 1ZBSA 1V4SA 3B8AX 1GLCG 2IVNA 4PA1A 2HNYA 3A5LC 1KFSA 3DLEA 3LWMA 2YJEA 3DMJA 4FOEA 2P9IA 4J2AA 4O5FA 5AQOA 4PY5A 1VSFA 4DSEA 1HRHA 4W5TA 1S5JA 2E20A 5EY4A 3WT0A 1TL3A 3VGKA 1IG8A 1T6CA 3SAFA 2QWMA 1J6ZA 3L2RA 1QS4A 3ZCMA 3LM2A 4CEOA 5BPNA 3RMAA 3OJSA 3EO3A 3QERA 3ZETB 2FSJA 1RBUA 1QZ5A 2X78A 1LAWA 2ZJRL 3ZEUB 3J7AP 5CYQA 4C1NI 4FWQA 3V4IA 4FJ5A 3G25A 1WBDA 4O0JA 3U3GA 4EZ6A 4F3OA 4FWPA 3NHGA 1HYVA 2GTDA 2QA4N 4K25A 5C15A 4DV7K 3L2VA 2BDPA 4Y0WA 3VTHA 3C7NB 4A2AA 1JLCA 2QWLA 5F0XA 1M90O 3SLCA 1RTJA 1SUQA 4H0VB 3CM5A 3K5OA 4FJXA 4FPBA 2IAJA 2FLOA 2HMIA 3C65A 5M1NA 2OZSA 3RVCA 4AH9A 4DQQA 4A57A 2HVHA 4DTMA 1EO1A 5LMNK 4DV1K 3AO3A 4FLUA 3KLFA 4LH5A 4CCHA 3BEXA 4CEZA 1T44A 2JWKA 4DUZK 1D4XA 4NYFA 2VCPA 3SPZA 2V7ZA 5LY3A 1IJJA 4WQ4C 3OYLA 4FJJA 5KPZA 3VQ5A 5AFUH 3EZ5A 4GKJK 3M8SA 1BGXT 3T1HK 4QS7A 1I94K 3NH1A 1MWKA 2FBXA 3QIPA 5AQUA 5K14A 3KK7A 5BPLA 3FZKA 2G8VA 2I5JA 3LZJA 3CERA 3WQUA 4A61A 4ZHRA 3OBYA 4DU1A 3AAPA 3CJCA 5SWMA 5LL6Z 4CD3A 5BRDA 3KWGA 3LP1A 1BL3A 1YVNA 3K2PA 3O9SA 4FJ8A 4BR5A 2YNHA 4FJ9A 4ISFA 5AQMA 3O4QA 1C0GA 3HVTA 4KV8A 3K5LA 2A1SA 3F73A 1J9AA 1JJ2M 3S41A 2ITGA 4JKCA 5FPEA 4BY9C 4KO0A 2UU9K 1VQ7N 4BVOA 4F2SA 4M3WA 2EWSA 2KFNA 4J8FA 1RDWX 2UYTA 3UB5A 1QZ6A 3KK2A 4FLXA 1DGKN 1KVCA 3LDSA 2PY5A 4JKFA 3P31A 2BGGA 1BO5O 4PKGA 1S9GA 3NBPA 4UY8O 4C1NK 4CERA 3SQ1A 4HHTA 3CD6N 1BQMA 2ASPA 3MXIA 2YKMA 2QI2A 3Q7CA 2OANA 3K9KA 4JI6K 4JI3K 1OVYA 3A5OC 4WFAL 3O6WA 2D5RA 2HBKA 1A5WA 1RT2A 4M3XA 3J7YP 4FK2A 3DYAA 1NJWA 3A8YA 4IOXA 4K8ZA 2VQFK 1RTHA 4DV6K 4I2PA 2P1JA 4B3RK 1T6DA 4U67L 4OKKA 3OVNA 4OGCA 2I7NA 1TL1A 3U3YA 4DSFA 4HUEA 2ZWHA 2NRXA 3SV3A 1S9EA 3UKRB 5C0YA 3K5NA 4CK3A 1JLGA 3EZWA 4BROA 3EN9A 4FM0A 1KAZA 5AZIB 5JLHA 3QEIA 4JI4K 3QBXA 3VEYA 4DTJA 4LF5K 1HNIA 5C10A 4M45A 4DMNA 5AQTA 1BI4A 1QQMA 2E1YA 4B3TK 5I3UA 4BDPA 3OYJA 5DM6L 2NLXA 4KTWA 2OA8A 1BCOA 2RN2A 1NGCA 3W0LA 4X66K 3SUQA 2OZMA 4JI0K 2G8IA 5B8HA 4LF4K 2FSKA 3FGUA 4BGBA 4N41A 3IFRA 1K8KB 3AVKA 3C6TA 4DKWA 2O8DA 2G8UA 4CW7B 3CFRA 3WXLA 1VQLN 3FZMA 3ZX0A 4JD2A 4OX9K 4DTPA 2NRVA 4JRPA 4O0IA 2A41A 4CVNE 4FJHA 1BUPA 5EVZA 4HWIA 3CCQN 4E7KA 4E1NA 4ELUA 3C94A 4OKJA 3IDHA 1HQEA 4BREA 4DSLA 1RT6A 1KD1O 2X6NA 5J2MA 5AQPA 1DLOA 3GL1A 4CGHA 3IS9A 3ZSOA 5GAEP 1X3NA 4FWRA 1NLVA 4X62K 4E19A 4DSIA 4MO4A 4KH4A 3HOSA 2X74A 2YHAA 4RW8A 3MAQA 1HNZK 3I8DA 1A5VA 2A42A 3D0PA 1FJGK 3AA3A 3ZETA 2V52B 3ULEB 3U4LA 3SYZA 3PX0A 3I8BA 1U2VB 3CXCM 3H1QA 1NKBA 4ID5A 3OW2M 4LD0A 2RE2A 1GOCA 3AO5A 4DQIA 3AO2A 3GBTA 5I42A 2A40A 1XHXA 4EAHD 3QICA 3K59A 1T05A 4FJGA 2P9IB 4CBWA 5HBMA 5C2DA 3C7NA 1JL2A 3B6OA 3M1FA 1JL1A 4LFBK 4N76A 3T19A 1N5YA 2IIRA 3OYIA 1Q9YA 5KGWA 1SL2A 4PWDA 3OYCA 1WAJA 4KHPK 1IKXA 4DHYA 3DAWA 3VF6A 4LSLA 1BDGA 1NGAA 3EEQA 2QW9A 5JS2A 1CLQA 1SAZA 3RWUA 3VA3A 5H1SQ 3AY9A 2Y1JA 2BTFA 3QLHA 3QEXA 3QEPA 3OS1A 3V81A 3MEGA 4JLHA 3FFKB 4N56A 1RDAA 1ASVA 3HVRA 4XH4A 3MN7A 3CCJN 2E88A 1RBVA 4F2RA 4BRAA 2WFBA 3DXMA 1GLDG 4B9SA 3TTDA 3CF5L 3CCVN 1LCUA 1MWMA 3VEOA 1KFDA 5CZ1A 4B9MA 2CH5A 4NLBA 1NNEA 4XH1A 4H8KA 3SJHA 3AA5X 2CGLA 2P5GA 4N47A 4ID1A 4A62A 3VTIA 3V9ZA 5HROA 3WXKA 1WSFA 4BDZA 1OH5A 3DOKA 3PX4A 3LDLA 1JXBA 3PSIA 2O8EB 1C0UA 5JLFA 3W3DA 4CESA 2HHSA 2D0BA 1G99A 5EX5A 1D9DA 3NFAA 3C6UA 2Q0RA 4W5OA 4K0KK 1XQSC 4O5BA 1H1VA 3CI5A 1VSHA 4BR9A 3AAQA 3SQ0A 4KB0A 3NMUA 3AVGA 1ILYA 1NK6A 3E9PA 3TAEA 5AQRA 3CJ9A 4BQZA 5KPTA 4DG1A 4DR4K 4DR3K 4WQ5A 1NJXA 2OTLN 2Q1NA 1EP4A 4QOZB 3AVJA 2D4WA 3SAHA 3TAGA 2P9SB 3FR0A 4YHHK 2ZJQL 1HPZA 2E2PA 1KVAA 3D2FA 5GINA 2PZSA 3ZSRA 3NAEA 2LSNA 4YOUA 2WTUA 4E7JA 4FYDA 3S9HA 1LV5A 4FWKA 3JAMO 1TKTA 2G8HA 1C0MA 4BDYA 2A5XA 4FWLA 3VEXA 1EWRA 3V1QA 4IBNA 4DTXA 1U49A 3MCAB 5HRNA 4RCHA 5I9EB 2UXBK 3VQ8A 4E0DA 4PUOA 4W5RA 2KW4A 2F7TA 1IBMK 3OS0A 2KLAA 3NH2A 2DFEA 4ISEA 3WXJA 1YI2N 3CM6A 4IOCL 4LFAK 4Z4IA 4CZMA 3V6DA 3U9ZA 2HVIA 2AJQA 4FWSA 4N5SA 3QEVA 4M41A 3AV9A 4IXCA 3QNOA 2E2QA 3CIPA 1X9SA 1TV6A 1GLAG 1NOZA 2WBNA 5CE3A 1ZC6A 4A2BA 4GKKK 3R1XA 2YV0X 4DR7K 3ULDA 3IG1A 2GEMA 3G71N 5FDLA 4XIUA 2Q31A 3E1YA 2HB5A 1OH7A 2ITMA 2P9LA 3O9UA 3DLGA 3U9DA 4NYNA 3BUZB 1QQNA 3M3ZA 2QKBA 2ZJPL 3Q7BA 4H0TB 4PKIA 3BZCA 5GIOA 1ASUA 3MN9A 3AGKA 3C6AA 4CGFA 3OYBA 3L6QA 2DFFA 3LANA 5EXWA 1BI4B 1NGBA 1RT5A 4F8RA 1S22A 1HYZA 2HF4A 4EHTA 3AGRA 3UE5A 3SZ2A 2QWOA 5AR0A 1XNRK 1LWCA 2KHOA 1R59O 3CC4N 3WQTA 4A59A 3SUNA 1NGHA 4GV6A 4ICLA 2P9UA 1S6PA 1YJWN 4IFEA 3K0SA 4O8UA 4IO8A 4YOYA 1NMDA 5AQFA 4CF1A 1NJZA 4BR7A 4CK2A 5AQGA 1C1CA 5D3GA 4CJSA 5HP1A 1WN7A 3QDKA 4K8XA 3KWIA 4CJEA 1VQPN 5M1FA 1FW6A 4MLHA 2YHXA 1SS6A 4IG0A 4JD2B 3ULEA 4E7LA 1T7PA 1HLUA 4IZ9A 2VG7A 4E1MA 1U2VA 3K58A 4OLBA 4CZJA 5KGXA 3PY8A 1QVFM 4RW9A 4KHYA 1NK8A 3VN5A 3OYMA 4CEFA 5J2NA 3ASMA 4LH4A 4CFDA 1NK7A 2ETJA 1HR0K 1BCMA 4H5NA 3LL3A 1C1BA 2YKNA 2Q2RA 2D0OA 3O80A 1NG9A 4DR5K 4WQ4A 3ZSQA 3VGMA 4IO9L 4BRCA 4CZHA 2W6LA 4KHUA 1K6YA 4MFBA 4DF4A 5J2PA 3ZT0A 1QQOA 3CCEN 4YY3K 2Q36A 1JLAA 3BZKA 2O4GA 3TPQA 4KI6A 3C95A 1QSYA 1QQCA 3WNGA 3EY1A 4OO1J 4RG8A 4HTUA 1B9FA 2W6KA 2ZE2A 5C2FA 4IDHA 1P8ZA 1B92A 4LFCK 3CG7A 3VQBA 4ILJA 4IWVA 4I2QA 4OLAA 1HNVA 3QB0A 2GELA 4QS9A 4KAZA 3L2UA 3O5BA 2YHYA 1T8EA 1KAYA 5CY4A 1S1TA 4FLWA 4I6MB 4JS4A 3GG4A 4K42A 3NVKA 4BR4A 2NRHA 5ADXH 4CIGA 3HM9A 3I33A 5AJ3K 2O8EA 2NRRA 4KKOA 1ATNA 3ID8A 2Z1IA 4FVMA 4FJIA 1HX1A 2AA4A 4AHSA 3G4SN 5C24A 3FE1A 4GNIA 3T1AA 1N32K 4BR0A 4FWOA 1EWQA 5BRHA 4CJ7A 2E8AA 4IFVA 5KRSA 4H4MA 3MX2A 4DS5A 4FCYA 3DXMB 3PO4A 4DTNA 2HBJA 1Z26A 3AVHA 1WB9A 3MN5A 2QWRA 4G9ZA 4CFBA 3DLHA 1KLNA 1XHZA 5ELZA 3E01A 3VQCA 1NGEA 4WFBL 2P9SA 4B9UA 1YUWA 2EX3A 5SZTA 4GV3A 3QETA 2YHBA 3NGYA 1FXXA 1WNSA 4FM1A 3SPYA 5GAHP 2IVOA 4R5PA 2DFHA 3J8AA 3GDQA 4ISGA 2O8BB 3HPGA 5CHIA 4FLTA 1LWEA 3VQ9A 4B1ZA 4YDUC 4CZLA 5A2QO 4DSKA 1WSHA 5IWAK 4ILHA 4WYBA 4C8NA 5AQIA 5BN9A 3OYGA 4B08A 4AHRA 4IEEA 4FWMA 3R9PA 3L3VA 4J2BA 3ZYYX 3PIPL 3U8XA 1KRPA 4AHCA 4FJLA 1C0TA 3QMLA 2E4LA 2YI1A 5FRNA 2ZM6K 4QCLA 1JCFA 1BISA 2OPRA 1FKOA 4MLEA 3V9UA 3GOIA 4DQRA 4JYAK 2OCEA 3TWHA 2P9KA 1TKXA 3D2FB 3O4WA 4KPYA 1L3TA 4BQLA 3VEZA 3VOVA 3VQ4A 3SAGA 4DV0K 1U6ZA 1Q81O 1N6QA 2QK9A 4FL9A 2E6MA 1OH8A 3E9LA 3KKRA 1T03A 2P9NB 1MDUB 3TSPA 3HO1A 3SNNA 4KI4A 2ZF5O 1VHXA 3TAMA 3M6GA 4CZEA 1XI1A 1GOBA 1YITN 5FPMA 1XNQK 4CI6A 4FPAA 2F8SA 2IC3A 2Z1GA 1NKEA 4JKEA 4CF2A 3TAFA 1NK0A 3CCMN 4GW6A 1BIZA 1NM1A 3RRGA 4EZ9A 4FJ7A 1U47A 2RHKA 2OYQA 4H5VA 1BU6O 1D9FA 1W7AA 3HM8A 1OH6A 2VGMA 4EHUA 4FZZA 1TKZA 2FXUA 4NCAA 2Q0UA 3ZT2A 2W41A 4BRGA 2NUBA 4JKDA 4FJNA 4KHQA 1SL0A 5AQWA 4BRPA 4JS5A 1RTDA 3CMAN 3F9MA 1RFQA 2I7PA 1JLEA 4BRIA 4CZGA 3LDOA 3CJBA 4CF8A 3I0RA 1VQMN 4Q0BA 5AFUA 2KZMA 3AVMA 5BPMA 4CZKA 4B8CA 3HYFA
chains in the Genus database with same CATH topology
1VK0A 4CJWA 3L8BA 2P5GA 4N47A 2KZZA 3KLHA 1S1XA 4ID1A 4EP5A 3QESA 3D45A 5JS1A 3HK2A 3V9ZA 4E7HA 2VG6A 3OYAA 5HROA 1I3AA 1IKYA 1WSFA 3DRRA 5CZ2A 3KJVA 3L2WA 4BDZA 3G10A 1A5XA 3DOKA 3SUOA 1L3SA 3PX4A 1IO2A 1EKEA 1JXBA 1CXUA 1B9DA 1RT1A 4O55A 4HUFA 1C0UA 3HJFA 1TAUA 4M3ZA 1VSJA 3LPTA 4DWIA 3VQDA 4CESA 2HHSA 4DU3A 4DFKA 3LP3A 2D0BA 4M3RA 1NK5A 3TR8A 1KCFA 3NFAA 1D9DA 3I0SA 3C6UA 2BE2A 4CEAA 1SKSA 1RBRA 4W5OA 2VG5A 4O5BA 2PYJA 5KRTA 1VSLA 1LW0A 1VSHA 3P5JA 5KI6A 3SQ0A 4KB0A 3AVGA 4CHNA 5HRPA 1NK6A 3V1OA 4FLYA 3TAEA 2Y1IA 3S3MA 4FW2A 1LAVA 3OYKA 3LZIA 1WSIA 4DG1A 4RW4A 4NCGA 1ZBLA 3K5MA 4CGIA 1NJXA 1D8YA 1EP4A 3KLIA 2W42A 3V9XA 4QOZB 5HRRA 4CJTA 3AVJA 3DI6A 3TARA 1SV5A 4Y1DA 4PQUA 3TAGA 4Z4HA 4I7FA 1YVUA 4IDKA 1RTIA 3CFPA 3HPHA 1KSPA 3PV8A 2B6AA 2X6SA 3RTVA 1HPZA 4CHYA 1KVAA 3AVCA 3BGRA 4DLGA 2PZSA 3ZSRA 3ZT4A 3KKSA 3NAEA 2LSNA 1Q8IA 2HHQA 4DTRA 4E7JA 4OKEA 2D0CA 3HPOA 4FYDA 4CE9A 3S9HA 4M3UA 3O3GA 4PA1A 4Y1CA 1LV5A 4CJQA 2HNYA 2IDOA 1KFSA 1TKDA 1BHLA 1TKTA 3DLEA 2G8HA 1Q9XA 1C0MA 1RT4A 4BDYA 3CFOA 3LWMA 3V9SA 3V1QA 3DMJA 4IBNA 4DTXA 1U49A 4J2AA 4HVJA 2D0AA 4CJLA 4E7IA 4DTOA 3KTQA 2HHTA 5HRNA 3VQ8A 1VSFA 4OPJA 1BIUA 4DSEA 3TANA 1HRHA 3S3NA 4W5TA 4E0DA 4PUOA 4PY5A 1S5JA 3BDPA 2HHVA 4W5RA 2KTQA 2KW4A 4CJVA 1TL3A 3KK3A 3OS0A 4ELTA 4KHSA 1F21A 3NH2A 3RMCA 4BWMA 3VQ7A 2DFEA 3ZT3A 2QKKA 2WONA 4KTZA 4C8LA 3LALA 1JXEA 4CHQA 4FLZA 1CZBA 3L2RA 3CM6A 1QS4A 3ZCMA 2OPSA 3WNEA 1RILA 4AHUA 4CEOA 3NE6A 3KLGA 3RMAA 4Z4IA 4KREA 3OJSA 3V6DA 3QERA 2HVIA 1RBUA 2X78A 4LSNA 2AJQA 1LAWA 1L3UA 4N5SA 3QEVA 1SKWA 4M41A 4Z4CA 3AV9A 3QNOA 2RF2A 1ZBIA 3O3HA 2XHBA 5CYQA 5C25A 3MEEA 4FZXC 3CQ8A 4M42A 1X9SA 1TV6A 2YNGA 4Z4EA 1NOZA 1UA0A 4M3TA 3KLEA 3V4IA 4FJ5A 1JLFA 3CYMA 1RT3A 4O0JA 3U3GA 4EZ6A 4F3OA 3HP6A 1QSSA 2HW3A 3AA4A 5T7BA 3OYFA 3NHGA 1VSMA 4TSXA 1HYVA 4OVLA 2R7YA 1SKRA 4F3TA 3L2VA 2BDPA 2YV0X 1ZBFA 3ZSVA 3OJUA 3SJJA 1JLCA 3MEDA 3ULDA 1IKWA 1ZBUA 3IG1A 4RW7A 5FDLA 1O1WA 3NF9A 4XIUA 1RTJA 4H4OA 2HB5A 3S3OA 1SUQA 2F8TA 3DLGA 3CM5A 3K5OA 4NYNA 4FJXA 2RKIA 2IAJA 2HMIA 2OZSA 4AH9A 1U04A 3VQAA 4DQQA 2HVHA 5J1EA 5FRMA 2QKBA 3VQ6A 4DTMA 1GOAA 3O3FA 3LP2A 1VSDA 3AO3A 4FLUA 4E89A 4LH5A 3KLFA 1TK5A 4CCHA 1ASUA 4CEZA 1C1AA 4CJ4A 2IGIA 1YTAA 1VRUA 3AVLA 4CGFA 3OYBA 1XC9A 1KVBA 1X9MA 2DFFA 3ALYA 3LANA 3HSTB 4CGGA 1BI4B 3SI6A 4NYFA 1RT5A 3THVA 4F8RA 3SPZA 1RDDA 4DTSA 2ATQA 3ZSZA 4FJJA 3OYLA 1HYZA 1JLBA 3VQ5A 3SZ2A 1QE1A 4FJKA 1LWCA 5DMRA 3EZ5A 3M8SA 2HHUA 4JRQA 2XY5A 3SUNA 1HJRA 1BGXT 4ICLA 3OY9A 1S6PA 5E41A 3SV4A 2KQ2A 3QNNA 1VRTA 3OYNA 3NH1A 4C8KA 2FBXA 4CF1A 1NJZA 3QIPA 4CK2A 1XWLA 3VQQA 1C1CA 5K14A 1UOCA 4DLEA 2G8VA 5D3GA 1RT7A 2I5JA 1WN7A 4CJSA 4CJPA 3LZJA 3U6FA 5HP1A 1W9HA 4K8XA 5CYMA 4DU4A 4L8RB 2ZQBA 3AVBA 3QINA 4OGEA 4CJEA 4O44A 2RPIA 1UWBA 3AO4A 5EU7A 3HXMA 4DU1A 3QEWA 1L5UA 5SWMA 2P5OA 2YNIA 2KFZA 2XO7A 3T3FA 3RR7A 4HCBA 4IG0A 2ZD1A 3LP1A 3NF7A 4E7LA 1R0AA 1BL3A 1T7PA 3K2PA 3OYHA 4E3SA 2VG7A 4CGJA 4E1MA 4FJ8A 4FXDA 3K58A 4OLBA 2BANA 2YNHA 4OJRA 5KGXA 3PY8A 4FJ9A 1YTUA 4FW1A 3O4QA 3HVTA 4KV8A 4OPKA 2A1SA 4RW9A 1J9AA 3K5LA 3F73A 5J2QA 1NK8A 3V1RA 3VN5A 4CEFA 3OYMA 5J2NA 4KHYA 2ITGA 3ASMA 4LH4A 4CHZA 4CFDA 3TAQA 1X1PA 1NK7A 1L3VA 3QO9A 2ETJA 4KO0A 2HNDA 4CJ5A 2IS3A 1BCMA 1TK8A 3RMBA 4CF0A 5DK5A 4AHTA 4KTQA 1RDBA 3M8RA 4B9VA 1J54A 1C1BA 2YKNA 1U45A 4F2SA 4M3WA 2KFNA 3IRXA 4HUGA 4B8CA 4FZYA 1WLJA 4DFPA 4DSJA 3ZSQA 3KK2A 4FLXA 2XY6A 1I39A 1KVCA 3FFIA 3LDSA 1S6QA 2PYLA 2PY5A 4KHUA 1K6YA 3SCXA 2BGGA 3NCIA 1DTQA 2B5JA 3AVFA 3DM2A 4MFBA 3UIQA 2GBZA 2GV9A 1HYSA 2O4IA 1S9GA 2GUIA 4DF4A 3NBPA 5J2PA 1VSEA 3KIOA 3LPUA 3ZT0A 4F4KA 4CERA 1JLAA 4HHTA 3SQ1A 2O4GA 1NK9A 1S1VA 1BQMA 1RCHA 1EX4A 1NOYA 4KI6A 1TGOA 4KFBA 3C95A 3MXIA 2YKMA 1QQCA 1JLQA 1QSYA 3WNGA 3EY1A 4CIEA 4IG3A 3DOLA 4DS4A 3KD1E 2G8FA 4RG8A 4HTUA 1B9FA 3EYZA 2ZE2A 3G0ZA 4ZTFA 3ISNC 3V9WA 2Z1HA 2D5RA 1JKHA 4Z0UA 4BACA 1A5WA 1RT2A 4DQPA 4M3XA 4DF8A 4CJFA 1ZYQA 3DYAA 1NJWA 4CF9A 4FK2A 4IKFA 4K8ZA 1B92A 1RTHA 4BE1A 1IH7A 1J53A 3CG7A 3VQBA 4OLAA 4I2QA 4I2PA 4AILC 4B3OA 1HNVA 2P1JA 3ZSWA 3SQ2A 3NH0A 4KHWA 4OKKA 3OVNA 1QHTA 4OGCA 3PO5A 2JGUA 4J2DA 3PUFA 1TL1A 3JYTA 3U3YA 4ZTJA 1WSEA 3K57A 1X9WA 4KAZA 3L2UA 4DSFA 1EETA 1T8EA 1U4BA 4HUEA 3QIOA 3TI0A 5CY4A 3L2QA 3SV3A 1S1TA 1S9EA 1LW2A 1TAQA 3DRSA 3HP9A 3SQ4A 3ZSYA 4FLWA 1YT3A 3K5NA 4CK3A 1JLGA 4JS4A 3ITHA 2XY7A 1BQNA 4FM0A 3ZSXA 1C6VA 4CEDA 4CIGA 4GVMA 3HM9A 3QEIA 4CJRA 4WE1A 1Z25A 3P83D 3PX6A 1ZBHA 4KKOA 4DTJA 2Z1JA 4FM2A 4I9LA 1HNIA 2Z1IA 1LWFA 3NF8A 4FVMA 4FJIA 4M45A 2WOMA 4DMNA 4DFMA 1D5AA 1BI4A 4AHSA 1CZ9A 5C24A 1NK4A 5I3UA 2EHGA 3T1AA 4BDPA 3OYJA 4KTWA 2OA8A 1BCOA 3VQEA 3AVIA 2RN2A 4MQ3A 3RRHA 4IFVA 5KRSA 4H4MA 3AO1A 3M8QA 4BE2A 4DS5A 3SUQA 3MXMA 4CJUA 4FCYA 1EXQA 5HLFA 2FBYA 2OZMA 3PO4A 2QXFA 4BWJA 4Z4GA 4DTNA 2G8IA 2FBVA 1Z26A 3LAMA 3AVHA 2FC0A 1FKPA 1HMVA 4CFBA 1KLNA 3DLHA 1XHZA 4G1QA 3E01A 3VQCA 3NGIA 2Q3SA 1FK9A 3C6TA 3AVKA 4N41A 4KRFA 1WAFA 1QTMA 1RBTA 2G8UA 4B9UA 2HNZA 4HCCA 3CFRA 1VSKA 4NCBA 2EX3A 1QSLA 5KTQA 3M8PA 3DLBA 5SZTA 1RBSA 3QETA 2YHBA 3NGYA 1FXXA 1WNSA 4FM1A 4DTPA 3SPYA 4B9NA 4CFAA 4R5PA 4JRPA 4KB1A 4O0IA 1RNHA 2DFHA 2DTUA 1ITGA 3HPGA 4FLTA 4FJHA 2YNFA 1LWEA 3LAKA 4C8MA 5C42A 3VQ9A 4B9TA 2XRIA 4DSKA 1WSHA 1TK0A 1REVA 4E7KA 4E1NA 2IOCA 4C8NA 2G8WA 3C94A 4OKJA 4ELUA 4KHNA 1UA1A 3H08A 3OYGA 4W5NA 4B08A 1HQEA 1VSIA 4DSLA 1RT6A 4AHRA 4I9QA 2X6NA 3L3VA 5J2MA 4J2BA 4EP4A 3P1GA 4CIFA 1DLOA 2HHWA 5HRSA 3NDKA 4CGHA 1U48A 3RR8A 1KRPA 4AHCA 4B9LA 1C0TA 4FJLA 3AVAA 2E4LA 3IS9A 3ZSOA 5FRNA 1IKVA 1NJYA 4QCLA 1DTTA 3L3UA 3MXJA 1BISA 2OPRA 4CHOA 4E19A 1FKOA 1SL1A 4DSIA 5FROA 4UQGA 3V9UA 4DQRA 2X74A 2YHAA 4RW8A 3KK1A 3MAQA 4J2EA 2P51A 1WSGA 3I8DA 4FLVA 4QAGA 1A5VA 3D0PA 4CHPA 4O4GA 1TVRA 3TWHA 1TKXA 3AA3A 3IAYA 4CEEA 4KPYA 4DTUA 1L3TA 1HQUA 3VQ4A 4DQSA 4B8AB 3SYZA 3PX0A 1N6QA 4FK4A 4W5QA 2QK9A 2E6MA 4LY7A 1UAXA 2B4JA 3KKRA 3NF6A 4IFYA 3NGZA 1T03A 1NKBA 2G8KA 4ID5A 3TAPA 4LD0A 3MECA 1GOCA 3AO5A 4DQIA 3AO2A 5I42A 4GMJB 4DFJA 3RMDA 1XHXA 3HO1A 3SNNA 1G15A 3K59A 1T05A 4FJGA 4KI4A 4Z4FA 5HBMA 4Q5VA 1W0HA 3TAMA 1JL2A 3B6OA 3DRPA 1JL1A 3LWLA 4C8OA 1XI1A 4N76A 1GOBA 1S1UA 3T19A 1S1WA 3VQPA 1N5YA 2DY4A 2OPQA 3OYIA 1Q9YA 3O4NA 5KGWA 1SL2A 4YFUA 2F8SA 4PWDA 4RW6A 3OYCA 2IC3A 3OS2A 2Z1GA 3AA2A 4YNQA 1Y97A 1NKEA 1NKCA 1WAJA 4M3YA 3AVNA 4CF2A 1IKXA 3TAFA 1NK0A 1J5OA 4GW6A 1BIZA 1IG9A 3RRGA 2XY8A 4EZ9A 4FJ7A 4LSLA 4FK0A 1U47A 5JS2A 1CLQA 2OYQA 2OPPA 1D9FA 3HL8A 4CJKA 3RWUA 3VA3A 4ZHRA 3VA0A 4BE0A 4AHVA 2F96A 2Y1JA 1KLMA 4FZZA 3QLHA 1KTQA 4CEQA 3QEXA 4ELVA 1TKZA 4NCAA 3B6PA 3WNFA 3QEPA 3ZT2A 3TABA 3OS1A 2E6LA 3MEGA 4CEBA 3V81A 4JLHA 2NUBA 4FJMA 4N56A 4CECA 2VWJA 2A1RA 1RDAA 1SL0A 4FJNA 4KHQA 1ASVA 3HVRA 1RBVA 1ASWA 4JS5A 1RTDA 4F2RA 4CGDA 3DLKA 3LP0A 1JLEA 3A2FA 4B9SA 3WNHA 1WSJA 4CK1A 4CJ3A 3OYDA 2VWKA 3OYEA 3DLRA 2FBTA 3JSMA 2HHXA 4CF8A 3I0RA 1RDCA 4CFCA 4Q0BA 1KFDA 2KZMA 1MU2A 3ZT1A 3AVMA 1CXQA 3F9KA 5CZ1A 4B9MA 2JLEA 3SUPA 3HT3A 3KD5E 4H8KA 3AA5X 3HYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VK0 A;  4CJW A;  3L8B A;  2P5G A;  4N47 A;  2KZZ A;  3KLH A;  1S1X A;  4ID1 A;  4EP5 A;  3QES A;  3D45 A;  5JS1 A;  3HK2 A;  3V9Z A;  4E7H A;  2VG6 A;  3OYA A;  5HRO A;  1I3A A;  1IKY A;  1WSF A;  3DRR A;  5CZ2 A;  3KJV A;  3L2W A;  4BDZ A;  3G10 A;  1A5X A;  3DOK A;  3SUO A;  1L3S A;  3PX4 A;  1IO2 A;  1EKE A;  1JXB A;  1CXU A;  1B9D A;  1RT1 A;  4O55 A;  4HUF A;  1C0U A;  3HJF A;  1TAU A;  4M3Z A;  1VSJ A;  3LPT A;  4DWI A;  3VQD A;  4CES A;  2HHS A;  4DU3 A;  4DFK A;  3LP3 A;  2D0B A;  4M3R A;  1NK5 A;  3TR8 A;  1KCF A;  3NFA A;  1D9D A;  3I0S A;  3C6U A;  2BE2 A;  4CEA A;  1SKS A;  1RBR A;  4W5O A;  2VG5 A;  4O5B A;  2PYJ A;  5KRT A;  1VSL A;  1LW0 A;  1VSH A;  3P5J A;  5KI6 A;  3SQ0 A;  4KB0 A;  3AVG A;  4CHN A;  5HRP A;  1NK6 A;  3V1O A;  4FLY A;  3TAE A;  2Y1I A;  3S3M A;  4FW2 A;  1LAV A;  3OYK A;  3LZI A;  1WSI A;  4DG1 A;  4RW4 A;  4NCG A;  1ZBL A;  3K5M A;  4CGI A;  1NJX A;  1D8Y A;  1EP4 A;  3KLI A;  2W42 A;  3V9X A;  4QOZ B;  5HRR A;  4CJT A;  3AVJ A;  3DI6 A;  3TAR A;  1SV5 A;  4Y1D A;  4PQU A;  3TAG A;  4Z4H A;  4I7F A;  1YVU A;  4IDK A;  1RTI A;  3CFP A;  3HPH A;  1KSP A;  3PV8 A;  2B6A A;  2X6S A;  3RTV A;  1HPZ A;  4CHY A;  1KVA A;  3AVC A;  3BGR A;  4DLG A;  2PZS A;  3ZSR A;  3ZT4 A;  3KKS A;  3NAE A;  2LSN A;  1Q8I A;  2HHQ A;  4DTR A;  4E7J A;  4OKE A;  2D0C A;  3HPO A;  4FYD A;  4CE9 A;  3S9H A;  4M3U A;  3O3G A;  4PA1 A;  4Y1C A;  1LV5 A;  4CJQ A;  2HNY A;  2IDO A;  1KFS A;  1TKD A;  1BHL A;  1TKT A;  3DLE A;  2G8H A;  1Q9X A;  1C0M A;  1RT4 A;  4BDY A;  3CFO A;  3LWM A;  3V9S A;  3V1Q A;  3DMJ A;  4IBN A;  4DTX A;  1U49 A;  4J2A A;  4HVJ A;  2D0A A;  4CJL A;  4E7I A;  4DTO A;  3KTQ A;  2HHT A;  5HRN A;  3VQ8 A;  1VSF A;  4OPJ A;  1BIU A;  4DSE A;  3TAN A;  1HRH A;  3S3N A;  4W5T A;  4E0D A;  4PUO A;  4PY5 A;  1S5J A;  3BDP A;  2HHV A;  4W5R A;  2KTQ A;  2KW4 A;  4CJV A;  1TL3 A;  3KK3 A;  3OS0 A;  4ELT A;  4KHS A;  1F21 A;  3NH2 A;  3RMC A;  4BWM A;  3VQ7 A;  2DFE A;  3ZT3 A;  2QKK A;  2WON A;  4KTZ A;  4C8L A;  3LAL A;  1JXE A;  4CHQ A;  4FLZ A;  1CZB A;  3L2R A;  3CM6 A;  1QS4 A;  3ZCM A;  2OPS A;  3WNE A;  1RIL A;  4AHU A;  4CEO A;  3NE6 A;  3KLG A;  3RMA A;  4Z4I A;  4KRE A;  3OJS A;  3V6D A;  3QER A;  2HVI A;  1RBU A;  2X78 A;  4LSN A;  2AJQ A;  1LAW A;  1L3U A;  4N5S A;  3QEV A;  1SKW A;  4M41 A;  4Z4C A;  3AV9 A;  3QNO A;  2RF2 A;  1ZBI A;  3O3H A;  2XHB A;  5CYQ A;  5C25 A;  3MEE A;  4FZX C;  3CQ8 A;  4M42 A;  1X9S A;  1TV6 A;  2YNG A;  4Z4E A;  1NOZ A;  1UA0 A;  4M3T A;  3KLE A;  3V4I A;  4FJ5 A;  1JLF A;  3CYM A;  1RT3 A;  4O0J A;  3U3G A;  4EZ6 A;  4F3O A;  3HP6 A;  1QSS A;  2HW3 A;  3AA4 A;  5T7B A;  3OYF A;  3NHG A;  1VSM A;  4TSX A;  1HYV A;  4OVL A;  2R7Y A;  1SKR A;  4F3T A;  3L2V A;  2BDP A;  2YV0 X;  1ZBF A;  3ZSV A;  3OJU A;  3SJJ A;  1JLC A;  3MED A;  3ULD A;  1IKW A;  1ZBU A;  3IG1 A;  4RW7 A;  5FDL A;  1O1W A;  3NF9 A;  4XIU A;  1RTJ A;  4H4O A;  2HB5 A;  3S3O A;  1SUQ A;  2F8T A;  3DLG A;  3CM5 A;  3K5O A;  4NYN A;  4FJX A;  2RKI A;  2IAJ A;  2HMI A;  2OZS A;  4AH9 A;  1U04 A;  3VQA A;  4DQQ A;  2HVH A;  5J1E A;  5FRM A;  2QKB A;  3VQ6 A;  4DTM A;  1GOA A;  3O3F A;  3LP2 A;  1VSD A;  3AO3 A;  4FLU A;  4E89 A;  4LH5 A;  3KLF A;  1TK5 A;  4CCH A;  1ASU A;  4CEZ A;  1C1A A;  4CJ4 A;  2IGI A;  1YTA A;  1VRU A;  3AVL A;  4CGF A;  3OYB A;  1XC9 A;  1KVB A;  1X9M A;  2DFF A;  3ALY A;  3LAN A;  3HST B;  4CGG A;  1BI4 B;  3SI6 A;  4NYF A;  1RT5 A;  3THV A;  4F8R A;  3SPZ A;  1RDD A;  4DTS A;  2ATQ A;  3ZSZ A;  4FJJ A;  3OYL A;  1HYZ A;  1JLB A;  3VQ5 A;  3SZ2 A;  1QE1 A;  4FJK A;  1LWC A;  5DMR A;  3EZ5 A;  3M8S A;  2HHU A;  4JRQ A;  2XY5 A;  3SUN A;  1HJR A;  1BGX T;  4ICL A;  3OY9 A;  1S6P A;  5E41 A;  3SV4 A;  2KQ2 A;  3QNN A;  1VRT A;  3OYN A;  3NH1 A;  4C8K A;  2FBX A;  4CF1 A;  1NJZ A;  3QIP A;  4CK2 A;  1XWL A;  3VQQ A;  1C1C A;  5K14 A;  1UOC A;  4DLE A;  2G8V A;  5D3G A;  1RT7 A;  2I5J A;  1WN7 A;  4CJS A;  4CJP A;  3LZJ A;  3U6F A;  5HP1 A;  1W9H A;  4K8X A;  5CYM A;  4DU4 A;  4L8R B;  2ZQB A;  3AVB A;  3QIN A;  4OGE A;  4CJE A;  4O44 A;  2RPI A;  1UWB A;  3AO4 A;  5EU7 A;  3HXM A;  4DU1 A;  3QEW A;  1L5U A;  5SWM A;  2P5O A;  2YNI A;  2KFZ A;  2XO7 A;  3T3F A;  3RR7 A;  4HCB A;  4IG0 A;  2ZD1 A;  3LP1 A;  3NF7 A;  4E7L A;  1R0A A;  1BL3 A;  1T7P A;  3K2P A;  3OYH A;  4E3S A;  2VG7 A;  4CGJ A;  4E1M A;  4FJ8 A;  4FXD A;  3K58 A;  4OLB A;  2BAN A;  2YNH A;  4OJR A;  5KGX A;  3PY8 A;  4FJ9 A;  1YTU A;  4FW1 A;  3O4Q A;  3HVT A;  4KV8 A;  4OPK A;  2A1S A;  4RW9 A;  1J9A A;  3K5L A;  3F73 A;  5J2Q A;  1NK8 A;  3V1R A;  3VN5 A;  4CEF A;  3OYM A;  5J2N A;  4KHY A;  2ITG A;  3ASM A;  4LH4 A;  4CHZ A;  4CFD A;  3TAQ A;  1X1P A;  1NK7 A;  1L3V A;  3QO9 A;  2ETJ A;  4KO0 A;  2HND A;  4CJ5 A;  2IS3 A;  1BCM A;  1TK8 A;  3RMB A;  4CF0 A;  5DK5 A;  4AHT A;  4KTQ A;  1RDB A;  3M8R A;  4B9V A;  1J54 A;  1C1B A;  2YKN A;  1U45 A;  4F2S A;  4M3W A;  2KFN A;  3IRX A;  4HUG A;  4B8C A;  4FZY A;  1WLJ A;  4DFP A;  4DSJ A;  3ZSQ A;  3KK2 A;  4FLX A;  2XY6 A;  1I39 A;  1KVC A;  3FFI A;  3LDS A;  1S6Q A;  2PYL A;  2PY5 A;  4KHU A;  1K6Y A;  3SCX A;  2BGG A;  3NCI A;  1DTQ A;  2B5J A;  3AVF A;  3DM2 A;  4MFB A;  3UIQ A;  2GBZ A;  2GV9 A;  1HYS A;  2O4I A;  1S9G A;  2GUI A;  4DF4 A;  3NBP A;  5J2P A;  1VSE A;  3KIO A;  3LPU A;  3ZT0 A;  4F4K A;  4CER A;  1JLA A;  4HHT A;  3SQ1 A;  2O4G A;  1NK9 A;  1S1V A;  1BQM A;  1RCH A;  1EX4 A;  1NOY A;  4KI6 A;  1TGO A;  4KFB A;  3C95 A;  3MXI A;  2YKM A;  1QQC A;  1JLQ A;  1QSY A;  3WNG A;  3EY1 A;  4CIE A;  4IG3 A;  3DOL A;  4DS4 A;  3KD1 E;  2G8F A;  4RG8 A;  4HTU A;  1B9F A;  3EYZ A;  2ZE2 A;  3G0Z A;  4ZTF A;  3ISN C;  3V9W A;  2Z1H A;  2D5R A;  1JKH A;  4Z0U A;  4BAC A;  1A5W A;  1RT2 A;  4DQP A;  4M3X A;  4DF8 A;  4CJF A;  1ZYQ A;  3DYA A;  1NJW A;  4CF9 A;  4FK2 A;  4IKF A;  4K8Z A;  1B92 A;  1RTH A;  4BE1 A;  1IH7 A;  1J53 A;  3CG7 A;  3VQB A;  4OLA A;  4I2Q A;  4I2P A;  4AIL C;  4B3O A;  1HNV A;  2P1J A;  3ZSW A;  3SQ2 A;  3NH0 A;  4KHW A;  4OKK A;  3OVN A;  1QHT A;  4OGC A;  3PO5 A;  2JGU A;  4J2D A;  3PUF A;  1TL1 A;  3JYT A;  3U3Y A;  4ZTJ A;  1WSE A;  3K57 A;  1X9W A;  4KAZ A;  3L2U A;  4DSF A;  1EET A;  1T8E A;  1U4B A;  4HUE A;  3QIO A;  3TI0 A;  5CY4 A;  3L2Q A;  3SV3 A;  1S1T A;  1S9E A;  1LW2 A;  1TAQ A;  3DRS A;  3HP9 A;  3SQ4 A;  3ZSY A;  4FLW A;  1YT3 A;  3K5N A;  4CK3 A;  1JLG A;  4JS4 A;  3ITH A;  2XY7 A;  1BQN A;  4FM0 A;  3ZSX A;  1C6V A;  4CED A;  4CIG A;  4GVM A;  3HM9 A;  3QEI A;  4CJR A;  4WE1 A;  1Z25 A;  3P83 D;  3PX6 A;  1ZBH A;  4KKO A;  4DTJ A;  2Z1J A;  4FM2 A;  4I9L A;  1HNI A;  2Z1I A;  1LWF A;  3NF8 A;  4FVM A;  4FJI A;  4M45 A;  2WOM A;  4DMN A;  4DFM A;  1D5A A;  1BI4 A;  4AHS A;  1CZ9 A;  5C24 A;  1NK4 A;  5I3U A;  2EHG A;  3T1A A;  4BDP A;  3OYJ A;  4KTW A;  2OA8 A;  1BCO A;  3VQE A;  3AVI A;  2RN2 A;  4MQ3 A;  3RRH A;  4IFV A;  5KRS A;  4H4M A;  3AO1 A;  3M8Q A;  4BE2 A;  4DS5 A;  3SUQ A;  3MXM A;  4CJU A;  4FCY A;  1EXQ A;  5HLF A;  2FBY A;  2OZM A;  3PO4 A;  2QXF A;  4BWJ A;  4Z4G A;  4DTN A;  2G8I A;  2FBV A;  1Z26 A;  3LAM A;  3AVH A;  2FC0 A;  1FKP A;  1HMV A;  4CFB A;  1KLN A;  3DLH A;  1XHZ A;  4G1Q A;  3E01 A;  3VQC A;  3NGI A;  2Q3S A;  1FK9 A;  3C6T A;  3AVK A;  4N41 A;  4KRF A;  1WAF A;  1QTM A;  1RBT A;  2G8U A;  4B9U A;  2HNZ A;  4HCC A;  3CFR A;  1VSK A;  4NCB A;  2EX3 A;  1QSL A;  5KTQ A;  3M8P A;  3DLB A;  5SZT A;  1RBS A;  3QET A;  2YHB A;  3NGY A;  1FXX A;  1WNS A;  4FM1 A;  4DTP A;  3SPY A;  4B9N A;  4CFA A;  4R5P A;  4JRP A;  4KB1 A;  4O0I A;  1RNH A;  2DFH A;  2DTU A;  1ITG A;  3HPG A;  4FLT A;  4FJH A;  2YNF A;  1LWE A;  3LAK A;  4C8M A;  5C42 A;  3VQ9 A;  4B9T A;  2XRI A;  4DSK A;  1WSH A;  1TK0 A;  1REV A;  4E7K A;  4E1N A;  2IOC A;  4C8N A;  2G8W A;  3C94 A;  4OKJ A;  4ELU A;  4KHN A;  1UA1 A;  3H08 A;  3OYG A;  4W5N A;  4B08 A;  1HQE A;  1VSI A;  4DSL A;  1RT6 A;  4AHR A;  4I9Q A;  2X6N A;  3L3V A;  5J2M A;  4J2B A;  4EP4 A;  3P1G A;  4CIF A;  1DLO A;  2HHW A;  5HRS A;  3NDK A;  4CGH A;  1U48 A;  3RR8 A;  1KRP A;  4AHC A;  4B9L A;  1C0T A;  4FJL A;  3AVA A;  2E4L A;  3IS9 A;  3ZSO A;  5FRN A;  1IKV A;  1NJY A;  4QCL A;  1DTT A;  3L3U A;  3MXJ A;  1BIS A;  2OPR A;  4CHO A;  4E19 A;  1FKO A;  1SL1 A;  4DSI A;  5FRO A;  4UQG A;  3V9U A;  4DQR A;  2X74 A;  2YHA A;  4RW8 A;  3KK1 A;  3MAQ A;  4J2E A;  2P51 A;  1WSG A;  3I8D A;  4FLV A;  4QAG A;  1A5V A;  3D0P A;  4CHP A;  4O4G A;  1TVR A;  3TWH A;  1TKX A;  3AA3 A;  3IAY A;  4CEE A;  4KPY A;  4DTU A;  1L3T A;  1HQU A;  3VQ4 A;  4DQS A;  4B8A B;  3SYZ A;  3PX0 A;  1N6Q A;  4FK4 A;  4W5Q A;  2QK9 A;  2E6M A;  4LY7 A;  1UAX A;  2B4J A;  3KKR A;  3NF6 A;  4IFY A;  3NGZ A;  1T03 A;  1NKB A;  2G8K A;  4ID5 A;  3TAP A;  4LD0 A;  3MEC A;  1GOC A;  3AO5 A;  4DQI A;  3AO2 A;  5I42 A;  4GMJ B;  4DFJ A;  3RMD A;  1XHX A;  3HO1 A;  3SNN A;  1G15 A;  3K59 A;  1T05 A;  4FJG A;  4KI4 A;  4Z4F A;  5HBM A;  4Q5V A;  1W0H A;  3TAM A;  1JL2 A;  3B6O A;  3DRP A;  1JL1 A;  3LWL A;  4C8O A;  1XI1 A;  4N76 A;  1GOB A;  1S1U A;  3T19 A;  1S1W A;  3VQP A;  1N5Y A;  2DY4 A;  2OPQ A;  3OYI A;  1Q9Y A;  3O4N A;  5KGW A;  1SL2 A;  4YFU A;  2F8S A;  4PWD A;  4RW6 A;  3OYC A;  2IC3 A;  3OS2 A;  2Z1G A;  3AA2 A;  4YNQ A;  1Y97 A;  1NKE A;  1NKC A;  1WAJ A;  4M3Y A;  3AVN A;  4CF2 A;  1IKX A;  3TAF A;  1NK0 A;  1J5O A;  4GW6 A;  1BIZ A;  1IG9 A;  3RRG A;  2XY8 A;  4EZ9 A;  4FJ7 A;  4LSL A;  4FK0 A;  1U47 A;  5JS2 A;  1CLQ A;  2OYQ A;  2OPP A;  1D9F A;  3HL8 A;  4CJK A;  3RWU A;  3VA3 A;  4ZHR A;  3VA0 A;  4BE0 A;  4AHV A;  2F96 A;  2Y1J A;  1KLM A;  4FZZ A;  3QLH A;  1KTQ A;  4CEQ A;  3QEX A;  4ELV A;  1TKZ A;  4NCA A;  3B6P A;  3WNF A;  3QEP A;  3ZT2 A;  3TAB A;  3OS1 A;  2E6L A;  3MEG A;  4CEB A;  3V81 A;  4JLH A;  2NUB A;  4FJM A;  4N56 A;  4CEC A;  2VWJ A;  2A1R A;  1RDA A;  1SL0 A;  4FJN A;  4KHQ A;  1ASV A;  3HVR A;  1RBV A;  1ASW A;  4JS5 A;  1RTD A;  4F2R A;  4CGD A;  3DLK A;  3LP0 A;  1JLE A;  3A2F A;  4B9S A;  3WNH A;  1WSJ A;  4CK1 A;  4CJ3 A;  3OYD A;  2VWK A;  3OYE A;  3DLR A;  2FBT A;  3JSM A;  2HHX A;  4CF8 A;  3I0R A;  1RDC A;  4CFC A;  4Q0B A;  1KFD A;  2KZM A;  1MU2 A;  3ZT1 A;  3AVM A;  1CXQ A;  3F9K A;  5CZ1 A;  4B9M A;  2JLE A;  3SUP A;  3HT3 A;  3KD5 E;  4H8K A;  3AA5 X;  3HYF A; 
#chains in the Genus database with same CATH topology
 2ZGZ A;  1VK0 A;  3L8B A;  2P9L B;  3KLH A;  2VG6 A;  4YOW A;  3OYA A;  1I3A A;  1IKY A;  3DRR A;  3KJV A;  3FLC O;  3PIO L;  3KVG A;  4AQY K;  4HUF A;  4M3Z A;  4OPH A;  1VSJ A;  3LPT A;  4DFK A;  3THY B;  1NK5 A;  3OA9 A;  4AM6 A;  5AQH A;  3ZX3 A;  2VG5 A;  1VSL A;  1LW0 A;  4NLC A;  3P5J A;  3S3M A;  1KQS M;  4FW2 A;  4JK9 A;  3OYK A;  3R6M A;  1E4G T;  2OTJ N;  4DB3 A;  4RW4 A;  4YOT A;  3LDN A;  3MWP A;  3ENH A;  4IEI A;  3KLI A;  2W42 A;  3V9X A;  4CJT A;  1HJO A;  3FZH A;  5FLX O;  5AZJ A;  4I7F A;  1ATS A;  1RTI A;  2P9U B;  1NGJ A;  4H0Y B;  3CME N;  2B6A A;  3THW A;  4JAX A;  3CJA A;  1WUA A;  4CHY A;  1MA9 B;  3KKS A;  3EE9 A;  2HHQ A;  3TSQ A;  4OKE A;  1WOQ A;  4CE9 A;  4M3U A;  4JI2 K;  4Y1C A;  4H0P A;  4JKG A;  2HBM A;  4BRL A;  1RT4 A;  3V9S A;  2FF3 B;  3L4Q A;  2PBD A;  3JS6 A;  3KTQ A;  2D0A A;  2F9W A;  5AQY A;  4CJL A;  4E7I A;  2Q97 A;  3A5N C;  1BIU A;  4OPJ A;  4CJV A;  4BG8 A;  2QEX N;  3TTC A;  3WEE B;  4KHS A;  1F21 A;  3RMC A;  3VQ7 A;  2QKK A;  2WON A;  4KTZ A;  3LAL A;  1JXE A;  4CHQ A;  1NGG A;  5KQ8 A;  3WUH A;  2OPS A;  3NE6 A;  3KLG A;  3R3L A;  4I6M A;  4KRE A;  4BVP A;  4LF7 K;  2WUS A;  1SKW A;  4Z4C A;  2XHB A;  4M42 A;  3MEE A;  4BC2 A;  3CQ8 A;  2YNG A;  4Z4E A;  1UA0 A;  4M3T A;  1VQN N;  3KLE A;  3O8M A;  3ATU A;  4LF8 K;  1E3M A;  4GVE A;  3CYM A;  2PFU A;  3HP6 A;  1QSS A;  5AQL A;  4B1Y B;  1VSM A;  3UKU A;  2R7Y A;  1SKR A;  4F3T A;  1ZBF A;  2NRZ A;  3CPW M;  3SJJ A;  1VAZ A;  1M1K O;  1ZBU A;  4DUY K;  4RW7 A;  2O8F B;  1O1W A;  3D2E A;  4MO5 A;  4H4O A;  5AQS A;  2GX9 A;  3J81 O;  1U04 A;  3C6H A;  3DXK A;  2D0P A;  3VQ6 A;  3CCS N;  5AQN A;  1ATR A;  1T3V A;  1VSD A;  1Q7Y O;  3EKS A;  4IJN A;  1C1A A;  5JIC A;  2V7Y A;  3RSE B;  2IGI A;  1XC9 A;  1KVB A;  3SBG A;  2O8B A;  3HI0 A;  3ALY A;  4CGG A;  3HTV A;  1RDD A;  3ZSZ A;  4LF9 K;  4CBX A;  1JLB A;  4FJK A;  2IVP A;  3N4P A;  2F9T A;  4DV4 K;  2QM1 A;  5DMR A;  4DQ8 A;  2HOE A;  4JRQ A;  5FPD A;  4OPA A;  4BR2 A;  3OY9 A;  3BF1 A;  3VPZ A;  1LOT B;  5E41 A;  3SV4 A;  3OYN A;  4C8K A;  1RT7 A;  2J4R A;  3U6F A;  4MDB A;  1W9H A;  4DU4 A;  5GAD P;  2RPI A;  3AO4 A;  1L5U A;  2GUP A;  2CH6 A;  2KFZ A;  2XO7 A;  3VMF B;  3T3F A;  4HCB A;  4K41 A;  4PL7 A;  3OYH A;  4CGJ A;  4FXD A;  3VEN A;  2BAN A;  4OJR A;  3PLA A;  1WBB A;  4FW1 A;  2P9N A;  1GLJ O;  3EL2 A;  5J2Q A;  3V1R A;  3ZX2 A;  1L3V A;  1X1P A;  1X3M A;  3QO9 A;  2HND A;  4CJ5 A;  2IS3 A;  5EOY A;  1TK8 A;  3RMB A;  4AHT A;  4KTQ A;  3M8R A;  5BRF A;  1U45 A;  1YIJ N;  2W40 A;  3IRX A;  4HUG A;  2CGK A;  2F4V K;  1WLJ A;  4DFP A;  1W2B M;  3FFI A;  1S6Q A;  3SCX A;  3NCI A;  1DTQ A;  3DM2 A;  2GV9 A;  1HYS A;  1KAX A;  3LDP A;  1VSE A;  4F4K A;  4IJA A;  4BRD A;  1NOY A;  1EX4 A;  2YHW A;  2P9K B;  4CIE A;  1VQO N;  3DOL A;  4AM7 A;  2UUB K;  4GY2 B;  2G8F A;  5IT9 O;  3IMX A;  3EYZ A;  4ZTF A;  4B3M K;  4BRN A;  4BAC A;  4Z0U A;  4RTF D;  4DF8 A;  1ZYQ A;  4CF9 A;  4IKF A;  1NMN A;  1QVG M;  4BE1 A;  1J53 A;  3HRG A;  3HBT A;  4B3O A;  3SQ2 A;  3ZSW A;  4KHW A;  4J2D A;  3PO5 A;  3PUF A;  1X9J A;  1U4B A;  3O9Q A;  3TI0 A;  3L2Q A;  3SQ4 A;  4B9L A;  1LW2 A;  1TAQ A;  3ITH A;  4H5W A;  1C6V A;  4GVM A;  4JK8 A;  4WE1 A;  1Z25 A;  3P83 D;  3PX6 A;  1ZBH A;  4FM2 A;  1LWF A;  3NF8 A;  2WOM A;  3THY A;  1D5A A;  4DR6 K;  2EHG A;  3VET A;  4YOX A;  5AQX A;  3AVI A;  4M7Y A;  4MQ3 A;  3H3O B;  3M8Q A;  1EXQ A;  2FBY A;  1XMO K;  1V4T A;  1BWF O;  2QXF A;  4BWJ A;  4Z4G A;  5CR4 A;  3LAM A;  2QWQ A;  1HMV A;  2CGJ A;  3MN6 A;  2D1K A;  4G1Q A;  3NGI A;  4KRF A;  4C23 A;  2HNZ A;  2H3G X;  1VSK A;  5BRE A;  3ZLJ A;  4DR1 K;  5KTQ A;  2YCH A;  1RBS A;  2A6A A;  1VQ4 N;  2A3Z A;  2ASO A;  4B9N A;  3E66 A;  4KB1 A;  3MCP A;  1O13 A;  5HL7 L;  2YNF A;  4C8M A;  3LAK A;  5C42 A;  4A5A A;  2NZT A;  3MK6 A;  1REV A;  4FVU A;  2PAV A;  4KHN A;  3H08 A;  1VSI A;  1GLF O;  3O9R A;  4I9Q A;  3ENO A;  2HHW A;  5HRS A;  3NDK A;  3KHY A;  3RR8 A;  3IUC A;  3AVA A;  3WEE A;  4FSV A;  3SBT A;  1DTT A;  3L3U A;  5AZJ B;  1S72 N;  4CHO A;  1SL1 A;  5FRO A;  3DJC A;  4J2E A;  1WSG A;  4BRF A;  4QAG A;  4WFN L;  1TVR A;  3THW B;  3T1Y K;  3IAY A;  3A5M C;  4CEE A;  2QWN A;  1SQK A;  4DTU A;  3CJ1 A;  4DQS A;  4B8A B;  4FK4 A;  3K9J A;  1BG3 A;  2O8C B;  4LY7 A;  2B4J A;  3NF6 A;  3NGZ A;  4JKG B;  4XH5 A;  3TAP A;  3CJ7 A;  3TSU A;  3MEC A;  4DFJ A;  3RMD A;  3FZL A;  1G15 A;  4YDU A;  4Q5V A;  1W0H A;  4C8O A;  5LMU K;  4KBO A;  4LF6 K;  1YXQ A;  2DY4 A;  2O8F A;  2OPQ A;  4CZF A;  1HKC A;  1XMQ K;  1ESV A;  4YFU A;  4RW6 A;  3OS2 A;  4YNQ A;  3SMS A;  2QWP A;  3JXU A;  1NKC A;  4M3Y A;  1RGI A;  1J5O A;  3T69 A;  4FK0 A;  2XY8 A;  4FOI A;  3HL8 A;  4BRQ A;  3CCR N;  3CCL N;  3VA0 A;  4BE0 A;  1KLM A;  1KTQ A;  3FZF A;  3WNF A;  3SMP A;  3RSE A;  3TAB A;  3MMV A;  3GE1 A;  2E6L A;  4CEB A;  4JI5 K;  1IBK K;  4QS8 A;  1DEJ A;  4CEC A;  2A1R A;  1VQK N;  2P9P B;  1ASW A;  4CGD A;  3DLK A;  1KXP A;  3LP0 A;  5TKY A;  3CC2 N;  3A2F A;  4CK1 A;  3OYD A;  4CJ3 A;  3OYE A;  3DLR A;  2FBT A;  3UKU B;  3JSM A;  4L3Q A;  1RDC A;  4CFC A;  2E5L K;  1MU2 A;  3ZT1 A;  3F9K A;  1K9M O;  5AQK A;  2E1Z A;  3HT3 A;  3D2E B;  3KD5 E;  3EKU A;  1L3S A;  4CJW A;  1TYQ B;  3QES A;  2NRW A;  1XUP O;  3D45 A;  1IBL K;  3BP8 A;  1K8A O;  3WXI A;  3L2W A;  3J7Z O;  1HNW K;  1A5X A;  3DXK B;  4JI8 K;  1Q18 A;  4H5R A;  3HJF A;  1B9D A;  4B1X B;  5DM7 L;  1GLB G;  1N8R O;  1TAU A;  4DWI A;  4DU3 A;  4M3R A;  1YF5 L;  3VES A;  3TR8 A;  2NRT A;  2BE2 A;  1Z05 A;  4FWN A;  1RBR A;  4CEA A;  1SKS A;  2UUA K;  4DV3 K;  3D6R A;  1QHA A;  4CHN A;  5HRP A;  4B1U B;  2KKZ A;  2Y1I A;  2AP1 A;  1Q86 O;  1ZBL A;  3K5M A;  4CGI A;  3TAR A;  1GLE G;  4PQU A;  4H03 B;  3CQY A;  3CFP A;  1KSP A;  1DKG D;  3PV8 A;  4KH6 A;  4DV5 K;  2ASM A;  2X6S A;  1W97 L;  3BGR A;  5GAG P;  3ZT4 A;  3VGL A;  1Q8I A;  4WF9 L;  4H0X B;  4CZI A;  4PHT X;  4JNE A;  4DTR A;  3HOT A;  4B9Q A;  2D0C A;  3HPO A;  3O3G A;  4CJQ A;  1IV0 A;  2IDO A;  1TKD A;  1BHL A;  1Q9X A;  3CFO A;  3H6E A;  3OBW A;  4HVJ A;  2HHT A;  4DTO A;  3MX5 A;  2FSN A;  3TAN A;  3S3N A;  2NNW A;  4CD1 A;  2HHV A;  3BDP A;  4JKA A;  2KTQ A;  4EFH A;  3KK3 A;  1XC3 A;  4ELT A;  1SZ2 A;  4BWM A;  3ZT3 A;  4JKH A;  5M1K A;  1HKG A;  4C8L A;  2BUP A;  4FLZ A;  1CZB A;  3OTO K;  3D7E O;  3WNE A;  3LDQ A;  1RIL A;  3L0Q A;  4AHU A;  2YX6 A;  1EQY A;  4LSN A;  4M7X A;  1L3U A;  5M1Q A;  1HUX A;  4JK7 A;  2RF2 A;  5ADX A;  1ZBI A;  3O3H A;  5C25 A;  4FZX C;  4U7B A;  5LJW A;  5BN8 A;  3IKM A;  4JEP A;  1Q82 O;  1JLF A;  1RT3 A;  3TU5 A;  4PKH A;  2HW3 A;  3AA4 A;  5T7B A;  3OYF A;  3THX A;  4TSX A;  4OVL A;  4X64 K;  2HMP A;  2BH1 A;  5TKW A;  3ZSV A;  2VGN A;  3OJU A;  3MED A;  1IKW A;  5AQQ A;  4BRK A;  3AAR A;  1YAG A;  3O9T A;  4ILG B;  1BA0 A;  3NF9 A;  2UUC K;  1VQ6 N;  2F8T A;  3S3O A;  1DT9 A;  2RKI A;  5HOO A;  4RWT A;  3VQA A;  5J1E A;  5FRM A;  1GOA A;  3O3F A;  3LP2 A;  3H45 C;  4H5T A;  4BG9 A;  1OKJ A;  3F5T A;  4E89 A;  1TK5 A;  1NGF A;  3O08 A;  4CJ4 A;  4E1J A;  1NJI O;  1VQ5 N;  1YTA A;  1VRU A;  3AVL A;  1J5E K;  1NU0 A;  5BR8 K;  1X9M A;  2HF3 A;  4M63 C;  3HST B;  4Z94 A;  2V51 B;  3LM9 A;  3SI6 A;  3H3N O;  4YOR A;  3THV A;  4O8K A;  4DTS A;  3CCU N;  2ATQ A;  5KPR A;  4JN4 A;  1QE1 A;  1RDU A;  4JV5 K;  2HHU A;  2XY5 A;  1HJR A;  1E4F T;  2KQ2 A;  5GIP A;  1VRT A;  3QNN A;  4JHD B;  3HZ6 A;  3OHR A;  3VEW A;  1XWL A;  3VQQ A;  2FF6 A;  1UOC A;  4DLE A;  3O1B A;  4CJP A;  3BF3 A;  1BA1 A;  5CYM A;  4L8R B;  2ZQB A;  3AVB A;  3QIN A;  4OGE A;  3HXM A;  4O44 A;  1UWB A;  5EU7 A;  3QEW A;  2P5O A;  1KC8 O;  2YNI A;  3RR7 A;  1C0F A;  2GWK A;  1S3X A;  2ZD1 A;  3NF7 A;  1R0A A;  4E3S A;  4IOA L;  3PSF A;  2O8C A;  4BC3 A;  1YTU A;  3R8E A;  1P90 A;  3DLL L;  4OPK A;  1NGD A;  4CHZ A;  4WCE L;  3TAQ A;  1NGI A;  4CF0 A;  3TTF A;  1Z6R A;  3EE8 A;  5DK5 A;  1RDB A;  4B9V A;  3ATV A;  1J54 A;  1TUY A;  4FZY A;  3G6E N;  4DSJ A;  2HST A;  2XY6 A;  2PYL A;  1I39 A;  3I55 N;  4YOV A;  1N36 K;  4FO0 A;  3AVF A;  2B5J A;  3UIQ A;  2GBZ A;  2O4I A;  2GUI A;  4JKB A;  3KIO A;  3LPU A;  3HSC A;  3ZEU A;  1NK9 A;  1S1V A;  1RCH A;  5E84 A;  2QTD A;  5F1X A;  1TGO A;  4KFB A;  1JLQ A;  4IG3 A;  2E2O A;  4DS4 A;  2UXD K;  5JVG L;  3BY5 A;  3KD1 E;  5LJV A;  3G0Z A;  3ISN C;  3V9W A;  2Z1H A;  5C12 A;  1JKH A;  4DQP A;  4CJF A;  2P9P A;  3ID6 A;  1IH7 A;  4AIL C;  4R79 A;  3NH0 A;  1QHT A;  2JGU A;  3JYT A;  4ZTJ A;  1X9W A;  1WSE A;  3K57 A;  3VER A;  2DPN A;  4AF1 A;  3CET A;  1EET A;  3QIO A;  4PL8 A;  4NXN K;  3DRS A;  3HP9 A;  3O1W A;  1TYQ A;  3ZSY A;  1YT3 A;  3NVM A;  2XY7 A;  1BQN A;  4DCH A;  5AQV A;  3ZSX A;  1GLL O;  4CED A;  4CJR A;  4B3S K;  3CPE A;  3SK3 A;  2Z1J A;  4I9L A;  4K43 A;  4DFM A;  1NK4 A;  1CZ9 A;  1K73 O;  5M1P A;  5AQJ A;  3VEV A;  1JCG A;  1YJ9 N;  3VQE A;  3RRH A;  4BE2 A;  3AO1 A;  4BRM A;  3MXM A;  4CJU A;  2JWL A;  3VF2 A;  3H1V X;  5HLF A;  4JI7 K;  3MWT A;  2FBV A;  5AQZ A;  2FC0 A;  1FKP A;  1HPM A;  3QFP A;  2HHH K;  2Q3S A;  1FK9 A;  5E26 A;  4F9O A;  1WAF A;  5KQD A;  5MLC Q;  1QTM A;  1RBT A;  4JI1 K;  4HCC A;  3J80 O;  4NCB A;  1QSL A;  3L4I A;  3M8P A;  3DLB A;  4CFA A;  1RNH A;  2UXC K;  4B1W B;  2DTU A;  1ITG A;  4MDA A;  1HNX K;  1N34 K;  4B9T A;  2XRI A;  1TK0 A;  5JMV A;  2E2N A;  2IOC A;  2G8W A;  4DR2 K;  1UA1 A;  3VF4 A;  3CHW A;  4W5N A;  4GV9 A;  3H46 O;  3MDQ A;  4EP4 A;  3P1G A;  4CIF A;  4BGA A;  1U48 A;  2HBL A;  1IKV A;  1NJY A;  1VQ8 N;  4BRH A;  3MXJ A;  4H0O A;  3P39 A;  4UQG A;  3KK1 A;  2P51 A;  4FLV A;  4NXM K;  4CHP A;  4O4G A;  3ENB A;  2ZGY A;  1HQU A;  2QXL A;  4W5Q A;  3WXM B;  1ZXO A;  1UAX A;  1Y64 A;  2YJF A;  4IFY A;  2G8K A;  5FPN A;  3T7Z A;  1NWK A;  4EIA A;  4NO7 A;  5F2R A;  4X65 K;  3C0B A;  4GMJ B;  3CQX A;  4Z4F A;  4LC9 B;  3LWL A;  3DRP A;  2GWJ A;  5JVH L;  1S1U A;  3VQP A;  1S1W A;  1HKB A;  1NBW A;  3QFU A;  3O4N A;  3UKR A;  1YJN N;  3AA2 A;  1Y97 A;  3AVN A;  5M1O A;  4XEI A;  1IG9 A;  5AZI A;  1BOT O;  4CBU A;  2OPP A;  4CJK A;  4KH5 A;  2VQE K;  2VWB A;  4BC4 A;  4AHV A;  2F96 A;  3A0I X;  4CEQ A;  4ELV A;  3B6P A;  1OVQ A;  4FJM A;  3QBW A;  2VWJ A;  4DV2 K;  4WQ5 C;  4NB4 A;  3WNH A;  1WSJ A;  3THX B;  2VWK A;  2HHX A;  1CXQ A;  1K8K A;  2JLE A;  3SUP A;  1YHQ N;  4HTL A;  4JHD A;  1S1X A;  4EP5 A;  3KZB A;  5JS1 A;  3P38 A;  4E7H A;  3HK2 A;  2KZZ A;  3M5R A;  5CZ2 A;  3F2K A;  3G10 A;  3SUO A;  1IO2 A;  1EKE A;  1CXU A;  1RT1 A;  4O55 A;  4BC5 A;  3I56 N;  3VQD A;  3LP3 A;  1KCF A;  3DWL A;  3I0S A;  4A5B A;  1N33 K;  4B1V A;  2PYJ A;  5KRT A;  5KI6 A;  3V1O A;  4FLY A;  1LAV A;  3LZI A;  1WSI A;  3E9O A;  3P4I A;  4NCG A;  1VQ9 N;  1D8Y A;  5HRR A;  3DI6 A;  1SV5 A;  4Y1D A;  4V19 S;  4Z4H A;  5BR9 A;  3CC7 N;  1YVU A;  4IDK A;  2WC9 A;  2O8D B;  1JCE A;  3HPH A;  3N4Q A;  1CZA N;  3RTV A;  3AVC A;  1TUU A;  2VYP A;  4DLG A;  1ZBS A;  1V4S A;  3B8A X;  1GLC G;  2IVN A;  4PA1 A;  2HNY A;  3A5L C;  1KFS A;  3DLE A;  3LWM A;  2YJE A;  3DMJ A;  4FOE A;  2P9I A;  4J2A A;  4O5F A;  5AQO A;  4PY5 A;  1VSF A;  4DSE A;  1HRH A;  4W5T A;  1S5J A;  2E20 A;  5EY4 A;  3WT0 A;  1TL3 A;  3VGK A;  1IG8 A;  1T6C A;  3SAF A;  2QWM A;  1J6Z A;  3L2R A;  1QS4 A;  3ZCM A;  3LM2 A;  4CEO A;  5BPN A;  3RMA A;  3OJS A;  3EO3 A;  3QER A;  3ZET B;  2FSJ A;  1RBU A;  1QZ5 A;  2X78 A;  1LAW A;  2ZJR L;  3ZEU B;  3J7A P;  5CYQ A;  4C1N I;  4FWQ A;  3V4I A;  4FJ5 A;  3G25 A;  1WBD A;  4O0J A;  3U3G A;  4EZ6 A;  4F3O A;  4FWP A;  3NHG A;  1HYV A;  2GTD A;  2QA4 N;  4K25 A;  5C15 A;  4DV7 K;  3L2V A;  2BDP A;  4Y0W A;  3VTH A;  3C7N B;  4A2A A;  1JLC A;  2QWL A;  5F0X A;  1M90 O;  3SLC A;  1RTJ A;  1SUQ A;  4H0V B;  3CM5 A;  3K5O A;  4FJX A;  4FPB A;  2IAJ A;  2FLO A;  2HMI A;  3C65 A;  5M1N A;  2OZS A;  3RVC A;  4AH9 A;  4DQQ A;  4A57 A;  2HVH A;  4DTM A;  1EO1 A;  5LMN K;  4DV1 K;  3AO3 A;  4FLU A;  3KLF A;  4LH5 A;  4CCH A;  3BEX A;  4CEZ A;  1T44 A;  2JWK A;  4DUZ K;  1D4X A;  4NYF A;  2VCP A;  3SPZ A;  2V7Z A;  5LY3 A;  1IJJ A;  4WQ4 C;  3OYL A;  4FJJ A;  5KPZ A;  3VQ5 A;  5AFU H;  3EZ5 A;  4GKJ K;  3M8S A;  1BGX T;  3T1H K;  4QS7 A;  1I94 K;  3NH1 A;  1MWK A;  2FBX A;  3QIP A;  5AQU A;  5K14 A;  3KK7 A;  5BPL A;  3FZK A;  2G8V A;  2I5J A;  3LZJ A;  3CER A;  3WQU A;  4A61 A;  4ZHR A;  3OBY A;  4DU1 A;  3AAP A;  3CJC A;  5SWM A;  5LL6 Z;  4CD3 A;  5BRD A;  3KWG A;  3LP1 A;  1BL3 A;  1YVN A;  3K2P A;  3O9S A;  4FJ8 A;  4BR5 A;  2YNH A;  4FJ9 A;  4ISF A;  5AQM A;  3O4Q A;  1C0G A;  3HVT A;  4KV8 A;  3K5L A;  2A1S A;  3F73 A;  1J9A A;  1JJ2 M;  3S41 A;  2ITG A;  4JKC A;  5FPE A;  4BY9 C;  4KO0 A;  2UU9 K;  1VQ7 N;  4BVO A;  4F2S A;  4M3W A;  2EWS A;  2KFN A;  4J8F A;  1RDW X;  2UYT A;  3UB5 A;  1QZ6 A;  3KK2 A;  4FLX A;  1DGK N;  1KVC A;  3LDS A;  2PY5 A;  4JKF A;  3P31 A;  2BGG A;  1BO5 O;  4PKG A;  1S9G A;  3NBP A;  4UY8 O;  4C1N K;  4CER A;  3SQ1 A;  4HHT A;  3CD6 N;  1BQM A;  2ASP A;  3MXI A;  2YKM A;  2QI2 A;  3Q7C A;  2OAN A;  3K9K A;  4JI6 K;  4JI3 K;  1OVY A;  3A5O C;  4WFA L;  3O6W A;  2D5R A;  2HBK A;  1A5W A;  1RT2 A;  4M3X A;  3J7Y P;  4FK2 A;  3DYA A;  1NJW A;  3A8Y A;  4IOX A;  4K8Z A;  2VQF K;  1RTH A;  4DV6 K;  4I2P A;  2P1J A;  4B3R K;  1T6D A;  4U67 L;  4OKK A;  3OVN A;  4OGC A;  2I7N A;  1TL1 A;  3U3Y A;  4DSF A;  4HUE A;  2ZWH A;  2NRX A;  3SV3 A;  1S9E A;  3UKR B;  5C0Y A;  3K5N A;  4CK3 A;  1JLG A;  3EZW A;  4BRO A;  3EN9 A;  4FM0 A;  1KAZ A;  5AZI B;  5JLH A;  3QEI A;  4JI4 K;  3QBX A;  3VEY A;  4DTJ A;  4LF5 K;  1HNI A;  5C10 A;  4M45 A;  4DMN A;  5AQT A;  1BI4 A;  1QQM A;  2E1Y A;  4B3T K;  5I3U A;  4BDP A;  3OYJ A;  5DM6 L;  2NLX A;  4KTW A;  2OA8 A;  1BCO A;  2RN2 A;  1NGC A;  3W0L A;  4X66 K;  3SUQ A;  2OZM A;  4JI0 K;  2G8I A;  5B8H A;  4LF4 K;  2FSK A;  3FGU A;  4BGB A;  4N41 A;  3IFR A;  1K8K B;  3AVK A;  3C6T A;  4DKW A;  2O8D A;  2G8U A;  4CW7 B;  3CFR A;  3WXL A;  1VQL N;  3FZM A;  3ZX0 A;  4JD2 A;  4OX9 K;  4DTP A;  2NRV A;  4JRP A;  4O0I A;  2A41 A;  4CVN E;  4FJH A;  1BUP A;  5EVZ A;  4HWI A;  3CCQ N;  4E7K A;  4E1N A;  4ELU A;  3C94 A;  4OKJ A;  3IDH A;  1HQE A;  4BRE A;  4DSL A;  1RT6 A;  1KD1 O;  2X6N A;  5J2M A;  5AQP A;  1DLO A;  3GL1 A;  4CGH A;  3IS9 A;  3ZSO A;  5GAE P;  1X3N A;  4FWR A;  1NLV A;  4X62 K;  4E19 A;  4DSI A;  4MO4 A;  4KH4 A;  3HOS A;  2X74 A;  2YHA A;  4RW8 A;  3MAQ A;  1HNZ K;  3I8D A;  1A5V A;  2A42 A;  3D0P A;  1FJG K;  3AA3 A;  3ZET A;  2V52 B;  3ULE B;  3U4L A;  3SYZ A;  3PX0 A;  3I8B A;  1U2V B;  3CXC M;  3H1Q A;  1NKB A;  4ID5 A;  3OW2 M;  4LD0 A;  2RE2 A;  1GOC A;  3AO5 A;  4DQI A;  3AO2 A;  3GBT A;  5I42 A;  2A40 A;  1XHX A;  4EAH D;  3QIC A;  3K59 A;  1T05 A;  4FJG A;  2P9I B;  4CBW A;  5HBM A;  5C2D A;  3C7N A;  1JL2 A;  3B6O A;  3M1F A;  1JL1 A;  4LFB K;  4N76 A;  3T19 A;  1N5Y A;  2IIR A;  3OYI A;  1Q9Y A;  5KGW A;  1SL2 A;  4PWD A;  3OYC A;  1WAJ A;  4KHP K;  1IKX A;  4DHY A;  3DAW A;  3VF6 A;  4LSL A;  1BDG A;  1NGA A;  3EEQ A;  2QW9 A;  5JS2 A;  1CLQ A;  1SAZ A;  3RWU A;  3VA3 A;  5H1S Q;  3AY9 A;  2Y1J A;  2BTF A;  3QLH A;  3QEX A;  3QEP A;  3OS1 A;  3V81 A;  3MEG A;  4JLH A;  3FFK B;  4N56 A;  1RDA A;  1ASV A;  3HVR A;  4XH4 A;  3MN7 A;  3CCJ N;  2E88 A;  1RBV A;  4F2R A;  4BRA A;  2WFB A;  3DXM A;  1GLD G;  4B9S A;  3TTD A;  3CF5 L;  3CCV N;  1LCU A;  1MWM A;  3VEO A;  1KFD A;  5CZ1 A;  4B9M A;  2CH5 A;  4NLB A;  1NNE A;  4XH1 A;  4H8K A;  3SJH A;  3AA5 X;  2CGL A;  2P5G A;  4N47 A;  4ID1 A;  4A62 A;  3VTI A;  3V9Z A;  5HRO A;  3WXK A;  1WSF A;  4BDZ A;  1OH5 A;  3DOK A;  3PX4 A;  3LDL A;  1JXB A;  3PSI A;  2O8E B;  1C0U A;  5JLF A;  3W3D A;  4CES A;  2HHS A;  2D0B A;  1G99 A;  5EX5 A;  1D9D A;  3NFA A;  3C6U A;  2Q0R A;  4W5O A;  4K0K K;  1XQS C;  4O5B A;  1H1V A;  3CI5 A;  1VSH A;  4BR9 A;  3AAQ A;  3SQ0 A;  4KB0 A;  3NMU A;  3AVG A;  1ILY A;  1NK6 A;  3E9P A;  3TAE A;  5AQR A;  3CJ9 A;  4BQZ A;  5KPT A;  4DG1 A;  4DR4 K;  4DR3 K;  4WQ5 A;  1NJX A;  2OTL N;  2Q1N A;  1EP4 A;  4QOZ B;  3AVJ A;  2D4W A;  3SAH A;  3TAG A;  2P9S B;  3FR0 A;  4YHH K;  2ZJQ L;  1HPZ A;  2E2P A;  1KVA A;  3D2F A;  5GIN A;  2PZS A;  3ZSR A;  3NAE A;  2LSN A;  4YOU A;  2WTU A;  4E7J A;  4FYD A;  3S9H A;  1LV5 A;  4FWK A;  3JAM O;  1TKT A;  2G8H A;  1C0M A;  4BDY A;  2A5X A;  4FWL A;  3VEX A;  1EWR A;  3V1Q A;  4IBN A;  4DTX A;  1U49 A;  3MCA B;  5HRN A;  4RCH A;  5I9E B;  2UXB K;  3VQ8 A;  4E0D A;  4PUO A;  4W5R A;  2KW4 A;  2F7T A;  1IBM K;  3OS0 A;  2KLA A;  3NH2 A;  2DFE A;  4ISE A;  3WXJ A;  1YI2 N;  3CM6 A;  4IOC L;  4LFA K;  4Z4I A;  4CZM A;  3V6D A;  3U9Z A;  2HVI A;  2AJQ A;  4FWS A;  4N5S A;  3QEV A;  4M41 A;  3AV9 A;  4IXC A;  3QNO A;  2E2Q A;  3CIP A;  1X9S A;  1TV6 A;  1GLA G;  1NOZ A;  2WBN A;  5CE3 A;  1ZC6 A;  4A2B A;  4GKK K;  3R1X A;  2YV0 X;  4DR7 K;  3ULD A;  3IG1 A;  2GEM A;  3G71 N;  5FDL A;  4XIU A;  2Q31 A;  3E1Y A;  2HB5 A;  1OH7 A;  2ITM A;  2P9L A;  3O9U A;  3DLG A;  3U9D A;  4NYN A;  3BUZ B;  1QQN A;  3M3Z A;  2QKB A;  2ZJP L;  3Q7B A;  4H0T B;  4PKI A;  3BZC A;  5GIO A;  1ASU A;  3MN9 A;  3AGK A;  3C6A A;  4CGF A;  3OYB A;  3L6Q A;  2DFF A;  3LAN A;  5EXW A;  1BI4 B;  1NGB A;  1RT5 A;  4F8R A;  1S22 A;  1HYZ A;  2HF4 A;  4EHT A;  3AGR A;  3UE5 A;  3SZ2 A;  2QWO A;  5AR0 A;  1XNR K;  1LWC A;  2KHO A;  1R59 O;  3CC4 N;  3WQT A;  4A59 A;  3SUN A;  1NGH A;  4GV6 A;  4ICL A;  2P9U A;  1S6P A;  1YJW N;  4IFE A;  3K0S A;  4O8U A;  4IO8 A;  4YOY A;  1NMD A;  5AQF A;  4CF1 A;  1NJZ A;  4BR7 A;  4CK2 A;  5AQG A;  1C1C A;  5D3G A;  4CJS A;  5HP1 A;  1WN7 A;  3QDK A;  4K8X A;  3KWI A;  4CJE A;  1VQP N;  5M1F A;  1FW6 A;  4MLH A;  2YHX A;  1SS6 A;  4IG0 A;  4JD2 B;  3ULE A;  4E7L A;  1T7P A;  1HLU A;  4IZ9 A;  2VG7 A;  4E1M A;  1U2V A;  3K58 A;  4OLB A;  4CZJ A;  5KGX A;  3PY8 A;  1QVF M;  4RW9 A;  4KHY A;  1NK8 A;  3VN5 A;  3OYM A;  4CEF A;  5J2N A;  3ASM A;  4LH4 A;  4CFD A;  1NK7 A;  2ETJ A;  1HR0 K;  1BCM A;  4H5N A;  3LL3 A;  1C1B A;  2YKN A;  2Q2R A;  2D0O A;  3O80 A;  1NG9 A;  4DR5 K;  4WQ4 A;  3ZSQ A;  3VGM A;  4IO9 L;  4BRC A;  4CZH A;  2W6L A;  4KHU A;  1K6Y A;  4MFB A;  4DF4 A;  5J2P A;  3ZT0 A;  1QQO A;  3CCE N;  4YY3 K;  2Q36 A;  1JLA A;  3BZK A;  2O4G A;  3TPQ A;  4KI6 A;  3C95 A;  1QSY A;  1QQC A;  3WNG A;  3EY1 A;  4OO1 J;  4RG8 A;  4HTU A;  1B9F A;  2W6K A;  2ZE2 A;  5C2F A;  4IDH A;  1P8Z A;  1B92 A;  4LFC K;  3CG7 A;  3VQB A;  4ILJ A;  4IWV A;  4I2Q A;  4OLA A;  1HNV A;  3QB0 A;  2GEL A;  4QS9 A;  4KAZ A;  3L2U A;  3O5B A;  2YHY A;  1T8E A;  1KAY A;  5CY4 A;  1S1T A;  4FLW A;  4I6M B;  4JS4 A;  3GG4 A;  4K42 A;  3NVK A;  4BR4 A;  2NRH A;  5ADX H;  4CIG A;  3HM9 A;  3I33 A;  5AJ3 K;  2O8E A;  2NRR A;  4KKO A;  1ATN A;  3ID8 A;  2Z1I A;  4FVM A;  4FJI A;  1HX1 A;  2AA4 A;  4AHS A;  3G4S N;  5C24 A;  3FE1 A;  4GNI A;  3T1A A;  1N32 K;  4BR0 A;  4FWO A;  1EWQ A;  5BRH A;  4CJ7 A;  2E8A A;  4IFV A;  5KRS A;  4H4M A;  3MX2 A;  4DS5 A;  4FCY A;  3DXM B;  3PO4 A;  4DTN A;  2HBJ A;  1Z26 A;  3AVH A;  1WB9 A;  3MN5 A;  2QWR A;  4G9Z A;  4CFB A;  3DLH A;  1KLN A;  1XHZ A;  5ELZ A;  3E01 A;  3VQC A;  1NGE A;  4WFB L;  2P9S A;  4B9U A;  1YUW A;  2EX3 A;  5SZT A;  4GV3 A;  3QET A;  2YHB A;  3NGY A;  1FXX A;  1WNS A;  4FM1 A;  3SPY A;  5GAH P;  2IVO A;  4R5P A;  2DFH A;  3J8A A;  3GDQ A;  4ISG A;  2O8B B;  3HPG A;  5CHI A;  4FLT A;  1LWE A;  3VQ9 A;  4B1Z A;  4YDU C;  4CZL A;  5A2Q O;  4DSK A;  1WSH A;  5IWA K;  4ILH A;  4WYB A;  4C8N A;  5AQI A;  5BN9 A;  3OYG A;  4B08 A;  4AHR A;  4IEE A;  4FWM A;  3R9P A;  3L3V A;  4J2B A;  3ZYY X;  3PIP L;  3U8X A;  1KRP A;  4AHC A;  4FJL A;  1C0T A;  3QML A;  2E4L A;  2YI1 A;  5FRN A;  2ZM6 K;  4QCL A;  1JCF A;  1BIS A;  2OPR A;  1FKO A;  4MLE A;  3V9U A;  3GOI A;  4DQR A;  4JYA K;  2OCE A;  3TWH A;  2P9K A;  1TKX A;  3D2F B;  3O4W A;  4KPY A;  1L3T A;  4BQL A;  3VEZ A;  3VOV A;  3VQ4 A;  3SAG A;  4DV0 K;  1U6Z A;  1Q81 O;  1N6Q A;  2QK9 A;  4FL9 A;  2E6M A;  1OH8 A;  3E9L A;  3KKR A;  1T03 A;  2P9N B;  1MDU B;  3TSP A;  3HO1 A;  3SNN A;  4KI4 A;  2ZF5 O;  1VHX A;  3TAM A;  3M6G A;  4CZE A;  1XI1 A;  1GOB A;  1YIT N;  5FPM A;  1XNQ K;  4CI6 A;  4FPA A;  2F8S A;  2IC3 A;  2Z1G A;  1NKE A;  4JKE A;  4CF2 A;  3TAF A;  1NK0 A;  3CCM N;  4GW6 A;  1BIZ A;  1NM1 A;  3RRG A;  4EZ9 A;  4FJ7 A;  1U47 A;  2RHK A;  2OYQ A;  4H5V A;  1BU6 O;  1D9F A;  1W7A A;  3HM8 A;  1OH6 A;  2VGM A;  4EHU A;  4FZZ A;  1TKZ A;  2FXU A;  4NCA A;  2Q0U A;  3ZT2 A;  2W41 A;  4BRG A;  2NUB A;  4JKD A;  4FJN A;  4KHQ A;  1SL0 A;  5AQW A;  4BRP A;  4JS5 A;  1RTD A;  3CMA N;  3F9M A;  1RFQ A;  2I7P A;  1JLE A;  4BRI A;  4CZG A;  3LDO A;  3CJB A;  4CF8 A;  3I0R A;  1VQM N;  4Q0B A;  5AFU A;  2KZM A;  3AVM A;  5BPM A;  4CZK A;  4B8C A;  3HYF A; 
#chains in the Genus database with same CATH homology
 1VK0 A;  4CJW A;  3L8B A;  2P5G A;  4N47 A;  2KZZ A;  3KLH A;  1S1X A;  4ID1 A;  4EP5 A;  3QES A;  3D45 A;  5JS1 A;  3HK2 A;  3V9Z A;  4E7H A;  2VG6 A;  3OYA A;  5HRO A;  1I3A A;  1IKY A;  1WSF A;  3DRR A;  5CZ2 A;  3KJV A;  3L2W A;  4BDZ A;  3G10 A;  1A5X A;  3DOK A;  3SUO A;  1L3S A;  3PX4 A;  1IO2 A;  1EKE A;  1JXB A;  1CXU A;  1B9D A;  1RT1 A;  4O55 A;  4HUF A;  1C0U A;  3HJF A;  1TAU A;  4M3Z A;  1VSJ A;  3LPT A;  4DWI A;  3VQD A;  4CES A;  2HHS A;  4DU3 A;  4DFK A;  3LP3 A;  2D0B A;  4M3R A;  1NK5 A;  3TR8 A;  1KCF A;  3NFA A;  1D9D A;  3I0S A;  3C6U A;  2BE2 A;  4CEA A;  1SKS A;  1RBR A;  4W5O A;  2VG5 A;  4O5B A;  2PYJ A;  5KRT A;  1VSL A;  1LW0 A;  1VSH A;  3P5J A;  5KI6 A;  3SQ0 A;  4KB0 A;  3AVG A;  4CHN A;  5HRP A;  1NK6 A;  3V1O A;  4FLY A;  3TAE A;  2Y1I A;  3S3M A;  4FW2 A;  1LAV A;  3OYK A;  3LZI A;  1WSI A;  4DG1 A;  4RW4 A;  4NCG A;  1ZBL A;  3K5M A;  4CGI A;  1NJX A;  1D8Y A;  1EP4 A;  3KLI A;  2W42 A;  3V9X A;  4QOZ B;  5HRR A;  4CJT A;  3AVJ A;  3DI6 A;  3TAR A;  1SV5 A;  4Y1D A;  4PQU A;  3TAG A;  4Z4H A;  4I7F A;  1YVU A;  4IDK A;  1RTI A;  3CFP A;  3HPH A;  1KSP A;  3PV8 A;  2B6A A;  2X6S A;  3RTV A;  1HPZ A;  4CHY A;  1KVA A;  3AVC A;  3BGR A;  4DLG A;  2PZS A;  3ZSR A;  3ZT4 A;  3KKS A;  3NAE A;  2LSN A;  1Q8I A;  2HHQ A;  4DTR A;  4E7J A;  4OKE A;  2D0C A;  3HPO A;  4FYD A;  4CE9 A;  3S9H A;  4M3U A;  3O3G A;  4PA1 A;  4Y1C A;  1LV5 A;  4CJQ A;  2HNY A;  2IDO A;  1KFS A;  1TKD A;  1BHL A;  1TKT A;  3DLE A;  2G8H A;  1Q9X A;  1C0M A;  1RT4 A;  4BDY A;  3CFO A;  3LWM A;  3V9S A;  3V1Q A;  3DMJ A;  4IBN A;  4DTX A;  1U49 A;  4J2A A;  4HVJ A;  2D0A A;  4CJL A;  4E7I A;  4DTO A;  3KTQ A;  2HHT A;  5HRN A;  3VQ8 A;  1VSF A;  4OPJ A;  1BIU A;  4DSE A;  3TAN A;  1HRH A;  3S3N A;  4W5T A;  4E0D A;  4PUO A;  4PY5 A;  1S5J A;  3BDP A;  2HHV A;  4W5R A;  2KTQ A;  2KW4 A;  4CJV A;  1TL3 A;  3KK3 A;  3OS0 A;  4ELT A;  4KHS A;  1F21 A;  3NH2 A;  3RMC A;  4BWM A;  3VQ7 A;  2DFE A;  3ZT3 A;  2QKK A;  2WON A;  4KTZ A;  4C8L A;  3LAL A;  1JXE A;  4CHQ A;  4FLZ A;  1CZB A;  3L2R A;  3CM6 A;  1QS4 A;  3ZCM A;  2OPS A;  3WNE A;  1RIL A;  4AHU A;  4CEO A;  3NE6 A;  3KLG A;  3RMA A;  4Z4I A;  4KRE A;  3OJS A;  3V6D A;  3QER A;  2HVI A;  1RBU A;  2X78 A;  4LSN A;  2AJQ A;  1LAW A;  1L3U A;  4N5S A;  3QEV A;  1SKW A;  4M41 A;  4Z4C A;  3AV9 A;  3QNO A;  2RF2 A;  1ZBI A;  3O3H A;  2XHB A;  5CYQ A;  5C25 A;  3MEE A;  4FZX C;  3CQ8 A;  4M42 A;  1X9S A;  1TV6 A;  2YNG A;  4Z4E A;  1NOZ A;  1UA0 A;  4M3T A;  3KLE A;  3V4I A;  4FJ5 A;  1JLF A;  3CYM A;  1RT3 A;  4O0J A;  3U3G A;  4EZ6 A;  4F3O A;  3HP6 A;  1QSS A;  2HW3 A;  3AA4 A;  5T7B A;  3OYF A;  3NHG A;  1VSM A;  4TSX A;  1HYV A;  4OVL A;  2R7Y A;  1SKR A;  4F3T A;  3L2V A;  2BDP A;  2YV0 X;  1ZBF A;  3ZSV A;  3OJU A;  3SJJ A;  1JLC A;  3MED A;  3ULD A;  1IKW A;  1ZBU A;  3IG1 A;  4RW7 A;  5FDL A;  1O1W A;  3NF9 A;  4XIU A;  1RTJ A;  4H4O A;  2HB5 A;  3S3O A;  1SUQ A;  2F8T A;  3DLG A;  3CM5 A;  3K5O A;  4NYN A;  4FJX A;  2RKI A;  2IAJ A;  2HMI A;  2OZS A;  4AH9 A;  1U04 A;  3VQA A;  4DQQ A;  2HVH A;  5J1E A;  5FRM A;  2QKB A;  3VQ6 A;  4DTM A;  1GOA A;  3O3F A;  3LP2 A;  1VSD A;  3AO3 A;  4FLU A;  4E89 A;  4LH5 A;  3KLF A;  1TK5 A;  4CCH A;  1ASU A;  4CEZ A;  1C1A A;  4CJ4 A;  2IGI A;  1YTA A;  1VRU A;  3AVL A;  4CGF A;  3OYB A;  1XC9 A;  1KVB A;  1X9M A;  2DFF A;  3ALY A;  3LAN A;  3HST B;  4CGG A;  1BI4 B;  3SI6 A;  4NYF A;  1RT5 A;  3THV A;  4F8R A;  3SPZ A;  1RDD A;  4DTS A;  2ATQ A;  3ZSZ A;  4FJJ A;  3OYL A;  1HYZ A;  1JLB A;  3VQ5 A;  3SZ2 A;  1QE1 A;  4FJK A;  1LWC A;  5DMR A;  3EZ5 A;  3M8S A;  2HHU A;  4JRQ A;  2XY5 A;  3SUN A;  1HJR A;  1BGX T;  4ICL A;  3OY9 A;  1S6P A;  5E41 A;  3SV4 A;  2KQ2 A;  3QNN A;  1VRT A;  3OYN A;  3NH1 A;  4C8K A;  2FBX A;  4CF1 A;  1NJZ A;  3QIP A;  4CK2 A;  1XWL A;  3VQQ A;  1C1C A;  5K14 A;  1UOC A;  4DLE A;  2G8V A;  5D3G A;  1RT7 A;  2I5J A;  1WN7 A;  4CJS A;  4CJP A;  3LZJ A;  3U6F A;  5HP1 A;  1W9H A;  4K8X A;  5CYM A;  4DU4 A;  4L8R B;  2ZQB A;  3AVB A;  3QIN A;  4OGE A;  4CJE A;  4O44 A;  2RPI A;  1UWB A;  3AO4 A;  5EU7 A;  3HXM A;  4DU1 A;  3QEW A;  1L5U A;  5SWM A;  2P5O A;  2YNI A;  2KFZ A;  2XO7 A;  3T3F A;  3RR7 A;  4HCB A;  4IG0 A;  2ZD1 A;  3LP1 A;  3NF7 A;  4E7L A;  1R0A A;  1BL3 A;  1T7P A;  3K2P A;  3OYH A;  4E3S A;  2VG7 A;  4CGJ A;  4E1M A;  4FJ8 A;  4FXD A;  3K58 A;  4OLB A;  2BAN A;  2YNH A;  4OJR A;  5KGX A;  3PY8 A;  4FJ9 A;  1YTU A;  4FW1 A;  3O4Q A;  3HVT A;  4KV8 A;  4OPK A;  2A1S A;  4RW9 A;  1J9A A;  3K5L A;  3F73 A;  5J2Q A;  1NK8 A;  3V1R A;  3VN5 A;  4CEF A;  3OYM A;  5J2N A;  4KHY A;  2ITG A;  3ASM A;  4LH4 A;  4CHZ A;  4CFD A;  3TAQ A;  1X1P A;  1NK7 A;  1L3V A;  3QO9 A;  2ETJ A;  4KO0 A;  2HND A;  4CJ5 A;  2IS3 A;  1BCM A;  1TK8 A;  3RMB A;  4CF0 A;  5DK5 A;  4AHT A;  4KTQ A;  1RDB A;  3M8R A;  4B9V A;  1J54 A;  1C1B A;  2YKN A;  1U45 A;  4F2S A;  4M3W A;  2KFN A;  3IRX A;  4HUG A;  4B8C A;  4FZY A;  1WLJ A;  4DFP A;  4DSJ A;  3ZSQ A;  3KK2 A;  4FLX A;  2XY6 A;  1I39 A;  1KVC A;  3FFI A;  3LDS A;  1S6Q A;  2PYL A;  2PY5 A;  4KHU A;  1K6Y A;  3SCX A;  2BGG A;  3NCI A;  1DTQ A;  2B5J A;  3AVF A;  3DM2 A;  4MFB A;  3UIQ A;  2GBZ A;  2GV9 A;  1HYS A;  2O4I A;  1S9G A;  2GUI A;  4DF4 A;  3NBP A;  5J2P A;  1VSE A;  3KIO A;  3LPU A;  3ZT0 A;  4F4K A;  4CER A;  1JLA A;  4HHT A;  3SQ1 A;  2O4G A;  1NK9 A;  1S1V A;  1BQM A;  1RCH A;  1EX4 A;  1NOY A;  4KI6 A;  1TGO A;  4KFB A;  3C95 A;  3MXI A;  2YKM A;  1QQC A;  1JLQ A;  1QSY A;  3WNG A;  3EY1 A;  4CIE A;  4IG3 A;  3DOL A;  4DS4 A;  3KD1 E;  2G8F A;  4RG8 A;  4HTU A;  1B9F A;  3EYZ A;  2ZE2 A;  3G0Z A;  4ZTF A;  3ISN C;  3V9W A;  2Z1H A;  2D5R A;  1JKH A;  4Z0U A;  4BAC A;  1A5W A;  1RT2 A;  4DQP A;  4M3X A;  4DF8 A;  4CJF A;  1ZYQ A;  3DYA A;  1NJW A;  4CF9 A;  4FK2 A;  4IKF A;  4K8Z A;  1B92 A;  1RTH A;  4BE1 A;  1IH7 A;  1J53 A;  3CG7 A;  3VQB A;  4OLA A;  4I2Q A;  4I2P A;  4AIL C;  4B3O A;  1HNV A;  2P1J A;  3ZSW A;  3SQ2 A;  3NH0 A;  4KHW A;  4OKK A;  3OVN A;  1QHT A;  4OGC A;  3PO5 A;  2JGU A;  4J2D A;  3PUF A;  1TL1 A;  3JYT A;  3U3Y A;  4ZTJ A;  1WSE A;  3K57 A;  1X9W A;  4KAZ A;  3L2U A;  4DSF A;  1EET A;  1T8E A;  1U4B A;  4HUE A;  3QIO A;  3TI0 A;  5CY4 A;  3L2Q A;  3SV3 A;  1S1T A;  1S9E A;  1LW2 A;  1TAQ A;  3DRS A;  3HP9 A;  3SQ4 A;  3ZSY A;  4FLW A;  1YT3 A;  3K5N A;  4CK3 A;  1JLG A;  4JS4 A;  3ITH A;  2XY7 A;  1BQN A;  4FM0 A;  3ZSX A;  1C6V A;  4CED A;  4CIG A;  4GVM A;  3HM9 A;  3QEI A;  4CJR A;  4WE1 A;  1Z25 A;  3P83 D;  3PX6 A;  1ZBH A;  4KKO A;  4DTJ A;  2Z1J A;  4FM2 A;  4I9L A;  1HNI A;  2Z1I A;  1LWF A;  3NF8 A;  4FVM A;  4FJI A;  4M45 A;  2WOM A;  4DMN A;  4DFM A;  1D5A A;  1BI4 A;  4AHS A;  1CZ9 A;  5C24 A;  1NK4 A;  5I3U A;  2EHG A;  3T1A A;  4BDP A;  3OYJ A;  4KTW A;  2OA8 A;  1BCO A;  3VQE A;  3AVI A;  2RN2 A;  4MQ3 A;  3RRH A;  4IFV A;  5KRS A;  4H4M A;  3AO1 A;  3M8Q A;  4BE2 A;  4DS5 A;  3SUQ A;  3MXM A;  4CJU A;  4FCY A;  1EXQ A;  5HLF A;  2FBY A;  2OZM A;  3PO4 A;  2QXF A;  4BWJ A;  4Z4G A;  4DTN A;  2G8I A;  2FBV A;  1Z26 A;  3LAM A;  3AVH A;  2FC0 A;  1FKP A;  1HMV A;  4CFB A;  1KLN A;  3DLH A;  1XHZ A;  4G1Q A;  3E01 A;  3VQC A;  3NGI A;  2Q3S A;  1FK9 A;  3C6T A;  3AVK A;  4N41 A;  4KRF A;  1WAF A;  1QTM A;  1RBT A;  2G8U A;  4B9U A;  2HNZ A;  4HCC A;  3CFR A;  1VSK A;  4NCB A;  2EX3 A;  1QSL A;  5KTQ A;  3M8P A;  3DLB A;  5SZT A;  1RBS A;  3QET A;  2YHB A;  3NGY A;  1FXX A;  1WNS A;  4FM1 A;  4DTP A;  3SPY A;  4B9N A;  4CFA A;  4R5P A;  4JRP A;  4KB1 A;  4O0I A;  1RNH A;  2DFH A;  2DTU A;  1ITG A;  3HPG A;  4FLT A;  4FJH A;  2YNF A;  1LWE A;  3LAK A;  4C8M A;  5C42 A;  3VQ9 A;  4B9T A;  2XRI A;  4DSK A;  1WSH A;  1TK0 A;  1REV A;  4E7K A;  4E1N A;  2IOC A;  4C8N A;  2G8W A;  3C94 A;  4OKJ A;  4ELU A;  4KHN A;  1UA1 A;  3H08 A;  3OYG A;  4W5N A;  4B08 A;  1HQE A;  1VSI A;  4DSL A;  1RT6 A;  4AHR A;  4I9Q A;  2X6N A;  3L3V A;  5J2M A;  4J2B A;  4EP4 A;  3P1G A;  4CIF A;  1DLO A;  2HHW A;  5HRS A;  3NDK A;  4CGH A;  1U48 A;  3RR8 A;  1KRP A;  4AHC A;  4B9L A;  1C0T A;  4FJL A;  3AVA A;  2E4L A;  3IS9 A;  3ZSO A;  5FRN A;  1IKV A;  1NJY A;  4QCL A;  1DTT A;  3L3U A;  3MXJ A;  1BIS A;  2OPR A;  4CHO A;  4E19 A;  1FKO A;  1SL1 A;  4DSI A;  5FRO A;  4UQG A;  3V9U A;  4DQR A;  2X74 A;  2YHA A;  4RW8 A;  3KK1 A;  3MAQ A;  4J2E A;  2P51 A;  1WSG A;  3I8D A;  4FLV A;  4QAG A;  1A5V A;  3D0P A;  4CHP A;  4O4G A;  1TVR A;  3TWH A;  1TKX A;  3AA3 A;  3IAY A;  4CEE A;  4KPY A;  4DTU A;  1L3T A;  1HQU A;  3VQ4 A;  4DQS A;  4B8A B;  3SYZ A;  3PX0 A;  1N6Q A;  4FK4 A;  4W5Q A;  2QK9 A;  2E6M A;  4LY7 A;  1UAX A;  2B4J A;  3KKR A;  3NF6 A;  4IFY A;  3NGZ A;  1T03 A;  1NKB A;  2G8K A;  4ID5 A;  3TAP A;  4LD0 A;  3MEC A;  1GOC A;  3AO5 A;  4DQI A;  3AO2 A;  5I42 A;  4GMJ B;  4DFJ A;  3RMD A;  1XHX A;  3HO1 A;  3SNN A;  1G15 A;  3K59 A;  1T05 A;  4FJG A;  4KI4 A;  4Z4F A;  5HBM A;  4Q5V A;  1W0H A;  3TAM A;  1JL2 A;  3B6O A;  3DRP A;  1JL1 A;  3LWL A;  4C8O A;  1XI1 A;  4N76 A;  1GOB A;  1S1U A;  3T19 A;  1S1W A;  3VQP A;  1N5Y A;  2DY4 A;  2OPQ A;  3OYI A;  1Q9Y A;  3O4N A;  5KGW A;  1SL2 A;  4YFU A;  2F8S A;  4PWD A;  4RW6 A;  3OYC A;  2IC3 A;  3OS2 A;  2Z1G A;  3AA2 A;  4YNQ A;  1Y97 A;  1NKE A;  1NKC A;  1WAJ A;  4M3Y A;  3AVN A;  4CF2 A;  1IKX A;  3TAF A;  1NK0 A;  1J5O A;  4GW6 A;  1BIZ A;  1IG9 A;  3RRG A;  2XY8 A;  4EZ9 A;  4FJ7 A;  4LSL A;  4FK0 A;  1U47 A;  5JS2 A;  1CLQ A;  2OYQ A;  2OPP A;  1D9F A;  3HL8 A;  4CJK A;  3RWU A;  3VA3 A;  4ZHR A;  3VA0 A;  4BE0 A;  4AHV A;  2F96 A;  2Y1J A;  1KLM A;  4FZZ A;  3QLH A;  1KTQ A;  4CEQ A;  3QEX A;  4ELV A;  1TKZ A;  4NCA A;  3B6P A;  3WNF A;  3QEP A;  3ZT2 A;  3TAB A;  3OS1 A;  2E6L A;  3MEG A;  4CEB A;  3V81 A;  4JLH A;  2NUB A;  4FJM A;  4N56 A;  4CEC A;  2VWJ A;  2A1R A;  1RDA A;  1SL0 A;  4FJN A;  4KHQ A;  1ASV A;  3HVR A;  1RBV A;  1ASW A;  4JS5 A;  1RTD A;  4F2R A;  4CGD A;  3DLK A;  3LP0 A;  1JLE A;  3A2F A;  4B9S A;  3WNH A;  1WSJ A;  4CK1 A;  4CJ3 A;  3OYD A;  2VWK A;  3OYE A;  3DLR A;  2FBT A;  3JSM A;  2HHX A;  4CF8 A;  3I0R A;  1RDC A;  4CFC A;  4Q0B A;  1KFD A;  2KZM A;  1MU2 A;  3ZT1 A;  3AVM A;  1CXQ A;  3F9K A;  5CZ1 A;  4B9M A;  2JLE A;  3SUP A;  3HT3 A;  3KD5 E;  4H8K A;  3AA5 X;  3HYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...