4CGDA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cgdA00
2HMIA 4FLTA 5HRPA 4HUGA 3OYBA 1TK5A 4O55A 1IKVA 3MEEA 4IG0A 3ZSVA 1BISA 1VRTA 3VN5A 2FBVA 1XWLA 3K5LA 4O5BA 2HHWA 2D5RA 3TAQA 3S3MA 3DLHA 4FJKA 2IOCA 4CJEA 1NK4A 4C8OA 4CECA 3VA3A 3OYEA 3HXMA 4AHTA 4B9MA 5DMRA 3OYLA 2P5GA 4HUEA 5KI6A 4FLZA 1QE1A 4W5OA 5EU7A 4OKJA 2XY8A 2ZE2A 4KKOA 3K59A 2HHVA 2G8VA 5C24A 3SV3A 3NF8A 3PO4A 1TKDA 4FM0A 4NYFA 3SUNA 4DU3A 3U3YA 4FJJA 1HNIA 2XO7A 4KHYA 3TAFA 2OPRA 3EZ5A 1NOZA 2YKMA 4O4GA 4CEDA 4E1NA 1CZ9A 1KVCA 2NUBA 4CFCA 4EP4A 1WSEA 4OGCA 2HHTA 3VQEA 1FKOA 2X6NA 4M3TA 4AHRA 2D0CA 3NF7A 4N5SA 3ASMA 3P5JA 4YFUA 3RMCA 3CYMA 1J53A 1EXQA 4FYDA 1L3SA 2HHXA 4ELVA 1C1AA 1U04A 2IC3A 4ICLA 4QOZB 4CGIA 1KRPA 1CLQA 4PA1A 2EX3A 4DTNA 1IO2A 3AVHA 1W0HA 4CHNA 4DTRA 4N56A 3KLGA 1SKSA 1NK7A 2D0BA 4RG8A 4FLVA 3G0ZA 4DFJA 3QNNA 3O3GA 3RWUA 1NKEA 4DMNA 1RT7A 3AVGA 4KTQA 4AILC 3CFRA 2BE2A 2BGGA 1ZBHA 3VQDA 3CFOA 3WNHA 4EP5A 3MECA 1RDDA 4CGJA 1XI1A 4E19A 4E7LA 1C0MA 2X6SA 2DFHA 3AA5X 4CE9A 4CHQA 1C0TA 1HPZA 1HJRA 1RT5A 3BGRA 3QINA 1WSFA 3SV4A 1S6QA 4B8AB 2Y1IA 4KRFA 1S6PA 3OS1A 3AA3A 3V1QA 4CJRA 3NF6A 3TARA 2A1SA 4DSFA 3V81A 3LWMA 1LWCA 4H4OA 4CHOA 4JS5A 3C6TA 4FZXC 3LPUA 3UIQA 4FJLA 4LY7A 1EKEA 1JLFA 1VSDA 1RDAA 4OGEA 2QXFA 3T1AA 3RR8A 1NJWA 1WN7A 4CHYA 4DQPA 1EX4A 3O4QA 2B4JA 1NKBA 3TI0A 1Y97A 3LZIA 2G8FA 4Z4IA 2HHSA 1U45A 4FJ5A 3AVCA 1GOAA 1RILA 1DTQA 4CJ3A 1XHZA 3V9UA 4B9SA 3MEGA 1RT4A 4LH4A 2HNYA 4C8NA 4N47A 3NGIA 3NGZA 3OY9A 3M8PA 3DLKA 1TAQA 2KQ2A 1ZBFA 4CJ5A 4CK3A 4DQRA 4CEFA 5HRNA 1D9FA 3P1GA 3TAEA 2PY5A 2IS3A 3HYFA 2F8SA 4CEQA 1LW0A 3ZT1A 1JLAA 4Y1DA 3KK1A 5CY4A 3OJSA 4HUFA 4DFKA 1YT3A 3QETA 1LAWA 4CIGA 4DF4A 1TKXA 4WE1A 4KHWA 3LALA 4CEZA 4KI6A 1NOYA 3SQ2A 1NK5A 3OYFA 4NCAA 3LAMA 2F8TA 2YHAA 4DLEA 4IBNA 3D0PA 4ID5A 3IS9A 3ZSRA 1ZYQA 1Q9YA 1C1CA 4FJHA 1LAVA 3KLIA 3KJVA 4DQSA 3SPZA 3CG7A 3KKSA 4M42A 4FW1A 1REVA 3F73A 5J2QA 1WLJA 3RRGA 4KPYA 2KFZA 2GBZA 2WOMA 4CF1A 1D8YA 1JLCA 4M3ZA 1VSKA 1S1XA 3FFIA 1G15A 4LH5A 1RCHA 1NK0A 3ZSQA 5HROA 1TAUA 3DLRA 1KFSA 3F9KA 1LWEA 1TKTA 1F21A 3MXMA 3ZSXA 1JLBA 2R7YA 3HO1A 2XY5A 3MXJA 3JSMA 4F3TA 3OYMA 1XC9A 1KLMA 3OS2A 3H08A 3NHGA 4W5QA 2OA8A 2FBTA 4E89A 5CZ1A 4JS4A 3D45A 3RRHA 2DFFA 1ASVA 2F96A 1B9FA 4HTUA 4FJGA 2OPSA 2IDOA 4GVMA 4OLBA 1Z25A 5CZ2A 3K58A 4B9TA 4FJNA 5D3GA 3HK2A 1NJXA 1C1BA 3DLEA 4QAGA 4KO0A 3O3FA 3LP0A 3QIPA 3NH1A 3NH0A 3OYAA 1HQEA 4CFBA 4CCHA 4F4KA 3AVAA 4RW6A 3V9ZA 4B9LA 1SL1A 4M3XA 4K8XA 4KHQA 1U48A 1BIUA 3LDSA 1QSSA 3TWHA 3ZSOA 4F3OA 4DQIA 1ZBUA 4DFMA 4F2SA 2HW3A 4N41A 1BCOA 3SZ2A 3KD1E 1RNHA 1RT6A 3AO3A 3LP1A 4HHTA 3QEVA 1UA1A 1X9WA 1BGXT 3NDKA 1D9DA 3O4NA 1C6VA 3VQ7A 4CJUA 3DRPA 1SL0A 1WAFA 4FJ7A 3HT3A 4FM1A 3PX6A 1S5JA 4OPKA 4B3OA 1UA0A 1T03A 1NKCA 1QSYA 4AHSA 1S1UA 3LANA 3TR8A 1LWFA 4BE2A 4ZTFA 4ID1A 4RW7A 3PV8A 3O3HA 4AH9A 4DWIA 4CK1A 3CM5A 3DM2A 4GW6A 2P1JA 3I0SA 1HYZA 3L2VA 3WNFA 3DMJA 3AV9A 4DLGA 4OLAA 4FVMA 4CIFA 4CGFA 1YVUA 4NYNA 2DY4A 2X74A 2KZZA 1RBRA 1S9EA 1NJYA 4RW9A 1SL2A 3T3FA 2Y1JA 5KGXA 1I3AA 2KW4A 3L2RA 4Z4FA 3K5MA 3S3OA 1DTTA 1BI4B 1EETA 3QNOA 1IH7A 2HVHA 3QO9A 1RBUA 3AA4A 4I9LA 1IKWA 4AHUA 2G8WA 2HHQA 2DTUA 4AHCA 1BL3A 3HPGA 1KFDA 4E7IA 1IG9A 1LW2A 3VQ5A 4BE0A 1S1TA 3I0RA 3KLFA 2KZMA 4CHPA 5FRNA 2YHBA 4IFYA 1JKHA 4OVLA 2JGUA 2FBYA 3HSTB 4CJFA 3KK2A 3BDPA 4FJXA 4TSXA 4FK2A 1KTQA 1L3VA 2P51A 2RN2A 3VQ4A 3TABA 1C0UA 1FKPA 1QHTA 2HNDA 4LSNA 5KRTA 2PZSA 1CXQA 3ZCMA 3ISNC 4Z4EA 1SKRA 4CJ4A 4CESA 4CGDA 2ETJA 3MEDA 5I42A 2HHUA 3KKRA 3KLHA 3NFAA 3OJUA 4IFVA 5JS2A 4E3SA 3K5OA 2WONA 3V6DA 3B6PA 4DS5A 1T05A 4M45A 1K6YA 4CF2A 3EY1A 2OYQA 4MQ3A 3WNGA 4BWMA 3JYTA 2JLEA 4JLHA 3I8DA 4CJLA 4R5PA 3A2FA 2E6LA 1KSPA 1VK0A 5E41A 1VSEA 3KLEA 3RMAA 3AVIA 2YV0X 4G1QA 4Y1CA 4CF9A 1WNSA 4AHVA 2ITGA 3PX4A 1J54A 2ZQBA 3NGYA 4KHUA 5HLFA 2G8HA 3RR7A 4C8LA 4CEEA 2Z1JA 4KTZA 1KVBA 1MU2A 4ELTA 3PUFA 2XHBA 1RBTA 3ULDA 3CQ8A 4ELUA 3AO5A 3NH2A 3SPYA 3LP2A 5C25A 2KTQA 1VSFA 3C94A 4E7HA 1HRHA 1U47A 1A5XA 4K8ZA 2HVIA 3IAYA 1WSJA 4FZZA 3ALYA 4FK4A 3NBPA 4BDPA 3IG1A 4O0IA 4B9NA 3MAQA 4CIEA 3AVBA 1JXEA 2RF2A 3HVTA 4HCCA 4PWDA 4EZ6A 5HRSA 4ZTJA 1Q9XA 1YTUA 2G8UA 4F8RA 3VQCA 1S9GA 4B8CA 3ZSWA 1YTAA 1TK8A 3P83D 2VG7A 3OYIA 1BQNA 4FLYA 1B92A 4I2PA 4O0JA 4BWJA 2VWJA 3VQQA 3DLBA 4FJIA 3MXIA 4OJRA 3HP9A 4XIUA 1ZBIA 5SZTA 1QS4A 2VG5A 1B9DA 1L3TA 3RMBA 2OZSA 1DLOA 2Z1IA 5FROA 1N6QA 2ZD1A 4DS4A 4IKFA 3K2PA 2YNIA 4DTXA 3QEPA 1L5UA 1JXBA 1WSIA 4Z0UA 1IKXA 3DLGA 3U6FA 1ZBLA 4CK2A 1SKWA 5JS1A 1U4BA 3T19A 3AVJA 3KTQA 4E0DA 4NCBA 5K14A 2BDPA 3QERA 1RT3A 1VSHA 4CHZA 2EHGA 5KRSA 2GUIA 4CJQA 2YNGA 1A5VA 4PUOA 1GOBA 4CJSA 2Z1HA 3RTVA 4DF8A 2IAJA 3LWLA 4W5RA 4DTUA 4DFPA 3U3GA 1RBVA 1TKZA 3HJFA 4M41A 1L3UA 5DK5A 4CEOA 4ZHRA 3HM9A 1BIZA 3G10A 3OYHA 4M3RA 3L8BA 3IRXA 4W5TA 1VSJA 4FM2A 4KAZA 3B6OA 4B9UA 2I5JA 1HYSA 3AVNA 3LP3A 2VWKA 4M3WA 3DOKA 1FK9A 3VA0A 4DU4A 4CF8A 4C8KA 2G8IA 1ITGA 4YNQA 3M8RA 4BDYA 1HYVA 3AVLA 4DTOA 3SUQA 3PY8A 4FW2A 3QLHA 2QK9A 2FBXA 4M3UA 3S9HA 1Z26A 1NK8A 4FZYA 4Z4GA 5C42A 4KV8A 4I9QA 4HVJA 1VSLA 2O4IA 3ZT4A 3K5NA 1RTJA 2E6MA 2LSNA 4KI4A 4N76A 4BACA 5HBMA 3NAEA 4DQQA 4MFBA 2FC0A 3HP6A 1HQUA 3AVMA 3ZSZA 4KFBA 1TL3A 1VRUA 3RMDA 4OKKA 3ZT3A 3OYNA 2YKNA 4RW4A 4BE1A 3THVA 2A1RA 1RBSA 4KB0A 3SQ0A 3HPOA 3DOLA 2BANA 3HVRA 1XHXA 3OYGA 1ASUA 2DFEA 4CJKA 1CZBA 1WAJA 3OYKA 3HL8A 3SUPA 3LZJA 1BCMA 5J1EA 3EYZA 1R0AA 1T8EA 1Q8IA 5I3UA 4F2RA 2G8KA 2OPPA 1RDCA 3V1RA 3E01A 3OYJA 3KK3A 4DTPA 3ITHA 5KGWA 4FJMA 4FJ8A 3TAGA 1TVRA 4Q0BA 3CFPA 3NE6A 3M8QA 4FK0A 1UWBA 3PX0A 2XY6A 3QEIA 3VQBA 4BDZA 1JL1A 1SV5A 2PYLA 3QESA 3OVNA 3L3UA 3L3VA 1TK0A 3DYAA 1UOCA 4DSIA 5J2PA 2PYJA 4J2AA 3SUOA 1JL2A 3VQ8A 2XRIA 4QCLA 1VSIA 4KHNA 4E1MA 5FDLA 1X1PA 1SUQA 2RKIA 3WNEA 5SWMA 1LV5A 3SI6A 1RTDA 3NF9A 1X9SA 4IDKA 4E7JA 3LPTA 4LSLA 1U49A 5KTQA 3AO1A 4J2BA 2HNZA 4KTWA 5T7BA 3V9SA 1J9AA 3CM6A 3ZSYA 3SNNA 4J2EA 4OKEA 4DTSA 1X9MA 1RTHA 2ATQA 1D5AA 4PY5A 1RTIA 1WSHA 1JLQA 4CJTA 1UAXA 4FXDA 1T7PA 2YNHA 1BHLA 2Q3SA 1J5OA 2AJQA 4IG3A 5HP1A 4L8RB 3AA2A 2YNFA 3VQPA 2IGIA 5HRRA 4B08A 3VQ6A 4JRPA 4DSEA 3SQ1A 1NK6A 4EZ9A 1I39A 5J2NA 4FJ9A 4CERA 1NK9A 4C8MA 4LD0A 4CGGA 1KLNA 2P5OA 1IKYA 2HB5A 1RDBA 2E4LA 4CJVA 2QKKA 4CEAA 1S1WA 1TV6A 1NJZA 4CGHA 4DTJA 3V4IA 4PQUA 2X78A 1KCFA 4I7FA 3L2UA 3AVFA 1TGOA 2OZMA 1TL1A 3KIOA 1WSGA 3M8SA 2GV9A 3C95A 1QSLA 1W9HA 4I2QA 3DRRA 1HNVA 4CJPA 4DSJA 4DSKA 3SCXA 2Z1GA 1VSMA 3L2QA 4E7KA 2B6AA 4O44A 3VQAA 5J2MA 4CEBA 2QKBA 3QEWA 5FRMA 4FCYA 2RPIA 2KFNA 1QQCA 4FLWA 1JLGA 4CFAA 3K57A 4FLXA 1JLEA 3LAKA 4DU1A 4DG1A 1ASWA 3HPHA 2B5JA 3V9WA 4UQGA 3PO5A 4KHSA 4KB1A 3OYCA 2XY7A 3S3NA 3TANA 3SQ4A 3V1OA 4Q5VA 1BI4A 1A5WA 1HMVA 2OPQA 3DRSA 3ZT2A 4FLUA 3TAPA 1EP4A 4CFDA 3OYDA 4CF0A 4B9VA 4GMJB 4HCBA 1KVAA 4KREA 1GOCA 1QTMA 5CYQA 3OS0A 4DTMA 1BQMA 4RW8A 4JRQA 4NCGA 4CJWA 4DSLA 3VQ9A 4Z4CA 3SYZA 1FXXA 3V9XA 3KD5E 5CYMA 4H4MA 4Z4HA 3AO4A 3NCIA 3DI6A 1O1WA 2VG6A 2D0AA 3AVKA 1N5YA 3L2WA 4M3YA 3QEXA 3TAMA 4W5NA 3SJJA 2W42A 4H8KA 1RT1A 3AO2A 3C6UA 1S1VA 1RT2A 3ZT0A 3QIOA 4J2DA 2O4GA 1CXUA 4OPJA
chains in the Genus database with same CATH superfamily
4FLTA 4HUGA 1TK5A 3ID6A 3D2EA 4PL8A 1NGHA 1RFQA 2FBVA 3ZX3A 1IJJA 2WTUA 2Q0UA 2QWNA 4AHTA 5DMRA 2RE2A 4H5VA 4DV4K 4HUEA 5KI6A 4FLZA 2ZE2A 1IBMK 2VWBA 4B9QA 1YXQA 4NYFA 3TAFA 1Q86O 5ELZA 2P9IA 4CEDA 4O4GA 1CZ9A 4OGCA 4AQYK 4DV2K 3CIPA 4N5SA 2D0CA 2GWJA 4BRQA 3D2FB 1L3SA 2HHXA 1QZ5A 2HSTA 2IC3A 5LMNK 5M1QA 1U2VB 1IO2A 4NLCA 4XH4A 4DTRA 4RG8A 3RWUA 3WEEA 1NKEA 2YJEA 3WXIA 1ZBHA 3VQDA 3WNHA 4X65K 2O8FB 5EXWA 1XI1A 4E7LA 2WBNA 2IVOA 3QINA 5AFUH 1WSFA 3VF4A 2E88A 3OS1A 1EQYA 1QQOA 4X62K 1LWCA 4JS5A 3LPUA 1VSDA 4OGEA 3T1AA 3RR8A 2QXFA 1K8KB 4PKIA 3VGLA 1Y97A 2J4RA 3QFPA 4KH4A 3O9RA 2G8FA 2HHSA 1U45A 4FJ5A 3AVCA 1GOAA 1DTQA 1ATRA 4C8NA 2QA4N 2HNYA 4K41A 3OY9A 3DLKA 1ZBFA 1I94K 1GLEG 4JKAA 1D9FA 3TAEA 5GIPA 5MLCQ 2QWMA 1LW0A 3ZT1A 4Y1DA 3KK1A 1YT3A 3QETA 2QWQA 2WC9A 4KHWA 4ISEA 3LALA 3CJ7A 4HWIA 3SQ2A 1FW6A 3LAMA 2ZWHA 1C1CA 3SPZA 4BRCA 3RRGA 4KH5A 2GX9A 2GBZA 3LDLA 1NWKA 1JLCA 3P31A 1YHQN 2O8DA 1RCHA 3GBTA 1NK0A 1XNRK 3CC4N 5HROA 3ZX2A 3F9KA 5C15A 3MXMA 3ZSXA 2R7YA 3JSMA 5HOOA 3OS2A 4H03B 4E89A 5AQFA 3QBXA 2CGLA 3D45A 4FJGA 4OLBA 5CZ2A 4FJNA 1NJXA 1C1BA 3NH1A 4F4KA 5BREA 3AVAA 1VQPN 3V9ZA 1TUUA 2DPNA 3IKMA 1SL1A 3LDSA 3ZSOA 4F3OA 1ZBUA 2E2PA 1BCOA 3ZX0A 3KD1E 1RNHA 1N32K 1V4SA 4HHTA 5AQIA 3EEQA 2NRZA 1H1VA 2QW9A 4CJUA 3DRPA 3HT3A 3QDKA 4BRHA 3H1VX 3OW2M 1NKCA 4AHSA 3CERA 3QB0A 4ID1A 4AH9A 5GAHP 4CK1A 3DM2A 2P1JA 3L2VA 1HYZA 4DLGA 5E26A 4OLAA 5M1NA 2GELA 4CGFA 2X74A 2Q1NA 1S9EA 2Q97A 1NGGA 4IFEA 4RW9A 4BR2A 3T3FA 4JI3K 2KW4A 4Z4FA 2HVHA 3K5MA 1DTTA 3QNOA 2FSNA 5JLFA 3QO9A 3R1XA 1Q82O 1BL3A 2ZJRL 1KFDA 4E7IA 3IDHA 1IG9A 3HSCA 2UU9K 4FK2A 4X66K 1L3VA 2P51A 5M1KA 2ASPA 2A40A 3ZCMA 4Z4EA 4MLHA 3GOIA 4CGDA 3MEDA 3NFAA 3OJUA 4IFVA 4BRFA 3FZLA 3MCAB 4DS5A 5C2FA 4M45A 3O6WA 3EY1A 2OYQA 3JYTA 4CJLA 3VETA 2E6LA 5H1SQ 4LF9K 4G1QA 4Y1CA 3G25A 4CF9A 4AHVA 2ITGA 5FPEA 4BVPA 3EE8A 4CEEA 4KTZA 1MU2A 2XHBA 3AO5A 3OHRA 3NH2A 5AQWA 3C94A 1A5XA 1WSJA 4BG8A 4H5TA 3CF5L 3MAQA 3HVTA 1JXEA 4EZ6A 1YVNA 3VQCA 4GV9A 3OYIA 4O0JA 3DLBA 4FJIA 2O8CA 3MK6A 1QHAA 3R6MA 4LFCK 4DUZK 1L3TA 1DLOA 1N6QA 3RVCA 1JJ2M 4YOTA 4IKFA 3K2PA 4K0KK 4DTXA 4LF6K 1JXBA 2E2QA 1WSIA 1E4FT 3DLGA 3O9QA 3U6FA 3KVGA 1ZBLA 1S72N 1U4BA 1SKWA 2HBJA 4YOVA 3BUZB 3L4IA 5K14A 1VSHA 2EHGA 5KRSA 4CJQA 3FFKB 4JI6K 3CPWM 1GOBA 2IAJA 4CZJA 4W5RA 3LWLA 3O8MA 4BRKA 4DTUA 4CEOA 2YHYA 5C10A 3P38A 4W5TA 1HYSA 3B6OA 4B9UA 1FK9A 4FL9A 4C8KA 2Q0RA 1HYVA 4FW2A 2QK9A 1KC8O 3UB5A 3NVKA 1NK8A 2O8DB 2V51B 1BWFO 2P9KB 2O4IA 4CZKA 2LSNA 5AR0A 1WOQA 3AVMA 4DB3A 3ZEUA 1VQKN 4OKKA 3ZT3A 2BANA 1S3XA 3TU5A 4CJKA 1CZBA 4EAHD 1YAGA 1T8EA 5J1EA 4B3TK 1TYQB 3SAHA 5JVGL 3ITHA 3N4QA 4M7YA 4FJMA 1TVRA 3J7YP 3M8QA 2PBDA 3QEIA 3VQBA 4BDZA 1JL1A 1SV5A 1K8KA 3OVNA 3A8YA 5EX5A 3L3VA 3HRGA 5AQOA 2E1YA 3K9JA 5J2PA 1JL2A 1VSIA 2HF3A 5SWMA 4CBWA 4J8FA 4F9OA 5KPRA 1XMOK 4JI7K 2HNZA 5AZIB 3CETA 4O8UA 1BHLA 4CJ7A 3WEEB 5HP1A 5A2QO 1YUWA 2YNFA 2D1KA 3VQPA 2IGIA 4DSEA 5J2NA 1U2VA 2FSKA 4A61A 5GIOA 1J5EK 1HNWK 4CGHA 2FF3B 1VQ8N 1HX1A 4I7FA 1IBKK 4JI1K 4IWVA 3M8SA 4DSKA 5BPNA 3AGRA 4E7KA 3VQAA 2W41A 4WFBL 4BY9C 1BO5O 2RPIA 3EZWA 1QQCA 5AFUA 4CFAA 5BRHA 3H45C 3LAKA 2B5JA 4B1XB 3V1OA 4Q5VA 1BI4A 3DRSA 4FLUA 4CF0A 4B9VA 4GMJB 4MDAA 1LCUA 4JKCA 1GOCA 2P9UA 3A5LC 4DTMA 2FF6A 3M6GA 4NCGA 4Z4CA 1MA9B 3V9XA 5BPLA 2HHHK 2E5LK 4XH1A 4DHYA 3I33A 4H0TB 5AQGA 3SJJA 4QS8A 4H8KA 2JWLA 3SJHA 3TTCA 3CCEN 2P9LB 3CD6N 3O5BA 3VF6A 3DXKA 1VQMN 5HRPA 3MEEA 3T1HK 3AAPA 5CR4A 3QMLA 2D5RA 3TAQA 4FJKA 3THXB 4CECA 1U6ZA 4U67L 3OYEA 3CCRN 3I56N 4YY3K 2P5GA 5EVZA 3K0SA 1ESVA 2NRWA 1QE1A 3FGUA 3MWTA 5EU7A 4W5OA 4KKOA 3K59A 2HHVA 5C24A 3SV3A 3OBWA 4FM0A 3SUNA 2QEXN 3U3YA 2XO7A 4KHYA 2OPRA 1NOZA 3AY9A 4E1NA 2HHTA 2X6NA 4M3TA 4AHRA 3ASMA 4RCHA 3P5JA 5TKWA 1BU6O 3CYMA 1J53A 1EXQA 3SMSA 3CCSN 1C1AA 4CGIA 3FZFA 4V19S 3ZETA 4PA1A 1J6ZA 1QZ6A 3LDOA 4Y0WA 4N56A 3MN6A 5KQDA 3QNNA 3G0ZA 3IFRA 5AQSA 3O3GA 4DMNA 1RT7A 3CPEA 4A2AA 4BQLA 4KTQA 4XH5A 4JI2K 3CFRA 2BE2A 3CFOA 3MECA 1DKGD 3M5RA 1T3VA 3UKRA 2EWSA 4A5AA 2X6SA 4CE9A 4CHQA 3ZEUB 3WQUA 3MX2A 1T6CA 3SV4A 1D4XA 2YJFA 3AA3A 3O9UA 3V1QA 4CJRA 3NF6A 3TARA 1ATSA 2P9KA 3LWMA 3ZLJA 4CHOA 2O8BB 2NRXA 1N33K 4LY7A 1EKEA 1JLFA 4G9ZA 1X3MA 3IUCA 1RGIA 1C0FA 1RILA 4CJ3A 4B3MK 4FWQA 3NGIA 3WXKA 3VEZA 4CEFA 3P1GA 3C7NB 2PY5A 2IS3A 4GNIA 4CEQA 2F8SA 2O8EB 4HUFA 4JHDA 4CIGA 4KI6A 1Z6RA 3BEXA 5EOYA 3D0PA 3LDPA 1VAZA 1ZYQA 2WFBA 1N8RO 3KJVA 4M42A 2QTDA 2WOMA 4M3ZA 4I6MA 1TAUA 1NGAA 1TKTA 2HBKA 1VQON 3H08A 3UE5A 5CZ1A 4JS4A 1EWRA 3U9DA 2Q2RA 2OTLN 1ASVA 2E20A 5LMUK 4GVMA 3K58A 4B9TA 5D3GA 1HJOA 3DLEA 3LP0A 5KQ8A 4CCHA 3NH0A 1HQEA 4CFBA 4EHUA 1U48A 2GWKA 4YDUA 1QSSA 3TWHA 3ZETB 3E9LA 4DQIA 3P39A 3VF2A 3I55N 4N41A 5AQYA 4BQZA 3AO3A 4JKGB 5DM7L 3J80O 3VEVA 3O4NA 5F0XA 1Z05A 1XUPO 1WAFA 4KH6A 3T1YK 1UA0A 1T03A 1BA1A 4MDBA 3TR8A 1OH8A 3PV8A 4BC5A 3O3HA 3DMJA 4CIFA 4NYNA 1V4TA 2DY4A 3ATUA 1NJYA 1SL2A 4NLBA 1S22A 2AA4A 4I9LA 3AA4A 5BN9A 2DTUA 5KPTA 4AHCA 4DV0K 3KLFA 1K9MO 4CHPA 2YHBA 2P9LA 1RDUA 2JGUA 4JAXA 4OVLA 3UKUA 3KK2A 4A59A 1W97L 1KTQA 1TUYA 3VEYA 1SKRA 4CESA 3O80A 3DWLA 5I42A 4IJNA 4JKGA 5JS2A 3K5OA 4OPAA 5JLHA 3V6DA 1T05A 3O9TA 4MQ3A 5AZJB 4EHTA 4R5PA 3AARA 5JVHL 3KLEA 3AVIA 2YV0X 4BVOA 4KHUA 2ZQBA 2G8HA 4IOXA 3RR7A 4C8LA 3E9OA 4DR1K 5AQMA 1RBTA 4ELUA 3LP2A 1DT9A 4H0VB 2UUCK 2KTQA 2GTDA 4WQ4C 3EO3A 2KKZA 3HOTA 4O0IA 4BRDA 5HRSA 5FPDA 2G8UA 3DAWA 3TSUA 3ZSWA 3LDNA 1BQNA 4FLYA 4BR9A 1R59O 5AJ3K 2VWJA 3QICA 3HP9A 4XIUA 4GKKK 4JI0K 2ZD1A 2YNIA 1L5UA 1E3MA 5GAEP 5JS1A 3T19A 1NM1A 3AVJA 4NCBA 4E0DA 4JHDB 2BDPA 4QS7A 2A5XA 2GUIA 2YNGA 1A5VA 5AQXA 4H0OA 4IJAA 1MDUB 3CQXA 1T6DA 2ZJQL 4DFPA 2ZM6K 1TKZA 3HJFA 4M41A 5AQUA 3L6QA 2HF4A 2QM1A 3L8BA 1VSJA 4OX9K 2I5JA 2OTJN 4DCHA 3DOKA 4PKHA 4MO4A 4A5BA 1ITGA 4YNQA 3M8RA 3IAYA 3SUQA 4GKJK 3QLHA 2W6LA 2FBXA 2BTFA 3ID8A 4Z4GA 4I9QA 2OCEA 3K5NA 1RTJA 2E6MA 4YHHK 4N76A 4BACA 5HBMA 4MFBA 3EN9A 1HQUA 2NZTA 3RMDA 4BE1A 2A1RA 3K9KA 4KB0A 3R8EA 3HVRA 3UKRB 1LOTB 1XHXA 2DFEA 3SUPA 3LZJA 1R0AA 1Q8IA 5I3UA 5F1XA 1RDCA 2P9PA 4BRAA 4BG9A 4FJ8A 3TAGA 4ILHA 3CFPA 2A3ZA 3WUHA 3PX0A 2XY6A 3FZMA 2PYLA 2UXCK 3FR0A 3DYAA 4DSIA 4GV6A 4DV3K 3SUOA 5AQQA 4QS9A 3WXLA 3PIPL 2A41A 1BUPA 4LF5K 5FDLA 4OO1J 2V52B 5BRDA 3B8AX 2RKIA 1LV5A 1RDWX 5FLXO 1QQNA 4E7JA 4JN4A 1U49A 4NXNK 1WUAA 3M1FA 4KTWA 5T7BA 4JK7A 3V9SA 3ZSYA 4OKEA 4DTSA 4FPAA 2ATQA 1D5AA 1RTIA 1JLQA 4CJTA 2PAVA 3A5NC 1UAXA 4FXDA 2Q3SA 4C1NK 4DR2K 1J5OA 4IG3A 3HBTA 3EKUA 3AA2A 4BC2A 4B08A 5HRRA 3SQ1A 3DLLL 4EZ9A 1I39A 1DGKN 4CERA 5BR9A 5AZJA 4CGGA 1IKYA 4JI8K 5AQPA 3D2FA 1TV6A 2ZF5O 4PQUA 3CMAN 2X78A 4U7BA 3P4IA 3L2UA 2OZMA 3KIOA 2P9NA 4DSJA 2GV9A 3C95A 1W9HA 3O1BA 3DRRA 1HNVA 4I2QA 2P9IB 2Z1GA 3Q7BA 3L2QA 3Q7CA 5J2MA 3QEWA 1VQ4N 4FCYA 3AAQA 5CE3A 4FLWA 4RWTA 4FLXA 4JKDA 1JLEA 3ENOA 5BPMA 3HPHA 3V9WA 4KB1A 2XY7A 1SZ2A 3TAPA 1SQKA 3FZHA 4HCBA 1P90A 1K73O 4EIAA 1QTMA 5CYQA 2NRHA 4JRQA 4DSLA 1FXXA 4H4MA 3AVKA 4L3QA 3L2WA 4JEPA 4M3YA 3VMFB 4W5NA 4ISGA 1YJWN 3AO2A 5CHIA 3C6UA 1S1VA 2HBMA 3ZT0A 2V7YA 3FE1A 2HMIA 4CI6A 3OYBA 4H0YB 1IKVA 3ZSVA 2BH1A 1VRTA 3VN5A 2QXLA 3BP8A 1XWLA 3K5LA 4LF8K 1GLJO 4CJEA 3SMPA 1MWMA 5FPMA 3HXMA 4B3SK 3JS6A 4B1WB 4OKJA 5AZIA 1HUXA 3PO4A 1NGCA 1TKDA 4CZLA 2H3GX 3L0QA 2I7NA 2NUBA 1WSEA 4B1UB 1FKOA 4K25A 2QWRA 3MN9A 2D4WA 3RMCA 4BR4A 4BGBA 4ELVA 4ICLA 1U04A 1HKCA 3SBTA 2UUAK 2EX3A 3NVMA 4DTNA 3AVHA 3OA9A 3EKSA 4CHNA 2BUPA 1SKSA 1NK7A 4FLVA 3VGKA 1HKGA 3AVGA 3MWPA 4AILC 2O8EA 4DV1K 4BC3A 2BGGA 4FWMA 4EP5A 1RDDA 4CGJA 4BGAA 3MCPA 1C0TA 1HPZA 1HJRA 3BGRA 2Q31A 1S6QA 4B8AB 1YJNN 1S6PA 3KHYA 4FO0A 1NMDA 4DSFA 4H4OA 4FZXC 4DUYK 3UIQA 4FJLA 4FJHA 4I6MB 3DXMA 3TTFA 4DQPA 1NJWA 4CHYA 3O4QA 2B4JA 1NKBA 1KXPA 3TI0A 3LZIA 5JICA 1VQLN 3SK3A 1HKBA 3MEGA 1RT4A 4WQ5C 4N47A 1TAQA 4CJ5A 4KBOA 5HRNA 3E66A 3HYFA 1ZBSA 4K43A 3OJSA 1LAWA 1TKXA 4CEZA 3H3NO 1NOYA 1NK5A 2VGMA 4NCAA 2F8TA 4DLEA 3VEOA 4IBNA 5IT9O 4ID5A 1IG8A 3C6HA 1Q9YA 1LAVA 4DQSA 1EWQA 3CG7A 4FW1A 3F73A 2KFZA 4KPYA 3F2KA 4CF1A 4JYAK 1D8YA 4CW7B 1S1XA 2O8CB 4LH5A 3DLRA 1F21A 3MXJA 5M1FA 1NGDA 1KLMA 2FBTA 1GLFO 2O8FA 5AQHA 1Z25A 1VQ5N 4IZ9A 3LL3A 2QKKA 2Q36A 2ZGZA 4RW6A 4BRLA 4M3XA 1BIUA 4JKHA 3BF3A 3J7ZO 4F2SA 2HW3A 1RT6A 3LP1A 1Y64A 1X9WA 1BGXT 5GINA 4IDHA 3VQ7A 3G4SN 2YX6A 2F7TA 4FJ7A 1X9JA 3PX6A 4FM1A 1YF5L 1N34K 1NLVA 1S5JA 4OPKA 4B3OA 1QSYA 3LANA 4CZFA 4JV5K 3TPQA 4BE2A 4RW7A 4DWIA 3CM5A 4GW6A 1VQ6N 4LFAK 3AV9A 1DEJA 1BA0A 1YVUA 5AQRA 3J81O 4LF7K 2KZZA 4JI5K 5ADXA 1WB9A 5KGXA 3THXA 1I3AA 3CC2N 3S3OA 1BI4B 4JKFA 4AHUA 1RBUA 2G8WA 1IKWA 3LM9A 1JCEA 2OANA 4JD2B 3VQ5A 4BE0A 2KZMA 3DXKB 1OH7A 4IFYA 4CJFA 3HSTB 4C23A 2E1ZA 4FJXA 4TSXA 1M1KO 3PSIA 2P9SA 2P9NB 3VQ4A 1C0UA 5KRTA 2D0PA 3TABA 1CXQA 3U4LA 3ISNC 3VEXA 3VERA 4WCEL 3BZCA 3KLHA 4DV5K 2HHUA 4JD2A 2JLEA 3HZ6A 3I8DA 3A2FA 1KSPA 1VK0A 5E41A 2VGNA 1J54A 4BRIA 1GLBG 5HLFA 2Z1JA 1KVBA 3PUFA 1SS6A 3SPYA 5C25A 3BZKA 1VSFA 4E7HA 4K8ZA 2HVIA 5GADP 4FK4A 3NBPA 4BDPA 3IG1A 4HCCA 1GLDG 2RF2A 4PWDA 4ZTJA 1Q9XA 4PL7A 3CMEN 1YTAA 1TK8A 3P83D 2VG7A 1B92A 4BWJA 4OPHA 1ZBIA 1B9DA 3RMBA 5FROA 4DS4A 1HR0K 4MLEA 3QEPA 3CCJN 3T69A 4Z0UA 4FOEA 1IKXA 3O9SA 3VENA 3W0LA 4WQ5A 4CK2A 3KTQA 3QERA 1RT3A 4UY8O 3CCUN 5C12A 4E1JA 4PUOA 1JCFA 2Z1HA 2FXUA 4WQ4A 4C1NI 3WQTA 5LY3A 3G6EN 3U3GA 1RBVA 3D6RA 5DK5A 3VTHA 4ZHRA 3HM9A 5AQNA 4JKEA 1BIZA 3A5MC 4M3RA 3OYHA 3IRXA 4FM2A 4BR0A 4JKBA 3LP3A 2VWKA 4M3WA 1C0GA 4CF8A 4BDYA 3PY8A 1XNQK 1W2BM 1GLCG 2VQFK 1XQSC 4FZYA 5C42A 1W7AA 1NGFA 4CZHA 1VSLA 4HVJA 3KWGA 3ZT4A 3CCQN 4NXMK 3NAEA 2W6KA 3R3LA 3ZSZA 1VRUA 3BF1A 4CZMA 3OYNA 4RW4A 4DR5K 3BY5A 3RSEB 3U9ZA 3QBWA 1WAJA 3WXMB 3OYKA 3HL8A 2G8KA 3V1RA 3E01A 1K8AO 4Q0BA 3NE6A 4GY2B 4FK0A 5AQJA 1UWBA 4DQ8A 3ULEB 4YOUA 3L3UA 1TK0A 1HNXK 1UOCA 2PYJA 3F5TA 4J2AA 5I9EB 2XRIA 1KQSM 3O08A 4KHNA 4E1MA 2AP1A 4GVEA 2NNWA 3HI0A 3WNEA 4DR7K 1BG3A 3CJAA 1EO1A 2YCHA 5B8HA 4IDKA 3LPTA 3OBYA 3AO1A 3J8AA 4J2BA 4BROA 4J2EA 4PKGA 3GG4A 1X9MA 1RTHA 3CCLN 1WSHA 4BRMA 5F2RA 3C0BA 1T7PA 4A2BA 2AJQA 3OTOK 1NG9A 2ZJPL 1MWKA 4L8RB 1QVFM 4FPBA 4IXCA 1NK9A 1NNEA 2E8AA 4LD0A 1KLNA 2P5OA 2YHWA 3A5OC 2UXBK 1KAXA 2E4LA 2E2NA 4DTJA 4AM7A 1Q81O 5AQLA 1KCFA 3W3DA 3KWIA 1OH5A 4FWPA 1TL1A 3O4WA 3THYA 4XEIA 3GE1A 4KHPK 4O44A 4CEBA 5AQKA 2KFNA 2ASMA 1JLGA 3K57A 3MN5A 1ASWA 3PO5A 3QFUA 4UQGA 4KHSA 3N4PA 3ZT2A 1HMVA 2UXDK 3CJ1A 4RTFD 3NMUA 1EP4A 4CFDA 3OYDA 1QQMA 2HMPA 4IEEA 3WT0A 3LDQA 1BQMA 2GUPA 2VYPA 3LM2A 4CJWA 1NGEA 3SLCA 3H46O 3SYZA 1KD1O 2E2OA 3G71N 4BRNA 3NCIA 3FLCO 3DI6A 4NB4A 1O1WA 4H5RA 3VESA 3CJBA 2W42A 4BRGA 1RT1A 3THYB 5LJWA 1OVQA 3QIOA 4J2DA 1CXUA 1Q7YO 4JNEA 5JMVA 1NMNA 3TSPA 2A6AA 4O55A 4IG0A 1BISA 4ILJA 4O5BA 2HHWA 3C6AA 3S3MA 3DLHA 2IOCA 4C8OA 3VA3A 4B9MA 3OYLA 2CGKA 4PHTX 3VOVA 2XY8A 2G8VA 3NF8A 2IVNA 4FWRA 4DU3A 4FJJA 2JWKA 1HNIA 3E9PA 3R9PA 4IOCL 3EZ5A 3SBGA 2YKMA 4EP4A 3SAFA 1KVCA 4CFCA 3PLAA 3VQEA 3IMXA 3NF7A 4YFUA 1YITN 5M1OA 2CH5A 4FVUA 4FYDA 4IO8A 1P8ZA 4QOZB 5M1PA 1KRPA 1CLQA 3ENBA 4B1VA 1W0HA 3KLGA 1GLLO 2D0BA 4DFJA 1BOTO 1FJGK 3VGMA 1YI2N 3RSEA 3H6EA 3O1WA 2W40A 3C7NA 4E19A 4LF4K 1C0MA 4WFAL 2DFHA 3AA5X 5GAGP 1RT5A 3CI5A 1WBDA 1WBBA 4KRFA 2Y1IA 3VEWA 1XC3A 3KK7A 1N36K 1JCGA 2A1SA 4BC4A 3V81A 3C6TA 2RHKA 4X64K 2O8BA 1RDAA 2UUBK 1WN7A 1EX4A 2D0OA 4Z4IA 4ILGB 4FWNA 1XHZA 3V9UA 5E84A 4B9SA 4LH4A 3NGZA 2P9PB 3ATVA 3M8PA 2KQ2A 4DQRA 4CK3A 2VCPA 2NRRA 4CVNE 3J7AP 1JLAA 2PFUA 5CY4A 4DFKA 4DF4A 4WE1A 3OYFA 2YHAA 3MDQA 4YORA 2F4VK 3IS9A 3ZSRA 3KLIA 3GL1A 3KKSA 3HTVA 1REVA 4IO9L 5J2QA 1WLJA 4Z94A 1VSKA 3FFIA 1G15A 5LL6Z 3ZSQA 1ZC6A 1KFSA 1LWEA 1JLBA 5AQTA 4GV3A 2XY5A 3HO1A 4F3TA 3OYMA 1XC9A 3NHGA 4M63C 4W5QA 1YIJN 2OA8A 2A42A 4DV6K 3RRHA 1NGIA 4O5FA 2DFFA 2F96A 1B9FA 4HTUA 2OPSA 2IDOA 5BR8K 3HK2A 4QAGA 3O3FA 4KO0A 1NK4A 3QIPA 3OYAA 4DR4K 2KHOA 5TKYA 4B9LA 4FWOA 4K8XA 4KHQA 4DFMA 3SZ2A 4A57A 3VPZA 3QEVA 1UA1A 3NDKA 1D9DA 1BDGA 1C6VA 3E1YA 5BN8A 2KLAA 1SL0A 1NBWA 5KPZA 2CGJA 2UYTA 1VQNN 4K42A 1S1UA 1LWFA 4ZTFA 4YOWA 5AQVA 3D7EO 4CD1A 3I0SA 3WNFA 4FVMA 5ADXH 2QWPA 4DR3K 2P9UB 4JI4K 1RBRA 1SAZA 2NRVA 2Y1JA 3CCVN 3ENHA 3L2RA 3GDQA 1EETA 1IH7A 1NGBA 2HHQA 1T44A 3HPGA 3D2EB 1LW2A 4YOXA 1M90O 1S1TA 3I0RA 4YOYA 4A62A 5FRNA 1JKHA 1OKJA 2FBYA 3HM8A 3BDPA 4CBUA 4R79A 2P9SB 2RN2A 2PZSA 1QHTA 1FKPA 2HNDA 4LSNA 4QCLA 3UKUB 4CJ4A 4FWKA 2ETJA 1IBLK 3JAMO 3KKRA 4MO5A 4BRPA 4E3SA 3ZYYX 2WONA 3SAGA 2ASOA 3B6PA 1K6YA 4CF2A 3WNGA 4BWMA 4WF9L 4JLHA 1HLUA 1VSEA 3RMAA 4M7XA 1WNSA 3PX4A 3NGYA 4IOAL 1Q18A 1X3NA 4ELTA 3ULDA 3F9MA 3CQ8A 3A0IX 1U47A 1HRHA 4AF1A 3T7ZA 4CBXA 2ZGYA 3ALYA 3H1QA 4B1ZA 3JXUA 4FZZA 4B3RK 4B9NA 4CIEA 1OVYA 3AVBA 3TTDA 4FSVA 5FPNA 1YTUA 4F8RA 1S9GA 1XMQK 4AM6A 4B8CA 1ZXOA 3THWA 3MX5A 4I2PA 3CHWA 3VQQA 3MXIA 1KAZA 4OJRA 5EY4A 1VQ7N 5SZTA 1QS4A 2VG5A 4DKWA 2OZSA 2Z1IA 2QI2A 3I8BA 4WFNL 1O13A 3CC7N 4CZGA 4EFHA 1TYQA 2WUSA 4CHZA 3HOSA 3CQYA 1GLAG 4CJSA 3RTVA 4DF8A 4FOIA 4CD3A 4IEIA 1L3UA 2QWOA 3G10A 4KAZA 3M3ZA 4YDUC 3AVNA 3VA0A 4DU4A 4FWSA 2G8IA 4DTOA 3AVLA 1CZAN 4M3UA 3S9HA 1Z26A 5BRFA 2IVPA 1KAYA 4KV8A 3ULEA 4KI4A 1NU0A 3H3OB 4DQQA 1IV0A 2FC0A 3HP6A 1ATNA 3L4QA 4KFBA 1TL3A 4BR5A 3CXCM 4LFBK 5C0YA 2HOEA 2YKNA 4H0XB 3THVA 1RBSA 5AQZA 3SQ0A 3HPOA 1E4GT 3DOLA 2ITMA 1HPMA 3OYGA 1ASUA 4O8KA 5DM6L 1BCMA 3EYZA 4NO7A 1VHXA 2F9TA 4F2RA 2OPPA 5HL7L 3OYJA 3KK3A 4DTPA 5KGWA 4H0PA 3MMVA 3QESA 2VQEK 4BREA 3DXMB 3TSQA 3VQ8A 4BR7A 1VQ9N 3THWB 1G99A 3PIOL 1X1PA 1SUQA 4LC9B 1NJIO 3PSFA 2QWLA 4FWLA 3SI6A 2CH6A 4JK9A 1RTDA 3NF9A 1X9SA 4LSLA 5KTQA 1QVGM 1J9AA 2V7ZA 3CM6A 3SNNA 4PY5A 1YJ9N 3VTIA 4B1YB 1NGJA 3DJCA 2YNHA 3CJ9A 3CJCA 3VQ6A 4JRPA 1NK6A 4FJ9A 4C8MA 3EE9A 4ISFA 2HB5A 1RDBA 4CZIA 4CJVA 4CEAA 1S1WA 1NJZA 3V4IA 4DR6K 4WYBA 2NLXA 3AVFA 4H5NA 1TGOA 3U8XA 1QSLA 1WSGA 4CJPA 3SCXA 1HNZK 2IIRA 1VSMA 2B6AA 2QKBA 4HTLA 3WXJA 5FRMA 5LJVA 5C2DA 4DU1A 4DG1A 4JK8A 3OYCA 3S3NA 3TANA 3SQ4A 1A5WA 2OPQA 3CCMN 1KVAA 2YI1A 4KREA 3AGKA 3S41A 4H5WA 2F9WA 3OS0A 4RW8A 3MN7A 3VQ9A 3FZKA 2YHXA 3C65A 2NRTA 4DV7K 5CYMA 3KD5E 4Z4HA 3AO4A 2VG6A 2D0AA 1N5YA 1OH6A 1ILYA 3EL2A 3QEXA 3TAMA 2FSJA 2FLOA 2I7PA 1RT2A 5IWAK 3KZBA 4CZEA 2O4GA 2GEMA 2HBLA 4OPJA
chains in the Genus database with same CATH topology
2HMIA 4FLTA 5HRPA 4HUGA 3OYBA 1TK5A 4O55A 1IKVA 3MEEA 4IG0A 3ZSVA 1BISA 1VRTA 3VN5A 2FBVA 1XWLA 3K5LA 4O5BA 2HHWA 2D5RA 3TAQA 3S3MA 3DLHA 4FJKA 2IOCA 4CJEA 1NK4A 4C8OA 4CECA 3VA3A 3OYEA 3HXMA 4AHTA 4B9MA 5DMRA 3OYLA 2P5GA 4HUEA 5KI6A 4FLZA 1QE1A 4W5OA 5EU7A 4OKJA 2XY8A 2ZE2A 4KKOA 3K59A 2HHVA 2G8VA 5C24A 3SV3A 3NF8A 3PO4A 1TKDA 4FM0A 4NYFA 3SUNA 4DU3A 3U3YA 4FJJA 1HNIA 2XO7A 4KHYA 3TAFA 2OPRA 3EZ5A 1NOZA 2YKMA 4O4GA 4CEDA 4E1NA 1CZ9A 1KVCA 2NUBA 4CFCA 4EP4A 1WSEA 4OGCA 2HHTA 3VQEA 1FKOA 2X6NA 4M3TA 4AHRA 2D0CA 3NF7A 4N5SA 3ASMA 3P5JA 4YFUA 3RMCA 3CYMA 1J53A 1EXQA 4FYDA 1L3SA 2HHXA 4ELVA 1C1AA 1U04A 2IC3A 4ICLA 4QOZB 4CGIA 1KRPA 1CLQA 4PA1A 2EX3A 4DTNA 1IO2A 3AVHA 1W0HA 4CHNA 4DTRA 4N56A 3KLGA 1SKSA 1NK7A 2D0BA 4RG8A 4FLVA 3G0ZA 4DFJA 3QNNA 3O3GA 3RWUA 1NKEA 4DMNA 1RT7A 3AVGA 4KTQA 4AILC 3CFRA 2BE2A 2BGGA 1ZBHA 3VQDA 3CFOA 3WNHA 4EP5A 3MECA 1RDDA 4CGJA 1XI1A 4E19A 4E7LA 1C0MA 2X6SA 2DFHA 3AA5X 4CE9A 4CHQA 1C0TA 1HPZA 1HJRA 1RT5A 3BGRA 3QINA 1WSFA 3SV4A 1S6QA 4B8AB 2Y1IA 4KRFA 1S6PA 3OS1A 3AA3A 3V1QA 4CJRA 3NF6A 3TARA 2A1SA 4DSFA 3V81A 3LWMA 1LWCA 4H4OA 4CHOA 4JS5A 3C6TA 4FZXC 3LPUA 3UIQA 4FJLA 4LY7A 1EKEA 1JLFA 1VSDA 1RDAA 4OGEA 2QXFA 3T1AA 3RR8A 1NJWA 1WN7A 4CHYA 4DQPA 1EX4A 3O4QA 2B4JA 1NKBA 3TI0A 1Y97A 3LZIA 2G8FA 4Z4IA 2HHSA 1U45A 4FJ5A 3AVCA 1GOAA 1RILA 1DTQA 4CJ3A 1XHZA 3V9UA 4B9SA 3MEGA 1RT4A 4LH4A 2HNYA 4C8NA 4N47A 3NGIA 3NGZA 3OY9A 3M8PA 3DLKA 1TAQA 2KQ2A 1ZBFA 4CJ5A 4CK3A 4DQRA 4CEFA 5HRNA 1D9FA 3P1GA 3TAEA 2PY5A 2IS3A 3HYFA 2F8SA 4CEQA 1LW0A 3ZT1A 1JLAA 4Y1DA 3KK1A 5CY4A 3OJSA 4HUFA 4DFKA 1YT3A 3QETA 1LAWA 4CIGA 4DF4A 1TKXA 4WE1A 4KHWA 3LALA 4CEZA 4KI6A 1NOYA 3SQ2A 1NK5A 3OYFA 4NCAA 3LAMA 2F8TA 2YHAA 4DLEA 4IBNA 3D0PA 4ID5A 3IS9A 3ZSRA 1ZYQA 1Q9YA 1C1CA 4FJHA 1LAVA 3KLIA 3KJVA 4DQSA 3SPZA 3CG7A 3KKSA 4M42A 4FW1A 1REVA 3F73A 5J2QA 1WLJA 3RRGA 4KPYA 2KFZA 2GBZA 2WOMA 4CF1A 1D8YA 1JLCA 4M3ZA 1VSKA 1S1XA 3FFIA 1G15A 4LH5A 1RCHA 1NK0A 3ZSQA 5HROA 1TAUA 3DLRA 1KFSA 3F9KA 1LWEA 1TKTA 1F21A 3MXMA 3ZSXA 1JLBA 2R7YA 3HO1A 2XY5A 3MXJA 3JSMA 4F3TA 3OYMA 1XC9A 1KLMA 3OS2A 3H08A 3NHGA 4W5QA 2OA8A 2FBTA 4E89A 5CZ1A 4JS4A 3D45A 3RRHA 2DFFA 1ASVA 2F96A 1B9FA 4HTUA 4FJGA 2OPSA 2IDOA 4GVMA 4OLBA 1Z25A 5CZ2A 3K58A 4B9TA 4FJNA 5D3GA 3HK2A 1NJXA 1C1BA 3DLEA 4QAGA 4KO0A 3O3FA 3LP0A 3QIPA 3NH1A 3NH0A 3OYAA 1HQEA 4CFBA 4CCHA 4F4KA 3AVAA 4RW6A 3V9ZA 4B9LA 1SL1A 4M3XA 4K8XA 4KHQA 1U48A 1BIUA 3LDSA 1QSSA 3TWHA 3ZSOA 4F3OA 4DQIA 1ZBUA 4DFMA 4F2SA 2HW3A 4N41A 1BCOA 3SZ2A 3KD1E 1RNHA 1RT6A 3AO3A 3LP1A 4HHTA 3QEVA 1UA1A 1X9WA 1BGXT 3NDKA 1D9DA 3O4NA 1C6VA 3VQ7A 4CJUA 3DRPA 1SL0A 1WAFA 4FJ7A 3HT3A 4FM1A 3PX6A 1S5JA 4OPKA 4B3OA 1UA0A 1T03A 1NKCA 1QSYA 4AHSA 1S1UA 3LANA 3TR8A 1LWFA 4BE2A 4ZTFA 4ID1A 4RW7A 3PV8A 3O3HA 4AH9A 4DWIA 4CK1A 3CM5A 3DM2A 4GW6A 2P1JA 3I0SA 1HYZA 3L2VA 3WNFA 3DMJA 3AV9A 4DLGA 4OLAA 4FVMA 4CIFA 4CGFA 1YVUA 4NYNA 2DY4A 2X74A 2KZZA 1RBRA 1S9EA 1NJYA 4RW9A 1SL2A 3T3FA 2Y1JA 5KGXA 1I3AA 2KW4A 3L2RA 4Z4FA 3K5MA 3S3OA 1DTTA 1BI4B 1EETA 3QNOA 1IH7A 2HVHA 3QO9A 1RBUA 3AA4A 4I9LA 1IKWA 4AHUA 2G8WA 2HHQA 2DTUA 4AHCA 1BL3A 3HPGA 1KFDA 4E7IA 1IG9A 1LW2A 3VQ5A 4BE0A 1S1TA 3I0RA 3KLFA 2KZMA 4CHPA 5FRNA 2YHBA 4IFYA 1JKHA 4OVLA 2JGUA 2FBYA 3HSTB 4CJFA 3KK2A 3BDPA 4FJXA 4TSXA 4FK2A 1KTQA 1L3VA 2P51A 2RN2A 3VQ4A 3TABA 1C0UA 1FKPA 1QHTA 2HNDA 4LSNA 5KRTA 2PZSA 1CXQA 3ZCMA 3ISNC 4Z4EA 1SKRA 4CJ4A 4CESA 4CGDA 2ETJA 3MEDA 5I42A 2HHUA 3KKRA 3KLHA 3NFAA 3OJUA 4IFVA 5JS2A 4E3SA 3K5OA 2WONA 3V6DA 3B6PA 4DS5A 1T05A 4M45A 1K6YA 4CF2A 3EY1A 2OYQA 4MQ3A 3WNGA 4BWMA 3JYTA 2JLEA 4JLHA 3I8DA 4CJLA 4R5PA 3A2FA 2E6LA 1KSPA 1VK0A 5E41A 1VSEA 3KLEA 3RMAA 3AVIA 2YV0X 4G1QA 4Y1CA 4CF9A 1WNSA 4AHVA 2ITGA 3PX4A 1J54A 2ZQBA 3NGYA 4KHUA 5HLFA 2G8HA 3RR7A 4C8LA 4CEEA 2Z1JA 4KTZA 1KVBA 1MU2A 4ELTA 3PUFA 2XHBA 1RBTA 3ULDA 3CQ8A 4ELUA 3AO5A 3NH2A 3SPYA 3LP2A 5C25A 2KTQA 1VSFA 3C94A 4E7HA 1HRHA 1U47A 1A5XA 4K8ZA 2HVIA 3IAYA 1WSJA 4FZZA 3ALYA 4FK4A 3NBPA 4BDPA 3IG1A 4O0IA 4B9NA 3MAQA 4CIEA 3AVBA 1JXEA 2RF2A 3HVTA 4HCCA 4PWDA 4EZ6A 5HRSA 4ZTJA 1Q9XA 1YTUA 2G8UA 4F8RA 3VQCA 1S9GA 4B8CA 3ZSWA 1YTAA 1TK8A 3P83D 2VG7A 3OYIA 1BQNA 4FLYA 1B92A 4I2PA 4O0JA 4BWJA 2VWJA 3VQQA 3DLBA 4FJIA 3MXIA 4OJRA 3HP9A 4XIUA 1ZBIA 5SZTA 1QS4A 2VG5A 1B9DA 1L3TA 3RMBA 2OZSA 1DLOA 2Z1IA 5FROA 1N6QA 2ZD1A 4DS4A 4IKFA 3K2PA 2YNIA 4DTXA 3QEPA 1L5UA 1JXBA 1WSIA 4Z0UA 1IKXA 3DLGA 3U6FA 1ZBLA 4CK2A 1SKWA 5JS1A 1U4BA 3T19A 3AVJA 3KTQA 4E0DA 4NCBA 5K14A 2BDPA 3QERA 1RT3A 1VSHA 4CHZA 2EHGA 5KRSA 2GUIA 4CJQA 2YNGA 1A5VA 4PUOA 1GOBA 4CJSA 2Z1HA 3RTVA 4DF8A 2IAJA 3LWLA 4W5RA 4DTUA 4DFPA 3U3GA 1RBVA 1TKZA 3HJFA 4M41A 1L3UA 5DK5A 4CEOA 4ZHRA 3HM9A 1BIZA 3G10A 3OYHA 4M3RA 3L8BA 3IRXA 4W5TA 1VSJA 4FM2A 4KAZA 3B6OA 4B9UA 2I5JA 1HYSA 3AVNA 3LP3A 2VWKA 4M3WA 3DOKA 1FK9A 3VA0A 4DU4A 4CF8A 4C8KA 2G8IA 1ITGA 4YNQA 3M8RA 4BDYA 1HYVA 3AVLA 4DTOA 3SUQA 3PY8A 4FW2A 3QLHA 2QK9A 2FBXA 4M3UA 3S9HA 1Z26A 1NK8A 4FZYA 4Z4GA 5C42A 4KV8A 4I9QA 4HVJA 1VSLA 2O4IA 3ZT4A 3K5NA 1RTJA 2E6MA 2LSNA 4KI4A 4N76A 4BACA 5HBMA 3NAEA 4DQQA 4MFBA 2FC0A 3HP6A 1HQUA 3AVMA 3ZSZA 4KFBA 1TL3A 1VRUA 3RMDA 4OKKA 3ZT3A 3OYNA 2YKNA 4RW4A 4BE1A 3THVA 2A1RA 1RBSA 4KB0A 3SQ0A 3HPOA 3DOLA 2BANA 3HVRA 1XHXA 3OYGA 1ASUA 2DFEA 4CJKA 1CZBA 1WAJA 3OYKA 3HL8A 3SUPA 3LZJA 1BCMA 5J1EA 3EYZA 1R0AA 1T8EA 1Q8IA 5I3UA 4F2RA 2G8KA 2OPPA 1RDCA 3V1RA 3E01A 3OYJA 3KK3A 4DTPA 3ITHA 5KGWA 4FJMA 4FJ8A 3TAGA 1TVRA 4Q0BA 3CFPA 3NE6A 3M8QA 4FK0A 1UWBA 3PX0A 2XY6A 3QEIA 3VQBA 4BDZA 1JL1A 1SV5A 2PYLA 3QESA 3OVNA 3L3UA 3L3VA 1TK0A 3DYAA 1UOCA 4DSIA 5J2PA 2PYJA 4J2AA 3SUOA 1JL2A 3VQ8A 2XRIA 4QCLA 1VSIA 4KHNA 4E1MA 5FDLA 1X1PA 1SUQA 2RKIA 3WNEA 5SWMA 1LV5A 3SI6A 1RTDA 3NF9A 1X9SA 4IDKA 4E7JA 3LPTA 4LSLA 1U49A 5KTQA 3AO1A 4J2BA 2HNZA 4KTWA 5T7BA 3V9SA 1J9AA 3CM6A 3ZSYA 3SNNA 4J2EA 4OKEA 4DTSA 1X9MA 1RTHA 2ATQA 1D5AA 4PY5A 1RTIA 1WSHA 1JLQA 4CJTA 1UAXA 4FXDA 1T7PA 2YNHA 1BHLA 2Q3SA 1J5OA 2AJQA 4IG3A 5HP1A 4L8RB 3AA2A 2YNFA 3VQPA 2IGIA 5HRRA 4B08A 3VQ6A 4JRPA 4DSEA 3SQ1A 1NK6A 4EZ9A 1I39A 5J2NA 4FJ9A 4CERA 1NK9A 4C8MA 4LD0A 4CGGA 1KLNA 2P5OA 1IKYA 2HB5A 1RDBA 2E4LA 4CJVA 2QKKA 4CEAA 1S1WA 1TV6A 1NJZA 4CGHA 4DTJA 3V4IA 4PQUA 2X78A 1KCFA 4I7FA 3L2UA 3AVFA 1TGOA 2OZMA 1TL1A 3KIOA 1WSGA 3M8SA 2GV9A 3C95A 1QSLA 1W9HA 4I2QA 3DRRA 1HNVA 4CJPA 4DSJA 4DSKA 3SCXA 2Z1GA 1VSMA 3L2QA 4E7KA 2B6AA 4O44A 3VQAA 5J2MA 4CEBA 2QKBA 3QEWA 5FRMA 4FCYA 2RPIA 2KFNA 1QQCA 4FLWA 1JLGA 4CFAA 3K57A 4FLXA 1JLEA 3LAKA 4DU1A 4DG1A 1ASWA 3HPHA 2B5JA 3V9WA 4UQGA 3PO5A 4KHSA 4KB1A 3OYCA 2XY7A 3S3NA 3TANA 3SQ4A 3V1OA 4Q5VA 1BI4A 1A5WA 1HMVA 2OPQA 3DRSA 3ZT2A 4FLUA 3TAPA 1EP4A 4CFDA 3OYDA 4CF0A 4B9VA 4GMJB 4HCBA 1KVAA 4KREA 1GOCA 1QTMA 5CYQA 3OS0A 4DTMA 1BQMA 4RW8A 4JRQA 4NCGA 4CJWA 4DSLA 3VQ9A 4Z4CA 3SYZA 1FXXA 3V9XA 3KD5E 5CYMA 4H4MA 4Z4HA 3AO4A 3NCIA 3DI6A 1O1WA 2VG6A 2D0AA 3AVKA 1N5YA 3L2WA 4M3YA 3QEXA 3TAMA 4W5NA 3SJJA 2W42A 4H8KA 1RT1A 3AO2A 3C6UA 1S1VA 1RT2A 3ZT0A 3QIOA 4J2DA 2O4GA 1CXUA 4OPJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMI A;  4FLT A;  5HRP A;  4HUG A;  3OYB A;  1TK5 A;  4O55 A;  1IKV A;  3MEE A;  4IG0 A;  3ZSV A;  1BIS A;  1VRT A;  3VN5 A;  2FBV A;  1XWL A;  3K5L A;  4O5B A;  2HHW A;  2D5R A;  3TAQ A;  3S3M A;  3DLH A;  4FJK A;  2IOC A;  4CJE A;  1NK4 A;  4C8O A;  4CEC A;  3VA3 A;  3OYE A;  3HXM A;  4AHT A;  4B9M A;  5DMR A;  3OYL A;  2P5G A;  4HUE A;  5KI6 A;  4FLZ A;  1QE1 A;  4W5O A;  5EU7 A;  4OKJ A;  2XY8 A;  2ZE2 A;  4KKO A;  3K59 A;  2HHV A;  2G8V A;  5C24 A;  3SV3 A;  3NF8 A;  3PO4 A;  1TKD A;  4FM0 A;  4NYF A;  3SUN A;  4DU3 A;  3U3Y A;  4FJJ A;  1HNI A;  2XO7 A;  4KHY A;  3TAF A;  2OPR A;  3EZ5 A;  1NOZ A;  2YKM A;  4O4G A;  4CED A;  4E1N A;  1CZ9 A;  1KVC A;  2NUB A;  4CFC A;  4EP4 A;  1WSE A;  4OGC A;  2HHT A;  3VQE A;  1FKO A;  2X6N A;  4M3T A;  4AHR A;  2D0C A;  3NF7 A;  4N5S A;  3ASM A;  3P5J A;  4YFU A;  3RMC A;  3CYM A;  1J53 A;  1EXQ A;  4FYD A;  1L3S A;  2HHX A;  4ELV A;  1C1A A;  1U04 A;  2IC3 A;  4ICL A;  4QOZ B;  4CGI A;  1KRP A;  1CLQ A;  4PA1 A;  2EX3 A;  4DTN A;  1IO2 A;  3AVH A;  1W0H A;  4CHN A;  4DTR A;  4N56 A;  3KLG A;  1SKS A;  1NK7 A;  2D0B A;  4RG8 A;  4FLV A;  3G0Z A;  4DFJ A;  3QNN A;  3O3G A;  3RWU A;  1NKE A;  4DMN A;  1RT7 A;  3AVG A;  4KTQ A;  4AIL C;  3CFR A;  2BE2 A;  2BGG A;  1ZBH A;  3VQD A;  3CFO A;  3WNH A;  4EP5 A;  3MEC A;  1RDD A;  4CGJ A;  1XI1 A;  4E19 A;  4E7L A;  1C0M A;  2X6S A;  2DFH A;  3AA5 X;  4CE9 A;  4CHQ A;  1C0T A;  1HPZ A;  1HJR A;  1RT5 A;  3BGR A;  3QIN A;  1WSF A;  3SV4 A;  1S6Q A;  4B8A B;  2Y1I A;  4KRF A;  1S6P A;  3OS1 A;  3AA3 A;  3V1Q A;  4CJR A;  3NF6 A;  3TAR A;  2A1S A;  4DSF A;  3V81 A;  3LWM A;  1LWC A;  4H4O A;  4CHO A;  4JS5 A;  3C6T A;  4FZX C;  3LPU A;  3UIQ A;  4FJL A;  4LY7 A;  1EKE A;  1JLF A;  1VSD A;  1RDA A;  4OGE A;  2QXF A;  3T1A A;  3RR8 A;  1NJW A;  1WN7 A;  4CHY A;  4DQP A;  1EX4 A;  3O4Q A;  2B4J A;  1NKB A;  3TI0 A;  1Y97 A;  3LZI A;  2G8F A;  4Z4I A;  2HHS A;  1U45 A;  4FJ5 A;  3AVC A;  1GOA A;  1RIL A;  1DTQ A;  4CJ3 A;  1XHZ A;  3V9U A;  4B9S A;  3MEG A;  1RT4 A;  4LH4 A;  2HNY A;  4C8N A;  4N47 A;  3NGI A;  3NGZ A;  3OY9 A;  3M8P A;  3DLK A;  1TAQ A;  2KQ2 A;  1ZBF A;  4CJ5 A;  4CK3 A;  4DQR A;  4CEF A;  5HRN A;  1D9F A;  3P1G A;  3TAE A;  2PY5 A;  2IS3 A;  3HYF A;  2F8S A;  4CEQ A;  1LW0 A;  3ZT1 A;  1JLA A;  4Y1D A;  3KK1 A;  5CY4 A;  3OJS A;  4HUF A;  4DFK A;  1YT3 A;  3QET A;  1LAW A;  4CIG A;  4DF4 A;  1TKX A;  4WE1 A;  4KHW A;  3LAL A;  4CEZ A;  4KI6 A;  1NOY A;  3SQ2 A;  1NK5 A;  3OYF A;  4NCA A;  3LAM A;  2F8T A;  2YHA A;  4DLE A;  4IBN A;  3D0P A;  4ID5 A;  3IS9 A;  3ZSR A;  1ZYQ A;  1Q9Y A;  1C1C A;  4FJH A;  1LAV A;  3KLI A;  3KJV A;  4DQS A;  3SPZ A;  3CG7 A;  3KKS A;  4M42 A;  4FW1 A;  1REV A;  3F73 A;  5J2Q A;  1WLJ A;  3RRG A;  4KPY A;  2KFZ A;  2GBZ A;  2WOM A;  4CF1 A;  1D8Y A;  1JLC A;  4M3Z A;  1VSK A;  1S1X A;  3FFI A;  1G15 A;  4LH5 A;  1RCH A;  1NK0 A;  3ZSQ A;  5HRO A;  1TAU A;  3DLR A;  1KFS A;  3F9K A;  1LWE A;  1TKT A;  1F21 A;  3MXM A;  3ZSX A;  1JLB A;  2R7Y A;  3HO1 A;  2XY5 A;  3MXJ A;  3JSM A;  4F3T A;  3OYM A;  1XC9 A;  1KLM A;  3OS2 A;  3H08 A;  3NHG A;  4W5Q A;  2OA8 A;  2FBT A;  4E89 A;  5CZ1 A;  4JS4 A;  3D45 A;  3RRH A;  2DFF A;  1ASV A;  2F96 A;  1B9F A;  4HTU A;  4FJG A;  2OPS A;  2IDO A;  4GVM A;  4OLB A;  1Z25 A;  5CZ2 A;  3K58 A;  4B9T A;  4FJN A;  5D3G A;  3HK2 A;  1NJX A;  1C1B A;  3DLE A;  4QAG A;  4KO0 A;  3O3F A;  3LP0 A;  3QIP A;  3NH1 A;  3NH0 A;  3OYA A;  1HQE A;  4CFB A;  4CCH A;  4F4K A;  3AVA A;  4RW6 A;  3V9Z A;  4B9L A;  1SL1 A;  4M3X A;  4K8X A;  4KHQ A;  1U48 A;  1BIU A;  3LDS A;  1QSS A;  3TWH A;  3ZSO A;  4F3O A;  4DQI A;  1ZBU A;  4DFM A;  4F2S A;  2HW3 A;  4N41 A;  1BCO A;  3SZ2 A;  3KD1 E;  1RNH A;  1RT6 A;  3AO3 A;  3LP1 A;  4HHT A;  3QEV A;  1UA1 A;  1X9W A;  1BGX T;  3NDK A;  1D9D A;  3O4N A;  1C6V A;  3VQ7 A;  4CJU A;  3DRP A;  1SL0 A;  1WAF A;  4FJ7 A;  3HT3 A;  4FM1 A;  3PX6 A;  1S5J A;  4OPK A;  4B3O A;  1UA0 A;  1T03 A;  1NKC A;  1QSY A;  4AHS A;  1S1U A;  3LAN A;  3TR8 A;  1LWF A;  4BE2 A;  4ZTF A;  4ID1 A;  4RW7 A;  3PV8 A;  3O3H A;  4AH9 A;  4DWI A;  4CK1 A;  3CM5 A;  3DM2 A;  4GW6 A;  2P1J A;  3I0S A;  1HYZ A;  3L2V A;  3WNF A;  3DMJ A;  3AV9 A;  4DLG A;  4OLA A;  4FVM A;  4CIF A;  4CGF A;  1YVU A;  4NYN A;  2DY4 A;  2X74 A;  2KZZ A;  1RBR A;  1S9E A;  1NJY A;  4RW9 A;  1SL2 A;  3T3F A;  2Y1J A;  5KGX A;  1I3A A;  2KW4 A;  3L2R A;  4Z4F A;  3K5M A;  3S3O A;  1DTT A;  1BI4 B;  1EET A;  3QNO A;  1IH7 A;  2HVH A;  3QO9 A;  1RBU A;  3AA4 A;  4I9L A;  1IKW A;  4AHU A;  2G8W A;  2HHQ A;  2DTU A;  4AHC A;  1BL3 A;  3HPG A;  1KFD A;  4E7I A;  1IG9 A;  1LW2 A;  3VQ5 A;  4BE0 A;  1S1T A;  3I0R A;  3KLF A;  2KZM A;  4CHP A;  5FRN A;  2YHB A;  4IFY A;  1JKH A;  4OVL A;  2JGU A;  2FBY A;  3HST B;  4CJF A;  3KK2 A;  3BDP A;  4FJX A;  4TSX A;  4FK2 A;  1KTQ A;  1L3V A;  2P51 A;  2RN2 A;  3VQ4 A;  3TAB A;  1C0U A;  1FKP A;  1QHT A;  2HND A;  4LSN A;  5KRT A;  2PZS A;  1CXQ A;  3ZCM A;  3ISN C;  4Z4E A;  1SKR A;  4CJ4 A;  4CES A;  4CGD A;  2ETJ A;  3MED A;  5I42 A;  2HHU A;  3KKR A;  3KLH A;  3NFA A;  3OJU A;  4IFV A;  5JS2 A;  4E3S A;  3K5O A;  2WON A;  3V6D A;  3B6P A;  4DS5 A;  1T05 A;  4M45 A;  1K6Y A;  4CF2 A;  3EY1 A;  2OYQ A;  4MQ3 A;  3WNG A;  4BWM A;  3JYT A;  2JLE A;  4JLH A;  3I8D A;  4CJL A;  4R5P A;  3A2F A;  2E6L A;  1KSP A;  1VK0 A;  5E41 A;  1VSE A;  3KLE A;  3RMA A;  3AVI A;  2YV0 X;  4G1Q A;  4Y1C A;  4CF9 A;  1WNS A;  4AHV A;  2ITG A;  3PX4 A;  1J54 A;  2ZQB A;  3NGY A;  4KHU A;  5HLF A;  2G8H A;  3RR7 A;  4C8L A;  4CEE A;  2Z1J A;  4KTZ A;  1KVB A;  1MU2 A;  4ELT A;  3PUF A;  2XHB A;  1RBT A;  3ULD A;  3CQ8 A;  4ELU A;  3AO5 A;  3NH2 A;  3SPY A;  3LP2 A;  5C25 A;  2KTQ A;  1VSF A;  3C94 A;  4E7H A;  1HRH A;  1U47 A;  1A5X A;  4K8Z A;  2HVI A;  3IAY A;  1WSJ A;  4FZZ A;  3ALY A;  4FK4 A;  3NBP A;  4BDP A;  3IG1 A;  4O0I A;  4B9N A;  3MAQ A;  4CIE A;  3AVB A;  1JXE A;  2RF2 A;  3HVT A;  4HCC A;  4PWD A;  4EZ6 A;  5HRS A;  4ZTJ A;  1Q9X A;  1YTU A;  2G8U A;  4F8R A;  3VQC A;  1S9G A;  4B8C A;  3ZSW A;  1YTA A;  1TK8 A;  3P83 D;  2VG7 A;  3OYI A;  1BQN A;  4FLY A;  1B92 A;  4I2P A;  4O0J A;  4BWJ A;  2VWJ A;  3VQQ A;  3DLB A;  4FJI A;  3MXI A;  4OJR A;  3HP9 A;  4XIU A;  1ZBI A;  5SZT A;  1QS4 A;  2VG5 A;  1B9D A;  1L3T A;  3RMB A;  2OZS A;  1DLO A;  2Z1I A;  5FRO A;  1N6Q A;  2ZD1 A;  4DS4 A;  4IKF A;  3K2P A;  2YNI A;  4DTX A;  3QEP A;  1L5U A;  1JXB A;  1WSI A;  4Z0U A;  1IKX A;  3DLG A;  3U6F A;  1ZBL A;  4CK2 A;  1SKW A;  5JS1 A;  1U4B A;  3T19 A;  3AVJ A;  3KTQ A;  4E0D A;  4NCB A;  5K14 A;  2BDP A;  3QER A;  1RT3 A;  1VSH A;  4CHZ A;  2EHG A;  5KRS A;  2GUI A;  4CJQ A;  2YNG A;  1A5V A;  4PUO A;  1GOB A;  4CJS A;  2Z1H A;  3RTV A;  4DF8 A;  2IAJ A;  3LWL A;  4W5R A;  4DTU A;  4DFP A;  3U3G A;  1RBV A;  1TKZ A;  3HJF A;  4M41 A;  1L3U A;  5DK5 A;  4CEO A;  4ZHR A;  3HM9 A;  1BIZ A;  3G10 A;  3OYH A;  4M3R A;  3L8B A;  3IRX A;  4W5T A;  1VSJ A;  4FM2 A;  4KAZ A;  3B6O A;  4B9U A;  2I5J A;  1HYS A;  3AVN A;  3LP3 A;  2VWK A;  4M3W A;  3DOK A;  1FK9 A;  3VA0 A;  4DU4 A;  4CF8 A;  4C8K A;  2G8I A;  1ITG A;  4YNQ A;  3M8R A;  4BDY A;  1HYV A;  3AVL A;  4DTO A;  3SUQ A;  3PY8 A;  4FW2 A;  3QLH A;  2QK9 A;  2FBX A;  4M3U A;  3S9H A;  1Z26 A;  1NK8 A;  4FZY A;  4Z4G A;  5C42 A;  4KV8 A;  4I9Q A;  4HVJ A;  1VSL A;  2O4I A;  3ZT4 A;  3K5N A;  1RTJ A;  2E6M A;  2LSN A;  4KI4 A;  4N76 A;  4BAC A;  5HBM A;  3NAE A;  4DQQ A;  4MFB A;  2FC0 A;  3HP6 A;  1HQU A;  3AVM A;  3ZSZ A;  4KFB A;  1TL3 A;  1VRU A;  3RMD A;  4OKK A;  3ZT3 A;  3OYN A;  2YKN A;  4RW4 A;  4BE1 A;  3THV A;  2A1R A;  1RBS A;  4KB0 A;  3SQ0 A;  3HPO A;  3DOL A;  2BAN A;  3HVR A;  1XHX A;  3OYG A;  1ASU A;  2DFE A;  4CJK A;  1CZB A;  1WAJ A;  3OYK A;  3HL8 A;  3SUP A;  3LZJ A;  1BCM A;  5J1E A;  3EYZ A;  1R0A A;  1T8E A;  1Q8I A;  5I3U A;  4F2R A;  2G8K A;  2OPP A;  1RDC A;  3V1R A;  3E01 A;  3OYJ A;  3KK3 A;  4DTP A;  3ITH A;  5KGW A;  4FJM A;  4FJ8 A;  3TAG A;  1TVR A;  4Q0B A;  3CFP A;  3NE6 A;  3M8Q A;  4FK0 A;  1UWB A;  3PX0 A;  2XY6 A;  3QEI A;  3VQB A;  4BDZ A;  1JL1 A;  1SV5 A;  2PYL A;  3QES A;  3OVN A;  3L3U A;  3L3V A;  1TK0 A;  3DYA A;  1UOC A;  4DSI A;  5J2P A;  2PYJ A;  4J2A A;  3SUO A;  1JL2 A;  3VQ8 A;  2XRI A;  4QCL A;  1VSI A;  4KHN A;  4E1M A;  5FDL A;  1X1P A;  1SUQ A;  2RKI A;  3WNE A;  5SWM A;  1LV5 A;  3SI6 A;  1RTD A;  3NF9 A;  1X9S A;  4IDK A;  4E7J A;  3LPT A;  4LSL A;  1U49 A;  5KTQ A;  3AO1 A;  4J2B A;  2HNZ A;  4KTW A;  5T7B A;  3V9S A;  1J9A A;  3CM6 A;  3ZSY A;  3SNN A;  4J2E A;  4OKE A;  4DTS A;  1X9M A;  1RTH A;  2ATQ A;  1D5A A;  4PY5 A;  1RTI A;  1WSH A;  1JLQ A;  4CJT A;  1UAX A;  4FXD A;  1T7P A;  2YNH A;  1BHL A;  2Q3S A;  1J5O A;  2AJQ A;  4IG3 A;  5HP1 A;  4L8R B;  3AA2 A;  2YNF A;  3VQP A;  2IGI A;  5HRR A;  4B08 A;  3VQ6 A;  4JRP A;  4DSE A;  3SQ1 A;  1NK6 A;  4EZ9 A;  1I39 A;  5J2N A;  4FJ9 A;  4CER A;  1NK9 A;  4C8M A;  4LD0 A;  4CGG A;  1KLN A;  2P5O A;  1IKY A;  2HB5 A;  1RDB A;  2E4L A;  4CJV A;  2QKK A;  4CEA A;  1S1W A;  1TV6 A;  1NJZ A;  4CGH A;  4DTJ A;  3V4I A;  4PQU A;  2X78 A;  1KCF A;  4I7F A;  3L2U A;  3AVF A;  1TGO A;  2OZM A;  1TL1 A;  3KIO A;  1WSG A;  3M8S A;  2GV9 A;  3C95 A;  1QSL A;  1W9H A;  4I2Q A;  3DRR A;  1HNV A;  4CJP A;  4DSJ A;  4DSK A;  3SCX A;  2Z1G A;  1VSM A;  3L2Q A;  4E7K A;  2B6A A;  4O44 A;  3VQA A;  5J2M A;  4CEB A;  2QKB A;  3QEW A;  5FRM A;  4FCY A;  2RPI A;  2KFN A;  1QQC A;  4FLW A;  1JLG A;  4CFA A;  3K57 A;  4FLX A;  1JLE A;  3LAK A;  4DU1 A;  4DG1 A;  1ASW A;  3HPH A;  2B5J A;  3V9W A;  4UQG A;  3PO5 A;  4KHS A;  4KB1 A;  3OYC A;  2XY7 A;  3S3N A;  3TAN A;  3SQ4 A;  3V1O A;  4Q5V A;  1BI4 A;  1A5W A;  1HMV A;  2OPQ A;  3DRS A;  3ZT2 A;  4FLU A;  3TAP A;  1EP4 A;  4CFD A;  3OYD A;  4CF0 A;  4B9V A;  4GMJ B;  4HCB A;  1KVA A;  4KRE A;  1GOC A;  1QTM A;  5CYQ A;  3OS0 A;  4DTM A;  1BQM A;  4RW8 A;  4JRQ A;  4NCG A;  4CJW A;  4DSL A;  3VQ9 A;  4Z4C A;  3SYZ A;  1FXX A;  3V9X A;  3KD5 E;  5CYM A;  4H4M A;  4Z4H A;  3AO4 A;  3NCI A;  3DI6 A;  1O1W A;  2VG6 A;  2D0A A;  3AVK A;  1N5Y A;  3L2W A;  4M3Y A;  3QEX A;  3TAM A;  4W5N A;  3SJJ A;  2W42 A;  4H8K A;  1RT1 A;  3AO2 A;  3C6U A;  1S1V A;  1RT2 A;  3ZT0 A;  3QIO A;  4J2D A;  2O4G A;  1CXU A;  4OPJ A; 
#chains in the Genus database with same CATH topology
 4FLT A;  4HUG A;  1TK5 A;  3ID6 A;  3D2E A;  4PL8 A;  1NGH A;  1RFQ A;  2FBV A;  3ZX3 A;  1IJJ A;  2WTU A;  2Q0U A;  2QWN A;  4AHT A;  5DMR A;  2RE2 A;  4H5V A;  4DV4 K;  4HUE A;  5KI6 A;  4FLZ A;  2ZE2 A;  1IBM K;  2VWB A;  4B9Q A;  1YXQ A;  4NYF A;  3TAF A;  1Q86 O;  5ELZ A;  2P9I A;  4CED A;  4O4G A;  1CZ9 A;  4OGC A;  4AQY K;  4DV2 K;  3CIP A;  4N5S A;  2D0C A;  2GWJ A;  4BRQ A;  3D2F B;  1L3S A;  2HHX A;  1QZ5 A;  2HST A;  2IC3 A;  5LMN K;  5M1Q A;  1U2V B;  1IO2 A;  4NLC A;  4XH4 A;  4DTR A;  4RG8 A;  3RWU A;  3WEE A;  1NKE A;  2YJE A;  3WXI A;  1ZBH A;  3VQD A;  3WNH A;  4X65 K;  2O8F B;  5EXW A;  1XI1 A;  4E7L A;  2WBN A;  2IVO A;  3QIN A;  5AFU H;  1WSF A;  3VF4 A;  2E88 A;  3OS1 A;  1EQY A;  1QQO A;  4X62 K;  1LWC A;  4JS5 A;  3LPU A;  1VSD A;  4OGE A;  3T1A A;  3RR8 A;  2QXF A;  1K8K B;  4PKI A;  3VGL A;  1Y97 A;  2J4R A;  3QFP A;  4KH4 A;  3O9R A;  2G8F A;  2HHS A;  1U45 A;  4FJ5 A;  3AVC A;  1GOA A;  1DTQ A;  1ATR A;  4C8N A;  2QA4 N;  2HNY A;  4K41 A;  3OY9 A;  3DLK A;  1ZBF A;  1I94 K;  1GLE G;  4JKA A;  1D9F A;  3TAE A;  5GIP A;  5MLC Q;  2QWM A;  1LW0 A;  3ZT1 A;  4Y1D A;  3KK1 A;  1YT3 A;  3QET A;  2QWQ A;  2WC9 A;  4KHW A;  4ISE A;  3LAL A;  3CJ7 A;  4HWI A;  3SQ2 A;  1FW6 A;  3LAM A;  2ZWH A;  1C1C A;  3SPZ A;  4BRC A;  3RRG A;  4KH5 A;  2GX9 A;  2GBZ A;  3LDL A;  1NWK A;  1JLC A;  3P31 A;  1YHQ N;  2O8D A;  1RCH A;  3GBT A;  1NK0 A;  1XNR K;  3CC4 N;  5HRO A;  3ZX2 A;  3F9K A;  5C15 A;  3MXM A;  3ZSX A;  2R7Y A;  3JSM A;  5HOO A;  3OS2 A;  4H03 B;  4E89 A;  5AQF A;  3QBX A;  2CGL A;  3D45 A;  4FJG A;  4OLB A;  5CZ2 A;  4FJN A;  1NJX A;  1C1B A;  3NH1 A;  4F4K A;  5BRE A;  3AVA A;  1VQP N;  3V9Z A;  1TUU A;  2DPN A;  3IKM A;  1SL1 A;  3LDS A;  3ZSO A;  4F3O A;  1ZBU A;  2E2P A;  1BCO A;  3ZX0 A;  3KD1 E;  1RNH A;  1N32 K;  1V4S A;  4HHT A;  5AQI A;  3EEQ A;  2NRZ A;  1H1V A;  2QW9 A;  4CJU A;  3DRP A;  3HT3 A;  3QDK A;  4BRH A;  3H1V X;  3OW2 M;  1NKC A;  4AHS A;  3CER A;  3QB0 A;  4ID1 A;  4AH9 A;  5GAH P;  4CK1 A;  3DM2 A;  2P1J A;  3L2V A;  1HYZ A;  4DLG A;  5E26 A;  4OLA A;  5M1N A;  2GEL A;  4CGF A;  2X74 A;  2Q1N A;  1S9E A;  2Q97 A;  1NGG A;  4IFE A;  4RW9 A;  4BR2 A;  3T3F A;  4JI3 K;  2KW4 A;  4Z4F A;  2HVH A;  3K5M A;  1DTT A;  3QNO A;  2FSN A;  5JLF A;  3QO9 A;  3R1X A;  1Q82 O;  1BL3 A;  2ZJR L;  1KFD A;  4E7I A;  3IDH A;  1IG9 A;  3HSC A;  2UU9 K;  4FK2 A;  4X66 K;  1L3V A;  2P51 A;  5M1K A;  2ASP A;  2A40 A;  3ZCM A;  4Z4E A;  4MLH A;  3GOI A;  4CGD A;  3MED A;  3NFA A;  3OJU A;  4IFV A;  4BRF A;  3FZL A;  3MCA B;  4DS5 A;  5C2F A;  4M45 A;  3O6W A;  3EY1 A;  2OYQ A;  3JYT A;  4CJL A;  3VET A;  2E6L A;  5H1S Q;  4LF9 K;  4G1Q A;  4Y1C A;  3G25 A;  4CF9 A;  4AHV A;  2ITG A;  5FPE A;  4BVP A;  3EE8 A;  4CEE A;  4KTZ A;  1MU2 A;  2XHB A;  3AO5 A;  3OHR A;  3NH2 A;  5AQW A;  3C94 A;  1A5X A;  1WSJ A;  4BG8 A;  4H5T A;  3CF5 L;  3MAQ A;  3HVT A;  1JXE A;  4EZ6 A;  1YVN A;  3VQC A;  4GV9 A;  3OYI A;  4O0J A;  3DLB A;  4FJI A;  2O8C A;  3MK6 A;  1QHA A;  3R6M A;  4LFC K;  4DUZ K;  1L3T A;  1DLO A;  1N6Q A;  3RVC A;  1JJ2 M;  4YOT A;  4IKF A;  3K2P A;  4K0K K;  4DTX A;  4LF6 K;  1JXB A;  2E2Q A;  1WSI A;  1E4F T;  3DLG A;  3O9Q A;  3U6F A;  3KVG A;  1ZBL A;  1S72 N;  1U4B A;  1SKW A;  2HBJ A;  4YOV A;  3BUZ B;  3L4I A;  5K14 A;  1VSH A;  2EHG A;  5KRS A;  4CJQ A;  3FFK B;  4JI6 K;  3CPW M;  1GOB A;  2IAJ A;  4CZJ A;  4W5R A;  3LWL A;  3O8M A;  4BRK A;  4DTU A;  4CEO A;  2YHY A;  5C10 A;  3P38 A;  4W5T A;  1HYS A;  3B6O A;  4B9U A;  1FK9 A;  4FL9 A;  4C8K A;  2Q0R A;  1HYV A;  4FW2 A;  2QK9 A;  1KC8 O;  3UB5 A;  3NVK A;  1NK8 A;  2O8D B;  2V51 B;  1BWF O;  2P9K B;  2O4I A;  4CZK A;  2LSN A;  5AR0 A;  1WOQ A;  3AVM A;  4DB3 A;  3ZEU A;  1VQK N;  4OKK A;  3ZT3 A;  2BAN A;  1S3X A;  3TU5 A;  4CJK A;  1CZB A;  4EAH D;  1YAG A;  1T8E A;  5J1E A;  4B3T K;  1TYQ B;  3SAH A;  5JVG L;  3ITH A;  3N4Q A;  4M7Y A;  4FJM A;  1TVR A;  3J7Y P;  3M8Q A;  2PBD A;  3QEI A;  3VQB A;  4BDZ A;  1JL1 A;  1SV5 A;  1K8K A;  3OVN A;  3A8Y A;  5EX5 A;  3L3V A;  3HRG A;  5AQO A;  2E1Y A;  3K9J A;  5J2P A;  1JL2 A;  1VSI A;  2HF3 A;  5SWM A;  4CBW A;  4J8F A;  4F9O A;  5KPR A;  1XMO K;  4JI7 K;  2HNZ A;  5AZI B;  3CET A;  4O8U A;  1BHL A;  4CJ7 A;  3WEE B;  5HP1 A;  5A2Q O;  1YUW A;  2YNF A;  2D1K A;  3VQP A;  2IGI A;  4DSE A;  5J2N A;  1U2V A;  2FSK A;  4A61 A;  5GIO A;  1J5E K;  1HNW K;  4CGH A;  2FF3 B;  1VQ8 N;  1HX1 A;  4I7F A;  1IBK K;  4JI1 K;  4IWV A;  3M8S A;  4DSK A;  5BPN A;  3AGR A;  4E7K A;  3VQA A;  2W41 A;  4WFB L;  4BY9 C;  1BO5 O;  2RPI A;  3EZW A;  1QQC A;  5AFU A;  4CFA A;  5BRH A;  3H45 C;  3LAK A;  2B5J A;  4B1X B;  3V1O A;  4Q5V A;  1BI4 A;  3DRS A;  4FLU A;  4CF0 A;  4B9V A;  4GMJ B;  4MDA A;  1LCU A;  4JKC A;  1GOC A;  2P9U A;  3A5L C;  4DTM A;  2FF6 A;  3M6G A;  4NCG A;  4Z4C A;  1MA9 B;  3V9X A;  5BPL A;  2HHH K;  2E5L K;  4XH1 A;  4DHY A;  3I33 A;  4H0T B;  5AQG A;  3SJJ A;  4QS8 A;  4H8K A;  2JWL A;  3SJH A;  3TTC A;  3CCE N;  2P9L B;  3CD6 N;  3O5B A;  3VF6 A;  3DXK A;  1VQM N;  5HRP A;  3MEE A;  3T1H K;  3AAP A;  5CR4 A;  3QML A;  2D5R A;  3TAQ A;  4FJK A;  3THX B;  4CEC A;  1U6Z A;  4U67 L;  3OYE A;  3CCR N;  3I56 N;  4YY3 K;  2P5G A;  5EVZ A;  3K0S A;  1ESV A;  2NRW A;  1QE1 A;  3FGU A;  3MWT A;  5EU7 A;  4W5O A;  4KKO A;  3K59 A;  2HHV A;  5C24 A;  3SV3 A;  3OBW A;  4FM0 A;  3SUN A;  2QEX N;  3U3Y A;  2XO7 A;  4KHY A;  2OPR A;  1NOZ A;  3AY9 A;  4E1N A;  2HHT A;  2X6N A;  4M3T A;  4AHR A;  3ASM A;  4RCH A;  3P5J A;  5TKW A;  1BU6 O;  3CYM A;  1J53 A;  1EXQ A;  3SMS A;  3CCS N;  1C1A A;  4CGI A;  3FZF A;  4V19 S;  3ZET A;  4PA1 A;  1J6Z A;  1QZ6 A;  3LDO A;  4Y0W A;  4N56 A;  3MN6 A;  5KQD A;  3QNN A;  3G0Z A;  3IFR A;  5AQS A;  3O3G A;  4DMN A;  1RT7 A;  3CPE A;  4A2A A;  4BQL A;  4KTQ A;  4XH5 A;  4JI2 K;  3CFR A;  2BE2 A;  3CFO A;  3MEC A;  1DKG D;  3M5R A;  1T3V A;  3UKR A;  2EWS A;  4A5A A;  2X6S A;  4CE9 A;  4CHQ A;  3ZEU B;  3WQU A;  3MX2 A;  1T6C A;  3SV4 A;  1D4X A;  2YJF A;  3AA3 A;  3O9U A;  3V1Q A;  4CJR A;  3NF6 A;  3TAR A;  1ATS A;  2P9K A;  3LWM A;  3ZLJ A;  4CHO A;  2O8B B;  2NRX A;  1N33 K;  4LY7 A;  1EKE A;  1JLF A;  4G9Z A;  1X3M A;  3IUC A;  1RGI A;  1C0F A;  1RIL A;  4CJ3 A;  4B3M K;  4FWQ A;  3NGI A;  3WXK A;  3VEZ A;  4CEF A;  3P1G A;  3C7N B;  2PY5 A;  2IS3 A;  4GNI A;  4CEQ A;  2F8S A;  2O8E B;  4HUF A;  4JHD A;  4CIG A;  4KI6 A;  1Z6R A;  3BEX A;  5EOY A;  3D0P A;  3LDP A;  1VAZ A;  1ZYQ A;  2WFB A;  1N8R O;  3KJV A;  4M42 A;  2QTD A;  2WOM A;  4M3Z A;  4I6M A;  1TAU A;  1NGA A;  1TKT A;  2HBK A;  1VQO N;  3H08 A;  3UE5 A;  5CZ1 A;  4JS4 A;  1EWR A;  3U9D A;  2Q2R A;  2OTL N;  1ASV A;  2E20 A;  5LMU K;  4GVM A;  3K58 A;  4B9T A;  5D3G A;  1HJO A;  3DLE A;  3LP0 A;  5KQ8 A;  4CCH A;  3NH0 A;  1HQE A;  4CFB A;  4EHU A;  1U48 A;  2GWK A;  4YDU A;  1QSS A;  3TWH A;  3ZET B;  3E9L A;  4DQI A;  3P39 A;  3VF2 A;  3I55 N;  4N41 A;  5AQY A;  4BQZ A;  3AO3 A;  4JKG B;  5DM7 L;  3J80 O;  3VEV A;  3O4N A;  5F0X A;  1Z05 A;  1XUP O;  1WAF A;  4KH6 A;  3T1Y K;  1UA0 A;  1T03 A;  1BA1 A;  4MDB A;  3TR8 A;  1OH8 A;  3PV8 A;  4BC5 A;  3O3H A;  3DMJ A;  4CIF A;  4NYN A;  1V4T A;  2DY4 A;  3ATU A;  1NJY A;  1SL2 A;  4NLB A;  1S22 A;  2AA4 A;  4I9L A;  3AA4 A;  5BN9 A;  2DTU A;  5KPT A;  4AHC A;  4DV0 K;  3KLF A;  1K9M O;  4CHP A;  2YHB A;  2P9L A;  1RDU A;  2JGU A;  4JAX A;  4OVL A;  3UKU A;  3KK2 A;  4A59 A;  1W97 L;  1KTQ A;  1TUY A;  3VEY A;  1SKR A;  4CES A;  3O80 A;  3DWL A;  5I42 A;  4IJN A;  4JKG A;  5JS2 A;  3K5O A;  4OPA A;  5JLH A;  3V6D A;  1T05 A;  3O9T A;  4MQ3 A;  5AZJ B;  4EHT A;  4R5P A;  3AAR A;  5JVH L;  3KLE A;  3AVI A;  2YV0 X;  4BVO A;  4KHU A;  2ZQB A;  2G8H A;  4IOX A;  3RR7 A;  4C8L A;  3E9O A;  4DR1 K;  5AQM A;  1RBT A;  4ELU A;  3LP2 A;  1DT9 A;  4H0V B;  2UUC K;  2KTQ A;  2GTD A;  4WQ4 C;  3EO3 A;  2KKZ A;  3HOT A;  4O0I A;  4BRD A;  5HRS A;  5FPD A;  2G8U A;  3DAW A;  3TSU A;  3ZSW A;  3LDN A;  1BQN A;  4FLY A;  4BR9 A;  1R59 O;  5AJ3 K;  2VWJ A;  3QIC A;  3HP9 A;  4XIU A;  4GKK K;  4JI0 K;  2ZD1 A;  2YNI A;  1L5U A;  1E3M A;  5GAE P;  5JS1 A;  3T19 A;  1NM1 A;  3AVJ A;  4NCB A;  4E0D A;  4JHD B;  2BDP A;  4QS7 A;  2A5X A;  2GUI A;  2YNG A;  1A5V A;  5AQX A;  4H0O A;  4IJA A;  1MDU B;  3CQX A;  1T6D A;  2ZJQ L;  4DFP A;  2ZM6 K;  1TKZ A;  3HJF A;  4M41 A;  5AQU A;  3L6Q A;  2HF4 A;  2QM1 A;  3L8B A;  1VSJ A;  4OX9 K;  2I5J A;  2OTJ N;  4DCH A;  3DOK A;  4PKH A;  4MO4 A;  4A5B A;  1ITG A;  4YNQ A;  3M8R A;  3IAY A;  3SUQ A;  4GKJ K;  3QLH A;  2W6L A;  2FBX A;  2BTF A;  3ID8 A;  4Z4G A;  4I9Q A;  2OCE A;  3K5N A;  1RTJ A;  2E6M A;  4YHH K;  4N76 A;  4BAC A;  5HBM A;  4MFB A;  3EN9 A;  1HQU A;  2NZT A;  3RMD A;  4BE1 A;  2A1R A;  3K9K A;  4KB0 A;  3R8E A;  3HVR A;  3UKR B;  1LOT B;  1XHX A;  2DFE A;  3SUP A;  3LZJ A;  1R0A A;  1Q8I A;  5I3U A;  5F1X A;  1RDC A;  2P9P A;  4BRA A;  4BG9 A;  4FJ8 A;  3TAG A;  4ILH A;  3CFP A;  2A3Z A;  3WUH A;  3PX0 A;  2XY6 A;  3FZM A;  2PYL A;  2UXC K;  3FR0 A;  3DYA A;  4DSI A;  4GV6 A;  4DV3 K;  3SUO A;  5AQQ A;  4QS9 A;  3WXL A;  3PIP L;  2A41 A;  1BUP A;  4LF5 K;  5FDL A;  4OO1 J;  2V52 B;  5BRD A;  3B8A X;  2RKI A;  1LV5 A;  1RDW X;  5FLX O;  1QQN A;  4E7J A;  4JN4 A;  1U49 A;  4NXN K;  1WUA A;  3M1F A;  4KTW A;  5T7B A;  4JK7 A;  3V9S A;  3ZSY A;  4OKE A;  4DTS A;  4FPA A;  2ATQ A;  1D5A A;  1RTI A;  1JLQ A;  4CJT A;  2PAV A;  3A5N C;  1UAX A;  4FXD A;  2Q3S A;  4C1N K;  4DR2 K;  1J5O A;  4IG3 A;  3HBT A;  3EKU A;  3AA2 A;  4BC2 A;  4B08 A;  5HRR A;  3SQ1 A;  3DLL L;  4EZ9 A;  1I39 A;  1DGK N;  4CER A;  5BR9 A;  5AZJ A;  4CGG A;  1IKY A;  4JI8 K;  5AQP A;  3D2F A;  1TV6 A;  2ZF5 O;  4PQU A;  3CMA N;  2X78 A;  4U7B A;  3P4I A;  3L2U A;  2OZM A;  3KIO A;  2P9N A;  4DSJ A;  2GV9 A;  3C95 A;  1W9H A;  3O1B A;  3DRR A;  1HNV A;  4I2Q A;  2P9I B;  2Z1G A;  3Q7B A;  3L2Q A;  3Q7C A;  5J2M A;  3QEW A;  1VQ4 N;  4FCY A;  3AAQ A;  5CE3 A;  4FLW A;  4RWT A;  4FLX A;  4JKD A;  1JLE A;  3ENO A;  5BPM A;  3HPH A;  3V9W A;  4KB1 A;  2XY7 A;  1SZ2 A;  3TAP A;  1SQK A;  3FZH A;  4HCB A;  1P90 A;  1K73 O;  4EIA A;  1QTM A;  5CYQ A;  2NRH A;  4JRQ A;  4DSL A;  1FXX A;  4H4M A;  3AVK A;  4L3Q A;  3L2W A;  4JEP A;  4M3Y A;  3VMF B;  4W5N A;  4ISG A;  1YJW N;  3AO2 A;  5CHI A;  3C6U A;  1S1V A;  2HBM A;  3ZT0 A;  2V7Y A;  3FE1 A;  2HMI A;  4CI6 A;  3OYB A;  4H0Y B;  1IKV A;  3ZSV A;  2BH1 A;  1VRT A;  3VN5 A;  2QXL A;  3BP8 A;  1XWL A;  3K5L A;  4LF8 K;  1GLJ O;  4CJE A;  3SMP A;  1MWM A;  5FPM A;  3HXM A;  4B3S K;  3JS6 A;  4B1W B;  4OKJ A;  5AZI A;  1HUX A;  3PO4 A;  1NGC A;  1TKD A;  4CZL A;  2H3G X;  3L0Q A;  2I7N A;  2NUB A;  1WSE A;  4B1U B;  1FKO A;  4K25 A;  2QWR A;  3MN9 A;  2D4W A;  3RMC A;  4BR4 A;  4BGB A;  4ELV A;  4ICL A;  1U04 A;  1HKC A;  3SBT A;  2UUA K;  2EX3 A;  3NVM A;  4DTN A;  3AVH A;  3OA9 A;  3EKS A;  4CHN A;  2BUP A;  1SKS A;  1NK7 A;  4FLV A;  3VGK A;  1HKG A;  3AVG A;  3MWP A;  4AIL C;  2O8E A;  4DV1 K;  4BC3 A;  2BGG A;  4FWM A;  4EP5 A;  1RDD A;  4CGJ A;  4BGA A;  3MCP A;  1C0T A;  1HPZ A;  1HJR A;  3BGR A;  2Q31 A;  1S6Q A;  4B8A B;  1YJN N;  1S6P A;  3KHY A;  4FO0 A;  1NMD A;  4DSF A;  4H4O A;  4FZX C;  4DUY K;  3UIQ A;  4FJL A;  4FJH A;  4I6M B;  3DXM A;  3TTF A;  4DQP A;  1NJW A;  4CHY A;  3O4Q A;  2B4J A;  1NKB A;  1KXP A;  3TI0 A;  3LZI A;  5JIC A;  1VQL N;  3SK3 A;  1HKB A;  3MEG A;  1RT4 A;  4WQ5 C;  4N47 A;  1TAQ A;  4CJ5 A;  4KBO A;  5HRN A;  3E66 A;  3HYF A;  1ZBS A;  4K43 A;  3OJS A;  1LAW A;  1TKX A;  4CEZ A;  3H3N O;  1NOY A;  1NK5 A;  2VGM A;  4NCA A;  2F8T A;  4DLE A;  3VEO A;  4IBN A;  5IT9 O;  4ID5 A;  1IG8 A;  3C6H A;  1Q9Y A;  1LAV A;  4DQS A;  1EWQ A;  3CG7 A;  4FW1 A;  3F73 A;  2KFZ A;  4KPY A;  3F2K A;  4CF1 A;  4JYA K;  1D8Y A;  4CW7 B;  1S1X A;  2O8C B;  4LH5 A;  3DLR A;  1F21 A;  3MXJ A;  5M1F A;  1NGD A;  1KLM A;  2FBT A;  1GLF O;  2O8F A;  5AQH A;  1Z25 A;  1VQ5 N;  4IZ9 A;  3LL3 A;  2QKK A;  2Q36 A;  2ZGZ A;  4RW6 A;  4BRL A;  4M3X A;  1BIU A;  4JKH A;  3BF3 A;  3J7Z O;  4F2S A;  2HW3 A;  1RT6 A;  3LP1 A;  1Y64 A;  1X9W A;  1BGX T;  5GIN A;  4IDH A;  3VQ7 A;  3G4S N;  2YX6 A;  2F7T A;  4FJ7 A;  1X9J A;  3PX6 A;  4FM1 A;  1YF5 L;  1N34 K;  1NLV A;  1S5J A;  4OPK A;  4B3O A;  1QSY A;  3LAN A;  4CZF A;  4JV5 K;  3TPQ A;  4BE2 A;  4RW7 A;  4DWI A;  3CM5 A;  4GW6 A;  1VQ6 N;  4LFA K;  3AV9 A;  1DEJ A;  1BA0 A;  1YVU A;  5AQR A;  3J81 O;  4LF7 K;  2KZZ A;  4JI5 K;  5ADX A;  1WB9 A;  5KGX A;  3THX A;  1I3A A;  3CC2 N;  3S3O A;  1BI4 B;  4JKF A;  4AHU A;  1RBU A;  2G8W A;  1IKW A;  3LM9 A;  1JCE A;  2OAN A;  4JD2 B;  3VQ5 A;  4BE0 A;  2KZM A;  3DXK B;  1OH7 A;  4IFY A;  4CJF A;  3HST B;  4C23 A;  2E1Z A;  4FJX A;  4TSX A;  1M1K O;  3PSI A;  2P9S A;  2P9N B;  3VQ4 A;  1C0U A;  5KRT A;  2D0P A;  3TAB A;  1CXQ A;  3U4L A;  3ISN C;  3VEX A;  3VER A;  4WCE L;  3BZC A;  3KLH A;  4DV5 K;  2HHU A;  4JD2 A;  2JLE A;  3HZ6 A;  3I8D A;  3A2F A;  1KSP A;  1VK0 A;  5E41 A;  2VGN A;  1J54 A;  4BRI A;  1GLB G;  5HLF A;  2Z1J A;  1KVB A;  3PUF A;  1SS6 A;  3SPY A;  5C25 A;  3BZK A;  1VSF A;  4E7H A;  4K8Z A;  2HVI A;  5GAD P;  4FK4 A;  3NBP A;  4BDP A;  3IG1 A;  4HCC A;  1GLD G;  2RF2 A;  4PWD A;  4ZTJ A;  1Q9X A;  4PL7 A;  3CME N;  1YTA A;  1TK8 A;  3P83 D;  2VG7 A;  1B92 A;  4BWJ A;  4OPH A;  1ZBI A;  1B9D A;  3RMB A;  5FRO A;  4DS4 A;  1HR0 K;  4MLE A;  3QEP A;  3CCJ N;  3T69 A;  4Z0U A;  4FOE A;  1IKX A;  3O9S A;  3VEN A;  3W0L A;  4WQ5 A;  4CK2 A;  3KTQ A;  3QER A;  1RT3 A;  4UY8 O;  3CCU N;  5C12 A;  4E1J A;  4PUO A;  1JCF A;  2Z1H A;  2FXU A;  4WQ4 A;  4C1N I;  3WQT A;  5LY3 A;  3G6E N;  3U3G A;  1RBV A;  3D6R A;  5DK5 A;  3VTH A;  4ZHR A;  3HM9 A;  5AQN A;  4JKE A;  1BIZ A;  3A5M C;  4M3R A;  3OYH A;  3IRX A;  4FM2 A;  4BR0 A;  4JKB A;  3LP3 A;  2VWK A;  4M3W A;  1C0G A;  4CF8 A;  4BDY A;  3PY8 A;  1XNQ K;  1W2B M;  1GLC G;  2VQF K;  1XQS C;  4FZY A;  5C42 A;  1W7A A;  1NGF A;  4CZH A;  1VSL A;  4HVJ A;  3KWG A;  3ZT4 A;  3CCQ N;  4NXM K;  3NAE A;  2W6K A;  3R3L A;  3ZSZ A;  1VRU A;  3BF1 A;  4CZM A;  3OYN A;  4RW4 A;  4DR5 K;  3BY5 A;  3RSE B;  3U9Z A;  3QBW A;  1WAJ A;  3WXM B;  3OYK A;  3HL8 A;  2G8K A;  3V1R A;  3E01 A;  1K8A O;  4Q0B A;  3NE6 A;  4GY2 B;  4FK0 A;  5AQJ A;  1UWB A;  4DQ8 A;  3ULE B;  4YOU A;  3L3U A;  1TK0 A;  1HNX K;  1UOC A;  2PYJ A;  3F5T A;  4J2A A;  5I9E B;  2XRI A;  1KQS M;  3O08 A;  4KHN A;  4E1M A;  2AP1 A;  4GVE A;  2NNW A;  3HI0 A;  3WNE A;  4DR7 K;  1BG3 A;  3CJA A;  1EO1 A;  2YCH A;  5B8H A;  4IDK A;  3LPT A;  3OBY A;  3AO1 A;  3J8A A;  4J2B A;  4BRO A;  4J2E A;  4PKG A;  3GG4 A;  1X9M A;  1RTH A;  3CCL N;  1WSH A;  4BRM A;  5F2R A;  3C0B A;  1T7P A;  4A2B A;  2AJQ A;  3OTO K;  1NG9 A;  2ZJP L;  1MWK A;  4L8R B;  1QVF M;  4FPB A;  4IXC A;  1NK9 A;  1NNE A;  2E8A A;  4LD0 A;  1KLN A;  2P5O A;  2YHW A;  3A5O C;  2UXB K;  1KAX A;  2E4L A;  2E2N A;  4DTJ A;  4AM7 A;  1Q81 O;  5AQL A;  1KCF A;  3W3D A;  3KWI A;  1OH5 A;  4FWP A;  1TL1 A;  3O4W A;  3THY A;  4XEI A;  3GE1 A;  4KHP K;  4O44 A;  4CEB A;  5AQK A;  2KFN A;  2ASM A;  1JLG A;  3K57 A;  3MN5 A;  1ASW A;  3PO5 A;  3QFU A;  4UQG A;  4KHS A;  3N4P A;  3ZT2 A;  1HMV A;  2UXD K;  3CJ1 A;  4RTF D;  3NMU A;  1EP4 A;  4CFD A;  3OYD A;  1QQM A;  2HMP A;  4IEE A;  3WT0 A;  3LDQ A;  1BQM A;  2GUP A;  2VYP A;  3LM2 A;  4CJW A;  1NGE A;  3SLC A;  3H46 O;  3SYZ A;  1KD1 O;  2E2O A;  3G71 N;  4BRN A;  3NCI A;  3FLC O;  3DI6 A;  4NB4 A;  1O1W A;  4H5R A;  3VES A;  3CJB A;  2W42 A;  4BRG A;  1RT1 A;  3THY B;  5LJW A;  1OVQ A;  3QIO A;  4J2D A;  1CXU A;  1Q7Y O;  4JNE A;  5JMV A;  1NMN A;  3TSP A;  2A6A A;  4O55 A;  4IG0 A;  1BIS A;  4ILJ A;  4O5B A;  2HHW A;  3C6A A;  3S3M A;  3DLH A;  2IOC A;  4C8O A;  3VA3 A;  4B9M A;  3OYL A;  2CGK A;  4PHT X;  3VOV A;  2XY8 A;  2G8V A;  3NF8 A;  2IVN A;  4FWR A;  4DU3 A;  4FJJ A;  2JWK A;  1HNI A;  3E9P A;  3R9P A;  4IOC L;  3EZ5 A;  3SBG A;  2YKM A;  4EP4 A;  3SAF A;  1KVC A;  4CFC A;  3PLA A;  3VQE A;  3IMX A;  3NF7 A;  4YFU A;  1YIT N;  5M1O A;  2CH5 A;  4FVU A;  4FYD A;  4IO8 A;  1P8Z A;  4QOZ B;  5M1P A;  1KRP A;  1CLQ A;  3ENB A;  4B1V A;  1W0H A;  3KLG A;  1GLL O;  2D0B A;  4DFJ A;  1BOT O;  1FJG K;  3VGM A;  1YI2 N;  3RSE A;  3H6E A;  3O1W A;  2W40 A;  3C7N A;  4E19 A;  4LF4 K;  1C0M A;  4WFA L;  2DFH A;  3AA5 X;  5GAG P;  1RT5 A;  3CI5 A;  1WBD A;  1WBB A;  4KRF A;  2Y1I A;  3VEW A;  1XC3 A;  3KK7 A;  1N36 K;  1JCG A;  2A1S A;  4BC4 A;  3V81 A;  3C6T A;  2RHK A;  4X64 K;  2O8B A;  1RDA A;  2UUB K;  1WN7 A;  1EX4 A;  2D0O A;  4Z4I A;  4ILG B;  4FWN A;  1XHZ A;  3V9U A;  5E84 A;  4B9S A;  4LH4 A;  3NGZ A;  2P9P B;  3ATV A;  3M8P A;  2KQ2 A;  4DQR A;  4CK3 A;  2VCP A;  2NRR A;  4CVN E;  3J7A P;  1JLA A;  2PFU A;  5CY4 A;  4DFK A;  4DF4 A;  4WE1 A;  3OYF A;  2YHA A;  3MDQ A;  4YOR A;  2F4V K;  3IS9 A;  3ZSR A;  3KLI A;  3GL1 A;  3KKS A;  3HTV A;  1REV A;  4IO9 L;  5J2Q A;  1WLJ A;  4Z94 A;  1VSK A;  3FFI A;  1G15 A;  5LL6 Z;  3ZSQ A;  1ZC6 A;  1KFS A;  1LWE A;  1JLB A;  5AQT A;  4GV3 A;  2XY5 A;  3HO1 A;  4F3T A;  3OYM A;  1XC9 A;  3NHG A;  4M63 C;  4W5Q A;  1YIJ N;  2OA8 A;  2A42 A;  4DV6 K;  3RRH A;  1NGI A;  4O5F A;  2DFF A;  2F96 A;  1B9F A;  4HTU A;  2OPS A;  2IDO A;  5BR8 K;  3HK2 A;  4QAG A;  3O3F A;  4KO0 A;  1NK4 A;  3QIP A;  3OYA A;  4DR4 K;  2KHO A;  5TKY A;  4B9L A;  4FWO A;  4K8X A;  4KHQ A;  4DFM A;  3SZ2 A;  4A57 A;  3VPZ A;  3QEV A;  1UA1 A;  3NDK A;  1D9D A;  1BDG A;  1C6V A;  3E1Y A;  5BN8 A;  2KLA A;  1SL0 A;  1NBW A;  5KPZ A;  2CGJ A;  2UYT A;  1VQN N;  4K42 A;  1S1U A;  1LWF A;  4ZTF A;  4YOW A;  5AQV A;  3D7E O;  4CD1 A;  3I0S A;  3WNF A;  4FVM A;  5ADX H;  2QWP A;  4DR3 K;  2P9U B;  4JI4 K;  1RBR A;  1SAZ A;  2NRV A;  2Y1J A;  3CCV N;  3ENH A;  3L2R A;  3GDQ A;  1EET A;  1IH7 A;  1NGB A;  2HHQ A;  1T44 A;  3HPG A;  3D2E B;  1LW2 A;  4YOX A;  1M90 O;  1S1T A;  3I0R A;  4YOY A;  4A62 A;  5FRN A;  1JKH A;  1OKJ A;  2FBY A;  3HM8 A;  3BDP A;  4CBU A;  4R79 A;  2P9S B;  2RN2 A;  2PZS A;  1QHT A;  1FKP A;  2HND A;  4LSN A;  4QCL A;  3UKU B;  4CJ4 A;  4FWK A;  2ETJ A;  1IBL K;  3JAM O;  3KKR A;  4MO5 A;  4BRP A;  4E3S A;  3ZYY X;  2WON A;  3SAG A;  2ASO A;  3B6P A;  1K6Y A;  4CF2 A;  3WNG A;  4BWM A;  4WF9 L;  4JLH A;  1HLU A;  1VSE A;  3RMA A;  4M7X A;  1WNS A;  3PX4 A;  3NGY A;  4IOA L;  1Q18 A;  1X3N A;  4ELT A;  3ULD A;  3F9M A;  3CQ8 A;  3A0I X;  1U47 A;  1HRH A;  4AF1 A;  3T7Z A;  4CBX A;  2ZGY A;  3ALY A;  3H1Q A;  4B1Z A;  3JXU A;  4FZZ A;  4B3R K;  4B9N A;  4CIE A;  1OVY A;  3AVB A;  3TTD A;  4FSV A;  5FPN A;  1YTU A;  4F8R A;  1S9G A;  1XMQ K;  4AM6 A;  4B8C A;  1ZXO A;  3THW A;  3MX5 A;  4I2P A;  3CHW A;  3VQQ A;  3MXI A;  1KAZ A;  4OJR A;  5EY4 A;  1VQ7 N;  5SZT A;  1QS4 A;  2VG5 A;  4DKW A;  2OZS A;  2Z1I A;  2QI2 A;  3I8B A;  4WFN L;  1O13 A;  3CC7 N;  4CZG A;  4EFH A;  1TYQ A;  2WUS A;  4CHZ A;  3HOS A;  3CQY A;  1GLA G;  4CJS A;  3RTV A;  4DF8 A;  4FOI A;  4CD3 A;  4IEI A;  1L3U A;  2QWO A;  3G10 A;  4KAZ A;  3M3Z A;  4YDU C;  3AVN A;  3VA0 A;  4DU4 A;  4FWS A;  2G8I A;  4DTO A;  3AVL A;  1CZA N;  4M3U A;  3S9H A;  1Z26 A;  5BRF A;  2IVP A;  1KAY A;  4KV8 A;  3ULE A;  4KI4 A;  1NU0 A;  3H3O B;  4DQQ A;  1IV0 A;  2FC0 A;  3HP6 A;  1ATN A;  3L4Q A;  4KFB A;  1TL3 A;  4BR5 A;  3CXC M;  4LFB K;  5C0Y A;  2HOE A;  2YKN A;  4H0X B;  3THV A;  1RBS A;  5AQZ A;  3SQ0 A;  3HPO A;  1E4G T;  3DOL A;  2ITM A;  1HPM A;  3OYG A;  1ASU A;  4O8K A;  5DM6 L;  1BCM A;  3EYZ A;  4NO7 A;  1VHX A;  2F9T A;  4F2R A;  2OPP A;  5HL7 L;  3OYJ A;  3KK3 A;  4DTP A;  5KGW A;  4H0P A;  3MMV A;  3QES A;  2VQE K;  4BRE A;  3DXM B;  3TSQ A;  3VQ8 A;  4BR7 A;  1VQ9 N;  3THW B;  1G99 A;  3PIO L;  1X1P A;  1SUQ A;  4LC9 B;  1NJI O;  3PSF A;  2QWL A;  4FWL A;  3SI6 A;  2CH6 A;  4JK9 A;  1RTD A;  3NF9 A;  1X9S A;  4LSL A;  5KTQ A;  1QVG M;  1J9A A;  2V7Z A;  3CM6 A;  3SNN A;  4PY5 A;  1YJ9 N;  3VTI A;  4B1Y B;  1NGJ A;  3DJC A;  2YNH A;  3CJ9 A;  3CJC A;  3VQ6 A;  4JRP A;  1NK6 A;  4FJ9 A;  4C8M A;  3EE9 A;  4ISF A;  2HB5 A;  1RDB A;  4CZI A;  4CJV A;  4CEA A;  1S1W A;  1NJZ A;  3V4I A;  4DR6 K;  4WYB A;  2NLX A;  3AVF A;  4H5N A;  1TGO A;  3U8X A;  1QSL A;  1WSG A;  4CJP A;  3SCX A;  1HNZ K;  2IIR A;  1VSM A;  2B6A A;  2QKB A;  4HTL A;  3WXJ A;  5FRM A;  5LJV A;  5C2D A;  4DU1 A;  4DG1 A;  4JK8 A;  3OYC A;  3S3N A;  3TAN A;  3SQ4 A;  1A5W A;  2OPQ A;  3CCM N;  1KVA A;  2YI1 A;  4KRE A;  3AGK A;  3S41 A;  4H5W A;  2F9W A;  3OS0 A;  4RW8 A;  3MN7 A;  3VQ9 A;  3FZK A;  2YHX A;  3C65 A;  2NRT A;  4DV7 K;  5CYM A;  3KD5 E;  4Z4H A;  3AO4 A;  2VG6 A;  2D0A A;  1N5Y A;  1OH6 A;  1ILY A;  3EL2 A;  3QEX A;  3TAM A;  2FSJ A;  2FLO A;  2I7P A;  1RT2 A;  5IWA K;  3KZB A;  4CZE A;  2O4G A;  2GEM A;  2HBL A;  4OPJ A; 
#chains in the Genus database with same CATH homology
 2HMI A;  4FLT A;  5HRP A;  4HUG A;  3OYB A;  1TK5 A;  4O55 A;  1IKV A;  3MEE A;  4IG0 A;  3ZSV A;  1BIS A;  1VRT A;  3VN5 A;  2FBV A;  1XWL A;  3K5L A;  4O5B A;  2HHW A;  2D5R A;  3TAQ A;  3S3M A;  3DLH A;  4FJK A;  2IOC A;  4CJE A;  1NK4 A;  4C8O A;  4CEC A;  3VA3 A;  3OYE A;  3HXM A;  4AHT A;  4B9M A;  5DMR A;  3OYL A;  2P5G A;  4HUE A;  5KI6 A;  4FLZ A;  1QE1 A;  4W5O A;  5EU7 A;  4OKJ A;  2XY8 A;  2ZE2 A;  4KKO A;  3K59 A;  2HHV A;  2G8V A;  5C24 A;  3SV3 A;  3NF8 A;  3PO4 A;  1TKD A;  4FM0 A;  4NYF A;  3SUN A;  4DU3 A;  3U3Y A;  4FJJ A;  1HNI A;  2XO7 A;  4KHY A;  3TAF A;  2OPR A;  3EZ5 A;  1NOZ A;  2YKM A;  4O4G A;  4CED A;  4E1N A;  1CZ9 A;  1KVC A;  2NUB A;  4CFC A;  4EP4 A;  1WSE A;  4OGC A;  2HHT A;  3VQE A;  1FKO A;  2X6N A;  4M3T A;  4AHR A;  2D0C A;  3NF7 A;  4N5S A;  3ASM A;  3P5J A;  4YFU A;  3RMC A;  3CYM A;  1J53 A;  1EXQ A;  4FYD A;  1L3S A;  2HHX A;  4ELV A;  1C1A A;  1U04 A;  2IC3 A;  4ICL A;  4QOZ B;  4CGI A;  1KRP A;  1CLQ A;  4PA1 A;  2EX3 A;  4DTN A;  1IO2 A;  3AVH A;  1W0H A;  4CHN A;  4DTR A;  4N56 A;  3KLG A;  1SKS A;  1NK7 A;  2D0B A;  4RG8 A;  4FLV A;  3G0Z A;  4DFJ A;  3QNN A;  3O3G A;  3RWU A;  1NKE A;  4DMN A;  1RT7 A;  3AVG A;  4KTQ A;  4AIL C;  3CFR A;  2BE2 A;  2BGG A;  1ZBH A;  3VQD A;  3CFO A;  3WNH A;  4EP5 A;  3MEC A;  1RDD A;  4CGJ A;  1XI1 A;  4E19 A;  4E7L A;  1C0M A;  2X6S A;  2DFH A;  3AA5 X;  4CE9 A;  4CHQ A;  1C0T A;  1HPZ A;  1HJR A;  1RT5 A;  3BGR A;  3QIN A;  1WSF A;  3SV4 A;  1S6Q A;  4B8A B;  2Y1I A;  4KRF A;  1S6P A;  3OS1 A;  3AA3 A;  3V1Q A;  4CJR A;  3NF6 A;  3TAR A;  2A1S A;  4DSF A;  3V81 A;  3LWM A;  1LWC A;  4H4O A;  4CHO A;  4JS5 A;  3C6T A;  4FZX C;  3LPU A;  3UIQ A;  4FJL A;  4LY7 A;  1EKE A;  1JLF A;  1VSD A;  1RDA A;  4OGE A;  2QXF A;  3T1A A;  3RR8 A;  1NJW A;  1WN7 A;  4CHY A;  4DQP A;  1EX4 A;  3O4Q A;  2B4J A;  1NKB A;  3TI0 A;  1Y97 A;  3LZI A;  2G8F A;  4Z4I A;  2HHS A;  1U45 A;  4FJ5 A;  3AVC A;  1GOA A;  1RIL A;  1DTQ A;  4CJ3 A;  1XHZ A;  3V9U A;  4B9S A;  3MEG A;  1RT4 A;  4LH4 A;  2HNY A;  4C8N A;  4N47 A;  3NGI A;  3NGZ A;  3OY9 A;  3M8P A;  3DLK A;  1TAQ A;  2KQ2 A;  1ZBF A;  4CJ5 A;  4CK3 A;  4DQR A;  4CEF A;  5HRN A;  1D9F A;  3P1G A;  3TAE A;  2PY5 A;  2IS3 A;  3HYF A;  2F8S A;  4CEQ A;  1LW0 A;  3ZT1 A;  1JLA A;  4Y1D A;  3KK1 A;  5CY4 A;  3OJS A;  4HUF A;  4DFK A;  1YT3 A;  3QET A;  1LAW A;  4CIG A;  4DF4 A;  1TKX A;  4WE1 A;  4KHW A;  3LAL A;  4CEZ A;  4KI6 A;  1NOY A;  3SQ2 A;  1NK5 A;  3OYF A;  4NCA A;  3LAM A;  2F8T A;  2YHA A;  4DLE A;  4IBN A;  3D0P A;  4ID5 A;  3IS9 A;  3ZSR A;  1ZYQ A;  1Q9Y A;  1C1C A;  4FJH A;  1LAV A;  3KLI A;  3KJV A;  4DQS A;  3SPZ A;  3CG7 A;  3KKS A;  4M42 A;  4FW1 A;  1REV A;  3F73 A;  5J2Q A;  1WLJ A;  3RRG A;  4KPY A;  2KFZ A;  2GBZ A;  2WOM A;  4CF1 A;  1D8Y A;  1JLC A;  4M3Z A;  1VSK A;  1S1X A;  3FFI A;  1G15 A;  4LH5 A;  1RCH A;  1NK0 A;  3ZSQ A;  5HRO A;  1TAU A;  3DLR A;  1KFS A;  3F9K A;  1LWE A;  1TKT A;  1F21 A;  3MXM A;  3ZSX A;  1JLB A;  2R7Y A;  3HO1 A;  2XY5 A;  3MXJ A;  3JSM A;  4F3T A;  3OYM A;  1XC9 A;  1KLM A;  3OS2 A;  3H08 A;  3NHG A;  4W5Q A;  2OA8 A;  2FBT A;  4E89 A;  5CZ1 A;  4JS4 A;  3D45 A;  3RRH A;  2DFF A;  1ASV A;  2F96 A;  1B9F A;  4HTU A;  4FJG A;  2OPS A;  2IDO A;  4GVM A;  4OLB A;  1Z25 A;  5CZ2 A;  3K58 A;  4B9T A;  4FJN A;  5D3G A;  3HK2 A;  1NJX A;  1C1B A;  3DLE A;  4QAG A;  4KO0 A;  3O3F A;  3LP0 A;  3QIP A;  3NH1 A;  3NH0 A;  3OYA A;  1HQE A;  4CFB A;  4CCH A;  4F4K A;  3AVA A;  4RW6 A;  3V9Z A;  4B9L A;  1SL1 A;  4M3X A;  4K8X A;  4KHQ A;  1U48 A;  1BIU A;  3LDS A;  1QSS A;  3TWH A;  3ZSO A;  4F3O A;  4DQI A;  1ZBU A;  4DFM A;  4F2S A;  2HW3 A;  4N41 A;  1BCO A;  3SZ2 A;  3KD1 E;  1RNH A;  1RT6 A;  3AO3 A;  3LP1 A;  4HHT A;  3QEV A;  1UA1 A;  1X9W A;  1BGX T;  3NDK A;  1D9D A;  3O4N A;  1C6V A;  3VQ7 A;  4CJU A;  3DRP A;  1SL0 A;  1WAF A;  4FJ7 A;  3HT3 A;  4FM1 A;  3PX6 A;  1S5J A;  4OPK A;  4B3O A;  1UA0 A;  1T03 A;  1NKC A;  1QSY A;  4AHS A;  1S1U A;  3LAN A;  3TR8 A;  1LWF A;  4BE2 A;  4ZTF A;  4ID1 A;  4RW7 A;  3PV8 A;  3O3H A;  4AH9 A;  4DWI A;  4CK1 A;  3CM5 A;  3DM2 A;  4GW6 A;  2P1J A;  3I0S A;  1HYZ A;  3L2V A;  3WNF A;  3DMJ A;  3AV9 A;  4DLG A;  4OLA A;  4FVM A;  4CIF A;  4CGF A;  1YVU A;  4NYN A;  2DY4 A;  2X74 A;  2KZZ A;  1RBR A;  1S9E A;  1NJY A;  4RW9 A;  1SL2 A;  3T3F A;  2Y1J A;  5KGX A;  1I3A A;  2KW4 A;  3L2R A;  4Z4F A;  3K5M A;  3S3O A;  1DTT A;  1BI4 B;  1EET A;  3QNO A;  1IH7 A;  2HVH A;  3QO9 A;  1RBU A;  3AA4 A;  4I9L A;  1IKW A;  4AHU A;  2G8W A;  2HHQ A;  2DTU A;  4AHC A;  1BL3 A;  3HPG A;  1KFD A;  4E7I A;  1IG9 A;  1LW2 A;  3VQ5 A;  4BE0 A;  1S1T A;  3I0R A;  3KLF A;  2KZM A;  4CHP A;  5FRN A;  2YHB A;  4IFY A;  1JKH A;  4OVL A;  2JGU A;  2FBY A;  3HST B;  4CJF A;  3KK2 A;  3BDP A;  4FJX A;  4TSX A;  4FK2 A;  1KTQ A;  1L3V A;  2P51 A;  2RN2 A;  3VQ4 A;  3TAB A;  1C0U A;  1FKP A;  1QHT A;  2HND A;  4LSN A;  5KRT A;  2PZS A;  1CXQ A;  3ZCM A;  3ISN C;  4Z4E A;  1SKR A;  4CJ4 A;  4CES A;  4CGD A;  2ETJ A;  3MED A;  5I42 A;  2HHU A;  3KKR A;  3KLH A;  3NFA A;  3OJU A;  4IFV A;  5JS2 A;  4E3S A;  3K5O A;  2WON A;  3V6D A;  3B6P A;  4DS5 A;  1T05 A;  4M45 A;  1K6Y A;  4CF2 A;  3EY1 A;  2OYQ A;  4MQ3 A;  3WNG A;  4BWM A;  3JYT A;  2JLE A;  4JLH A;  3I8D A;  4CJL A;  4R5P A;  3A2F A;  2E6L A;  1KSP A;  1VK0 A;  5E41 A;  1VSE A;  3KLE A;  3RMA A;  3AVI A;  2YV0 X;  4G1Q A;  4Y1C A;  4CF9 A;  1WNS A;  4AHV A;  2ITG A;  3PX4 A;  1J54 A;  2ZQB A;  3NGY A;  4KHU A;  5HLF A;  2G8H A;  3RR7 A;  4C8L A;  4CEE A;  2Z1J A;  4KTZ A;  1KVB A;  1MU2 A;  4ELT A;  3PUF A;  2XHB A;  1RBT A;  3ULD A;  3CQ8 A;  4ELU A;  3AO5 A;  3NH2 A;  3SPY A;  3LP2 A;  5C25 A;  2KTQ A;  1VSF A;  3C94 A;  4E7H A;  1HRH A;  1U47 A;  1A5X A;  4K8Z A;  2HVI A;  3IAY A;  1WSJ A;  4FZZ A;  3ALY A;  4FK4 A;  3NBP A;  4BDP A;  3IG1 A;  4O0I A;  4B9N A;  3MAQ A;  4CIE A;  3AVB A;  1JXE A;  2RF2 A;  3HVT A;  4HCC A;  4PWD A;  4EZ6 A;  5HRS A;  4ZTJ A;  1Q9X A;  1YTU A;  2G8U A;  4F8R A;  3VQC A;  1S9G A;  4B8C A;  3ZSW A;  1YTA A;  1TK8 A;  3P83 D;  2VG7 A;  3OYI A;  1BQN A;  4FLY A;  1B92 A;  4I2P A;  4O0J A;  4BWJ A;  2VWJ A;  3VQQ A;  3DLB A;  4FJI A;  3MXI A;  4OJR A;  3HP9 A;  4XIU A;  1ZBI A;  5SZT A;  1QS4 A;  2VG5 A;  1B9D A;  1L3T A;  3RMB A;  2OZS A;  1DLO A;  2Z1I A;  5FRO A;  1N6Q A;  2ZD1 A;  4DS4 A;  4IKF A;  3K2P A;  2YNI A;  4DTX A;  3QEP A;  1L5U A;  1JXB A;  1WSI A;  4Z0U A;  1IKX A;  3DLG A;  3U6F A;  1ZBL A;  4CK2 A;  1SKW A;  5JS1 A;  1U4B A;  3T19 A;  3AVJ A;  3KTQ A;  4E0D A;  4NCB A;  5K14 A;  2BDP A;  3QER A;  1RT3 A;  1VSH A;  4CHZ A;  2EHG A;  5KRS A;  2GUI A;  4CJQ A;  2YNG A;  1A5V A;  4PUO A;  1GOB A;  4CJS A;  2Z1H A;  3RTV A;  4DF8 A;  2IAJ A;  3LWL A;  4W5R A;  4DTU A;  4DFP A;  3U3G A;  1RBV A;  1TKZ A;  3HJF A;  4M41 A;  1L3U A;  5DK5 A;  4CEO A;  4ZHR A;  3HM9 A;  1BIZ A;  3G10 A;  3OYH A;  4M3R A;  3L8B A;  3IRX A;  4W5T A;  1VSJ A;  4FM2 A;  4KAZ A;  3B6O A;  4B9U A;  2I5J A;  1HYS A;  3AVN A;  3LP3 A;  2VWK A;  4M3W A;  3DOK A;  1FK9 A;  3VA0 A;  4DU4 A;  4CF8 A;  4C8K A;  2G8I A;  1ITG A;  4YNQ A;  3M8R A;  4BDY A;  1HYV A;  3AVL A;  4DTO A;  3SUQ A;  3PY8 A;  4FW2 A;  3QLH A;  2QK9 A;  2FBX A;  4M3U A;  3S9H A;  1Z26 A;  1NK8 A;  4FZY A;  4Z4G A;  5C42 A;  4KV8 A;  4I9Q A;  4HVJ A;  1VSL A;  2O4I A;  3ZT4 A;  3K5N A;  1RTJ A;  2E6M A;  2LSN A;  4KI4 A;  4N76 A;  4BAC A;  5HBM A;  3NAE A;  4DQQ A;  4MFB A;  2FC0 A;  3HP6 A;  1HQU A;  3AVM A;  3ZSZ A;  4KFB A;  1TL3 A;  1VRU A;  3RMD A;  4OKK A;  3ZT3 A;  3OYN A;  2YKN A;  4RW4 A;  4BE1 A;  3THV A;  2A1R A;  1RBS A;  4KB0 A;  3SQ0 A;  3HPO A;  3DOL A;  2BAN A;  3HVR A;  1XHX A;  3OYG A;  1ASU A;  2DFE A;  4CJK A;  1CZB A;  1WAJ A;  3OYK A;  3HL8 A;  3SUP A;  3LZJ A;  1BCM A;  5J1E A;  3EYZ A;  1R0A A;  1T8E A;  1Q8I A;  5I3U A;  4F2R A;  2G8K A;  2OPP A;  1RDC A;  3V1R A;  3E01 A;  3OYJ A;  3KK3 A;  4DTP A;  3ITH A;  5KGW A;  4FJM A;  4FJ8 A;  3TAG A;  1TVR A;  4Q0B A;  3CFP A;  3NE6 A;  3M8Q A;  4FK0 A;  1UWB A;  3PX0 A;  2XY6 A;  3QEI A;  3VQB A;  4BDZ A;  1JL1 A;  1SV5 A;  2PYL A;  3QES A;  3OVN A;  3L3U A;  3L3V A;  1TK0 A;  3DYA A;  1UOC A;  4DSI A;  5J2P A;  2PYJ A;  4J2A A;  3SUO A;  1JL2 A;  3VQ8 A;  2XRI A;  4QCL A;  1VSI A;  4KHN A;  4E1M A;  5FDL A;  1X1P A;  1SUQ A;  2RKI A;  3WNE A;  5SWM A;  1LV5 A;  3SI6 A;  1RTD A;  3NF9 A;  1X9S A;  4IDK A;  4E7J A;  3LPT A;  4LSL A;  1U49 A;  5KTQ A;  3AO1 A;  4J2B A;  2HNZ A;  4KTW A;  5T7B A;  3V9S A;  1J9A A;  3CM6 A;  3ZSY A;  3SNN A;  4J2E A;  4OKE A;  4DTS A;  1X9M A;  1RTH A;  2ATQ A;  1D5A A;  4PY5 A;  1RTI A;  1WSH A;  1JLQ A;  4CJT A;  1UAX A;  4FXD A;  1T7P A;  2YNH A;  1BHL A;  2Q3S A;  1J5O A;  2AJQ A;  4IG3 A;  5HP1 A;  4L8R B;  3AA2 A;  2YNF A;  3VQP A;  2IGI A;  5HRR A;  4B08 A;  3VQ6 A;  4JRP A;  4DSE A;  3SQ1 A;  1NK6 A;  4EZ9 A;  1I39 A;  5J2N A;  4FJ9 A;  4CER A;  1NK9 A;  4C8M A;  4LD0 A;  4CGG A;  1KLN A;  2P5O A;  1IKY A;  2HB5 A;  1RDB A;  2E4L A;  4CJV A;  2QKK A;  4CEA A;  1S1W A;  1TV6 A;  1NJZ A;  4CGH A;  4DTJ A;  3V4I A;  4PQU A;  2X78 A;  1KCF A;  4I7F A;  3L2U A;  3AVF A;  1TGO A;  2OZM A;  1TL1 A;  3KIO A;  1WSG A;  3M8S A;  2GV9 A;  3C95 A;  1QSL A;  1W9H A;  4I2Q A;  3DRR A;  1HNV A;  4CJP A;  4DSJ A;  4DSK A;  3SCX A;  2Z1G A;  1VSM A;  3L2Q A;  4E7K A;  2B6A A;  4O44 A;  3VQA A;  5J2M A;  4CEB A;  2QKB A;  3QEW A;  5FRM A;  4FCY A;  2RPI A;  2KFN A;  1QQC A;  4FLW A;  1JLG A;  4CFA A;  3K57 A;  4FLX A;  1JLE A;  3LAK A;  4DU1 A;  4DG1 A;  1ASW A;  3HPH A;  2B5J A;  3V9W A;  4UQG A;  3PO5 A;  4KHS A;  4KB1 A;  3OYC A;  2XY7 A;  3S3N A;  3TAN A;  3SQ4 A;  3V1O A;  4Q5V A;  1BI4 A;  1A5W A;  1HMV A;  2OPQ A;  3DRS A;  3ZT2 A;  4FLU A;  3TAP A;  1EP4 A;  4CFD A;  3OYD A;  4CF0 A;  4B9V A;  4GMJ B;  4HCB A;  1KVA A;  4KRE A;  1GOC A;  1QTM A;  5CYQ A;  3OS0 A;  4DTM A;  1BQM A;  4RW8 A;  4JRQ A;  4NCG A;  4CJW A;  4DSL A;  3VQ9 A;  4Z4C A;  3SYZ A;  1FXX A;  3V9X A;  3KD5 E;  5CYM A;  4H4M A;  4Z4H A;  3AO4 A;  3NCI A;  3DI6 A;  1O1W A;  2VG6 A;  2D0A A;  3AVK A;  1N5Y A;  3L2W A;  4M3Y A;  3QEX A;  3TAM A;  4W5N A;  3SJJ A;  2W42 A;  4H8K A;  1RT1 A;  3AO2 A;  3C6U A;  1S1V A;  1RT2 A;  3ZT0 A;  3QIO A;  4J2D A;  2O4G A;  1CXU A;  4OPJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...