4CGDA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cgdA00
4OPJA 3S3OA 1HJRA 2PYLA 1DLOA 4L8RB 2IS3A 3DLKA 2XY6A 3HJFA 1IKXA 4CGFA 1VSFA 4UQGA 2VG5A 4FLZA 5E41A 1XWLA 1U47A 1QS4A 4WE1A 3L2VA 2LSNA 2RF2A 1RDCA 3U6FA 3SPYA 2BDPA 4H8KA 4IG0A 4HUGA 4AHSA 3LWMA 3DRSA 3M8RA 1S9EA 1RNHA 3B6PA 3VN5A 1ZBFA 3VQ9A 4CF0A 1QSSA 3TAEA 3LDSA 4O44A 2F8TA 1T8EA 1Q9XA 4FJLA 1BHLA 4B9LA 4KKOA 4CK1A 3AO1A 2HVIA 3HPOA 4BE0A 4EZ9A 2WOMA 3CM6A 2YKNA 1B9FA 3OS2A 3OYCA 3TAPA 1L3SA 1N6QA 4HCCA 1UWBA 1S6QA 3K5OA 4DQQA 4F2RA 4QOZB 1UA0A 1LWCA 3VA3A 1SKSA 1JLCA 3O4QA 2P5GA 4OKEA 2IAJA 1SL1A 4CGIA 3AVHA 1JLQA 3RRGA 4NCGA 1T7PA 1WAJA 4ID5A 3OYLA 3L2UA 1L3TA 4KI4A 1JLFA 3NGZA 5SZTA 1J54A 3VQPA 3V9SA 4FCYA 1D9DA 4CEFA 1KRPA 1RTIA 5CYQA 3K57A 3QERA 4CJ4A 3EYZA 3EZ5A 4C8MA 2X6SA 4QAGA 4CFAA 3ULDA 4OVLA 4DLGA 4FVMA 1KTQA 4DSJA 1DTTA 4CHZA 4FLXA 1EKEA 4AHVA 4B8AB 4N5SA 1RBRA 2OPQA 2YHAA 5EU7A 4JRPA 4B9TA 3QIOA 3TAFA 4Z0UA 4E89A 3RMAA 1HQEA 1JLAA 3IRXA 1WSGA 4Z4GA 1NKEA 2EHGA 2G8IA 2YV0X 3OVNA 3OYBA 2D0CA 4EZ6A 4DSIA 2QXFA 1QHTA 3OJUA 2ZD1A 1QTMA 1B92A 2OZSA 4FZYA 4IFVA 2HHSA 4LD0A 1JLEA 2BGGA 1TVRA 4DSFA 1L3VA 3NH2A 3M8QA 4F4KA 4DMNA 1Z26A 4DF4A 4N47A 3C95A 1S1UA 3LP3A 3ZSYA 3SUNA 1C0MA 4C8OA 4E1MA 1ZBLA 4CEDA 4CIGA 3V4IA 2R7YA 4FJGA 4B3OA 1NK7A 4KHWA 3CFRA 3DLBA 3NGIA 3TWHA 3CFOA 2PYJA 4M3ZA 4E7IA 1FXXA 3VQ4A 4CEQA 4CJFA 3OYMA 4YFUA 4HUEA 3SUOA 1TAUA 2BANA 2KFNA 3LP1A 4M42A 1SL0A 4NCBA 3F73A 1J5OA 4OKJA 1T03A 1X9WA 4FW2A 1S1XA 4BDYA 2PZSA 4FZXC 2HHUA 2ETJA 3KLHA 2VG6A 4M3YA 3MEDA 2W42A 4RW6A 3QNNA 4HVJA 4DSEA 1G15A 5J1EA 4CJQA 3WNHA 1WNSA 1RDAA 3ASMA 3HSTB 3ZT1A 3F9KA 3NH0A 3MXIA 3QEPA 1NJZA 3HVTA 3PX4A 1UAXA 4CGDA 2IDOA 3FFIA 4B8CA 4OGEA 1FK9A 3L3UA 4H4OA 4CJRA 1XC9A 1C1CA 2OPPA 2OPSA 4DSLA 4DTPA 3RRHA 4B9SA 1IKYA 4KREA 2GUIA 1R0AA 2B4JA 3QLHA 3OYFA 4CFCA 5FROA 1Z25A 4RW8A 1TV6A 5CZ1A 4KHSA 2PY5A 1RBTA 3ZSRA 1TL3A 1HNIA 1HQUA 3NH1A 4FJHA 4FJ8A 1NKBA 3BGRA 3VQ8A 3NHGA 3TANA 5KGXA 3PX0A 3V1OA 1XHZA 3PUFA 1W9HA 5K14A 3NF6A 1TK5A 3OYHA 4FK4A 1Q8IA 2P51A 4BACA 4KO0A 1WSIA 1NK0A 4FJXA 4M3UA 1J9AA 4AHTA 3S9HA 1UOCA 4E7KA 3RMDA 2YNIA 3DOKA 3DM2A 5FRMA 2HHQA 3ZSXA 1LW2A 1ZYQA 4LH5A 3QIPA 4CJWA 2HMIA 4DLEA 3DYAA 4CHOA 1MU2A 4RG8A 3K2PA 4I7FA 4FZZA 3EY1A 4ICLA 3E01A 1C6VA 2XO7A 2P5OA 3OYJA 2G8VA 1T05A 3KK1A 4OPKA 3MEGA 4F3OA 1SKRA 1RBSA 4GMJB 4CEZA 4DTSA 3LANA 3KKRA 3VQEA 1JLBA 1RT7A 3AVCA 3QO9A 4F2SA 4LH4A 4QCLA 3C6TA 3QEXA 3OYNA 3JSMA 2IOCA 3AO3A 5I42A 4CCHA 4CEAA 1WSHA 3LP0A 4FW1A 3L2QA 1J53A 1KLMA 1ASWA 4RW7A 1RT3A 3AA3A 3DMJA 3QINA 3CFPA 4DTMA 1KLNA 1D8YA 2ZQBA 3VQBA 4DFKA 4FJMA 2BE2A 2HNZA 1CZ9A 2OPRA 4DTNA 3QEVA 3TAMA 4ZTJA 5HRNA 4FM2A 5JS2A 4M3XA 1VSMA 4LY7A 3IS9A 5HROA 5J2MA 2GV9A 1UA1A 4M45A 4KTQA 2A1SA 3ITHA 3P1GA 2HHTA 3VQ6A 4N76A 4CESA 4LSNA 3VQ7A 3TABA 3SQ0A 1RT2A 4AHUA 4CK3A 5KTQA 3VA0A 3RMCA 4O0IA 4DWIA 2HVHA 4R5PA 3AVIA 1S9GA 4O55A 4CJ5A 4FYDA 3TAQA 4KHUA 2YKMA 4BDZA 3C6UA 3QNOA 1JL2A 4JS5A 2D0AA 1C0UA 1S6PA 1VRUA 4XIUA 4DFJA 1VSEA 1IG9A 3LPTA 4KB1A 4FJKA 4EP4A 4GVMA 1TKTA 2G8UA 3ZCMA 3CQ8A 4PQUA 3AA2A 1KVBA 3T1AA 3K5NA 4TSXA 1ZBHA 4O4GA 3OJSA 3NGYA 5HRSA 3D45A 5T7BA 2P1JA 4I9QA 4CJLA 2VWKA 1FKPA 1TK0A 2G8WA 4I2QA 4AILC 1QSLA 4J2EA 1YVUA 3PV8A 4FLUA 2D0BA 3NBPA 1HNVA 1F21A 4FLWA 3VQQA 1W0HA 3ALYA 3QETA 3HPHA 3THVA 4KB0A 4FK2A 1LWEA 3AA5X 4DS5A 1BIUA 1TKZA 4PWDA 5SWMA 5FRNA 4Y1DA 1NJYA 3NAEA 4E7JA 4CF2A 4O5BA 4HUFA 1VSHA 3IAYA 1ZBUA 1Q9YA 4FJJA 4CJSA 4CJTA 3AVAA 3HPGA 2HNYA 3U3YA 3OYEA 4CE9A 3SJJA 4IG3A 2DFEA 4KV8A 3V9ZA 4AHCA 1JKHA 3HL8A 2XRIA 3KK3A 3HT3A 3PX6A 2DY4A 1HPZA 3H08A 1RDBA 4DQIA 3OYGA 4DTUA 2GBZA 3ZSVA 4HHTA 3HK2A 2XY8A 1SL2A 3RR8A 1LW0A 3AO5A 1JLGA 4G1QA 3AVNA 1RT4A 1XHXA 2VG7A 4Y1CA 4CHYA 2HHXA 3ZSQA 1VSIA 2G8HA 5C24A 3JYTA 4CJKA 3KD1E 5JS1A 1VSDA 4W5OA 1TL1A 4E1NA 4PY5A 1ITGA 3PY8A 1BGXT 3ZT0A 1IO2A 4DF8A 4NYFA 2VWJA 1S5JA 4CGJA 2OA8A 4DTOA 3KKSA 4E19A 1DTQA 4RW9A 3G0ZA 4CHNA 3HP9A 3ZT3A 4PUOA 1BL3A 3C94A 1IKVA 5HRRA 3OYKA 3MEEA 1ZBIA 5I3UA 4CJVA 4NCAA 4DS4A 1HYVA 3L2WA 4JRQA 3LZIA 4IKFA 2A1RA 1RCHA 1JL1A 1A5WA 1FKOA 1QE1A 1TKXA 3SQ4A 5HP1A 4M3TA 4BDPA 1K6YA 1L5UA 3ZSZA 3WNEA 5J2QA 1NK6A 4CFBA 1BIZA 3QESA 1U48A 1LAWA 2FBYA 2HNDA 4CERA 3KJVA 1RBUA 3SUQA 5FDLA 4DU3A 1JXBA 4CJ3A 3K5LA 4B9VA 4FJ9A 1YTUA 3SQ2A 3QEIA 1TK8A 4BWJA 4LSLA 4B9MA 4K8XA 2Z1JA 1TGOA 4I2PA 3AA4A 3ZT4A 1NOYA 5CYMA 2X74A 3BDPA 1D5AA 4JS4A 4O0JA 3V6DA 1QSYA 3KD5E 1CLQA 4KTWA 1LAVA 3SPZA 2B6AA 4CEOA 4DQSA 2YNHA 3TARA 1BI4B 2E4LA 3OY9A 3KTQA 1YTAA 4CF1A 3L8BA 1LWFA 2KW4A 2KQ2A 4Z4HA 5C42A 3V9UA 1NOZA 4K8ZA 3K58A 1GOAA 1VK0A 3KLIA 3AV9A 1BISA 2JGUA 2ZE2A 4CF8A 4Z4EA 3SI6A 3AVGA 4RW4A 4KFBA 2Z1IA 3NF8A 3HP6A 2XY5A 3SUPA 5DMRA 2YHBA 4FM1A 4KHNA 4PA1A 4OLAA 4CHPA 4IFYA 3O3GA 1JXEA 4M41A 4CK2A 4DQPA 3AVLA 1RT1A 3KLEA 5HBMA 3DLRA 4HTUA 2QKKA 3MAQA 4KI6A 3V81A 2F96A 3VQCA 3HM9A 4B9UA 4Z4IA 1QQCA 4JLHA 2JLEA 2IGIA 1O1WA 3NFAA 2E6MA 3OS1A 1NKCA 4C8NA 3AVJA 4CHQA 3ZSWA 1NJWA 1RTDA 3TR8A 4E3SA 3K5MA 3NDKA 3QEWA 3UIQA 3O4NA 4MQ3A 5CY4A 1IKWA 3V9WA 5D3GA 2KTQA 1SV5A 4KHYA 2ITGA 3AVKA 4CGGA 3AO2A 1D9FA 1I3AA 3ISNC 3NF7A 3I0SA 3HO1A 3SZ2A 4KTZA 3T3FA 1RDDA 3SCXA 1C1AA 4AHRA 3PO5A 2FC0A 1B9DA 4W5NA 3MECA 2DFFA 3P5JA 3K59A 3LWLA 4FLTA 3LZJA 4KAZA 4FLYA 1KVAA 3LAKA 2HHWA 4DQRA 4CJEA 1REVA 4HCBA 2KZZA 4E7HA 4DU4A 4FJ7A 2XHBA 2WONA 1HYSA 1S1VA 2EX3A 4OJRA 4J2BA 2AJQA 4CFDA 3B6OA 5KI6A 5KRTA 1WSJA 2NUBA 2RPIA 2RKIA 3O3FA 1KVCA 4GW6A 4NYNA 3OYIA 4J2DA 3AVFA 1NK4A 1C1BA 2FBTA 2O4IA 3VQ5A 3HYFA 5DK5A 3ZSOA 1VSKA 3NCIA 3TAGA 4H4MA 3KIOA 3P83D 5J2NA 4W5TA 3KLGA 2D5RA 1S1WA 4E0DA 4W5RA 3AVBA 2FBXA 3NE6A 2QKBA 1U04A 1GOCA 1X9MA 1EX4A 4I9LA 4BWMA 1ASUA 1RTHA 1C0TA 1A5XA 2HB5A 1Y97A 3LP2A 4Q5VA 4J2AA 4Z4FA 3A2FA 4YNQA 3AVMA 1N5YA 4CJUA 3CM5A 1X9SA 1RTJA 1KSPA 1KFSA 1EP4A 3D0PA 3TI0A 3HVRA 1NK5A 1CXQA 1TKDA 3DRPA 1VRTA 4ELVA 4OKKA 2HHVA 4KHQA 1RILA 3WNFA 1EETA 5HLFA 1X1PA 4ID1A 4FJIA 2KZMA 4DU1A 1I39A 2O4GA 3CYMA 3G10A 3WNGA 4ZHRA 4FM0A 4KRFA 4OLBA 1KFDA 1SUQA 4DG1A 4ELTA 4M3WA 4CEBA 4C8KA 3V1RA 1HYZA 1HRHA 4BE2A 1RBVA 1NK8A 2Q3SA 4EP5A 3I8DA 5HRPA 3LALA 3KLFA 2KFZA 1YT3A 2YNFA 4MFBA 2XY7A 2I5JA 3DI6A 3M8PA 3KK2A 3MXJA 1IH7A 3OS0A 3SYZA 1CXUA 2ATQA 4C8LA 3VQDA 2Z1GA 3MXMA 3NF9A 1VSJA 4OGCA 3I0RA 1BI4A 2X6NA 4IBNA 4DTXA 1U45A 4F8RA 1L3UA 1WN7A 3DLEA 1S1TA 3RWUA 1LV5A 4W5QA 1HMVA 3OYAA 5C25A 3SV4A 2Y1JA 4E7LA 4B9NA 4DFPA 1RT5A 3DLGA 4N41A 3O3HA 4F3TA 3DOLA 4M3RA 4N56A 4FJ5A 2G8KA 1EXQA 4CIFA 4DTJA 5KRSA 1SKWA 3DLHA 2HW3A 2Z1HA 1GOBA 4CJPA 1VSLA 1BQMA 1WSFA 3IG1A 3LPUA 4FXDA 2QK9A 4B08A 2E6LA 3L2RA 4ZTFA 5J2PA 1BCMA 1KCFA 2X78A 3S3NA 3RR7A 3RMBA 1BCOA 3CG7A 3U3GA 2IC3A 1ASVA 1WSEA 3V1QA 2RN2A 4CGHA 4CIEA 1XI1A 2OYQA 4BE1A 4FK0A 3SQ1A 5KGWA 1RT6A 3HXMA 3M8SA 4KPYA 1U4BA 5CZ2A 1BQNA 4CECA 1U49A 2DFHA 4FLVA 4Q0BA 2FBVA 3AO4A 4FJNA 1CZBA 3L3VA 3S3MA 3PO4A 1WAFA 2Y1IA 4CF9A 3ZT2A 2G8FA 4IDKA 1NJXA 4Z4CA 2OZMA 2B5JA 2F8SA 3RTVA 4CEEA 3OYDA 3T19A 1NK9A 2DTUA 3SNNA 4DFMA 1WLJA 4DSKA 4ELUA 4AH9A 1A5VA 1TAQA 3SV3A 3LAMA 4DTRA 2YNGA 3DRRA 3VQAA 3V9XA
chains in the Genus database with same CATH superfamily
3DLKA 3C7NB 4H0VB 2Q0RA 4UQGA 2VG5A 4FLZA 3IMXA 3EO3A 1XWLA 1U47A 2KHOA 2GX9A 2RF2A 4H8KA 4HUGA 4AHSA 2HOEA 5JVGL 2V7ZA 1ZBFA 2F7TA 3VQ9A 3TSPA 1S72N 1QSSA 3LDSA 1Q9XA 1BHLA 4B9LA 4CK1A 2WUSA 3M3ZA 3HPOA 3CM6A 1L3SA 2HBKA 4M7YA 1UWBA 1S6QA 4DV0K 1JLCA 4OKEA 2W40A 4JK8A 5LL6Z 1T7PA 4ID5A 3L2UA 3CD6N 4YORA 4KI4A 4IOAL 4WFBL 1BO5O 1D9DA 4DV6K 3ULDA 4DSJA 4CHZA 3O80A 5EU7A 2OPQA 4JRPA 4B9TA 3TAFA 2CGKA 1NGBA 1WSGA 3GBTA 2EHGA 4H03B 1NMNA 1QHTA 3OJUA 1B92A 4IFVA 4FSVA 2P9SA 4IFEA 4DSFA 3AY9A 5GAGP 3NH2A 1Z05A 2FF3B 1S1UA 4X66K 5AQWA 4C8OA 4E1MA 1ZBLA 4FJGA 2O8DA 3O9RA 2HMPA 3NGIA 5ADXH 4E7IA 4B3RK 3VQ4A 3PSIA 3U8XA 3KHYA 4OKJA 4FZXC 1S1XA 2PZSA 2VG6A 3CI5A 3A5MC 3SMSA 1WNSA 4IO8A 4JI2K 3NH0A 3QEPA 3PX4A 4BVPA 4B8CA 3FFIA 3OBYA 4H0PA 1YJNN 4DSLA 4DTPA 3RRHA 4KREA 4CZJA 3F2KA 3HZ6A 1NGHA 5FROA 3VF6A 4RW8A 4BC3A 4YOUA 1NMDA 1HNIA 1YXQA 3C7NA 1NKBA 3G4SN 1GLLO 3BGRA 5AQPA 3V1OA 3C6HA 4JKCA 5AJ3K 1NK0A 4M3UA 3G6EN 3RMDA 3DM2A 2HHQA 1IBKK 1LW2A 3QIPA 1T6DA 4OX9K 4CHOA 1MU2A 4RG8A 1IBLK 3K2PA 4FZZA 4YOVA 3MX2A 2XO7A 4F3OA 1YIJN 4GMJB 1JLBA 1RT7A 4F2SA 1VQON 1K9MO 3C6TA 5BPNA 3OYNA 3JSMA 3D2FB 4UY8O 1ZBSA 1WSHA 3LP0A 3CFPA 1J53A 1KLMA 4DTMA 1VQ6N 1D8YA 4FJMA 1VSMA 2BTFA 2WTUA 5IT9O 5J2MA 3ITHA 4CESA 5AQOA 4ISFA 4AHUA 4CK3A 2PAVA 3PSFA 4JI5K 4KHUA 3H6EA 2D0AA 2GUPA 1VRUA 4BRDA 1HLUA 2QWNA 4FJKA 3I8BA 3R3LA 4MDAA 3E9PA 3KK7A 2UYTA 5HRSA 5EOYA 3KWIA 4I9QA 4CJLA 2VWKA 1TK0A 3L6QA 3O1BA 3HOSA 1DT9A 3BZKA 2FSNA 5C2DA 1HNVA 1XUPO 1OKJA 1W0HA 3HPHA 4KB0A 5AQHA 4DCHA 3AA5X 1BIUA 1NGDA 2UUAK 1DEJA 5FRNA 1XNQK 1SQKA 1VSHA 3ZX0A 4CJSA 3AVAA 4BC5A 4WCEL 4H5RA 1W2BM 5C0YA 2JWKA 3E1YA 4BREA 1JKHA 3KK3A 2DY4A 3H08A 4DV4K 3CCEN 4DTUA 3ZSVA 2A6AA 4DV7K 1Q7YO 1BOTO 2E20A 4XH5A 4X62K 4WFAL 3ENHA 1BWFO 1G99A 4CBWA 4JI6K 1BGXT 1MA9B 3D6RA 4NO7A 3ZT0A 4DR6K 4CGJA 4DTOA 4RW9A 3CETA 3W0LA 1VQMN 1BL3A 3C94A 5HRRA 2D0PA 3OYKA 1ZBIA 5I3UA 3FZKA 5M1FA 3O9UA 2UXBK 3L2WA 4IKFA 1IG8A 2NRWA 1JL1A 1QE1A 5HP1A 5M1KA 1K6YA 1L5UA 3D2FA 3WNEA 5J2QA 1BIZA 1Q18A 4FPAA 1NGCA 1YAGA 5AQKA 3SUQA 4CZEA 3K5LA 4B9VA 1YTUA 2HF4A 1NGAA 4LSLA 3K9KA 4K8XA 1TGOA 3BDPA 3V6DA 1CLQA 3VERA 4CEOA 5TKYA 4F9OA 2UUBK 1QZ6A 3OY9A 3CF5L 1QQMA 3M1FA 3P39A 4JKDA 2KQ2A 3MN5A 5F0XA 3SK3A 3HTVA 3ZX3A 2J4RA 1HNZK 3V9UA 1ILYA 3VEXA 3AV9A 2JGUA 2ZE2A 4IO9L 3AVGA 3ENBA 4KFBA 5AQIA 2YHBA 2P9NB 4H0YB 3AVLA 3AAQA 5BN8A 4KI6A 3V81A 3HM9A 5ADXA 4H0XB 4WQ4A 5GADP 1MWMA 4CBXA 2IGIA 2YX6A 4Y0WA 4JN4A 4O5FA 1WB9A 4CHQA 3ZSWA 1NJWA 3TR8A 4DR3K 2IVNA 1YUWA 4KHYA 2WC9A 3AO2A 5BRHA 3HO1A 3T3FA 5M1OA 1DKGD 4AHRA 1VHXA 1HKCA 3P38A 1SAZA 1HUXA 4CJEA 4HCBA 4B3TK 4FJ7A 3VPZA 2WONA 2EX3A 3CCJN 2QTDA 2NUBA 2RKIA 3O3FA 4J2DA 3AVFA 2O4IA 3NCIA 5AQVA 4FWLA 3TAGA 4BG9A 5J2NA 4W5TA 1ATSA 1S1WA 5EVZA 3NE6A 5LJVA 1EX4A 1JCEA 3EN9A 1A5XA 4Q5VA 3A2FA 3AVMA 1N5YA 1KFSA 3CM5A 1KSPA 1RTJA 1D4XA 1VRTA 4ELVA 4OKKA 3U4LA 5HLFA 4JYAK 5ELZA 2UU9K 5FPNA 3CQYA 1NWKA 4XH1A 4ZHRA 3CYMA 2Q97A 1WBDA 4M3WA 2IVPA 5F2RA 1LOTB 5AQNA 2E88A 5HRPA 4YDUC 2XY7A 2P9IB 4H0TB 3DI6A 3M8PA 3KK2A 3MXJA 3VQDA 4DV3K 3MXMA 3VGKA 1VSJA 4WQ5C 4JKEA 3RWUA 1WN7A 3DLEA 1LV5A 1JCFA 3OYAA 4B9NA 2CGLA 3DLGA 4N41A 3O3HA 4F3TA 3DOLA 4FJ5A 2NZTA 4K41A 1M90O 4PKGA 2P9NA 4CJPA 1NU0A 1VSLA 2QK9A 4B08A 3RR7A 3CCSN 1BCMA 1O13A 3MN6A 3VEYA 2HBMA 2OTJN 5FPEA 3U3GA 2IC3A 2RN2A 1Z6RA 1BU6O 3L4QA 5KGWA 1RT6A 3M8SA 4KPYA 1BQNA 1U49A 2DFHA 2A41A 2QEXN 5LMUK 3E9LA 3ULEB 4XEIA 1WAFA 2Y1IA 4CF9A 4LF4K 1NJXA 1N33K 3SNNA 3FGUA 3SBGA 4DTRA 4CZHA 4K25A 4CJ5A 4BRMA 4OPJA 4EHUA 4L8RB 3WXKA 4IJAA 3HJFA 4BC4A 1QS4A 2I7PA 1FW6A 1RDCA 3U6FA 4IG0A 2QWRA 1RNHA 4CF0A 4DR5K 2F8TA 3R8EA 4KKOA 5LJWA 1X3NA 4EZ9A 2WOMA 4HCCA 2YKNA 4BVOA 4B3MK 1N8RO 3DJCA 3DXKB 4CBUA 1UA0A 1SKSA 5HOOA 2IAJA 3SBTA 1HJOA 1ZC6A 5BN9A 4JI4K 4BR7A 4CGIA 1SL1A 4BRQA 3RRGA 4BC2A 3OYLA 1L3TA 2VGMA 1JLFA 3NGZA 4XH4A 1J54A 1RTIA 3RVCA 5CYQA 3QERA 4R79A 1GLJO 1IV0A 1KTQA 4N5SA 2P9IA 3QIOA 4Z0UA 4E89A 1HQEA 1JLAA 4IZ9A 4PL7A 2G8IA 2YV0X 3U9DA 3J81O 2D0CA 4EZ6A 2ASPA 3VEOA 2HHSA 4ILGB 3M8QA 2I7NA 1Z26A 2GEMA 2VYPA 3ZSYA 4DF4A 3SUNA 1N32K 4FWRA 4ILJA 3BUZB 2YHXA 4B3OA 1NK7A 4KHWA 3CFOA 3W3DA 2HBJA 5AQYA 1FXXA 4YFUA 1TAUA 3CCQN 2BANA 4AM7A 3LP1A 4BGBA 1SL0A 4NCBA 1J5OA 3GG4A 2KFNA 4FW2A 4BDYA 4BR5A 3MEDA 4RW6A 5AQTA 3IUCA 4HVJA 5J1EA 4H0OA 5I9EB 3EL2A 2RE2A 3MN7A 3HSTB 3MXIA 3RSEB 3R6MA 3ULEA 3HSCA 3O9QA 1FK9A 1HX1A 4H4OA 4OGEA 4DR1K 1C1CA 2OPPA 1E4FT 2OPSA 5E84A 2CH5A 4YOTA 4A62A 1BA1A 2RHKA 4CFCA 3G25A 1TV6A 4KHSA 1IJJA 5AQZA 1HQUA 4FJ8A 4NXNK 1VQPN 4IEEA 3A0IX 5FPDA 1VQNN 3NHGA 5KGXA 1W9HA 3F5TA 1TK5A 3OYHA 4FOEA 4BACA 4KO0A 1J9AA 4AHTA 4LFBK 4E7KA 3DOKA 2FLOA 1ZYQA 4CZFA 4FWOA 5HL7L 3T1YK 1GLFO 2HMIA 1SZ2A 4DLEA 3DYAA 4A2BA 4ICLA 3DXKA 3O5BA 3QO9A 4LF7K 5GAEP 3QEXA 3T69A 5EXWA 5I42A 4LFAK 4CCHA 3PIOL 3L2QA 1ASWA 1RT3A 3AA3A 3QINA 2QW9A 2ZQBA 4DFKA 2BE2A 2HNZA 4ZTJA 4DTNA 4BGAA 4FM2A 5JS2A 4M3XA 4LY7A 2ZJRL 3TTCA 4LF8K 5HROA 2PBDA 2NLXA 4IEIA 3OBWA 3VQ6A 5AQFA 3VQ7A 3SQ0A 1RT2A 4IJNA 4DWIA 4O0IA 4IXCA 3G71N 3TAQA 4WF9L 2YKMA 4BDZA 1S6PA 4XIUA 1VSEA 3LPTA 2G8UA 3CQ8A 4PQUA 1KVBA 2OTLN 4O4GA 4FPBA 1WOQA 4BRLA 1FKPA 4B9QA 4I2QA 4J2EA 3PV8A 3TSUA 2QWMA 2VWBA 1NJIO 4A61A 1E4GT 3ALYA 4FO0A 1GLEG 3RSEA 4PWDA 1YF5L 5SWMA 4Y1DA 3NAEA 4CF2A 4O5BA 4OO1J 3QB0A 3HPGA 3U3YA 3OYEA 3FZFA 3V9ZA 1XMQK 4MLEA 4AHCA 3MK6A 2XRIA 3HT3A 1HPZA 3OYGA 2GBZA 3QBWA 4HHTA 2XY8A 3RR8A 3T1HK 1LW0A 4G1QA 1JLGA 3AVNA 5JICA 1VSIA 3TTDA 2HHHK 1NNEA 4IOXA 1EQYA 4CJKA 3M6GA 5GIOA 3KD1E 1TL1A 4E1NA 1ITGA 4BRCA 1J5EK 1IO2A 3FZLA 3K0SA 2VWJA 4JAXA 4CI6A 1P90A 4IOCL 3WQTA 2ZJPL 3DXMB 3HP9A 1HR0K 3THWB 1IKVA 4CJVA 4CD1A 3ENOA 3LZIA 2FSJA 1RCHA 3UKRB 2JWLA 4BDPA 3ZYYX 1U6ZA 1X3MA 4CFBA 2HNDA 4CERA 1KXPA 3KJVA 1RBUA 5FDLA 4CJ3A 2O8CB 4FJ9A 1TK8A 4BWJA 2NRXA 4B9MA 2Z1JA 1W7AA 1NOYA 2X74A 1D5AA 1QSYA 3KD5E 2B6AA 4EAHD 3HOTA 4K43A 1BI4B 3CPWM 5BR9A 3KTQA 1YTAA 3A5LC 3L8BA 3S41A 2KW4A 4Z4HA 1GOAA 1BISA 3BY5A 3VGMA 4ISEA 3ZETB 1QVFM 2GTDA 4OLAA 3O3GA 4CK2A 1RT1A 3E9OA 5HBMA 4MLHA 2W6KA 2QWQA 4B9UA 4Z4IA 4BR4A 3CJBA 3EKSA 3OA9A 1QQCA 4X65K 2JLEA 4GKJK 1O1WA 4C23A 1WBBA 2E2QA 4C8NA 3AVJA 3QEWA 4MQ3A 3EEQA 1SV5A 1D9FA 1I3AA 3WXIA 4KTZA 3SJHA 1VQ8N 2DFFA 3UKUB 4FLYA 2YHWA 1KVAA 3A5OC 2KZZA 4E7HA 4DU4A 3GDQA 3IKMA 1MWKA 2AA4A 4OJRA 5KI6A 1WSJA 5A2QO 1KVCA 3VMFB 2FBTA 1KC8O 3HYFA 3DXMA 4FOIA 5TKWA 3A8YA 2FBXA 1X9MA 4L3QA 4I9LA 4BWMA 1RTHA 1C0TA 1Y97A 3THWA 4J2AA 4LF6K 1WUAA 5BREA 3D0PA 3D2EB 3UKRA 5JVHL 3MWTA 4DUZK 4K0KK 4DU1A 5AQXA 3WNGA 2A3ZA 4V19S 1SUQA 4DG1A 4ELTA 4DV1K 4CEBA 4C8KA 1HRHA 4BE2A 4JI1K 4U7BA 2O8CA 3KLFA 4H5WA 2E5LK 4C8LA 4JKAA 3OS0A 3QMLA 1CXUA 2ATQA 3LL3A 3NF9A 2CH6A 1BI4A 3I0RA 4IBNA 4F8RA 5AQRA 3SMPA 4W5QA 1HMVA 4B1WB 5C25A 2Y1JA 4M3RA 4N56A 3ZETA 1XNRK 4DTJA 4M63C 4O8UA 5BR8K 1XQSC 3I55N 1BQMA 1WSFA 3L2RA 4ZTFA 4U67L 1DGKN 4BG8A 1NBWA 4FWQA 1NGEA 1WSEA 4CGHA 4CIEA 1XI1A 2OYQA 2H3GX 4BE1A 3F9MA 3C6AA 3SQ1A 3HXMA 1U4BA 5CZ2A 3AGRA 4CW7B 4FJNA 3S3MA 4HTLA 2OZMA 2B5JA 1VQ7N 2F8SA 3T19A 1NK9A 4WFNL 4DFMA 4ELUA 3UKUA 4AH9A 3SV3A 3LAMA 1OH7A 3GL1A 3S3OA 1HJRA 2PYLA 1T3VA 2IS3A 2XY6A 1NG9A 1IKXA 1M1KO 4CGFA 1VSFA 3LDNA 3NMUA 2LSNA 2GELA 4LF5K 3LWMA 3PIPL 3TU5A 3M8RA 1S9EA 3B6PA 5M1QA 3VN5A 1C0GA 1T8EA 2FSKA 3HBTA 4FJLA 3J80O 2HVIA 3WXMB 3JXUA 3OS2A 1MDUB 3TAPA 2FF6A 1TUYA 3CJ1A 3K5OA 4KH6A 4DQQA 4KBOA 1LWCA 4JEPA 2P5GA 4H5NA 4GKKK 2O8EB 3D2EA 3CCVN 1JLQA 5LY3A 4JK7A 3D7EO 4NCGA 3FZMA 1I94K 3MMVA 4FWPA 3V9SA 2VCPA 3VQPA 2GWKA 1HNXK 4CEFA 1KRPA 5C15A 4KH4A 2ASMA 4A5AA 3EYZA 4GV3A 2X6SA 2YHYA 4CFAA 4OVLA 4FLXA 4AHVA 1YVNA 4B8AB 3RMAA 5C2FA 3IRXA 5IWAK 2ZM6K 1QQNA 4Z4GA 3WXLA 1NKEA 4EFHA 3OVNA 1SS6A 1V4SA 4BRGA 4MDBA 4DB3A 4DSIA 2QXFA 1NLVA 2OZSA 4FZYA 1QTMA 4DUYK 1JLEA 2BGGA 1TVRA 4F4KA 4DMNA 4A59A 3J7AP 4N47A 3C95A 3LP3A 2W41A 1C0MA 3Q7CA 4CEDA 2R7YA 1BUPA 4MO5A 3O9TA 3CFRA 3DLBA 3PLAA 2PYJA 4M3ZA 4CEQA 4CJFA 2P9UB 4M42A 3AARA 3BZCA 1X9WA 2HHUA 1N34K 3KLHA 4M3YA 3DLLL 2W42A 3QNNA 4DSEA 1C0FA 3WNHA 3ZT1A 2IVOA 3IFRA 2Q31A 3F9KA 3P4IA 1NJZA 4BRIA 1UAXA 2E1YA 4CJRA 4RWTA 3THXB 2E8AA 2GUIA 1R0AA 2QWOA 3DRRA 2OANA 4A57A 1Z25A 2UUCK 5CZ1A 3V9XA 3ZSRA 3NH1A 3VQ8A 3TANA 3PX0A 1XHZA 3PUFA 5KPRA 3NF6A 3TTFA 1Q8IA 5DM6L 1WSIA 3LDQA 2KKZA 3S9HA 1UOCA 3VOVA 2YNIA 5FRMA 1OH6A 4CZIA 4CJWA 1Q82O 4CZMA 1BDGA 3UE5A 4I7FA 3TSQA 3EY1A 3E01A 4YY3K 4DV2K 2P5OA 1BG3A 3I33A 3CPEA 1SKRA 4DTSA 4JK9A 2O8EA 3KKRA 3VQEA 4LH4A 4QCLA 2VQEK 1LCUA 3AO3A 4CEAA 3V4IA 4RW7A 1KLNA 2QM1A 3VQBA 3QEVA 4B3SK 3OW2M 5EX5A 3CQXA 5FLXO 1UA1A 2GV9A 1KAYA 3P1GA 2HHTA 3DAWA 3TABA 3FFKB 2CGJA 3VA0A 4R5PA 3FZHA 5AQSA 4O55A 1S9GA 4FYDA 3C6UA 2D1KA 3O6WA 4KB1A 5AZJB 4GVMA 3J7ZO 1TKTA 3ZCMA 3TPQA 3AA2A 1RDWX 4BRPA 4PKHA 3OJSA 2P9LB 1ESVA 2NRZA 3D45A 2P1JA 2P9UA 2QI2A 5T7BA 3LM9A 3CJCA 2G8WA 2QWPA 4AILC 1QSLA 2HF3A 1YVUA 2D0BA 3NBPA 1VQLN 4FLWA 2WBNA 3VQQA 3THVA 4NB4A 3QETA 4DS5A 2A42A 1NJYA 4E7JA 4M7XA 5CHIA 4FJJA 3ZLJA 3K9JA 3THXA 4CJTA 3SJJA 2DFEA 1XC3A 2GWJA 5DM7L 4CZLA 3HL8A 3VGLA 4DQIA 4JI7K 4BRNA 3HK2A 1SL2A 1YITN 2HHWA 4Y1CA 1XHXA 2VG7A 4CHYA 2HHXA 3ZSQA 3VTHA 5C24A 3JYTA 5JS1A 4W5OA 4PY5A 4BR0A 4NYFA 5GAHP 4JI8K 3FR0A 4GNIA 3KKSA 3G0ZA 3ZT3A 4PUOA 3VEWA 3MEEA 4NCAA 4DS4A 1NGFA 4JRQA 5B8HA 2BUPA 1K8AO 1FKOA 1A5WA 3SQ4A 1GLCG 2ZJQL 4M3TA 4DV5K 1IBMK 3QESA 1U48A 5H1SQ 3QBXA 4DU3A 2ASOA 3OHRA 2QA4N 4I2PA 4O0JA 3JAMO 1LAVA 4DQSA 2YNHA 2E4LA 2E2NA 2Q2RA 3O08A 3AAPA 4CF1A 4NLCA 5C42A 1Q81O 4ILHA 4AM6A 4K8ZA 3K58A 3BF1A 4Z4EA 4CF8A 3SI6A 5AZJA 4FM1A 3SAHA 3WXJA 4KHNA 4PA1A 4IFYA 4WQ4C 4DQPA 3M5RA 3P31A 2WFBA 3DLRA 5AZIB 4HTUA 3J7YP 2P9LA 2YJEA 3EE9A 2NRTA 1GLDG 2P9PB 3J8AA 3NFAA 1NKCA 2E6MA 5F1XA 4BRHA 4B1VA 1RTDA 3O1WA 3UIQA 2OCEA 1IKWA 3V9WA 4CJ7A 2KTQA 2ITGA 4NXMK 4CGGA 3LDOA 3ISNC 3NF7A 5C10A 5BPLA 3SCXA 4QS8A 1RDDA 3PO5A 1C1AA 4JD2B 3P5JA 4FLTA 3LZJA 2NNWA 1BA0A 3R1XA 3QFUA 4LC9B 5AQUA 2XHBA 1HYSA 1S1VA 1T6CA 4J2BA 5GIPA 3B6OA 1ATNA 2RPIA 3OYIA 4G9ZA 4NYNA 1NK4A 1C1BA 4GVEA 3VQ5A 4H4MA 3O9SA 3QFPA 3KIOA 3P83D 4E0DA 2D5RA 1VQ9N 1YJ9N 1U04A 1GOCA 4KAZA 4W5NA 2HB5A 4JKGB 4Z4FA 4YNQA 3HVRA 2HHVA 4KHQA 1RILA 4B1UB 4YOWA 4ID1A 4YHHK 2O4GA 1OVQA 3G10A 4B1ZA 4OLBA 2UXDK 1KFDA 4EP5A 3I8DA 4BY9C 3LALA 1Q86O 2VGNA 2KFZA 1YT3A 2YNFA 2F4VK 4MFBA 5AQJA 2I5JA 5CR4A 4C1NK 2Z1GA 3LDPA 3CHWA 4DTXA 2X6NA 1U45A 4YDUA 3L4IA 2NRVA 1S1TA 4IWVA 5MLCQ 5GINA 3SV4A 4EIAA 1RT5A 2HBLA 2D4WA 4WQ5A 4CIFA 3DLHA 1SKWA 2HW3A 2Z1HA 1GOBA 2Q1NA 3LPUA 5AZIA 2E6LA 4H5VA 2YJFA 3S3NA 1KCFA 2X78A 3RMBA 1BCOA 3CJ9A 4DQ8A 1ASVA 1QHAA 2P9PA 4RCHA 3ATVA 4FK0A 4OPAA 3WEEB 3VESA 3GE1A 4CECA 4GV6A 4BQZA 4Q0BA 3AO4A 4QS7A 3PO4A 3VETA 3FLCO 4X64K 2G8FA 2UXCK 3B8AX 4IDKA 4B1XB 4Z4CA 4CEEA 2DTUA 1NM1A 1NGJA 4JD2A 4CZGA 1A5VA 1TAQA 2YNGA 1W97L 1DLOA 3R9PA 1GLAG 5E41A 3NVMA 4WE1A 3L2VA 3SPYA 3N4QA 2BDPA 3FE1A 2NRHA 3CERA 3DRSA 4I6MB 1CZAN 3TAEA 4O44A 1HKGA 3ZX2A 1YI2N 3AO1A 3MX5A 4BE0A 3OYCA 5KPZA 1B9FA 1N6QA 5AQGA 1VAZA 4QOZB 4JKGA 4F2RA 4IDHA 3VA3A 4BROA 3O4QA 3AVHA 1WAJA 5BRDA 5EY4A 5SZTA 1K73O 4FCYA 3CC4N 5AFUH 3K57A 4CJ4A 3BEXA 3EZ5A 4C8MA 1OH8A 4QAGA 4DLGA 4FVMA 1DTTA 1EKEA 1R59O 4FWMA 1RBRA 2YHAA 1VQ4N 3EZWA 4FVUA 3VEVA 1YJWN 4HWIA 4DHYA 3SAGA 3OYBA 2HSTA 5JMVA 2ZD1A 4LD0A 1L3VA 2F9WA 3WUHA 4CIGA 4JNEA 3TWHA 2FXUA 4ISGA 3OYMA 4HUEA 3SUOA 4EHTA 2ZGZA 5AQLA 3F73A 1T03A 2ETJA 3H46O 5LMNK 1G15A 4CJQA 3ASMA 1RDAA 3WEEA 4BRFA 3ID8A 2W6LA 3HVTA 3AGKA 2ZWHA 4CGDA 2IDOA 1XC9A 3L3UA 3Q7BA 4B9SA 5BPMA 1IKYA 2B4JA 2F9TA 3OYFA 3CIPA 3CMAN 1VQ5N 2PY5A 1RBTA 1TL3A 2NRRA 2V52B 4FJHA 2Q36A 3H1VX 3JS6A 5JLHA 1V4TA 4JI3K 4KH5A 2O8BB 5K14A 5KPTA 4FK4A 2P51A 4FJXA 4DR2K 5E26A 4I6MA 3ZSXA 4LH5A 1XMOK 2V7YA 3O8MA 3THYB 1E3MA 2Q0UA 3QICA 1C6VA 3OYJA 2G8VA 1T05A 3KK1A 4OPKA 3MEGA 2QXLA 1RBSA 4CEZA 3LANA 3T7ZA 4JKHA 3AVCA 3IDHA 3CXCM 4FWKA 3SAFA 1S22A 2IOCA 4FW1A 1YHQN 3DMJA 2OPRA 3U9ZA 1CZ9A 3TAMA 5C12A 5HRNA 3C65A 5JLFA 1OVYA 3IS9A 4M45A 3KZBA 2A1SA 4KTQA 4N76A 4LSNA 3OTOK 2P9KB 5KTQA 2HVHA 3RMCA 3AVIA 1KAZA 4J8FA 3H45C 2VQFK 3QNOA 1JL2A 5M1PA 2E1ZA 4JS5A 1C0UA 4DFJA 1IG9A 1KQSM 4JKFA 3VF4A 4EP4A 4JKBA 4DR7K 3VEZA 3K5NA 3T1AA 3QDKA 2E2PA 4TSXA 1ZBHA 1ZXOA 3NGYA 4GV9A 4PL8A 4BR9A 4YOXA 1K8KB 2QWLA 3CCLN 3ATUA 4FLUA 1F21A 4FL9A 4FK2A 1LWEA 1TKZA 3BF3A 1TYQB 3DWLA 4CVNE 4HUFA 3IAYA 3MN9A 1ZBUA 4OPHA 1S3XA 1Q9YA 2HNYA 4CE9A 3CC7N 2DPNA 4IG3A 4KV8A 4AF1A 3PX6A 1H1VA 1RDBA 4O8KA 4K42A 1ATRA 2ZGYA 4RTFD 3MCAB 3AO5A 1RT4A 2AP1A 2D0OA 5AQQA 4YOYA 4JI0K 2G8HA 1QVGM 1HPMA 2O8BA 1VSDA 3PY8A 3LDLA 3HI0A 4BQLA 4DF8A 1S5JA 2OA8A 1J6ZA 4E19A 1DTQA 3THYA 3VENA 4CHNA 2EWSA 4LFCK 4A2AA 3O4WA 1HYVA 2A1RA 4GY2B 4NLBA 1TKXA 3EE8A 1RDUA 4BRAA 3ZSZA 1U2VB 1NK6A 1LAWA 2FBYA 2ZF5O 3CJ7A 5AFUA 1JXBA 1QQOA 4CD3A 3ZEUB 3SQ2A 3QEIA 4DKWA 3CCMN 3A5NC 3H3NO 3LM2A 1QZ5A 3ZT4A 3AA4A 1JJ2M 5CYMA 4JS4A 3ID6A 3UB5A 4KTWA 3SPZA 1RFQA 5KQ8A 3TARA 2P9KA 3HM8A 2O8FB 1JCGA 1LWFA 4DR4K 1NOZA 1VK0A 3KLIA 5M1NA 4RW4A 4FWNA 2Z1IA 3NF8A 3HP6A 2XY5A 3SUPA 1X9JA 3E66A 5DMRA 4CZKA 4PHTX 4CHPA 1JXEA 4M41A 2IIRA 4BR2A 3KLEA 4JV5K 2A5XA 2QKKA 4KHPK 3MAQA 2F96A 3VQCA 1EWRA 1K8KA 4JLHA 5AQMA 3CC2N 3BP8A 3OS1A 3MCPA 4E3SA 2PFUA 3K5MA 3NDKA 1TYQA 1OH5A 3O4NA 5CY4A 3CCUN 5D3GA 3CMEN 3CCRN 5BRFA 3AVKA 3MWPA 4H5TA 3I0SA 3WT0A 1FJGK 3SZ2A 2FC0A 1B9DA 1KAXA 3H1QA 3MECA 3K59A 3LWLA 2ITMA 3LAKA 4DQRA 1EO1A 4JHDB 1REVA 3EKUA 3VF2A 4E1JA 1VQKN 2BH1A 3MDQA 2AJQA 4CFDA 4GW6A 5FPMA 1Y64A 5DK5A 3C0BA 1VSKA 3ZSOA 4QS9A 3KLGA 2YI1A 4W5RA 3AVBA 2QKBA 4A5BA 5KRTA 1ASUA 1RGIA 3LP2A 4WYBA 1GLBG 4CJUA 1X9SA 1EP4A 3TI0A 1NK5A 1TKDA 1CXQA 3DRPA 5CE3A 5KQDA 3WNFA 1EETA 3VTIA 1X1PA 4FJIA 2KZMA 4FWSA 1I39A 1U2VA 4Z94A 4FM0A 3KWGA 4KRFA 2E2OA 3H3OB 3V1RA 1HYZA 1NK8A 4LF9K 1RBVA 2Q3SA 1T44A 3ZEUA 5AR0A 4BRKA 4PKIA 1IH7A 3SYZA 1HKBA 4OGCA 3NVKA 4AQYK 1L3UA 1NGGA 2O8FA 4E7LA 4DFPA 3GOIA 2P9SB 1NGIA 2V51B 3WQUA 2G8KA 1EXQA 5KRSA 4C1NI 1TUUA 2O8DB 3IG1A 4FXDA 1HNWK 3CJAA 3N4PA 5J2PA 2A40A 3CG7A 1KD1O 4MO4A 3L0QA 3V1QA 2YCHA 3SLCA 3I56N 1EWQA 3KVGA 4B1YB 4FLVA 2FBVA 1CZBA 3L3VA 3ZT2A 3RTVA 3OYDA 1WLJA 4DSKA 2KLAA 1N36K 1P8ZA 3QLHA 3VQAA 3HRGA 4JHDA
chains in the Genus database with same CATH topology
4OPJA 3S3OA 1HJRA 2PYLA 1DLOA 4L8RB 2IS3A 3DLKA 2XY6A 3HJFA 1IKXA 4CGFA 1VSFA 4UQGA 2VG5A 4FLZA 5E41A 1XWLA 1U47A 1QS4A 4WE1A 3L2VA 2LSNA 2RF2A 1RDCA 3U6FA 3SPYA 2BDPA 4H8KA 4IG0A 4HUGA 4AHSA 3LWMA 3DRSA 3M8RA 1S9EA 1RNHA 3B6PA 3VN5A 1ZBFA 3VQ9A 4CF0A 1QSSA 3TAEA 3LDSA 4O44A 2F8TA 1T8EA 1Q9XA 4FJLA 1BHLA 4B9LA 4KKOA 4CK1A 3AO1A 2HVIA 3HPOA 4BE0A 4EZ9A 2WOMA 3CM6A 2YKNA 1B9FA 3OS2A 3OYCA 3TAPA 1L3SA 1N6QA 4HCCA 1UWBA 1S6QA 3K5OA 4DQQA 4F2RA 4QOZB 1UA0A 1LWCA 3VA3A 1SKSA 1JLCA 3O4QA 2P5GA 4OKEA 2IAJA 1SL1A 4CGIA 3AVHA 1JLQA 3RRGA 4NCGA 1T7PA 1WAJA 4ID5A 3OYLA 3L2UA 1L3TA 4KI4A 1JLFA 3NGZA 5SZTA 1J54A 3VQPA 3V9SA 4FCYA 1D9DA 4CEFA 1KRPA 1RTIA 5CYQA 3K57A 3QERA 4CJ4A 3EYZA 3EZ5A 4C8MA 2X6SA 4QAGA 4CFAA 3ULDA 4OVLA 4DLGA 4FVMA 1KTQA 4DSJA 1DTTA 4CHZA 4FLXA 1EKEA 4AHVA 4B8AB 4N5SA 1RBRA 2OPQA 2YHAA 5EU7A 4JRPA 4B9TA 3QIOA 3TAFA 4Z0UA 4E89A 3RMAA 1HQEA 1JLAA 3IRXA 1WSGA 4Z4GA 1NKEA 2EHGA 2G8IA 2YV0X 3OVNA 3OYBA 2D0CA 4EZ6A 4DSIA 2QXFA 1QHTA 3OJUA 2ZD1A 1QTMA 1B92A 2OZSA 4FZYA 4IFVA 2HHSA 4LD0A 1JLEA 2BGGA 1TVRA 4DSFA 1L3VA 3NH2A 3M8QA 4F4KA 4DMNA 1Z26A 4DF4A 4N47A 3C95A 1S1UA 3LP3A 3ZSYA 3SUNA 1C0MA 4C8OA 4E1MA 1ZBLA 4CEDA 4CIGA 3V4IA 2R7YA 4FJGA 4B3OA 1NK7A 4KHWA 3CFRA 3DLBA 3NGIA 3TWHA 3CFOA 2PYJA 4M3ZA 4E7IA 1FXXA 3VQ4A 4CEQA 4CJFA 3OYMA 4YFUA 4HUEA 3SUOA 1TAUA 2BANA 2KFNA 3LP1A 4M42A 1SL0A 4NCBA 3F73A 1J5OA 4OKJA 1T03A 1X9WA 4FW2A 1S1XA 4BDYA 2PZSA 4FZXC 2HHUA 2ETJA 3KLHA 2VG6A 4M3YA 3MEDA 2W42A 4RW6A 3QNNA 4HVJA 4DSEA 1G15A 5J1EA 4CJQA 3WNHA 1WNSA 1RDAA 3ASMA 3HSTB 3ZT1A 3F9KA 3NH0A 3MXIA 3QEPA 1NJZA 3HVTA 3PX4A 1UAXA 4CGDA 2IDOA 3FFIA 4B8CA 4OGEA 1FK9A 3L3UA 4H4OA 4CJRA 1XC9A 1C1CA 2OPPA 2OPSA 4DSLA 4DTPA 3RRHA 4B9SA 1IKYA 4KREA 2GUIA 1R0AA 2B4JA 3QLHA 3OYFA 4CFCA 5FROA 1Z25A 4RW8A 1TV6A 5CZ1A 4KHSA 2PY5A 1RBTA 3ZSRA 1TL3A 1HNIA 1HQUA 3NH1A 4FJHA 4FJ8A 1NKBA 3BGRA 3VQ8A 3NHGA 3TANA 5KGXA 3PX0A 3V1OA 1XHZA 3PUFA 1W9HA 5K14A 3NF6A 1TK5A 3OYHA 4FK4A 1Q8IA 2P51A 4BACA 4KO0A 1WSIA 1NK0A 4FJXA 4M3UA 1J9AA 4AHTA 3S9HA 1UOCA 4E7KA 3RMDA 2YNIA 3DOKA 3DM2A 5FRMA 2HHQA 3ZSXA 1LW2A 1ZYQA 4LH5A 3QIPA 4CJWA 2HMIA 4DLEA 3DYAA 4CHOA 1MU2A 4RG8A 3K2PA 4I7FA 4FZZA 3EY1A 4ICLA 3E01A 1C6VA 2XO7A 2P5OA 3OYJA 2G8VA 1T05A 3KK1A 4OPKA 3MEGA 4F3OA 1SKRA 1RBSA 4GMJB 4CEZA 4DTSA 3LANA 3KKRA 3VQEA 1JLBA 1RT7A 3AVCA 3QO9A 4F2SA 4LH4A 4QCLA 3C6TA 3QEXA 3OYNA 3JSMA 2IOCA 3AO3A 5I42A 4CCHA 4CEAA 1WSHA 3LP0A 4FW1A 3L2QA 1J53A 1KLMA 1ASWA 4RW7A 1RT3A 3AA3A 3DMJA 3QINA 3CFPA 4DTMA 1KLNA 1D8YA 2ZQBA 3VQBA 4DFKA 4FJMA 2BE2A 2HNZA 1CZ9A 2OPRA 4DTNA 3QEVA 3TAMA 4ZTJA 5HRNA 4FM2A 5JS2A 4M3XA 1VSMA 4LY7A 3IS9A 5HROA 5J2MA 2GV9A 1UA1A 4M45A 4KTQA 2A1SA 3ITHA 3P1GA 2HHTA 3VQ6A 4N76A 4CESA 4LSNA 3VQ7A 3TABA 3SQ0A 1RT2A 4AHUA 4CK3A 5KTQA 3VA0A 3RMCA 4O0IA 4DWIA 2HVHA 4R5PA 3AVIA 1S9GA 4O55A 4CJ5A 4FYDA 3TAQA 4KHUA 2YKMA 4BDZA 3C6UA 3QNOA 1JL2A 4JS5A 2D0AA 1C0UA 1S6PA 1VRUA 4XIUA 4DFJA 1VSEA 1IG9A 3LPTA 4KB1A 4FJKA 4EP4A 4GVMA 1TKTA 2G8UA 3ZCMA 3CQ8A 4PQUA 3AA2A 1KVBA 3T1AA 3K5NA 4TSXA 1ZBHA 4O4GA 3OJSA 3NGYA 5HRSA 3D45A 5T7BA 2P1JA 4I9QA 4CJLA 2VWKA 1FKPA 1TK0A 2G8WA 4I2QA 4AILC 1QSLA 4J2EA 1YVUA 3PV8A 4FLUA 2D0BA 3NBPA 1HNVA 1F21A 4FLWA 3VQQA 1W0HA 3ALYA 3QETA 3HPHA 3THVA 4KB0A 4FK2A 1LWEA 3AA5X 4DS5A 1BIUA 1TKZA 4PWDA 5SWMA 5FRNA 4Y1DA 1NJYA 3NAEA 4E7JA 4CF2A 4O5BA 4HUFA 1VSHA 3IAYA 1ZBUA 1Q9YA 4FJJA 4CJSA 4CJTA 3AVAA 3HPGA 2HNYA 3U3YA 3OYEA 4CE9A 3SJJA 4IG3A 2DFEA 4KV8A 3V9ZA 4AHCA 1JKHA 3HL8A 2XRIA 3KK3A 3HT3A 3PX6A 2DY4A 1HPZA 3H08A 1RDBA 4DQIA 3OYGA 4DTUA 2GBZA 3ZSVA 4HHTA 3HK2A 2XY8A 1SL2A 3RR8A 1LW0A 3AO5A 1JLGA 4G1QA 3AVNA 1RT4A 1XHXA 2VG7A 4Y1CA 4CHYA 2HHXA 3ZSQA 1VSIA 2G8HA 5C24A 3JYTA 4CJKA 3KD1E 5JS1A 1VSDA 4W5OA 1TL1A 4E1NA 4PY5A 1ITGA 3PY8A 1BGXT 3ZT0A 1IO2A 4DF8A 4NYFA 2VWJA 1S5JA 4CGJA 2OA8A 4DTOA 3KKSA 4E19A 1DTQA 4RW9A 3G0ZA 4CHNA 3HP9A 3ZT3A 4PUOA 1BL3A 3C94A 1IKVA 5HRRA 3OYKA 3MEEA 1ZBIA 5I3UA 4CJVA 4NCAA 4DS4A 1HYVA 3L2WA 4JRQA 3LZIA 4IKFA 2A1RA 1RCHA 1JL1A 1A5WA 1FKOA 1QE1A 1TKXA 3SQ4A 5HP1A 4M3TA 4BDPA 1K6YA 1L5UA 3ZSZA 3WNEA 5J2QA 1NK6A 4CFBA 1BIZA 3QESA 1U48A 1LAWA 2FBYA 2HNDA 4CERA 3KJVA 1RBUA 3SUQA 5FDLA 4DU3A 1JXBA 4CJ3A 3K5LA 4B9VA 4FJ9A 1YTUA 3SQ2A 3QEIA 1TK8A 4BWJA 4LSLA 4B9MA 4K8XA 2Z1JA 1TGOA 4I2PA 3AA4A 3ZT4A 1NOYA 5CYMA 2X74A 3BDPA 1D5AA 4JS4A 4O0JA 3V6DA 1QSYA 3KD5E 1CLQA 4KTWA 1LAVA 3SPZA 2B6AA 4CEOA 4DQSA 2YNHA 3TARA 1BI4B 2E4LA 3OY9A 3KTQA 1YTAA 4CF1A 3L8BA 1LWFA 2KW4A 2KQ2A 4Z4HA 5C42A 3V9UA 1NOZA 4K8ZA 3K58A 1GOAA 1VK0A 3KLIA 3AV9A 1BISA 2JGUA 2ZE2A 4CF8A 4Z4EA 3SI6A 3AVGA 4RW4A 4KFBA 2Z1IA 3NF8A 3HP6A 2XY5A 3SUPA 5DMRA 2YHBA 4FM1A 4KHNA 4PA1A 4OLAA 4CHPA 4IFYA 3O3GA 1JXEA 4M41A 4CK2A 4DQPA 3AVLA 1RT1A 3KLEA 5HBMA 3DLRA 4HTUA 2QKKA 3MAQA 4KI6A 3V81A 2F96A 3VQCA 3HM9A 4B9UA 4Z4IA 1QQCA 4JLHA 2JLEA 2IGIA 1O1WA 3NFAA 2E6MA 3OS1A 1NKCA 4C8NA 3AVJA 4CHQA 3ZSWA 1NJWA 1RTDA 3TR8A 4E3SA 3K5MA 3NDKA 3QEWA 3UIQA 3O4NA 4MQ3A 5CY4A 1IKWA 3V9WA 5D3GA 2KTQA 1SV5A 4KHYA 2ITGA 3AVKA 4CGGA 3AO2A 1D9FA 1I3AA 3ISNC 3NF7A 3I0SA 3HO1A 3SZ2A 4KTZA 3T3FA 1RDDA 3SCXA 1C1AA 4AHRA 3PO5A 2FC0A 1B9DA 4W5NA 3MECA 2DFFA 3P5JA 3K59A 3LWLA 4FLTA 3LZJA 4KAZA 4FLYA 1KVAA 3LAKA 2HHWA 4DQRA 4CJEA 1REVA 4HCBA 2KZZA 4E7HA 4DU4A 4FJ7A 2XHBA 2WONA 1HYSA 1S1VA 2EX3A 4OJRA 4J2BA 2AJQA 4CFDA 3B6OA 5KI6A 5KRTA 1WSJA 2NUBA 2RPIA 2RKIA 3O3FA 1KVCA 4GW6A 4NYNA 3OYIA 4J2DA 3AVFA 1NK4A 1C1BA 2FBTA 2O4IA 3VQ5A 3HYFA 5DK5A 3ZSOA 1VSKA 3NCIA 3TAGA 4H4MA 3KIOA 3P83D 5J2NA 4W5TA 3KLGA 2D5RA 1S1WA 4E0DA 4W5RA 3AVBA 2FBXA 3NE6A 2QKBA 1U04A 1GOCA 1X9MA 1EX4A 4I9LA 4BWMA 1ASUA 1RTHA 1C0TA 1A5XA 2HB5A 1Y97A 3LP2A 4Q5VA 4J2AA 4Z4FA 3A2FA 4YNQA 3AVMA 1N5YA 4CJUA 3CM5A 1X9SA 1RTJA 1KSPA 1KFSA 1EP4A 3D0PA 3TI0A 3HVRA 1NK5A 1CXQA 1TKDA 3DRPA 1VRTA 4ELVA 4OKKA 2HHVA 4KHQA 1RILA 3WNFA 1EETA 5HLFA 1X1PA 4ID1A 4FJIA 2KZMA 4DU1A 1I39A 2O4GA 3CYMA 3G10A 3WNGA 4ZHRA 4FM0A 4KRFA 4OLBA 1KFDA 1SUQA 4DG1A 4ELTA 4M3WA 4CEBA 4C8KA 3V1RA 1HYZA 1HRHA 4BE2A 1RBVA 1NK8A 2Q3SA 4EP5A 3I8DA 5HRPA 3LALA 3KLFA 2KFZA 1YT3A 2YNFA 4MFBA 2XY7A 2I5JA 3DI6A 3M8PA 3KK2A 3MXJA 1IH7A 3OS0A 3SYZA 1CXUA 2ATQA 4C8LA 3VQDA 2Z1GA 3MXMA 3NF9A 1VSJA 4OGCA 3I0RA 1BI4A 2X6NA 4IBNA 4DTXA 1U45A 4F8RA 1L3UA 1WN7A 3DLEA 1S1TA 3RWUA 1LV5A 4W5QA 1HMVA 3OYAA 5C25A 3SV4A 2Y1JA 4E7LA 4B9NA 4DFPA 1RT5A 3DLGA 4N41A 3O3HA 4F3TA 3DOLA 4M3RA 4N56A 4FJ5A 2G8KA 1EXQA 4CIFA 4DTJA 5KRSA 1SKWA 3DLHA 2HW3A 2Z1HA 1GOBA 4CJPA 1VSLA 1BQMA 1WSFA 3IG1A 3LPUA 4FXDA 2QK9A 4B08A 2E6LA 3L2RA 4ZTFA 5J2PA 1BCMA 1KCFA 2X78A 3S3NA 3RR7A 3RMBA 1BCOA 3CG7A 3U3GA 2IC3A 1ASVA 1WSEA 3V1QA 2RN2A 4CGHA 4CIEA 1XI1A 2OYQA 4BE1A 4FK0A 3SQ1A 5KGWA 1RT6A 3HXMA 3M8SA 4KPYA 1U4BA 5CZ2A 1BQNA 4CECA 1U49A 2DFHA 4FLVA 4Q0BA 2FBVA 3AO4A 4FJNA 1CZBA 3L3VA 3S3MA 3PO4A 1WAFA 2Y1IA 4CF9A 3ZT2A 2G8FA 4IDKA 1NJXA 4Z4CA 2OZMA 2B5JA 2F8SA 3RTVA 4CEEA 3OYDA 3T19A 1NK9A 2DTUA 3SNNA 4DFMA 1WLJA 4DSKA 4ELUA 4AH9A 1A5VA 1TAQA 3SV3A 3LAMA 4DTRA 2YNGA 3DRRA 3VQAA 3V9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPJ A;  3S3O A;  1HJR A;  2PYL A;  1DLO A;  4L8R B;  2IS3 A;  3DLK A;  2XY6 A;  3HJF A;  1IKX A;  4CGF A;  1VSF A;  4UQG A;  2VG5 A;  4FLZ A;  5E41 A;  1XWL A;  1U47 A;  1QS4 A;  4WE1 A;  3L2V A;  2LSN A;  2RF2 A;  1RDC A;  3U6F A;  3SPY A;  2BDP A;  4H8K A;  4IG0 A;  4HUG A;  4AHS A;  3LWM A;  3DRS A;  3M8R A;  1S9E A;  1RNH A;  3B6P A;  3VN5 A;  1ZBF A;  3VQ9 A;  4CF0 A;  1QSS A;  3TAE A;  3LDS A;  4O44 A;  2F8T A;  1T8E A;  1Q9X A;  4FJL A;  1BHL A;  4B9L A;  4KKO A;  4CK1 A;  3AO1 A;  2HVI A;  3HPO A;  4BE0 A;  4EZ9 A;  2WOM A;  3CM6 A;  2YKN A;  1B9F A;  3OS2 A;  3OYC A;  3TAP A;  1L3S A;  1N6Q A;  4HCC A;  1UWB A;  1S6Q A;  3K5O A;  4DQQ A;  4F2R A;  4QOZ B;  1UA0 A;  1LWC A;  3VA3 A;  1SKS A;  1JLC A;  3O4Q A;  2P5G A;  4OKE A;  2IAJ A;  1SL1 A;  4CGI A;  3AVH A;  1JLQ A;  3RRG A;  4NCG A;  1T7P A;  1WAJ A;  4ID5 A;  3OYL A;  3L2U A;  1L3T A;  4KI4 A;  1JLF A;  3NGZ A;  5SZT A;  1J54 A;  3VQP A;  3V9S A;  4FCY A;  1D9D A;  4CEF A;  1KRP A;  1RTI A;  5CYQ A;  3K57 A;  3QER A;  4CJ4 A;  3EYZ A;  3EZ5 A;  4C8M A;  2X6S A;  4QAG A;  4CFA A;  3ULD A;  4OVL A;  4DLG A;  4FVM A;  1KTQ A;  4DSJ A;  1DTT A;  4CHZ A;  4FLX A;  1EKE A;  4AHV A;  4B8A B;  4N5S A;  1RBR A;  2OPQ A;  2YHA A;  5EU7 A;  4JRP A;  4B9T A;  3QIO A;  3TAF A;  4Z0U A;  4E89 A;  3RMA A;  1HQE A;  1JLA A;  3IRX A;  1WSG A;  4Z4G A;  1NKE A;  2EHG A;  2G8I A;  2YV0 X;  3OVN A;  3OYB A;  2D0C A;  4EZ6 A;  4DSI A;  2QXF A;  1QHT A;  3OJU A;  2ZD1 A;  1QTM A;  1B92 A;  2OZS A;  4FZY A;  4IFV A;  2HHS A;  4LD0 A;  1JLE A;  2BGG A;  1TVR A;  4DSF A;  1L3V A;  3NH2 A;  3M8Q A;  4F4K A;  4DMN A;  1Z26 A;  4DF4 A;  4N47 A;  3C95 A;  1S1U A;  3LP3 A;  3ZSY A;  3SUN A;  1C0M A;  4C8O A;  4E1M A;  1ZBL A;  4CED A;  4CIG A;  3V4I A;  2R7Y A;  4FJG A;  4B3O A;  1NK7 A;  4KHW A;  3CFR A;  3DLB A;  3NGI A;  3TWH A;  3CFO A;  2PYJ A;  4M3Z A;  4E7I A;  1FXX A;  3VQ4 A;  4CEQ A;  4CJF A;  3OYM A;  4YFU A;  4HUE A;  3SUO A;  1TAU A;  2BAN A;  2KFN A;  3LP1 A;  4M42 A;  1SL0 A;  4NCB A;  3F73 A;  1J5O A;  4OKJ A;  1T03 A;  1X9W A;  4FW2 A;  1S1X A;  4BDY A;  2PZS A;  4FZX C;  2HHU A;  2ETJ A;  3KLH A;  2VG6 A;  4M3Y A;  3MED A;  2W42 A;  4RW6 A;  3QNN A;  4HVJ A;  4DSE A;  1G15 A;  5J1E A;  4CJQ A;  3WNH A;  1WNS A;  1RDA A;  3ASM A;  3HST B;  3ZT1 A;  3F9K A;  3NH0 A;  3MXI A;  3QEP A;  1NJZ A;  3HVT A;  3PX4 A;  1UAX A;  4CGD A;  2IDO A;  3FFI A;  4B8C A;  4OGE A;  1FK9 A;  3L3U A;  4H4O A;  4CJR A;  1XC9 A;  1C1C A;  2OPP A;  2OPS A;  4DSL A;  4DTP A;  3RRH A;  4B9S A;  1IKY A;  4KRE A;  2GUI A;  1R0A A;  2B4J A;  3QLH A;  3OYF A;  4CFC A;  5FRO A;  1Z25 A;  4RW8 A;  1TV6 A;  5CZ1 A;  4KHS A;  2PY5 A;  1RBT A;  3ZSR A;  1TL3 A;  1HNI A;  1HQU A;  3NH1 A;  4FJH A;  4FJ8 A;  1NKB A;  3BGR A;  3VQ8 A;  3NHG A;  3TAN A;  5KGX A;  3PX0 A;  3V1O A;  1XHZ A;  3PUF A;  1W9H A;  5K14 A;  3NF6 A;  1TK5 A;  3OYH A;  4FK4 A;  1Q8I A;  2P51 A;  4BAC A;  4KO0 A;  1WSI A;  1NK0 A;  4FJX A;  4M3U A;  1J9A A;  4AHT A;  3S9H A;  1UOC A;  4E7K A;  3RMD A;  2YNI A;  3DOK A;  3DM2 A;  5FRM A;  2HHQ A;  3ZSX A;  1LW2 A;  1ZYQ A;  4LH5 A;  3QIP A;  4CJW A;  2HMI A;  4DLE A;  3DYA A;  4CHO A;  1MU2 A;  4RG8 A;  3K2P A;  4I7F A;  4FZZ A;  3EY1 A;  4ICL A;  3E01 A;  1C6V A;  2XO7 A;  2P5O A;  3OYJ A;  2G8V A;  1T05 A;  3KK1 A;  4OPK A;  3MEG A;  4F3O A;  1SKR A;  1RBS A;  4GMJ B;  4CEZ A;  4DTS A;  3LAN A;  3KKR A;  3VQE A;  1JLB A;  1RT7 A;  3AVC A;  3QO9 A;  4F2S A;  4LH4 A;  4QCL A;  3C6T A;  3QEX A;  3OYN A;  3JSM A;  2IOC A;  3AO3 A;  5I42 A;  4CCH A;  4CEA A;  1WSH A;  3LP0 A;  4FW1 A;  3L2Q A;  1J53 A;  1KLM A;  1ASW A;  4RW7 A;  1RT3 A;  3AA3 A;  3DMJ A;  3QIN A;  3CFP A;  4DTM A;  1KLN A;  1D8Y A;  2ZQB A;  3VQB A;  4DFK A;  4FJM A;  2BE2 A;  2HNZ A;  1CZ9 A;  2OPR A;  4DTN A;  3QEV A;  3TAM A;  4ZTJ A;  5HRN A;  4FM2 A;  5JS2 A;  4M3X A;  1VSM A;  4LY7 A;  3IS9 A;  5HRO A;  5J2M A;  2GV9 A;  1UA1 A;  4M45 A;  4KTQ A;  2A1S A;  3ITH A;  3P1G A;  2HHT A;  3VQ6 A;  4N76 A;  4CES A;  4LSN A;  3VQ7 A;  3TAB A;  3SQ0 A;  1RT2 A;  4AHU A;  4CK3 A;  5KTQ A;  3VA0 A;  3RMC A;  4O0I A;  4DWI A;  2HVH A;  4R5P A;  3AVI A;  1S9G A;  4O55 A;  4CJ5 A;  4FYD A;  3TAQ A;  4KHU A;  2YKM A;  4BDZ A;  3C6U A;  3QNO A;  1JL2 A;  4JS5 A;  2D0A A;  1C0U A;  1S6P A;  1VRU A;  4XIU A;  4DFJ A;  1VSE A;  1IG9 A;  3LPT A;  4KB1 A;  4FJK A;  4EP4 A;  4GVM A;  1TKT A;  2G8U A;  3ZCM A;  3CQ8 A;  4PQU A;  3AA2 A;  1KVB A;  3T1A A;  3K5N A;  4TSX A;  1ZBH A;  4O4G A;  3OJS A;  3NGY A;  5HRS A;  3D45 A;  5T7B A;  2P1J A;  4I9Q A;  4CJL A;  2VWK A;  1FKP A;  1TK0 A;  2G8W A;  4I2Q A;  4AIL C;  1QSL A;  4J2E A;  1YVU A;  3PV8 A;  4FLU A;  2D0B A;  3NBP A;  1HNV A;  1F21 A;  4FLW A;  3VQQ A;  1W0H A;  3ALY A;  3QET A;  3HPH A;  3THV A;  4KB0 A;  4FK2 A;  1LWE A;  3AA5 X;  4DS5 A;  1BIU A;  1TKZ A;  4PWD A;  5SWM A;  5FRN A;  4Y1D A;  1NJY A;  3NAE A;  4E7J A;  4CF2 A;  4O5B A;  4HUF A;  1VSH A;  3IAY A;  1ZBU A;  1Q9Y A;  4FJJ A;  4CJS A;  4CJT A;  3AVA A;  3HPG A;  2HNY A;  3U3Y A;  3OYE A;  4CE9 A;  3SJJ A;  4IG3 A;  2DFE A;  4KV8 A;  3V9Z A;  4AHC A;  1JKH A;  3HL8 A;  2XRI A;  3KK3 A;  3HT3 A;  3PX6 A;  2DY4 A;  1HPZ A;  3H08 A;  1RDB A;  4DQI A;  3OYG A;  4DTU A;  2GBZ A;  3ZSV A;  4HHT A;  3HK2 A;  2XY8 A;  1SL2 A;  3RR8 A;  1LW0 A;  3AO5 A;  1JLG A;  4G1Q A;  3AVN A;  1RT4 A;  1XHX A;  2VG7 A;  4Y1C A;  4CHY A;  2HHX A;  3ZSQ A;  1VSI A;  2G8H A;  5C24 A;  3JYT A;  4CJK A;  3KD1 E;  5JS1 A;  1VSD A;  4W5O A;  1TL1 A;  4E1N A;  4PY5 A;  1ITG A;  3PY8 A;  1BGX T;  3ZT0 A;  1IO2 A;  4DF8 A;  4NYF A;  2VWJ A;  1S5J A;  4CGJ A;  2OA8 A;  4DTO A;  3KKS A;  4E19 A;  1DTQ A;  4RW9 A;  3G0Z A;  4CHN A;  3HP9 A;  3ZT3 A;  4PUO A;  1BL3 A;  3C94 A;  1IKV A;  5HRR A;  3OYK A;  3MEE A;  1ZBI A;  5I3U A;  4CJV A;  4NCA A;  4DS4 A;  1HYV A;  3L2W A;  4JRQ A;  3LZI A;  4IKF A;  2A1R A;  1RCH A;  1JL1 A;  1A5W A;  1FKO A;  1QE1 A;  1TKX A;  3SQ4 A;  5HP1 A;  4M3T A;  4BDP A;  1K6Y A;  1L5U A;  3ZSZ A;  3WNE A;  5J2Q A;  1NK6 A;  4CFB A;  1BIZ A;  3QES A;  1U48 A;  1LAW A;  2FBY A;  2HND A;  4CER A;  3KJV A;  1RBU A;  3SUQ A;  5FDL A;  4DU3 A;  1JXB A;  4CJ3 A;  3K5L A;  4B9V A;  4FJ9 A;  1YTU A;  3SQ2 A;  3QEI A;  1TK8 A;  4BWJ A;  4LSL A;  4B9M A;  4K8X A;  2Z1J A;  1TGO A;  4I2P A;  3AA4 A;  3ZT4 A;  1NOY A;  5CYM A;  2X74 A;  3BDP A;  1D5A A;  4JS4 A;  4O0J A;  3V6D A;  1QSY A;  3KD5 E;  1CLQ A;  4KTW A;  1LAV A;  3SPZ A;  2B6A A;  4CEO A;  4DQS A;  2YNH A;  3TAR A;  1BI4 B;  2E4L A;  3OY9 A;  3KTQ A;  1YTA A;  4CF1 A;  3L8B A;  1LWF A;  2KW4 A;  2KQ2 A;  4Z4H A;  5C42 A;  3V9U A;  1NOZ A;  4K8Z A;  3K58 A;  1GOA A;  1VK0 A;  3KLI A;  3AV9 A;  1BIS A;  2JGU A;  2ZE2 A;  4CF8 A;  4Z4E A;  3SI6 A;  3AVG A;  4RW4 A;  4KFB A;  2Z1I A;  3NF8 A;  3HP6 A;  2XY5 A;  3SUP A;  5DMR A;  2YHB A;  4FM1 A;  4KHN A;  4PA1 A;  4OLA A;  4CHP A;  4IFY A;  3O3G A;  1JXE A;  4M41 A;  4CK2 A;  4DQP A;  3AVL A;  1RT1 A;  3KLE A;  5HBM A;  3DLR A;  4HTU A;  2QKK A;  3MAQ A;  4KI6 A;  3V81 A;  2F96 A;  3VQC A;  3HM9 A;  4B9U A;  4Z4I A;  1QQC A;  4JLH A;  2JLE A;  2IGI A;  1O1W A;  3NFA A;  2E6M A;  3OS1 A;  1NKC A;  4C8N A;  3AVJ A;  4CHQ A;  3ZSW A;  1NJW A;  1RTD A;  3TR8 A;  4E3S A;  3K5M A;  3NDK A;  3QEW A;  3UIQ A;  3O4N A;  4MQ3 A;  5CY4 A;  1IKW A;  3V9W A;  5D3G A;  2KTQ A;  1SV5 A;  4KHY A;  2ITG A;  3AVK A;  4CGG A;  3AO2 A;  1D9F A;  1I3A A;  3ISN C;  3NF7 A;  3I0S A;  3HO1 A;  3SZ2 A;  4KTZ A;  3T3F A;  1RDD A;  3SCX A;  1C1A A;  4AHR A;  3PO5 A;  2FC0 A;  1B9D A;  4W5N A;  3MEC A;  2DFF A;  3P5J A;  3K59 A;  3LWL A;  4FLT A;  3LZJ A;  4KAZ A;  4FLY A;  1KVA A;  3LAK A;  2HHW A;  4DQR A;  4CJE A;  1REV A;  4HCB A;  2KZZ A;  4E7H A;  4DU4 A;  4FJ7 A;  2XHB A;  2WON A;  1HYS A;  1S1V A;  2EX3 A;  4OJR A;  4J2B A;  2AJQ A;  4CFD A;  3B6O A;  5KI6 A;  5KRT A;  1WSJ A;  2NUB A;  2RPI A;  2RKI A;  3O3F A;  1KVC A;  4GW6 A;  4NYN A;  3OYI A;  4J2D A;  3AVF A;  1NK4 A;  1C1B A;  2FBT A;  2O4I A;  3VQ5 A;  3HYF A;  5DK5 A;  3ZSO A;  1VSK A;  3NCI A;  3TAG A;  4H4M A;  3KIO A;  3P83 D;  5J2N A;  4W5T A;  3KLG A;  2D5R A;  1S1W A;  4E0D A;  4W5R A;  3AVB A;  2FBX A;  3NE6 A;  2QKB A;  1U04 A;  1GOC A;  1X9M A;  1EX4 A;  4I9L A;  4BWM A;  1ASU A;  1RTH A;  1C0T A;  1A5X A;  2HB5 A;  1Y97 A;  3LP2 A;  4Q5V A;  4J2A A;  4Z4F A;  3A2F A;  4YNQ A;  3AVM A;  1N5Y A;  4CJU A;  3CM5 A;  1X9S A;  1RTJ A;  1KSP A;  1KFS A;  1EP4 A;  3D0P A;  3TI0 A;  3HVR A;  1NK5 A;  1CXQ A;  1TKD A;  3DRP A;  1VRT A;  4ELV A;  4OKK A;  2HHV A;  4KHQ A;  1RIL A;  3WNF A;  1EET A;  5HLF A;  1X1P A;  4ID1 A;  4FJI A;  2KZM A;  4DU1 A;  1I39 A;  2O4G A;  3CYM A;  3G10 A;  3WNG A;  4ZHR A;  4FM0 A;  4KRF A;  4OLB A;  1KFD A;  1SUQ A;  4DG1 A;  4ELT A;  4M3W A;  4CEB A;  4C8K A;  3V1R A;  1HYZ A;  1HRH A;  4BE2 A;  1RBV A;  1NK8 A;  2Q3S A;  4EP5 A;  3I8D A;  5HRP A;  3LAL A;  3KLF A;  2KFZ A;  1YT3 A;  2YNF A;  4MFB A;  2XY7 A;  2I5J A;  3DI6 A;  3M8P A;  3KK2 A;  3MXJ A;  1IH7 A;  3OS0 A;  3SYZ A;  1CXU A;  2ATQ A;  4C8L A;  3VQD A;  2Z1G A;  3MXM A;  3NF9 A;  1VSJ A;  4OGC A;  3I0R A;  1BI4 A;  2X6N A;  4IBN A;  4DTX A;  1U45 A;  4F8R A;  1L3U A;  1WN7 A;  3DLE A;  1S1T A;  3RWU A;  1LV5 A;  4W5Q A;  1HMV A;  3OYA A;  5C25 A;  3SV4 A;  2Y1J A;  4E7L A;  4B9N A;  4DFP A;  1RT5 A;  3DLG A;  4N41 A;  3O3H A;  4F3T A;  3DOL A;  4M3R A;  4N56 A;  4FJ5 A;  2G8K A;  1EXQ A;  4CIF A;  4DTJ A;  5KRS A;  1SKW A;  3DLH A;  2HW3 A;  2Z1H A;  1GOB A;  4CJP A;  1VSL A;  1BQM A;  1WSF A;  3IG1 A;  3LPU A;  4FXD A;  2QK9 A;  4B08 A;  2E6L A;  3L2R A;  4ZTF A;  5J2P A;  1BCM A;  1KCF A;  2X78 A;  3S3N A;  3RR7 A;  3RMB A;  1BCO A;  3CG7 A;  3U3G A;  2IC3 A;  1ASV A;  1WSE A;  3V1Q A;  2RN2 A;  4CGH A;  4CIE A;  1XI1 A;  2OYQ A;  4BE1 A;  4FK0 A;  3SQ1 A;  5KGW A;  1RT6 A;  3HXM A;  3M8S A;  4KPY A;  1U4B A;  5CZ2 A;  1BQN A;  4CEC A;  1U49 A;  2DFH A;  4FLV A;  4Q0B A;  2FBV A;  3AO4 A;  4FJN A;  1CZB A;  3L3V A;  3S3M A;  3PO4 A;  1WAF A;  2Y1I A;  4CF9 A;  3ZT2 A;  2G8F A;  4IDK A;  1NJX A;  4Z4C A;  2OZM A;  2B5J A;  2F8S A;  3RTV A;  4CEE A;  3OYD A;  3T19 A;  1NK9 A;  2DTU A;  3SNN A;  4DFM A;  1WLJ A;  4DSK A;  4ELU A;  4AH9 A;  1A5V A;  1TAQ A;  3SV3 A;  3LAM A;  4DTR A;  2YNG A;  3DRR A;  3VQA A;  3V9X A; 
#chains in the Genus database with same CATH topology
 3DLK A;  3C7N B;  4H0V B;  2Q0R A;  4UQG A;  2VG5 A;  4FLZ A;  3IMX A;  3EO3 A;  1XWL A;  1U47 A;  2KHO A;  2GX9 A;  2RF2 A;  4H8K A;  4HUG A;  4AHS A;  2HOE A;  5JVG L;  2V7Z A;  1ZBF A;  2F7T A;  3VQ9 A;  3TSP A;  1S72 N;  1QSS A;  3LDS A;  1Q9X A;  1BHL A;  4B9L A;  4CK1 A;  2WUS A;  3M3Z A;  3HPO A;  3CM6 A;  1L3S A;  2HBK A;  4M7Y A;  1UWB A;  1S6Q A;  4DV0 K;  1JLC A;  4OKE A;  2W40 A;  4JK8 A;  5LL6 Z;  1T7P A;  4ID5 A;  3L2U A;  3CD6 N;  4YOR A;  4KI4 A;  4IOA L;  4WFB L;  1BO5 O;  1D9D A;  4DV6 K;  3ULD A;  4DSJ A;  4CHZ A;  3O80 A;  5EU7 A;  2OPQ A;  4JRP A;  4B9T A;  3TAF A;  2CGK A;  1NGB A;  1WSG A;  3GBT A;  2EHG A;  4H03 B;  1NMN A;  1QHT A;  3OJU A;  1B92 A;  4IFV A;  4FSV A;  2P9S A;  4IFE A;  4DSF A;  3AY9 A;  5GAG P;  3NH2 A;  1Z05 A;  2FF3 B;  1S1U A;  4X66 K;  5AQW A;  4C8O A;  4E1M A;  1ZBL A;  4FJG A;  2O8D A;  3O9R A;  2HMP A;  3NGI A;  5ADX H;  4E7I A;  4B3R K;  3VQ4 A;  3PSI A;  3U8X A;  3KHY A;  4OKJ A;  4FZX C;  1S1X A;  2PZS A;  2VG6 A;  3CI5 A;  3A5M C;  3SMS A;  1WNS A;  4IO8 A;  4JI2 K;  3NH0 A;  3QEP A;  3PX4 A;  4BVP A;  4B8C A;  3FFI A;  3OBY A;  4H0P A;  1YJN N;  4DSL A;  4DTP A;  3RRH A;  4KRE A;  4CZJ A;  3F2K A;  3HZ6 A;  1NGH A;  5FRO A;  3VF6 A;  4RW8 A;  4BC3 A;  4YOU A;  1NMD A;  1HNI A;  1YXQ A;  3C7N A;  1NKB A;  3G4S N;  1GLL O;  3BGR A;  5AQP A;  3V1O A;  3C6H A;  4JKC A;  5AJ3 K;  1NK0 A;  4M3U A;  3G6E N;  3RMD A;  3DM2 A;  2HHQ A;  1IBK K;  1LW2 A;  3QIP A;  1T6D A;  4OX9 K;  4CHO A;  1MU2 A;  4RG8 A;  1IBL K;  3K2P A;  4FZZ A;  4YOV A;  3MX2 A;  2XO7 A;  4F3O A;  1YIJ N;  4GMJ B;  1JLB A;  1RT7 A;  4F2S A;  1VQO N;  1K9M O;  3C6T A;  5BPN A;  3OYN A;  3JSM A;  3D2F B;  4UY8 O;  1ZBS A;  1WSH A;  3LP0 A;  3CFP A;  1J53 A;  1KLM A;  4DTM A;  1VQ6 N;  1D8Y A;  4FJM A;  1VSM A;  2BTF A;  2WTU A;  5IT9 O;  5J2M A;  3ITH A;  4CES A;  5AQO A;  4ISF A;  4AHU A;  4CK3 A;  2PAV A;  3PSF A;  4JI5 K;  4KHU A;  3H6E A;  2D0A A;  2GUP A;  1VRU A;  4BRD A;  1HLU A;  2QWN A;  4FJK A;  3I8B A;  3R3L A;  4MDA A;  3E9P A;  3KK7 A;  2UYT A;  5HRS A;  5EOY A;  3KWI A;  4I9Q A;  4CJL A;  2VWK A;  1TK0 A;  3L6Q A;  3O1B A;  3HOS A;  1DT9 A;  3BZK A;  2FSN A;  5C2D A;  1HNV A;  1XUP O;  1OKJ A;  1W0H A;  3HPH A;  4KB0 A;  5AQH A;  4DCH A;  3AA5 X;  1BIU A;  1NGD A;  2UUA K;  1DEJ A;  5FRN A;  1XNQ K;  1SQK A;  1VSH A;  3ZX0 A;  4CJS A;  3AVA A;  4BC5 A;  4WCE L;  4H5R A;  1W2B M;  5C0Y A;  2JWK A;  3E1Y A;  4BRE A;  1JKH A;  3KK3 A;  2DY4 A;  3H08 A;  4DV4 K;  3CCE N;  4DTU A;  3ZSV A;  2A6A A;  4DV7 K;  1Q7Y O;  1BOT O;  2E20 A;  4XH5 A;  4X62 K;  4WFA L;  3ENH A;  1BWF O;  1G99 A;  4CBW A;  4JI6 K;  1BGX T;  1MA9 B;  3D6R A;  4NO7 A;  3ZT0 A;  4DR6 K;  4CGJ A;  4DTO A;  4RW9 A;  3CET A;  3W0L A;  1VQM N;  1BL3 A;  3C94 A;  5HRR A;  2D0P A;  3OYK A;  1ZBI A;  5I3U A;  3FZK A;  5M1F A;  3O9U A;  2UXB K;  3L2W A;  4IKF A;  1IG8 A;  2NRW A;  1JL1 A;  1QE1 A;  5HP1 A;  5M1K A;  1K6Y A;  1L5U A;  3D2F A;  3WNE A;  5J2Q A;  1BIZ A;  1Q18 A;  4FPA A;  1NGC A;  1YAG A;  5AQK A;  3SUQ A;  4CZE A;  3K5L A;  4B9V A;  1YTU A;  2HF4 A;  1NGA A;  4LSL A;  3K9K A;  4K8X A;  1TGO A;  3BDP A;  3V6D A;  1CLQ A;  3VER A;  4CEO A;  5TKY A;  4F9O A;  2UUB K;  1QZ6 A;  3OY9 A;  3CF5 L;  1QQM A;  3M1F A;  3P39 A;  4JKD A;  2KQ2 A;  3MN5 A;  5F0X A;  3SK3 A;  3HTV A;  3ZX3 A;  2J4R A;  1HNZ K;  3V9U A;  1ILY A;  3VEX A;  3AV9 A;  2JGU A;  2ZE2 A;  4IO9 L;  3AVG A;  3ENB A;  4KFB A;  5AQI A;  2YHB A;  2P9N B;  4H0Y B;  3AVL A;  3AAQ A;  5BN8 A;  4KI6 A;  3V81 A;  3HM9 A;  5ADX A;  4H0X B;  4WQ4 A;  5GAD P;  1MWM A;  4CBX A;  2IGI A;  2YX6 A;  4Y0W A;  4JN4 A;  4O5F A;  1WB9 A;  4CHQ A;  3ZSW A;  1NJW A;  3TR8 A;  4DR3 K;  2IVN A;  1YUW A;  4KHY A;  2WC9 A;  3AO2 A;  5BRH A;  3HO1 A;  3T3F A;  5M1O A;  1DKG D;  4AHR A;  1VHX A;  1HKC A;  3P38 A;  1SAZ A;  1HUX A;  4CJE A;  4HCB A;  4B3T K;  4FJ7 A;  3VPZ A;  2WON A;  2EX3 A;  3CCJ N;  2QTD A;  2NUB A;  2RKI A;  3O3F A;  4J2D A;  3AVF A;  2O4I A;  3NCI A;  5AQV A;  4FWL A;  3TAG A;  4BG9 A;  5J2N A;  4W5T A;  1ATS A;  1S1W A;  5EVZ A;  3NE6 A;  5LJV A;  1EX4 A;  1JCE A;  3EN9 A;  1A5X A;  4Q5V A;  3A2F A;  3AVM A;  1N5Y A;  1KFS A;  3CM5 A;  1KSP A;  1RTJ A;  1D4X A;  1VRT A;  4ELV A;  4OKK A;  3U4L A;  5HLF A;  4JYA K;  5ELZ A;  2UU9 K;  5FPN A;  3CQY A;  1NWK A;  4XH1 A;  4ZHR A;  3CYM A;  2Q97 A;  1WBD A;  4M3W A;  2IVP A;  5F2R A;  1LOT B;  5AQN A;  2E88 A;  5HRP A;  4YDU C;  2XY7 A;  2P9I B;  4H0T B;  3DI6 A;  3M8P A;  3KK2 A;  3MXJ A;  3VQD A;  4DV3 K;  3MXM A;  3VGK A;  1VSJ A;  4WQ5 C;  4JKE A;  3RWU A;  1WN7 A;  3DLE A;  1LV5 A;  1JCF A;  3OYA A;  4B9N A;  2CGL A;  3DLG A;  4N41 A;  3O3H A;  4F3T A;  3DOL A;  4FJ5 A;  2NZT A;  4K41 A;  1M90 O;  4PKG A;  2P9N A;  4CJP A;  1NU0 A;  1VSL A;  2QK9 A;  4B08 A;  3RR7 A;  3CCS N;  1BCM A;  1O13 A;  3MN6 A;  3VEY A;  2HBM A;  2OTJ N;  5FPE A;  3U3G A;  2IC3 A;  2RN2 A;  1Z6R A;  1BU6 O;  3L4Q A;  5KGW A;  1RT6 A;  3M8S A;  4KPY A;  1BQN A;  1U49 A;  2DFH A;  2A41 A;  2QEX N;  5LMU K;  3E9L A;  3ULE B;  4XEI A;  1WAF A;  2Y1I A;  4CF9 A;  4LF4 K;  1NJX A;  1N33 K;  3SNN A;  3FGU A;  3SBG A;  4DTR A;  4CZH A;  4K25 A;  4CJ5 A;  4BRM A;  4OPJ A;  4EHU A;  4L8R B;  3WXK A;  4IJA A;  3HJF A;  4BC4 A;  1QS4 A;  2I7P A;  1FW6 A;  1RDC A;  3U6F A;  4IG0 A;  2QWR A;  1RNH A;  4CF0 A;  4DR5 K;  2F8T A;  3R8E A;  4KKO A;  5LJW A;  1X3N A;  4EZ9 A;  2WOM A;  4HCC A;  2YKN A;  4BVO A;  4B3M K;  1N8R O;  3DJC A;  3DXK B;  4CBU A;  1UA0 A;  1SKS A;  5HOO A;  2IAJ A;  3SBT A;  1HJO A;  1ZC6 A;  5BN9 A;  4JI4 K;  4BR7 A;  4CGI A;  1SL1 A;  4BRQ A;  3RRG A;  4BC2 A;  3OYL A;  1L3T A;  2VGM A;  1JLF A;  3NGZ A;  4XH4 A;  1J54 A;  1RTI A;  3RVC A;  5CYQ A;  3QER A;  4R79 A;  1GLJ O;  1IV0 A;  1KTQ A;  4N5S A;  2P9I A;  3QIO A;  4Z0U A;  4E89 A;  1HQE A;  1JLA A;  4IZ9 A;  4PL7 A;  2G8I A;  2YV0 X;  3U9D A;  3J81 O;  2D0C A;  4EZ6 A;  2ASP A;  3VEO A;  2HHS A;  4ILG B;  3M8Q A;  2I7N A;  1Z26 A;  2GEM A;  2VYP A;  3ZSY A;  4DF4 A;  3SUN A;  1N32 K;  4FWR A;  4ILJ A;  3BUZ B;  2YHX A;  4B3O A;  1NK7 A;  4KHW A;  3CFO A;  3W3D A;  2HBJ A;  5AQY A;  1FXX A;  4YFU A;  1TAU A;  3CCQ N;  2BAN A;  4AM7 A;  3LP1 A;  4BGB A;  1SL0 A;  4NCB A;  1J5O A;  3GG4 A;  2KFN A;  4FW2 A;  4BDY A;  4BR5 A;  3MED A;  4RW6 A;  5AQT A;  3IUC A;  4HVJ A;  5J1E A;  4H0O A;  5I9E B;  3EL2 A;  2RE2 A;  3MN7 A;  3HST B;  3MXI A;  3RSE B;  3R6M A;  3ULE A;  3HSC A;  3O9Q A;  1FK9 A;  1HX1 A;  4H4O A;  4OGE A;  4DR1 K;  1C1C A;  2OPP A;  1E4F T;  2OPS A;  5E84 A;  2CH5 A;  4YOT A;  4A62 A;  1BA1 A;  2RHK A;  4CFC A;  3G25 A;  1TV6 A;  4KHS A;  1IJJ A;  5AQZ A;  1HQU A;  4FJ8 A;  4NXN K;  1VQP N;  4IEE A;  3A0I X;  5FPD A;  1VQN N;  3NHG A;  5KGX A;  1W9H A;  3F5T A;  1TK5 A;  3OYH A;  4FOE A;  4BAC A;  4KO0 A;  1J9A A;  4AHT A;  4LFB K;  4E7K A;  3DOK A;  2FLO A;  1ZYQ A;  4CZF A;  4FWO A;  5HL7 L;  3T1Y K;  1GLF O;  2HMI A;  1SZ2 A;  4DLE A;  3DYA A;  4A2B A;  4ICL A;  3DXK A;  3O5B A;  3QO9 A;  4LF7 K;  5GAE P;  3QEX A;  3T69 A;  5EXW A;  5I42 A;  4LFA K;  4CCH A;  3PIO L;  3L2Q A;  1ASW A;  1RT3 A;  3AA3 A;  3QIN A;  2QW9 A;  2ZQB A;  4DFK A;  2BE2 A;  2HNZ A;  4ZTJ A;  4DTN A;  4BGA A;  4FM2 A;  5JS2 A;  4M3X A;  4LY7 A;  2ZJR L;  3TTC A;  4LF8 K;  5HRO A;  2PBD A;  2NLX A;  4IEI A;  3OBW A;  3VQ6 A;  5AQF A;  3VQ7 A;  3SQ0 A;  1RT2 A;  4IJN A;  4DWI A;  4O0I A;  4IXC A;  3G71 N;  3TAQ A;  4WF9 L;  2YKM A;  4BDZ A;  1S6P A;  4XIU A;  1VSE A;  3LPT A;  2G8U A;  3CQ8 A;  4PQU A;  1KVB A;  2OTL N;  4O4G A;  4FPB A;  1WOQ A;  4BRL A;  1FKP A;  4B9Q A;  4I2Q A;  4J2E A;  3PV8 A;  3TSU A;  2QWM A;  2VWB A;  1NJI O;  4A61 A;  1E4G T;  3ALY A;  4FO0 A;  1GLE G;  3RSE A;  4PWD A;  1YF5 L;  5SWM A;  4Y1D A;  3NAE A;  4CF2 A;  4O5B A;  4OO1 J;  3QB0 A;  3HPG A;  3U3Y A;  3OYE A;  3FZF A;  3V9Z A;  1XMQ K;  4MLE A;  4AHC A;  3MK6 A;  2XRI A;  3HT3 A;  1HPZ A;  3OYG A;  2GBZ A;  3QBW A;  4HHT A;  2XY8 A;  3RR8 A;  3T1H K;  1LW0 A;  4G1Q A;  1JLG A;  3AVN A;  5JIC A;  1VSI A;  3TTD A;  2HHH K;  1NNE A;  4IOX A;  1EQY A;  4CJK A;  3M6G A;  5GIO A;  3KD1 E;  1TL1 A;  4E1N A;  1ITG A;  4BRC A;  1J5E K;  1IO2 A;  3FZL A;  3K0S A;  2VWJ A;  4JAX A;  4CI6 A;  1P90 A;  4IOC L;  3WQT A;  2ZJP L;  3DXM B;  3HP9 A;  1HR0 K;  3THW B;  1IKV A;  4CJV A;  4CD1 A;  3ENO A;  3LZI A;  2FSJ A;  1RCH A;  3UKR B;  2JWL A;  4BDP A;  3ZYY X;  1U6Z A;  1X3M A;  4CFB A;  2HND A;  4CER A;  1KXP A;  3KJV A;  1RBU A;  5FDL A;  4CJ3 A;  2O8C B;  4FJ9 A;  1TK8 A;  4BWJ A;  2NRX A;  4B9M A;  2Z1J A;  1W7A A;  1NOY A;  2X74 A;  1D5A A;  1QSY A;  3KD5 E;  2B6A A;  4EAH D;  3HOT A;  4K43 A;  1BI4 B;  3CPW M;  5BR9 A;  3KTQ A;  1YTA A;  3A5L C;  3L8B A;  3S41 A;  2KW4 A;  4Z4H A;  1GOA A;  1BIS A;  3BY5 A;  3VGM A;  4ISE A;  3ZET B;  1QVF M;  2GTD A;  4OLA A;  3O3G A;  4CK2 A;  1RT1 A;  3E9O A;  5HBM A;  4MLH A;  2W6K A;  2QWQ A;  4B9U A;  4Z4I A;  4BR4 A;  3CJB A;  3EKS A;  3OA9 A;  1QQC A;  4X65 K;  2JLE A;  4GKJ K;  1O1W A;  4C23 A;  1WBB A;  2E2Q A;  4C8N A;  3AVJ A;  3QEW A;  4MQ3 A;  3EEQ A;  1SV5 A;  1D9F A;  1I3A A;  3WXI A;  4KTZ A;  3SJH A;  1VQ8 N;  2DFF A;  3UKU B;  4FLY A;  2YHW A;  1KVA A;  3A5O C;  2KZZ A;  4E7H A;  4DU4 A;  3GDQ A;  3IKM A;  1MWK A;  2AA4 A;  4OJR A;  5KI6 A;  1WSJ A;  5A2Q O;  1KVC A;  3VMF B;  2FBT A;  1KC8 O;  3HYF A;  3DXM A;  4FOI A;  5TKW A;  3A8Y A;  2FBX A;  1X9M A;  4L3Q A;  4I9L A;  4BWM A;  1RTH A;  1C0T A;  1Y97 A;  3THW A;  4J2A A;  4LF6 K;  1WUA A;  5BRE A;  3D0P A;  3D2E B;  3UKR A;  5JVH L;  3MWT A;  4DUZ K;  4K0K K;  4DU1 A;  5AQX A;  3WNG A;  2A3Z A;  4V19 S;  1SUQ A;  4DG1 A;  4ELT A;  4DV1 K;  4CEB A;  4C8K A;  1HRH A;  4BE2 A;  4JI1 K;  4U7B A;  2O8C A;  3KLF A;  4H5W A;  2E5L K;  4C8L A;  4JKA A;  3OS0 A;  3QML A;  1CXU A;  2ATQ A;  3LL3 A;  3NF9 A;  2CH6 A;  1BI4 A;  3I0R A;  4IBN A;  4F8R A;  5AQR A;  3SMP A;  4W5Q A;  1HMV A;  4B1W B;  5C25 A;  2Y1J A;  4M3R A;  4N56 A;  3ZET A;  1XNR K;  4DTJ A;  4M63 C;  4O8U A;  5BR8 K;  1XQS C;  3I55 N;  1BQM A;  1WSF A;  3L2R A;  4ZTF A;  4U67 L;  1DGK N;  4BG8 A;  1NBW A;  4FWQ A;  1NGE A;  1WSE A;  4CGH A;  4CIE A;  1XI1 A;  2OYQ A;  2H3G X;  4BE1 A;  3F9M A;  3C6A A;  3SQ1 A;  3HXM A;  1U4B A;  5CZ2 A;  3AGR A;  4CW7 B;  4FJN A;  3S3M A;  4HTL A;  2OZM A;  2B5J A;  1VQ7 N;  2F8S A;  3T19 A;  1NK9 A;  4WFN L;  4DFM A;  4ELU A;  3UKU A;  4AH9 A;  3SV3 A;  3LAM A;  1OH7 A;  3GL1 A;  3S3O A;  1HJR A;  2PYL A;  1T3V A;  2IS3 A;  2XY6 A;  1NG9 A;  1IKX A;  1M1K O;  4CGF A;  1VSF A;  3LDN A;  3NMU A;  2LSN A;  2GEL A;  4LF5 K;  3LWM A;  3PIP L;  3TU5 A;  3M8R A;  1S9E A;  3B6P A;  5M1Q A;  3VN5 A;  1C0G A;  1T8E A;  2FSK A;  3HBT A;  4FJL A;  3J80 O;  2HVI A;  3WXM B;  3JXU A;  3OS2 A;  1MDU B;  3TAP A;  2FF6 A;  1TUY A;  3CJ1 A;  3K5O A;  4KH6 A;  4DQQ A;  4KBO A;  1LWC A;  4JEP A;  2P5G A;  4H5N A;  4GKK K;  2O8E B;  3D2E A;  3CCV N;  1JLQ A;  5LY3 A;  4JK7 A;  3D7E O;  4NCG A;  3FZM A;  1I94 K;  3MMV A;  4FWP A;  3V9S A;  2VCP A;  3VQP A;  2GWK A;  1HNX K;  4CEF A;  1KRP A;  5C15 A;  4KH4 A;  2ASM A;  4A5A A;  3EYZ A;  4GV3 A;  2X6S A;  2YHY A;  4CFA A;  4OVL A;  4FLX A;  4AHV A;  1YVN A;  4B8A B;  3RMA A;  5C2F A;  3IRX A;  5IWA K;  2ZM6 K;  1QQN A;  4Z4G A;  3WXL A;  1NKE A;  4EFH A;  3OVN A;  1SS6 A;  1V4S A;  4BRG A;  4MDB A;  4DB3 A;  4DSI A;  2QXF A;  1NLV A;  2OZS A;  4FZY A;  1QTM A;  4DUY K;  1JLE A;  2BGG A;  1TVR A;  4F4K A;  4DMN A;  4A59 A;  3J7A P;  4N47 A;  3C95 A;  3LP3 A;  2W41 A;  1C0M A;  3Q7C A;  4CED A;  2R7Y A;  1BUP A;  4MO5 A;  3O9T A;  3CFR A;  3DLB A;  3PLA A;  2PYJ A;  4M3Z A;  4CEQ A;  4CJF A;  2P9U B;  4M42 A;  3AAR A;  3BZC A;  1X9W A;  2HHU A;  1N34 K;  3KLH A;  4M3Y A;  3DLL L;  2W42 A;  3QNN A;  4DSE A;  1C0F A;  3WNH A;  3ZT1 A;  2IVO A;  3IFR A;  2Q31 A;  3F9K A;  3P4I A;  1NJZ A;  4BRI A;  1UAX A;  2E1Y A;  4CJR A;  4RWT A;  3THX B;  2E8A A;  2GUI A;  1R0A A;  2QWO A;  3DRR A;  2OAN A;  4A57 A;  1Z25 A;  2UUC K;  5CZ1 A;  3V9X A;  3ZSR A;  3NH1 A;  3VQ8 A;  3TAN A;  3PX0 A;  1XHZ A;  3PUF A;  5KPR A;  3NF6 A;  3TTF A;  1Q8I A;  5DM6 L;  1WSI A;  3LDQ A;  2KKZ A;  3S9H A;  1UOC A;  3VOV A;  2YNI A;  5FRM A;  1OH6 A;  4CZI A;  4CJW A;  1Q82 O;  4CZM A;  1BDG A;  3UE5 A;  4I7F A;  3TSQ A;  3EY1 A;  3E01 A;  4YY3 K;  4DV2 K;  2P5O A;  1BG3 A;  3I33 A;  3CPE A;  1SKR A;  4DTS A;  4JK9 A;  2O8E A;  3KKR A;  3VQE A;  4LH4 A;  4QCL A;  2VQE K;  1LCU A;  3AO3 A;  4CEA A;  3V4I A;  4RW7 A;  1KLN A;  2QM1 A;  3VQB A;  3QEV A;  4B3S K;  3OW2 M;  5EX5 A;  3CQX A;  5FLX O;  1UA1 A;  2GV9 A;  1KAY A;  3P1G A;  2HHT A;  3DAW A;  3TAB A;  3FFK B;  2CGJ A;  3VA0 A;  4R5P A;  3FZH A;  5AQS A;  4O55 A;  1S9G A;  4FYD A;  3C6U A;  2D1K A;  3O6W A;  4KB1 A;  5AZJ B;  4GVM A;  3J7Z O;  1TKT A;  3ZCM A;  3TPQ A;  3AA2 A;  1RDW X;  4BRP A;  4PKH A;  3OJS A;  2P9L B;  1ESV A;  2NRZ A;  3D45 A;  2P1J A;  2P9U A;  2QI2 A;  5T7B A;  3LM9 A;  3CJC A;  2G8W A;  2QWP A;  4AIL C;  1QSL A;  2HF3 A;  1YVU A;  2D0B A;  3NBP A;  1VQL N;  4FLW A;  2WBN A;  3VQQ A;  3THV A;  4NB4 A;  3QET A;  4DS5 A;  2A42 A;  1NJY A;  4E7J A;  4M7X A;  5CHI A;  4FJJ A;  3ZLJ A;  3K9J A;  3THX A;  4CJT A;  3SJJ A;  2DFE A;  1XC3 A;  2GWJ A;  5DM7 L;  4CZL A;  3HL8 A;  3VGL A;  4DQI A;  4JI7 K;  4BRN A;  3HK2 A;  1SL2 A;  1YIT N;  2HHW A;  4Y1C A;  1XHX A;  2VG7 A;  4CHY A;  2HHX A;  3ZSQ A;  3VTH A;  5C24 A;  3JYT A;  5JS1 A;  4W5O A;  4PY5 A;  4BR0 A;  4NYF A;  5GAH P;  4JI8 K;  3FR0 A;  4GNI A;  3KKS A;  3G0Z A;  3ZT3 A;  4PUO A;  3VEW A;  3MEE A;  4NCA A;  4DS4 A;  1NGF A;  4JRQ A;  5B8H A;  2BUP A;  1K8A O;  1FKO A;  1A5W A;  3SQ4 A;  1GLC G;  2ZJQ L;  4M3T A;  4DV5 K;  1IBM K;  3QES A;  1U48 A;  5H1S Q;  3QBX A;  4DU3 A;  2ASO A;  3OHR A;  2QA4 N;  4I2P A;  4O0J A;  3JAM O;  1LAV A;  4DQS A;  2YNH A;  2E4L A;  2E2N A;  2Q2R A;  3O08 A;  3AAP A;  4CF1 A;  4NLC A;  5C42 A;  1Q81 O;  4ILH A;  4AM6 A;  4K8Z A;  3K58 A;  3BF1 A;  4Z4E A;  4CF8 A;  3SI6 A;  5AZJ A;  4FM1 A;  3SAH A;  3WXJ A;  4KHN A;  4PA1 A;  4IFY A;  4WQ4 C;  4DQP A;  3M5R A;  3P31 A;  2WFB A;  3DLR A;  5AZI B;  4HTU A;  3J7Y P;  2P9L A;  2YJE A;  3EE9 A;  2NRT A;  1GLD G;  2P9P B;  3J8A A;  3NFA A;  1NKC A;  2E6M A;  5F1X A;  4BRH A;  4B1V A;  1RTD A;  3O1W A;  3UIQ A;  2OCE A;  1IKW A;  3V9W A;  4CJ7 A;  2KTQ A;  2ITG A;  4NXM K;  4CGG A;  3LDO A;  3ISN C;  3NF7 A;  5C10 A;  5BPL A;  3SCX A;  4QS8 A;  1RDD A;  3PO5 A;  1C1A A;  4JD2 B;  3P5J A;  4FLT A;  3LZJ A;  2NNW A;  1BA0 A;  3R1X A;  3QFU A;  4LC9 B;  5AQU A;  2XHB A;  1HYS A;  1S1V A;  1T6C A;  4J2B A;  5GIP A;  3B6O A;  1ATN A;  2RPI A;  3OYI A;  4G9Z A;  4NYN A;  1NK4 A;  1C1B A;  4GVE A;  3VQ5 A;  4H4M A;  3O9S A;  3QFP A;  3KIO A;  3P83 D;  4E0D A;  2D5R A;  1VQ9 N;  1YJ9 N;  1U04 A;  1GOC A;  4KAZ A;  4W5N A;  2HB5 A;  4JKG B;  4Z4F A;  4YNQ A;  3HVR A;  2HHV A;  4KHQ A;  1RIL A;  4B1U B;  4YOW A;  4ID1 A;  4YHH K;  2O4G A;  1OVQ A;  3G10 A;  4B1Z A;  4OLB A;  2UXD K;  1KFD A;  4EP5 A;  3I8D A;  4BY9 C;  3LAL A;  1Q86 O;  2VGN A;  2KFZ A;  1YT3 A;  2YNF A;  2F4V K;  4MFB A;  5AQJ A;  2I5J A;  5CR4 A;  4C1N K;  2Z1G A;  3LDP A;  3CHW A;  4DTX A;  2X6N A;  1U45 A;  4YDU A;  3L4I A;  2NRV A;  1S1T A;  4IWV A;  5MLC Q;  5GIN A;  3SV4 A;  4EIA A;  1RT5 A;  2HBL A;  2D4W A;  4WQ5 A;  4CIF A;  3DLH A;  1SKW A;  2HW3 A;  2Z1H A;  1GOB A;  2Q1N A;  3LPU A;  5AZI A;  2E6L A;  4H5V A;  2YJF A;  3S3N A;  1KCF A;  2X78 A;  3RMB A;  1BCO A;  3CJ9 A;  4DQ8 A;  1ASV A;  1QHA A;  2P9P A;  4RCH A;  3ATV A;  4FK0 A;  4OPA A;  3WEE B;  3VES A;  3GE1 A;  4CEC A;  4GV6 A;  4BQZ A;  4Q0B A;  3AO4 A;  4QS7 A;  3PO4 A;  3VET A;  3FLC O;  4X64 K;  2G8F A;  2UXC K;  3B8A X;  4IDK A;  4B1X B;  4Z4C A;  4CEE A;  2DTU A;  1NM1 A;  1NGJ A;  4JD2 A;  4CZG A;  1A5V A;  1TAQ A;  2YNG A;  1W97 L;  1DLO A;  3R9P A;  1GLA G;  5E41 A;  3NVM A;  4WE1 A;  3L2V A;  3SPY A;  3N4Q A;  2BDP A;  3FE1 A;  2NRH A;  3CER A;  3DRS A;  4I6M B;  1CZA N;  3TAE A;  4O44 A;  1HKG A;  3ZX2 A;  1YI2 N;  3AO1 A;  3MX5 A;  4BE0 A;  3OYC A;  5KPZ A;  1B9F A;  1N6Q A;  5AQG A;  1VAZ A;  4QOZ B;  4JKG A;  4F2R A;  4IDH A;  3VA3 A;  4BRO A;  3O4Q A;  3AVH A;  1WAJ A;  5BRD A;  5EY4 A;  5SZT A;  1K73 O;  4FCY A;  3CC4 N;  5AFU H;  3K57 A;  4CJ4 A;  3BEX A;  3EZ5 A;  4C8M A;  1OH8 A;  4QAG A;  4DLG A;  4FVM A;  1DTT A;  1EKE A;  1R59 O;  4FWM A;  1RBR A;  2YHA A;  1VQ4 N;  3EZW A;  4FVU A;  3VEV A;  1YJW N;  4HWI A;  4DHY A;  3SAG A;  3OYB A;  2HST A;  5JMV A;  2ZD1 A;  4LD0 A;  1L3V A;  2F9W A;  3WUH A;  4CIG A;  4JNE A;  3TWH A;  2FXU A;  4ISG A;  3OYM A;  4HUE A;  3SUO A;  4EHT A;  2ZGZ A;  5AQL A;  3F73 A;  1T03 A;  2ETJ A;  3H46 O;  5LMN K;  1G15 A;  4CJQ A;  3ASM A;  1RDA A;  3WEE A;  4BRF A;  3ID8 A;  2W6L A;  3HVT A;  3AGK A;  2ZWH A;  4CGD A;  2IDO A;  1XC9 A;  3L3U A;  3Q7B A;  4B9S A;  5BPM A;  1IKY A;  2B4J A;  2F9T A;  3OYF A;  3CIP A;  3CMA N;  1VQ5 N;  2PY5 A;  1RBT A;  1TL3 A;  2NRR A;  2V52 B;  4FJH A;  2Q36 A;  3H1V X;  3JS6 A;  5JLH A;  1V4T A;  4JI3 K;  4KH5 A;  2O8B B;  5K14 A;  5KPT A;  4FK4 A;  2P51 A;  4FJX A;  4DR2 K;  5E26 A;  4I6M A;  3ZSX A;  4LH5 A;  1XMO K;  2V7Y A;  3O8M A;  3THY B;  1E3M A;  2Q0U A;  3QIC A;  1C6V A;  3OYJ A;  2G8V A;  1T05 A;  3KK1 A;  4OPK A;  3MEG A;  2QXL A;  1RBS A;  4CEZ A;  3LAN A;  3T7Z A;  4JKH A;  3AVC A;  3IDH A;  3CXC M;  4FWK A;  3SAF A;  1S22 A;  2IOC A;  4FW1 A;  1YHQ N;  3DMJ A;  2OPR A;  3U9Z A;  1CZ9 A;  3TAM A;  5C12 A;  5HRN A;  3C65 A;  5JLF A;  1OVY A;  3IS9 A;  4M45 A;  3KZB A;  2A1S A;  4KTQ A;  4N76 A;  4LSN A;  3OTO K;  2P9K B;  5KTQ A;  2HVH A;  3RMC A;  3AVI A;  1KAZ A;  4J8F A;  3H45 C;  2VQF K;  3QNO A;  1JL2 A;  5M1P A;  2E1Z A;  4JS5 A;  1C0U A;  4DFJ A;  1IG9 A;  1KQS M;  4JKF A;  3VF4 A;  4EP4 A;  4JKB A;  4DR7 K;  3VEZ A;  3K5N A;  3T1A A;  3QDK A;  2E2P A;  4TSX A;  1ZBH A;  1ZXO A;  3NGY A;  4GV9 A;  4PL8 A;  4BR9 A;  4YOX A;  1K8K B;  2QWL A;  3CCL N;  3ATU A;  4FLU A;  1F21 A;  4FL9 A;  4FK2 A;  1LWE A;  1TKZ A;  3BF3 A;  1TYQ B;  3DWL A;  4CVN E;  4HUF A;  3IAY A;  3MN9 A;  1ZBU A;  4OPH A;  1S3X A;  1Q9Y A;  2HNY A;  4CE9 A;  3CC7 N;  2DPN A;  4IG3 A;  4KV8 A;  4AF1 A;  3PX6 A;  1H1V A;  1RDB A;  4O8K A;  4K42 A;  1ATR A;  2ZGY A;  4RTF D;  3MCA B;  3AO5 A;  1RT4 A;  2AP1 A;  2D0O A;  5AQQ A;  4YOY A;  4JI0 K;  2G8H A;  1QVG M;  1HPM A;  2O8B A;  1VSD A;  3PY8 A;  3LDL A;  3HI0 A;  4BQL A;  4DF8 A;  1S5J A;  2OA8 A;  1J6Z A;  4E19 A;  1DTQ A;  3THY A;  3VEN A;  4CHN A;  2EWS A;  4LFC K;  4A2A A;  3O4W A;  1HYV A;  2A1R A;  4GY2 B;  4NLB A;  1TKX A;  3EE8 A;  1RDU A;  4BRA A;  3ZSZ A;  1U2V B;  1NK6 A;  1LAW A;  2FBY A;  2ZF5 O;  3CJ7 A;  5AFU A;  1JXB A;  1QQO A;  4CD3 A;  3ZEU B;  3SQ2 A;  3QEI A;  4DKW A;  3CCM N;  3A5N C;  3H3N O;  3LM2 A;  1QZ5 A;  3ZT4 A;  3AA4 A;  1JJ2 M;  5CYM A;  4JS4 A;  3ID6 A;  3UB5 A;  4KTW A;  3SPZ A;  1RFQ A;  5KQ8 A;  3TAR A;  2P9K A;  3HM8 A;  2O8F B;  1JCG A;  1LWF A;  4DR4 K;  1NOZ A;  1VK0 A;  3KLI A;  5M1N A;  4RW4 A;  4FWN A;  2Z1I A;  3NF8 A;  3HP6 A;  2XY5 A;  3SUP A;  1X9J A;  3E66 A;  5DMR A;  4CZK A;  4PHT X;  4CHP A;  1JXE A;  4M41 A;  2IIR A;  4BR2 A;  3KLE A;  4JV5 K;  2A5X A;  2QKK A;  4KHP K;  3MAQ A;  2F96 A;  3VQC A;  1EWR A;  1K8K A;  4JLH A;  5AQM A;  3CC2 N;  3BP8 A;  3OS1 A;  3MCP A;  4E3S A;  2PFU A;  3K5M A;  3NDK A;  1TYQ A;  1OH5 A;  3O4N A;  5CY4 A;  3CCU N;  5D3G A;  3CME N;  3CCR N;  5BRF A;  3AVK A;  3MWP A;  4H5T A;  3I0S A;  3WT0 A;  1FJG K;  3SZ2 A;  2FC0 A;  1B9D A;  1KAX A;  3H1Q A;  3MEC A;  3K59 A;  3LWL A;  2ITM A;  3LAK A;  4DQR A;  1EO1 A;  4JHD B;  1REV A;  3EKU A;  3VF2 A;  4E1J A;  1VQK N;  2BH1 A;  3MDQ A;  2AJQ A;  4CFD A;  4GW6 A;  5FPM A;  1Y64 A;  5DK5 A;  3C0B A;  1VSK A;  3ZSO A;  4QS9 A;  3KLG A;  2YI1 A;  4W5R A;  3AVB A;  2QKB A;  4A5B A;  5KRT A;  1ASU A;  1RGI A;  3LP2 A;  4WYB A;  1GLB G;  4CJU A;  1X9S A;  1EP4 A;  3TI0 A;  1NK5 A;  1TKD A;  1CXQ A;  3DRP A;  5CE3 A;  5KQD A;  3WNF A;  1EET A;  3VTI A;  1X1P A;  4FJI A;  2KZM A;  4FWS A;  1I39 A;  1U2V A;  4Z94 A;  4FM0 A;  3KWG A;  4KRF A;  2E2O A;  3H3O B;  3V1R A;  1HYZ A;  1NK8 A;  4LF9 K;  1RBV A;  2Q3S A;  1T44 A;  3ZEU A;  5AR0 A;  4BRK A;  4PKI A;  1IH7 A;  3SYZ A;  1HKB A;  4OGC A;  3NVK A;  4AQY K;  1L3U A;  1NGG A;  2O8F A;  4E7L A;  4DFP A;  3GOI A;  2P9S B;  1NGI A;  2V51 B;  3WQU A;  2G8K A;  1EXQ A;  5KRS A;  4C1N I;  1TUU A;  2O8D B;  3IG1 A;  4FXD A;  1HNW K;  3CJA A;  3N4P A;  5J2P A;  2A40 A;  3CG7 A;  1KD1 O;  4MO4 A;  3L0Q A;  3V1Q A;  2YCH A;  3SLC A;  3I56 N;  1EWQ A;  3KVG A;  4B1Y B;  4FLV A;  2FBV A;  1CZB A;  3L3V A;  3ZT2 A;  3RTV A;  3OYD A;  1WLJ A;  4DSK A;  2KLA A;  1N36 K;  1P8Z A;  3QLH A;  3VQA A;  3HRG A;  4JHD A; 
#chains in the Genus database with same CATH homology
 4OPJ A;  3S3O A;  1HJR A;  2PYL A;  1DLO A;  4L8R B;  2IS3 A;  3DLK A;  2XY6 A;  3HJF A;  1IKX A;  4CGF A;  1VSF A;  4UQG A;  2VG5 A;  4FLZ A;  5E41 A;  1XWL A;  1U47 A;  1QS4 A;  4WE1 A;  3L2V A;  2LSN A;  2RF2 A;  1RDC A;  3U6F A;  3SPY A;  2BDP A;  4H8K A;  4IG0 A;  4HUG A;  4AHS A;  3LWM A;  3DRS A;  3M8R A;  1S9E A;  1RNH A;  3B6P A;  3VN5 A;  1ZBF A;  3VQ9 A;  4CF0 A;  1QSS A;  3TAE A;  3LDS A;  4O44 A;  2F8T A;  1T8E A;  1Q9X A;  4FJL A;  1BHL A;  4B9L A;  4KKO A;  4CK1 A;  3AO1 A;  2HVI A;  3HPO A;  4BE0 A;  4EZ9 A;  2WOM A;  3CM6 A;  2YKN A;  1B9F A;  3OS2 A;  3OYC A;  3TAP A;  1L3S A;  1N6Q A;  4HCC A;  1UWB A;  1S6Q A;  3K5O A;  4DQQ A;  4F2R A;  4QOZ B;  1UA0 A;  1LWC A;  3VA3 A;  1SKS A;  1JLC A;  3O4Q A;  2P5G A;  4OKE A;  2IAJ A;  1SL1 A;  4CGI A;  3AVH A;  1JLQ A;  3RRG A;  4NCG A;  1T7P A;  1WAJ A;  4ID5 A;  3OYL A;  3L2U A;  1L3T A;  4KI4 A;  1JLF A;  3NGZ A;  5SZT A;  1J54 A;  3VQP A;  3V9S A;  4FCY A;  1D9D A;  4CEF A;  1KRP A;  1RTI A;  5CYQ A;  3K57 A;  3QER A;  4CJ4 A;  3EYZ A;  3EZ5 A;  4C8M A;  2X6S A;  4QAG A;  4CFA A;  3ULD A;  4OVL A;  4DLG A;  4FVM A;  1KTQ A;  4DSJ A;  1DTT A;  4CHZ A;  4FLX A;  1EKE A;  4AHV A;  4B8A B;  4N5S A;  1RBR A;  2OPQ A;  2YHA A;  5EU7 A;  4JRP A;  4B9T A;  3QIO A;  3TAF A;  4Z0U A;  4E89 A;  3RMA A;  1HQE A;  1JLA A;  3IRX A;  1WSG A;  4Z4G A;  1NKE A;  2EHG A;  2G8I A;  2YV0 X;  3OVN A;  3OYB A;  2D0C A;  4EZ6 A;  4DSI A;  2QXF A;  1QHT A;  3OJU A;  2ZD1 A;  1QTM A;  1B92 A;  2OZS A;  4FZY A;  4IFV A;  2HHS A;  4LD0 A;  1JLE A;  2BGG A;  1TVR A;  4DSF A;  1L3V A;  3NH2 A;  3M8Q A;  4F4K A;  4DMN A;  1Z26 A;  4DF4 A;  4N47 A;  3C95 A;  1S1U A;  3LP3 A;  3ZSY A;  3SUN A;  1C0M A;  4C8O A;  4E1M A;  1ZBL A;  4CED A;  4CIG A;  3V4I A;  2R7Y A;  4FJG A;  4B3O A;  1NK7 A;  4KHW A;  3CFR A;  3DLB A;  3NGI A;  3TWH A;  3CFO A;  2PYJ A;  4M3Z A;  4E7I A;  1FXX A;  3VQ4 A;  4CEQ A;  4CJF A;  3OYM A;  4YFU A;  4HUE A;  3SUO A;  1TAU A;  2BAN A;  2KFN A;  3LP1 A;  4M42 A;  1SL0 A;  4NCB A;  3F73 A;  1J5O A;  4OKJ A;  1T03 A;  1X9W A;  4FW2 A;  1S1X A;  4BDY A;  2PZS A;  4FZX C;  2HHU A;  2ETJ A;  3KLH A;  2VG6 A;  4M3Y A;  3MED A;  2W42 A;  4RW6 A;  3QNN A;  4HVJ A;  4DSE A;  1G15 A;  5J1E A;  4CJQ A;  3WNH A;  1WNS A;  1RDA A;  3ASM A;  3HST B;  3ZT1 A;  3F9K A;  3NH0 A;  3MXI A;  3QEP A;  1NJZ A;  3HVT A;  3PX4 A;  1UAX A;  4CGD A;  2IDO A;  3FFI A;  4B8C A;  4OGE A;  1FK9 A;  3L3U A;  4H4O A;  4CJR A;  1XC9 A;  1C1C A;  2OPP A;  2OPS A;  4DSL A;  4DTP A;  3RRH A;  4B9S A;  1IKY A;  4KRE A;  2GUI A;  1R0A A;  2B4J A;  3QLH A;  3OYF A;  4CFC A;  5FRO A;  1Z25 A;  4RW8 A;  1TV6 A;  5CZ1 A;  4KHS A;  2PY5 A;  1RBT A;  3ZSR A;  1TL3 A;  1HNI A;  1HQU A;  3NH1 A;  4FJH A;  4FJ8 A;  1NKB A;  3BGR A;  3VQ8 A;  3NHG A;  3TAN A;  5KGX A;  3PX0 A;  3V1O A;  1XHZ A;  3PUF A;  1W9H A;  5K14 A;  3NF6 A;  1TK5 A;  3OYH A;  4FK4 A;  1Q8I A;  2P51 A;  4BAC A;  4KO0 A;  1WSI A;  1NK0 A;  4FJX A;  4M3U A;  1J9A A;  4AHT A;  3S9H A;  1UOC A;  4E7K A;  3RMD A;  2YNI A;  3DOK A;  3DM2 A;  5FRM A;  2HHQ A;  3ZSX A;  1LW2 A;  1ZYQ A;  4LH5 A;  3QIP A;  4CJW A;  2HMI A;  4DLE A;  3DYA A;  4CHO A;  1MU2 A;  4RG8 A;  3K2P A;  4I7F A;  4FZZ A;  3EY1 A;  4ICL A;  3E01 A;  1C6V A;  2XO7 A;  2P5O A;  3OYJ A;  2G8V A;  1T05 A;  3KK1 A;  4OPK A;  3MEG A;  4F3O A;  1SKR A;  1RBS A;  4GMJ B;  4CEZ A;  4DTS A;  3LAN A;  3KKR A;  3VQE A;  1JLB A;  1RT7 A;  3AVC A;  3QO9 A;  4F2S A;  4LH4 A;  4QCL A;  3C6T A;  3QEX A;  3OYN A;  3JSM A;  2IOC A;  3AO3 A;  5I42 A;  4CCH A;  4CEA A;  1WSH A;  3LP0 A;  4FW1 A;  3L2Q A;  1J53 A;  1KLM A;  1ASW A;  4RW7 A;  1RT3 A;  3AA3 A;  3DMJ A;  3QIN A;  3CFP A;  4DTM A;  1KLN A;  1D8Y A;  2ZQB A;  3VQB A;  4DFK A;  4FJM A;  2BE2 A;  2HNZ A;  1CZ9 A;  2OPR A;  4DTN A;  3QEV A;  3TAM A;  4ZTJ A;  5HRN A;  4FM2 A;  5JS2 A;  4M3X A;  1VSM A;  4LY7 A;  3IS9 A;  5HRO A;  5J2M A;  2GV9 A;  1UA1 A;  4M45 A;  4KTQ A;  2A1S A;  3ITH A;  3P1G A;  2HHT A;  3VQ6 A;  4N76 A;  4CES A;  4LSN A;  3VQ7 A;  3TAB A;  3SQ0 A;  1RT2 A;  4AHU A;  4CK3 A;  5KTQ A;  3VA0 A;  3RMC A;  4O0I A;  4DWI A;  2HVH A;  4R5P A;  3AVI A;  1S9G A;  4O55 A;  4CJ5 A;  4FYD A;  3TAQ A;  4KHU A;  2YKM A;  4BDZ A;  3C6U A;  3QNO A;  1JL2 A;  4JS5 A;  2D0A A;  1C0U A;  1S6P A;  1VRU A;  4XIU A;  4DFJ A;  1VSE A;  1IG9 A;  3LPT A;  4KB1 A;  4FJK A;  4EP4 A;  4GVM A;  1TKT A;  2G8U A;  3ZCM A;  3CQ8 A;  4PQU A;  3AA2 A;  1KVB A;  3T1A A;  3K5N A;  4TSX A;  1ZBH A;  4O4G A;  3OJS A;  3NGY A;  5HRS A;  3D45 A;  5T7B A;  2P1J A;  4I9Q A;  4CJL A;  2VWK A;  1FKP A;  1TK0 A;  2G8W A;  4I2Q A;  4AIL C;  1QSL A;  4J2E A;  1YVU A;  3PV8 A;  4FLU A;  2D0B A;  3NBP A;  1HNV A;  1F21 A;  4FLW A;  3VQQ A;  1W0H A;  3ALY A;  3QET A;  3HPH A;  3THV A;  4KB0 A;  4FK2 A;  1LWE A;  3AA5 X;  4DS5 A;  1BIU A;  1TKZ A;  4PWD A;  5SWM A;  5FRN A;  4Y1D A;  1NJY A;  3NAE A;  4E7J A;  4CF2 A;  4O5B A;  4HUF A;  1VSH A;  3IAY A;  1ZBU A;  1Q9Y A;  4FJJ A;  4CJS A;  4CJT A;  3AVA A;  3HPG A;  2HNY A;  3U3Y A;  3OYE A;  4CE9 A;  3SJJ A;  4IG3 A;  2DFE A;  4KV8 A;  3V9Z A;  4AHC A;  1JKH A;  3HL8 A;  2XRI A;  3KK3 A;  3HT3 A;  3PX6 A;  2DY4 A;  1HPZ A;  3H08 A;  1RDB A;  4DQI A;  3OYG A;  4DTU A;  2GBZ A;  3ZSV A;  4HHT A;  3HK2 A;  2XY8 A;  1SL2 A;  3RR8 A;  1LW0 A;  3AO5 A;  1JLG A;  4G1Q A;  3AVN A;  1RT4 A;  1XHX A;  2VG7 A;  4Y1C A;  4CHY A;  2HHX A;  3ZSQ A;  1VSI A;  2G8H A;  5C24 A;  3JYT A;  4CJK A;  3KD1 E;  5JS1 A;  1VSD A;  4W5O A;  1TL1 A;  4E1N A;  4PY5 A;  1ITG A;  3PY8 A;  1BGX T;  3ZT0 A;  1IO2 A;  4DF8 A;  4NYF A;  2VWJ A;  1S5J A;  4CGJ A;  2OA8 A;  4DTO A;  3KKS A;  4E19 A;  1DTQ A;  4RW9 A;  3G0Z A;  4CHN A;  3HP9 A;  3ZT3 A;  4PUO A;  1BL3 A;  3C94 A;  1IKV A;  5HRR A;  3OYK A;  3MEE A;  1ZBI A;  5I3U A;  4CJV A;  4NCA A;  4DS4 A;  1HYV A;  3L2W A;  4JRQ A;  3LZI A;  4IKF A;  2A1R A;  1RCH A;  1JL1 A;  1A5W A;  1FKO A;  1QE1 A;  1TKX A;  3SQ4 A;  5HP1 A;  4M3T A;  4BDP A;  1K6Y A;  1L5U A;  3ZSZ A;  3WNE A;  5J2Q A;  1NK6 A;  4CFB A;  1BIZ A;  3QES A;  1U48 A;  1LAW A;  2FBY A;  2HND A;  4CER A;  3KJV A;  1RBU A;  3SUQ A;  5FDL A;  4DU3 A;  1JXB A;  4CJ3 A;  3K5L A;  4B9V A;  4FJ9 A;  1YTU A;  3SQ2 A;  3QEI A;  1TK8 A;  4BWJ A;  4LSL A;  4B9M A;  4K8X A;  2Z1J A;  1TGO A;  4I2P A;  3AA4 A;  3ZT4 A;  1NOY A;  5CYM A;  2X74 A;  3BDP A;  1D5A A;  4JS4 A;  4O0J A;  3V6D A;  1QSY A;  3KD5 E;  1CLQ A;  4KTW A;  1LAV A;  3SPZ A;  2B6A A;  4CEO A;  4DQS A;  2YNH A;  3TAR A;  1BI4 B;  2E4L A;  3OY9 A;  3KTQ A;  1YTA A;  4CF1 A;  3L8B A;  1LWF A;  2KW4 A;  2KQ2 A;  4Z4H A;  5C42 A;  3V9U A;  1NOZ A;  4K8Z A;  3K58 A;  1GOA A;  1VK0 A;  3KLI A;  3AV9 A;  1BIS A;  2JGU A;  2ZE2 A;  4CF8 A;  4Z4E A;  3SI6 A;  3AVG A;  4RW4 A;  4KFB A;  2Z1I A;  3NF8 A;  3HP6 A;  2XY5 A;  3SUP A;  5DMR A;  2YHB A;  4FM1 A;  4KHN A;  4PA1 A;  4OLA A;  4CHP A;  4IFY A;  3O3G A;  1JXE A;  4M41 A;  4CK2 A;  4DQP A;  3AVL A;  1RT1 A;  3KLE A;  5HBM A;  3DLR A;  4HTU A;  2QKK A;  3MAQ A;  4KI6 A;  3V81 A;  2F96 A;  3VQC A;  3HM9 A;  4B9U A;  4Z4I A;  1QQC A;  4JLH A;  2JLE A;  2IGI A;  1O1W A;  3NFA A;  2E6M A;  3OS1 A;  1NKC A;  4C8N A;  3AVJ A;  4CHQ A;  3ZSW A;  1NJW A;  1RTD A;  3TR8 A;  4E3S A;  3K5M A;  3NDK A;  3QEW A;  3UIQ A;  3O4N A;  4MQ3 A;  5CY4 A;  1IKW A;  3V9W A;  5D3G A;  2KTQ A;  1SV5 A;  4KHY A;  2ITG A;  3AVK A;  4CGG A;  3AO2 A;  1D9F A;  1I3A A;  3ISN C;  3NF7 A;  3I0S A;  3HO1 A;  3SZ2 A;  4KTZ A;  3T3F A;  1RDD A;  3SCX A;  1C1A A;  4AHR A;  3PO5 A;  2FC0 A;  1B9D A;  4W5N A;  3MEC A;  2DFF A;  3P5J A;  3K59 A;  3LWL A;  4FLT A;  3LZJ A;  4KAZ A;  4FLY A;  1KVA A;  3LAK A;  2HHW A;  4DQR A;  4CJE A;  1REV A;  4HCB A;  2KZZ A;  4E7H A;  4DU4 A;  4FJ7 A;  2XHB A;  2WON A;  1HYS A;  1S1V A;  2EX3 A;  4OJR A;  4J2B A;  2AJQ A;  4CFD A;  3B6O A;  5KI6 A;  5KRT A;  1WSJ A;  2NUB A;  2RPI A;  2RKI A;  3O3F A;  1KVC A;  4GW6 A;  4NYN A;  3OYI A;  4J2D A;  3AVF A;  1NK4 A;  1C1B A;  2FBT A;  2O4I A;  3VQ5 A;  3HYF A;  5DK5 A;  3ZSO A;  1VSK A;  3NCI A;  3TAG A;  4H4M A;  3KIO A;  3P83 D;  5J2N A;  4W5T A;  3KLG A;  2D5R A;  1S1W A;  4E0D A;  4W5R A;  3AVB A;  2FBX A;  3NE6 A;  2QKB A;  1U04 A;  1GOC A;  1X9M A;  1EX4 A;  4I9L A;  4BWM A;  1ASU A;  1RTH A;  1C0T A;  1A5X A;  2HB5 A;  1Y97 A;  3LP2 A;  4Q5V A;  4J2A A;  4Z4F A;  3A2F A;  4YNQ A;  3AVM A;  1N5Y A;  4CJU A;  3CM5 A;  1X9S A;  1RTJ A;  1KSP A;  1KFS A;  1EP4 A;  3D0P A;  3TI0 A;  3HVR A;  1NK5 A;  1CXQ A;  1TKD A;  3DRP A;  1VRT A;  4ELV A;  4OKK A;  2HHV A;  4KHQ A;  1RIL A;  3WNF A;  1EET A;  5HLF A;  1X1P A;  4ID1 A;  4FJI A;  2KZM A;  4DU1 A;  1I39 A;  2O4G A;  3CYM A;  3G10 A;  3WNG A;  4ZHR A;  4FM0 A;  4KRF A;  4OLB A;  1KFD A;  1SUQ A;  4DG1 A;  4ELT A;  4M3W A;  4CEB A;  4C8K A;  3V1R A;  1HYZ A;  1HRH A;  4BE2 A;  1RBV A;  1NK8 A;  2Q3S A;  4EP5 A;  3I8D A;  5HRP A;  3LAL A;  3KLF A;  2KFZ A;  1YT3 A;  2YNF A;  4MFB A;  2XY7 A;  2I5J A;  3DI6 A;  3M8P A;  3KK2 A;  3MXJ A;  1IH7 A;  3OS0 A;  3SYZ A;  1CXU A;  2ATQ A;  4C8L A;  3VQD A;  2Z1G A;  3MXM A;  3NF9 A;  1VSJ A;  4OGC A;  3I0R A;  1BI4 A;  2X6N A;  4IBN A;  4DTX A;  1U45 A;  4F8R A;  1L3U A;  1WN7 A;  3DLE A;  1S1T A;  3RWU A;  1LV5 A;  4W5Q A;  1HMV A;  3OYA A;  5C25 A;  3SV4 A;  2Y1J A;  4E7L A;  4B9N A;  4DFP A;  1RT5 A;  3DLG A;  4N41 A;  3O3H A;  4F3T A;  3DOL A;  4M3R A;  4N56 A;  4FJ5 A;  2G8K A;  1EXQ A;  4CIF A;  4DTJ A;  5KRS A;  1SKW A;  3DLH A;  2HW3 A;  2Z1H A;  1GOB A;  4CJP A;  1VSL A;  1BQM A;  1WSF A;  3IG1 A;  3LPU A;  4FXD A;  2QK9 A;  4B08 A;  2E6L A;  3L2R A;  4ZTF A;  5J2P A;  1BCM A;  1KCF A;  2X78 A;  3S3N A;  3RR7 A;  3RMB A;  1BCO A;  3CG7 A;  3U3G A;  2IC3 A;  1ASV A;  1WSE A;  3V1Q A;  2RN2 A;  4CGH A;  4CIE A;  1XI1 A;  2OYQ A;  4BE1 A;  4FK0 A;  3SQ1 A;  5KGW A;  1RT6 A;  3HXM A;  3M8S A;  4KPY A;  1U4B A;  5CZ2 A;  1BQN A;  4CEC A;  1U49 A;  2DFH A;  4FLV A;  4Q0B A;  2FBV A;  3AO4 A;  4FJN A;  1CZB A;  3L3V A;  3S3M A;  3PO4 A;  1WAF A;  2Y1I A;  4CF9 A;  3ZT2 A;  2G8F A;  4IDK A;  1NJX A;  4Z4C A;  2OZM A;  2B5J A;  2F8S A;  3RTV A;  4CEE A;  3OYD A;  3T19 A;  1NK9 A;  2DTU A;  3SNN A;  4DFM A;  1WLJ A;  4DSK A;  4ELU A;  4AH9 A;  1A5V A;  1TAQ A;  3SV3 A;  3LAM A;  4DTR A;  2YNG A;  3DRR A;  3VQA A;  3V9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...