4CGDA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cgdA00
4CEZA 2HHSA 3NAEA 1HYSA 3MEEA 4FJIA 3LP1A 3OY9A 4CJWA 1A5VA 4FLTA 1WSFA 4B9SA 4N41A 3ZT2A 3TAPA 5FRMA 1XWLA 4DMNA 2X6SA 1NK9A 4I2PA 1NOZA 4CFCA 2OPQA 3IAYA 3LWLA 3TAFA 1SL0A 4KPYA 3HP9A 1S1VA 1TK5A 1ITGA 1W9HA 2DFHA 2HHWA 5DMRA 4Z4HA 4EZ9A 1HPZA 1C0TA 3HPOA 1A5WA 4UQGA 2RKIA 1KVBA 2ATQA 3K5LA 4OKEA 1BIZA 3RWUA 3U6FA 3VQBA 4KB1A 3K57A 3PO5A 2GBZA 1NK8A 1WAFA 4Q5VA 3L2RA 4AILC 1QHTA 5JS1A 3OYKA 3OS0A 1BQNA 1SL1A 3KJVA 4M45A 1RBSA 1RT3A 4NYNA 4FJHA 4I9QA 3CFRA 4Y1DA 4DTUA 4DTJA 3AO5A 4LSLA 3DRSA 3ZCMA 2OZSA 4H4OA 3QEWA 3SUNA 2G8FA 4FJMA 1VK0A 2HNZA 2IS3A 4BE2A 4ICLA 4FM1A 4BDYA 4ELUA 1RTJA 1MU2A 3DOLA 3VQ8A 1D9DA 3VQQA 4C8KA 4NCGA 5CY4A 1KSPA 4BWMA 3AVNA 1S9GA 4CJRA 3OYFA 1RTDA 1SKWA 1QSYA 1U4BA 1BI4B 1VRUA 2IDOA 3KIOA 4OKJA 5JS2A 5C24A 1VSKA 3MECA 3KK3A 3NGIA 5KI6A 5HRPA 2JGUA 3EYZA 3LZIA 4DF8A 2F8SA 2HVIA 2ETJA 1VSHA 4F3OA 1K6YA 3NF6A 4FYDA 3ZT4A 3OYMA 4AHUA 3BGRA 4Z4GA 1C0UA 1GOBA 3C95A 1UOCA 3AVBA 1HNIA 5J2PA 4E7LA 4M3YA 1TKXA 1EX4A 5CYMA 3RMAA 2B4JA 4KHNA 4ELTA 3AA2A 4AH9A 1S1XA 4MFBA 2Z1IA 3TABA 3AV9A 4O44A 1HMVA 5KGXA 4FW2A 5KRTA 3ZT1A 3CFOA 4DS5A 3ZSYA 4DFJA 2FBTA 4LY7A 4CF2A 1I39A 1U04A 2B6AA 3O4QA 4CF8A 5J2NA 4CGFA 4N56A 1J5OA 2HW3A 3KLIA 1HRHA 1TKZA 3KK2A 3NH0A 3HPHA 3M8RA 1JLAA 2HVHA 3VQCA 3OYGA 4E7KA 2Z1JA 3NH2A 1TAUA 3RRGA 1LAVA 1KLNA 1UAXA 1ZBHA 4Z4IA 3NE6A 5HBMA 2JLEA 3TAMA 3HM9A 1LW0A 1VSFA 2DTUA 4HVJA 3D45A 4DQRA 3SUOA 4FJGA 1SUQA 2W42A 4DTNA 4I9LA 4DQPA 4KTQA 4JS5A 3SPYA 4OGEA 1XHZA 1L5UA 4Z4FA 4E1MA 1B92A 1JXEA 1NK4A 2HHUA 3KLEA 3O3GA 4AHCA 4DLEA 3V9ZA 2X78A 4IG0A 1W0HA 2ZE2A 3V6DA 4M3UA 4B9MA 3AVKA 1WSGA 1ZBUA 2IC3A 1JXBA 1TGOA 3HVRA 2IOCA 1CLQA 3AVIA 3OYDA 3MEGA 2A1SA 3O3HA 1NK7A 3V81A 3TAGA 2HHTA 1NK6A 4OKKA 2G8WA 1ASUA 1JL1A 3A2FA 3KKSA 2FBVA 3PO4A 3SUPA 1RDBA 3OYBA 1LV5A 4OPJA 1IG9A 4CJKA 1IO2A 1X1PA 2BE2A 2QXFA 4QAGA 1REVA 1JLGA 4DSFA 3ZSXA 3PV8A 4KI4A 3D0PA 4FLYA 4CCHA 1RBTA 4FJNA 1VSJA 4W5RA 3CM6A 1GOCA 3V9WA 1RBRA 4KREA 4KV8A 3I8DA 4DF4A 3B6PA 4IKFA 4CHNA 4CHZA 3P83D 4K8XA 3HJFA 1YT3A 1C6VA 4CK1A 4PUOA 4OJRA 1LW2A 3LPTA 4F2SA 4DQSA 3AVJA 1YVUA 4FJ5A 3SNNA 3QINA 1RDCA 3HXMA 3E01A 3T19A 3V4IA 1WSEA 3RRHA 1T8EA 4KHSA 5CYQA 2FBXA 4CHQA 2HHXA 3S3OA 4H4MA 3PUFA 1NJXA 4KHYA 4W5OA 1TK8A 2QKKA 5KTQA 2XRIA 4CEFA 3P5JA 3OYAA 1C1AA 4FW1A 2KZZA 4OVLA 4CJ3A 2KFZA 5DK5A 3DYAA 3SZ2A 2AJQA 4R5PA 3SUQA 4KTZA 4DTRA 4CIGA 1B9FA 4CJ4A 3SPZA 2D0BA 3AA3A 1QS4A 1BHLA 3LZJA 2Y1JA 1TKDA 2RN2A 1QSSA 2XO7A 5T7BA 4FJJA 4LH5A 3PX4A 4IBNA 3VQDA 4E7JA 1HJRA 4DTMA 1FKOA 4B9LA 5HROA 2F96A 3MXJA 4FJXA 4KHUA 3KLFA 4I2QA 4FLUA 2D5RA 1Q8IA 4FLVA 5I42A 3IS9A 1RT5A 3JYTA 4CGIA 1U45A 4ID5A 2P5GA 4CJ5A 3AO4A 3SQ1A 3LPUA 2YKMA 1ZBLA 3VA0A 3HK2A 1L3SA 4AHVA 2DFEA 3KLGA 4FLXA 1EETA 2Z1HA 2BGGA 2G8IA 4B9UA 1VRTA 1VSLA 1VSDA 4BWJA 2GV9A 3CG7A 1TAQA 2IGIA 4PA1A 1U47A 1T05A 3TR8A 4M3XA 4QOZB 3QLHA 3QNOA 3ITHA 3K2PA 2RF2A 3TWHA 2VWJA 4F4KA 4W5NA 1RCHA 1S5JA 1C1BA 4CJSA 4CJFA 1U49A 4DSKA 2VG6A 3RTVA 3SV3A 2HHVA 3OVNA 4BE0A 5HRRA 1RBUA 1XHXA 1XC9A 1YTUA 2ITGA 4XIUA 1EXQA 1J53A 4CGGA 1Z25A 3AA5X 4HHTA 1SKSA 3VQ9A 1HYZA 1IKWA 4KO0A 3QNNA 4NCAA 3ZSQA 2ZD1A 4DTOA 4N76A 1BCOA 3WNHA 3V9UA 1IH7A 1LWFA 4DFKA 3MEDA 3NFAA 4RW6A 4O0IA 1FXXA 4FM0A 5J2QA 4YNQA 3TAEA 4E0DA 5SZTA 4FLWA 4K8ZA 4C8MA 2F8TA 1HNVA 3NBPA 2KTQA 1B9DA 4PQUA 1JL2A 3DLHA 2WOMA 3M8QA 1CZBA 3QIPA 3K59A 4DS4A 1BISA 1RDDA 2P1JA 1TV6A 3AO1A 4CJLA 1KFDA 1A5XA 1BGXT 2FC0A 4B08A 3T1AA 4CJQA 3S9HA 2NUBA 3ZSWA 4DWIA 4CIFA 3LP3A 4DQIA 1RTIA 2YKNA 3AVLA 2RPIA 4OGCA 3QERA 4ELVA 1RT4A 2I5JA 3MXIA 1C0MA 4KB0A 2E6LA 3S3NA 2YNIA 3K5OA 3OJSA 3V1QA 3THVA 3UIQA 1JLQA 3LAMA 1RT6A 4LD0A 1DTQA 4CJVA 4DU3A 3RMDA 1QTMA 2OZMA 3HO1A 4CF9A 4DLGA 4NYFA 3L2UA 1KFSA 3L3VA 1HYVA 4M42A 4CJUA 2BDPA 3AVFA 3SQ0A 1NK0A 4YFUA 4FK2A 1JKHA 3VQPA 4CHOA 1RNHA 3LALA 3OYJA 1T03A 3DI6A 2A1RA 2P5OA 4CEEA 2KW4A 1WNSA 4J2BA 3RMBA 3CQ8A 4CJEA 3QEIA 2QKBA 1VSIA 1QE1A 1ASWA 4BDZA 2XY5A 4OPKA 4DQQA 4KAZA 3AVCA 4RW7A 5KRSA 3OYCA 5CZ2A 1WN7A 4CGJA 4JS4A 5HP1A 3TAQA 1KCFA 3CYMA 4KKOA 1BQMA 4FZZA 3O4NA 3ZSVA 4DTPA 3SQ2A 3VQEA 4BACA 2OYQA 4KTWA 1O1WA 4DSEA 3L2WA 4FK0A 3DM2A 4CHPA 4WE1A 5I3UA 1ZBFA 1VSMA 3DLEA 2FBYA 3HT3A 2G8UA 4CGDA 1IKVA 3SCXA 1NK5A 1Z26A 2KFNA 4E89A 1L3TA 3QESA 3L8BA 1IKXA 3V1OA 3H08A 1N6QA 2O4GA 1UA0A 2OA8A 2GUIA 3DLGA 3DRRA 4H8KA 4C8OA 4HUFA 4CFDA 4KFBA 4CERA 4KHQA 5J1EA 4FJ8A 1JLFA 3AA4A 5KGWA 4CEAA 2WONA 1WSJA 3KK1A 4BE1A 1D8YA 4NCBA 1RBVA 3AO3A 3DLKA 5SWMA 1ZBIA 1J9AA 3NHGA 3V9XA 4FJ7A 1CXUA 5EU7A 1VSEA 3SI6A 1Y97A 3SQ4A 4W5TA 3S3MA 2DFFA 4IDKA 3NH1A 1TL3A 3VQAA 4AHTA 4FM2A 3T3FA 3VA3A 3LP2A 1RT7A 4I7FA 4DG1A 4Y1CA 5CZ1A 3VQ4A 3LANA 4FXDA 1NKCA 3VQ5A 5K14A 3LWMA 1U48A 4DSJA 1BCMA 3ASMA 4O55A 1KRPA 2PYJA 1S9EA 3OYEA 2EX3A 4CECA 4M3TA 2YNHA 4TSXA 1EP4A 2HNYA 3AVHA 4IG3A 1SV5A 3V1RA 3L2QA 2PZSA 3NGYA 4M3RA 1LAWA 4M3ZA 4O0JA 4IFYA 3P1GA 4GMJB 4HUEA 1ZYQA 3ZT3A 3I0RA 4J2AA 3DOKA 1TL1A 1NKBA 4CF1A 3IRXA 4LSNA 3LAKA 3TANA 3L3UA 1L3VA 1S1UA 3VN5A 2G8VA 1KLMA 4RW4A 4CK3A 3DMJA 3VQ6A 4KHWA 4DTXA 4DU1A 3OYHA 4DSIA 3QETA 2VG7A 5HRNA 1DTTA 4OLBA 1S1TA 4F8RA 2EHGA 2QK9A 2YNFA 4E19A 4E3SA 2KZMA 4FK4A 3KLHA 3VQ7A 3AVAA 4DTSA 4QCLA 1WAJA 5HLFA 4CFAA 3SV4A 3MAQA 1NJWA 3TARA 2OPPA 3ULDA 1S1WA 3U3YA 1IKYA 4CJTA 4LH4A 4M41A 2O4IA 3FFIA 2PY5A 1Q9YA 2HHQA 1UA1A 2YV0X 2KQ2A 3OYLA 2HMIA 3V9SA 1QSLA 1HQEA 3M8PA 4C8LA 2VWKA 1RILA 3QIOA 5FROA 3CM5A 4CIEA 2BANA 2IAJA 3ZSZA 4CEQA 2Z1GA 3BDPA 4Z0UA 1D5AA 1JLEA 3C94A 3OS1A 4HCCA 4O4GA 3ZT0A 2E4LA 3OS2A 4ZTJA 3B6OA 4JRPA 1L3UA 4FCYA 2HNDA 3NCIA 4HCBA 3NF7A 1I3AA 3NF8A 1QQCA 3QO9A 4CF0A 3ZSOA 5D3GA 4O5BA 3EY1A 3OYIA 3PX6A 1BL3A 1HQUA 1RTHA 3C6TA 4FJLA 2DY4A 3RR7A 2ZQBA 4HUGA 4B3OA 1X9MA 3K58A 1RDAA 1SL2A 3KD1E 4EZ6A 4ID1A 1RT1A 3L2VA 3PX0A 4F3TA 4CJPA 3KD5E 3QEXA 4Q0BA 3KTQA 1XI1A 1G15A 1R0AA 4JLHA 1CXQA 4B8CA 1T7PA 4E1NA 5HRSA 4B8AB 3M8SA 4N47A 1WSIA 2XY8A 1NKEA 4KI6A 1YTAA 3HL8A 3SYZA 4Z4CA 4B9VA 2VG5A 3HYFA 3QEPA 1FKPA 1LWCA 1KVAA 1UWBA 2XHBA 4PY5A 4E7HA 2PYLA 2Q3SA 4RG8A 3JSMA 3EZ5A 4AHSA 2Y1IA 3G0ZA 3K5MA 1D9FA 4B9NA 4DFPA 4RW9A 2YHBA 1FK9A 3WNFA 4Z4EA 1WSHA 3F9KA 1X9WA 3DLBA 4FZXC 4JRQA 3QEVA 3HPGA 3LP0A 3K5NA 2G8HA 1NJZA 3RMCA 1JLBA 4G1QA 3U3GA 2OPRA 4IFVA 1X9SA 4FZYA 4PWDA 4N5SA 2LSNA 1TVRA 1ASVA 1KTQA 2YNGA 3WNEA 4CEBA 4FLZA 3O3FA 3F73A 3WNGA 1TKTA 2D0CA 3AO2A 5J2MA 1TK0A 3I0SA 1BI4A 3ZSRA 4CE9A 4DSLA 1Q9XA 4C8NA 3IG1A 3PY8A 4M3WA 4CEDA 2R7YA 4FJ9A 3HSTB 3KKRA 1J54A 4MQ3A 5FRNA 3AVGA 3HP6A 4W5QA 4CHYA 4DU4A 1F21A 4FJKA 3LDSA 4RW8A 5E41A 4ZTFA 2G8KA 4BDPA 1EKEA 2YHAA 4CESA 4FVMA 3MXMA 3AVMA 3NDKA 3SJJA 2HB5A 1S6PA 3OJUA 3DRPA 4OLAA 4GVMA 2XY7A 4CGHA 3NF9A 1S6QA 2P51A 4B9TA 2X6NA 2OPSA 4GW6A 4E7IA 3RR8A 1LWEA 1BIUA 1WLJA 1NJYA 4EP5A 3OYNA 1NOYA 3CFPA 1GOAA 2E6MA 3ALYA 3DLRA 4CFBA 1DLOA 1RT2A 2B5JA 3ISNC 5C42A 4ZHRA 4KRFA 3NGZA 5FDLA 4DFMA 1KVCA 2X74A 4EP4A 3TI0A 2XY6A 1SKRA 3C6UA 1CZ9A 4CK2A 4F2RA 4J2DA 2D0AA 4CEOA 1C1CA 1N5YA 5C25A 3G10A 3HVTA 4HTUA 1JLCA 4L8RB 4J2EA 4AHRA
chains in the Genus database with same CATH superfamily
4BR9A 3BUZB 4CEZA 2HHSA 4Y0WA 2HBLA 3OY9A 3CMEN 4N41A 3CCJN 5CR4A 5FRMA 2X6SA 4I2PA 4CFCA 2E2NA 4M7XA 4YOUA 4CZHA 3HP9A 1TK5A 2HHWA 1ESVA 5DMRA 4JI5K 4BC3A 2A3ZA 5C12A 3JAMO 1T3VA 2ATQA 4K43A 4OKEA 3U6FA 2GELA 2YCHA 4AILC 5FPEA 3OS0A 5BR8K 4NYNA 4FJHA 4BRQA 4DTUA 4DTJA 4LSLA 5E84A 2OZSA 1BOTO 1QZ6A 1RTJA 1MU2A 1ZXOA 2YHWA 3VQQA 1IV0A 4NCGA 1KSPA 2E2OA 2QWLA 2IDOA 4OKJA 4KTQA 3GL1A 4DV1K 3THXB 3LZIA 2HVIA 2W6LA 4B1YB 1C0FA 1K6YA 1NU0A 3ZX3A 4BRNA 2F7TA 4AHUA 1UOCA 3AVBA 5J2PA 3VEXA 2B4JA 2HF4A 4AH9A 1S1XA 2GWJA 2Z1IA 3D7EO 3TABA 1HMVA 5KGXA 5KRTA 1KC8O 4LY7A 3JS6A 2QTDA 2B6AA 4N56A 2ZJRL 1VQ6N 5AR0A 1GLFO 3HSCA 2RHKA 3NH2A 1UAXA 3TAMA 2JLEA 3UKUA 1EWQA 3SUOA 4ISEA 2FSNA 3RSEB 3FZLA 1LOTB 3P38A 1X9JA 4JS5A 4YY3K 2PFUA 3O9TA 4JEPA 1B92A 3KLEA 3O3GA 4DLEA 3KWGA 1W0HA 3PLAA 1JXBA 1TGOA 3HVRA 2IOCA 3TSUA 2A1SA 5F1XA 1NK7A 3V81A 2O8EB 2BUPA 4DB3A 5A2QO 4OKKA 4DR6K 4IZ9A 1ASUA 3AARA 1YJNN 1LV5A 2BE2A 4DSFA 4DV6K 3SAHA 4JKFA 1TUUA 4FJNA 1VSJA 1GOCA 5JLHA 4BG9A 4CHZA 3TTCA 4K8XA 4GVEA 3HJFA 4CK1A 1C6VA 4PUOA 4OJRA 4C1NK 4H5VA 4F2SA 5EY4A 1RDCA 2A6AA 3FZFA 4AM6A 3HI0A 2QM1A 3ZLJA 3PUFA 1V4TA 1BDGA 3P5JA 3DWLA 1Y64A 4JI1K 4FW1A 1FW6A 4OVLA 2KFZA 4IO8A 3L4QA 2KLAA 4R5PA 3VESA 4KTZA 4DTRA 3S3NA 3CC2N 2D0BA 3AA3A 2Y1JA 3MN6A 1HLUA 2IIRA 2RN2A 3FZMA 4CZJA 1E3MA 4MDBA 5DM7L 3VEOA 4FJJA 3PX4A 4B9LA 4DTMA 1FKOA 2Q0RA 2ZGZA 4JI7K 3U8XA 4I2QA 3VEYA 1XNQK 4FLVA 5I42A 1RT5A 3P39A 4FO0A 1U45A 4ID5A 3CC4N 4YDUA 4B9UA 4GKJK 3CI5A 4M3XA 4I6MB 4QOZB 1T6DA 3QNOA 3WQTA 4DR7K 4Z94A 4YOWA 4F4KA 3O9UA 1WBDA 1C1BA 2UUAK 5BPLA 4BE0A 1YTUA 1EXQA 1Z25A 4HHTA 2NNWA 4KO0A 4NCAA 2ZD1A 1BCOA 3WNHA 1RDUA 4JKHA 3NFAA 3DXMB 4FM0A 4LF4K 4EHUA 2F8TA 3VEWA 3O1WA 2GUPA 2HOEA 3CXCM 1JL2A 4IWVA 1CZBA 3K59A 4CJLA 3IUCA 1BGXT 4CIFA 3M6GA 4DR2K 4DQIA 3CJ7A 3AVLA 3KZBA 4JD2A 1C0MA 4KB0A 3O1BA 3ZETB 3CMAN 3EEQA 3J80O 4LD0A 3KVGA 4YOVA 1N8RO 4CF9A 5AQZA 1HYVA 1WUAA 4YOYA 3Q7BA 3ZX2A 2BDPA 4YFUA 1JKHA 4CHOA 1RNHA 3LALA 5FLXO 4CZEA 1S72N 2ZM6K 4CEEA 4J2BA 5GAGP 2HMPA 2NRHA 2QKBA 1VSIA 5C15A 2QA4N 4RW7A 4CGJA 3CJ1A 4A61A 3TAQA 1KCFA 3CYMA 4FZZA 1YJWN 2OYQA 2E2PA 1O1WA 5M1FA 1DKGD 4JKAA 2J4RA 1ZBFA 2FBYA 2KKZA 3CCUN 1Z26A 2KFNA 1H1VA 3QESA 2O4GA 3OA9A 3DLGA 3D6RA 4CERA 4WF9L 3AA4A 4CBUA 1WSJA 3KK1A 4NCBA 5M1PA 3GOIA 4FSVA 2UU9K 1CXUA 4WYBA 2UXCK 3S3MA 3SQ4A 4IDKA 3PO5A 3T3FA 2Q1NA 3VQ4A 5K14A 1BCMA 3ASMA 1KRPA 3PIOL 2YNHA 1XMQK 4M3RA 3DJCA 5BRHA 5AQPA 2ZF5O 1N34K 4GMJB 3OBWA 3Q7CA 4BG8A 3DOKA 4JI8K 1TL1A 1YXQA 1LCUA 4CF1A 3UKUB 5M1KA 3IRXA 3LAKA 1L3VA 3L3UA 2G8VA 1S1UA 4M7YA 1KLMA 3VF6A 3SK3A 3E1YA 4KHWA 3K0SA 4WQ5A 3QETA 4H5NA 2VG7A 5HRNA 4YOXA 3QFPA 1BA1A 4F8RA 4E19A 5AQYA 1YJ9N 2FSJA 3VQ7A 1WAJA 5HLFA 4CFAA 1XNRK 4DV4K 4B1UB 2O4IA 3FFIA 4DR5K 2HMIA 4WQ5C 1NGEA 4FWPA 5FROA 4CIEA 2BANA 3ZSZA 3BDPA 4C1NI 2W41A 4HCCA 4DUZK 4O4GA 5GINA 4ZTJA 3B6OA 4O5FA 4HCBA 4ISFA 2P9KB 4OPHA 4FPAA 4JNEA 4QS9A 2ZQBA 1QZ5A 1X9MA 3KD1E 1RDAA 4EZ6A 1RT1A 2WFBA 3PX0A 4CJPA 3QEXA 3KTQA 4JLHA 5AQHA 4CD3A 5HRSA 1NKEA 1YIJN 3QEPA 1KVAA 2XHBA 2Q2RA 4CD1A 3JSMA 1VQMN 1JCFA 3UB5A 4B9NA 4DFPA 2QW9A 2E20A 1QQNA 1X9WA 4RCHA 3HPGA 3LP0A 2G8HA 4IEEA 4LF6K 3RMCA 4FWKA 4G1QA 2HSTA 1X9SA 4FZYA 4PWDA 5LJWA 1VQ5N 4IEIA 4XEIA 4CEBA 2YNGA 1K8AO 3AO2A 3ZSRA 4C8NA 5DM6L 2NRXA 4FJ9A 1J54A 4DV7K 5FRNA 4BRAA 4H5WA 4H0TB 4ZTFA 1EKEA 1QHAA 4FVMA 3MXMA 3NDKA 3SJJA 3A5LC 4MO5A 2P51A 4B9TA 2X6NA 3LDOA 4GW6A 3W0LA 5CE3A 1WLJA 1NJYA 3OYNA 4FYDA 3CFPA 4NO7A 1DEJA 4DR1K 4BGAA 2B5JA 5C42A 4ZHRA 4DFMA 1VQPN 3C6UA 2E88A 4CK2A 4WFAL 1RFQA 3G10A 4HTUA 4L8RB 4J2EA 4GNIA 3RSEA 4CJWA 5AJ3K 1XWLA 1NOZA 3IAYA 3R6MA 1S1VA 1ITGA 4CBXA 2DFHA 1HPZA 1C0TA 1S3XA 2QWQA 4IOXA 3HPOA 2IVNA 1KVBA 4BR0A 1VQ4N 4EAHD 4K25A 2AA4A 1BQNA 1RT3A 2A40A 1J6ZA 3AO5A 3DRSA 4H4OA 4FJMA 1VK0A 4BE2A 4G9ZA 4H0VB 4FM1A 4CZIA 4CW7B 3CCEN 4ELUA 1D9DA 3DOLA 4JKCA 4LFAK 4BWMA 3SMPA 4CJRA 5LMUK 3THYA 1RTDA 3KIOA 5JS2A 3NGIA 3L6QA 2F8SA 4RWTA 3EYZA 3G6EN 3NF6A 3VGMA 3OYMA 3C95A 4H5RA 4CZMA 3E9LA 4PL8A 4M3YA 1EX4A 4JI3K 4DV5K 4KHNA 1ATSA 2VYPA 3AA2A 4MFBA 3AV9A 4FW2A 5JLFA 4KHPK 1NJIO 3KK2A 3HPHA 3E9PA 2HVHA 2Z1JA 1KLNA 1ZBHA 3NE6A 5HBMA 3HM9A 2DTUA 4FJGA 2W42A 4B9QA 3SPYA 1JXEA 1NK4A 1XMOK 3V9ZA 2X78A 1U6ZA 1NGDA 4B9MA 4DV2K 3JXUA 3R3LA 1WSGA 2ZWHA 3BZKA 3AVIA 3S41A 3O3HA 1MDUB 2AP1A 4JKBA 3A2FA 1GLDG 3IFRA 4OPJA 4CJKA 3M1FA 1QSYA 3PV8A 3DXMA 3ZSXA 1HPMA 1U2VA 3CCSN 4FLYA 1W7AA 1RBTA 1RGIA 2PBDA 3HOSA 3V9WA 1RBRA 4BC2A 2UXBK 4KV8A 1HR0K 5AQIA 3O08A 4CHNA 3P83D 4LF9K 3LPTA 4DQSA 3AVJA 4FJ5A 4FWOA 3SNNA 3HXMA 4B1WB 4BRGA 1GLEG 1T8EA 4KHSA 3CD6N 5CYQA 3EN9A 4H4MA 2P9UA 3ZETA 2UUBK 5BPNA 4BQLA 4W5OA 4FWRA 1Q18A 2XRIA 3OYAA 5FPNA 1DGKN 5DK5A 4WCEL 5B8HA 2AJQA 2VQEK 3SPZA 1B9FA 1QS4A 3O80A 4X64K 2XO7A 2QWOA 2ZGYA 4LH5A 1BUPA 4IBNA 4E7JA 1HJRA 5HROA 4KHUA 1XC3A 4CZLA 3QFUA 3L4IA 3LPUA 2A41A 1L3SA 2W40A 3SMSA 3KLGA 4FLXA 2BGGA 2G8IA 1BG3A 2HBJA 4BWJA 2GV9A 3CG7A 1TAQA 4PA1A 1U47A 1T05A 5LJVA 3QLHA 3ITHA 3K2PA 3TWHA 2VWBA 2VWJA 4ILJA 1XUPO 4W5NA 5FPMA 4CJSA 4JKGB 3OVNA 1E4FT 4MO4A 1RBUA 5HRRA 5BN9A 3C65A 1XC9A 4XIUA 2WC9A 4CGGA 3VETA 3H1QA 1HYZA 3SBGA 3ZSQA 2YJFA 4N76A 3T1YK 1LWFA 4O0IA 1NGFA 1FXXA 5J2QA 4YNQA 4LC9B 5SZTA 4FLWA 1O13A 4B3SK 4GV6A 3NBPA 4GKKK 2KTQA 2WOMA 3M8QA 4LF8K 2V51B 4IJAA 1BISA 3AO1A 5AQLA 2FC0A 3T1AA 4CJQA 3VERA 1RTIA 2YKNA 4ELVA 2RPIA 4CJ7A 3QERA 3MXIA 1KQSM 4B1XB 3OJSA 5JVGL 3V1QA 3THVA 5AQKA 1JLQA 4LFBK 3LAMA 1RT6A 1QTMA 2OZMA 3RMDA 4JKEA 4NYFA 3L2UA 1KFSA 3THWA 3CC7N 4FWMA 4H0XB 3BP8A 4FK2A 4V19S 4AM7A 3VQPA 2O8CA 1SS6A 3VEZA 1T03A 3G4SN 2NRWA 3CQ8A 2XY5A 3OYCA 3NVMA 3KHYA 5CZ2A 4JS4A 1WBBA 4KKOA 3ZSVA 1Q86O 2P9SB 4KTWA 4DSEA 3L2WA 4CHPA 2P9KA 4ILHA 1VSMA 5MLCQ 4CGDA 4OO1J 1NK5A 2QI2A 3L8BA 1N6QA 2OA8A 3THYB 2GUIA 4H03B 5AQSA 4CFDA 4KHQA 4FJ8A 5KGWA 4CEAA 2WONA 5SWMA 5TKWA 3V9XA 1HX1A 5H1SQ 5EU7A 4BRMA 3VMFB 3NH1A 4FM2A 3QBXA 3VQAA 1RT7A 2WUSA 4DSJA 2KHOA 1S9EA 3EE8A 2EX3A 5EX5A 3AVHA 3V1RA 1SV5A 3NGYA 3LM2A 2V7YA 2ZJPL 4O0JA 3J7AP 2YJEA 1ZYQA 1JJ2M 2E5LK 2OTJN 2ITMA 4DV3K 2EWSA 2W6KA 3FLCO 4DU1A 4DSIA 2F9TA 2QK9A 4OLBA 1S1TA 5EXWA 1Q7YO 4E3SA 2Q36A 3KLHA 1X3MA 1EWRA 1NGAA 2GWKA 4QCLA 3SV4A 3MAQA 1NJWA 4JHDA 3AY9A 4LH4A 2YX6A 2UXDK 1Q9YA 2HHQA 1MWKA 4YDUC 4BRIA 3QIOA 1RILA 3CM5A 2IAJA 1OVQA 3OS1A 3H3OB 1U2VB 3ZT0A 3OS2A 3AGRA 3F9MA 3NCIA 4B3MK 1I3AA 3ZSOA 3PX6A 3CPWM 1HQUA 1RTHA 3C6HA 3K58A 3CCLN 4FWNA 3L2VA 3VEVA 5KPRA 3MWTA 1CXQA 3ENHA 4YORA 4AF1A 1TYQA 2P9UB 1D4XA 2WBNA 4Z4CA 2VG5A 3HYFA 4C23A 1GLBG 4BC5A 4E7HA 2Q3SA 3EZ5A 2YHBA 1FK9A 1QVFM 3WNFA 4Z4EA 4JRQA 3QEVA 1NJZA 5AQOA 1Q81O 5C0YA 5JMVA 3HRGA 2HBKA 1TVRA 1KTQA 3H1VX 1OH7A 5LY3A 1VAZA 3O3FA 3WNGA 2D0CA 5J2MA 4KBOA 3IG1A 5M1QA 2O8BA 2D4WA 4XH1A 1NGJA 4HWIA 4DU4A 3P31A 4FJKA 4RW8A 4BDPA 1BA0A 4CESA 5KPTA 3OJUA 2XY7A 3NF9A 1S6QA 3F5TA 3RR8A 4EP5A 1NOYA 4KRFA 1DLOA 1RT2A 3ISNC 5FDLA 1DT9A 1Z05A 3TI0A 1SKRA 4B3TK 2P9IA 1N5YA 5C25A 4FWSA 5J2NA 1EO1A 4H0YB 3ENOA 3D2EA 3NAEA 3MEEA 4FLTA 1A5VA 2D1KA 1NBWA 1WSFA 4B9SA 3O9RA 3O8MA 4R79A 4K41A 1HNWK 5AQTA 4IFEA 1OH6A 2OPQA 3LWLA 3TAFA 1SL0A 4X65K 4EZ9A 3VTIA 4UQGA 2RKIA 3K5LA 2I7PA 1BIZA 3RWUA 3VQBA 4NXMK 1WAFA 4Q5VA 3THWB 1YHQN 3OYKA 1HUXA 3KJVA 4M45A 1RBSA 4GV9A 3CFRA 4Y1DA 2O8CB 4HTLA 3ZCMA 3H46O 4DCHA 3SUNA 2G8FA 2HNZA 3QMLA 4ICLA 4JI2K 4BDYA 2FXUA 4RTFD 3CQXA 1VQ9N 3CHWA 4C8KA 3AVNA 1S9GA 3OYFA 1BI4B 3VPZA 1VSKA 1ZBSA 3MECA 4DF8A 5KI6A 5HRPA 4CBWA 3AGKA 2ETJA 4F3OA 3ZX0A 4MDAA 3OW2M 1HKCA 3HM8A 3N4PA 3BGRA 4Z4GA 3TTDA 1HNIA 3MCAB 1YITN 2YHXA 3BEXA 5I9EB 5CYMA 5M1NA 3RMAA 4O44A 1VHXA 1IBLK 4JYAK 2GX9A 3WXIA 3ZT1A 3CFOA 4DS5A 1IBMK 3L0QA 4DFJA 4CF2A 1I39A 4DUYK 3O4QA 3A8YA 4CGFA 1J5OA 3KLIA 1HRHA 1OH8A 3NH0A 3M8RA 3VQCA 5LL6Z 4Z4IA 1K8KB 4ILGB 1C0GA 1VSFA 2ASPA 4HVJA 1OKJA 2A42A 1SUQA 2NRZA 4DTNA 4DQPA 5IT9O 4BROA 5TKYA 3H6EA 3EL2A 3V6DA 1YF5L 4U67L 3OBYA 4JKGA 3H3NO 4DV0K 2IC3A 3OYDA 2QWMA 3TAGA 1KAXA 3U9DA 3MX5A 1JL1A 3KKSA 3MX2A 2FBVA 3PO4A 2UYTA 3OYBA 3PIPL 1X1PA 4AQYK 2QXFA 4KI4A 4JHDB 3B8AX 4CI6A 3VF4A 4CCHA 4X66K 4FVUA 3CM6A 4KREA 4DF4A 2VCPA 3B6PA 3ID6A 3ENBA 1YT3A 1NLVA 1LW2A 1K73O 3LM9A 3VGKA 1WSEA 4IO9L 3CF5L 5EOYA 4K42A 4KH4A 4KHYA 3LDLA 2QKKA 5KTQA 4CEFA 3ZEUB 1BWFO 2KZZA 3AAQA 4BREA 4CJ3A 4A57A 3DYAA 3ATUA 4DKWA 3BZCA 3SUQA 1TYQB 4FXDA 1BHLA 4JI6K 5T7BA 1KAYA 3A5MC 3VQDA 2F96A 3MXJA 5C10A 1M1KO 3A5OC 4FLUA 3VF2A 3J7ZO 4K0KK 4CGIA 1JCGA 2P5GA 4CJ5A 2P9SA 3NMUA 5BN8A 2P9NA 3VA0A 4XH4A 3HK2A 1VSDA 5GIOA 3ULEB 2NLXA 5AQVA 2RF2A 2E1ZA 4DSKA 3I8BA 1U49A 2O8BB 1IBKK 2VG6A 3CJ9A 4DR3K 1XHXA 2ITGA 1J53A 3AA5X 1J5EK 1ATNA 4PKGA 4F9OA 1IKWA 1HNZK 3E9OA 5C2FA 4DTOA 3O6WA 1GLCG 1IH7A 4DFKA 3MEDA 4RW6A 4E0DA 3TAEA 4K8ZA 4C8MA 1HNVA 4NLCA 3QICA 3BF3A 3J8AA 4PQUA 3DLHA 4DS4A 3QB0A 3FE1A 1YVNA 3WEEA 1RDDA 2P1JA 1TV6A 1KFDA 3OHRA 1A5XA 5IWAK 2F4VK 2P9IB 2NUBA 3ZSWA 4A2BA 3I56N 4DWIA 1Q82O 2CGJA 4U7BA 4OGCA 2Q97A 3GDQA 5ELZA 3D2EB 2E6LA 2YNIA 5M1OA 3UIQA 3WXKA 1DTQA 4CJVA 4DU3A 3R9PA 3GBTA 3HO1A 4H0PA 1VQON 1RDWX 4CJUA 4PL7A 4QS7A 4BGBA 4GY2B 2P5OA 4WQ4A 1WNSA 3RMBA 3O9QA 4CJEA 3MMVA 1QE1A 1ASWA 3EO3A 3AVCA 1WN7A 5HP1A 3C0BA 2D0PA 5AZIB 4DTPA 3SQ2A 2CH5A 3CCRN 3DM2A 4WE1A 5I3UA 3CIPA 4KH6A 3DLEA 4WQ4C 3P4IA 4BRHA 4H0OA 3SJHA 3V1OA 5BPMA 1UA0A 4C8OA 2RE2A 4H8KA 3DRRA 4HUFA 1JLFA 4BE1A 1QQOA 1D8YA 3AO3A 1ZBIA 1J9AA 1VQ8N 4CZGA 4FJ7A 2QWNA 3SI6A 1VSEA 4PY5A 2DFFA 1TL3A 4AHTA 3CERA 4I7FA 4Y1CA 2JWKA 3ATVA 3LANA 5F2RA 1NKCA 3VQ5A 3LWMA 2NRVA 1U48A 3TTFA 4B1ZA 3U4LA 4CECA 4M3TA 2P9PB 4TSXA 4DQ8A 2PZSA 1BO5O 3L2QA 1X3NA 1LAWA 5ADXA 4IFYA 3P1GA 2FSKA 3CCQN 1SQKA 4BRCA 4FWLA 3I0RA 4J2AA 4O8UA 2NRRA 4LSNA 2QEXN 3C6AA 3TANA 4CVNE 4RW4A 4GV3A 3DMJA 4DTXA 3LDQA 3D2FA 3OYHA 5AQGA 1DTTA 3U9ZA 2YNFA 4IXCA 4FK4A 4B3RK 4YHHK 3AVAA 3DLLL 2JWLA 4EHTA 3TARA 4M41A 2PY5A 1UA1A 3OYLA 3V9SA 5AQQA 1HQEA 5AQWA 1QSLA 3MK6A 3CCVN 4NXNK 4CEQA 2I7NA 4Z0UA 1D5AA 3C94A 3EZWA 1ATRA 4EFHA 1L3UA 4FCYA 3CCMN 1NMDA 2HHHK 4BRDA 3H45C 4O5BA 3OYIA 1BL3A 1WB9A 4IDHA 4FJLA 4OX9K 5FPDA 3EKSA 4Q0BA 4PKHA 1G15A 1R0AA 1HKBA 4B8CA 1T7PA 4E1NA 3M8SA 4B8AB 4N47A 2BH1A 5ADXH 1WSIA 2XY8A 1YTAA 1ZC6A 2ASMA 3HL8A 5KQ8A 3SYZA 4BR4A 1NWKA 1FKPA 1LWCA 1P90A 1UWBA 4AHSA 5AQXA 2Y1IA 2P9LA 2HBMA 2GEMA 4RW9A 1WSHA 3DLBA 3K5NA 5CHIA 1JLBA 1YI2N 3U3GA 1QQMA 2OPRA 2E1YA 1BU6O 3NVKA 4N5SA 2LSNA 1ASVA 3SBTA 3ID8A 4FLZA 3F73A 2FLOA 1TK0A 1BI4A 3R1XA 5E26A 4CE9A 4DSLA 2P9NB 2YHYA 4M3WA 4CEDA 2R7YA 1Z6RA 3HSTB 3KKRA 5HOOA 3MN9A 3AVGA 2IVPA 4W5QA 3HP6A 4CHYA 1F21A 3MDQA 3M3ZA 2YHAA 5C2DA 4OLAA 2PAVA 2HB5A 1S6PA 1CZAN 4BVOA 1HNXK 4IOAL 1K9MO 2OPSA 3FFKB 4E7IA 4DR4K 1LWEA 1BIUA 1GOAA 4CFBA 3ALYA 4E1JA 1NGBA 3NGZA 3TU5A 1KVCA 2V7ZA 2X74A 4EP4A 2XY6A 1CZ9A 2QWRA 2GTDA 2VGNA 2D0AA 4CEOA 1C1CA 3FZHA 1K8KA 3ZYYX 2VQFK 4AHRA 1HYSA 4FJIA 3LP1A 3WEEB 3A5NC 1FJGK 3MWPA 3ZT2A 3TAPA 4DMNA 1NK9A 4KPYA 1W9HA 2F9WA 4Z4HA 4A2AA 1A5WA 4CZFA 4BY9C 1NGGA 4BR5A 4JK8A 2IVOA 4BC4A 4KB1A 3MCPA 3K57A 2GBZA 1NK8A 3L2RA 5JS1A 1QHTA 1SL1A 2QXLA 4I9QA 3HZ6A 5AZJB 1YUWA 4FOEA 3VGLA 3UKRA 3G25A 3K9KA 3QEWA 1W97L 2IS3A 5GAHP 2O8FA 2O8DA 3VQ8A 5CY4A 1NGIA 1SKWA 3IDHA 1U4BA 1VRUA 3KK3A 5C24A 2HHVA 2JGUA 1VSHA 4H5TA 3ZT4A 3F2KA 1C0UA 1GOBA 3ZEUA 3LL3A 4E7LA 4MLHA 1TKXA 1NMNA 3LDNA 3MN5A 4ELTA 2OCEA 4O8KA 2ZJQL 3ZSYA 2FBTA 3RVCA 1NGCA 1U04A 3HBTA 4CF8A 4FOIA 2HW3A 1TKZA 4A5BA 1JLAA 1IJJA 4JKDA 3WXMB 2A5XA 3OYGA 1EQYA 4E7KA 1V4SA 2CGKA 1TAUA 3RRGA 1LAVA 3SLCA 3A0IX 1LW0A 3TPQA 3D45A 4DQRA 3AAPA 4JI0K 1NGHA 4I9LA 4OGEA 1XHZA 3K9JA 1L5UA 4Z4FA 4E1MA 2HHUA 4AHCA 3ULEA 3FGUA 4IG0A 1MWMA 2ZE2A 4XH5A 4M3UA 5AQUA 3O5BA 3AVKA 1ZBUA 3VTHA 3D2FB 1CLQA 3CJBA 3MEGA 1NK6A 3KWIA 2G8WA 3CPEA 3SUPA 1RDBA 1IG9A 1IO2A 4QAGA 1REVA 1JLGA 3D0PA 3IMXA 4W5RA 1P8ZA 2OTLN 3I8DA 4QS8A 4IKFA 5AFUA 1ILYA 3CJAA 1NNEA 5AQRA 1YVUA 3QINA 3TSQA 1E4GT 3E01A 3T19A 5F0XA 3RRHA 3V4IA 3WXJA 2FBXA 4CHQA 2HHXA 3VOVA 1WOQA 3S3OA 1NJXA 2DPNA 4JN4A 1TK8A 3DXKA 2YI1A 1C1AA 3M5RA 4BR7A 3SZ2A 3GG4A 4J2DA 3I33A 4CIGA 2HHTA 4YOTA 4CJ4A 4ISGA 2D0OA 1TKDA 3LZJA 1N36K 1QSSA 3BY5A 4BR2A 4UY8O 4FJXA 3T7ZA 4FPBA 3KLFA 5BRDA 2D5RA 1Q8IA 2P9LB 3C7NA 3IS9A 5AZIA 2NZTA 3JYTA 3AO4A 3IKMA 3T1HK 3SQ1A 3T69A 2YKMA 1ZBLA 4AHVA 2DFEA 1EETA 2Z1HA 3KK7A 3SAFA 4NLBA 1VRTA 1KXPA 1VSLA 2IGIA 3TR8A 1QVGM 4OPAA 5AFUH 1RCHA 1S5JA 4CJFA 3RTVA 3SV3A 1YAGA 4LF5K 1GLAG 4BRFA 5KQDA 4CZKA 2V52B 1SKSA 3VQ9A 3QNNA 1KD1O 4LFCK 3CJCA 3V9UA 4IJNA 2CGLA 2P9PA 1B9DA 1N32K 3QIPA 5AQMA 1I94K 4JAXA 3EE9A 4B08A 3WUHA 4A59A 3S9HA 3LP3A 2Q31A 1RT4A 2I5JA 4BRLA 4FL9A 1M90O 3DAWA 3N4QA 3K5OA 3LDPA 4B1VA 4JV5K 4JK7A 2E2QA 4J8FA 2WTUA 4DLGA 3L3VA 1OH5A 4M42A 4PKIA 3AVFA 3SQ0A 1NK0A 3BF1A 3HOTA 3OYJA 3CETA 3DI6A 3WXLA 2A1RA 3WT0A 1VQ7N 1TUYA 1G99A 2KW4A 1VQLN 3UE5A 3QEIA 2OANA 4BDZA 4WFNL 4OPKA 4DQQA 4KAZA 5KRSA 1BQMA 3O4NA 4A5AA 2FF6A 3VQEA 3W3DA 4DHYA 4BACA 5JVHL 3UKRB 3THXA 4FK0A 3O9SA 4JI4K 2VGMA 2O8FB 2O8DB 2G8UA 3HT3A 3SCXA 1IKVA 2FF3B 4BRKA 4E89A 5BRFA 1L3TA 1IKXA 3H08A 4KFBA 5J1EA 3TSPA 2E8AA 5HL7L 1RBVA 3DLKA 3NHGA 3FR0A 1Y97A 4W5TA 3VA3A 3LP2A 4DG1A 5CZ1A 1VQKN 3PSFA 1NG9A 4O55A 2PYJA 3OYEA 5EVZA 1MA9B 3J81O 4LF7K 1EP4A 2HNYA 4IG3A 4M3ZA 4MLEA 4PHTX 4HUEA 5BR9A 3ZT3A 3CQYA 4M63C 1NKBA 1R59O 1XQSC 4JD2B 3VN5A 4CK3A 3VQ6A 2Q0UA 3EKUA 5AQFA 3HTVA 1HKGA 2O8EA 3QDKA 2EHGA 2KZMA 4BQZA 1GLLO 1S22A 4DTSA 1W2BM 5KPZA 2BTFA 2OPPA 3ULDA 1S1WA 4JK9A 3U3YA 1JCEA 1IKYA 2H3GX 4CJTA 1OVYA 5GADP 2YV0X 5GAEP 2QWPA 1N33K 2KQ2A 3PSIA 3M8PA 4C8LA 2VWKA 1T6CA 3MN7A 2Z1GA 4L3QA 4BVPA 1JLEA 3VENA 4NB4A 2E4LA 4JRPA 2HNDA 3GE1A 3NF7A 3NF8A 1QQCA 3QO9A 4CF0A 5D3GA 3EY1A 3R8EA 4IOCL 4EIAA 3C6TA 2DY4A 3RR7A 4HUGA 4B3OA 1SL2A 4ID1A 4F3TA 3KD5E 2UUCK 1XI1A 5LMNK 4X62K 3E66A 1KAZA 4KH5A 4KI6A 3O4WA 2CH6A 5JICA 4B9VA 3DXKB 3I55N 5BREA 2PYLA 4RG8A 3G0ZA 3WQUA 3K5MA 1D9FA 1NM1A 4BRPA 3J7YP 5AZJA 3F9KA 4FZXC 1T44A 1SAZA 4A62A 4IFVA 3C7NB 3WNEA 4I6MA 5AQJA 1TKTA 5AQNA 3I0SA 3QBWA 1Q9XA 3PY8A 4MQ3A 3LDSA 5E41A 2G8KA 1HJOA 3AVMA 3DRPA 3SAGA 4GVMA 4CGHA 4WFBL 2NRTA 2ASOA 1SZ2A 1GLJO 2E6MA 2HF3A 3DLRA 3G71N 3FZKA 1IG8A 1VQNN 4F2RA 3OTOK 3HVTA 1JLCA 4FWQA 5GIPA
chains in the Genus database with same CATH topology
4CEZA 2HHSA 3NAEA 1HYSA 3MEEA 4FJIA 3LP1A 3OY9A 4CJWA 1A5VA 4FLTA 1WSFA 4B9SA 4N41A 3ZT2A 3TAPA 5FRMA 1XWLA 4DMNA 2X6SA 1NK9A 4I2PA 1NOZA 4CFCA 2OPQA 3IAYA 3LWLA 3TAFA 1SL0A 4KPYA 3HP9A 1S1VA 1TK5A 1ITGA 1W9HA 2DFHA 2HHWA 5DMRA 4Z4HA 4EZ9A 1HPZA 1C0TA 3HPOA 1A5WA 4UQGA 2RKIA 1KVBA 2ATQA 3K5LA 4OKEA 1BIZA 3RWUA 3U6FA 3VQBA 4KB1A 3K57A 3PO5A 2GBZA 1NK8A 1WAFA 4Q5VA 3L2RA 4AILC 1QHTA 5JS1A 3OYKA 3OS0A 1BQNA 1SL1A 3KJVA 4M45A 1RBSA 1RT3A 4NYNA 4FJHA 4I9QA 3CFRA 4Y1DA 4DTUA 4DTJA 3AO5A 4LSLA 3DRSA 3ZCMA 2OZSA 4H4OA 3QEWA 3SUNA 2G8FA 4FJMA 1VK0A 2HNZA 2IS3A 4BE2A 4ICLA 4FM1A 4BDYA 4ELUA 1RTJA 1MU2A 3DOLA 3VQ8A 1D9DA 3VQQA 4C8KA 4NCGA 5CY4A 1KSPA 4BWMA 3AVNA 1S9GA 4CJRA 3OYFA 1RTDA 1SKWA 1QSYA 1U4BA 1BI4B 1VRUA 2IDOA 3KIOA 4OKJA 5JS2A 5C24A 1VSKA 3MECA 3KK3A 3NGIA 5KI6A 5HRPA 2JGUA 3EYZA 3LZIA 4DF8A 2F8SA 2HVIA 2ETJA 1VSHA 4F3OA 1K6YA 3NF6A 4FYDA 3ZT4A 3OYMA 4AHUA 3BGRA 4Z4GA 1C0UA 1GOBA 3C95A 1UOCA 3AVBA 1HNIA 5J2PA 4E7LA 4M3YA 1TKXA 1EX4A 5CYMA 3RMAA 2B4JA 4KHNA 4ELTA 3AA2A 4AH9A 1S1XA 4MFBA 2Z1IA 3TABA 3AV9A 4O44A 1HMVA 5KGXA 4FW2A 5KRTA 3ZT1A 3CFOA 4DS5A 3ZSYA 4DFJA 2FBTA 4LY7A 4CF2A 1I39A 1U04A 2B6AA 3O4QA 4CF8A 5J2NA 4CGFA 4N56A 1J5OA 2HW3A 3KLIA 1HRHA 1TKZA 3KK2A 3NH0A 3HPHA 3M8RA 1JLAA 2HVHA 3VQCA 3OYGA 4E7KA 2Z1JA 3NH2A 1TAUA 3RRGA 1LAVA 1KLNA 1UAXA 1ZBHA 4Z4IA 3NE6A 5HBMA 2JLEA 3TAMA 3HM9A 1LW0A 1VSFA 2DTUA 4HVJA 3D45A 4DQRA 3SUOA 4FJGA 1SUQA 2W42A 4DTNA 4I9LA 4DQPA 4KTQA 4JS5A 3SPYA 4OGEA 1XHZA 1L5UA 4Z4FA 4E1MA 1B92A 1JXEA 1NK4A 2HHUA 3KLEA 3O3GA 4AHCA 4DLEA 3V9ZA 2X78A 4IG0A 1W0HA 2ZE2A 3V6DA 4M3UA 4B9MA 3AVKA 1WSGA 1ZBUA 2IC3A 1JXBA 1TGOA 3HVRA 2IOCA 1CLQA 3AVIA 3OYDA 3MEGA 2A1SA 3O3HA 1NK7A 3V81A 3TAGA 2HHTA 1NK6A 4OKKA 2G8WA 1ASUA 1JL1A 3A2FA 3KKSA 2FBVA 3PO4A 3SUPA 1RDBA 3OYBA 1LV5A 4OPJA 1IG9A 4CJKA 1IO2A 1X1PA 2BE2A 2QXFA 4QAGA 1REVA 1JLGA 4DSFA 3ZSXA 3PV8A 4KI4A 3D0PA 4FLYA 4CCHA 1RBTA 4FJNA 1VSJA 4W5RA 3CM6A 1GOCA 3V9WA 1RBRA 4KREA 4KV8A 3I8DA 4DF4A 3B6PA 4IKFA 4CHNA 4CHZA 3P83D 4K8XA 3HJFA 1YT3A 1C6VA 4CK1A 4PUOA 4OJRA 1LW2A 3LPTA 4F2SA 4DQSA 3AVJA 1YVUA 4FJ5A 3SNNA 3QINA 1RDCA 3HXMA 3E01A 3T19A 3V4IA 1WSEA 3RRHA 1T8EA 4KHSA 5CYQA 2FBXA 4CHQA 2HHXA 3S3OA 4H4MA 3PUFA 1NJXA 4KHYA 4W5OA 1TK8A 2QKKA 5KTQA 2XRIA 4CEFA 3P5JA 3OYAA 1C1AA 4FW1A 2KZZA 4OVLA 4CJ3A 2KFZA 5DK5A 3DYAA 3SZ2A 2AJQA 4R5PA 3SUQA 4KTZA 4DTRA 4CIGA 1B9FA 4CJ4A 3SPZA 2D0BA 3AA3A 1QS4A 1BHLA 3LZJA 2Y1JA 1TKDA 2RN2A 1QSSA 2XO7A 5T7BA 4FJJA 4LH5A 3PX4A 4IBNA 3VQDA 4E7JA 1HJRA 4DTMA 1FKOA 4B9LA 5HROA 2F96A 3MXJA 4FJXA 4KHUA 3KLFA 4I2QA 4FLUA 2D5RA 1Q8IA 4FLVA 5I42A 3IS9A 1RT5A 3JYTA 4CGIA 1U45A 4ID5A 2P5GA 4CJ5A 3AO4A 3SQ1A 3LPUA 2YKMA 1ZBLA 3VA0A 3HK2A 1L3SA 4AHVA 2DFEA 3KLGA 4FLXA 1EETA 2Z1HA 2BGGA 2G8IA 4B9UA 1VRTA 1VSLA 1VSDA 4BWJA 2GV9A 3CG7A 1TAQA 2IGIA 4PA1A 1U47A 1T05A 3TR8A 4M3XA 4QOZB 3QLHA 3QNOA 3ITHA 3K2PA 2RF2A 3TWHA 2VWJA 4F4KA 4W5NA 1RCHA 1S5JA 1C1BA 4CJSA 4CJFA 1U49A 4DSKA 2VG6A 3RTVA 3SV3A 2HHVA 3OVNA 4BE0A 5HRRA 1RBUA 1XHXA 1XC9A 1YTUA 2ITGA 4XIUA 1EXQA 1J53A 4CGGA 1Z25A 3AA5X 4HHTA 1SKSA 3VQ9A 1HYZA 1IKWA 4KO0A 3QNNA 4NCAA 3ZSQA 2ZD1A 4DTOA 4N76A 1BCOA 3WNHA 3V9UA 1IH7A 1LWFA 4DFKA 3MEDA 3NFAA 4RW6A 4O0IA 1FXXA 4FM0A 5J2QA 4YNQA 3TAEA 4E0DA 5SZTA 4FLWA 4K8ZA 4C8MA 2F8TA 1HNVA 3NBPA 2KTQA 1B9DA 4PQUA 1JL2A 3DLHA 2WOMA 3M8QA 1CZBA 3QIPA 3K59A 4DS4A 1BISA 1RDDA 2P1JA 1TV6A 3AO1A 4CJLA 1KFDA 1A5XA 1BGXT 2FC0A 4B08A 3T1AA 4CJQA 3S9HA 2NUBA 3ZSWA 4DWIA 4CIFA 3LP3A 4DQIA 1RTIA 2YKNA 3AVLA 2RPIA 4OGCA 3QERA 4ELVA 1RT4A 2I5JA 3MXIA 1C0MA 4KB0A 2E6LA 3S3NA 2YNIA 3K5OA 3OJSA 3V1QA 3THVA 3UIQA 1JLQA 3LAMA 1RT6A 4LD0A 1DTQA 4CJVA 4DU3A 3RMDA 1QTMA 2OZMA 3HO1A 4CF9A 4DLGA 4NYFA 3L2UA 1KFSA 3L3VA 1HYVA 4M42A 4CJUA 2BDPA 3AVFA 3SQ0A 1NK0A 4YFUA 4FK2A 1JKHA 3VQPA 4CHOA 1RNHA 3LALA 3OYJA 1T03A 3DI6A 2A1RA 2P5OA 4CEEA 2KW4A 1WNSA 4J2BA 3RMBA 3CQ8A 4CJEA 3QEIA 2QKBA 1VSIA 1QE1A 1ASWA 4BDZA 2XY5A 4OPKA 4DQQA 4KAZA 3AVCA 4RW7A 5KRSA 3OYCA 5CZ2A 1WN7A 4CGJA 4JS4A 5HP1A 3TAQA 1KCFA 3CYMA 4KKOA 1BQMA 4FZZA 3O4NA 3ZSVA 4DTPA 3SQ2A 3VQEA 4BACA 2OYQA 4KTWA 1O1WA 4DSEA 3L2WA 4FK0A 3DM2A 4CHPA 4WE1A 5I3UA 1ZBFA 1VSMA 3DLEA 2FBYA 3HT3A 2G8UA 4CGDA 1IKVA 3SCXA 1NK5A 1Z26A 2KFNA 4E89A 1L3TA 3QESA 3L8BA 1IKXA 3V1OA 3H08A 1N6QA 2O4GA 1UA0A 2OA8A 2GUIA 3DLGA 3DRRA 4H8KA 4C8OA 4HUFA 4CFDA 4KFBA 4CERA 4KHQA 5J1EA 4FJ8A 1JLFA 3AA4A 5KGWA 4CEAA 2WONA 1WSJA 3KK1A 4BE1A 1D8YA 4NCBA 1RBVA 3AO3A 3DLKA 5SWMA 1ZBIA 1J9AA 3NHGA 3V9XA 4FJ7A 1CXUA 5EU7A 1VSEA 3SI6A 1Y97A 3SQ4A 4W5TA 3S3MA 2DFFA 4IDKA 3NH1A 1TL3A 3VQAA 4AHTA 4FM2A 3T3FA 3VA3A 3LP2A 1RT7A 4I7FA 4DG1A 4Y1CA 5CZ1A 3VQ4A 3LANA 4FXDA 1NKCA 3VQ5A 5K14A 3LWMA 1U48A 4DSJA 1BCMA 3ASMA 4O55A 1KRPA 2PYJA 1S9EA 3OYEA 2EX3A 4CECA 4M3TA 2YNHA 4TSXA 1EP4A 2HNYA 3AVHA 4IG3A 1SV5A 3V1RA 3L2QA 2PZSA 3NGYA 4M3RA 1LAWA 4M3ZA 4O0JA 4IFYA 3P1GA 4GMJB 4HUEA 1ZYQA 3ZT3A 3I0RA 4J2AA 3DOKA 1TL1A 1NKBA 4CF1A 3IRXA 4LSNA 3LAKA 3TANA 3L3UA 1L3VA 1S1UA 3VN5A 2G8VA 1KLMA 4RW4A 4CK3A 3DMJA 3VQ6A 4KHWA 4DTXA 4DU1A 3OYHA 4DSIA 3QETA 2VG7A 5HRNA 1DTTA 4OLBA 1S1TA 4F8RA 2EHGA 2QK9A 2YNFA 4E19A 4E3SA 2KZMA 4FK4A 3KLHA 3VQ7A 3AVAA 4DTSA 4QCLA 1WAJA 5HLFA 4CFAA 3SV4A 3MAQA 1NJWA 3TARA 2OPPA 3ULDA 1S1WA 3U3YA 1IKYA 4CJTA 4LH4A 4M41A 2O4IA 3FFIA 2PY5A 1Q9YA 2HHQA 1UA1A 2YV0X 2KQ2A 3OYLA 2HMIA 3V9SA 1QSLA 1HQEA 3M8PA 4C8LA 2VWKA 1RILA 3QIOA 5FROA 3CM5A 4CIEA 2BANA 2IAJA 3ZSZA 4CEQA 2Z1GA 3BDPA 4Z0UA 1D5AA 1JLEA 3C94A 3OS1A 4HCCA 4O4GA 3ZT0A 2E4LA 3OS2A 4ZTJA 3B6OA 4JRPA 1L3UA 4FCYA 2HNDA 3NCIA 4HCBA 3NF7A 1I3AA 3NF8A 1QQCA 3QO9A 4CF0A 3ZSOA 5D3GA 4O5BA 3EY1A 3OYIA 3PX6A 1BL3A 1HQUA 1RTHA 3C6TA 4FJLA 2DY4A 3RR7A 2ZQBA 4HUGA 4B3OA 1X9MA 3K58A 1RDAA 1SL2A 3KD1E 4EZ6A 4ID1A 1RT1A 3L2VA 3PX0A 4F3TA 4CJPA 3KD5E 3QEXA 4Q0BA 3KTQA 1XI1A 1G15A 1R0AA 4JLHA 1CXQA 4B8CA 1T7PA 4E1NA 5HRSA 4B8AB 3M8SA 4N47A 1WSIA 2XY8A 1NKEA 4KI6A 1YTAA 3HL8A 3SYZA 4Z4CA 4B9VA 2VG5A 3HYFA 3QEPA 1FKPA 1LWCA 1KVAA 1UWBA 2XHBA 4PY5A 4E7HA 2PYLA 2Q3SA 4RG8A 3JSMA 3EZ5A 4AHSA 2Y1IA 3G0ZA 3K5MA 1D9FA 4B9NA 4DFPA 4RW9A 2YHBA 1FK9A 3WNFA 4Z4EA 1WSHA 3F9KA 1X9WA 3DLBA 4FZXC 4JRQA 3QEVA 3HPGA 3LP0A 3K5NA 2G8HA 1NJZA 3RMCA 1JLBA 4G1QA 3U3GA 2OPRA 4IFVA 1X9SA 4FZYA 4PWDA 4N5SA 2LSNA 1TVRA 1ASVA 1KTQA 2YNGA 3WNEA 4CEBA 4FLZA 3O3FA 3F73A 3WNGA 1TKTA 2D0CA 3AO2A 5J2MA 1TK0A 3I0SA 1BI4A 3ZSRA 4CE9A 4DSLA 1Q9XA 4C8NA 3IG1A 3PY8A 4M3WA 4CEDA 2R7YA 4FJ9A 3HSTB 3KKRA 1J54A 4MQ3A 5FRNA 3AVGA 3HP6A 4W5QA 4CHYA 4DU4A 1F21A 4FJKA 3LDSA 4RW8A 5E41A 4ZTFA 2G8KA 4BDPA 1EKEA 2YHAA 4CESA 4FVMA 3MXMA 3AVMA 3NDKA 3SJJA 2HB5A 1S6PA 3OJUA 3DRPA 4OLAA 4GVMA 2XY7A 4CGHA 3NF9A 1S6QA 2P51A 4B9TA 2X6NA 2OPSA 4GW6A 4E7IA 3RR8A 1LWEA 1BIUA 1WLJA 1NJYA 4EP5A 3OYNA 1NOYA 3CFPA 1GOAA 2E6MA 3ALYA 3DLRA 4CFBA 1DLOA 1RT2A 2B5JA 3ISNC 5C42A 4ZHRA 4KRFA 3NGZA 5FDLA 4DFMA 1KVCA 2X74A 4EP4A 3TI0A 2XY6A 1SKRA 3C6UA 1CZ9A 4CK2A 4F2RA 4J2DA 2D0AA 4CEOA 1C1CA 1N5YA 5C25A 3G10A 3HVTA 4HTUA 1JLCA 4L8RB 4J2EA 4AHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CEZ A;  2HHS A;  3NAE A;  1HYS A;  3MEE A;  4FJI A;  3LP1 A;  3OY9 A;  4CJW A;  1A5V A;  4FLT A;  1WSF A;  4B9S A;  4N41 A;  3ZT2 A;  3TAP A;  5FRM A;  1XWL A;  4DMN A;  2X6S A;  1NK9 A;  4I2P A;  1NOZ A;  4CFC A;  2OPQ A;  3IAY A;  3LWL A;  3TAF A;  1SL0 A;  4KPY A;  3HP9 A;  1S1V A;  1TK5 A;  1ITG A;  1W9H A;  2DFH A;  2HHW A;  5DMR A;  4Z4H A;  4EZ9 A;  1HPZ A;  1C0T A;  3HPO A;  1A5W A;  4UQG A;  2RKI A;  1KVB A;  2ATQ A;  3K5L A;  4OKE A;  1BIZ A;  3RWU A;  3U6F A;  3VQB A;  4KB1 A;  3K57 A;  3PO5 A;  2GBZ A;  1NK8 A;  1WAF A;  4Q5V A;  3L2R A;  4AIL C;  1QHT A;  5JS1 A;  3OYK A;  3OS0 A;  1BQN A;  1SL1 A;  3KJV A;  4M45 A;  1RBS A;  1RT3 A;  4NYN A;  4FJH A;  4I9Q A;  3CFR A;  4Y1D A;  4DTU A;  4DTJ A;  3AO5 A;  4LSL A;  3DRS A;  3ZCM A;  2OZS A;  4H4O A;  3QEW A;  3SUN A;  2G8F A;  4FJM A;  1VK0 A;  2HNZ A;  2IS3 A;  4BE2 A;  4ICL A;  4FM1 A;  4BDY A;  4ELU A;  1RTJ A;  1MU2 A;  3DOL A;  3VQ8 A;  1D9D A;  3VQQ A;  4C8K A;  4NCG A;  5CY4 A;  1KSP A;  4BWM A;  3AVN A;  1S9G A;  4CJR A;  3OYF A;  1RTD A;  1SKW A;  1QSY A;  1U4B A;  1BI4 B;  1VRU A;  2IDO A;  3KIO A;  4OKJ A;  5JS2 A;  5C24 A;  1VSK A;  3MEC A;  3KK3 A;  3NGI A;  5KI6 A;  5HRP A;  2JGU A;  3EYZ A;  3LZI A;  4DF8 A;  2F8S A;  2HVI A;  2ETJ A;  1VSH A;  4F3O A;  1K6Y A;  3NF6 A;  4FYD A;  3ZT4 A;  3OYM A;  4AHU A;  3BGR A;  4Z4G A;  1C0U A;  1GOB A;  3C95 A;  1UOC A;  3AVB A;  1HNI A;  5J2P A;  4E7L A;  4M3Y A;  1TKX A;  1EX4 A;  5CYM A;  3RMA A;  2B4J A;  4KHN A;  4ELT A;  3AA2 A;  4AH9 A;  1S1X A;  4MFB A;  2Z1I A;  3TAB A;  3AV9 A;  4O44 A;  1HMV A;  5KGX A;  4FW2 A;  5KRT A;  3ZT1 A;  3CFO A;  4DS5 A;  3ZSY A;  4DFJ A;  2FBT A;  4LY7 A;  4CF2 A;  1I39 A;  1U04 A;  2B6A A;  3O4Q A;  4CF8 A;  5J2N A;  4CGF A;  4N56 A;  1J5O A;  2HW3 A;  3KLI A;  1HRH A;  1TKZ A;  3KK2 A;  3NH0 A;  3HPH A;  3M8R A;  1JLA A;  2HVH A;  3VQC A;  3OYG A;  4E7K A;  2Z1J A;  3NH2 A;  1TAU A;  3RRG A;  1LAV A;  1KLN A;  1UAX A;  1ZBH A;  4Z4I A;  3NE6 A;  5HBM A;  2JLE A;  3TAM A;  3HM9 A;  1LW0 A;  1VSF A;  2DTU A;  4HVJ A;  3D45 A;  4DQR A;  3SUO A;  4FJG A;  1SUQ A;  2W42 A;  4DTN A;  4I9L A;  4DQP A;  4KTQ A;  4JS5 A;  3SPY A;  4OGE A;  1XHZ A;  1L5U A;  4Z4F A;  4E1M A;  1B92 A;  1JXE A;  1NK4 A;  2HHU A;  3KLE A;  3O3G A;  4AHC A;  4DLE A;  3V9Z A;  2X78 A;  4IG0 A;  1W0H A;  2ZE2 A;  3V6D A;  4M3U A;  4B9M A;  3AVK A;  1WSG A;  1ZBU A;  2IC3 A;  1JXB A;  1TGO A;  3HVR A;  2IOC A;  1CLQ A;  3AVI A;  3OYD A;  3MEG A;  2A1S A;  3O3H A;  1NK7 A;  3V81 A;  3TAG A;  2HHT A;  1NK6 A;  4OKK A;  2G8W A;  1ASU A;  1JL1 A;  3A2F A;  3KKS A;  2FBV A;  3PO4 A;  3SUP A;  1RDB A;  3OYB A;  1LV5 A;  4OPJ A;  1IG9 A;  4CJK A;  1IO2 A;  1X1P A;  2BE2 A;  2QXF A;  4QAG A;  1REV A;  1JLG A;  4DSF A;  3ZSX A;  3PV8 A;  4KI4 A;  3D0P A;  4FLY A;  4CCH A;  1RBT A;  4FJN A;  1VSJ A;  4W5R A;  3CM6 A;  1GOC A;  3V9W A;  1RBR A;  4KRE A;  4KV8 A;  3I8D A;  4DF4 A;  3B6P A;  4IKF A;  4CHN A;  4CHZ A;  3P83 D;  4K8X A;  3HJF A;  1YT3 A;  1C6V A;  4CK1 A;  4PUO A;  4OJR A;  1LW2 A;  3LPT A;  4F2S A;  4DQS A;  3AVJ A;  1YVU A;  4FJ5 A;  3SNN A;  3QIN A;  1RDC A;  3HXM A;  3E01 A;  3T19 A;  3V4I A;  1WSE A;  3RRH A;  1T8E A;  4KHS A;  5CYQ A;  2FBX A;  4CHQ A;  2HHX A;  3S3O A;  4H4M A;  3PUF A;  1NJX A;  4KHY A;  4W5O A;  1TK8 A;  2QKK A;  5KTQ A;  2XRI A;  4CEF A;  3P5J A;  3OYA A;  1C1A A;  4FW1 A;  2KZZ A;  4OVL A;  4CJ3 A;  2KFZ A;  5DK5 A;  3DYA A;  3SZ2 A;  2AJQ A;  4R5P A;  3SUQ A;  4KTZ A;  4DTR A;  4CIG A;  1B9F A;  4CJ4 A;  3SPZ A;  2D0B A;  3AA3 A;  1QS4 A;  1BHL A;  3LZJ A;  2Y1J A;  1TKD A;  2RN2 A;  1QSS A;  2XO7 A;  5T7B A;  4FJJ A;  4LH5 A;  3PX4 A;  4IBN A;  3VQD A;  4E7J A;  1HJR A;  4DTM A;  1FKO A;  4B9L A;  5HRO A;  2F96 A;  3MXJ A;  4FJX A;  4KHU A;  3KLF A;  4I2Q A;  4FLU A;  2D5R A;  1Q8I A;  4FLV A;  5I42 A;  3IS9 A;  1RT5 A;  3JYT A;  4CGI A;  1U45 A;  4ID5 A;  2P5G A;  4CJ5 A;  3AO4 A;  3SQ1 A;  3LPU A;  2YKM A;  1ZBL A;  3VA0 A;  3HK2 A;  1L3S A;  4AHV A;  2DFE A;  3KLG A;  4FLX A;  1EET A;  2Z1H A;  2BGG A;  2G8I A;  4B9U A;  1VRT A;  1VSL A;  1VSD A;  4BWJ A;  2GV9 A;  3CG7 A;  1TAQ A;  2IGI A;  4PA1 A;  1U47 A;  1T05 A;  3TR8 A;  4M3X A;  4QOZ B;  3QLH A;  3QNO A;  3ITH A;  3K2P A;  2RF2 A;  3TWH A;  2VWJ A;  4F4K A;  4W5N A;  1RCH A;  1S5J A;  1C1B A;  4CJS A;  4CJF A;  1U49 A;  4DSK A;  2VG6 A;  3RTV A;  3SV3 A;  2HHV A;  3OVN A;  4BE0 A;  5HRR A;  1RBU A;  1XHX A;  1XC9 A;  1YTU A;  2ITG A;  4XIU A;  1EXQ A;  1J53 A;  4CGG A;  1Z25 A;  3AA5 X;  4HHT A;  1SKS A;  3VQ9 A;  1HYZ A;  1IKW A;  4KO0 A;  3QNN A;  4NCA A;  3ZSQ A;  2ZD1 A;  4DTO A;  4N76 A;  1BCO A;  3WNH A;  3V9U A;  1IH7 A;  1LWF A;  4DFK A;  3MED A;  3NFA A;  4RW6 A;  4O0I A;  1FXX A;  4FM0 A;  5J2Q A;  4YNQ A;  3TAE A;  4E0D A;  5SZT A;  4FLW A;  4K8Z A;  4C8M A;  2F8T A;  1HNV A;  3NBP A;  2KTQ A;  1B9D A;  4PQU A;  1JL2 A;  3DLH A;  2WOM A;  3M8Q A;  1CZB A;  3QIP A;  3K59 A;  4DS4 A;  1BIS A;  1RDD A;  2P1J A;  1TV6 A;  3AO1 A;  4CJL A;  1KFD A;  1A5X A;  1BGX T;  2FC0 A;  4B08 A;  3T1A A;  4CJQ A;  3S9H A;  2NUB A;  3ZSW A;  4DWI A;  4CIF A;  3LP3 A;  4DQI A;  1RTI A;  2YKN A;  3AVL A;  2RPI A;  4OGC A;  3QER A;  4ELV A;  1RT4 A;  2I5J A;  3MXI A;  1C0M A;  4KB0 A;  2E6L A;  3S3N A;  2YNI A;  3K5O A;  3OJS A;  3V1Q A;  3THV A;  3UIQ A;  1JLQ A;  3LAM A;  1RT6 A;  4LD0 A;  1DTQ A;  4CJV A;  4DU3 A;  3RMD A;  1QTM A;  2OZM A;  3HO1 A;  4CF9 A;  4DLG A;  4NYF A;  3L2U A;  1KFS A;  3L3V A;  1HYV A;  4M42 A;  4CJU A;  2BDP A;  3AVF A;  3SQ0 A;  1NK0 A;  4YFU A;  4FK2 A;  1JKH A;  3VQP A;  4CHO A;  1RNH A;  3LAL A;  3OYJ A;  1T03 A;  3DI6 A;  2A1R A;  2P5O A;  4CEE A;  2KW4 A;  1WNS A;  4J2B A;  3RMB A;  3CQ8 A;  4CJE A;  3QEI A;  2QKB A;  1VSI A;  1QE1 A;  1ASW A;  4BDZ A;  2XY5 A;  4OPK A;  4DQQ A;  4KAZ A;  3AVC A;  4RW7 A;  5KRS A;  3OYC A;  5CZ2 A;  1WN7 A;  4CGJ A;  4JS4 A;  5HP1 A;  3TAQ A;  1KCF A;  3CYM A;  4KKO A;  1BQM A;  4FZZ A;  3O4N A;  3ZSV A;  4DTP A;  3SQ2 A;  3VQE A;  4BAC A;  2OYQ A;  4KTW A;  1O1W A;  4DSE A;  3L2W A;  4FK0 A;  3DM2 A;  4CHP A;  4WE1 A;  5I3U A;  1ZBF A;  1VSM A;  3DLE A;  2FBY A;  3HT3 A;  2G8U A;  4CGD A;  1IKV A;  3SCX A;  1NK5 A;  1Z26 A;  2KFN A;  4E89 A;  1L3T A;  3QES A;  3L8B A;  1IKX A;  3V1O A;  3H08 A;  1N6Q A;  2O4G A;  1UA0 A;  2OA8 A;  2GUI A;  3DLG A;  3DRR A;  4H8K A;  4C8O A;  4HUF A;  4CFD A;  4KFB A;  4CER A;  4KHQ A;  5J1E A;  4FJ8 A;  1JLF A;  3AA4 A;  5KGW A;  4CEA A;  2WON A;  1WSJ A;  3KK1 A;  4BE1 A;  1D8Y A;  4NCB A;  1RBV A;  3AO3 A;  3DLK A;  5SWM A;  1ZBI A;  1J9A A;  3NHG A;  3V9X A;  4FJ7 A;  1CXU A;  5EU7 A;  1VSE A;  3SI6 A;  1Y97 A;  3SQ4 A;  4W5T A;  3S3M A;  2DFF A;  4IDK A;  3NH1 A;  1TL3 A;  3VQA A;  4AHT A;  4FM2 A;  3T3F A;  3VA3 A;  3LP2 A;  1RT7 A;  4I7F A;  4DG1 A;  4Y1C A;  5CZ1 A;  3VQ4 A;  3LAN A;  4FXD A;  1NKC A;  3VQ5 A;  5K14 A;  3LWM A;  1U48 A;  4DSJ A;  1BCM A;  3ASM A;  4O55 A;  1KRP A;  2PYJ A;  1S9E A;  3OYE A;  2EX3 A;  4CEC A;  4M3T A;  2YNH A;  4TSX A;  1EP4 A;  2HNY A;  3AVH A;  4IG3 A;  1SV5 A;  3V1R A;  3L2Q A;  2PZS A;  3NGY A;  4M3R A;  1LAW A;  4M3Z A;  4O0J A;  4IFY A;  3P1G A;  4GMJ B;  4HUE A;  1ZYQ A;  3ZT3 A;  3I0R A;  4J2A A;  3DOK A;  1TL1 A;  1NKB A;  4CF1 A;  3IRX A;  4LSN A;  3LAK A;  3TAN A;  3L3U A;  1L3V A;  1S1U A;  3VN5 A;  2G8V A;  1KLM A;  4RW4 A;  4CK3 A;  3DMJ A;  3VQ6 A;  4KHW A;  4DTX A;  4DU1 A;  3OYH A;  4DSI A;  3QET A;  2VG7 A;  5HRN A;  1DTT A;  4OLB A;  1S1T A;  4F8R A;  2EHG A;  2QK9 A;  2YNF A;  4E19 A;  4E3S A;  2KZM A;  4FK4 A;  3KLH A;  3VQ7 A;  3AVA A;  4DTS A;  4QCL A;  1WAJ A;  5HLF A;  4CFA A;  3SV4 A;  3MAQ A;  1NJW A;  3TAR A;  2OPP A;  3ULD A;  1S1W A;  3U3Y A;  1IKY A;  4CJT A;  4LH4 A;  4M41 A;  2O4I A;  3FFI A;  2PY5 A;  1Q9Y A;  2HHQ A;  1UA1 A;  2YV0 X;  2KQ2 A;  3OYL A;  2HMI A;  3V9S A;  1QSL A;  1HQE A;  3M8P A;  4C8L A;  2VWK A;  1RIL A;  3QIO A;  5FRO A;  3CM5 A;  4CIE A;  2BAN A;  2IAJ A;  3ZSZ A;  4CEQ A;  2Z1G A;  3BDP A;  4Z0U A;  1D5A A;  1JLE A;  3C94 A;  3OS1 A;  4HCC A;  4O4G A;  3ZT0 A;  2E4L A;  3OS2 A;  4ZTJ A;  3B6O A;  4JRP A;  1L3U A;  4FCY A;  2HND A;  3NCI A;  4HCB A;  3NF7 A;  1I3A A;  3NF8 A;  1QQC A;  3QO9 A;  4CF0 A;  3ZSO A;  5D3G A;  4O5B A;  3EY1 A;  3OYI A;  3PX6 A;  1BL3 A;  1HQU A;  1RTH A;  3C6T A;  4FJL A;  2DY4 A;  3RR7 A;  2ZQB A;  4HUG A;  4B3O A;  1X9M A;  3K58 A;  1RDA A;  1SL2 A;  3KD1 E;  4EZ6 A;  4ID1 A;  1RT1 A;  3L2V A;  3PX0 A;  4F3T A;  4CJP A;  3KD5 E;  3QEX A;  4Q0B A;  3KTQ A;  1XI1 A;  1G15 A;  1R0A A;  4JLH A;  1CXQ A;  4B8C A;  1T7P A;  4E1N A;  5HRS A;  4B8A B;  3M8S A;  4N47 A;  1WSI A;  2XY8 A;  1NKE A;  4KI6 A;  1YTA A;  3HL8 A;  3SYZ A;  4Z4C A;  4B9V A;  2VG5 A;  3HYF A;  3QEP A;  1FKP A;  1LWC A;  1KVA A;  1UWB A;  2XHB A;  4PY5 A;  4E7H A;  2PYL A;  2Q3S A;  4RG8 A;  3JSM A;  3EZ5 A;  4AHS A;  2Y1I A;  3G0Z A;  3K5M A;  1D9F A;  4B9N A;  4DFP A;  4RW9 A;  2YHB A;  1FK9 A;  3WNF A;  4Z4E A;  1WSH A;  3F9K A;  1X9W A;  3DLB A;  4FZX C;  4JRQ A;  3QEV A;  3HPG A;  3LP0 A;  3K5N A;  2G8H A;  1NJZ A;  3RMC A;  1JLB A;  4G1Q A;  3U3G A;  2OPR A;  4IFV A;  1X9S A;  4FZY A;  4PWD A;  4N5S A;  2LSN A;  1TVR A;  1ASV A;  1KTQ A;  2YNG A;  3WNE A;  4CEB A;  4FLZ A;  3O3F A;  3F73 A;  3WNG A;  1TKT A;  2D0C A;  3AO2 A;  5J2M A;  1TK0 A;  3I0S A;  1BI4 A;  3ZSR A;  4CE9 A;  4DSL A;  1Q9X A;  4C8N A;  3IG1 A;  3PY8 A;  4M3W A;  4CED A;  2R7Y A;  4FJ9 A;  3HST B;  3KKR A;  1J54 A;  4MQ3 A;  5FRN A;  3AVG A;  3HP6 A;  4W5Q A;  4CHY A;  4DU4 A;  1F21 A;  4FJK A;  3LDS A;  4RW8 A;  5E41 A;  4ZTF A;  2G8K A;  4BDP A;  1EKE A;  2YHA A;  4CES A;  4FVM A;  3MXM A;  3AVM A;  3NDK A;  3SJJ A;  2HB5 A;  1S6P A;  3OJU A;  3DRP A;  4OLA A;  4GVM A;  2XY7 A;  4CGH A;  3NF9 A;  1S6Q A;  2P51 A;  4B9T A;  2X6N A;  2OPS A;  4GW6 A;  4E7I A;  3RR8 A;  1LWE A;  1BIU A;  1WLJ A;  1NJY A;  4EP5 A;  3OYN A;  1NOY A;  3CFP A;  1GOA A;  2E6M A;  3ALY A;  3DLR A;  4CFB A;  1DLO A;  1RT2 A;  2B5J A;  3ISN C;  5C42 A;  4ZHR A;  4KRF A;  3NGZ A;  5FDL A;  4DFM A;  1KVC A;  2X74 A;  4EP4 A;  3TI0 A;  2XY6 A;  1SKR A;  3C6U A;  1CZ9 A;  4CK2 A;  4F2R A;  4J2D A;  2D0A A;  4CEO A;  1C1C A;  1N5Y A;  5C25 A;  3G10 A;  3HVT A;  4HTU A;  1JLC A;  4L8R B;  4J2E A;  4AHR A; 
#chains in the Genus database with same CATH topology
 4BR9 A;  3BUZ B;  4CEZ A;  2HHS A;  4Y0W A;  2HBL A;  3OY9 A;  3CME N;  4N41 A;  3CCJ N;  5CR4 A;  5FRM A;  2X6S A;  4I2P A;  4CFC A;  2E2N A;  4M7X A;  4YOU A;  4CZH A;  3HP9 A;  1TK5 A;  2HHW A;  1ESV A;  5DMR A;  4JI5 K;  4BC3 A;  2A3Z A;  5C12 A;  3JAM O;  1T3V A;  2ATQ A;  4K43 A;  4OKE A;  3U6F A;  2GEL A;  2YCH A;  4AIL C;  5FPE A;  3OS0 A;  5BR8 K;  4NYN A;  4FJH A;  4BRQ A;  4DTU A;  4DTJ A;  4LSL A;  5E84 A;  2OZS A;  1BOT O;  1QZ6 A;  1RTJ A;  1MU2 A;  1ZXO A;  2YHW A;  3VQQ A;  1IV0 A;  4NCG A;  1KSP A;  2E2O A;  2QWL A;  2IDO A;  4OKJ A;  4KTQ A;  3GL1 A;  4DV1 K;  3THX B;  3LZI A;  2HVI A;  2W6L A;  4B1Y B;  1C0F A;  1K6Y A;  1NU0 A;  3ZX3 A;  4BRN A;  2F7T A;  4AHU A;  1UOC A;  3AVB A;  5J2P A;  3VEX A;  2B4J A;  2HF4 A;  4AH9 A;  1S1X A;  2GWJ A;  2Z1I A;  3D7E O;  3TAB A;  1HMV A;  5KGX A;  5KRT A;  1KC8 O;  4LY7 A;  3JS6 A;  2QTD A;  2B6A A;  4N56 A;  2ZJR L;  1VQ6 N;  5AR0 A;  1GLF O;  3HSC A;  2RHK A;  3NH2 A;  1UAX A;  3TAM A;  2JLE A;  3UKU A;  1EWQ A;  3SUO A;  4ISE A;  2FSN A;  3RSE B;  3FZL A;  1LOT B;  3P38 A;  1X9J A;  4JS5 A;  4YY3 K;  2PFU A;  3O9T A;  4JEP A;  1B92 A;  3KLE A;  3O3G A;  4DLE A;  3KWG A;  1W0H A;  3PLA A;  1JXB A;  1TGO A;  3HVR A;  2IOC A;  3TSU A;  2A1S A;  5F1X A;  1NK7 A;  3V81 A;  2O8E B;  2BUP A;  4DB3 A;  5A2Q O;  4OKK A;  4DR6 K;  4IZ9 A;  1ASU A;  3AAR A;  1YJN N;  1LV5 A;  2BE2 A;  4DSF A;  4DV6 K;  3SAH A;  4JKF A;  1TUU A;  4FJN A;  1VSJ A;  1GOC A;  5JLH A;  4BG9 A;  4CHZ A;  3TTC A;  4K8X A;  4GVE A;  3HJF A;  4CK1 A;  1C6V A;  4PUO A;  4OJR A;  4C1N K;  4H5V A;  4F2S A;  5EY4 A;  1RDC A;  2A6A A;  3FZF A;  4AM6 A;  3HI0 A;  2QM1 A;  3ZLJ A;  3PUF A;  1V4T A;  1BDG A;  3P5J A;  3DWL A;  1Y64 A;  4JI1 K;  4FW1 A;  1FW6 A;  4OVL A;  2KFZ A;  4IO8 A;  3L4Q A;  2KLA A;  4R5P A;  3VES A;  4KTZ A;  4DTR A;  3S3N A;  3CC2 N;  2D0B A;  3AA3 A;  2Y1J A;  3MN6 A;  1HLU A;  2IIR A;  2RN2 A;  3FZM A;  4CZJ A;  1E3M A;  4MDB A;  5DM7 L;  3VEO A;  4FJJ A;  3PX4 A;  4B9L A;  4DTM A;  1FKO A;  2Q0R A;  2ZGZ A;  4JI7 K;  3U8X A;  4I2Q A;  3VEY A;  1XNQ K;  4FLV A;  5I42 A;  1RT5 A;  3P39 A;  4FO0 A;  1U45 A;  4ID5 A;  3CC4 N;  4YDU A;  4B9U A;  4GKJ K;  3CI5 A;  4M3X A;  4I6M B;  4QOZ B;  1T6D A;  3QNO A;  3WQT A;  4DR7 K;  4Z94 A;  4YOW A;  4F4K A;  3O9U A;  1WBD A;  1C1B A;  2UUA K;  5BPL A;  4BE0 A;  1YTU A;  1EXQ A;  1Z25 A;  4HHT A;  2NNW A;  4KO0 A;  4NCA A;  2ZD1 A;  1BCO A;  3WNH A;  1RDU A;  4JKH A;  3NFA A;  3DXM B;  4FM0 A;  4LF4 K;  4EHU A;  2F8T A;  3VEW A;  3O1W A;  2GUP A;  2HOE A;  3CXC M;  1JL2 A;  4IWV A;  1CZB A;  3K59 A;  4CJL A;  3IUC A;  1BGX T;  4CIF A;  3M6G A;  4DR2 K;  4DQI A;  3CJ7 A;  3AVL A;  3KZB A;  4JD2 A;  1C0M A;  4KB0 A;  3O1B A;  3ZET B;  3CMA N;  3EEQ A;  3J80 O;  4LD0 A;  3KVG A;  4YOV A;  1N8R O;  4CF9 A;  5AQZ A;  1HYV A;  1WUA A;  4YOY A;  3Q7B A;  3ZX2 A;  2BDP A;  4YFU A;  1JKH A;  4CHO A;  1RNH A;  3LAL A;  5FLX O;  4CZE A;  1S72 N;  2ZM6 K;  4CEE A;  4J2B A;  5GAG P;  2HMP A;  2NRH A;  2QKB A;  1VSI A;  5C15 A;  2QA4 N;  4RW7 A;  4CGJ A;  3CJ1 A;  4A61 A;  3TAQ A;  1KCF A;  3CYM A;  4FZZ A;  1YJW N;  2OYQ A;  2E2P A;  1O1W A;  5M1F A;  1DKG D;  4JKA A;  2J4R A;  1ZBF A;  2FBY A;  2KKZ A;  3CCU N;  1Z26 A;  2KFN A;  1H1V A;  3QES A;  2O4G A;  3OA9 A;  3DLG A;  3D6R A;  4CER A;  4WF9 L;  3AA4 A;  4CBU A;  1WSJ A;  3KK1 A;  4NCB A;  5M1P A;  3GOI A;  4FSV A;  2UU9 K;  1CXU A;  4WYB A;  2UXC K;  3S3M A;  3SQ4 A;  4IDK A;  3PO5 A;  3T3F A;  2Q1N A;  3VQ4 A;  5K14 A;  1BCM A;  3ASM A;  1KRP A;  3PIO L;  2YNH A;  1XMQ K;  4M3R A;  3DJC A;  5BRH A;  5AQP A;  2ZF5 O;  1N34 K;  4GMJ B;  3OBW A;  3Q7C A;  4BG8 A;  3DOK A;  4JI8 K;  1TL1 A;  1YXQ A;  1LCU A;  4CF1 A;  3UKU B;  5M1K A;  3IRX A;  3LAK A;  1L3V A;  3L3U A;  2G8V A;  1S1U A;  4M7Y A;  1KLM A;  3VF6 A;  3SK3 A;  3E1Y A;  4KHW A;  3K0S A;  4WQ5 A;  3QET A;  4H5N A;  2VG7 A;  5HRN A;  4YOX A;  3QFP A;  1BA1 A;  4F8R A;  4E19 A;  5AQY A;  1YJ9 N;  2FSJ A;  3VQ7 A;  1WAJ A;  5HLF A;  4CFA A;  1XNR K;  4DV4 K;  4B1U B;  2O4I A;  3FFI A;  4DR5 K;  2HMI A;  4WQ5 C;  1NGE A;  4FWP A;  5FRO A;  4CIE A;  2BAN A;  3ZSZ A;  3BDP A;  4C1N I;  2W41 A;  4HCC A;  4DUZ K;  4O4G A;  5GIN A;  4ZTJ A;  3B6O A;  4O5F A;  4HCB A;  4ISF A;  2P9K B;  4OPH A;  4FPA A;  4JNE A;  4QS9 A;  2ZQB A;  1QZ5 A;  1X9M A;  3KD1 E;  1RDA A;  4EZ6 A;  1RT1 A;  2WFB A;  3PX0 A;  4CJP A;  3QEX A;  3KTQ A;  4JLH A;  5AQH A;  4CD3 A;  5HRS A;  1NKE A;  1YIJ N;  3QEP A;  1KVA A;  2XHB A;  2Q2R A;  4CD1 A;  3JSM A;  1VQM N;  1JCF A;  3UB5 A;  4B9N A;  4DFP A;  2QW9 A;  2E20 A;  1QQN A;  1X9W A;  4RCH A;  3HPG A;  3LP0 A;  2G8H A;  4IEE A;  4LF6 K;  3RMC A;  4FWK A;  4G1Q A;  2HST A;  1X9S A;  4FZY A;  4PWD A;  5LJW A;  1VQ5 N;  4IEI A;  4XEI A;  4CEB A;  2YNG A;  1K8A O;  3AO2 A;  3ZSR A;  4C8N A;  5DM6 L;  2NRX A;  4FJ9 A;  1J54 A;  4DV7 K;  5FRN A;  4BRA A;  4H5W A;  4H0T B;  4ZTF A;  1EKE A;  1QHA A;  4FVM A;  3MXM A;  3NDK A;  3SJJ A;  3A5L C;  4MO5 A;  2P51 A;  4B9T A;  2X6N A;  3LDO A;  4GW6 A;  3W0L A;  5CE3 A;  1WLJ A;  1NJY A;  3OYN A;  4FYD A;  3CFP A;  4NO7 A;  1DEJ A;  4DR1 K;  4BGA A;  2B5J A;  5C42 A;  4ZHR A;  4DFM A;  1VQP N;  3C6U A;  2E88 A;  4CK2 A;  4WFA L;  1RFQ A;  3G10 A;  4HTU A;  4L8R B;  4J2E A;  4GNI A;  3RSE A;  4CJW A;  5AJ3 K;  1XWL A;  1NOZ A;  3IAY A;  3R6M A;  1S1V A;  1ITG A;  4CBX A;  2DFH A;  1HPZ A;  1C0T A;  1S3X A;  2QWQ A;  4IOX A;  3HPO A;  2IVN A;  1KVB A;  4BR0 A;  1VQ4 N;  4EAH D;  4K25 A;  2AA4 A;  1BQN A;  1RT3 A;  2A40 A;  1J6Z A;  3AO5 A;  3DRS A;  4H4O A;  4FJM A;  1VK0 A;  4BE2 A;  4G9Z A;  4H0V B;  4FM1 A;  4CZI A;  4CW7 B;  3CCE N;  4ELU A;  1D9D A;  3DOL A;  4JKC A;  4LFA K;  4BWM A;  3SMP A;  4CJR A;  5LMU K;  3THY A;  1RTD A;  3KIO A;  5JS2 A;  3NGI A;  3L6Q A;  2F8S A;  4RWT A;  3EYZ A;  3G6E N;  3NF6 A;  3VGM A;  3OYM A;  3C95 A;  4H5R A;  4CZM A;  3E9L A;  4PL8 A;  4M3Y A;  1EX4 A;  4JI3 K;  4DV5 K;  4KHN A;  1ATS A;  2VYP A;  3AA2 A;  4MFB A;  3AV9 A;  4FW2 A;  5JLF A;  4KHP K;  1NJI O;  3KK2 A;  3HPH A;  3E9P A;  2HVH A;  2Z1J A;  1KLN A;  1ZBH A;  3NE6 A;  5HBM A;  3HM9 A;  2DTU A;  4FJG A;  2W42 A;  4B9Q A;  3SPY A;  1JXE A;  1NK4 A;  1XMO K;  3V9Z A;  2X78 A;  1U6Z A;  1NGD A;  4B9M A;  4DV2 K;  3JXU A;  3R3L A;  1WSG A;  2ZWH A;  3BZK A;  3AVI A;  3S41 A;  3O3H A;  1MDU B;  2AP1 A;  4JKB A;  3A2F A;  1GLD G;  3IFR A;  4OPJ A;  4CJK A;  3M1F A;  1QSY A;  3PV8 A;  3DXM A;  3ZSX A;  1HPM A;  1U2V A;  3CCS N;  4FLY A;  1W7A A;  1RBT A;  1RGI A;  2PBD A;  3HOS A;  3V9W A;  1RBR A;  4BC2 A;  2UXB K;  4KV8 A;  1HR0 K;  5AQI A;  3O08 A;  4CHN A;  3P83 D;  4LF9 K;  3LPT A;  4DQS A;  3AVJ A;  4FJ5 A;  4FWO A;  3SNN A;  3HXM A;  4B1W B;  4BRG A;  1GLE G;  1T8E A;  4KHS A;  3CD6 N;  5CYQ A;  3EN9 A;  4H4M A;  2P9U A;  3ZET A;  2UUB K;  5BPN A;  4BQL A;  4W5O A;  4FWR A;  1Q18 A;  2XRI A;  3OYA A;  5FPN A;  1DGK N;  5DK5 A;  4WCE L;  5B8H A;  2AJQ A;  2VQE K;  3SPZ A;  1B9F A;  1QS4 A;  3O80 A;  4X64 K;  2XO7 A;  2QWO A;  2ZGY A;  4LH5 A;  1BUP A;  4IBN A;  4E7J A;  1HJR A;  5HRO A;  4KHU A;  1XC3 A;  4CZL A;  3QFU A;  3L4I A;  3LPU A;  2A41 A;  1L3S A;  2W40 A;  3SMS A;  3KLG A;  4FLX A;  2BGG A;  2G8I A;  1BG3 A;  2HBJ A;  4BWJ A;  2GV9 A;  3CG7 A;  1TAQ A;  4PA1 A;  1U47 A;  1T05 A;  5LJV A;  3QLH A;  3ITH A;  3K2P A;  3TWH A;  2VWB A;  2VWJ A;  4ILJ A;  1XUP O;  4W5N A;  5FPM A;  4CJS A;  4JKG B;  3OVN A;  1E4F T;  4MO4 A;  1RBU A;  5HRR A;  5BN9 A;  3C65 A;  1XC9 A;  4XIU A;  2WC9 A;  4CGG A;  3VET A;  3H1Q A;  1HYZ A;  3SBG A;  3ZSQ A;  2YJF A;  4N76 A;  3T1Y K;  1LWF A;  4O0I A;  1NGF A;  1FXX A;  5J2Q A;  4YNQ A;  4LC9 B;  5SZT A;  4FLW A;  1O13 A;  4B3S K;  4GV6 A;  3NBP A;  4GKK K;  2KTQ A;  2WOM A;  3M8Q A;  4LF8 K;  2V51 B;  4IJA A;  1BIS A;  3AO1 A;  5AQL A;  2FC0 A;  3T1A A;  4CJQ A;  3VER A;  1RTI A;  2YKN A;  4ELV A;  2RPI A;  4CJ7 A;  3QER A;  3MXI A;  1KQS M;  4B1X B;  3OJS A;  5JVG L;  3V1Q A;  3THV A;  5AQK A;  1JLQ A;  4LFB K;  3LAM A;  1RT6 A;  1QTM A;  2OZM A;  3RMD A;  4JKE A;  4NYF A;  3L2U A;  1KFS A;  3THW A;  3CC7 N;  4FWM A;  4H0X B;  3BP8 A;  4FK2 A;  4V19 S;  4AM7 A;  3VQP A;  2O8C A;  1SS6 A;  3VEZ A;  1T03 A;  3G4S N;  2NRW A;  3CQ8 A;  2XY5 A;  3OYC A;  3NVM A;  3KHY A;  5CZ2 A;  4JS4 A;  1WBB A;  4KKO A;  3ZSV A;  1Q86 O;  2P9S B;  4KTW A;  4DSE A;  3L2W A;  4CHP A;  2P9K A;  4ILH A;  1VSM A;  5MLC Q;  4CGD A;  4OO1 J;  1NK5 A;  2QI2 A;  3L8B A;  1N6Q A;  2OA8 A;  3THY B;  2GUI A;  4H03 B;  5AQS A;  4CFD A;  4KHQ A;  4FJ8 A;  5KGW A;  4CEA A;  2WON A;  5SWM A;  5TKW A;  3V9X A;  1HX1 A;  5H1S Q;  5EU7 A;  4BRM A;  3VMF B;  3NH1 A;  4FM2 A;  3QBX A;  3VQA A;  1RT7 A;  2WUS A;  4DSJ A;  2KHO A;  1S9E A;  3EE8 A;  2EX3 A;  5EX5 A;  3AVH A;  3V1R A;  1SV5 A;  3NGY A;  3LM2 A;  2V7Y A;  2ZJP L;  4O0J A;  3J7A P;  2YJE A;  1ZYQ A;  1JJ2 M;  2E5L K;  2OTJ N;  2ITM A;  4DV3 K;  2EWS A;  2W6K A;  3FLC O;  4DU1 A;  4DSI A;  2F9T A;  2QK9 A;  4OLB A;  1S1T A;  5EXW A;  1Q7Y O;  4E3S A;  2Q36 A;  3KLH A;  1X3M A;  1EWR A;  1NGA A;  2GWK A;  4QCL A;  3SV4 A;  3MAQ A;  1NJW A;  4JHD A;  3AY9 A;  4LH4 A;  2YX6 A;  2UXD K;  1Q9Y A;  2HHQ A;  1MWK A;  4YDU C;  4BRI A;  3QIO A;  1RIL A;  3CM5 A;  2IAJ A;  1OVQ A;  3OS1 A;  3H3O B;  1U2V B;  3ZT0 A;  3OS2 A;  3AGR A;  3F9M A;  3NCI A;  4B3M K;  1I3A A;  3ZSO A;  3PX6 A;  3CPW M;  1HQU A;  1RTH A;  3C6H A;  3K58 A;  3CCL N;  4FWN A;  3L2V A;  3VEV A;  5KPR A;  3MWT A;  1CXQ A;  3ENH A;  4YOR A;  4AF1 A;  1TYQ A;  2P9U B;  1D4X A;  2WBN A;  4Z4C A;  2VG5 A;  3HYF A;  4C23 A;  1GLB G;  4BC5 A;  4E7H A;  2Q3S A;  3EZ5 A;  2YHB A;  1FK9 A;  1QVF M;  3WNF A;  4Z4E A;  4JRQ A;  3QEV A;  1NJZ A;  5AQO A;  1Q81 O;  5C0Y A;  5JMV A;  3HRG A;  2HBK A;  1TVR A;  1KTQ A;  3H1V X;  1OH7 A;  5LY3 A;  1VAZ A;  3O3F A;  3WNG A;  2D0C A;  5J2M A;  4KBO A;  3IG1 A;  5M1Q A;  2O8B A;  2D4W A;  4XH1 A;  1NGJ A;  4HWI A;  4DU4 A;  3P31 A;  4FJK A;  4RW8 A;  4BDP A;  1BA0 A;  4CES A;  5KPT A;  3OJU A;  2XY7 A;  3NF9 A;  1S6Q A;  3F5T A;  3RR8 A;  4EP5 A;  1NOY A;  4KRF A;  1DLO A;  1RT2 A;  3ISN C;  5FDL A;  1DT9 A;  1Z05 A;  3TI0 A;  1SKR A;  4B3T K;  2P9I A;  1N5Y A;  5C25 A;  4FWS A;  5J2N A;  1EO1 A;  4H0Y B;  3ENO A;  3D2E A;  3NAE A;  3MEE A;  4FLT A;  1A5V A;  2D1K A;  1NBW A;  1WSF A;  4B9S A;  3O9R A;  3O8M A;  4R79 A;  4K41 A;  1HNW K;  5AQT A;  4IFE A;  1OH6 A;  2OPQ A;  3LWL A;  3TAF A;  1SL0 A;  4X65 K;  4EZ9 A;  3VTI A;  4UQG A;  2RKI A;  3K5L A;  2I7P A;  1BIZ A;  3RWU A;  3VQB A;  4NXM K;  1WAF A;  4Q5V A;  3THW B;  1YHQ N;  3OYK A;  1HUX A;  3KJV A;  4M45 A;  1RBS A;  4GV9 A;  3CFR A;  4Y1D A;  2O8C B;  4HTL A;  3ZCM A;  3H46 O;  4DCH A;  3SUN A;  2G8F A;  2HNZ A;  3QML A;  4ICL A;  4JI2 K;  4BDY A;  2FXU A;  4RTF D;  3CQX A;  1VQ9 N;  3CHW A;  4C8K A;  3AVN A;  1S9G A;  3OYF A;  1BI4 B;  3VPZ A;  1VSK A;  1ZBS A;  3MEC A;  4DF8 A;  5KI6 A;  5HRP A;  4CBW A;  3AGK A;  2ETJ A;  4F3O A;  3ZX0 A;  4MDA A;  3OW2 M;  1HKC A;  3HM8 A;  3N4P A;  3BGR A;  4Z4G A;  3TTD A;  1HNI A;  3MCA B;  1YIT N;  2YHX A;  3BEX A;  5I9E B;  5CYM A;  5M1N A;  3RMA A;  4O44 A;  1VHX A;  1IBL K;  4JYA K;  2GX9 A;  3WXI A;  3ZT1 A;  3CFO A;  4DS5 A;  1IBM K;  3L0Q A;  4DFJ A;  4CF2 A;  1I39 A;  4DUY K;  3O4Q A;  3A8Y A;  4CGF A;  1J5O A;  3KLI A;  1HRH A;  1OH8 A;  3NH0 A;  3M8R A;  3VQC A;  5LL6 Z;  4Z4I A;  1K8K B;  4ILG B;  1C0G A;  1VSF A;  2ASP A;  4HVJ A;  1OKJ A;  2A42 A;  1SUQ A;  2NRZ A;  4DTN A;  4DQP A;  5IT9 O;  4BRO A;  5TKY A;  3H6E A;  3EL2 A;  3V6D A;  1YF5 L;  4U67 L;  3OBY A;  4JKG A;  3H3N O;  4DV0 K;  2IC3 A;  3OYD A;  2QWM A;  3TAG A;  1KAX A;  3U9D A;  3MX5 A;  1JL1 A;  3KKS A;  3MX2 A;  2FBV A;  3PO4 A;  2UYT A;  3OYB A;  3PIP L;  1X1P A;  4AQY K;  2QXF A;  4KI4 A;  4JHD B;  3B8A X;  4CI6 A;  3VF4 A;  4CCH A;  4X66 K;  4FVU A;  3CM6 A;  4KRE A;  4DF4 A;  2VCP A;  3B6P A;  3ID6 A;  3ENB A;  1YT3 A;  1NLV A;  1LW2 A;  1K73 O;  3LM9 A;  3VGK A;  1WSE A;  4IO9 L;  3CF5 L;  5EOY A;  4K42 A;  4KH4 A;  4KHY A;  3LDL A;  2QKK A;  5KTQ A;  4CEF A;  3ZEU B;  1BWF O;  2KZZ A;  3AAQ A;  4BRE A;  4CJ3 A;  4A57 A;  3DYA A;  3ATU A;  4DKW A;  3BZC A;  3SUQ A;  1TYQ B;  4FXD A;  1BHL A;  4JI6 K;  5T7B A;  1KAY A;  3A5M C;  3VQD A;  2F96 A;  3MXJ A;  5C10 A;  1M1K O;  3A5O C;  4FLU A;  3VF2 A;  3J7Z O;  4K0K K;  4CGI A;  1JCG A;  2P5G A;  4CJ5 A;  2P9S A;  3NMU A;  5BN8 A;  2P9N A;  3VA0 A;  4XH4 A;  3HK2 A;  1VSD A;  5GIO A;  3ULE B;  2NLX A;  5AQV A;  2RF2 A;  2E1Z A;  4DSK A;  3I8B A;  1U49 A;  2O8B B;  1IBK K;  2VG6 A;  3CJ9 A;  4DR3 K;  1XHX A;  2ITG A;  1J53 A;  3AA5 X;  1J5E K;  1ATN A;  4PKG A;  4F9O A;  1IKW A;  1HNZ K;  3E9O A;  5C2F A;  4DTO A;  3O6W A;  1GLC G;  1IH7 A;  4DFK A;  3MED A;  4RW6 A;  4E0D A;  3TAE A;  4K8Z A;  4C8M A;  1HNV A;  4NLC A;  3QIC A;  3BF3 A;  3J8A A;  4PQU A;  3DLH A;  4DS4 A;  3QB0 A;  3FE1 A;  1YVN A;  3WEE A;  1RDD A;  2P1J A;  1TV6 A;  1KFD A;  3OHR A;  1A5X A;  5IWA K;  2F4V K;  2P9I B;  2NUB A;  3ZSW A;  4A2B A;  3I56 N;  4DWI A;  1Q82 O;  2CGJ A;  4U7B A;  4OGC A;  2Q97 A;  3GDQ A;  5ELZ A;  3D2E B;  2E6L A;  2YNI A;  5M1O A;  3UIQ A;  3WXK A;  1DTQ A;  4CJV A;  4DU3 A;  3R9P A;  3GBT A;  3HO1 A;  4H0P A;  1VQO N;  1RDW X;  4CJU A;  4PL7 A;  4QS7 A;  4BGB A;  4GY2 B;  2P5O A;  4WQ4 A;  1WNS A;  3RMB A;  3O9Q A;  4CJE A;  3MMV A;  1QE1 A;  1ASW A;  3EO3 A;  3AVC A;  1WN7 A;  5HP1 A;  3C0B A;  2D0P A;  5AZI B;  4DTP A;  3SQ2 A;  2CH5 A;  3CCR N;  3DM2 A;  4WE1 A;  5I3U A;  3CIP A;  4KH6 A;  3DLE A;  4WQ4 C;  3P4I A;  4BRH A;  4H0O A;  3SJH A;  3V1O A;  5BPM A;  1UA0 A;  4C8O A;  2RE2 A;  4H8K A;  3DRR A;  4HUF A;  1JLF A;  4BE1 A;  1QQO A;  1D8Y A;  3AO3 A;  1ZBI A;  1J9A A;  1VQ8 N;  4CZG A;  4FJ7 A;  2QWN A;  3SI6 A;  1VSE A;  4PY5 A;  2DFF A;  1TL3 A;  4AHT A;  3CER A;  4I7F A;  4Y1C A;  2JWK A;  3ATV A;  3LAN A;  5F2R A;  1NKC A;  3VQ5 A;  3LWM A;  2NRV A;  1U48 A;  3TTF A;  4B1Z A;  3U4L A;  4CEC A;  4M3T A;  2P9P B;  4TSX A;  4DQ8 A;  2PZS A;  1BO5 O;  3L2Q A;  1X3N A;  1LAW A;  5ADX A;  4IFY A;  3P1G A;  2FSK A;  3CCQ N;  1SQK A;  4BRC A;  4FWL A;  3I0R A;  4J2A A;  4O8U A;  2NRR A;  4LSN A;  2QEX N;  3C6A A;  3TAN A;  4CVN E;  4RW4 A;  4GV3 A;  3DMJ A;  4DTX A;  3LDQ A;  3D2F A;  3OYH A;  5AQG A;  1DTT A;  3U9Z A;  2YNF A;  4IXC A;  4FK4 A;  4B3R K;  4YHH K;  3AVA A;  3DLL L;  2JWL A;  4EHT A;  3TAR A;  4M41 A;  2PY5 A;  1UA1 A;  3OYL A;  3V9S A;  5AQQ A;  1HQE A;  5AQW A;  1QSL A;  3MK6 A;  3CCV N;  4NXN K;  4CEQ A;  2I7N A;  4Z0U A;  1D5A A;  3C94 A;  3EZW A;  1ATR A;  4EFH A;  1L3U A;  4FCY A;  3CCM N;  1NMD A;  2HHH K;  4BRD A;  3H45 C;  4O5B A;  3OYI A;  1BL3 A;  1WB9 A;  4IDH A;  4FJL A;  4OX9 K;  5FPD A;  3EKS A;  4Q0B A;  4PKH A;  1G15 A;  1R0A A;  1HKB A;  4B8C A;  1T7P A;  4E1N A;  3M8S A;  4B8A B;  4N47 A;  2BH1 A;  5ADX H;  1WSI A;  2XY8 A;  1YTA A;  1ZC6 A;  2ASM A;  3HL8 A;  5KQ8 A;  3SYZ A;  4BR4 A;  1NWK A;  1FKP A;  1LWC A;  1P90 A;  1UWB A;  4AHS A;  5AQX A;  2Y1I A;  2P9L A;  2HBM A;  2GEM A;  4RW9 A;  1WSH A;  3DLB A;  3K5N A;  5CHI A;  1JLB A;  1YI2 N;  3U3G A;  1QQM A;  2OPR A;  2E1Y A;  1BU6 O;  3NVK A;  4N5S A;  2LSN A;  1ASV A;  3SBT A;  3ID8 A;  4FLZ A;  3F73 A;  2FLO A;  1TK0 A;  1BI4 A;  3R1X A;  5E26 A;  4CE9 A;  4DSL A;  2P9N B;  2YHY A;  4M3W A;  4CED A;  2R7Y A;  1Z6R A;  3HST B;  3KKR A;  5HOO A;  3MN9 A;  3AVG A;  2IVP A;  4W5Q A;  3HP6 A;  4CHY A;  1F21 A;  3MDQ A;  3M3Z A;  2YHA A;  5C2D A;  4OLA A;  2PAV A;  2HB5 A;  1S6P A;  1CZA N;  4BVO A;  1HNX K;  4IOA L;  1K9M O;  2OPS A;  3FFK B;  4E7I A;  4DR4 K;  1LWE A;  1BIU A;  1GOA A;  4CFB A;  3ALY A;  4E1J A;  1NGB A;  3NGZ A;  3TU5 A;  1KVC A;  2V7Z A;  2X74 A;  4EP4 A;  2XY6 A;  1CZ9 A;  2QWR A;  2GTD A;  2VGN A;  2D0A A;  4CEO A;  1C1C A;  3FZH A;  1K8K A;  3ZYY X;  2VQF K;  4AHR A;  1HYS A;  4FJI A;  3LP1 A;  3WEE B;  3A5N C;  1FJG K;  3MWP A;  3ZT2 A;  3TAP A;  4DMN A;  1NK9 A;  4KPY A;  1W9H A;  2F9W A;  4Z4H A;  4A2A A;  1A5W A;  4CZF A;  4BY9 C;  1NGG A;  4BR5 A;  4JK8 A;  2IVO A;  4BC4 A;  4KB1 A;  3MCP A;  3K57 A;  2GBZ A;  1NK8 A;  3L2R A;  5JS1 A;  1QHT A;  1SL1 A;  2QXL A;  4I9Q A;  3HZ6 A;  5AZJ B;  1YUW A;  4FOE A;  3VGL A;  3UKR A;  3G25 A;  3K9K A;  3QEW A;  1W97 L;  2IS3 A;  5GAH P;  2O8F A;  2O8D A;  3VQ8 A;  5CY4 A;  1NGI A;  1SKW A;  3IDH A;  1U4B A;  1VRU A;  3KK3 A;  5C24 A;  2HHV A;  2JGU A;  1VSH A;  4H5T A;  3ZT4 A;  3F2K A;  1C0U A;  1GOB A;  3ZEU A;  3LL3 A;  4E7L A;  4MLH A;  1TKX A;  1NMN A;  3LDN A;  3MN5 A;  4ELT A;  2OCE A;  4O8K A;  2ZJQ L;  3ZSY A;  2FBT A;  3RVC A;  1NGC A;  1U04 A;  3HBT A;  4CF8 A;  4FOI A;  2HW3 A;  1TKZ A;  4A5B A;  1JLA A;  1IJJ A;  4JKD A;  3WXM B;  2A5X A;  3OYG A;  1EQY A;  4E7K A;  1V4S A;  2CGK A;  1TAU A;  3RRG A;  1LAV A;  3SLC A;  3A0I X;  1LW0 A;  3TPQ A;  3D45 A;  4DQR A;  3AAP A;  4JI0 K;  1NGH A;  4I9L A;  4OGE A;  1XHZ A;  3K9J A;  1L5U A;  4Z4F A;  4E1M A;  2HHU A;  4AHC A;  3ULE A;  3FGU A;  4IG0 A;  1MWM A;  2ZE2 A;  4XH5 A;  4M3U A;  5AQU A;  3O5B A;  3AVK A;  1ZBU A;  3VTH A;  3D2F B;  1CLQ A;  3CJB A;  3MEG A;  1NK6 A;  3KWI A;  2G8W A;  3CPE A;  3SUP A;  1RDB A;  1IG9 A;  1IO2 A;  4QAG A;  1REV A;  1JLG A;  3D0P A;  3IMX A;  4W5R A;  1P8Z A;  2OTL N;  3I8D A;  4QS8 A;  4IKF A;  5AFU A;  1ILY A;  3CJA A;  1NNE A;  5AQR A;  1YVU A;  3QIN A;  3TSQ A;  1E4G T;  3E01 A;  3T19 A;  5F0X A;  3RRH A;  3V4I A;  3WXJ A;  2FBX A;  4CHQ A;  2HHX A;  3VOV A;  1WOQ A;  3S3O A;  1NJX A;  2DPN A;  4JN4 A;  1TK8 A;  3DXK A;  2YI1 A;  1C1A A;  3M5R A;  4BR7 A;  3SZ2 A;  3GG4 A;  4J2D A;  3I33 A;  4CIG A;  2HHT A;  4YOT A;  4CJ4 A;  4ISG A;  2D0O A;  1TKD A;  3LZJ A;  1N36 K;  1QSS A;  3BY5 A;  4BR2 A;  4UY8 O;  4FJX A;  3T7Z A;  4FPB A;  3KLF A;  5BRD A;  2D5R A;  1Q8I A;  2P9L B;  3C7N A;  3IS9 A;  5AZI A;  2NZT A;  3JYT A;  3AO4 A;  3IKM A;  3T1H K;  3SQ1 A;  3T69 A;  2YKM A;  1ZBL A;  4AHV A;  2DFE A;  1EET A;  2Z1H A;  3KK7 A;  3SAF A;  4NLB A;  1VRT A;  1KXP A;  1VSL A;  2IGI A;  3TR8 A;  1QVG M;  4OPA A;  5AFU H;  1RCH A;  1S5J A;  4CJF A;  3RTV A;  3SV3 A;  1YAG A;  4LF5 K;  1GLA G;  4BRF A;  5KQD A;  4CZK A;  2V52 B;  1SKS A;  3VQ9 A;  3QNN A;  1KD1 O;  4LFC K;  3CJC A;  3V9U A;  4IJN A;  2CGL A;  2P9P A;  1B9D A;  1N32 K;  3QIP A;  5AQM A;  1I94 K;  4JAX A;  3EE9 A;  4B08 A;  3WUH A;  4A59 A;  3S9H A;  3LP3 A;  2Q31 A;  1RT4 A;  2I5J A;  4BRL A;  4FL9 A;  1M90 O;  3DAW A;  3N4Q A;  3K5O A;  3LDP A;  4B1V A;  4JV5 K;  4JK7 A;  2E2Q A;  4J8F A;  2WTU A;  4DLG A;  3L3V A;  1OH5 A;  4M42 A;  4PKI A;  3AVF A;  3SQ0 A;  1NK0 A;  3BF1 A;  3HOT A;  3OYJ A;  3CET A;  3DI6 A;  3WXL A;  2A1R A;  3WT0 A;  1VQ7 N;  1TUY A;  1G99 A;  2KW4 A;  1VQL N;  3UE5 A;  3QEI A;  2OAN A;  4BDZ A;  4WFN L;  4OPK A;  4DQQ A;  4KAZ A;  5KRS A;  1BQM A;  3O4N A;  4A5A A;  2FF6 A;  3VQE A;  3W3D A;  4DHY A;  4BAC A;  5JVH L;  3UKR B;  3THX A;  4FK0 A;  3O9S A;  4JI4 K;  2VGM A;  2O8F B;  2O8D B;  2G8U A;  3HT3 A;  3SCX A;  1IKV A;  2FF3 B;  4BRK A;  4E89 A;  5BRF A;  1L3T A;  1IKX A;  3H08 A;  4KFB A;  5J1E A;  3TSP A;  2E8A A;  5HL7 L;  1RBV A;  3DLK A;  3NHG A;  3FR0 A;  1Y97 A;  4W5T A;  3VA3 A;  3LP2 A;  4DG1 A;  5CZ1 A;  1VQK N;  3PSF A;  1NG9 A;  4O55 A;  2PYJ A;  3OYE A;  5EVZ A;  1MA9 B;  3J81 O;  4LF7 K;  1EP4 A;  2HNY A;  4IG3 A;  4M3Z A;  4MLE A;  4PHT X;  4HUE A;  5BR9 A;  3ZT3 A;  3CQY A;  4M63 C;  1NKB A;  1R59 O;  1XQS C;  4JD2 B;  3VN5 A;  4CK3 A;  3VQ6 A;  2Q0U A;  3EKU A;  5AQF A;  3HTV A;  1HKG A;  2O8E A;  3QDK A;  2EHG A;  2KZM A;  4BQZ A;  1GLL O;  1S22 A;  4DTS A;  1W2B M;  5KPZ A;  2BTF A;  2OPP A;  3ULD A;  1S1W A;  4JK9 A;  3U3Y A;  1JCE A;  1IKY A;  2H3G X;  4CJT A;  1OVY A;  5GAD P;  2YV0 X;  5GAE P;  2QWP A;  1N33 K;  2KQ2 A;  3PSI A;  3M8P A;  4C8L A;  2VWK A;  1T6C A;  3MN7 A;  2Z1G A;  4L3Q A;  4BVP A;  1JLE A;  3VEN A;  4NB4 A;  2E4L A;  4JRP A;  2HND A;  3GE1 A;  3NF7 A;  3NF8 A;  1QQC A;  3QO9 A;  4CF0 A;  5D3G A;  3EY1 A;  3R8E A;  4IOC L;  4EIA A;  3C6T A;  2DY4 A;  3RR7 A;  4HUG A;  4B3O A;  1SL2 A;  4ID1 A;  4F3T A;  3KD5 E;  2UUC K;  1XI1 A;  5LMN K;  4X62 K;  3E66 A;  1KAZ A;  4KH5 A;  4KI6 A;  3O4W A;  2CH6 A;  5JIC A;  4B9V A;  3DXK B;  3I55 N;  5BRE A;  2PYL A;  4RG8 A;  3G0Z A;  3WQU A;  3K5M A;  1D9F A;  1NM1 A;  4BRP A;  3J7Y P;  5AZJ A;  3F9K A;  4FZX C;  1T44 A;  1SAZ A;  4A62 A;  4IFV A;  3C7N B;  3WNE A;  4I6M A;  5AQJ A;  1TKT A;  5AQN A;  3I0S A;  3QBW A;  1Q9X A;  3PY8 A;  4MQ3 A;  3LDS A;  5E41 A;  2G8K A;  1HJO A;  3AVM A;  3DRP A;  3SAG A;  4GVM A;  4CGH A;  4WFB L;  2NRT A;  2ASO A;  1SZ2 A;  1GLJ O;  2E6M A;  2HF3 A;  3DLR A;  3G71 N;  3FZK A;  1IG8 A;  1VQN N;  4F2R A;  3OTO K;  3HVT A;  1JLC A;  4FWQ A;  5GIP A; 
#chains in the Genus database with same CATH homology
 4CEZ A;  2HHS A;  3NAE A;  1HYS A;  3MEE A;  4FJI A;  3LP1 A;  3OY9 A;  4CJW A;  1A5V A;  4FLT A;  1WSF A;  4B9S A;  4N41 A;  3ZT2 A;  3TAP A;  5FRM A;  1XWL A;  4DMN A;  2X6S A;  1NK9 A;  4I2P A;  1NOZ A;  4CFC A;  2OPQ A;  3IAY A;  3LWL A;  3TAF A;  1SL0 A;  4KPY A;  3HP9 A;  1S1V A;  1TK5 A;  1ITG A;  1W9H A;  2DFH A;  2HHW A;  5DMR A;  4Z4H A;  4EZ9 A;  1HPZ A;  1C0T A;  3HPO A;  1A5W A;  4UQG A;  2RKI A;  1KVB A;  2ATQ A;  3K5L A;  4OKE A;  1BIZ A;  3RWU A;  3U6F A;  3VQB A;  4KB1 A;  3K57 A;  3PO5 A;  2GBZ A;  1NK8 A;  1WAF A;  4Q5V A;  3L2R A;  4AIL C;  1QHT A;  5JS1 A;  3OYK A;  3OS0 A;  1BQN A;  1SL1 A;  3KJV A;  4M45 A;  1RBS A;  1RT3 A;  4NYN A;  4FJH A;  4I9Q A;  3CFR A;  4Y1D A;  4DTU A;  4DTJ A;  3AO5 A;  4LSL A;  3DRS A;  3ZCM A;  2OZS A;  4H4O A;  3QEW A;  3SUN A;  2G8F A;  4FJM A;  1VK0 A;  2HNZ A;  2IS3 A;  4BE2 A;  4ICL A;  4FM1 A;  4BDY A;  4ELU A;  1RTJ A;  1MU2 A;  3DOL A;  3VQ8 A;  1D9D A;  3VQQ A;  4C8K A;  4NCG A;  5CY4 A;  1KSP A;  4BWM A;  3AVN A;  1S9G A;  4CJR A;  3OYF A;  1RTD A;  1SKW A;  1QSY A;  1U4B A;  1BI4 B;  1VRU A;  2IDO A;  3KIO A;  4OKJ A;  5JS2 A;  5C24 A;  1VSK A;  3MEC A;  3KK3 A;  3NGI A;  5KI6 A;  5HRP A;  2JGU A;  3EYZ A;  3LZI A;  4DF8 A;  2F8S A;  2HVI A;  2ETJ A;  1VSH A;  4F3O A;  1K6Y A;  3NF6 A;  4FYD A;  3ZT4 A;  3OYM A;  4AHU A;  3BGR A;  4Z4G A;  1C0U A;  1GOB A;  3C95 A;  1UOC A;  3AVB A;  1HNI A;  5J2P A;  4E7L A;  4M3Y A;  1TKX A;  1EX4 A;  5CYM A;  3RMA A;  2B4J A;  4KHN A;  4ELT A;  3AA2 A;  4AH9 A;  1S1X A;  4MFB A;  2Z1I A;  3TAB A;  3AV9 A;  4O44 A;  1HMV A;  5KGX A;  4FW2 A;  5KRT A;  3ZT1 A;  3CFO A;  4DS5 A;  3ZSY A;  4DFJ A;  2FBT A;  4LY7 A;  4CF2 A;  1I39 A;  1U04 A;  2B6A A;  3O4Q A;  4CF8 A;  5J2N A;  4CGF A;  4N56 A;  1J5O A;  2HW3 A;  3KLI A;  1HRH A;  1TKZ A;  3KK2 A;  3NH0 A;  3HPH A;  3M8R A;  1JLA A;  2HVH A;  3VQC A;  3OYG A;  4E7K A;  2Z1J A;  3NH2 A;  1TAU A;  3RRG A;  1LAV A;  1KLN A;  1UAX A;  1ZBH A;  4Z4I A;  3NE6 A;  5HBM A;  2JLE A;  3TAM A;  3HM9 A;  1LW0 A;  1VSF A;  2DTU A;  4HVJ A;  3D45 A;  4DQR A;  3SUO A;  4FJG A;  1SUQ A;  2W42 A;  4DTN A;  4I9L A;  4DQP A;  4KTQ A;  4JS5 A;  3SPY A;  4OGE A;  1XHZ A;  1L5U A;  4Z4F A;  4E1M A;  1B92 A;  1JXE A;  1NK4 A;  2HHU A;  3KLE A;  3O3G A;  4AHC A;  4DLE A;  3V9Z A;  2X78 A;  4IG0 A;  1W0H A;  2ZE2 A;  3V6D A;  4M3U A;  4B9M A;  3AVK A;  1WSG A;  1ZBU A;  2IC3 A;  1JXB A;  1TGO A;  3HVR A;  2IOC A;  1CLQ A;  3AVI A;  3OYD A;  3MEG A;  2A1S A;  3O3H A;  1NK7 A;  3V81 A;  3TAG A;  2HHT A;  1NK6 A;  4OKK A;  2G8W A;  1ASU A;  1JL1 A;  3A2F A;  3KKS A;  2FBV A;  3PO4 A;  3SUP A;  1RDB A;  3OYB A;  1LV5 A;  4OPJ A;  1IG9 A;  4CJK A;  1IO2 A;  1X1P A;  2BE2 A;  2QXF A;  4QAG A;  1REV A;  1JLG A;  4DSF A;  3ZSX A;  3PV8 A;  4KI4 A;  3D0P A;  4FLY A;  4CCH A;  1RBT A;  4FJN A;  1VSJ A;  4W5R A;  3CM6 A;  1GOC A;  3V9W A;  1RBR A;  4KRE A;  4KV8 A;  3I8D A;  4DF4 A;  3B6P A;  4IKF A;  4CHN A;  4CHZ A;  3P83 D;  4K8X A;  3HJF A;  1YT3 A;  1C6V A;  4CK1 A;  4PUO A;  4OJR A;  1LW2 A;  3LPT A;  4F2S A;  4DQS A;  3AVJ A;  1YVU A;  4FJ5 A;  3SNN A;  3QIN A;  1RDC A;  3HXM A;  3E01 A;  3T19 A;  3V4I A;  1WSE A;  3RRH A;  1T8E A;  4KHS A;  5CYQ A;  2FBX A;  4CHQ A;  2HHX A;  3S3O A;  4H4M A;  3PUF A;  1NJX A;  4KHY A;  4W5O A;  1TK8 A;  2QKK A;  5KTQ A;  2XRI A;  4CEF A;  3P5J A;  3OYA A;  1C1A A;  4FW1 A;  2KZZ A;  4OVL A;  4CJ3 A;  2KFZ A;  5DK5 A;  3DYA A;  3SZ2 A;  2AJQ A;  4R5P A;  3SUQ A;  4KTZ A;  4DTR A;  4CIG A;  1B9F A;  4CJ4 A;  3SPZ A;  2D0B A;  3AA3 A;  1QS4 A;  1BHL A;  3LZJ A;  2Y1J A;  1TKD A;  2RN2 A;  1QSS A;  2XO7 A;  5T7B A;  4FJJ A;  4LH5 A;  3PX4 A;  4IBN A;  3VQD A;  4E7J A;  1HJR A;  4DTM A;  1FKO A;  4B9L A;  5HRO A;  2F96 A;  3MXJ A;  4FJX A;  4KHU A;  3KLF A;  4I2Q A;  4FLU A;  2D5R A;  1Q8I A;  4FLV A;  5I42 A;  3IS9 A;  1RT5 A;  3JYT A;  4CGI A;  1U45 A;  4ID5 A;  2P5G A;  4CJ5 A;  3AO4 A;  3SQ1 A;  3LPU A;  2YKM A;  1ZBL A;  3VA0 A;  3HK2 A;  1L3S A;  4AHV A;  2DFE A;  3KLG A;  4FLX A;  1EET A;  2Z1H A;  2BGG A;  2G8I A;  4B9U A;  1VRT A;  1VSL A;  1VSD A;  4BWJ A;  2GV9 A;  3CG7 A;  1TAQ A;  2IGI A;  4PA1 A;  1U47 A;  1T05 A;  3TR8 A;  4M3X A;  4QOZ B;  3QLH A;  3QNO A;  3ITH A;  3K2P A;  2RF2 A;  3TWH A;  2VWJ A;  4F4K A;  4W5N A;  1RCH A;  1S5J A;  1C1B A;  4CJS A;  4CJF A;  1U49 A;  4DSK A;  2VG6 A;  3RTV A;  3SV3 A;  2HHV A;  3OVN A;  4BE0 A;  5HRR A;  1RBU A;  1XHX A;  1XC9 A;  1YTU A;  2ITG A;  4XIU A;  1EXQ A;  1J53 A;  4CGG A;  1Z25 A;  3AA5 X;  4HHT A;  1SKS A;  3VQ9 A;  1HYZ A;  1IKW A;  4KO0 A;  3QNN A;  4NCA A;  3ZSQ A;  2ZD1 A;  4DTO A;  4N76 A;  1BCO A;  3WNH A;  3V9U A;  1IH7 A;  1LWF A;  4DFK A;  3MED A;  3NFA A;  4RW6 A;  4O0I A;  1FXX A;  4FM0 A;  5J2Q A;  4YNQ A;  3TAE A;  4E0D A;  5SZT A;  4FLW A;  4K8Z A;  4C8M A;  2F8T A;  1HNV A;  3NBP A;  2KTQ A;  1B9D A;  4PQU A;  1JL2 A;  3DLH A;  2WOM A;  3M8Q A;  1CZB A;  3QIP A;  3K59 A;  4DS4 A;  1BIS A;  1RDD A;  2P1J A;  1TV6 A;  3AO1 A;  4CJL A;  1KFD A;  1A5X A;  1BGX T;  2FC0 A;  4B08 A;  3T1A A;  4CJQ A;  3S9H A;  2NUB A;  3ZSW A;  4DWI A;  4CIF A;  3LP3 A;  4DQI A;  1RTI A;  2YKN A;  3AVL A;  2RPI A;  4OGC A;  3QER A;  4ELV A;  1RT4 A;  2I5J A;  3MXI A;  1C0M A;  4KB0 A;  2E6L A;  3S3N A;  2YNI A;  3K5O A;  3OJS A;  3V1Q A;  3THV A;  3UIQ A;  1JLQ A;  3LAM A;  1RT6 A;  4LD0 A;  1DTQ A;  4CJV A;  4DU3 A;  3RMD A;  1QTM A;  2OZM A;  3HO1 A;  4CF9 A;  4DLG A;  4NYF A;  3L2U A;  1KFS A;  3L3V A;  1HYV A;  4M42 A;  4CJU A;  2BDP A;  3AVF A;  3SQ0 A;  1NK0 A;  4YFU A;  4FK2 A;  1JKH A;  3VQP A;  4CHO A;  1RNH A;  3LAL A;  3OYJ A;  1T03 A;  3DI6 A;  2A1R A;  2P5O A;  4CEE A;  2KW4 A;  1WNS A;  4J2B A;  3RMB A;  3CQ8 A;  4CJE A;  3QEI A;  2QKB A;  1VSI A;  1QE1 A;  1ASW A;  4BDZ A;  2XY5 A;  4OPK A;  4DQQ A;  4KAZ A;  3AVC A;  4RW7 A;  5KRS A;  3OYC A;  5CZ2 A;  1WN7 A;  4CGJ A;  4JS4 A;  5HP1 A;  3TAQ A;  1KCF A;  3CYM A;  4KKO A;  1BQM A;  4FZZ A;  3O4N A;  3ZSV A;  4DTP A;  3SQ2 A;  3VQE A;  4BAC A;  2OYQ A;  4KTW A;  1O1W A;  4DSE A;  3L2W A;  4FK0 A;  3DM2 A;  4CHP A;  4WE1 A;  5I3U A;  1ZBF A;  1VSM A;  3DLE A;  2FBY A;  3HT3 A;  2G8U A;  4CGD A;  1IKV A;  3SCX A;  1NK5 A;  1Z26 A;  2KFN A;  4E89 A;  1L3T A;  3QES A;  3L8B A;  1IKX A;  3V1O A;  3H08 A;  1N6Q A;  2O4G A;  1UA0 A;  2OA8 A;  2GUI A;  3DLG A;  3DRR A;  4H8K A;  4C8O A;  4HUF A;  4CFD A;  4KFB A;  4CER A;  4KHQ A;  5J1E A;  4FJ8 A;  1JLF A;  3AA4 A;  5KGW A;  4CEA A;  2WON A;  1WSJ A;  3KK1 A;  4BE1 A;  1D8Y A;  4NCB A;  1RBV A;  3AO3 A;  3DLK A;  5SWM A;  1ZBI A;  1J9A A;  3NHG A;  3V9X A;  4FJ7 A;  1CXU A;  5EU7 A;  1VSE A;  3SI6 A;  1Y97 A;  3SQ4 A;  4W5T A;  3S3M A;  2DFF A;  4IDK A;  3NH1 A;  1TL3 A;  3VQA A;  4AHT A;  4FM2 A;  3T3F A;  3VA3 A;  3LP2 A;  1RT7 A;  4I7F A;  4DG1 A;  4Y1C A;  5CZ1 A;  3VQ4 A;  3LAN A;  4FXD A;  1NKC A;  3VQ5 A;  5K14 A;  3LWM A;  1U48 A;  4DSJ A;  1BCM A;  3ASM A;  4O55 A;  1KRP A;  2PYJ A;  1S9E A;  3OYE A;  2EX3 A;  4CEC A;  4M3T A;  2YNH A;  4TSX A;  1EP4 A;  2HNY A;  3AVH A;  4IG3 A;  1SV5 A;  3V1R A;  3L2Q A;  2PZS A;  3NGY A;  4M3R A;  1LAW A;  4M3Z A;  4O0J A;  4IFY A;  3P1G A;  4GMJ B;  4HUE A;  1ZYQ A;  3ZT3 A;  3I0R A;  4J2A A;  3DOK A;  1TL1 A;  1NKB A;  4CF1 A;  3IRX A;  4LSN A;  3LAK A;  3TAN A;  3L3U A;  1L3V A;  1S1U A;  3VN5 A;  2G8V A;  1KLM A;  4RW4 A;  4CK3 A;  3DMJ A;  3VQ6 A;  4KHW A;  4DTX A;  4DU1 A;  3OYH A;  4DSI A;  3QET A;  2VG7 A;  5HRN A;  1DTT A;  4OLB A;  1S1T A;  4F8R A;  2EHG A;  2QK9 A;  2YNF A;  4E19 A;  4E3S A;  2KZM A;  4FK4 A;  3KLH A;  3VQ7 A;  3AVA A;  4DTS A;  4QCL A;  1WAJ A;  5HLF A;  4CFA A;  3SV4 A;  3MAQ A;  1NJW A;  3TAR A;  2OPP A;  3ULD A;  1S1W A;  3U3Y A;  1IKY A;  4CJT A;  4LH4 A;  4M41 A;  2O4I A;  3FFI A;  2PY5 A;  1Q9Y A;  2HHQ A;  1UA1 A;  2YV0 X;  2KQ2 A;  3OYL A;  2HMI A;  3V9S A;  1QSL A;  1HQE A;  3M8P A;  4C8L A;  2VWK A;  1RIL A;  3QIO A;  5FRO A;  3CM5 A;  4CIE A;  2BAN A;  2IAJ A;  3ZSZ A;  4CEQ A;  2Z1G A;  3BDP A;  4Z0U A;  1D5A A;  1JLE A;  3C94 A;  3OS1 A;  4HCC A;  4O4G A;  3ZT0 A;  2E4L A;  3OS2 A;  4ZTJ A;  3B6O A;  4JRP A;  1L3U A;  4FCY A;  2HND A;  3NCI A;  4HCB A;  3NF7 A;  1I3A A;  3NF8 A;  1QQC A;  3QO9 A;  4CF0 A;  3ZSO A;  5D3G A;  4O5B A;  3EY1 A;  3OYI A;  3PX6 A;  1BL3 A;  1HQU A;  1RTH A;  3C6T A;  4FJL A;  2DY4 A;  3RR7 A;  2ZQB A;  4HUG A;  4B3O A;  1X9M A;  3K58 A;  1RDA A;  1SL2 A;  3KD1 E;  4EZ6 A;  4ID1 A;  1RT1 A;  3L2V A;  3PX0 A;  4F3T A;  4CJP A;  3KD5 E;  3QEX A;  4Q0B A;  3KTQ A;  1XI1 A;  1G15 A;  1R0A A;  4JLH A;  1CXQ A;  4B8C A;  1T7P A;  4E1N A;  5HRS A;  4B8A B;  3M8S A;  4N47 A;  1WSI A;  2XY8 A;  1NKE A;  4KI6 A;  1YTA A;  3HL8 A;  3SYZ A;  4Z4C A;  4B9V A;  2VG5 A;  3HYF A;  3QEP A;  1FKP A;  1LWC A;  1KVA A;  1UWB A;  2XHB A;  4PY5 A;  4E7H A;  2PYL A;  2Q3S A;  4RG8 A;  3JSM A;  3EZ5 A;  4AHS A;  2Y1I A;  3G0Z A;  3K5M A;  1D9F A;  4B9N A;  4DFP A;  4RW9 A;  2YHB A;  1FK9 A;  3WNF A;  4Z4E A;  1WSH A;  3F9K A;  1X9W A;  3DLB A;  4FZX C;  4JRQ A;  3QEV A;  3HPG A;  3LP0 A;  3K5N A;  2G8H A;  1NJZ A;  3RMC A;  1JLB A;  4G1Q A;  3U3G A;  2OPR A;  4IFV A;  1X9S A;  4FZY A;  4PWD A;  4N5S A;  2LSN A;  1TVR A;  1ASV A;  1KTQ A;  2YNG A;  3WNE A;  4CEB A;  4FLZ A;  3O3F A;  3F73 A;  3WNG A;  1TKT A;  2D0C A;  3AO2 A;  5J2M A;  1TK0 A;  3I0S A;  1BI4 A;  3ZSR A;  4CE9 A;  4DSL A;  1Q9X A;  4C8N A;  3IG1 A;  3PY8 A;  4M3W A;  4CED A;  2R7Y A;  4FJ9 A;  3HST B;  3KKR A;  1J54 A;  4MQ3 A;  5FRN A;  3AVG A;  3HP6 A;  4W5Q A;  4CHY A;  4DU4 A;  1F21 A;  4FJK A;  3LDS A;  4RW8 A;  5E41 A;  4ZTF A;  2G8K A;  4BDP A;  1EKE A;  2YHA A;  4CES A;  4FVM A;  3MXM A;  3AVM A;  3NDK A;  3SJJ A;  2HB5 A;  1S6P A;  3OJU A;  3DRP A;  4OLA A;  4GVM A;  2XY7 A;  4CGH A;  3NF9 A;  1S6Q A;  2P51 A;  4B9T A;  2X6N A;  2OPS A;  4GW6 A;  4E7I A;  3RR8 A;  1LWE A;  1BIU A;  1WLJ A;  1NJY A;  4EP5 A;  3OYN A;  1NOY A;  3CFP A;  1GOA A;  2E6M A;  3ALY A;  3DLR A;  4CFB A;  1DLO A;  1RT2 A;  2B5J A;  3ISN C;  5C42 A;  4ZHR A;  4KRF A;  3NGZ A;  5FDL A;  4DFM A;  1KVC A;  2X74 A;  4EP4 A;  3TI0 A;  2XY6 A;  1SKR A;  3C6U A;  1CZ9 A;  4CK2 A;  4F2R A;  4J2D A;  2D0A A;  4CEO A;  1C1C A;  1N5Y A;  5C25 A;  3G10 A;  3HVT A;  4HTU A;  1JLC A;  4L8R B;  4J2E A;  4AHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...