4CGFA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 56
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cgfA00
4CFDA 1HPZA 4CFCA 1RT2A 4O44A 3TAMA 3AO1A 4CGFA 4BE2A 3LPTA 3SUQA 2VG7A 1S5JA 2ITGA 3HSTB 5HP1A 3MXIA 2IGIA 1HQUA 4FZYA 1O1WA 4OGEA 3OYAA 4PA1A 4Q0BA 3PUFA 4Q5VA 1JLGA 3OS1A 3SUOA 1L3TA 1NK7A 3IS9A 4DQPA 4H4OA 3HXMA 3DLHA 4M3RA 3WNFA 4FJIA 1CLQA 3LDSA 3HP9A 1HYVA 4AH9A 3L8BA 1IKVA 1JKHA 4DQSA 4DU1A 2P1JA 2XY5A 2XY7A 2HNDA 4DSLA 4CGDA 2FC0A 1IO2A 3VQ5A 1Z26A 1VRTA 3UIQA 5FRMA 4YNQA 1RBVA 1BQNA 5E41A 1WSFA 4DF8A 3QEPA 1BGXT 2ATQA 3M8QA 3NDKA 4BE0A 3LWLA 4M3XA 3VQ7A 3HPOA 1IKYA 1IKXA 3NGIA 4F3TA 2KZZA 4F3OA 4DFJA 5FDLA 1FK9A 3SPYA 1R0AA 3HVRA 4ELUA 1RTDA 3HL8A 4CJVA 2KTQA 1U48A 2ZD1A 2JLEA 2OZSA 2KFZA 5KI6A 1NJWA 3LZJA 4FJXA 4JLHA 4B9MA 4FJ5A 1VSDA 4LH4A 3VN5A 4FLUA 3KJVA 3DMJA 4ELTA 4Z4CA 4FJ7A 4DWIA 2A1SA 1C0MA 1LV5A 4LSLA 3ZT1A 4KRFA 5KTQA 3LP0A 1RDBA 3WNGA 4BDPA 2HVIA 1S1UA 4HCBA 1XHXA 4FJJA 5CZ1A 3HO1A 3HM9A 3OYEA 3G0ZA 3QERA 3DOKA 1SL0A 1QS4A 5J2QA 4N41A 3AVKA 3AVGA 4CEDA 4G1QA 4FW2A 2QKKA 1RT5A 3NF8A 3F9KA 3NF6A 1LAVA 4OPJA 2HHQA 3CM5A 3KLEA 3MEGA 3MEEA 4IG0A 4KKOA 3CG7A 1NK4A 3EY1A 2GBZA 1T8EA 3QETA 1JXEA 3SUPA 1GOCA 4HCCA 1D9DA 3M8SA 3WNEA 3KK2A 1T7PA 4IKFA 3HVTA 4QCLA 3LP2A 3U3GA 2YHBA 1C1BA 3IAYA 4Z4IA 3KTQA 4I7FA 3ZT3A 3DLEA 4DG1A 3F73A 1VSLA 3ITHA 1VSFA 1LWFA 3O3HA 3AO5A 3T19A 4IFYA 1QSYA 2HHSA 3AA2A 3VQBA 4Z4EA 1UOCA 4DTUA 3V9SA 4FVMA 2AJQA 4DTNA 4FM1A 2G8FA 4E7IA 4K8ZA 4FK0A 3L2RA 1VSJA 1U47A 3SNNA 1G15A 4FLYA 1WSIA 2PYLA 1KFDA 5K14A 4HVJA 3TARA 3SCXA 4KB1A 1BISA 1UWBA 1CZBA 3M8RA 4AHRA 1RT6A 3SQ1A 3ZT0A 3OS0A 5FROA 3RMBA 5C25A 3RRGA 4JS5A 3V9ZA 1ZYQA 1TVRA 4FJNA 4FXDA 4E19A 4Z4GA 4IDKA 2ETJA 3NH0A 4DTSA 2IS3A 4KV8A 3K5LA 3LAKA 3OY9A 4CJPA 1W0HA 1J9AA 1JLCA 1WAJA 2EX3A 4FLWA 4DFPA 1BI4A 1RDAA 1IH7A 4WE1A 5C42A 1TKDA 2DY4A 4NCBA 3NFAA 1XI1A 4DMNA 3BDPA 4F4KA 4CHOA 1HNIA 2YHAA 3DRRA 4W5QA 3OYJA 3OJSA 4FM0A 2X6SA 5DMRA 2YNFA 3FFIA 1NK9A 3ALYA 4PY5A 3AVLA 4BE1A 3ZSQA 1S1TA 1TV6A 1RTJA 2WONA 4MFBA 4TSXA 1U49A 1JLFA 2E4LA 2HMIA 3H08A 4DS4A 1WN7A 4M3YA 3I0SA 2YNGA 4B08A 4DTOA 3DLBA 1HMVA 4DS5A 4W5TA 5HBMA 2XY8A 1KLMA 4PQUA 3ZSRA 2VG5A 3PX0A 4OVLA 4KHNA 3C6UA 3MEDA 3KLIA 3AA4A 1BCMA 4FJGA 4CJUA 4GMJB 2O4GA 4BWJA 1JXBA 3TAPA 2ZQBA 1KRPA 4EZ9A 1UAXA 3RMAA 3AA3A 1SUQA 4GVMA 3V1OA 1EXQA 3CFOA 4OPKA 1L5UA 2OPPA 2HHUA 3V6DA 1Q9XA 5I42A 1S6QA 1U04A 4CJKA 1NK6A 1BL3A 1L3UA 3AVBA 4B3OA 2LSNA 4CJ4A 3K5OA 4BDZA 1UA1A 1X9SA 3DLGA 1SKWA 2BGGA 2F8SA 3TI0A 2KZMA 1C0UA 3ZSOA 3KK1A 4JRPA 2F8TA 3O4NA 4E7JA 1LW0A 4I9QA 4FJ8A 3A2FA 4CF9A 4DLEA 4CJEA 4O4GA 3V9UA 1J54A 2Z1IA 4CEOA 1NK5A 3AVCA 4CIFA 4FLTA 4E7LA 1NJZA 4CESA 3DOLA 4O0IA 3D0PA 1WSHA 3DM2A 3P5JA 1IKWA 3ZSYA 1HQEA 4E89A 3PY8A 4Z4FA 1B92A 4E1MA 2P5OA 1RDDA 2B5JA 2VWJA 4F8RA 1QE1A 4B8CA 2HNZA 3LANA 4AILC 4B9TA 2XHBA 3SZ2A 4DLGA 2GV9A 3HYFA 4ZHRA 4DSKA 4DQRA 3MXMA 3LP3A 3NCIA 4M45A 4RW9A 3OYLA 4Z4HA 2Q3SA 4QOZB 1D9FA 4OGCA 1S6PA 3IRXA 1LWCA 2OPSA 2YKMA 3QO9A 5SZTA 4DSIA 1ZBIA 4FZXC 1TKXA 1VSIA 3ZSVA 4CHNA 3PX6A 4J2BA 3U3YA 1HNVA 4N47A 3OYHA 3KIOA 2G8HA 2YKNA 5HRRA 4KTQA 4EP4A 2RPIA 4BWMA 3ISNC 4OJRA 2A1RA 4AHSA 3ZSZA 4KHWA 1KLNA 1MU2A 3NF9A 1QQCA 3SV3A 4AHUA 1KSPA 3DRSA 4B8AB 2IC3A 4E7KA 3O3FA 2E6LA 5CYQA 1W9HA 4RW6A 3PV8A 3QIPA 4ZTJA 4KI4A 1YVUA 5CYMA 3VQDA 4E1NA 2D5RA 4KHUA 2X6NA 3AVIA 3ZCMA 2Z1HA 4M3WA 3K57A 1ITGA 1JLAA 4CHQA 2O4IA 3AO4A 4CHPA 5KGWA 4CEAA 4CJQA 3OYGA 3IG1A 1RTHA 3TWHA 1NOYA 2HHWA 2KW4A 4DSEA 4CK1A 3V1RA 3V81A 4I2QA 1KVAA 3JYTA 2PZSA 4I9LA 3LPUA 3OYDA 4CJRA 1JLQA 3K59A 3OVNA 1CXUA 4RW7A 5D3GA 3L3UA 4LSNA 3SQ0A 3VQAA 4CJWA 5JS2A 4NCAA 1TAUA 1B9DA 1JLEA 4AHTA 4HTUA 5DK5A 1QSLA 2FBTA 4CEEA 1RT7A 1ASWA 3CQ8A 4CCHA 4KI6A 1YTAA 3LWMA 3NE6A 5T7BA 1C1CA 3S3OA 3AO3A 3KD1E 3O3GA 4BACA 3NGYA 4M3UA 3OYMA 1BHLA 3MXJA 5J2PA 1UA0A 3T3FA 4CFAA 4N76A 1RILA 4H4MA 3RR7A 2QKBA 1VK0A 1IG9A 1LWEA 3BGRA 3S9HA 4FK4A 3O4QA 3L3VA 1DTTA 2G8KA 2OPQA 1S1VA 3B6OA 4M42A 4KHYA 2FBXA 3VA3A 3SQ4A 2BDPA 1CXQA 4DQIA 4W5NA 1JL2A 4Z0UA 1FKPA 4PUOA 3EYZA 1C0TA 2HHVA 2W42A 4J2EA 4DSJA 2YV0X 4QAGA 4KAZA 2WOMA 2RN2A 3VQ8A 4CFBA 4H8KA 5HRPA 4YFUA 3QNNA 4CF2A 1LW2A 4RW8A 3TAQA 3D45A 3RRHA 4CJ3A 2NUBA 1NKCA 3K58A 2XO7A 3HPGA 4FLVA 2HVHA 1K6YA 1J53A 1F21A 1S9EA 3SUNA 4CJFA 4W5OA 4LD0A 3C95A 3ASMA 3CM6A 4OKKA 1BIZA 4CEQA 4B9UA 1BQMA 1XWLA 2RF2A 3KKSA 3RR8A 1KVBA 1TKZA 1REVA 3DI6A 3HPHA 3ZSXA 3OYCA 4DQQA 1GOAA 1RBUA 3LP1A 3SV4A 1Y97A 1WSGA 3QEWA 3V4IA 4J2AA 5CY4A 1ZBHA 2FBVA 3HP6A 3ULDA 1ASVA 4CECA 3P1GA 5J2MA 4KPYA 1LAWA 4LH5A 5CZ2A 3VQ4A 3QESA 1L3VA 4C8KA 4KREA 1DLOA 5HLFA 1NJYA 5KGXA 2OA8A 1CZ9A 1WSJA 4FM2A 2HHXA 3KLHA 4N56A 4ELVA 1GOBA 4CGGA 2IOCA 3TABA 2G8VA 3EZ5A 1SL2A 4B9LA 2D0AA 1Z25A 2EHGA 4KFBA 3LALA 4AHVA 4CF0A 4DU3A 4HUFA 3SPZA 2G8IA 4C8OA 2HNYA 1HRHA 4CF8A 3QINA 1QTMA 4KHSA 1B9FA 3VQCA 4O55A 1EX4A 1KTQA 3KLFA 3KK3A 3QEIA 3RMCA 3OYIA 4N5SA 3OYBA 2DFHA 1A5XA 4DFMA 1RCHA 4OKJA 4FLXA 3NF7A 2R7YA 1WLJA 1Q9YA 1RBSA 2IDOA 2I5JA 1ZBUA 4M41A 1HJRA 1NKBA 4OLAA 4CEBA 3MAQA 4GW6A 4L8RB 1KCFA 4FJ9A 4HUEA 3AV9A 3NAEA 4F2SA 4UQGA 4DSFA 1VSMA 2FBYA 3E01A 4CJSA 3OYFA 4HUGA 2P5GA 3JSMA 3DLKA 4OKEA 1QSSA 3QIOA 2KQ2A 1SKSA 3OYNA 1X9WA 1EP4A 3AVJA 1ZBLA 2HW3A 3SI6A 2D0BA 4CHZA 1KFSA 1I39A 3M8PA 4CIGA 2OYQA 3V9XA 1TL1A 3TR8A 3DYAA 3QEVA 3AVFA 3KD5E 1RNHA 3K5MA 1J5OA 3AVAA 1TGOA 2Z1GA 4KHQA 3NGZA 3OYKA 1NK8A 4HHTA 3AO2A 4DF4A 4M3ZA 4CE9A 1TK8A 4PWDA 2XY6A 1BI4B 4J2DA 5KRTA 3SQ2A 3T1AA 5J2NA 3KKRA 3VQ9A 4FW1A 3AVHA 3HJFA 1VRUA 3L2WA 2F96A 3DRPA 4FLZA 3RWUA 2Z1JA 1RT1A 1S9GA 4IFVA 1X1PA 3L2QA 4B9NA 4F2RA 3NHGA 1BCOA 4C8MA 4DTPA 2PY5A 4LY7A 3L2VA 1RBRA 3U6FA 4B9SA 4M3TA 4CJ5A 4CGJA 3I8DA 1TKTA 3OJUA 4FJMA 4NYNA 5I3UA 1JLBA 2DFFA 2X78A 4DTRA 2Y1IA 2ZE2A 4R5PA 2E6MA 3OS2A 4FJLA 1NOZA 2BANA 2QXFA 5KRSA 3G10A 3PO4A 3TAEA 4DTXA 1QHTA 3B6PA 3NH1A 1N5YA 3HT3A 2DTUA 4ID5A 1SL1A 1EKEA 1TK5A 2DFEA 1NK0A 1T03A 1VSEA 2HHTA 3RMDA 1A5WA 3CYMA 4IBNA 3LZIA 3QLHA 2B6AA 4BDYA 4FZZA 1JL1A 1C1AA 2VWKA 1TK0A 2PYJA 4NYFA 1FXXA 2D0CA 3SJJA 2KFNA 1HYSA 1D8YA 3DLRA 4JRQA 1NKEA 3K5NA 1XHZA 4K8XA 3QEXA 4CK3A 1SV5A 3I0RA 4OLBA 2HB5A 2G8UA 4KTZA 2OPRA 4DTMA 3VQPA 4CF1A 4CJTA 4DFKA 1L3SA 1S1WA 4ID1A 2P51A 1EETA 1TAQA 3VQ6A 2Y1JA 4EZ6A 1D5AA 1RDCA 4FK2A 2X74A 4C8LA 1RT3A 3ZT2A 4FJHA 5SWMA 1BIUA 1I3AA 1WAFA 3P83D 4CEZA 1YT3A 2OZMA 1SKRA 3HK2A 1ASUA 3VQEA 4CGHA 3SYZA 1Q8IA 3AVMA 3ZSWA 2QK9A 3TAFA 4AHCA 3CFPA 1U4BA 3L2UA 4C8NA 5HRNA 3CFRA 1WSEA 3PX4A 4EP5A 3NBPA 3PO5A 4JS4A 3V1QA 3WNHA 4IG3A 1KVCA 2YNIA 2B4JA 1YTUA 1ZBFA 3QNOA 1VSKA 1WNSA 1RBTA 1T05A 3K2PA 4NCGA 2IAJA 5HROA 1DTQA 2GUIA 3LAMA 5FRNA 4KO0A 3AA5X 4W5RA 1HYZA 4CEFA 4DU4A 2VG6A 5J1EA 2G8WA 4O0JA 2JGUA 4I2PA 4CIEA 3KLGA 1U45A 4E0DA 4FCYA 4KB0A 3S3NA 3TAGA 4FYDA 2BE2A 4ICLA 2RKIA 4MQ3A 3NH2A 4CHYA 5C24A 3ZT4A 4DTJA 1A5VA 5HRSA 1RTIA 4E7HA 4CGIA 3VA0A 3MECA 1S1XA 4FJKA 1VSHA 3THVA 3AVNA 4CERA 3RTVA 4ZTFA 3S3MA 3C6TA 1RT4A 4CJLA 1X9MA 4RW4A 4Y1DA 4RG8A 2XRIA 5EU7A 1C6VA 4B9VA 3V9WA 4O5BA 3VQQA 3TANA 1NJXA 4CK2A 1XC9A 1N6QA 2YNHA 1FKOA 3C94A 4E3SA 4XIUA 4KTWA 4Y1CA 5JS1A 1TL3A
chains in the Genus database with same CATH superfamily
5JICA 1HPZA 1VQ9N 4KH4A 3LPTA 2VG7A 1XNQK 3HOTA 3MXIA 3M1FA 1VQ7N 1O1WA 3PUFA 3OS1A 3SUOA 1L3TA 3AAPA 3O1WA 3QMLA 3AARA 4DQPA 1BA1A 4H4OA 3DLHA 1CLQA 4K43A 3VEOA 1HYVA 2F9WA 4DSLA 1VQKN 2HNDA 2VQFK 1IO2A 2P9KB 3VQ5A 1VRTA 3UIQA 3THYA 5C0YA 4NLBA 3N4QA 4DF8A 1WSFA 3LWLA 3SJHA 4M3XA 3NGIA 1IKYA 1IKXA 4DFJA 3HI0A 5A2QO 4ELUA 2KFZA 2JLEA 2OZSA 5KI6A 4FJXA 1YF5L 2UUBK 3BEXA 4BRFA 4JI6K 1ZBSA 4FJ7A 4B3RK 1C0MA 5FPMA 3LP0A 1RDBA 4BDPA 4FJJA 1MWKA 1GLCG 1DKGD 3SAHA 3QERA 1GLJO 4PKIA 3ENBA 4A61A 4CEDA 4GV9A 3NF6A 3G25A 4XEIA 1E4GT 5BPMA 3MEGA 3MEEA 4IG0A 3R8EA 3QETA 2QWPA 3KK2A 4IKFA 1V4SA 3LP2A 1C1BA 4Z4IA 1HNZK 3O3HA 1DEJA 3BF3A 4DTUA 4DTNA 4K8ZA 2QEXN 4E7IA 3C6HA 3QDKA 2PYLA 4HVJA 4CZLA 3F9MA 3RRGA 5FROA 3RMBA 4WFNL 1ZYQA 4E19A 5DM6L 5BPNA 5AQZA 3CJBA 4IOCL 4JI3K 3MK6A 1BI4A 2YJFA 2WC9A 1TKDA 1XI1A 1W97L 3ZYYX 2E1YA 4DMNA 1HNIA 2YHAA 4FM0A 2X6SA 2ITMA 3ALYA 4PY5A 3AVLA 3ZSQA 3Q7BA 1S1TA 4JN4A 2HMIA 4MFBA 4MO5A 1OH7A 4DS4A 3KVGA 1O13A 2YNGA 4DTOA 3W3DA 3DLBA 1HMVA 1Q81O 4PQUA 2FF6A 1YI2N 1K8KA 3AA4A 4FJGA 4GMJB 2O4GA 4BWJA 2H3GX 1KRPA 4BR2A 3SLCA 4EZ9A 5AQFA 2E20A 1W2BM 2HHUA 2NRVA 3LM2A 2GTDA 4CJ4A 4BDZA 4OPAA 4BRGA 2A41A 1LW0A 4DLEA 2I7NA 2F4VK 4CJEA 1JCEA 3V9UA 1J54A 2NZTA 1NK5A 2NLXA 1KAXA 1T6CA 2VYPA 1WSHA 1HQEA 3VTHA 3IUCA 5EY4A 5KQDA 4F8RA 2HNZA 2V51B 4AILC 3K9KA 3SZ2A 4ZHRA 4JK7A 2VCPA 3MXMA 1S72N 4M45A 1ZXOA 5AQIA 5AQWA 4FZXC 1TKXA 1NBWA 4N47A 1VHXA 4KTQA 3VTIA 2G8HA 5HRRA 3U9DA 3VEVA 5AQUA 1Q86O 3ISNC 2A1RA 4KHWA 1KLNA 3NF9A 1QQCA 1P90A 4B8AB 4DV6K 3OHRA 4ZTJA 4KI4A 1YVUA 2QWRA 3AVIA 4M3WA 1ITGA 2W41A 4LF9K 1NMDA 3OYGA 3CCLN 3TWHA 1U2VA 2KW4A 1QQOA 5AQJA 3V1RA 4BR5A 1Q7YO 5KPRA 4I2QA 4YORA 4IJAA 3K59A 3OVNA 3SQ0A 5JLFA 3O1BA 4AHTA 4HTUA 2E5LK 5GAHP 4FWNA 1QSLA 1M90O 3CQ8A 3H1QA 3NE6A 3VESA 5T7BA 3AO3A 3O3GA 3NGYA 1QVGM 3OYMA 1UA0A 3RR7A 1VK0A 3IFRA 1DTTA 2G8KA 2OPQA 4KHYA 2FBXA 3SQ4A 4MO4A 3SMSA 1J6ZA 4Z0UA 1FKPA 4PUOA 3THYB 2HHVA 2W42A 4J2EA 4DSJA 1YITN 4QAGA 2D0PA 2RN2A 3DJCA 3VQ8A 4CFBA 4X62K 3QNNA 1LOTB 3D45A 4CJ3A 2NUBA 1K6YA 1J53A 1F21A 3EN9A 4CJFA 3C95A 2ZJQL 4B9UA 1XWLA 3RR8A 1TKZA 1Z6RA 3LP1A 3QEWA 1R59O 5AQLA 3HP6A 3ULDA 1ASVA 4KPYA 5CZ2A 3QESA 1L3VA 3FE1A 4N56A 3DAWA 3A5LC 4CGGA 1N8RO 1SL2A 3JS6A 2O8EB 2D0AA 2NRWA 3TSPA 4KBOA 3SPZA 2HNYA 1HRHA 4CF8A 4O55A 1RDWX 4OKJA 4ISGA 3ATVA 3HM8A 4FLXA 4KHPK 3OBYA 1RBSA 2QWOA 1KCFA 3PLAA 3AV9A 3U4LA 2HSTA 3WXKA 4DSFA 4F2SA 2FBYA 5TKWA 4CJSA 2D4WA 4DR5K 2IVNA 4CZEA 3JSMA 3A8YA 4K42A 4DCHA 3SBGA 2D0BA 3WT0A 4H0YB 1KFSA 2PBDA 3AVFA 2VWBA 3QEVA 1J5OA 3AVAA 3NGZA 3BP8A 3OYKA 3T1YK 4HHTA 4LC9B 2DPNA 4PWDA 4K25A 1BI4B 2YI1A 3CIPA 1HNWK 4JI8K 2Z1JA 1RT1A 2IVOA 4PL8A 4H5RA 1X1PA 1NNEA 4B1ZA 4F2RA 3CCEN 2PY5A 3U6FA 1KQSM 1TKTA 4O8UA 3OJUA 4NYNA 5I3UA 2ZE2A 4FJLA 4LFAK 4IJNA 4DTXA 1QHTA 3CCVN 3LM9A 1SL1A 1EKEA 3H3NO 1TK5A 2DFEA 1T03A 1VSEA 3J7AP 1A5WA 3CYMA 3LZIA 4BDYA 1JL1A 2WFBA 2PYJA 2FLOA 2HB5A 2G8UA 3IKMA 4KTZA 1VQ4N 4I6MA 2OPRA 4JKFA 4ID1A 4BC5A 2P51A 1EETA 2FXUA 4FK2A 4CI6A 3ZT2A 4FJHA 5SWMA 5HOOA 4CEZA 4ISFA 1ASUA 4CGHA 3WQTA 4BC3A 3ZLJA 4AHCA 3CFPA 5GAEP 3PO5A 4JS4A 2O8CA 3J80O 3SK3A 4DR7K 1WNSA 4LF7K 4NCGA 2GUIA 2AP1A 3C0BA 4KO0A 5BR8K 4W5RA 1HYZA 2G8WA 5C2FA 3FLCO 3QBXA 3TAGA 3S3NA 3NH2A 4IWVA 3ZT4A 5BRFA 1A5VA 4DV5K 5HRSA 4E7HA 2KLAA 3FZHA 3MECA 4G9ZA 4YDUC 3THWA 3THVA 5GAGP 2CH6A 3D6RA 1C6VA 1NGIA 3V9WA 4O5BA 4B3MK 4IO8A 2YNHA 1FKOA 5AQNA 1SL0A 2E88A 4Y1CA 4CZFA 4PL7A 5JS1A 4CFDA 4C1NK 1RT2A 4O44A 4CGFA 4BE2A 1DT9A 1Q18A 1S5JA 2ITGA 5HP1A 4H5VA 2OTLN 4B1YB 1YXQA 4BRMA 5C2DA 4DR2K 4BRPA 3IS9A 3WNFA 5IWAK 3BUZB 3DWLA 3LDSA 3FGUA 5AQMA 4AH9A 2XY7A 3E9PA 1XC3A 4FWLA 3CJ7A 1Z26A 2F9TA 5FRMA 4JI1K 1KAZA 1RBVA 3QEPA 2ATQA 3CC2N 4BE0A 3HPOA 2KZZA 5ADXA 4F3OA 5FDLA 1R0AA 1XNRK 3HVRA 1TUUA 1RTDA 3HL8A 1NJWA 3LZJA 1KAYA 3PIPL 4WFBL 4JLHA 5ELZA 4FJ5A 3QFUA 3KJVA 3DMJA 3THXA 4Z4CA 4ELTA 2HBLA 1LV5A 4JI7K 4LSLA 3ZT1A 4KRFA 1XHXA 3EEQA 3MX5A 3VF2A 3DOKA 3AVKA 4L3QA 4A57A 4FW2A 4R79A 1V4TA 1LAVA 4OPJA 4LF6K 2HHQA 4CZKA 4AF1A 3VEZA 4A2BA 1EWQA 1NK4A 3EY1A 2ZF5O 2GBZA 5M1PA 1T8EA 4JD2A 3VGLA 2ASOA 5M1QA 5H1SQ 3KTQA 4I7FA 3F73A 4J8FA 1VSLA 4BREA 1VSFA 3E9OA 2PFUA 3CHWA 4IFEA 1QSYA 4BC4A 3AA2A 1UOCA 4FVMA 5EXWA 4WCEL 1VSJA 4NO7A 1WSIA 3I55N 4JV5K 4LFCK 3VPZA 4AHRA 1RT6A 3SQ1A 5C25A 4FJNA 3ID8A 4JS5A 3V9ZA 3IDHA 1YAGA 4BVOA 4KV8A 3K5LA 1W0HA 4BQZA 4DFPA 5AQSA 1IH7A 4WE1A 5C42A 2DY4A 4NCBA 3VGKA 3EE8A 4CHOA 5F1XA 3DRRA 4W5QA 3OJSA 3FFIA 1NK9A 1OH6A 1TV6A 1NGGA 3GE1A 3HSCA 5TKYA 4M3YA 3I0SA 3T1HK 4DS5A 2VG5A 4FOIA 3PX0A 4KHNA 2IVPA 3MN9A 1NG9A 4CJUA 2OCEA 2ZQBA 1UAXA 3RMAA 4JEPA 3EO3A 4GVMA 3V1OA 4CZJA 5M1KA 4OPKA 1L5UA 3O9QA 1UA1A 3J8AA 1SKWA 4FWOA 2KZMA 4JRPA 3KK1A 4I9QA 4CF9A 4IZ9A 4I6MB 4CIFA 4E7LA 1GLBG 4BC2A 1T6DA 3DM2A 2QTDA 1IKWA 3ZSYA 4A2AA 1RDDA 2B5JA 3J7YP 3UKUB 4B9TA 4DLGA 4JI2K 2GV9A 4DQRA 2RE2A 3LP3A 1BU6O 3O80A 5C10A 2O8CB 4QOZB 3ZETA 1S6PA 1ZBIA 4DSIA 1VSIA 3PX6A 4C23A 2YHYA 4EP4A 2RPIA 4OJRA 3ZSZA 3SV3A 3CXCM 3O3FA 5CYQA 2O8EA 1W9HA 3JXUA 5CYMA 2D5RA 4KHUA 3THWB 5LY3A 3K57A 4CEAA 1RTHA 1NOYA 4LFBK 2PZSA 4I9LA 5BREA 1JLQA 4CJRA 1XMOK 4RW7A 5D3GA 4NCAA 1TAUA 1JLEA 5DK5A 2FBTA 5C15A 4KI6A 5LL6Z 1C1CA 4BACA 1BWFO 3MXJA 5BPLA 4H4MA 1C0GA 1IG9A 1T44A 1LWEA 3BGRA 4FK4A 3O4QA 3SAGA 3L3VA 4BROA 5GIOA 3B6OA 4M42A 1SQKA 4EFHA 2UYTA 4ILHA 1JL2A 3MWTA 3EYZA 2YV0X 3CJ9A 1LW2A 3HPGA 4CVNE 3WXMB 2OTJN 1S9EA 4W5OA 4UY8O 4OKKA 4CEQA 1BQMA 3I33A 2Q1NA 1REVA 3THXB 3V4IA 4YDUA 5CY4A 2FBVA 3O5BA 2YCHA 4AM7A 2Q36A 5J2MA 3VQ4A 4C8KA 2WTUA 3E1YA 1NJYA 1NWKA 5KGXA 1QZ5A 1WSJA 2ZJRL 4FM2A 4BVPA 3KLHA 1GOBA 2G8VA 4CBWA 1Z25A 4KFBA 4AHVA 4HUFA 2PAVA 3WXLA 2G8IA 3ID6A 2CGKA 4C8OA 5DM7L 4KHSA 1KTQA 4JD2B 3ENOA 1A5XA 4DFMA 4YOVA 1RCHA 3CCSN 5BN9A 1QHAA 3G4SN 5JVGL 1G99A 1ZBUA 4M41A 4DUZK 4OLAA 1I94K 4CZHA 4L8RB 4HUEA 3E01A 3VEXA 3OYFA 4HUGA 2P5GA 4YY3K 4BR0A 1QQNA 1QSSA 3QIOA 1NGJA 4B1WB 1X9WA 2HW3A 3AVJA 1ZBLA 3WXJA 2GX9A 5KPZA 3TPQA 4RWTA 1I39A 2OANA 3H45C 3TR8A 3KD5E 1RNHA 3K5MA 1TGOA 3AAQA 1TUYA 2W40A 3AO2A 4DF4A 4M3ZA 2XY6A 1K8AO 5LMNK 4J2DA 5J2NA 3VQ9A 4FW1A 3AVHA 1VRUA 4H0PA 3L2WA 4FLZA 1S9GA 2NRHA 5BRHA 4DTPA 1BCOA 4C8MA 4LY7A 1RBRA 2Q31A 4PKHA 4M3TA 4CJ5A 2HBMA 3F2KA 4X65K 3CCJN 1NGCA 2DFFA 2X78A 3OS2A 1NOZA 5KRSA 3G10A 5F0XA 3NH1A 5ADXH 3K9JA 2D0OA 3CCMN 2FF3B 5AZIA 1NK0A 1Q82O 3IMXA 3RMDA 2F7TA 4B9QA 1HKCA 2WUSA 4JKAA 1FXXA 3ZX2A 3U9ZA 1VQNN 4K8XA 4CK3A 1SV5A 4OLBA 2QWQA 4DTMA 3VQPA 1L3SA 1S1WA 3A5NC 2Y1JA 3A5OC 4XH1A 3TTCA 3O9TA 4JNEA 2P9NA 1RT3A 4C8LA 2O8BA 1I3AA 5I9EB 3P83D 2OZMA 1SKRA 3HK2A 3VQEA 4BRAA 3SYZA 2QK9A 1U4BA 4C8NA 5HRNA 3A5MC 1FJGK 3V1QA 5AQKA 2B4JA 1VSKA 1RBTA 2P9IA 3ZETB 1BOTO 1DTQA 1IV0A 5FRNA 1S3XA 2KHOA 4FWQA 4DU4A 3CC7N 3KLGA 1U45A 2ZWHA 4FCYA 1OH5A 4QS9A 3M3ZA 2I7PA 3RSEA 1ATNA 3VA0A 4GNIA 1VSHA 4HTLA 2Q2RA 3C6TA 1RT4A 1XMQK 2ZJPL 3FR0A 2CGJA 2XRIA 4RG8A 4B9VA 1NU0A 3I56N 1U6ZA 1TL3A 3FZKA 4CFCA 3TAMA 2NRZA 1Z05A 5JVHL 1K9MO 3HSTB 2IGIA 1HQUA 4FZYA 4DV3K 4K41A 4PA1A 2VQEK 4Q0BA 1M1KO 4Q5VA 4H03B 1NK7A 3MN5A 4BRCA 4WQ4C 3LDOA 4M3RA 3HP9A 5AQPA 4DQSA 2XY5A 4CGDA 1NGFA 3VETA 3LDQA 3MCPA 1ESVA 4BRKA 3CQYA 2WBNA 3M8QA 1MA9B 1VAZA 3VQ7A 4F3TA 1FK9A 3P38A 4BRQA 2ZD1A 4CW7B 3VF4A 3SBTA 1QVFM 4U7BA 3CCUN 1VSDA 4LH4A 4DWIA 2A1SA 4M7YA 1S1UA 4JHDA 2HF4A 2BH1A 3VGMA 3HM9A 1QS4A 4BRHA 5J2QA 4N41A 4G1QA 2QKKA 3NF8A 2A40A 2P9SA 3KLEA 4KKOA 3CG7A 2HBJA 1VQ8N 3F5TA 1D9DA 3WNEA 4QCLA 3HVTA 1YJNN 2YHBA 3IAYA 4JK9A 4IOXA 3MMVA 4CZGA 3ITHA 1LWFA 4CD3A 3AO5A 1N32K 3CI5A 4IEIA 4FK0A 4DV2K 3LL3A 2VGNA 4FLYA 3UKUA 3PIOL 1KFDA 1FW6A 3C6AA 5K14A 3VENA 1UWBA 1YHQN 3M8RA 3SAFA 4FXDA 1WB9A 4Z4GA 4IDKA 4DTSA 3DXMA 2IS3A 3JAMO 3LAKA 4CJPA 1J9AA 1JLCA 1WAJA 2EX3A 4RTFD 1RDAA 3C65A 3R1XA 4H0TB 3H46O 3BDPA 4F4KA 2ZGYA 1NGBA 5DMRA 2YNFA 4BE1A 1U49A 1RTJA 2WONA 2E4LA 4QS7A 4B08A 2ZGZA 4W5TA 5HBMA 1KLMA 1QQMA 1HJOA 3ZSRA 1N34K 1D4XA 3C6UA 3CD6N 1X9JA 2GUPA 3QFPA 1EXQA 4BR4A 3V6DA 1Q9XA 5AZIB 5I42A 1S6QA 1U04A 4CJKA 1BL3A 1RGIA 3AVBA 2LSNA 3K5OA 2FSNA 3DLGA 4WF9L 3TI0A 1C0UA 2F8TA 4DHYA 4E7JA 4FJ8A 3KK7A 4O4GA 5AQHA 2Z1IA 4CEOA 3GDQA 2HBKA 1NJZA 4CESA 3CF5L 2O8BB 2P9NB 3P5JA 4CBUA 1B92A 4E1MA 1VQ6N 4M63C 5CE3A 3PSIA 4XH4A 2V52B 3LANA 3C7NA 1KD1O 2XHBA 4FOEA 3NCIA 5F2RA 4Z4HA 1OVQA 3CJ1A 3IRXA 4ISEA 1LWCA 2YKMA 2QWLA 1HLUA 4CD1A 2P9IB 4CHNA 3ZSVA 4CBXA 1HNVA 2KKZA 3T69A 3EZWA 3SMPA 3GBTA 4DR1K 4AHSA 3M5RA 1MU2A 1YJWN 1KSPA 3DRSA 4O8KA 2IC3A 4E7KA 1WBDA 3E66A 1NGDA 3RSEB 4RW6A 3QIPA 4GY2B 4E1NA 5C12A 2X6NA 4YOUA 3VERA 2O4IA 4FWKA 4CJQA 4IEEA 3IG1A 5GADP 1Y64A 3LDLA 4DSEA 4CK1A 2Q0UA 3BF1A 3CJAA 4B1UB 1X3MA 3LPUA 3OYDA 3GG4A 2ASMA 4GKJK 4DR4K 1B9DA 1S22A 4DQ8A 1RT7A 1YTAA 4BRDA 3LWMA 3S3OA 3KD1E 1BHLA 3FFKB 2UXDK 3T3FA 4N76A 3BZCA 2QKBA 4JKDA 4BGBA 4JYAK 1S1VA 4B1VA 3VA3A 4NB4A 4W5NA 3DLLL 2CH5A 3OW2M 4KAZA 5HRPA 4H8KA 4YFUA 5E26A 4RW8A 3TAQA 3RRHA 4NXMK 2XO7A 3L6QA 3ASMA 3CM6A 1J5EK 1NLVA 1BIZA 4H0XB 2RF2A 3KKSA 3ZSXA 2HF3A 3OYCA 1GOAA 1RBUA 3OA9A 3SV4A 1Y97A 4J2AA 3I8BA 4JHDB 4LH5A 1OH8A 1DLOA 5HLFA 3CC4N 3KHYA 2OA8A 3HTVA 1EWRA 2HHXA 2D1KA 4YHHK 4ELVA 2QW9A 3TABA 3EZ5A 1HNXK 4B9LA 4HWIA 4B1XB 1WUAA 2NRXA 3LALA 4OPHA 2P9SB 1XQSC 2HOEA 4JAXA 1B9FA 4BG9A 1CZAN 3KLFA 3KK3A 3RMCA 3OYIA 3OYBA 2DFHA 4GVEA 3L4QA 4A5AA 4F9OA 5BN8A 1ZC6A 2O8DA 3NF7A 2R7YA 1Q9YA 2QWNA 1LCUA 1GLAG 2IDOA 4WQ4A 3MWPA 5AZJA 1HJRA 4BRLA 1NKBA 4GW6A 4YOXA 4FJ9A 4BR7A 4IXCA 1VSMA 3HOSA 1IBMK 5AFUA 5EOYA 3DLKA 2CGLA 3O9UA 3OYNA 1BUPA 1EP4A 4H0VB 2OYQA 3V9XA 4GV3A 3WUHA 4A62A 4DV1K 2Z1GA 3DXMB 1TK8A 1HKBA 2RHKA 2GWKA 5KRTA 3QB0A 3T1AA 1BDGA 2F96A 3DRPA 4WQ5C 3RWUA 4IFVA 4OX9K 1NGHA 4B3SK 3L2QA 4B9NA 3NHGA 4FWPA 4WYBA 2FSJA 4CGJA 3H3OB 3I8DA 1JLBA 2Y1IA 4DTRA 4R5PA 2E6MA 2YHXA 3MX2A 2QXFA 3MCAB 3PO4A 2E2QA 3B6PA 3VEWA 3E9LA 4ID5A 3MN7A 4BY9C 5AR0A 2HHHK 5AQOA 2HHTA 4IBNA 1YIJN 2B6AA 4FZZA 2A3ZA 3D2EA 1C1AA 2E2OA 4LF8K 1HYSA 1D8YA 3CMEN 4BR9A 3QEXA 4B3TK 3AY9A 5AQYA 2UUCK 1D5AA 1RDCA 1GLDG 3ZX3A 1BIUA 4U67L 1WAFA 1NGAA 2BTFA 4BRNA 4M7XA 3AVMA 3ZSWA 1IBKK 4DUYK 3O6WA 3CFRA 3C7NB 1WSEA 3BY5A 4EP5A 3NBPA 1NJIO 3WNHA 4IG3A 4Y0WA 2A42A 1YTUA 1ZBFA 3QNOA 1T05A 3K2PA 2IAJA 3CMAN 5HROA 3WEEA 2VGMA 3EE9A 3KZBA 1DGKN 2VG6A 5J1EA 4CIEA 2JGUA 4I2PA 4KB0A 1TYQA 2GELA 4E0DA 4LF4K 2BE2A 5AQXA 4EIAA 1S1XA 4GV6A 2QM1A 4CERA 3RTVA 2GEMA 4RW4A 4Y1DA 3J81O 5EU7A 1H1VA 3TANA 3VQQA 1NJXA 4H0OA 4DV7K 1XC9A 3KWIA 3C94A 4FO0A 4JI0K 4XIUA 4KTWA 4CGIA 4XH5A 4DR3K 3AO1A 5AQTA 4BQLA 3SUQA 2ASPA 3J7ZO 4OGEA 3W0LA 3OYAA 4FVUA 2P9LA 4AM6A 1JLGA 3D7EO 3EKSA 3QBWA 3HXMA 4FJIA 3L8BA 1IKVA 1JKHA 4DU1A 2P1JA 3UKRA 2FC0A 1HUXA 3TTDA 4YNQA 3TSQA 1BQNA 5E41A 1BO5O 2BUPA 1BGXT 3NDKA 1HKGA 3M6GA 2UUAK 1GLFO 4FPBA 3SPYA 3GOIA 2KTQA 4CJVA 5MLCQ 1U48A 3H1VX 4JKHA 2FSKA 2AA4A 4B9MA 4FL9A 5E84A 3VN5A 4FLUA 3ZEUA 3EKUA 4FWRA 5KPTA 5KTQA 2NRRA 3WNGA 5GINA 2HVIA 4HCBA 3O9RA 4JKGA 5CZ1A 3HO1A 3OYEA 3G0ZA 1NMNA 3ENHA 3R9PA 3VF6A 3AVGA 1C0FA 4IDHA 1RT5A 2YHWA 3F9KA 2QWMA 3CM5A 2UU9K 4PKGA 1MDUB 5JMVA 1JXEA 3SUPA 1GOCA 4HCCA 3CERA 4JK8A 3M8SA 1T7PA 3KWGA 1ILYA 2QA4N 3U3GA 2E8AA 1JCGA 1ATRA 5BR9A 2HMPA 3ULEB 3DLEA 3ZT3A 4DG1A 2O8DB 4AQYK 3T19A 1E4FT 3AGKA 4IFYA 4K0KK 3CCQN 5KQ8A 2HHSA 3VQBA 4Z4EA 4A59A 3V9SA 5AZJB 2AJQA 1YVNA 1RFQA 4FM1A 2G8FA 4WFAL 3L2RA 1K73O 1U47A 3SNNA 1G15A 2A5XA 3CETA 2A6AA 3TARA 3SCXA 4KB1A 1BISA 1CZBA 3FZLA 3ZT0A 3OS0A 1TVRA 4CZMA 2ETJA 3NH0A 4E1JA 4YOTA 4EHTA 5B8HA 1EQYA 3OY9A 2NRTA 5LJWA 2YX6A 4FLWA 2O8FA 3NMUA 1GLEG 3NFAA 1N36K 2V7YA 3OYJA 2EWSA 3L4IA 3TU5A 4TSXA 4MLHA 1JLFA 3H08A 1WN7A 1VQLN 2XY8A 4OVLA 4PHTX 3MEDA 3KLIA 1BCMA 1OKJA 1JXBA 3TAPA 1T3VA 3AA3A 1SUQA 3CFOA 1BG3A 4FWSA 3MN6A 4C1NI 2OPPA 1NK6A 1L3UA 4B3OA 3DXKA 2BGGA 2F8SA 3D2EB 1X9SA 2QXLA 5AQQA 5LJVA 3ZSOA 3O4NA 3A2FA 4YOWA 3S41A 5FPDA 3ATUA 1RDUA 4JI5K 5IT9O 3AVCA 4FLTA 2P9PA 2P9UA 4FWMA 3DOLA 4O0IA 3D0PA 4IOAL 4DV4K 4E89A 3PY8A 3R6MA 4Z4FA 2P5OA 3PSFA 2IIRA 2VWJA 1QE1A 4B8CA 4MDAA 3HYFA 3N4PA 4DSKA 3TSUA 5FPEA 3G6EN 4RW9A 3OYLA 2Q3SA 1JJ2M 4OGCA 1D9FA 2OPSA 5SZTA 3QO9A 3P4IA 3Q7CA 4JKEA 4WQ5A 4J2BA 3U3YA 3WEEB 3K0SA 5LMUK 3OYHA 3KIOA 2YKNA 2UXBK 4BWMA 4MDBA 5BRDA 1TYQB 4AHUA 5AFUH 3O8MA 2E6LA 2JWKA 2Q97A 3PV8A 3VQDA 5GIPA 3D2FA 1XUPO 5M1OA 2Z1HA 3ZCMA 1JLAA 4CHQA 3AO4A 4CHPA 5KGWA 1VQ5N 2HHWA 4ILJA 3V81A 1K8KB 1KVAA 3JYTA 3QICA 1CXUA 3L3UA 4LSNA 1HR0K 3VQAA 4CJWA 5JS2A 4BG8A 1E3MA 4QS8A 4CEEA 1ASWA 4CCHA 4FSVA 4M3UA 3CPWM 4V19S 2P9LB 3T7ZA 4ILGB 5J2PA 4CFAA 1RILA 1NM1A 4EAHD 3BZKA 3S9HA 3CQXA 4JI4K 2YJEA 2P9KA 3UKRB 3H6EA 2BDPA 1CXQA 1KC8O 4DQIA 3P39A 1C0TA 4H5NA 2WOMA 5AQGA 4CF2A 1N33K 1NKCA 3K58A 4FLVA 2HVHA 1SS6A 4H5WA 3SUNA 4LD0A 4DB3A 5CR4A 1WBBA 4BRIA 3VEYA 3U8XA 3NVKA 2E1ZA 1KVBA 3DI6A 3HPHA 4DQQA 1ATSA 3ZEUB 1WSGA 3B8AX 1ZBHA 4X66K 4CECA 3P1GA 1LAWA 4JKGB 3UE5A 4KREA 1CZ9A 4YOYA 2IOCA 5HL7L 2EHGA 3RVCA 4CF0A 4JKBA 4KH6A 4DU3A 5AJ3K 3HZ6A 3UB5A 4DR6K 3QINA 1QTMA 3VQCA 1EX4A 3QEIA 1VQMN 1YUWA 2GWJA 5FLXO 4DKWA 4N5SA 1U2VB 4H5TA 1WLJA 3FZMA 1HPMA 1SZ2A 2I5JA 3MDQA 4RCHA 4CEBA 3MAQA 4Z94A 1BA0A 3NAEA 4GKKK 4UQGA 4NLCA 3WQUA 3OTOK 3TTFA 4MLEA 1IJJA 4CZIA 4OKEA 3ZX0A 1GLLO 2KQ2A 1SKSA 3L0QA 5AQRA 3A0IX 3SI6A 4CHZA 3M8PA 1W7AA 4CIGA 4A5BA 1TL1A 3DYAA 2ZM6K 3OBWA 4KHQA 1NK8A 1MWMA 4CE9A 2O8FB 3SQ2A 3KKRA 3LDPA 3HJFA 4DV0K 1NGEA 3HRGA 3L2VA 2QI2A 4B9SA 2UXCK 4JKCA 5EX5A 3AGRA 4FJMA 5CHIA 2JWLA 2BANA 1HX1A 3TAEA 1N5YA 3HT3A 2DTUA 3P31A 4O5FA 4NXNK 3QLHA 4BGAA 1TK0A 2VWKA 1QZ6A 4NYFA 2KFNA 2D0CA 3SJJA 3DXKB 1SAZA 3G71N 3R3LA 1VQPN 4KH5A 3DLRA 4JRQA 1NKEA 3K5NA 1XHZA 2V7ZA 1EO1A 3I0RA 5EVZA 2E2NA 1OVYA 4CF1A 4CJTA 4DFKA 3VQ6A 1TAQA 4EZ6A 3GL1A 3VOVA 5M1FA 2X74A 2P9PB 2E2PA 1KXPA 2P9UB 3EL2A 1YT3A 1JCFA 1Q8IA 5FPNA 4OO1J 4LF5K 2NNWA 3O08A 3TAFA 1X3NA 3O4WA 3L2UA 3O9SA 3PX4A 3HBTA 1KVCA 2YNIA 4FPAA 3WXIA 2J4RA 1YJ9N 4CJ7A 5JLHA 3LAMA 3AA5X 3CJCA 3FZFA 4CEFA 1IBLK 1IG8A 3NVMA 4O0JA 5AQVA 4FYDA 2W6KA 4ICLA 2RKIA 4MQ3A 5M1NA 4CHYA 4IO9L 5C24A 4DTJA 1RTIA 2Q0RA 4FJKA 3AVNA 4ZTFA 3LDNA 3S3MA 3CPEA 4CJLA 1X9MA 4EHUA 2W6LA 3D2FB 4X64K 1VQON 1WOQA 1P8ZA 4CK2A 1N6QA 3VMFB 3ULEA 4E3SA 3CCRN
chains in the Genus database with same CATH topology
4CFDA 1HPZA 4CFCA 1RT2A 4O44A 3TAMA 3AO1A 4CGFA 4BE2A 3LPTA 3SUQA 2VG7A 1S5JA 2ITGA 3HSTB 5HP1A 3MXIA 2IGIA 1HQUA 4FZYA 1O1WA 4OGEA 3OYAA 4PA1A 4Q0BA 3PUFA 4Q5VA 1JLGA 3OS1A 3SUOA 1L3TA 1NK7A 3IS9A 4DQPA 4H4OA 3HXMA 3DLHA 4M3RA 3WNFA 4FJIA 1CLQA 3LDSA 3HP9A 1HYVA 4AH9A 3L8BA 1IKVA 1JKHA 4DQSA 4DU1A 2P1JA 2XY5A 2XY7A 2HNDA 4DSLA 4CGDA 2FC0A 1IO2A 3VQ5A 1Z26A 1VRTA 3UIQA 5FRMA 4YNQA 1RBVA 1BQNA 5E41A 1WSFA 4DF8A 3QEPA 1BGXT 2ATQA 3M8QA 3NDKA 4BE0A 3LWLA 4M3XA 3VQ7A 3HPOA 1IKYA 1IKXA 3NGIA 4F3TA 2KZZA 4F3OA 4DFJA 5FDLA 1FK9A 3SPYA 1R0AA 3HVRA 4ELUA 1RTDA 3HL8A 4CJVA 2KTQA 1U48A 2ZD1A 2JLEA 2OZSA 2KFZA 5KI6A 1NJWA 3LZJA 4FJXA 4JLHA 4B9MA 4FJ5A 1VSDA 4LH4A 3VN5A 4FLUA 3KJVA 3DMJA 4ELTA 4Z4CA 4FJ7A 4DWIA 2A1SA 1C0MA 1LV5A 4LSLA 3ZT1A 4KRFA 5KTQA 3LP0A 1RDBA 3WNGA 4BDPA 2HVIA 1S1UA 4HCBA 1XHXA 4FJJA 5CZ1A 3HO1A 3HM9A 3OYEA 3G0ZA 3QERA 3DOKA 1SL0A 1QS4A 5J2QA 4N41A 3AVKA 3AVGA 4CEDA 4G1QA 4FW2A 2QKKA 1RT5A 3NF8A 3F9KA 3NF6A 1LAVA 4OPJA 2HHQA 3CM5A 3KLEA 3MEGA 3MEEA 4IG0A 4KKOA 3CG7A 1NK4A 3EY1A 2GBZA 1T8EA 3QETA 1JXEA 3SUPA 1GOCA 4HCCA 1D9DA 3M8SA 3WNEA 3KK2A 1T7PA 4IKFA 3HVTA 4QCLA 3LP2A 3U3GA 2YHBA 1C1BA 3IAYA 4Z4IA 3KTQA 4I7FA 3ZT3A 3DLEA 4DG1A 3F73A 1VSLA 3ITHA 1VSFA 1LWFA 3O3HA 3AO5A 3T19A 4IFYA 1QSYA 2HHSA 3AA2A 3VQBA 4Z4EA 1UOCA 4DTUA 3V9SA 4FVMA 2AJQA 4DTNA 4FM1A 2G8FA 4E7IA 4K8ZA 4FK0A 3L2RA 1VSJA 1U47A 3SNNA 1G15A 4FLYA 1WSIA 2PYLA 1KFDA 5K14A 4HVJA 3TARA 3SCXA 4KB1A 1BISA 1UWBA 1CZBA 3M8RA 4AHRA 1RT6A 3SQ1A 3ZT0A 3OS0A 5FROA 3RMBA 5C25A 3RRGA 4JS5A 3V9ZA 1ZYQA 1TVRA 4FJNA 4FXDA 4E19A 4Z4GA 4IDKA 2ETJA 3NH0A 4DTSA 2IS3A 4KV8A 3K5LA 3LAKA 3OY9A 4CJPA 1W0HA 1J9AA 1JLCA 1WAJA 2EX3A 4FLWA 4DFPA 1BI4A 1RDAA 1IH7A 4WE1A 5C42A 1TKDA 2DY4A 4NCBA 3NFAA 1XI1A 4DMNA 3BDPA 4F4KA 4CHOA 1HNIA 2YHAA 3DRRA 4W5QA 3OYJA 3OJSA 4FM0A 2X6SA 5DMRA 2YNFA 3FFIA 1NK9A 3ALYA 4PY5A 3AVLA 4BE1A 3ZSQA 1S1TA 1TV6A 1RTJA 2WONA 4MFBA 4TSXA 1U49A 1JLFA 2E4LA 2HMIA 3H08A 4DS4A 1WN7A 4M3YA 3I0SA 2YNGA 4B08A 4DTOA 3DLBA 1HMVA 4DS5A 4W5TA 5HBMA 2XY8A 1KLMA 4PQUA 3ZSRA 2VG5A 3PX0A 4OVLA 4KHNA 3C6UA 3MEDA 3KLIA 3AA4A 1BCMA 4FJGA 4CJUA 4GMJB 2O4GA 4BWJA 1JXBA 3TAPA 2ZQBA 1KRPA 4EZ9A 1UAXA 3RMAA 3AA3A 1SUQA 4GVMA 3V1OA 1EXQA 3CFOA 4OPKA 1L5UA 2OPPA 2HHUA 3V6DA 1Q9XA 5I42A 1S6QA 1U04A 4CJKA 1NK6A 1BL3A 1L3UA 3AVBA 4B3OA 2LSNA 4CJ4A 3K5OA 4BDZA 1UA1A 1X9SA 3DLGA 1SKWA 2BGGA 2F8SA 3TI0A 2KZMA 1C0UA 3ZSOA 3KK1A 4JRPA 2F8TA 3O4NA 4E7JA 1LW0A 4I9QA 4FJ8A 3A2FA 4CF9A 4DLEA 4CJEA 4O4GA 3V9UA 1J54A 2Z1IA 4CEOA 1NK5A 3AVCA 4CIFA 4FLTA 4E7LA 1NJZA 4CESA 3DOLA 4O0IA 3D0PA 1WSHA 3DM2A 3P5JA 1IKWA 3ZSYA 1HQEA 4E89A 3PY8A 4Z4FA 1B92A 4E1MA 2P5OA 1RDDA 2B5JA 2VWJA 4F8RA 1QE1A 4B8CA 2HNZA 3LANA 4AILC 4B9TA 2XHBA 3SZ2A 4DLGA 2GV9A 3HYFA 4ZHRA 4DSKA 4DQRA 3MXMA 3LP3A 3NCIA 4M45A 4RW9A 3OYLA 4Z4HA 2Q3SA 4QOZB 1D9FA 4OGCA 1S6PA 3IRXA 1LWCA 2OPSA 2YKMA 3QO9A 5SZTA 4DSIA 1ZBIA 4FZXC 1TKXA 1VSIA 3ZSVA 4CHNA 3PX6A 4J2BA 3U3YA 1HNVA 4N47A 3OYHA 3KIOA 2G8HA 2YKNA 5HRRA 4KTQA 4EP4A 2RPIA 4BWMA 3ISNC 4OJRA 2A1RA 4AHSA 3ZSZA 4KHWA 1KLNA 1MU2A 3NF9A 1QQCA 3SV3A 4AHUA 1KSPA 3DRSA 4B8AB 2IC3A 4E7KA 3O3FA 2E6LA 5CYQA 1W9HA 4RW6A 3PV8A 3QIPA 4ZTJA 4KI4A 1YVUA 5CYMA 3VQDA 4E1NA 2D5RA 4KHUA 2X6NA 3AVIA 3ZCMA 2Z1HA 4M3WA 3K57A 1ITGA 1JLAA 4CHQA 2O4IA 3AO4A 4CHPA 5KGWA 4CEAA 4CJQA 3OYGA 3IG1A 1RTHA 3TWHA 1NOYA 2HHWA 2KW4A 4DSEA 4CK1A 3V1RA 3V81A 4I2QA 1KVAA 3JYTA 2PZSA 4I9LA 3LPUA 3OYDA 4CJRA 1JLQA 3K59A 3OVNA 1CXUA 4RW7A 5D3GA 3L3UA 4LSNA 3SQ0A 3VQAA 4CJWA 5JS2A 4NCAA 1TAUA 1B9DA 1JLEA 4AHTA 4HTUA 5DK5A 1QSLA 2FBTA 4CEEA 1RT7A 1ASWA 3CQ8A 4CCHA 4KI6A 1YTAA 3LWMA 3NE6A 5T7BA 1C1CA 3S3OA 3AO3A 3KD1E 3O3GA 4BACA 3NGYA 4M3UA 3OYMA 1BHLA 3MXJA 5J2PA 1UA0A 3T3FA 4CFAA 4N76A 1RILA 4H4MA 3RR7A 2QKBA 1VK0A 1IG9A 1LWEA 3BGRA 3S9HA 4FK4A 3O4QA 3L3VA 1DTTA 2G8KA 2OPQA 1S1VA 3B6OA 4M42A 4KHYA 2FBXA 3VA3A 3SQ4A 2BDPA 1CXQA 4DQIA 4W5NA 1JL2A 4Z0UA 1FKPA 4PUOA 3EYZA 1C0TA 2HHVA 2W42A 4J2EA 4DSJA 2YV0X 4QAGA 4KAZA 2WOMA 2RN2A 3VQ8A 4CFBA 4H8KA 5HRPA 4YFUA 3QNNA 4CF2A 1LW2A 4RW8A 3TAQA 3D45A 3RRHA 4CJ3A 2NUBA 1NKCA 3K58A 2XO7A 3HPGA 4FLVA 2HVHA 1K6YA 1J53A 1F21A 1S9EA 3SUNA 4CJFA 4W5OA 4LD0A 3C95A 3ASMA 3CM6A 4OKKA 1BIZA 4CEQA 4B9UA 1BQMA 1XWLA 2RF2A 3KKSA 3RR8A 1KVBA 1TKZA 1REVA 3DI6A 3HPHA 3ZSXA 3OYCA 4DQQA 1GOAA 1RBUA 3LP1A 3SV4A 1Y97A 1WSGA 3QEWA 3V4IA 4J2AA 5CY4A 1ZBHA 2FBVA 3HP6A 3ULDA 1ASVA 4CECA 3P1GA 5J2MA 4KPYA 1LAWA 4LH5A 5CZ2A 3VQ4A 3QESA 1L3VA 4C8KA 4KREA 1DLOA 5HLFA 1NJYA 5KGXA 2OA8A 1CZ9A 1WSJA 4FM2A 2HHXA 3KLHA 4N56A 4ELVA 1GOBA 4CGGA 2IOCA 3TABA 2G8VA 3EZ5A 1SL2A 4B9LA 2D0AA 1Z25A 2EHGA 4KFBA 3LALA 4AHVA 4CF0A 4DU3A 4HUFA 3SPZA 2G8IA 4C8OA 2HNYA 1HRHA 4CF8A 3QINA 1QTMA 4KHSA 1B9FA 3VQCA 4O55A 1EX4A 1KTQA 3KLFA 3KK3A 3QEIA 3RMCA 3OYIA 4N5SA 3OYBA 2DFHA 1A5XA 4DFMA 1RCHA 4OKJA 4FLXA 3NF7A 2R7YA 1WLJA 1Q9YA 1RBSA 2IDOA 2I5JA 1ZBUA 4M41A 1HJRA 1NKBA 4OLAA 4CEBA 3MAQA 4GW6A 4L8RB 1KCFA 4FJ9A 4HUEA 3AV9A 3NAEA 4F2SA 4UQGA 4DSFA 1VSMA 2FBYA 3E01A 4CJSA 3OYFA 4HUGA 2P5GA 3JSMA 3DLKA 4OKEA 1QSSA 3QIOA 2KQ2A 1SKSA 3OYNA 1X9WA 1EP4A 3AVJA 1ZBLA 2HW3A 3SI6A 2D0BA 4CHZA 1KFSA 1I39A 3M8PA 4CIGA 2OYQA 3V9XA 1TL1A 3TR8A 3DYAA 3QEVA 3AVFA 3KD5E 1RNHA 3K5MA 1J5OA 3AVAA 1TGOA 2Z1GA 4KHQA 3NGZA 3OYKA 1NK8A 4HHTA 3AO2A 4DF4A 4M3ZA 4CE9A 1TK8A 4PWDA 2XY6A 1BI4B 4J2DA 5KRTA 3SQ2A 3T1AA 5J2NA 3KKRA 3VQ9A 4FW1A 3AVHA 3HJFA 1VRUA 3L2WA 2F96A 3DRPA 4FLZA 3RWUA 2Z1JA 1RT1A 1S9GA 4IFVA 1X1PA 3L2QA 4B9NA 4F2RA 3NHGA 1BCOA 4C8MA 4DTPA 2PY5A 4LY7A 3L2VA 1RBRA 3U6FA 4B9SA 4M3TA 4CJ5A 4CGJA 3I8DA 1TKTA 3OJUA 4FJMA 4NYNA 5I3UA 1JLBA 2DFFA 2X78A 4DTRA 2Y1IA 2ZE2A 4R5PA 2E6MA 3OS2A 4FJLA 1NOZA 2BANA 2QXFA 5KRSA 3G10A 3PO4A 3TAEA 4DTXA 1QHTA 3B6PA 3NH1A 1N5YA 3HT3A 2DTUA 4ID5A 1SL1A 1EKEA 1TK5A 2DFEA 1NK0A 1T03A 1VSEA 2HHTA 3RMDA 1A5WA 3CYMA 4IBNA 3LZIA 3QLHA 2B6AA 4BDYA 4FZZA 1JL1A 1C1AA 2VWKA 1TK0A 2PYJA 4NYFA 1FXXA 2D0CA 3SJJA 2KFNA 1HYSA 1D8YA 3DLRA 4JRQA 1NKEA 3K5NA 1XHZA 4K8XA 3QEXA 4CK3A 1SV5A 3I0RA 4OLBA 2HB5A 2G8UA 4KTZA 2OPRA 4DTMA 3VQPA 4CF1A 4CJTA 4DFKA 1L3SA 1S1WA 4ID1A 2P51A 1EETA 1TAQA 3VQ6A 2Y1JA 4EZ6A 1D5AA 1RDCA 4FK2A 2X74A 4C8LA 1RT3A 3ZT2A 4FJHA 5SWMA 1BIUA 1I3AA 1WAFA 3P83D 4CEZA 1YT3A 2OZMA 1SKRA 3HK2A 1ASUA 3VQEA 4CGHA 3SYZA 1Q8IA 3AVMA 3ZSWA 2QK9A 3TAFA 4AHCA 3CFPA 1U4BA 3L2UA 4C8NA 5HRNA 3CFRA 1WSEA 3PX4A 4EP5A 3NBPA 3PO5A 4JS4A 3V1QA 3WNHA 4IG3A 1KVCA 2YNIA 2B4JA 1YTUA 1ZBFA 3QNOA 1VSKA 1WNSA 1RBTA 1T05A 3K2PA 4NCGA 2IAJA 5HROA 1DTQA 2GUIA 3LAMA 5FRNA 4KO0A 3AA5X 4W5RA 1HYZA 4CEFA 4DU4A 2VG6A 5J1EA 2G8WA 4O0JA 2JGUA 4I2PA 4CIEA 3KLGA 1U45A 4E0DA 4FCYA 4KB0A 3S3NA 3TAGA 4FYDA 2BE2A 4ICLA 2RKIA 4MQ3A 3NH2A 4CHYA 5C24A 3ZT4A 4DTJA 1A5VA 5HRSA 1RTIA 4E7HA 4CGIA 3VA0A 3MECA 1S1XA 4FJKA 1VSHA 3THVA 3AVNA 4CERA 3RTVA 4ZTFA 3S3MA 3C6TA 1RT4A 4CJLA 1X9MA 4RW4A 4Y1DA 4RG8A 2XRIA 5EU7A 1C6VA 4B9VA 3V9WA 4O5BA 3VQQA 3TANA 1NJXA 4CK2A 1XC9A 1N6QA 2YNHA 1FKOA 3C94A 4E3SA 4XIUA 4KTWA 4Y1CA 5JS1A 1TL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CFD A;  1HPZ A;  4CFC A;  1RT2 A;  4O44 A;  3TAM A;  3AO1 A;  4CGF A;  4BE2 A;  3LPT A;  3SUQ A;  2VG7 A;  1S5J A;  2ITG A;  3HST B;  5HP1 A;  3MXI A;  2IGI A;  1HQU A;  4FZY A;  1O1W A;  4OGE A;  3OYA A;  4PA1 A;  4Q0B A;  3PUF A;  4Q5V A;  1JLG A;  3OS1 A;  3SUO A;  1L3T A;  1NK7 A;  3IS9 A;  4DQP A;  4H4O A;  3HXM A;  3DLH A;  4M3R A;  3WNF A;  4FJI A;  1CLQ A;  3LDS A;  3HP9 A;  1HYV A;  4AH9 A;  3L8B A;  1IKV A;  1JKH A;  4DQS A;  4DU1 A;  2P1J A;  2XY5 A;  2XY7 A;  2HND A;  4DSL A;  4CGD A;  2FC0 A;  1IO2 A;  3VQ5 A;  1Z26 A;  1VRT A;  3UIQ A;  5FRM A;  4YNQ A;  1RBV A;  1BQN A;  5E41 A;  1WSF A;  4DF8 A;  3QEP A;  1BGX T;  2ATQ A;  3M8Q A;  3NDK A;  4BE0 A;  3LWL A;  4M3X A;  3VQ7 A;  3HPO A;  1IKY A;  1IKX A;  3NGI A;  4F3T A;  2KZZ A;  4F3O A;  4DFJ A;  5FDL A;  1FK9 A;  3SPY A;  1R0A A;  3HVR A;  4ELU A;  1RTD A;  3HL8 A;  4CJV A;  2KTQ A;  1U48 A;  2ZD1 A;  2JLE A;  2OZS A;  2KFZ A;  5KI6 A;  1NJW A;  3LZJ A;  4FJX A;  4JLH A;  4B9M A;  4FJ5 A;  1VSD A;  4LH4 A;  3VN5 A;  4FLU A;  3KJV A;  3DMJ A;  4ELT A;  4Z4C A;  4FJ7 A;  4DWI A;  2A1S A;  1C0M A;  1LV5 A;  4LSL A;  3ZT1 A;  4KRF A;  5KTQ A;  3LP0 A;  1RDB A;  3WNG A;  4BDP A;  2HVI A;  1S1U A;  4HCB A;  1XHX A;  4FJJ A;  5CZ1 A;  3HO1 A;  3HM9 A;  3OYE A;  3G0Z A;  3QER A;  3DOK A;  1SL0 A;  1QS4 A;  5J2Q A;  4N41 A;  3AVK A;  3AVG A;  4CED A;  4G1Q A;  4FW2 A;  2QKK A;  1RT5 A;  3NF8 A;  3F9K A;  3NF6 A;  1LAV A;  4OPJ A;  2HHQ A;  3CM5 A;  3KLE A;  3MEG A;  3MEE A;  4IG0 A;  4KKO A;  3CG7 A;  1NK4 A;  3EY1 A;  2GBZ A;  1T8E A;  3QET A;  1JXE A;  3SUP A;  1GOC A;  4HCC A;  1D9D A;  3M8S A;  3WNE A;  3KK2 A;  1T7P A;  4IKF A;  3HVT A;  4QCL A;  3LP2 A;  3U3G A;  2YHB A;  1C1B A;  3IAY A;  4Z4I A;  3KTQ A;  4I7F A;  3ZT3 A;  3DLE A;  4DG1 A;  3F73 A;  1VSL A;  3ITH A;  1VSF A;  1LWF A;  3O3H A;  3AO5 A;  3T19 A;  4IFY A;  1QSY A;  2HHS A;  3AA2 A;  3VQB A;  4Z4E A;  1UOC A;  4DTU A;  3V9S A;  4FVM A;  2AJQ A;  4DTN A;  4FM1 A;  2G8F A;  4E7I A;  4K8Z A;  4FK0 A;  3L2R A;  1VSJ A;  1U47 A;  3SNN A;  1G15 A;  4FLY A;  1WSI A;  2PYL A;  1KFD A;  5K14 A;  4HVJ A;  3TAR A;  3SCX A;  4KB1 A;  1BIS A;  1UWB A;  1CZB A;  3M8R A;  4AHR A;  1RT6 A;  3SQ1 A;  3ZT0 A;  3OS0 A;  5FRO A;  3RMB A;  5C25 A;  3RRG A;  4JS5 A;  3V9Z A;  1ZYQ A;  1TVR A;  4FJN A;  4FXD A;  4E19 A;  4Z4G A;  4IDK A;  2ETJ A;  3NH0 A;  4DTS A;  2IS3 A;  4KV8 A;  3K5L A;  3LAK A;  3OY9 A;  4CJP A;  1W0H A;  1J9A A;  1JLC A;  1WAJ A;  2EX3 A;  4FLW A;  4DFP A;  1BI4 A;  1RDA A;  1IH7 A;  4WE1 A;  5C42 A;  1TKD A;  2DY4 A;  4NCB A;  3NFA A;  1XI1 A;  4DMN A;  3BDP A;  4F4K A;  4CHO A;  1HNI A;  2YHA A;  3DRR A;  4W5Q A;  3OYJ A;  3OJS A;  4FM0 A;  2X6S A;  5DMR A;  2YNF A;  3FFI A;  1NK9 A;  3ALY A;  4PY5 A;  3AVL A;  4BE1 A;  3ZSQ A;  1S1T A;  1TV6 A;  1RTJ A;  2WON A;  4MFB A;  4TSX A;  1U49 A;  1JLF A;  2E4L A;  2HMI A;  3H08 A;  4DS4 A;  1WN7 A;  4M3Y A;  3I0S A;  2YNG A;  4B08 A;  4DTO A;  3DLB A;  1HMV A;  4DS5 A;  4W5T A;  5HBM A;  2XY8 A;  1KLM A;  4PQU A;  3ZSR A;  2VG5 A;  3PX0 A;  4OVL A;  4KHN A;  3C6U A;  3MED A;  3KLI A;  3AA4 A;  1BCM A;  4FJG A;  4CJU A;  4GMJ B;  2O4G A;  4BWJ A;  1JXB A;  3TAP A;  2ZQB A;  1KRP A;  4EZ9 A;  1UAX A;  3RMA A;  3AA3 A;  1SUQ A;  4GVM A;  3V1O A;  1EXQ A;  3CFO A;  4OPK A;  1L5U A;  2OPP A;  2HHU A;  3V6D A;  1Q9X A;  5I42 A;  1S6Q A;  1U04 A;  4CJK A;  1NK6 A;  1BL3 A;  1L3U A;  3AVB A;  4B3O A;  2LSN A;  4CJ4 A;  3K5O A;  4BDZ A;  1UA1 A;  1X9S A;  3DLG A;  1SKW A;  2BGG A;  2F8S A;  3TI0 A;  2KZM A;  1C0U A;  3ZSO A;  3KK1 A;  4JRP A;  2F8T A;  3O4N A;  4E7J A;  1LW0 A;  4I9Q A;  4FJ8 A;  3A2F A;  4CF9 A;  4DLE A;  4CJE A;  4O4G A;  3V9U A;  1J54 A;  2Z1I A;  4CEO A;  1NK5 A;  3AVC A;  4CIF A;  4FLT A;  4E7L A;  1NJZ A;  4CES A;  3DOL A;  4O0I A;  3D0P A;  1WSH A;  3DM2 A;  3P5J A;  1IKW A;  3ZSY A;  1HQE A;  4E89 A;  3PY8 A;  4Z4F A;  1B92 A;  4E1M A;  2P5O A;  1RDD A;  2B5J A;  2VWJ A;  4F8R A;  1QE1 A;  4B8C A;  2HNZ A;  3LAN A;  4AIL C;  4B9T A;  2XHB A;  3SZ2 A;  4DLG A;  2GV9 A;  3HYF A;  4ZHR A;  4DSK A;  4DQR A;  3MXM A;  3LP3 A;  3NCI A;  4M45 A;  4RW9 A;  3OYL A;  4Z4H A;  2Q3S A;  4QOZ B;  1D9F A;  4OGC A;  1S6P A;  3IRX A;  1LWC A;  2OPS A;  2YKM A;  3QO9 A;  5SZT A;  4DSI A;  1ZBI A;  4FZX C;  1TKX A;  1VSI A;  3ZSV A;  4CHN A;  3PX6 A;  4J2B A;  3U3Y A;  1HNV A;  4N47 A;  3OYH A;  3KIO A;  2G8H A;  2YKN A;  5HRR A;  4KTQ A;  4EP4 A;  2RPI A;  4BWM A;  3ISN C;  4OJR A;  2A1R A;  4AHS A;  3ZSZ A;  4KHW A;  1KLN A;  1MU2 A;  3NF9 A;  1QQC A;  3SV3 A;  4AHU A;  1KSP A;  3DRS A;  4B8A B;  2IC3 A;  4E7K A;  3O3F A;  2E6L A;  5CYQ A;  1W9H A;  4RW6 A;  3PV8 A;  3QIP A;  4ZTJ A;  4KI4 A;  1YVU A;  5CYM A;  3VQD A;  4E1N A;  2D5R A;  4KHU A;  2X6N A;  3AVI A;  3ZCM A;  2Z1H A;  4M3W A;  3K57 A;  1ITG A;  1JLA A;  4CHQ A;  2O4I A;  3AO4 A;  4CHP A;  5KGW A;  4CEA A;  4CJQ A;  3OYG A;  3IG1 A;  1RTH A;  3TWH A;  1NOY A;  2HHW A;  2KW4 A;  4DSE A;  4CK1 A;  3V1R A;  3V81 A;  4I2Q A;  1KVA A;  3JYT A;  2PZS A;  4I9L A;  3LPU A;  3OYD A;  4CJR A;  1JLQ A;  3K59 A;  3OVN A;  1CXU A;  4RW7 A;  5D3G A;  3L3U A;  4LSN A;  3SQ0 A;  3VQA A;  4CJW A;  5JS2 A;  4NCA A;  1TAU A;  1B9D A;  1JLE A;  4AHT A;  4HTU A;  5DK5 A;  1QSL A;  2FBT A;  4CEE A;  1RT7 A;  1ASW A;  3CQ8 A;  4CCH A;  4KI6 A;  1YTA A;  3LWM A;  3NE6 A;  5T7B A;  1C1C A;  3S3O A;  3AO3 A;  3KD1 E;  3O3G A;  4BAC A;  3NGY A;  4M3U A;  3OYM A;  1BHL A;  3MXJ A;  5J2P A;  1UA0 A;  3T3F A;  4CFA A;  4N76 A;  1RIL A;  4H4M A;  3RR7 A;  2QKB A;  1VK0 A;  1IG9 A;  1LWE A;  3BGR A;  3S9H A;  4FK4 A;  3O4Q A;  3L3V A;  1DTT A;  2G8K A;  2OPQ A;  1S1V A;  3B6O A;  4M42 A;  4KHY A;  2FBX A;  3VA3 A;  3SQ4 A;  2BDP A;  1CXQ A;  4DQI A;  4W5N A;  1JL2 A;  4Z0U A;  1FKP A;  4PUO A;  3EYZ A;  1C0T A;  2HHV A;  2W42 A;  4J2E A;  4DSJ A;  2YV0 X;  4QAG A;  4KAZ A;  2WOM A;  2RN2 A;  3VQ8 A;  4CFB A;  4H8K A;  5HRP A;  4YFU A;  3QNN A;  4CF2 A;  1LW2 A;  4RW8 A;  3TAQ A;  3D45 A;  3RRH A;  4CJ3 A;  2NUB A;  1NKC A;  3K58 A;  2XO7 A;  3HPG A;  4FLV A;  2HVH A;  1K6Y A;  1J53 A;  1F21 A;  1S9E A;  3SUN A;  4CJF A;  4W5O A;  4LD0 A;  3C95 A;  3ASM A;  3CM6 A;  4OKK A;  1BIZ A;  4CEQ A;  4B9U A;  1BQM A;  1XWL A;  2RF2 A;  3KKS A;  3RR8 A;  1KVB A;  1TKZ A;  1REV A;  3DI6 A;  3HPH A;  3ZSX A;  3OYC A;  4DQQ A;  1GOA A;  1RBU A;  3LP1 A;  3SV4 A;  1Y97 A;  1WSG A;  3QEW A;  3V4I A;  4J2A A;  5CY4 A;  1ZBH A;  2FBV A;  3HP6 A;  3ULD A;  1ASV A;  4CEC A;  3P1G A;  5J2M A;  4KPY A;  1LAW A;  4LH5 A;  5CZ2 A;  3VQ4 A;  3QES A;  1L3V A;  4C8K A;  4KRE A;  1DLO A;  5HLF A;  1NJY A;  5KGX A;  2OA8 A;  1CZ9 A;  1WSJ A;  4FM2 A;  2HHX A;  3KLH A;  4N56 A;  4ELV A;  1GOB A;  4CGG A;  2IOC A;  3TAB A;  2G8V A;  3EZ5 A;  1SL2 A;  4B9L A;  2D0A A;  1Z25 A;  2EHG A;  4KFB A;  3LAL A;  4AHV A;  4CF0 A;  4DU3 A;  4HUF A;  3SPZ A;  2G8I A;  4C8O A;  2HNY A;  1HRH A;  4CF8 A;  3QIN A;  1QTM A;  4KHS A;  1B9F A;  3VQC A;  4O55 A;  1EX4 A;  1KTQ A;  3KLF A;  3KK3 A;  3QEI A;  3RMC A;  3OYI A;  4N5S A;  3OYB A;  2DFH A;  1A5X A;  4DFM A;  1RCH A;  4OKJ A;  4FLX A;  3NF7 A;  2R7Y A;  1WLJ A;  1Q9Y A;  1RBS A;  2IDO A;  2I5J A;  1ZBU A;  4M41 A;  1HJR A;  1NKB A;  4OLA A;  4CEB A;  3MAQ A;  4GW6 A;  4L8R B;  1KCF A;  4FJ9 A;  4HUE A;  3AV9 A;  3NAE A;  4F2S A;  4UQG A;  4DSF A;  1VSM A;  2FBY A;  3E01 A;  4CJS A;  3OYF A;  4HUG A;  2P5G A;  3JSM A;  3DLK A;  4OKE A;  1QSS A;  3QIO A;  2KQ2 A;  1SKS A;  3OYN A;  1X9W A;  1EP4 A;  3AVJ A;  1ZBL A;  2HW3 A;  3SI6 A;  2D0B A;  4CHZ A;  1KFS A;  1I39 A;  3M8P A;  4CIG A;  2OYQ A;  3V9X A;  1TL1 A;  3TR8 A;  3DYA A;  3QEV A;  3AVF A;  3KD5 E;  1RNH A;  3K5M A;  1J5O A;  3AVA A;  1TGO A;  2Z1G A;  4KHQ A;  3NGZ A;  3OYK A;  1NK8 A;  4HHT A;  3AO2 A;  4DF4 A;  4M3Z A;  4CE9 A;  1TK8 A;  4PWD A;  2XY6 A;  1BI4 B;  4J2D A;  5KRT A;  3SQ2 A;  3T1A A;  5J2N A;  3KKR A;  3VQ9 A;  4FW1 A;  3AVH A;  3HJF A;  1VRU A;  3L2W A;  2F96 A;  3DRP A;  4FLZ A;  3RWU A;  2Z1J A;  1RT1 A;  1S9G A;  4IFV A;  1X1P A;  3L2Q A;  4B9N A;  4F2R A;  3NHG A;  1BCO A;  4C8M A;  4DTP A;  2PY5 A;  4LY7 A;  3L2V A;  1RBR A;  3U6F A;  4B9S A;  4M3T A;  4CJ5 A;  4CGJ A;  3I8D A;  1TKT A;  3OJU A;  4FJM A;  4NYN A;  5I3U A;  1JLB A;  2DFF A;  2X78 A;  4DTR A;  2Y1I A;  2ZE2 A;  4R5P A;  2E6M A;  3OS2 A;  4FJL A;  1NOZ A;  2BAN A;  2QXF A;  5KRS A;  3G10 A;  3PO4 A;  3TAE A;  4DTX A;  1QHT A;  3B6P A;  3NH1 A;  1N5Y A;  3HT3 A;  2DTU A;  4ID5 A;  1SL1 A;  1EKE A;  1TK5 A;  2DFE A;  1NK0 A;  1T03 A;  1VSE A;  2HHT A;  3RMD A;  1A5W A;  3CYM A;  4IBN A;  3LZI A;  3QLH A;  2B6A A;  4BDY A;  4FZZ A;  1JL1 A;  1C1A A;  2VWK A;  1TK0 A;  2PYJ A;  4NYF A;  1FXX A;  2D0C A;  3SJJ A;  2KFN A;  1HYS A;  1D8Y A;  3DLR A;  4JRQ A;  1NKE A;  3K5N A;  1XHZ A;  4K8X A;  3QEX A;  4CK3 A;  1SV5 A;  3I0R A;  4OLB A;  2HB5 A;  2G8U A;  4KTZ A;  2OPR A;  4DTM A;  3VQP A;  4CF1 A;  4CJT A;  4DFK A;  1L3S A;  1S1W A;  4ID1 A;  2P51 A;  1EET A;  1TAQ A;  3VQ6 A;  2Y1J A;  4EZ6 A;  1D5A A;  1RDC A;  4FK2 A;  2X74 A;  4C8L A;  1RT3 A;  3ZT2 A;  4FJH A;  5SWM A;  1BIU A;  1I3A A;  1WAF A;  3P83 D;  4CEZ A;  1YT3 A;  2OZM A;  1SKR A;  3HK2 A;  1ASU A;  3VQE A;  4CGH A;  3SYZ A;  1Q8I A;  3AVM A;  3ZSW A;  2QK9 A;  3TAF A;  4AHC A;  3CFP A;  1U4B A;  3L2U A;  4C8N A;  5HRN A;  3CFR A;  1WSE A;  3PX4 A;  4EP5 A;  3NBP A;  3PO5 A;  4JS4 A;  3V1Q A;  3WNH A;  4IG3 A;  1KVC A;  2YNI A;  2B4J A;  1YTU A;  1ZBF A;  3QNO A;  1VSK A;  1WNS A;  1RBT A;  1T05 A;  3K2P A;  4NCG A;  2IAJ A;  5HRO A;  1DTQ A;  2GUI A;  3LAM A;  5FRN A;  4KO0 A;  3AA5 X;  4W5R A;  1HYZ A;  4CEF A;  4DU4 A;  2VG6 A;  5J1E A;  2G8W A;  4O0J A;  2JGU A;  4I2P A;  4CIE A;  3KLG A;  1U45 A;  4E0D A;  4FCY A;  4KB0 A;  3S3N A;  3TAG A;  4FYD A;  2BE2 A;  4ICL A;  2RKI A;  4MQ3 A;  3NH2 A;  4CHY A;  5C24 A;  3ZT4 A;  4DTJ A;  1A5V A;  5HRS A;  1RTI A;  4E7H A;  4CGI A;  3VA0 A;  3MEC A;  1S1X A;  4FJK A;  1VSH A;  3THV A;  3AVN A;  4CER A;  3RTV A;  4ZTF A;  3S3M A;  3C6T A;  1RT4 A;  4CJL A;  1X9M A;  4RW4 A;  4Y1D A;  4RG8 A;  2XRI A;  5EU7 A;  1C6V A;  4B9V A;  3V9W A;  4O5B A;  3VQQ A;  3TAN A;  1NJX A;  4CK2 A;  1XC9 A;  1N6Q A;  2YNH A;  1FKO A;  3C94 A;  4E3S A;  4XIU A;  4KTW A;  4Y1C A;  5JS1 A;  1TL3 A; 
#chains in the Genus database with same CATH topology
 5JIC A;  1HPZ A;  1VQ9 N;  4KH4 A;  3LPT A;  2VG7 A;  1XNQ K;  3HOT A;  3MXI A;  3M1F A;  1VQ7 N;  1O1W A;  3PUF A;  3OS1 A;  3SUO A;  1L3T A;  3AAP A;  3O1W A;  3QML A;  3AAR A;  4DQP A;  1BA1 A;  4H4O A;  3DLH A;  1CLQ A;  4K43 A;  3VEO A;  1HYV A;  2F9W A;  4DSL A;  1VQK N;  2HND A;  2VQF K;  1IO2 A;  2P9K B;  3VQ5 A;  1VRT A;  3UIQ A;  3THY A;  5C0Y A;  4NLB A;  3N4Q A;  4DF8 A;  1WSF A;  3LWL A;  3SJH A;  4M3X A;  3NGI A;  1IKY A;  1IKX A;  4DFJ A;  3HI0 A;  5A2Q O;  4ELU A;  2KFZ A;  2JLE A;  2OZS A;  5KI6 A;  4FJX A;  1YF5 L;  2UUB K;  3BEX A;  4BRF A;  4JI6 K;  1ZBS A;  4FJ7 A;  4B3R K;  1C0M A;  5FPM A;  3LP0 A;  1RDB A;  4BDP A;  4FJJ A;  1MWK A;  1GLC G;  1DKG D;  3SAH A;  3QER A;  1GLJ O;  4PKI A;  3ENB A;  4A61 A;  4CED A;  4GV9 A;  3NF6 A;  3G25 A;  4XEI A;  1E4G T;  5BPM A;  3MEG A;  3MEE A;  4IG0 A;  3R8E A;  3QET A;  2QWP A;  3KK2 A;  4IKF A;  1V4S A;  3LP2 A;  1C1B A;  4Z4I A;  1HNZ K;  3O3H A;  1DEJ A;  3BF3 A;  4DTU A;  4DTN A;  4K8Z A;  2QEX N;  4E7I A;  3C6H A;  3QDK A;  2PYL A;  4HVJ A;  4CZL A;  3F9M A;  3RRG A;  5FRO A;  3RMB A;  4WFN L;  1ZYQ A;  4E19 A;  5DM6 L;  5BPN A;  5AQZ A;  3CJB A;  4IOC L;  4JI3 K;  3MK6 A;  1BI4 A;  2YJF A;  2WC9 A;  1TKD A;  1XI1 A;  1W97 L;  3ZYY X;  2E1Y A;  4DMN A;  1HNI A;  2YHA A;  4FM0 A;  2X6S A;  2ITM A;  3ALY A;  4PY5 A;  3AVL A;  3ZSQ A;  3Q7B A;  1S1T A;  4JN4 A;  2HMI A;  4MFB A;  4MO5 A;  1OH7 A;  4DS4 A;  3KVG A;  1O13 A;  2YNG A;  4DTO A;  3W3D A;  3DLB A;  1HMV A;  1Q81 O;  4PQU A;  2FF6 A;  1YI2 N;  1K8K A;  3AA4 A;  4FJG A;  4GMJ B;  2O4G A;  4BWJ A;  2H3G X;  1KRP A;  4BR2 A;  3SLC A;  4EZ9 A;  5AQF A;  2E20 A;  1W2B M;  2HHU A;  2NRV A;  3LM2 A;  2GTD A;  4CJ4 A;  4BDZ A;  4OPA A;  4BRG A;  2A41 A;  1LW0 A;  4DLE A;  2I7N A;  2F4V K;  4CJE A;  1JCE A;  3V9U A;  1J54 A;  2NZT A;  1NK5 A;  2NLX A;  1KAX A;  1T6C A;  2VYP A;  1WSH A;  1HQE A;  3VTH A;  3IUC A;  5EY4 A;  5KQD A;  4F8R A;  2HNZ A;  2V51 B;  4AIL C;  3K9K A;  3SZ2 A;  4ZHR A;  4JK7 A;  2VCP A;  3MXM A;  1S72 N;  4M45 A;  1ZXO A;  5AQI A;  5AQW A;  4FZX C;  1TKX A;  1NBW A;  4N47 A;  1VHX A;  4KTQ A;  3VTI A;  2G8H A;  5HRR A;  3U9D A;  3VEV A;  5AQU A;  1Q86 O;  3ISN C;  2A1R A;  4KHW A;  1KLN A;  3NF9 A;  1QQC A;  1P90 A;  4B8A B;  4DV6 K;  3OHR A;  4ZTJ A;  4KI4 A;  1YVU A;  2QWR A;  3AVI A;  4M3W A;  1ITG A;  2W41 A;  4LF9 K;  1NMD A;  3OYG A;  3CCL N;  3TWH A;  1U2V A;  2KW4 A;  1QQO A;  5AQJ A;  3V1R A;  4BR5 A;  1Q7Y O;  5KPR A;  4I2Q A;  4YOR A;  4IJA A;  3K59 A;  3OVN A;  3SQ0 A;  5JLF A;  3O1B A;  4AHT A;  4HTU A;  2E5L K;  5GAH P;  4FWN A;  1QSL A;  1M90 O;  3CQ8 A;  3H1Q A;  3NE6 A;  3VES A;  5T7B A;  3AO3 A;  3O3G A;  3NGY A;  1QVG M;  3OYM A;  1UA0 A;  3RR7 A;  1VK0 A;  3IFR A;  1DTT A;  2G8K A;  2OPQ A;  4KHY A;  2FBX A;  3SQ4 A;  4MO4 A;  3SMS A;  1J6Z A;  4Z0U A;  1FKP A;  4PUO A;  3THY B;  2HHV A;  2W42 A;  4J2E A;  4DSJ A;  1YIT N;  4QAG A;  2D0P A;  2RN2 A;  3DJC A;  3VQ8 A;  4CFB A;  4X62 K;  3QNN A;  1LOT B;  3D45 A;  4CJ3 A;  2NUB A;  1K6Y A;  1J53 A;  1F21 A;  3EN9 A;  4CJF A;  3C95 A;  2ZJQ L;  4B9U A;  1XWL A;  3RR8 A;  1TKZ A;  1Z6R A;  3LP1 A;  3QEW A;  1R59 O;  5AQL A;  3HP6 A;  3ULD A;  1ASV A;  4KPY A;  5CZ2 A;  3QES A;  1L3V A;  3FE1 A;  4N56 A;  3DAW A;  3A5L C;  4CGG A;  1N8R O;  1SL2 A;  3JS6 A;  2O8E B;  2D0A A;  2NRW A;  3TSP A;  4KBO A;  3SPZ A;  2HNY A;  1HRH A;  4CF8 A;  4O55 A;  1RDW X;  4OKJ A;  4ISG A;  3ATV A;  3HM8 A;  4FLX A;  4KHP K;  3OBY A;  1RBS A;  2QWO A;  1KCF A;  3PLA A;  3AV9 A;  3U4L A;  2HST A;  3WXK A;  4DSF A;  4F2S A;  2FBY A;  5TKW A;  4CJS A;  2D4W A;  4DR5 K;  2IVN A;  4CZE A;  3JSM A;  3A8Y A;  4K42 A;  4DCH A;  3SBG A;  2D0B A;  3WT0 A;  4H0Y B;  1KFS A;  2PBD A;  3AVF A;  2VWB A;  3QEV A;  1J5O A;  3AVA A;  3NGZ A;  3BP8 A;  3OYK A;  3T1Y K;  4HHT A;  4LC9 B;  2DPN A;  4PWD A;  4K25 A;  1BI4 B;  2YI1 A;  3CIP A;  1HNW K;  4JI8 K;  2Z1J A;  1RT1 A;  2IVO A;  4PL8 A;  4H5R A;  1X1P A;  1NNE A;  4B1Z A;  4F2R A;  3CCE N;  2PY5 A;  3U6F A;  1KQS M;  1TKT A;  4O8U A;  3OJU A;  4NYN A;  5I3U A;  2ZE2 A;  4FJL A;  4LFA K;  4IJN A;  4DTX A;  1QHT A;  3CCV N;  3LM9 A;  1SL1 A;  1EKE A;  3H3N O;  1TK5 A;  2DFE A;  1T03 A;  1VSE A;  3J7A P;  1A5W A;  3CYM A;  3LZI A;  4BDY A;  1JL1 A;  2WFB A;  2PYJ A;  2FLO A;  2HB5 A;  2G8U A;  3IKM A;  4KTZ A;  1VQ4 N;  4I6M A;  2OPR A;  4JKF A;  4ID1 A;  4BC5 A;  2P51 A;  1EET A;  2FXU A;  4FK2 A;  4CI6 A;  3ZT2 A;  4FJH A;  5SWM A;  5HOO A;  4CEZ A;  4ISF A;  1ASU A;  4CGH A;  3WQT A;  4BC3 A;  3ZLJ A;  4AHC A;  3CFP A;  5GAE P;  3PO5 A;  4JS4 A;  2O8C A;  3J80 O;  3SK3 A;  4DR7 K;  1WNS A;  4LF7 K;  4NCG A;  2GUI A;  2AP1 A;  3C0B A;  4KO0 A;  5BR8 K;  4W5R A;  1HYZ A;  2G8W A;  5C2F A;  3FLC O;  3QBX A;  3TAG A;  3S3N A;  3NH2 A;  4IWV A;  3ZT4 A;  5BRF A;  1A5V A;  4DV5 K;  5HRS A;  4E7H A;  2KLA A;  3FZH A;  3MEC A;  4G9Z A;  4YDU C;  3THW A;  3THV A;  5GAG P;  2CH6 A;  3D6R A;  1C6V A;  1NGI A;  3V9W A;  4O5B A;  4B3M K;  4IO8 A;  2YNH A;  1FKO A;  5AQN A;  1SL0 A;  2E88 A;  4Y1C A;  4CZF A;  4PL7 A;  5JS1 A;  4CFD A;  4C1N K;  1RT2 A;  4O44 A;  4CGF A;  4BE2 A;  1DT9 A;  1Q18 A;  1S5J A;  2ITG A;  5HP1 A;  4H5V A;  2OTL N;  4B1Y B;  1YXQ A;  4BRM A;  5C2D A;  4DR2 K;  4BRP A;  3IS9 A;  3WNF A;  5IWA K;  3BUZ B;  3DWL A;  3LDS A;  3FGU A;  5AQM A;  4AH9 A;  2XY7 A;  3E9P A;  1XC3 A;  4FWL A;  3CJ7 A;  1Z26 A;  2F9T A;  5FRM A;  4JI1 K;  1KAZ A;  1RBV A;  3QEP A;  2ATQ A;  3CC2 N;  4BE0 A;  3HPO A;  2KZZ A;  5ADX A;  4F3O A;  5FDL A;  1R0A A;  1XNR K;  3HVR A;  1TUU A;  1RTD A;  3HL8 A;  1NJW A;  3LZJ A;  1KAY A;  3PIP L;  4WFB L;  4JLH A;  5ELZ A;  4FJ5 A;  3QFU A;  3KJV A;  3DMJ A;  3THX A;  4Z4C A;  4ELT A;  2HBL A;  1LV5 A;  4JI7 K;  4LSL A;  3ZT1 A;  4KRF A;  1XHX A;  3EEQ A;  3MX5 A;  3VF2 A;  3DOK A;  3AVK A;  4L3Q A;  4A57 A;  4FW2 A;  4R79 A;  1V4T A;  1LAV A;  4OPJ A;  4LF6 K;  2HHQ A;  4CZK A;  4AF1 A;  3VEZ A;  4A2B A;  1EWQ A;  1NK4 A;  3EY1 A;  2ZF5 O;  2GBZ A;  5M1P A;  1T8E A;  4JD2 A;  3VGL A;  2ASO A;  5M1Q A;  5H1S Q;  3KTQ A;  4I7F A;  3F73 A;  4J8F A;  1VSL A;  4BRE A;  1VSF A;  3E9O A;  2PFU A;  3CHW A;  4IFE A;  1QSY A;  4BC4 A;  3AA2 A;  1UOC A;  4FVM A;  5EXW A;  4WCE L;  1VSJ A;  4NO7 A;  1WSI A;  3I55 N;  4JV5 K;  4LFC K;  3VPZ A;  4AHR A;  1RT6 A;  3SQ1 A;  5C25 A;  4FJN A;  3ID8 A;  4JS5 A;  3V9Z A;  3IDH A;  1YAG A;  4BVO A;  4KV8 A;  3K5L A;  1W0H A;  4BQZ A;  4DFP A;  5AQS A;  1IH7 A;  4WE1 A;  5C42 A;  2DY4 A;  4NCB A;  3VGK A;  3EE8 A;  4CHO A;  5F1X A;  3DRR A;  4W5Q A;  3OJS A;  3FFI A;  1NK9 A;  1OH6 A;  1TV6 A;  1NGG A;  3GE1 A;  3HSC A;  5TKY A;  4M3Y A;  3I0S A;  3T1H K;  4DS5 A;  2VG5 A;  4FOI A;  3PX0 A;  4KHN A;  2IVP A;  3MN9 A;  1NG9 A;  4CJU A;  2OCE A;  2ZQB A;  1UAX A;  3RMA A;  4JEP A;  3EO3 A;  4GVM A;  3V1O A;  4CZJ A;  5M1K A;  4OPK A;  1L5U A;  3O9Q A;  1UA1 A;  3J8A A;  1SKW A;  4FWO A;  2KZM A;  4JRP A;  3KK1 A;  4I9Q A;  4CF9 A;  4IZ9 A;  4I6M B;  4CIF A;  4E7L A;  1GLB G;  4BC2 A;  1T6D A;  3DM2 A;  2QTD A;  1IKW A;  3ZSY A;  4A2A A;  1RDD A;  2B5J A;  3J7Y P;  3UKU B;  4B9T A;  4DLG A;  4JI2 K;  2GV9 A;  4DQR A;  2RE2 A;  3LP3 A;  1BU6 O;  3O80 A;  5C10 A;  2O8C B;  4QOZ B;  3ZET A;  1S6P A;  1ZBI A;  4DSI A;  1VSI A;  3PX6 A;  4C23 A;  2YHY A;  4EP4 A;  2RPI A;  4OJR A;  3ZSZ A;  3SV3 A;  3CXC M;  3O3F A;  5CYQ A;  2O8E A;  1W9H A;  3JXU A;  5CYM A;  2D5R A;  4KHU A;  3THW B;  5LY3 A;  3K57 A;  4CEA A;  1RTH A;  1NOY A;  4LFB K;  2PZS A;  4I9L A;  5BRE A;  1JLQ A;  4CJR A;  1XMO K;  4RW7 A;  5D3G A;  4NCA A;  1TAU A;  1JLE A;  5DK5 A;  2FBT A;  5C15 A;  4KI6 A;  5LL6 Z;  1C1C A;  4BAC A;  1BWF O;  3MXJ A;  5BPL A;  4H4M A;  1C0G A;  1IG9 A;  1T44 A;  1LWE A;  3BGR A;  4FK4 A;  3O4Q A;  3SAG A;  3L3V A;  4BRO A;  5GIO A;  3B6O A;  4M42 A;  1SQK A;  4EFH A;  2UYT A;  4ILH A;  1JL2 A;  3MWT A;  3EYZ A;  2YV0 X;  3CJ9 A;  1LW2 A;  3HPG A;  4CVN E;  3WXM B;  2OTJ N;  1S9E A;  4W5O A;  4UY8 O;  4OKK A;  4CEQ A;  1BQM A;  3I33 A;  2Q1N A;  1REV A;  3THX B;  3V4I A;  4YDU A;  5CY4 A;  2FBV A;  3O5B A;  2YCH A;  4AM7 A;  2Q36 A;  5J2M A;  3VQ4 A;  4C8K A;  2WTU A;  3E1Y A;  1NJY A;  1NWK A;  5KGX A;  1QZ5 A;  1WSJ A;  2ZJR L;  4FM2 A;  4BVP A;  3KLH A;  1GOB A;  2G8V A;  4CBW A;  1Z25 A;  4KFB A;  4AHV A;  4HUF A;  2PAV A;  3WXL A;  2G8I A;  3ID6 A;  2CGK A;  4C8O A;  5DM7 L;  4KHS A;  1KTQ A;  4JD2 B;  3ENO A;  1A5X A;  4DFM A;  4YOV A;  1RCH A;  3CCS N;  5BN9 A;  1QHA A;  3G4S N;  5JVG L;  1G99 A;  1ZBU A;  4M41 A;  4DUZ K;  4OLA A;  1I94 K;  4CZH A;  4L8R B;  4HUE A;  3E01 A;  3VEX A;  3OYF A;  4HUG A;  2P5G A;  4YY3 K;  4BR0 A;  1QQN A;  1QSS A;  3QIO A;  1NGJ A;  4B1W B;  1X9W A;  2HW3 A;  3AVJ A;  1ZBL A;  3WXJ A;  2GX9 A;  5KPZ A;  3TPQ A;  4RWT A;  1I39 A;  2OAN A;  3H45 C;  3TR8 A;  3KD5 E;  1RNH A;  3K5M A;  1TGO A;  3AAQ A;  1TUY A;  2W40 A;  3AO2 A;  4DF4 A;  4M3Z A;  2XY6 A;  1K8A O;  5LMN K;  4J2D A;  5J2N A;  3VQ9 A;  4FW1 A;  3AVH A;  1VRU A;  4H0P A;  3L2W A;  4FLZ A;  1S9G A;  2NRH A;  5BRH A;  4DTP A;  1BCO A;  4C8M A;  4LY7 A;  1RBR A;  2Q31 A;  4PKH A;  4M3T A;  4CJ5 A;  2HBM A;  3F2K A;  4X65 K;  3CCJ N;  1NGC A;  2DFF A;  2X78 A;  3OS2 A;  1NOZ A;  5KRS A;  3G10 A;  5F0X A;  3NH1 A;  5ADX H;  3K9J A;  2D0O A;  3CCM N;  2FF3 B;  5AZI A;  1NK0 A;  1Q82 O;  3IMX A;  3RMD A;  2F7T A;  4B9Q A;  1HKC A;  2WUS A;  4JKA A;  1FXX A;  3ZX2 A;  3U9Z A;  1VQN N;  4K8X A;  4CK3 A;  1SV5 A;  4OLB A;  2QWQ A;  4DTM A;  3VQP A;  1L3S A;  1S1W A;  3A5N C;  2Y1J A;  3A5O C;  4XH1 A;  3TTC A;  3O9T A;  4JNE A;  2P9N A;  1RT3 A;  4C8L A;  2O8B A;  1I3A A;  5I9E B;  3P83 D;  2OZM A;  1SKR A;  3HK2 A;  3VQE A;  4BRA A;  3SYZ A;  2QK9 A;  1U4B A;  4C8N A;  5HRN A;  3A5M C;  1FJG K;  3V1Q A;  5AQK A;  2B4J A;  1VSK A;  1RBT A;  2P9I A;  3ZET B;  1BOT O;  1DTQ A;  1IV0 A;  5FRN A;  1S3X A;  2KHO A;  4FWQ A;  4DU4 A;  3CC7 N;  3KLG A;  1U45 A;  2ZWH A;  4FCY A;  1OH5 A;  4QS9 A;  3M3Z A;  2I7P A;  3RSE A;  1ATN A;  3VA0 A;  4GNI A;  1VSH A;  4HTL A;  2Q2R A;  3C6T A;  1RT4 A;  1XMQ K;  2ZJP L;  3FR0 A;  2CGJ A;  2XRI A;  4RG8 A;  4B9V A;  1NU0 A;  3I56 N;  1U6Z A;  1TL3 A;  3FZK A;  4CFC A;  3TAM A;  2NRZ A;  1Z05 A;  5JVH L;  1K9M O;  3HST B;  2IGI A;  1HQU A;  4FZY A;  4DV3 K;  4K41 A;  4PA1 A;  2VQE K;  4Q0B A;  1M1K O;  4Q5V A;  4H03 B;  1NK7 A;  3MN5 A;  4BRC A;  4WQ4 C;  3LDO A;  4M3R A;  3HP9 A;  5AQP A;  4DQS A;  2XY5 A;  4CGD A;  1NGF A;  3VET A;  3LDQ A;  3MCP A;  1ESV A;  4BRK A;  3CQY A;  2WBN A;  3M8Q A;  1MA9 B;  1VAZ A;  3VQ7 A;  4F3T A;  1FK9 A;  3P38 A;  4BRQ A;  2ZD1 A;  4CW7 B;  3VF4 A;  3SBT A;  1QVF M;  4U7B A;  3CCU N;  1VSD A;  4LH4 A;  4DWI A;  2A1S A;  4M7Y A;  1S1U A;  4JHD A;  2HF4 A;  2BH1 A;  3VGM A;  3HM9 A;  1QS4 A;  4BRH A;  5J2Q A;  4N41 A;  4G1Q A;  2QKK A;  3NF8 A;  2A40 A;  2P9S A;  3KLE A;  4KKO A;  3CG7 A;  2HBJ A;  1VQ8 N;  3F5T A;  1D9D A;  3WNE A;  4QCL A;  3HVT A;  1YJN N;  2YHB A;  3IAY A;  4JK9 A;  4IOX A;  3MMV A;  4CZG A;  3ITH A;  1LWF A;  4CD3 A;  3AO5 A;  1N32 K;  3CI5 A;  4IEI A;  4FK0 A;  4DV2 K;  3LL3 A;  2VGN A;  4FLY A;  3UKU A;  3PIO L;  1KFD A;  1FW6 A;  3C6A A;  5K14 A;  3VEN A;  1UWB A;  1YHQ N;  3M8R A;  3SAF A;  4FXD A;  1WB9 A;  4Z4G A;  4IDK A;  4DTS A;  3DXM A;  2IS3 A;  3JAM O;  3LAK A;  4CJP A;  1J9A A;  1JLC A;  1WAJ A;  2EX3 A;  4RTF D;  1RDA A;  3C65 A;  3R1X A;  4H0T B;  3H46 O;  3BDP A;  4F4K A;  2ZGY A;  1NGB A;  5DMR A;  2YNF A;  4BE1 A;  1U49 A;  1RTJ A;  2WON A;  2E4L A;  4QS7 A;  4B08 A;  2ZGZ A;  4W5T A;  5HBM A;  1KLM A;  1QQM A;  1HJO A;  3ZSR A;  1N34 K;  1D4X A;  3C6U A;  3CD6 N;  1X9J A;  2GUP A;  3QFP A;  1EXQ A;  4BR4 A;  3V6D A;  1Q9X A;  5AZI B;  5I42 A;  1S6Q A;  1U04 A;  4CJK A;  1BL3 A;  1RGI A;  3AVB A;  2LSN A;  3K5O A;  2FSN A;  3DLG A;  4WF9 L;  3TI0 A;  1C0U A;  2F8T A;  4DHY A;  4E7J A;  4FJ8 A;  3KK7 A;  4O4G A;  5AQH A;  2Z1I A;  4CEO A;  3GDQ A;  2HBK A;  1NJZ A;  4CES A;  3CF5 L;  2O8B B;  2P9N B;  3P5J A;  4CBU A;  1B92 A;  4E1M A;  1VQ6 N;  4M63 C;  5CE3 A;  3PSI A;  4XH4 A;  2V52 B;  3LAN A;  3C7N A;  1KD1 O;  2XHB A;  4FOE A;  3NCI A;  5F2R A;  4Z4H A;  1OVQ A;  3CJ1 A;  3IRX A;  4ISE A;  1LWC A;  2YKM A;  2QWL A;  1HLU A;  4CD1 A;  2P9I B;  4CHN A;  3ZSV A;  4CBX A;  1HNV A;  2KKZ A;  3T69 A;  3EZW A;  3SMP A;  3GBT A;  4DR1 K;  4AHS A;  3M5R A;  1MU2 A;  1YJW N;  1KSP A;  3DRS A;  4O8K A;  2IC3 A;  4E7K A;  1WBD A;  3E66 A;  1NGD A;  3RSE B;  4RW6 A;  3QIP A;  4GY2 B;  4E1N A;  5C12 A;  2X6N A;  4YOU A;  3VER A;  2O4I A;  4FWK A;  4CJQ A;  4IEE A;  3IG1 A;  5GAD P;  1Y64 A;  3LDL A;  4DSE A;  4CK1 A;  2Q0U A;  3BF1 A;  3CJA A;  4B1U B;  1X3M A;  3LPU A;  3OYD A;  3GG4 A;  2ASM A;  4GKJ K;  4DR4 K;  1B9D A;  1S22 A;  4DQ8 A;  1RT7 A;  1YTA A;  4BRD A;  3LWM A;  3S3O A;  3KD1 E;  1BHL A;  3FFK B;  2UXD K;  3T3F A;  4N76 A;  3BZC A;  2QKB A;  4JKD A;  4BGB A;  4JYA K;  1S1V A;  4B1V A;  3VA3 A;  4NB4 A;  4W5N A;  3DLL L;  2CH5 A;  3OW2 M;  4KAZ A;  5HRP A;  4H8K A;  4YFU A;  5E26 A;  4RW8 A;  3TAQ A;  3RRH A;  4NXM K;  2XO7 A;  3L6Q A;  3ASM A;  3CM6 A;  1J5E K;  1NLV A;  1BIZ A;  4H0X B;  2RF2 A;  3KKS A;  3ZSX A;  2HF3 A;  3OYC A;  1GOA A;  1RBU A;  3OA9 A;  3SV4 A;  1Y97 A;  4J2A A;  3I8B A;  4JHD B;  4LH5 A;  1OH8 A;  1DLO A;  5HLF A;  3CC4 N;  3KHY A;  2OA8 A;  3HTV A;  1EWR A;  2HHX A;  2D1K A;  4YHH K;  4ELV A;  2QW9 A;  3TAB A;  3EZ5 A;  1HNX K;  4B9L A;  4HWI A;  4B1X B;  1WUA A;  2NRX A;  3LAL A;  4OPH A;  2P9S B;  1XQS C;  2HOE A;  4JAX A;  1B9F A;  4BG9 A;  1CZA N;  3KLF A;  3KK3 A;  3RMC A;  3OYI A;  3OYB A;  2DFH A;  4GVE A;  3L4Q A;  4A5A A;  4F9O A;  5BN8 A;  1ZC6 A;  2O8D A;  3NF7 A;  2R7Y A;  1Q9Y A;  2QWN A;  1LCU A;  1GLA G;  2IDO A;  4WQ4 A;  3MWP A;  5AZJ A;  1HJR A;  4BRL A;  1NKB A;  4GW6 A;  4YOX A;  4FJ9 A;  4BR7 A;  4IXC A;  1VSM A;  3HOS A;  1IBM K;  5AFU A;  5EOY A;  3DLK A;  2CGL A;  3O9U A;  3OYN A;  1BUP A;  1EP4 A;  4H0V B;  2OYQ A;  3V9X A;  4GV3 A;  3WUH A;  4A62 A;  4DV1 K;  2Z1G A;  3DXM B;  1TK8 A;  1HKB A;  2RHK A;  2GWK A;  5KRT A;  3QB0 A;  3T1A A;  1BDG A;  2F96 A;  3DRP A;  4WQ5 C;  3RWU A;  4IFV A;  4OX9 K;  1NGH A;  4B3S K;  3L2Q A;  4B9N A;  3NHG A;  4FWP A;  4WYB A;  2FSJ A;  4CGJ A;  3H3O B;  3I8D A;  1JLB A;  2Y1I A;  4DTR A;  4R5P A;  2E6M A;  2YHX A;  3MX2 A;  2QXF A;  3MCA B;  3PO4 A;  2E2Q A;  3B6P A;  3VEW A;  3E9L A;  4ID5 A;  3MN7 A;  4BY9 C;  5AR0 A;  2HHH K;  5AQO A;  2HHT A;  4IBN A;  1YIJ N;  2B6A A;  4FZZ A;  2A3Z A;  3D2E A;  1C1A A;  2E2O A;  4LF8 K;  1HYS A;  1D8Y A;  3CME N;  4BR9 A;  3QEX A;  4B3T K;  3AY9 A;  5AQY A;  2UUC K;  1D5A A;  1RDC A;  1GLD G;  3ZX3 A;  1BIU A;  4U67 L;  1WAF A;  1NGA A;  2BTF A;  4BRN A;  4M7X A;  3AVM A;  3ZSW A;  1IBK K;  4DUY K;  3O6W A;  3CFR A;  3C7N B;  1WSE A;  3BY5 A;  4EP5 A;  3NBP A;  1NJI O;  3WNH A;  4IG3 A;  4Y0W A;  2A42 A;  1YTU A;  1ZBF A;  3QNO A;  1T05 A;  3K2P A;  2IAJ A;  3CMA N;  5HRO A;  3WEE A;  2VGM A;  3EE9 A;  3KZB A;  1DGK N;  2VG6 A;  5J1E A;  4CIE A;  2JGU A;  4I2P A;  4KB0 A;  1TYQ A;  2GEL A;  4E0D A;  4LF4 K;  2BE2 A;  5AQX A;  4EIA A;  1S1X A;  4GV6 A;  2QM1 A;  4CER A;  3RTV A;  2GEM A;  4RW4 A;  4Y1D A;  3J81 O;  5EU7 A;  1H1V A;  3TAN A;  3VQQ A;  1NJX A;  4H0O A;  4DV7 K;  1XC9 A;  3KWI A;  3C94 A;  4FO0 A;  4JI0 K;  4XIU A;  4KTW A;  4CGI A;  4XH5 A;  4DR3 K;  3AO1 A;  5AQT A;  4BQL A;  3SUQ A;  2ASP A;  3J7Z O;  4OGE A;  3W0L A;  3OYA A;  4FVU A;  2P9L A;  4AM6 A;  1JLG A;  3D7E O;  3EKS A;  3QBW A;  3HXM A;  4FJI A;  3L8B A;  1IKV A;  1JKH A;  4DU1 A;  2P1J A;  3UKR A;  2FC0 A;  1HUX A;  3TTD A;  4YNQ A;  3TSQ A;  1BQN A;  5E41 A;  1BO5 O;  2BUP A;  1BGX T;  3NDK A;  1HKG A;  3M6G A;  2UUA K;  1GLF O;  4FPB A;  3SPY A;  3GOI A;  2KTQ A;  4CJV A;  5MLC Q;  1U48 A;  3H1V X;  4JKH A;  2FSK A;  2AA4 A;  4B9M A;  4FL9 A;  5E84 A;  3VN5 A;  4FLU A;  3ZEU A;  3EKU A;  4FWR A;  5KPT A;  5KTQ A;  2NRR A;  3WNG A;  5GIN A;  2HVI A;  4HCB A;  3O9R A;  4JKG A;  5CZ1 A;  3HO1 A;  3OYE A;  3G0Z A;  1NMN A;  3ENH A;  3R9P A;  3VF6 A;  3AVG A;  1C0F A;  4IDH A;  1RT5 A;  2YHW A;  3F9K A;  2QWM A;  3CM5 A;  2UU9 K;  4PKG A;  1MDU B;  5JMV A;  1JXE A;  3SUP A;  1GOC A;  4HCC A;  3CER A;  4JK8 A;  3M8S A;  1T7P A;  3KWG A;  1ILY A;  2QA4 N;  3U3G A;  2E8A A;  1JCG A;  1ATR A;  5BR9 A;  2HMP A;  3ULE B;  3DLE A;  3ZT3 A;  4DG1 A;  2O8D B;  4AQY K;  3T19 A;  1E4F T;  3AGK A;  4IFY A;  4K0K K;  3CCQ N;  5KQ8 A;  2HHS A;  3VQB A;  4Z4E A;  4A59 A;  3V9S A;  5AZJ B;  2AJQ A;  1YVN A;  1RFQ A;  4FM1 A;  2G8F A;  4WFA L;  3L2R A;  1K73 O;  1U47 A;  3SNN A;  1G15 A;  2A5X A;  3CET A;  2A6A A;  3TAR A;  3SCX A;  4KB1 A;  1BIS A;  1CZB A;  3FZL A;  3ZT0 A;  3OS0 A;  1TVR A;  4CZM A;  2ETJ A;  3NH0 A;  4E1J A;  4YOT A;  4EHT A;  5B8H A;  1EQY A;  3OY9 A;  2NRT A;  5LJW A;  2YX6 A;  4FLW A;  2O8F A;  3NMU A;  1GLE G;  3NFA A;  1N36 K;  2V7Y A;  3OYJ A;  2EWS A;  3L4I A;  3TU5 A;  4TSX A;  4MLH A;  1JLF A;  3H08 A;  1WN7 A;  1VQL N;  2XY8 A;  4OVL A;  4PHT X;  3MED A;  3KLI A;  1BCM A;  1OKJ A;  1JXB A;  3TAP A;  1T3V A;  3AA3 A;  1SUQ A;  3CFO A;  1BG3 A;  4FWS A;  3MN6 A;  4C1N I;  2OPP A;  1NK6 A;  1L3U A;  4B3O A;  3DXK A;  2BGG A;  2F8S A;  3D2E B;  1X9S A;  2QXL A;  5AQQ A;  5LJV A;  3ZSO A;  3O4N A;  3A2F A;  4YOW A;  3S41 A;  5FPD A;  3ATU A;  1RDU A;  4JI5 K;  5IT9 O;  3AVC A;  4FLT A;  2P9P A;  2P9U A;  4FWM A;  3DOL A;  4O0I A;  3D0P A;  4IOA L;  4DV4 K;  4E89 A;  3PY8 A;  3R6M A;  4Z4F A;  2P5O A;  3PSF A;  2IIR A;  2VWJ A;  1QE1 A;  4B8C A;  4MDA A;  3HYF A;  3N4P A;  4DSK A;  3TSU A;  5FPE A;  3G6E N;  4RW9 A;  3OYL A;  2Q3S A;  1JJ2 M;  4OGC A;  1D9F A;  2OPS A;  5SZT A;  3QO9 A;  3P4I A;  3Q7C A;  4JKE A;  4WQ5 A;  4J2B A;  3U3Y A;  3WEE B;  3K0S A;  5LMU K;  3OYH A;  3KIO A;  2YKN A;  2UXB K;  4BWM A;  4MDB A;  5BRD A;  1TYQ B;  4AHU A;  5AFU H;  3O8M A;  2E6L A;  2JWK A;  2Q97 A;  3PV8 A;  3VQD A;  5GIP A;  3D2F A;  1XUP O;  5M1O A;  2Z1H A;  3ZCM A;  1JLA A;  4CHQ A;  3AO4 A;  4CHP A;  5KGW A;  1VQ5 N;  2HHW A;  4ILJ A;  3V81 A;  1K8K B;  1KVA A;  3JYT A;  3QIC A;  1CXU A;  3L3U A;  4LSN A;  1HR0 K;  3VQA A;  4CJW A;  5JS2 A;  4BG8 A;  1E3M A;  4QS8 A;  4CEE A;  1ASW A;  4CCH A;  4FSV A;  4M3U A;  3CPW M;  4V19 S;  2P9L B;  3T7Z A;  4ILG B;  5J2P A;  4CFA A;  1RIL A;  1NM1 A;  4EAH D;  3BZK A;  3S9H A;  3CQX A;  4JI4 K;  2YJE A;  2P9K A;  3UKR B;  3H6E A;  2BDP A;  1CXQ A;  1KC8 O;  4DQI A;  3P39 A;  1C0T A;  4H5N A;  2WOM A;  5AQG A;  4CF2 A;  1N33 K;  1NKC A;  3K58 A;  4FLV A;  2HVH A;  1SS6 A;  4H5W A;  3SUN A;  4LD0 A;  4DB3 A;  5CR4 A;  1WBB A;  4BRI A;  3VEY A;  3U8X A;  3NVK A;  2E1Z A;  1KVB A;  3DI6 A;  3HPH A;  4DQQ A;  1ATS A;  3ZEU B;  1WSG A;  3B8A X;  1ZBH A;  4X66 K;  4CEC A;  3P1G A;  1LAW A;  4JKG B;  3UE5 A;  4KRE A;  1CZ9 A;  4YOY A;  2IOC A;  5HL7 L;  2EHG A;  3RVC A;  4CF0 A;  4JKB A;  4KH6 A;  4DU3 A;  5AJ3 K;  3HZ6 A;  3UB5 A;  4DR6 K;  3QIN A;  1QTM A;  3VQC A;  1EX4 A;  3QEI A;  1VQM N;  1YUW A;  2GWJ A;  5FLX O;  4DKW A;  4N5S A;  1U2V B;  4H5T A;  1WLJ A;  3FZM A;  1HPM A;  1SZ2 A;  2I5J A;  3MDQ A;  4RCH A;  4CEB A;  3MAQ A;  4Z94 A;  1BA0 A;  3NAE A;  4GKK K;  4UQG A;  4NLC A;  3WQU A;  3OTO K;  3TTF A;  4MLE A;  1IJJ A;  4CZI A;  4OKE A;  3ZX0 A;  1GLL O;  2KQ2 A;  1SKS A;  3L0Q A;  5AQR A;  3A0I X;  3SI6 A;  4CHZ A;  3M8P A;  1W7A A;  4CIG A;  4A5B A;  1TL1 A;  3DYA A;  2ZM6 K;  3OBW A;  4KHQ A;  1NK8 A;  1MWM A;  4CE9 A;  2O8F B;  3SQ2 A;  3KKR A;  3LDP A;  3HJF A;  4DV0 K;  1NGE A;  3HRG A;  3L2V A;  2QI2 A;  4B9S A;  2UXC K;  4JKC A;  5EX5 A;  3AGR A;  4FJM A;  5CHI A;  2JWL A;  2BAN A;  1HX1 A;  3TAE A;  1N5Y A;  3HT3 A;  2DTU A;  3P31 A;  4O5F A;  4NXN K;  3QLH A;  4BGA A;  1TK0 A;  2VWK A;  1QZ6 A;  4NYF A;  2KFN A;  2D0C A;  3SJJ A;  3DXK B;  1SAZ A;  3G71 N;  3R3L A;  1VQP N;  4KH5 A;  3DLR A;  4JRQ A;  1NKE A;  3K5N A;  1XHZ A;  2V7Z A;  1EO1 A;  3I0R A;  5EVZ A;  2E2N A;  1OVY A;  4CF1 A;  4CJT A;  4DFK A;  3VQ6 A;  1TAQ A;  4EZ6 A;  3GL1 A;  3VOV A;  5M1F A;  2X74 A;  2P9P B;  2E2P A;  1KXP A;  2P9U B;  3EL2 A;  1YT3 A;  1JCF A;  1Q8I A;  5FPN A;  4OO1 J;  4LF5 K;  2NNW A;  3O08 A;  3TAF A;  1X3N A;  3O4W A;  3L2U A;  3O9S A;  3PX4 A;  3HBT A;  1KVC A;  2YNI A;  4FPA A;  3WXI A;  2J4R A;  1YJ9 N;  4CJ7 A;  5JLH A;  3LAM A;  3AA5 X;  3CJC A;  3FZF A;  4CEF A;  1IBL K;  1IG8 A;  3NVM A;  4O0J A;  5AQV A;  4FYD A;  2W6K A;  4ICL A;  2RKI A;  4MQ3 A;  5M1N A;  4CHY A;  4IO9 L;  5C24 A;  4DTJ A;  1RTI A;  2Q0R A;  4FJK A;  3AVN A;  4ZTF A;  3LDN A;  3S3M A;  3CPE A;  4CJL A;  1X9M A;  4EHU A;  2W6L A;  3D2F B;  4X64 K;  1VQO N;  1WOQ A;  1P8Z A;  4CK2 A;  1N6Q A;  3VMF B;  3ULE A;  4E3S A;  3CCR N; 
#chains in the Genus database with same CATH homology
 4CFD A;  1HPZ A;  4CFC A;  1RT2 A;  4O44 A;  3TAM A;  3AO1 A;  4CGF A;  4BE2 A;  3LPT A;  3SUQ A;  2VG7 A;  1S5J A;  2ITG A;  3HST B;  5HP1 A;  3MXI A;  2IGI A;  1HQU A;  4FZY A;  1O1W A;  4OGE A;  3OYA A;  4PA1 A;  4Q0B A;  3PUF A;  4Q5V A;  1JLG A;  3OS1 A;  3SUO A;  1L3T A;  1NK7 A;  3IS9 A;  4DQP A;  4H4O A;  3HXM A;  3DLH A;  4M3R A;  3WNF A;  4FJI A;  1CLQ A;  3LDS A;  3HP9 A;  1HYV A;  4AH9 A;  3L8B A;  1IKV A;  1JKH A;  4DQS A;  4DU1 A;  2P1J A;  2XY5 A;  2XY7 A;  2HND A;  4DSL A;  4CGD A;  2FC0 A;  1IO2 A;  3VQ5 A;  1Z26 A;  1VRT A;  3UIQ A;  5FRM A;  4YNQ A;  1RBV A;  1BQN A;  5E41 A;  1WSF A;  4DF8 A;  3QEP A;  1BGX T;  2ATQ A;  3M8Q A;  3NDK A;  4BE0 A;  3LWL A;  4M3X A;  3VQ7 A;  3HPO A;  1IKY A;  1IKX A;  3NGI A;  4F3T A;  2KZZ A;  4F3O A;  4DFJ A;  5FDL A;  1FK9 A;  3SPY A;  1R0A A;  3HVR A;  4ELU A;  1RTD A;  3HL8 A;  4CJV A;  2KTQ A;  1U48 A;  2ZD1 A;  2JLE A;  2OZS A;  2KFZ A;  5KI6 A;  1NJW A;  3LZJ A;  4FJX A;  4JLH A;  4B9M A;  4FJ5 A;  1VSD A;  4LH4 A;  3VN5 A;  4FLU A;  3KJV A;  3DMJ A;  4ELT A;  4Z4C A;  4FJ7 A;  4DWI A;  2A1S A;  1C0M A;  1LV5 A;  4LSL A;  3ZT1 A;  4KRF A;  5KTQ A;  3LP0 A;  1RDB A;  3WNG A;  4BDP A;  2HVI A;  1S1U A;  4HCB A;  1XHX A;  4FJJ A;  5CZ1 A;  3HO1 A;  3HM9 A;  3OYE A;  3G0Z A;  3QER A;  3DOK A;  1SL0 A;  1QS4 A;  5J2Q A;  4N41 A;  3AVK A;  3AVG A;  4CED A;  4G1Q A;  4FW2 A;  2QKK A;  1RT5 A;  3NF8 A;  3F9K A;  3NF6 A;  1LAV A;  4OPJ A;  2HHQ A;  3CM5 A;  3KLE A;  3MEG A;  3MEE A;  4IG0 A;  4KKO A;  3CG7 A;  1NK4 A;  3EY1 A;  2GBZ A;  1T8E A;  3QET A;  1JXE A;  3SUP A;  1GOC A;  4HCC A;  1D9D A;  3M8S A;  3WNE A;  3KK2 A;  1T7P A;  4IKF A;  3HVT A;  4QCL A;  3LP2 A;  3U3G A;  2YHB A;  1C1B A;  3IAY A;  4Z4I A;  3KTQ A;  4I7F A;  3ZT3 A;  3DLE A;  4DG1 A;  3F73 A;  1VSL A;  3ITH A;  1VSF A;  1LWF A;  3O3H A;  3AO5 A;  3T19 A;  4IFY A;  1QSY A;  2HHS A;  3AA2 A;  3VQB A;  4Z4E A;  1UOC A;  4DTU A;  3V9S A;  4FVM A;  2AJQ A;  4DTN A;  4FM1 A;  2G8F A;  4E7I A;  4K8Z A;  4FK0 A;  3L2R A;  1VSJ A;  1U47 A;  3SNN A;  1G15 A;  4FLY A;  1WSI A;  2PYL A;  1KFD A;  5K14 A;  4HVJ A;  3TAR A;  3SCX A;  4KB1 A;  1BIS A;  1UWB A;  1CZB A;  3M8R A;  4AHR A;  1RT6 A;  3SQ1 A;  3ZT0 A;  3OS0 A;  5FRO A;  3RMB A;  5C25 A;  3RRG A;  4JS5 A;  3V9Z A;  1ZYQ A;  1TVR A;  4FJN A;  4FXD A;  4E19 A;  4Z4G A;  4IDK A;  2ETJ A;  3NH0 A;  4DTS A;  2IS3 A;  4KV8 A;  3K5L A;  3LAK A;  3OY9 A;  4CJP A;  1W0H A;  1J9A A;  1JLC A;  1WAJ A;  2EX3 A;  4FLW A;  4DFP A;  1BI4 A;  1RDA A;  1IH7 A;  4WE1 A;  5C42 A;  1TKD A;  2DY4 A;  4NCB A;  3NFA A;  1XI1 A;  4DMN A;  3BDP A;  4F4K A;  4CHO A;  1HNI A;  2YHA A;  3DRR A;  4W5Q A;  3OYJ A;  3OJS A;  4FM0 A;  2X6S A;  5DMR A;  2YNF A;  3FFI A;  1NK9 A;  3ALY A;  4PY5 A;  3AVL A;  4BE1 A;  3ZSQ A;  1S1T A;  1TV6 A;  1RTJ A;  2WON A;  4MFB A;  4TSX A;  1U49 A;  1JLF A;  2E4L A;  2HMI A;  3H08 A;  4DS4 A;  1WN7 A;  4M3Y A;  3I0S A;  2YNG A;  4B08 A;  4DTO A;  3DLB A;  1HMV A;  4DS5 A;  4W5T A;  5HBM A;  2XY8 A;  1KLM A;  4PQU A;  3ZSR A;  2VG5 A;  3PX0 A;  4OVL A;  4KHN A;  3C6U A;  3MED A;  3KLI A;  3AA4 A;  1BCM A;  4FJG A;  4CJU A;  4GMJ B;  2O4G A;  4BWJ A;  1JXB A;  3TAP A;  2ZQB A;  1KRP A;  4EZ9 A;  1UAX A;  3RMA A;  3AA3 A;  1SUQ A;  4GVM A;  3V1O A;  1EXQ A;  3CFO A;  4OPK A;  1L5U A;  2OPP A;  2HHU A;  3V6D A;  1Q9X A;  5I42 A;  1S6Q A;  1U04 A;  4CJK A;  1NK6 A;  1BL3 A;  1L3U A;  3AVB A;  4B3O A;  2LSN A;  4CJ4 A;  3K5O A;  4BDZ A;  1UA1 A;  1X9S A;  3DLG A;  1SKW A;  2BGG A;  2F8S A;  3TI0 A;  2KZM A;  1C0U A;  3ZSO A;  3KK1 A;  4JRP A;  2F8T A;  3O4N A;  4E7J A;  1LW0 A;  4I9Q A;  4FJ8 A;  3A2F A;  4CF9 A;  4DLE A;  4CJE A;  4O4G A;  3V9U A;  1J54 A;  2Z1I A;  4CEO A;  1NK5 A;  3AVC A;  4CIF A;  4FLT A;  4E7L A;  1NJZ A;  4CES A;  3DOL A;  4O0I A;  3D0P A;  1WSH A;  3DM2 A;  3P5J A;  1IKW A;  3ZSY A;  1HQE A;  4E89 A;  3PY8 A;  4Z4F A;  1B92 A;  4E1M A;  2P5O A;  1RDD A;  2B5J A;  2VWJ A;  4F8R A;  1QE1 A;  4B8C A;  2HNZ A;  3LAN A;  4AIL C;  4B9T A;  2XHB A;  3SZ2 A;  4DLG A;  2GV9 A;  3HYF A;  4ZHR A;  4DSK A;  4DQR A;  3MXM A;  3LP3 A;  3NCI A;  4M45 A;  4RW9 A;  3OYL A;  4Z4H A;  2Q3S A;  4QOZ B;  1D9F A;  4OGC A;  1S6P A;  3IRX A;  1LWC A;  2OPS A;  2YKM A;  3QO9 A;  5SZT A;  4DSI A;  1ZBI A;  4FZX C;  1TKX A;  1VSI A;  3ZSV A;  4CHN A;  3PX6 A;  4J2B A;  3U3Y A;  1HNV A;  4N47 A;  3OYH A;  3KIO A;  2G8H A;  2YKN A;  5HRR A;  4KTQ A;  4EP4 A;  2RPI A;  4BWM A;  3ISN C;  4OJR A;  2A1R A;  4AHS A;  3ZSZ A;  4KHW A;  1KLN A;  1MU2 A;  3NF9 A;  1QQC A;  3SV3 A;  4AHU A;  1KSP A;  3DRS A;  4B8A B;  2IC3 A;  4E7K A;  3O3F A;  2E6L A;  5CYQ A;  1W9H A;  4RW6 A;  3PV8 A;  3QIP A;  4ZTJ A;  4KI4 A;  1YVU A;  5CYM A;  3VQD A;  4E1N A;  2D5R A;  4KHU A;  2X6N A;  3AVI A;  3ZCM A;  2Z1H A;  4M3W A;  3K57 A;  1ITG A;  1JLA A;  4CHQ A;  2O4I A;  3AO4 A;  4CHP A;  5KGW A;  4CEA A;  4CJQ A;  3OYG A;  3IG1 A;  1RTH A;  3TWH A;  1NOY A;  2HHW A;  2KW4 A;  4DSE A;  4CK1 A;  3V1R A;  3V81 A;  4I2Q A;  1KVA A;  3JYT A;  2PZS A;  4I9L A;  3LPU A;  3OYD A;  4CJR A;  1JLQ A;  3K59 A;  3OVN A;  1CXU A;  4RW7 A;  5D3G A;  3L3U A;  4LSN A;  3SQ0 A;  3VQA A;  4CJW A;  5JS2 A;  4NCA A;  1TAU A;  1B9D A;  1JLE A;  4AHT A;  4HTU A;  5DK5 A;  1QSL A;  2FBT A;  4CEE A;  1RT7 A;  1ASW A;  3CQ8 A;  4CCH A;  4KI6 A;  1YTA A;  3LWM A;  3NE6 A;  5T7B A;  1C1C A;  3S3O A;  3AO3 A;  3KD1 E;  3O3G A;  4BAC A;  3NGY A;  4M3U A;  3OYM A;  1BHL A;  3MXJ A;  5J2P A;  1UA0 A;  3T3F A;  4CFA A;  4N76 A;  1RIL A;  4H4M A;  3RR7 A;  2QKB A;  1VK0 A;  1IG9 A;  1LWE A;  3BGR A;  3S9H A;  4FK4 A;  3O4Q A;  3L3V A;  1DTT A;  2G8K A;  2OPQ A;  1S1V A;  3B6O A;  4M42 A;  4KHY A;  2FBX A;  3VA3 A;  3SQ4 A;  2BDP A;  1CXQ A;  4DQI A;  4W5N A;  1JL2 A;  4Z0U A;  1FKP A;  4PUO A;  3EYZ A;  1C0T A;  2HHV A;  2W42 A;  4J2E A;  4DSJ A;  2YV0 X;  4QAG A;  4KAZ A;  2WOM A;  2RN2 A;  3VQ8 A;  4CFB A;  4H8K A;  5HRP A;  4YFU A;  3QNN A;  4CF2 A;  1LW2 A;  4RW8 A;  3TAQ A;  3D45 A;  3RRH A;  4CJ3 A;  2NUB A;  1NKC A;  3K58 A;  2XO7 A;  3HPG A;  4FLV A;  2HVH A;  1K6Y A;  1J53 A;  1F21 A;  1S9E A;  3SUN A;  4CJF A;  4W5O A;  4LD0 A;  3C95 A;  3ASM A;  3CM6 A;  4OKK A;  1BIZ A;  4CEQ A;  4B9U A;  1BQM A;  1XWL A;  2RF2 A;  3KKS A;  3RR8 A;  1KVB A;  1TKZ A;  1REV A;  3DI6 A;  3HPH A;  3ZSX A;  3OYC A;  4DQQ A;  1GOA A;  1RBU A;  3LP1 A;  3SV4 A;  1Y97 A;  1WSG A;  3QEW A;  3V4I A;  4J2A A;  5CY4 A;  1ZBH A;  2FBV A;  3HP6 A;  3ULD A;  1ASV A;  4CEC A;  3P1G A;  5J2M A;  4KPY A;  1LAW A;  4LH5 A;  5CZ2 A;  3VQ4 A;  3QES A;  1L3V A;  4C8K A;  4KRE A;  1DLO A;  5HLF A;  1NJY A;  5KGX A;  2OA8 A;  1CZ9 A;  1WSJ A;  4FM2 A;  2HHX A;  3KLH A;  4N56 A;  4ELV A;  1GOB A;  4CGG A;  2IOC A;  3TAB A;  2G8V A;  3EZ5 A;  1SL2 A;  4B9L A;  2D0A A;  1Z25 A;  2EHG A;  4KFB A;  3LAL A;  4AHV A;  4CF0 A;  4DU3 A;  4HUF A;  3SPZ A;  2G8I A;  4C8O A;  2HNY A;  1HRH A;  4CF8 A;  3QIN A;  1QTM A;  4KHS A;  1B9F A;  3VQC A;  4O55 A;  1EX4 A;  1KTQ A;  3KLF A;  3KK3 A;  3QEI A;  3RMC A;  3OYI A;  4N5S A;  3OYB A;  2DFH A;  1A5X A;  4DFM A;  1RCH A;  4OKJ A;  4FLX A;  3NF7 A;  2R7Y A;  1WLJ A;  1Q9Y A;  1RBS A;  2IDO A;  2I5J A;  1ZBU A;  4M41 A;  1HJR A;  1NKB A;  4OLA A;  4CEB A;  3MAQ A;  4GW6 A;  4L8R B;  1KCF A;  4FJ9 A;  4HUE A;  3AV9 A;  3NAE A;  4F2S A;  4UQG A;  4DSF A;  1VSM A;  2FBY A;  3E01 A;  4CJS A;  3OYF A;  4HUG A;  2P5G A;  3JSM A;  3DLK A;  4OKE A;  1QSS A;  3QIO A;  2KQ2 A;  1SKS A;  3OYN A;  1X9W A;  1EP4 A;  3AVJ A;  1ZBL A;  2HW3 A;  3SI6 A;  2D0B A;  4CHZ A;  1KFS A;  1I39 A;  3M8P A;  4CIG A;  2OYQ A;  3V9X A;  1TL1 A;  3TR8 A;  3DYA A;  3QEV A;  3AVF A;  3KD5 E;  1RNH A;  3K5M A;  1J5O A;  3AVA A;  1TGO A;  2Z1G A;  4KHQ A;  3NGZ A;  3OYK A;  1NK8 A;  4HHT A;  3AO2 A;  4DF4 A;  4M3Z A;  4CE9 A;  1TK8 A;  4PWD A;  2XY6 A;  1BI4 B;  4J2D A;  5KRT A;  3SQ2 A;  3T1A A;  5J2N A;  3KKR A;  3VQ9 A;  4FW1 A;  3AVH A;  3HJF A;  1VRU A;  3L2W A;  2F96 A;  3DRP A;  4FLZ A;  3RWU A;  2Z1J A;  1RT1 A;  1S9G A;  4IFV A;  1X1P A;  3L2Q A;  4B9N A;  4F2R A;  3NHG A;  1BCO A;  4C8M A;  4DTP A;  2PY5 A;  4LY7 A;  3L2V A;  1RBR A;  3U6F A;  4B9S A;  4M3T A;  4CJ5 A;  4CGJ A;  3I8D A;  1TKT A;  3OJU A;  4FJM A;  4NYN A;  5I3U A;  1JLB A;  2DFF A;  2X78 A;  4DTR A;  2Y1I A;  2ZE2 A;  4R5P A;  2E6M A;  3OS2 A;  4FJL A;  1NOZ A;  2BAN A;  2QXF A;  5KRS A;  3G10 A;  3PO4 A;  3TAE A;  4DTX A;  1QHT A;  3B6P A;  3NH1 A;  1N5Y A;  3HT3 A;  2DTU A;  4ID5 A;  1SL1 A;  1EKE A;  1TK5 A;  2DFE A;  1NK0 A;  1T03 A;  1VSE A;  2HHT A;  3RMD A;  1A5W A;  3CYM A;  4IBN A;  3LZI A;  3QLH A;  2B6A A;  4BDY A;  4FZZ A;  1JL1 A;  1C1A A;  2VWK A;  1TK0 A;  2PYJ A;  4NYF A;  1FXX A;  2D0C A;  3SJJ A;  2KFN A;  1HYS A;  1D8Y A;  3DLR A;  4JRQ A;  1NKE A;  3K5N A;  1XHZ A;  4K8X A;  3QEX A;  4CK3 A;  1SV5 A;  3I0R A;  4OLB A;  2HB5 A;  2G8U A;  4KTZ A;  2OPR A;  4DTM A;  3VQP A;  4CF1 A;  4CJT A;  4DFK A;  1L3S A;  1S1W A;  4ID1 A;  2P51 A;  1EET A;  1TAQ A;  3VQ6 A;  2Y1J A;  4EZ6 A;  1D5A A;  1RDC A;  4FK2 A;  2X74 A;  4C8L A;  1RT3 A;  3ZT2 A;  4FJH A;  5SWM A;  1BIU A;  1I3A A;  1WAF A;  3P83 D;  4CEZ A;  1YT3 A;  2OZM A;  1SKR A;  3HK2 A;  1ASU A;  3VQE A;  4CGH A;  3SYZ A;  1Q8I A;  3AVM A;  3ZSW A;  2QK9 A;  3TAF A;  4AHC A;  3CFP A;  1U4B A;  3L2U A;  4C8N A;  5HRN A;  3CFR A;  1WSE A;  3PX4 A;  4EP5 A;  3NBP A;  3PO5 A;  4JS4 A;  3V1Q A;  3WNH A;  4IG3 A;  1KVC A;  2YNI A;  2B4J A;  1YTU A;  1ZBF A;  3QNO A;  1VSK A;  1WNS A;  1RBT A;  1T05 A;  3K2P A;  4NCG A;  2IAJ A;  5HRO A;  1DTQ A;  2GUI A;  3LAM A;  5FRN A;  4KO0 A;  3AA5 X;  4W5R A;  1HYZ A;  4CEF A;  4DU4 A;  2VG6 A;  5J1E A;  2G8W A;  4O0J A;  2JGU A;  4I2P A;  4CIE A;  3KLG A;  1U45 A;  4E0D A;  4FCY A;  4KB0 A;  3S3N A;  3TAG A;  4FYD A;  2BE2 A;  4ICL A;  2RKI A;  4MQ3 A;  3NH2 A;  4CHY A;  5C24 A;  3ZT4 A;  4DTJ A;  1A5V A;  5HRS A;  1RTI A;  4E7H A;  4CGI A;  3VA0 A;  3MEC A;  1S1X A;  4FJK A;  1VSH A;  3THV A;  3AVN A;  4CER A;  3RTV A;  4ZTF A;  3S3M A;  3C6T A;  1RT4 A;  4CJL A;  1X9M A;  4RW4 A;  4Y1D A;  4RG8 A;  2XRI A;  5EU7 A;  1C6V A;  4B9V A;  3V9W A;  4O5B A;  3VQQ A;  3TAN A;  1NJX A;  4CK2 A;  1XC9 A;  1N6Q A;  2YNH A;  1FKO A;  3C94 A;  4E3S A;  4XIU A;  4KTW A;  4Y1C A;  5JS1 A;  1TL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...