4CGFA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
148
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 56
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cgfA00
3NF6A 3B6PA 3V9ZA 3SJJA 4B9TA 4M3YA 2IDOA 2D5RA 4HUEA 1LWEA 4CK2A 3QO9A 4LSNA 2X6SA 2HB5A 4FLUA 5EU7A 4BE0A 1SL0A 1Q9XA 3VQEA 2B6AA 4DFJA 2XY8A 2VWJA 3KK1A 2JGUA 3EYZA 3OJSA 3O3FA 4CJ5A 2OPRA 1TV6A 2ZD1A 3TAMA 3V9UA 3SUQA 3L2VA 1I39A 4FJIA 1KLNA 4CEZA 4NCGA 5HRPA 3T3FA 4CJEA 3NF8A 3OS2A 2YNHA 3QNNA 1TK0A 2DFEA 1VSKA 3DOKA 3LWMA 4CE9A 3D0PA 4QAGA 2ZQBA 3DRSA 4WE1A 2G8KA 1S1TA 1O1WA 4CHPA 4CHYA 1KTQA 1DTQA 2G8HA 5CZ2A 3AA5X 2G8UA 4J2AA 4Z4FA 4AHSA 3MAQA 4GVMA 2B5JA 3AVCA 4CJSA 1WSFA 4DU3A 3KD1E 3PUFA 2E4LA 4OJRA 3QEIA 3AA2A 1IKXA 1VRUA 4FW2A 4B9SA 3OY9A 1JLBA 4CJFA 2RF2A 3U6FA 4K8ZA 2D0AA 1LW2A 3VQ6A 2IS3A 4KI6A 4RW9A 3HO1A 4FZYA 1MU2A 4CEFA 3K57A 4BE1A 1VSIA 3DLGA 4PA1A 1Z26A 3KLGA 3QEPA 2HHUA 1BI4B 4Y1DA 4CEQA 4CFAA 4E89A 3SQ1A 3RR7A 1TVRA 2A1SA 4I9LA 4MQ3A 5CY4A 3OYLA 4DS5A 5J2QA 4FM1A 4W5QA 1R0AA 3HM9A 3PO5A 2FBXA 2YKMA 4Q5VA 5FRMA 4GMJB 4RG8A 4B8AB 3KD5E 4F8RA 3RMBA 1GOCA 3LP1A 2OZSA 4J2DA 3QEWA 4HVJA 3V6DA 3E01A 3P1GA 3VA0A 1RILA 1S1UA 3AV9A 4LY7A 1BCMA 1TKXA 1VRTA 4Z4CA 4Z4HA 3ITHA 1IKYA 3QINA 1SUQA 3ASMA 4CJ3A 3OYAA 3C95A 4F2SA 4OPKA 3AVMA 4DSEA 2WONA 2B4JA 1NK5A 5HRSA 4CHNA 3SQ4A 3OYBA 2F96A 4H8KA 4C8OA 3LAKA 1S9GA 3V1RA 4BACA 3SI6A 4M42A 3KKSA 5JS1A 4LH5A 4FK0A 4DSJA 3AVBA 5E41A 3NCIA 3F73A 4ID5A 4BE2A 4KHUA 4H4OA 4CIGA 3AO3A 4ZTJA 2KZZA 1XHXA 3DMJA 4O4GA 3K2PA 5CYMA 3RR8A 2G8WA 3ZCMA 3S9HA 4KB1A 3HP6A 1X1PA 4YNQA 3V9SA 2PYJA 4O44A 4CHQA 3DM2A 1NK4A 1TKTA 4FJ7A 2Z1GA 4CGJA 4JRQA 4DTXA 1HNVA 4C8KA 1X9MA 2JLEA 2HNDA 3EY1A 3QNOA 5D3GA 4CHZA 1N6QA 1IG9A 4M3XA 3DYAA 3DLHA 3OYKA 4AHRA 4MFBA 1RT5A 4FJNA 3AO1A 3NBPA 4KTZA 4DF8A 4IKFA 4O55A 4FJJA 4KPYA 1UA0A 4CECA 4HHTA 4JRPA 3SPZA 3L2QA 3SCXA 4EP4A 1HQUA 1FKOA 5JS2A 2X74A 4CFCA 3BDPA 2VG5A 1RDCA 4B9UA 3I0RA 3LANA 1HNIA 2RPIA 3AA4A 3DLKA 1L3UA 4Q0BA 1RCHA 3AVJA 2XO7A 1B9DA 3ALYA 1SL1A 3IAYA 1UAXA 2BANA 1I3AA 1ASVA 1U45A 1S6QA 4W5NA 1RT7A 2HHTA 1HYZA 5J1EA 3MEEA 1NKCA 5T7BA 3HJFA 4CGGA 3KLFA 1RTDA 2PYLA 3NFAA 4NYFA 3L2WA 1C6VA 3QETA 1TAUA 3C6UA 4BWJA 4KAZA 1FK9A 1GOAA 3VQBA 2BE2A 1A5WA 4CFDA 4FJMA 3QLHA 4Y1CA 3AO4A 3V4IA 4CJQA 3TABA 1IKWA 4TSXA 5CYQA 2X78A 4FCYA 3LP0A 3AVLA 4CF8A 3V9WA 5C42A 1RT2A 4FJLA 1KSPA 1UOCA 4OKEA 5HLFA 1U4BA 4DFKA 1HRHA 4DQSA 1HQEA 1JLCA 3JSMA 4CJRA 4FJGA 2LSNA 3HPGA 1QSYA 1JL1A 3AVHA 4FVMA 3CQ8A 4EZ6A 3P5JA 1RBUA 3HPHA 4RW4A 1ASWA 4CIFA 2X6NA 1Q9YA 4E7IA 1BQMA 3DLRA 4ZTFA 3PO4A 2Z1HA 1WAJA 2YNGA 4KHWA 2XY5A 4M3UA 5FDLA 2FBVA 1XHZA 1D9DA 2RKIA 4CESA 4PWDA 1TL1A 5HBMA 1FKPA 3KIOA 3WNGA 4AHUA 3L3VA 1J53A 3ZT0A 1TK5A 4FXDA 1JL2A 1VSDA 3HSTB 3MEDA 1D8YA 4J2EA 3C94A 4IG0A 1ZBIA 1LW0A 1X9SA 1EKEA 3VN5A 4CHOA 2KW4A 3KLIA 3HPOA 4CJLA 3DRRA 1QS4A 1Q8IA 1BIUA 2OPPA 1HMVA 4O5BA 1BIZA 2HVHA 1ZBUA 4FM2A 1T7PA 3G0ZA 1SL2A 1BGXT 2OPQA 1C0UA 2W42A 1C1BA 1S1WA 2BGGA 2KZMA 3AVFA 3CFPA 4KFBA 2G8IA 3IS9A 4CF9A 4CJKA 1D9FA 3AVAA 1CXUA 3QEVA 5HRNA 1RBVA 4DTJA 2KQ2A 3PX4A 3O3GA 4DTMA 3F9KA 1BQNA 1A5VA 3VQ9A 3C6TA 4EP5A 3VQDA 3TARA 4FJ9A 1KCFA 4CGIA 1VSEA 4Z0UA 3NE6A 3OS0A 2F8TA 4B9NA 3SZ2A 4CGHA 2GV9A 3K59A 3JYTA 2P1JA 2ETJA 3H08A 4DFPA 3QIPA 1X9WA 4RW7A 2QK9A 2Y1JA 3SPYA 4CF2A 4LD0A 3HK2A 1ASUA 4DWIA 2HMIA 2HHQA 3OS1A 2GBZA 2A1RA 1J9AA 1UWBA 1HPZA 4I9QA 2ZE2A 1KVAA 2Z1IA 5KGXA 4OPJA 4K8XA 2DFFA 4I2PA 4PUOA 4OKJA 1S1VA 1RTJA 4FLVA 4OKKA 2NUBA 2PY5A 1S5JA 5DK5A 2HHVA 3LZJA 4NYNA 1F21A 4DSFA 4OLBA 4W5RA 3U3YA 1A5XA 4ZHRA 1WAFA 4H4MA 1TKZA 2DFHA 4CK3A 4AH9A 4CJ4A 1S6PA 1TL3A 4AHCA 4W5OA 2Y1IA 3RMDA 1U49A 3PY8A 1NK6A 3ZSRA 4HTUA 3TWHA 1L3VA 2I5JA 3LP2A 4DSKA 2HVIA 5KRTA 1QQCA 1D5AA 1VSLA 4DQQA 1XI1A 1REVA 3T19A 3CYMA 3OYDA 3SQ2A 1HJRA 5KTQA 3EZ5A 1WNSA 4W5TA 3AVKA 3P83D 4I2QA 1UA1A 4F2RA 3LPUA 2OYQA 4LH4A 2VWKA 3KLEA 1U04A 3NH0A 4NCAA 2KFZA 3NHGA 4B8CA 1JLQA 3ZT3A 4O0IA 2Q3SA 2P5OA 1GOBA 3NF7A 4XIUA 3KJVA 4IBNA 3VQAA 1B92A 1XWLA 3CG7A 4DU4A 4J2BA 1JKHA 1RDBA 3ZT2A 4E7HA 3SQ0A 4JS5A 5J2NA 2KTQA 3VA3A 4G1QA 1QTMA 3NGIA 4EZ9A 1HYSA 4M3RA 3CM5A 1LWCA 3CM6A 2E6MA 2HW3A 1BL3A 1VSHA 1RT1A 3QERA 2G8FA 4IFVA 4HUGA 1N5YA 4FK4A 4RW6A 3OYNA 3HVRA 2YHAA 2QXFA 4CEOA 4E7LA 4DSLA 1LWFA 4FZZA 4DFMA 1J54A 4B9VA 3SUOA 1WSHA 3L2UA 1VSFA 3KK2A 2P5GA 1RTIA 4DF4A 3NGYA 4N76A 4QCLA 4KB0A 1CZBA 1WSGA 3VQ7A 2AJQA 1T8EA 2HNYA 4FJKA 3MXMA 4FJXA 3SUPA 1NJXA 2HHSA 4Z4GA 3S3OA 3ZSZA 4KV8A 3MXIA 3O3HA 3RRGA 4F3OA 4M3TA 3M8PA 4ICLA 1ITGA 4AILC 1C0TA 2YNIA 3LZIA 1JXEA 1VSMA 3K5LA 1QSSA 4FLYA 2WOMA 2YKNA 4E19A 1S9EA 4CK1A 3RMCA 1LV5A 3ZSXA 2P51A 1EP4A 3CFRA 4CF1A 4CGDA 4CJTA 4Z4IA 4F3TA 3SNNA 3SUNA 1BI4A 1CXQA 4CFBA 3SYZA 1C0MA 1LAWA 4CEAA 4QOZB 2FC0A 4CGFA 1NOZA 1RT6A 4IG3A 1NKEA 2Z1JA 4M45A 2QKKA 3MXJA 2XY7A 1FXXA 4CEBA 1Z25A 1NK8A 4O0JA 3IG1A 3MEGA 4I7FA 3AVNA 5DMRA 3ZSOA 3HT3A 4FZXC 4AHTA 3OVNA 3QESA 5C25A 1YTUA 1G15A 2EHGA 3LWLA 3QEXA 4C8MA 3RTVA 1NJYA 3OYEA 5HROA 1RBSA 4CJWA 1NOYA 1RT3A 2PZSA 1KFDA 5FROA 1YTAA 3KK3A 1VSJA 1K6YA 4BDZA 4DTPA 3QIOA 3DLEA 1T05A 3DLBA 4CCHA 1JLEA 3AA3A 4CERA 4FM0A 3PX0A 4FLZA 4DLGA 1KLMA 4E7KA 4DS4A 4JS4A 3KLHA 3HXMA 4CJPA 2RN2A 4DTSA 2GUIA 3OYFA 4F4KA 4OGCA 4E3SA 3LP3A 3NAEA 3M8SA 3PV8A 4DSIA 5I42A 1SV5A 1SKWA 3VQPA 4FLXA 5SZTA 1BISA 4KRFA 4B08A 3NH1A 1YT3A 2XHBA 2EX3A 3O4QA 3SV3A 1QSLA 2FBTA 3V1QA 1JLAA 5KGWA 3ISNC 4FLWA 4LSLA 2XY6A 4CEDA 3RRHA 1WLJA 3S3MA 3TAGA 4BDPA 5J2PA 4DTUA 1CLQA 1TGOA 4DTRA 2YNFA 3VQ8A 4CIEA 5CZ1A 3KKRA 3SV4A 3TI0A 4KTQA 4CJVA 3I0SA 3I8DA 2DTUA 2YV0X 4C8NA 3TANA 3K5MA 5SWMA 4FLTA 1NK7A 4FJ5A 4L8RB 3KTQA 2VG6A 1EX4A 3K58A 2ITGA 4NCBA 4OGEA 3U3GA 4UQGA 1KVCA 3THVA 4DU1A 1TKDA 3DRPA 4ID1A 2IC3A 1KFSA 1WN7A 3V81A 2IOCA 2ATQA 4FJ8A 1L3TA 3HL8A 1U48A 3LPTA 4N47A 1WSJA 3S3NA 1C1CA 3AVGA 3MECA 5HRRA 3ZT1A 3TAQA 5C24A 1SKRA 5KI6A 4DQPA 4B9LA 3TAPA 1IH7A 1RNHA 1WSIA 1RTHA 4OLAA 4RW8A 3WNEA 3AO5A 1NK9A 3ZSYA 4R5PA 1J5OA 2OA8A 2QKBA 3AO2A 4N56A 1L5UA 1W0HA 4ELTA 1ZBHA 3OYHA 4B3OA 1KRPA 3HVTA 4HCCA 4E1NA 3VQCA 3LDSA 1QHTA 1S1XA 3L8BA 4ELVA 4ELUA 3D45A 3ZSWA 1EETA 1DLOA 2HHXA 1QE1A 4IFYA 3OJUA 1RT4A 3NDKA 3HYFA 1SKSA 3NF9A 1HYVA 5K14A 3ZSVA 1ZBLA 1C1AA 3OYMA 4CF0A 1Y97A 3A2FA 3ULDA 1NKBA 1U47A 2D0BA 4AHVA 4JLHA 4DQIA 4KHQA 2FBYA 4DLEA 1RDAA 3IRXA 1JLGA 3K5OA 2IGIA 4KO0A 4YFUA 5FRNA 3WNFA 2KFNA 3L2RA 4BWMA 3FFIA 1VK0A 4FW1A 2O4GA 4KREA 3ZT4A 3B6OA 4FYDA 4BDYA 1LAVA 3M8QA 3OYIA 3OYGA 1IKVA 3RWUA 1EXQA 3WNHA 1WSEA 3TAEA 1JXBA 1IO2A 3NH2A 4KKOA 4B9MA 3CFOA 4HCBA 4PY5A 4OVLA 4CJUA 3OYJA 1TK8A 3OYCA 3DOLA 4DQRA 1YVUA 1BHLA 3VQQA 2HHWA 2R7YA 3BGRA 1RBTA 3NGZA 4FJHA 4Z4EA 1NJWA 1JLFA 2VG7A 3HP9A 4DTNA 4E0DA 4PQUA 2BDPA 4M3WA 4KHYA 3T1AA 4KHNA 3ZSQA 5KRSA 1NJZA 3RMAA 1KVBA 1TAQA 1ZBFA 4DTOA 4M3ZA 2DY4A 2OZMA 2HNZA 4M41A 4E1MA 5J2MA 5I3UA 2O4IA 4HUFA 4DMNA 1T03A 4KI4A 4N41A 2YHBA 3G10A 3VQ4A 3M8RA 4KTWA 4GW6A 3LAMA 3V1OA 3UIQA 4KHSA 4C8LA 3LALA 4N5SA 3K5NA 2F8SA 1DTTA 2XRIA 3DI6A 5HP1A 3L3UA 4DG1A 1XC9A 1ZYQA 3VQ5A 4FK2A 3V9XA 2G8VA 2OPSA 1B9FA 2IAJA 3PX6A 1RDDA 1RBRA 4E7JA 3TAFA 4IDKA 1L3SA 1W9HA 3TR8A 3AVIA 1BCOA 3O4NA 4CEEA 1CZ9A 1NK0A 2E6LA 2D0CA
chains in the Genus database with same CATH superfamily
2Q97A 4ISGA 3GDQA 1QQOA 4DR5K 1LWEA 2QXLA 4GV3A 5EU7A 4BE0A 3VQEA 2HBKA 2XY8A 3CCVN 2ZD1A 3V9UA 3SUQA 2E88A 1KLNA 4NCGA 2QWLA 4CE9A 4QAGA 3DRSA 4WE1A 3SK3A 3THXB 3T7ZA 4CHPA 1DTQA 2G8UA 3D2FA 4DU3A 4CJSA 3PUFA 3ATUA 5AQMA 3AA2A 4JI5K 3OY9A 1JLBA 4K8ZA 3SAFA 4CBUA 4RW9A 2P9IA 4BE1A 2HHUA 1BI4B 4E89A 3CCSN 3SQ1A 1U6ZA 4MQ3A 4FWMA 4H5NA 1EQYA 4GMJB 4RG8A 4A2BA 3VETA 4B8AB 3QFUA 3RMBA 3LP1A 4J2DA 1N36K 4HVJA 3AV9A 3FR0A 3J80O 3AVMA 5AQLA 1GLEG 5CR4A 2NRXA 3CCJN 4BACA 3KKSA 4DR7K 4DSJA 4BE2A 3F73A 3AO3A 1XHXA 3DMJA 4O4GA 3K2PA 5CYMA 5FPDA 4YNQA 4CHQA 4JRQA 3DXKA 4DTXA 3H1VX 3LM9A 5D3GA 2RE2A 4CHZA 3T69A 2IIRA 3OYKA 1RT5A 3BF3A 4ILHA 1DT9A 4HHTA 2P9LA 2P9KB 3L2QA 1VQNN 1E3MA 2ZJRL 3I0RA 4Q0BA 3AVJA 1B9DA 1IJJA 3IAYA 2A6AA 1VQ9N 2D0PA 1HYZA 3CC2N 2HSTA 3LDLA 1C6VA 5FPMA 3QETA 1FK9A 4XH5A 3H45C 4FJMA 3AO4A 4CJQA 1IKWA 4CF8A 3V9WA 5E26A 2NRRA 5AQQA 3D2EA 4CJRA 3AVHA 3CQ8A 3HPHA 3SJHA 1Q9YA 4E7IA 3DLRA 2QWPA 2YNGA 5FDLA 1HNWK 2RKIA 3P4IA 1TL1A 3ZT0A 1TK5A 1RDUA 1JL2A 3MEDA 3C94A 1ZBIA 1LW0A 4CJLA 3DRRA 1BIUA 1BIZA 1ZBUA 4BC2A 1C1BA 1GLAG 3HSCA 4LF9K 3AVFA 4CF9A 3QB0A 3O9SA 4DTJA 2YHYA 4DTMA 1A5VA 3VQ9A 3TARA 1T6DA 4Z0UA 4HTLA 1V4TA 1NM1A 2GV9A 3K59A 1ESVA 1ATNA 2BTFA 2ETJA 4UY8O 4QS7A 4DFPA 4RW7A 4JKHA 3AGKA 3I55N 4DV3K 3OS1A 2GBZA 2OANA 1J9AA 4I9QA 1HPZA 2ZE2A 4OPJA 1TUYA 4I2PA 5FPEA 3GBTA 3CI5A 1YJ9N 1F21A 4W5RA 1A5XA 3UKRA 4ZHRA 1XMOK 1VQ8N 3MN9A 4AH9A 4CJ4A 3CC4N 4AHCA 4W5OA 1U49A 1NK6A 4FWNA 1L3VA 4DSKA 4FO0A 1N32K 1D5AA 1XI1A 3OYDA 3EZ5A 4JD2B 5AQOA 1UA1A 3P83D 4I2QA 3L0QA 3KLEA 4B1WB 4B8CA 3SBGA 4O0IA 2P5OA 2Q3SA 3BZKA 3NF7A 3SMSA 4IBNA 3VQAA 4J2BA 3PIOL 1RDBA 3SQ0A 5J2NA 3VA3A 4EZ9A 3QICA 1QTMA 3C0BA 3EE8A 2ASMA 2HW3A 3KVGA 3QERA 3ZX3A 4IFVA 5AQSA 2H3GX 4RW6A 4C1NK 4DCHA 1VSFA 1WOQA 3KK2A 4N76A 3RVCA 3E9LA 4LFBK 2QTDA 4FJXA 3K0SA 3S3OA 4NLCA 1N34K 2J4RA 1KC8O 1WBBA 1YAGA 3O3HA 4AILC 2YNIA 3LZIA 3K5LA 4EAHD 2P9SB 2WOMA 2YKNA 4E19A 3RMCA 4PL7A 3CD6N 3ZSXA 1TYQA 2P51A 4Z4IA 4CJTA 1C0MA 2O8DA 4QS8A 2FC0A 1VQ5N 4DR3K 4CEBA 1Z25A 3GG4A 4N41A 5DMRA 3LDNA 3LDQA 3QESA 5C25A 3QEXA 3RTVA 1NJYA 3IKMA 1RBSA 1NOYA 1RT3A 1KFDA 5FROA 3VPZA 3DLBA 3QIOA 3PX0A 4FLZA 1ATRA 4DS4A 1GLDG 5LJWA 4OGCA 3AY9A 3I8BA 2BH1A 3K9JA 1SV5A 1SKWA 1CZAN 4KRFA 4CJ7A 3HTVA 3NH1A 4B1ZA 3V1QA 2HMPA 3ISNC 3G25A 4LSLA 2XY6A 3CQXA 2UXCK 4RWTA 3RRHA 4BDPA 2HHHK 1TGOA 4DTRA 3C7NA 1RFQA 3KKRA 3I0SA 5EXWA 1XQSC 2I7NA 3ZEUA 3MDQA 4WQ4A 5AQXA 3TANA 1NK7A 3WQUA 2WUSA 4H0VB 4MO4A 4H0TB 3WEEA 4M63C 3K58A 2ITGA 4BC3A 4DU1A 3DRPA 4ID1A 2IC3A 4BRIA 2WC9A 5MLCQ 3V81A 2IOCA 3KWGA 4CZIA 4FJ8A 2E2QA 1U48A 1DGKN 2CH5A 1C1CA 3MECA 3ZT1A 3TAPA 1IH7A 2HBLA 1WSIA 1RTHA 4OLAA 1ZBSA 3LDOA 2QKBA 2E5LK 1L5UA 4GV9A 1W0HA 4E1NA 3GE1A 3F9MA 3L8BA 4ELUA 3D45A 4O5FA 4IFYA 1NU0A 1K73O 5JVHL 2O8BB 2V51B 4PKIA 5K14A 3ZSVA 2O8EA 3H3OB 3ULEA 1U47A 4AHVA 4KHQA 1YITN 3VTHA 1OH6A 2IGIA 1J5EK 4H5VA 2O4GA 4FL9A 2QWQA 1IKVA 3JXUA 1WSEA 3GOIA 4Y0WA 3TAEA 3TSQA 4YDUA 5BREA 1JXBA 4KKOA 4HCBA 4PY5A 3DOLA 4DHYA 4DQRA 2HBMA 4DV4K 4X65K 1G99A 4PQUA 4IO8A 3T1AA 3RMAA 1ATSA 1U2VA 3MWTA 3FFKB 5KPTA 4WFBL 2DY4A 4LFCK 2HNZA 4E1MA 3U9DA 4YOUA 1BWFO 2NNWA 3V1OA 3QBWA 3J8AA 4N5SA 4A5BA 2F8SA 1DTTA 3P31A 5AQFA 3L3UA 3S41A 4DG1A 1ZYQA 3V9XA 2G8VA 3DAWA 3WQTA 1RBRA 3O9RA 3TAFA 1W9HA 1NK0A 3BUZB 3IMXA 2OTLN 2E6LA 4IO9L 1EO1A 3B6PA 3V9ZA 4B9TA 5KQ8A 2IDOA 2D5RA 3QO9A 4LSNA 3KK7A 4JKBA 1IBLK 1Q9XA 2KLAA 2HBJA 4DFJA 4B1VA 3M5RA 4CZEA 4BGBA 4WQ5C 2OPRA 3HI0A 3BEXA 4FJIA 4H0OA 1BDGA 5JLFA 3D7EO 3QNNA 2YNHA 5AQWA 1VQMN 1VSKA 3DOKA 3DXMA 3D0PA 3GL1A 2G8KA 4J2AA 4AHSA 4B9QA 4GVMA 4IWVA 1WSFA 3CIPA 3QBXA 4FWRA 3VEVA 2E1YA 4K43A 4BR4A 3VQ6A 2IS3A 4KI6A 1M1KO 4H5RA 4IOCL 1MU2A 1VSIA 3C65A 3DLGA 4PA1A 1HNXK 1Z26A 1EWRA 3KLGA 4Y1DA 4CFAA 3NVKA 4DS5A 4FM1A 4W5QA 2P9NA 5AZIB 3PO5A 2YKMA 5FRMA 3KD5E 1NNEA 2OZSA 3E01A 1XC3A 3P1GA 3VA0A 1RILA 4JYAK 1BCMA 5EY4A 3ITHA 4CJ3A 3OBYA 2OCEA 1X3NA 3M1FA 1NK5A 3OYBA 4DV7K 4H8KA 3ZX2A 3LAKA 3UKUB 4F9OA 4LH5A 3NCIA 1C0GA 4KHUA 4ZTJA 1QHAA 3L6QA 1X1PA 3V9SA 2PYJA 4FSVA 5M1NA 1KAXA 3CJAA 4H03B 3QNOA 3QFPA 2FSJA 3DYAA 2ZWHA 4BRLA 4MO5A 4MFBA 1IBMK 3LM2A 3AO1A 3NBPA 4IKFA 4KPYA 4FJJA 1UA0A 5C2DA 4NXMK 1BO5O 4U7BA 5JS2A 4DUYK 2X74A 3BDPA 2VG5A 4GVEA 2RPIA 3AA4A 1L3UA 1SS6A 1RCHA 3U8XA 4M7YA 5AFUA 1UAXA 4W5NA 1ASVA 3C6HA 2HHTA 3ZETB 3VF4A 1K8KB 2PYLA 3NFAA 4DB3A 2GWKA 3VQBA 2NRVA 4CFDA 3QLHA 3EKUA 3CERA 3V4IA 4WFAL 4TSXA 5CYQA 1BOTO 3LP0A 3AVLA 5C42A 2YHWA 5EVZA 1KSPA 1UOCA 3THWB 3JSMA 2LSNA 3M3ZA 1QSYA 3P5JA 1RBUA 1ASWA 1Q18A 5IT9O 2FXUA 3VGKA 2W6LA 4ZTFA 4KH5A 4YOXA 1WB9A 1XHZA 1D9DA 4MLEA 4PWDA 3KIOA 4AHUA 3L3VA 1NJIO 3O9TA 3L4QA 1VSDA 4J2EA 1D8YA 4CZLA 4CHOA 2KW4A 1WBDA 1OVYA 1Q8IA 2O8CB 1HMVA 2HVHA 3MN6A 1SL2A 1BGXT 2OPQA 1M90O 2KZMA 4MLHA 3CFPA 4CJKA 3AVAA 1CXUA 2YI1A 3QEVA 5HRNA 1RBVA 2KQ2A 3F9KA 1E4FT 3VQDA 4IEIA 1VSEA 3NE6A 2F8TA 3E9PA 4B9NA 2GELA 1YHQN 1VQKN 3A0IX 1Q82O 3H08A 3R6MA 3QIPA 5AR0A 3SPYA 4LD0A 1ASUA 3T1YK 2HHQA 3FZLA 3OHRA 2GUPA 2YJFA 2WTUA 5AQUA 4PKHA 1KVAA 2Z1IA 4BR9A 3NMUA 2NUBA 2PY5A 1S5JA 2HHVA 4NYNA 4OLBA 3M6GA 1TKZA 2DFHA 3CHWA 1S6PA 1TL3A 3H1QA 2I5JA 3LP2A 3N4QA 4A59A 2HVIA 1QQCA 5ADXA 1OH7A 1VSLA 1REVA 3CYMA 1HJRA 1NGCA 3VEOA 1WNSA 4W5TA 4RCHA 3AVKA 4F2RA 1HR0K 2VWKA 3NH0A 3CJ7A 3SLCA 3U9ZA 1JLQA 3ZT3A 3CMAN 3Q7BA 5M1QA 3A5NC 3R8EA 3D2FB 4A5AA 4DU4A 3FE1A 3VTIA 2KTQA 4JI8K 3ENBA 4EHTA 3NGIA 5GAHP 4ISEA 1HYSA 1ZC6A 4M3RA 1LWCA 4JEPA 3F2KA 4OPAA 4IOAL 3RSEA 2P9IB 4FK4A 3OYNA 2QXFA 4FZZA 3E1YA 4BRKA 1WSHA 3L2UA 4KB0A 3VQ7A 1WSGA 3ZLJA 2HNYA 2D0OA 1NJXA 2HHSA 4DR6K 3ATVA 4H5TA 3MXIA 2VGMA 4F3OA 3M8PA 5HOOA 3VERA 1QSSA 2F9WA 4AQYK 5LJVA 1JCEA 3VESA 1I94K 3A5MC 1EP4A 1P8ZA 5KQDA 4CFBA 4CGFA 1RT6A 5F1XA 2O8FA 1HKCA 1NK8A 4FZXC 3AVNA 5AQNA 3ZSOA 4AHTA 1YTUA 1G15A 2EHGA 4DR4K 4L3QA 5HROA 4CJWA 1DKGD 3KK3A 4DTPA 4CCHA 4JHDA 1JLEA 4DLGA 4JS4A 3HXMA 4JI0K 2RN2A 3OTOK 4F4KA 4E3SA 2QM1A 4HWIA 3NAEA 2P9LB 3HZ6A 3VQPA 4FLXA 1NGAA 1BISA 2XHBA 2EX3A 1JLAA 1DEJA 5BRHA 4CEDA 1WLJA 4OO1J 2JWKA 4WYBA 3TI0A 5BR8K 4FWQA 2V52B 3IUCA 3F5TA 3R3LA 4C8NA 1NMDA 3VEWA 3K5MA 3CJ1A 4V19S 3KTQA 1EX4A 4AF1A 4NCBA 1NGFA 3U3GA 5BPLA 1KVCA 1YUWA 3DLLL 3THVA 2UXDK 2V7ZA 4BR7A 3HL8A 3D2EB 3LPTA 3O1BA 4YORA 4PHTX 3AVGA 1SKRA 3EN9A 4DQPA 5BPNA 4RW8A 3WNEA 3AO5A 2CH6A 3ZSYA 4R5PA 1J5OA 3WXKA 3OYHA 5AQKA 5ADXH 1EETA 2NRHA 1VQLN 1Y64A 2QWRA 1QE1A 2HHXA 5FLXO 1RT4A 3HRGA 4OPHA 1SKSA 2P9SA 3MX5A 1HYVA 5AQYA 1YJWN 4IOXA 3VEYA 4CF0A 3A2FA 3ULDA 1NKBA 2D0BA 1BA0A 4JLHA 4DQIA 3IRXA 4K25A 5KPRA 3K5OA 3G71N 3CJCA 4JNEA 5FRNA 2KFNA 1HUXA 2AA4A 4H0XB 1LCUA 1VK0A 3CF5L 4FW1A 4KREA 4A2AA 3B6OA 1LAVA 1EXQA 4FWPA 3WNHA 4FWOA 1IO2A 1NGIA 4B9MA 4OVLA 1TK8A 4JV5K 3VQQA 2UUCK 4FJHA 3BGRA 1RBTA 4Z4EA 4YHHK 4CZHA 3J7YP 2QWNA 4DTNA 1NG9A 2BDPA 4M3WA 3ZSQA 5AQZA 1KVBA 1TAQA 1JCGA 4M3ZA 4BRNA 3TTCA 1K8AO 3FZHA 3UKRB 5LMNK 2O4IA 4HUFA 3O5BA 4LC9B 3G10A 4KTWA 4GW6A 4B3TK 4KHSA 3LALA 3WUHA 3K5NA 4YOWA 3KWIA 1W2BM 1T6CA 3VQ5A 1YI2N 3FZMA 4XH1A 4EHUA 1L3SA 3TR8A 4CEEA 1BCOA 3C95A 1CZ9A 4LF6K 3A5LC 4IZ9A 4M3YA 4BGAA 4K41A 1HJOA 4HUEA 2F9TA 4CBXA 4YOVA 2X6SA 2HB5A 2B6AA 5GINA 3FLCO 2VWJA 4B3MK 2YJEA 4CVNE 4GY2B 3O3FA 1MWMA 2GWJA 3TAMA 3L2VA 2Q1NA 4JI6K 4CEZA 5AJ3K 3OS2A 2ZQBA 3OW2M 1S1TA 1KTQA 2G8HA 5CZ2A 3AARA 2D4WA 3E66A 4JI2K 5AQTA 3AVCA 5AQPA 2E4LA 1VQON 3QEIA 4DV6K 4FW2A 4CJFA 5BN8A 2HF4A 1LW2A 4IJAA 3HO1A 4FZYA 1TYQB 1Z05A 4CEFA 3ZYYX 3QEPA 4E1JA 4CEQA 3THYA 2O8DB 3RR7A 1S3XA 4I9LA 3SAHA 4B3SK 1FW6A 5J2QA 4CZFA 2FBXA 3LDPA 4F8RA 1NGBA 1GOCA 1QZ5A 3QEWA 1VAZA 2EWSA 1S1UA 4LY7A 3MCPA 1T3VA 1VRTA 1IKYA 1SUQA 3ASMA 2E20A 4NB4A 4F2SA 1TUUA 4DSEA 5GIOA 1N8RO 2WONA 3UB5A 1NGHA 2B4JA 3SQ4A 3H6EA 2F96A 4M42A 1S9GA 2YX6A 3W0LA 3B8AX 5AZJA 5E41A 4CIGA 3RR8A 2G8WA 3ZCMA 5JICA 3CQYA 4DKWA 4O44A 1XMQK 1NK4A 4FJ7A 1TKTA 2Z1GA 4CGJA 1X9MA 1QZ6A 2HNDA 1J6ZA 4JN4A 1N6QA 1IG9A 3C7NB 3DLHA 1X3MA 5ELZA 4AHRA 3ZEUB 4KTZA 4M7XA 2V7YA 4DF8A 4O55A 4CECA 4BRAA 3CC7N 2IVNA 3WEEB 5C2FA 1HQUA 3SCXA 4B9UA 1RDCA 3LANA 1N33K 3DLKA 4FVUA 3ALYA 4EIAA 2BANA 1U45A 2ZJPL 1VQ7N 3MK6A 1VHXA 3MEEA 1BUPA 4B1YB 3HJFA 4CGGA 4NYFA 4BWJA 4BR0A 4KAZA 1GOAA 2BE2A 2KKZA 1HNZK 1LOTB 2X78A 3T1HK 4FCYA 4RTFD 1RT2A 4OKEA 4JI4K 1OH8A 1U4BA 5JLHA 2O8EB 1HRHA 4DQSA 2UUAK 1JLCA 4FJGA 4GNIA 3HPGA 4FVMA 4FOIA 1MWKA 3IDHA 4CIFA 2X6NA 3EL2A 3JS6A 2A3ZA 2Z1HA 5BR9A 4LF4K 2XY5A 4M3UA 1VQ4N 4BREA 4AM6A 1XNQK 4JKAA 2A5XA 4CESA 5HBMA 1FKPA 2ZJQL 1J53A 4FXDA 3HSTB 3AAPA 2UUBK 4IG0A 5C15A 4X64K 3VEZA 1EKEA 3VN5A 3J7AP 3HPOA 2W40A 4O5BA 1MDUB 4BRHA 4FM2A 1T7PA 2WFBA 1QVFM 2AP1A 1C0UA 2CGJA 2IVPA 1S1WA 2P9UA 3TU5A 4KFBA 4JI7K 1D9FA 3PX4A 3O3GA 1HKGA 1U2VB 1BQNA 4EP5A 1OH5A 4BVOA 4CGIA 4JKGB 3OS0A 4WCEL 2E2PA 5LL6Z 3SZ2A 4CGHA 2P1JA 5TKWA 1X9WA 2QK9A 2Y1JA 4O8KA 4GKJK 4BG8A 4BRDA 3O4WA 1SAZA 4PUOA 1JCFA 4OKJA 4FLVA 4OKKA 3LZJA 3VF2A 4DSFA 2P9PA 5EX5A 4H4MA 3ZETA 3G4SN 2Y1IA 3O08A 3RMDA 3BY5A 3TWHA 5C10A 4H5WA 5KRTA 3CCUN 3SQ2A 5KTQA 4A62A 2A40A 2OYQA 4FPAA 4BRGA 3TSPA 2YHXA 1GOBA 3KJVA 3CG7A 1JKHA 3W3DA 4BQLA 5AQJA 4JS5A 3CM6A 2E6MA 3EKSA 1BL3A 4XH4A 2G8FA 4HUGA 1N5YA 4E7LA 3HVRA 2YHAA 3H3NO 4CEOA 4DSLA 1LWFA 1J54A 3N4PA 2P5GA 4B3RK 1SZ2A 4QCLA 3THXA 1CZBA 2E2NA 4KH4A 3MXMA 4EFHA 3SUPA 2JWLA 2ASOA 3EZWA 1SQKA 4KV8A 3BZCA 1C0FA 3RRGA 1ITGA 1C0TA 1VSMA 4GKKK 4CK1A 1OVQA 4CGDA 3SUNA 1BI4A 3SYZA 1LAWA 4CEAA 5F0XA 4MDAA 1NKEA 2Z1JA 4M45A 2QKKA 4DR2K 4CBWA 4CD3A 2XY7A 4I7FA 3MEGA 3OVNA 3CCQN 4C8MA 4JK8A 3TTDA 3HOSA 2Q0RA 3OYEA 4I6MB 2GEMA 2VWBA 2E8AA 5BRFA 1VSJA 4CZKA 4DV2K 3AA3A 4FM0A 3CXCM 3MN5A 4CJPA 4DTSA 2UXBK 2GUIA 3OYFA 1Q7YO 1NGDA 4KH6A 4DSIA 2HOEA 5SZTA 4B08A 1KD1O 5AQHA 3O4QA 1QSLA 1VQPN 5KGWA 4FLWA 4PL8A 3S3MA 5J2PA 4DTUA 1CLQA 4KTQA 2YNFA 4CJVA 3I8DA 2YV0X 4WQ5A 3TSUA 4BRPA 1YIJN 2P9KA 4L8RB 2VG6A 1HLUA 1KFSA 1WN7A 1BG3A 2ATQA 4N47A 2A41A 1BU6O 5HRRA 1YF5L 3WT0A 1RNHA 4BC5A 1MA9B 4JAXA 3O80A 1NK9A 2OA8A 2HF3A 4N56A 1ZBHA 1KRPA 3HVTA 3QDKA 3LDSA 2ZGYA 1YVNA 3SMPA 3ZSWA 3DWLA 3OJUA 3HYFA 2UYTA 1C1AA 3C6AA 3OYMA 1Y97A 3P39A 4A57A 3CPWM 2FBYA 1RDAA 3TPQA 4JKEA 4KO0A 3WNFA 3L2RA 4BWMA 4YY3K 3ZT4A 3KHYA 3OYGA 4LF8K 2FF3B 3ID8A 5AFUH 3O6WA 3CFOA 3O8MA 3EO3A 3OYCA 1YVUA 3FZFA 3LL3A 3MN7A 2VG7A 3HBTA 2PBDA 1NJZA 2VYPA 1GLFO 1ZBFA 2OZMA 1HPMA 5A2QO 4CD1A 5J2MA 5I3UA 4KI4A 4YOYA 2YHBA 4JI1K 3R1XA 3UIQA 3BP8A 4BROA 4C8LA 2XRIA 4A61A 1Z6RA 1XC9A 5AQGA 1P90A 5C12A 5M1FA 4FK2A 2OPSA 2IAJA 3HM8A 2ZF5O 2YCHA 3Q7CA 4ISFA 3AAQA 3O4NA 3A5OC 3NF6A 3SJJA 3DXKB 3FGUA 3CCRN 4CK2A 4BRQA 4DQ8A 4FLUA 1SL0A 3KK1A 3EEQA 2JGUA 3EYZA 3OJSA 4WQ4C 4CJ5A 1TV6A 1RDWX 1I39A 5AQRA 3H46O 3PSFA 5HRPA 4JD2A 3RSEB 3T3FA 4CJEA 3NF8A 1TK0A 2BUPA 2DFEA 3LWMA 3WXJA 4GV6A 5KPZA 1OKJA 1O1WA 4CHYA 4Z4FA 5I9EB 2CGLA 3AA5X 3J7ZO 1IG8A 5E84A 3MAQA 3K9KA 2B5JA 1R59O 3KD1E 2F7TA 4OJRA 3D6RA 3DJCA 1IKXA 1VRUA 3A8YA 4B9SA 2RF2A 3U6FA 2NZTA 2NLXA 2FSNA 2D0AA 3ID6A 4K42A 2KHOA 3K57A 1RGIA 3VGLA 5LMUK 4DUZK 1TVRA 2A1SA 2I7PA 5CY4A 3OYLA 3WXLA 2O8FB 1R0AA 3HM9A 4Q5VA 2QEXN 4BVPA 5DM6L 3R9PA 3V6DA 3VF6A 4Z4CA 1TKXA 4NXNK 4JHDB 4Z4HA 3QINA 3OYAA 4YDUC 4JKDA 4OPKA 3SBTA 1K9MO 5HRSA 4KHPK 4CHNA 5AQIA 4ILGB 1KAYA 5CE3A 1BA1A 4C8OA 3V1RA 3SI6A 4B1XB 5JS1A 4ILJA 3VGMA 4FK0A 4NLBA 2E2OA 3AVBA 4WFNL 4ID5A 4H4OA 2KZZA 5DM7L 5FPNA 4KB1A 3S9HA 3HP6A 3QMLA 2RHKA 3DM2A 1HNVA 4C8KA 2JLEA 3EY1A 3IFRA 3TTFA 3PIPL 4M3XA 3I33A 1HX1A 2VQFK 2W6KA 3J81O 2QWMA 4FJNA 2IVOA 5IWAK 3CCEN 2DPNA 1V4SA 4FWLA 4JRPA 3SPZA 3NVMA 1E4GT 4EP4A 1FKOA 4CFCA 1NGJA 1HNIA 2XO7A 1SL1A 1I3AA 1S6QA 4DR1K 1RT7A 4CZJA 5J1EA 4KBOA 4BY9C 1NKCA 1ZXOA 5T7BA 3KLFA 2UU9K 5M1KA 1RTDA 4DV5K 3L2WA 1TAUA 3C6UA 2Q31A 2FLOA 1A5WA 4Y1CA 2ZGZA 3TABA 3AGRA 1D4XA 2WBNA 3CJBA 4FJLA 5HLFA 4DFKA 1HQEA 1KAZA 1IV0A 1JL1A 4EZ6A 4BR5A 4BQZA 4RW4A 1BQMA 4FOEA 3L4IA 3PO4A 1WAJA 3VMFB 4KHWA 2FBVA 4NO7A 4BRMA 3ENHA 1T44A 3WNGA 3I56N 3HOTA 1W7AA 4X66K 4JKCA 2O8BA 1X9SA 3VOVA 2NRTA 3WXIA 3KLIA 1QS4A 2DTUA 2OPPA 3G0ZA 4IEEA 2W42A 2BGGA 2G8IA 3IS9A 1Q86O 1S22A 4QS9A 2ZM6K 2W41A 3C6TA 2QA4N 4FJ9A 1KCFA 5GAEP 3G6EN 3JYTA 5GIPA 1WUAA 4O8UA 4WF9L 4R79A 4FPBA 4CF2A 3HK2A 4DWIA 4IJNA 5M1PA 2HMIA 4IFEA 2A1RA 4BRFA 1UWBA 5C0YA 5KGXA 4K8XA 4IXCA 2DFFA 3P38A 4BRCA 1XNRK 1S1VA 1RTJA 5BN9A 5DK5A 5F2RA 5EOYA 1Q81O 3U3YA 3EE9A 1WAFA 2QWOA 4CK3A 3PY8A 1ILYA 3ZSRA 3O1WA 4CZMA 4HTUA 4IDHA 2A42A 4DQQA 3T19A 3PLAA 1YXQA 3LPUA 3MWPA 3MX2A 3O9QA 4J8FA 4LH4A 4C23A 1EWQA 1U04A 2KFZA 4NCAA 3NHGA 4XIUA 3SAGA 1B92A 3BF1A 1XWLA 4B1UB 3ZT2A 4E7HA 1JJ2M 2CGKA 4BR2A 2FF6A 4G1QA 1O13A 3CM5A 2NRWA 4CI6A 2Q36A 3CCMN 1VSHA 1RT1A 1S72N 4DFMA 3THYB 1NMNA 2QW9A 3SUOA 1KQSM 4B9VA 4BC4A 1RTIA 4DF4A 3NGYA 4FWKA 2VQEK 2AJQA 3KZBA 1T8EA 4FJKA 4JKFA 4Z4GA 1H1VA 1QQNA 4DV0K 3ZSZA 1NWKA 4M3TA 3CJ9A 4ICLA 4MDBA 2OTJN 1JXEA 4FLYA 1S9EA 4JKGA 2Q2RA 1LV5A 3CFRA 4CF1A 3ULEB 2ASPA 3CMEN 3SNNA 4F3TA 1CXQA 1NGGA 3PSIA 4QOZB 1NOZA 4IG3A 4CW7B 3MXJA 3O9UA 1FXXA 2VCPA 4O0JA 3IG1A 5AZIA 3HT3A 5AZJB 3LWLA 4CZGA 2PZSA 4FWSA 3VEXA 1YTAA 1K6YA 4BDZA 1T05A 3DLEA 3OBWA 4CERA 1KLMA 4E7KA 3KLHA 5M1OA 4H0PA 4PKGA 4YOTA 3LP3A 3M8SA 3PV8A 5HL7L 3U4LA 5I42A 3UKUA 2FSKA 3UE5A 2GTDA 1YT3A 3SV3A 2FBTA 5AQVA 2QI2A 3TAGA 4CIEA 3VQ8A 3SV4A 5CZ1A 5GAGP 1NLVA 5SWMA 4C1NI 5CHIA 4FLTA 4JI3K 4FJ5A 4OGEA 4UQGA 1YJNN 1TKDA 2PFUA 4XEIA 1W97L 1L3TA 3S3NA 1WSJA 3TAQA 1VQ6N 5C24A 1HKBA 5KI6A 3JAMO 4B9LA 4LF7K 3FZKA 1K8KA 3AO2A 4ELTA 4B3OA 4HCCA 3VQCA 1QHTA 1S1XA 4ELVA 4G9ZA 5JVGL 1GLJO 5JMVA 3VENA 1DLOA 3OA9A 1QQMA 4U67L 3NDKA 2PAVA 3DXMB 3E9OA 3ENOA 4DV1K 3NF9A 4K0KK 5BRDA 3THWA 4X62K 1ZBLA 2D1KA 5LY3A 2P9UB 3MMVA 3MCAB 4DLEA 3ZX0A 1JLGA 5GADP 2ITMA 4YFUA 4Z94A 3FFIA 4H0YB 3WXMB 2Q0UA 4FYDA 4BDYA 3M8QA 3OYIA 3RWUA 4I6MA 1NGEA 3NH2A 4LFAK 3OYJA 4CJUA 2VGNA 4JK9A 1BHLA 2HHWA 2O8CA 2R7YA 1QVGM 3NGZA 4JK7A 1NJWA 1JLFA 3CETA 2P9NB 3HP9A 4E0DA 1KXPA 4KHYA 2E1ZA 4KHNA 5KRSA 4DTOA 1XUPO 1GLCG 5B8HA 1X9JA 4M41A 2P9PB 4AM7A 2F4VK 1T03A 4DMNA 4BG9A 3VQ4A 5H1SQ 3M8RA 5TKYA 3LAMA 1IBKK 3CPEA 2GX9A 3DI6A 5HP1A 2NRZA 1NBWA 4LF5K 1B9FA 3PX6A 1RDDA 1FJGK 1GLBG 4E7JA 3CCLN 1GLLO 4IDKA 3AVIA 4OX9K 5BPMA 2D0CA
chains in the Genus database with same CATH topology
3NF6A 3B6PA 3V9ZA 3SJJA 4B9TA 4M3YA 2IDOA 2D5RA 4HUEA 1LWEA 4CK2A 3QO9A 4LSNA 2X6SA 2HB5A 4FLUA 5EU7A 4BE0A 1SL0A 1Q9XA 3VQEA 2B6AA 4DFJA 2XY8A 2VWJA 3KK1A 2JGUA 3EYZA 3OJSA 3O3FA 4CJ5A 2OPRA 1TV6A 2ZD1A 3TAMA 3V9UA 3SUQA 3L2VA 1I39A 4FJIA 1KLNA 4CEZA 4NCGA 5HRPA 3T3FA 4CJEA 3NF8A 3OS2A 2YNHA 3QNNA 1TK0A 2DFEA 1VSKA 3DOKA 3LWMA 4CE9A 3D0PA 4QAGA 2ZQBA 3DRSA 4WE1A 2G8KA 1S1TA 1O1WA 4CHPA 4CHYA 1KTQA 1DTQA 2G8HA 5CZ2A 3AA5X 2G8UA 4J2AA 4Z4FA 4AHSA 3MAQA 4GVMA 2B5JA 3AVCA 4CJSA 1WSFA 4DU3A 3KD1E 3PUFA 2E4LA 4OJRA 3QEIA 3AA2A 1IKXA 1VRUA 4FW2A 4B9SA 3OY9A 1JLBA 4CJFA 2RF2A 3U6FA 4K8ZA 2D0AA 1LW2A 3VQ6A 2IS3A 4KI6A 4RW9A 3HO1A 4FZYA 1MU2A 4CEFA 3K57A 4BE1A 1VSIA 3DLGA 4PA1A 1Z26A 3KLGA 3QEPA 2HHUA 1BI4B 4Y1DA 4CEQA 4CFAA 4E89A 3SQ1A 3RR7A 1TVRA 2A1SA 4I9LA 4MQ3A 5CY4A 3OYLA 4DS5A 5J2QA 4FM1A 4W5QA 1R0AA 3HM9A 3PO5A 2FBXA 2YKMA 4Q5VA 5FRMA 4GMJB 4RG8A 4B8AB 3KD5E 4F8RA 3RMBA 1GOCA 3LP1A 2OZSA 4J2DA 3QEWA 4HVJA 3V6DA 3E01A 3P1GA 3VA0A 1RILA 1S1UA 3AV9A 4LY7A 1BCMA 1TKXA 1VRTA 4Z4CA 4Z4HA 3ITHA 1IKYA 3QINA 1SUQA 3ASMA 4CJ3A 3OYAA 3C95A 4F2SA 4OPKA 3AVMA 4DSEA 2WONA 2B4JA 1NK5A 5HRSA 4CHNA 3SQ4A 3OYBA 2F96A 4H8KA 4C8OA 3LAKA 1S9GA 3V1RA 4BACA 3SI6A 4M42A 3KKSA 5JS1A 4LH5A 4FK0A 4DSJA 3AVBA 5E41A 3NCIA 3F73A 4ID5A 4BE2A 4KHUA 4H4OA 4CIGA 3AO3A 4ZTJA 2KZZA 1XHXA 3DMJA 4O4GA 3K2PA 5CYMA 3RR8A 2G8WA 3ZCMA 3S9HA 4KB1A 3HP6A 1X1PA 4YNQA 3V9SA 2PYJA 4O44A 4CHQA 3DM2A 1NK4A 1TKTA 4FJ7A 2Z1GA 4CGJA 4JRQA 4DTXA 1HNVA 4C8KA 1X9MA 2JLEA 2HNDA 3EY1A 3QNOA 5D3GA 4CHZA 1N6QA 1IG9A 4M3XA 3DYAA 3DLHA 3OYKA 4AHRA 4MFBA 1RT5A 4FJNA 3AO1A 3NBPA 4KTZA 4DF8A 4IKFA 4O55A 4FJJA 4KPYA 1UA0A 4CECA 4HHTA 4JRPA 3SPZA 3L2QA 3SCXA 4EP4A 1HQUA 1FKOA 5JS2A 2X74A 4CFCA 3BDPA 2VG5A 1RDCA 4B9UA 3I0RA 3LANA 1HNIA 2RPIA 3AA4A 3DLKA 1L3UA 4Q0BA 1RCHA 3AVJA 2XO7A 1B9DA 3ALYA 1SL1A 3IAYA 1UAXA 2BANA 1I3AA 1ASVA 1U45A 1S6QA 4W5NA 1RT7A 2HHTA 1HYZA 5J1EA 3MEEA 1NKCA 5T7BA 3HJFA 4CGGA 3KLFA 1RTDA 2PYLA 3NFAA 4NYFA 3L2WA 1C6VA 3QETA 1TAUA 3C6UA 4BWJA 4KAZA 1FK9A 1GOAA 3VQBA 2BE2A 1A5WA 4CFDA 4FJMA 3QLHA 4Y1CA 3AO4A 3V4IA 4CJQA 3TABA 1IKWA 4TSXA 5CYQA 2X78A 4FCYA 3LP0A 3AVLA 4CF8A 3V9WA 5C42A 1RT2A 4FJLA 1KSPA 1UOCA 4OKEA 5HLFA 1U4BA 4DFKA 1HRHA 4DQSA 1HQEA 1JLCA 3JSMA 4CJRA 4FJGA 2LSNA 3HPGA 1QSYA 1JL1A 3AVHA 4FVMA 3CQ8A 4EZ6A 3P5JA 1RBUA 3HPHA 4RW4A 1ASWA 4CIFA 2X6NA 1Q9YA 4E7IA 1BQMA 3DLRA 4ZTFA 3PO4A 2Z1HA 1WAJA 2YNGA 4KHWA 2XY5A 4M3UA 5FDLA 2FBVA 1XHZA 1D9DA 2RKIA 4CESA 4PWDA 1TL1A 5HBMA 1FKPA 3KIOA 3WNGA 4AHUA 3L3VA 1J53A 3ZT0A 1TK5A 4FXDA 1JL2A 1VSDA 3HSTB 3MEDA 1D8YA 4J2EA 3C94A 4IG0A 1ZBIA 1LW0A 1X9SA 1EKEA 3VN5A 4CHOA 2KW4A 3KLIA 3HPOA 4CJLA 3DRRA 1QS4A 1Q8IA 1BIUA 2OPPA 1HMVA 4O5BA 1BIZA 2HVHA 1ZBUA 4FM2A 1T7PA 3G0ZA 1SL2A 1BGXT 2OPQA 1C0UA 2W42A 1C1BA 1S1WA 2BGGA 2KZMA 3AVFA 3CFPA 4KFBA 2G8IA 3IS9A 4CF9A 4CJKA 1D9FA 3AVAA 1CXUA 3QEVA 5HRNA 1RBVA 4DTJA 2KQ2A 3PX4A 3O3GA 4DTMA 3F9KA 1BQNA 1A5VA 3VQ9A 3C6TA 4EP5A 3VQDA 3TARA 4FJ9A 1KCFA 4CGIA 1VSEA 4Z0UA 3NE6A 3OS0A 2F8TA 4B9NA 3SZ2A 4CGHA 2GV9A 3K59A 3JYTA 2P1JA 2ETJA 3H08A 4DFPA 3QIPA 1X9WA 4RW7A 2QK9A 2Y1JA 3SPYA 4CF2A 4LD0A 3HK2A 1ASUA 4DWIA 2HMIA 2HHQA 3OS1A 2GBZA 2A1RA 1J9AA 1UWBA 1HPZA 4I9QA 2ZE2A 1KVAA 2Z1IA 5KGXA 4OPJA 4K8XA 2DFFA 4I2PA 4PUOA 4OKJA 1S1VA 1RTJA 4FLVA 4OKKA 2NUBA 2PY5A 1S5JA 5DK5A 2HHVA 3LZJA 4NYNA 1F21A 4DSFA 4OLBA 4W5RA 3U3YA 1A5XA 4ZHRA 1WAFA 4H4MA 1TKZA 2DFHA 4CK3A 4AH9A 4CJ4A 1S6PA 1TL3A 4AHCA 4W5OA 2Y1IA 3RMDA 1U49A 3PY8A 1NK6A 3ZSRA 4HTUA 3TWHA 1L3VA 2I5JA 3LP2A 4DSKA 2HVIA 5KRTA 1QQCA 1D5AA 1VSLA 4DQQA 1XI1A 1REVA 3T19A 3CYMA 3OYDA 3SQ2A 1HJRA 5KTQA 3EZ5A 1WNSA 4W5TA 3AVKA 3P83D 4I2QA 1UA1A 4F2RA 3LPUA 2OYQA 4LH4A 2VWKA 3KLEA 1U04A 3NH0A 4NCAA 2KFZA 3NHGA 4B8CA 1JLQA 3ZT3A 4O0IA 2Q3SA 2P5OA 1GOBA 3NF7A 4XIUA 3KJVA 4IBNA 3VQAA 1B92A 1XWLA 3CG7A 4DU4A 4J2BA 1JKHA 1RDBA 3ZT2A 4E7HA 3SQ0A 4JS5A 5J2NA 2KTQA 3VA3A 4G1QA 1QTMA 3NGIA 4EZ9A 1HYSA 4M3RA 3CM5A 1LWCA 3CM6A 2E6MA 2HW3A 1BL3A 1VSHA 1RT1A 3QERA 2G8FA 4IFVA 4HUGA 1N5YA 4FK4A 4RW6A 3OYNA 3HVRA 2YHAA 2QXFA 4CEOA 4E7LA 4DSLA 1LWFA 4FZZA 4DFMA 1J54A 4B9VA 3SUOA 1WSHA 3L2UA 1VSFA 3KK2A 2P5GA 1RTIA 4DF4A 3NGYA 4N76A 4QCLA 4KB0A 1CZBA 1WSGA 3VQ7A 2AJQA 1T8EA 2HNYA 4FJKA 3MXMA 4FJXA 3SUPA 1NJXA 2HHSA 4Z4GA 3S3OA 3ZSZA 4KV8A 3MXIA 3O3HA 3RRGA 4F3OA 4M3TA 3M8PA 4ICLA 1ITGA 4AILC 1C0TA 2YNIA 3LZIA 1JXEA 1VSMA 3K5LA 1QSSA 4FLYA 2WOMA 2YKNA 4E19A 1S9EA 4CK1A 3RMCA 1LV5A 3ZSXA 2P51A 1EP4A 3CFRA 4CF1A 4CGDA 4CJTA 4Z4IA 4F3TA 3SNNA 3SUNA 1BI4A 1CXQA 4CFBA 3SYZA 1C0MA 1LAWA 4CEAA 4QOZB 2FC0A 4CGFA 1NOZA 1RT6A 4IG3A 1NKEA 2Z1JA 4M45A 2QKKA 3MXJA 2XY7A 1FXXA 4CEBA 1Z25A 1NK8A 4O0JA 3IG1A 3MEGA 4I7FA 3AVNA 5DMRA 3ZSOA 3HT3A 4FZXC 4AHTA 3OVNA 3QESA 5C25A 1YTUA 1G15A 2EHGA 3LWLA 3QEXA 4C8MA 3RTVA 1NJYA 3OYEA 5HROA 1RBSA 4CJWA 1NOYA 1RT3A 2PZSA 1KFDA 5FROA 1YTAA 3KK3A 1VSJA 1K6YA 4BDZA 4DTPA 3QIOA 3DLEA 1T05A 3DLBA 4CCHA 1JLEA 3AA3A 4CERA 4FM0A 3PX0A 4FLZA 4DLGA 1KLMA 4E7KA 4DS4A 4JS4A 3KLHA 3HXMA 4CJPA 2RN2A 4DTSA 2GUIA 3OYFA 4F4KA 4OGCA 4E3SA 3LP3A 3NAEA 3M8SA 3PV8A 4DSIA 5I42A 1SV5A 1SKWA 3VQPA 4FLXA 5SZTA 1BISA 4KRFA 4B08A 3NH1A 1YT3A 2XHBA 2EX3A 3O4QA 3SV3A 1QSLA 2FBTA 3V1QA 1JLAA 5KGWA 3ISNC 4FLWA 4LSLA 2XY6A 4CEDA 3RRHA 1WLJA 3S3MA 3TAGA 4BDPA 5J2PA 4DTUA 1CLQA 1TGOA 4DTRA 2YNFA 3VQ8A 4CIEA 5CZ1A 3KKRA 3SV4A 3TI0A 4KTQA 4CJVA 3I0SA 3I8DA 2DTUA 2YV0X 4C8NA 3TANA 3K5MA 5SWMA 4FLTA 1NK7A 4FJ5A 4L8RB 3KTQA 2VG6A 1EX4A 3K58A 2ITGA 4NCBA 4OGEA 3U3GA 4UQGA 1KVCA 3THVA 4DU1A 1TKDA 3DRPA 4ID1A 2IC3A 1KFSA 1WN7A 3V81A 2IOCA 2ATQA 4FJ8A 1L3TA 3HL8A 1U48A 3LPTA 4N47A 1WSJA 3S3NA 1C1CA 3AVGA 3MECA 5HRRA 3ZT1A 3TAQA 5C24A 1SKRA 5KI6A 4DQPA 4B9LA 3TAPA 1IH7A 1RNHA 1WSIA 1RTHA 4OLAA 4RW8A 3WNEA 3AO5A 1NK9A 3ZSYA 4R5PA 1J5OA 2OA8A 2QKBA 3AO2A 4N56A 1L5UA 1W0HA 4ELTA 1ZBHA 3OYHA 4B3OA 1KRPA 3HVTA 4HCCA 4E1NA 3VQCA 3LDSA 1QHTA 1S1XA 3L8BA 4ELVA 4ELUA 3D45A 3ZSWA 1EETA 1DLOA 2HHXA 1QE1A 4IFYA 3OJUA 1RT4A 3NDKA 3HYFA 1SKSA 3NF9A 1HYVA 5K14A 3ZSVA 1ZBLA 1C1AA 3OYMA 4CF0A 1Y97A 3A2FA 3ULDA 1NKBA 1U47A 2D0BA 4AHVA 4JLHA 4DQIA 4KHQA 2FBYA 4DLEA 1RDAA 3IRXA 1JLGA 3K5OA 2IGIA 4KO0A 4YFUA 5FRNA 3WNFA 2KFNA 3L2RA 4BWMA 3FFIA 1VK0A 4FW1A 2O4GA 4KREA 3ZT4A 3B6OA 4FYDA 4BDYA 1LAVA 3M8QA 3OYIA 3OYGA 1IKVA 3RWUA 1EXQA 3WNHA 1WSEA 3TAEA 1JXBA 1IO2A 3NH2A 4KKOA 4B9MA 3CFOA 4HCBA 4PY5A 4OVLA 4CJUA 3OYJA 1TK8A 3OYCA 3DOLA 4DQRA 1YVUA 1BHLA 3VQQA 2HHWA 2R7YA 3BGRA 1RBTA 3NGZA 4FJHA 4Z4EA 1NJWA 1JLFA 2VG7A 3HP9A 4DTNA 4E0DA 4PQUA 2BDPA 4M3WA 4KHYA 3T1AA 4KHNA 3ZSQA 5KRSA 1NJZA 3RMAA 1KVBA 1TAQA 1ZBFA 4DTOA 4M3ZA 2DY4A 2OZMA 2HNZA 4M41A 4E1MA 5J2MA 5I3UA 2O4IA 4HUFA 4DMNA 1T03A 4KI4A 4N41A 2YHBA 3G10A 3VQ4A 3M8RA 4KTWA 4GW6A 3LAMA 3V1OA 3UIQA 4KHSA 4C8LA 3LALA 4N5SA 3K5NA 2F8SA 1DTTA 2XRIA 3DI6A 5HP1A 3L3UA 4DG1A 1XC9A 1ZYQA 3VQ5A 4FK2A 3V9XA 2G8VA 2OPSA 1B9FA 2IAJA 3PX6A 1RDDA 1RBRA 4E7JA 3TAFA 4IDKA 1L3SA 1W9HA 3TR8A 3AVIA 1BCOA 3O4NA 4CEEA 1CZ9A 1NK0A 2E6LA 2D0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NF6 A;  3B6P A;  3V9Z A;  3SJJ A;  4B9T A;  4M3Y A;  2IDO A;  2D5R A;  4HUE A;  1LWE A;  4CK2 A;  3QO9 A;  4LSN A;  2X6S A;  2HB5 A;  4FLU A;  5EU7 A;  4BE0 A;  1SL0 A;  1Q9X A;  3VQE A;  2B6A A;  4DFJ A;  2XY8 A;  2VWJ A;  3KK1 A;  2JGU A;  3EYZ A;  3OJS A;  3O3F A;  4CJ5 A;  2OPR A;  1TV6 A;  2ZD1 A;  3TAM A;  3V9U A;  3SUQ A;  3L2V A;  1I39 A;  4FJI A;  1KLN A;  4CEZ A;  4NCG A;  5HRP A;  3T3F A;  4CJE A;  3NF8 A;  3OS2 A;  2YNH A;  3QNN A;  1TK0 A;  2DFE A;  1VSK A;  3DOK A;  3LWM A;  4CE9 A;  3D0P A;  4QAG A;  2ZQB A;  3DRS A;  4WE1 A;  2G8K A;  1S1T A;  1O1W A;  4CHP A;  4CHY A;  1KTQ A;  1DTQ A;  2G8H A;  5CZ2 A;  3AA5 X;  2G8U A;  4J2A A;  4Z4F A;  4AHS A;  3MAQ A;  4GVM A;  2B5J A;  3AVC A;  4CJS A;  1WSF A;  4DU3 A;  3KD1 E;  3PUF A;  2E4L A;  4OJR A;  3QEI A;  3AA2 A;  1IKX A;  1VRU A;  4FW2 A;  4B9S A;  3OY9 A;  1JLB A;  4CJF A;  2RF2 A;  3U6F A;  4K8Z A;  2D0A A;  1LW2 A;  3VQ6 A;  2IS3 A;  4KI6 A;  4RW9 A;  3HO1 A;  4FZY A;  1MU2 A;  4CEF A;  3K57 A;  4BE1 A;  1VSI A;  3DLG A;  4PA1 A;  1Z26 A;  3KLG A;  3QEP A;  2HHU A;  1BI4 B;  4Y1D A;  4CEQ A;  4CFA A;  4E89 A;  3SQ1 A;  3RR7 A;  1TVR A;  2A1S A;  4I9L A;  4MQ3 A;  5CY4 A;  3OYL A;  4DS5 A;  5J2Q A;  4FM1 A;  4W5Q A;  1R0A A;  3HM9 A;  3PO5 A;  2FBX A;  2YKM A;  4Q5V A;  5FRM A;  4GMJ B;  4RG8 A;  4B8A B;  3KD5 E;  4F8R A;  3RMB A;  1GOC A;  3LP1 A;  2OZS A;  4J2D A;  3QEW A;  4HVJ A;  3V6D A;  3E01 A;  3P1G A;  3VA0 A;  1RIL A;  1S1U A;  3AV9 A;  4LY7 A;  1BCM A;  1TKX A;  1VRT A;  4Z4C A;  4Z4H A;  3ITH A;  1IKY A;  3QIN A;  1SUQ A;  3ASM A;  4CJ3 A;  3OYA A;  3C95 A;  4F2S A;  4OPK A;  3AVM A;  4DSE A;  2WON A;  2B4J A;  1NK5 A;  5HRS A;  4CHN A;  3SQ4 A;  3OYB A;  2F96 A;  4H8K A;  4C8O A;  3LAK A;  1S9G A;  3V1R A;  4BAC A;  3SI6 A;  4M42 A;  3KKS A;  5JS1 A;  4LH5 A;  4FK0 A;  4DSJ A;  3AVB A;  5E41 A;  3NCI A;  3F73 A;  4ID5 A;  4BE2 A;  4KHU A;  4H4O A;  4CIG A;  3AO3 A;  4ZTJ A;  2KZZ A;  1XHX A;  3DMJ A;  4O4G A;  3K2P A;  5CYM A;  3RR8 A;  2G8W A;  3ZCM A;  3S9H A;  4KB1 A;  3HP6 A;  1X1P A;  4YNQ A;  3V9S A;  2PYJ A;  4O44 A;  4CHQ A;  3DM2 A;  1NK4 A;  1TKT A;  4FJ7 A;  2Z1G A;  4CGJ A;  4JRQ A;  4DTX A;  1HNV A;  4C8K A;  1X9M A;  2JLE A;  2HND A;  3EY1 A;  3QNO A;  5D3G A;  4CHZ A;  1N6Q A;  1IG9 A;  4M3X A;  3DYA A;  3DLH A;  3OYK A;  4AHR A;  4MFB A;  1RT5 A;  4FJN A;  3AO1 A;  3NBP A;  4KTZ A;  4DF8 A;  4IKF A;  4O55 A;  4FJJ A;  4KPY A;  1UA0 A;  4CEC A;  4HHT A;  4JRP A;  3SPZ A;  3L2Q A;  3SCX A;  4EP4 A;  1HQU A;  1FKO A;  5JS2 A;  2X74 A;  4CFC A;  3BDP A;  2VG5 A;  1RDC A;  4B9U A;  3I0R A;  3LAN A;  1HNI A;  2RPI A;  3AA4 A;  3DLK A;  1L3U A;  4Q0B A;  1RCH A;  3AVJ A;  2XO7 A;  1B9D A;  3ALY A;  1SL1 A;  3IAY A;  1UAX A;  2BAN A;  1I3A A;  1ASV A;  1U45 A;  1S6Q A;  4W5N A;  1RT7 A;  2HHT A;  1HYZ A;  5J1E A;  3MEE A;  1NKC A;  5T7B A;  3HJF A;  4CGG A;  3KLF A;  1RTD A;  2PYL A;  3NFA A;  4NYF A;  3L2W A;  1C6V A;  3QET A;  1TAU A;  3C6U A;  4BWJ A;  4KAZ A;  1FK9 A;  1GOA A;  3VQB A;  2BE2 A;  1A5W A;  4CFD A;  4FJM A;  3QLH A;  4Y1C A;  3AO4 A;  3V4I A;  4CJQ A;  3TAB A;  1IKW A;  4TSX A;  5CYQ A;  2X78 A;  4FCY A;  3LP0 A;  3AVL A;  4CF8 A;  3V9W A;  5C42 A;  1RT2 A;  4FJL A;  1KSP A;  1UOC A;  4OKE A;  5HLF A;  1U4B A;  4DFK A;  1HRH A;  4DQS A;  1HQE A;  1JLC A;  3JSM A;  4CJR A;  4FJG A;  2LSN A;  3HPG A;  1QSY A;  1JL1 A;  3AVH A;  4FVM A;  3CQ8 A;  4EZ6 A;  3P5J A;  1RBU A;  3HPH A;  4RW4 A;  1ASW A;  4CIF A;  2X6N A;  1Q9Y A;  4E7I A;  1BQM A;  3DLR A;  4ZTF A;  3PO4 A;  2Z1H A;  1WAJ A;  2YNG A;  4KHW A;  2XY5 A;  4M3U A;  5FDL A;  2FBV A;  1XHZ A;  1D9D A;  2RKI A;  4CES A;  4PWD A;  1TL1 A;  5HBM A;  1FKP A;  3KIO A;  3WNG A;  4AHU A;  3L3V A;  1J53 A;  3ZT0 A;  1TK5 A;  4FXD A;  1JL2 A;  1VSD A;  3HST B;  3MED A;  1D8Y A;  4J2E A;  3C94 A;  4IG0 A;  1ZBI A;  1LW0 A;  1X9S A;  1EKE A;  3VN5 A;  4CHO A;  2KW4 A;  3KLI A;  3HPO A;  4CJL A;  3DRR A;  1QS4 A;  1Q8I A;  1BIU A;  2OPP A;  1HMV A;  4O5B A;  1BIZ A;  2HVH A;  1ZBU A;  4FM2 A;  1T7P A;  3G0Z A;  1SL2 A;  1BGX T;  2OPQ A;  1C0U A;  2W42 A;  1C1B A;  1S1W A;  2BGG A;  2KZM A;  3AVF A;  3CFP A;  4KFB A;  2G8I A;  3IS9 A;  4CF9 A;  4CJK A;  1D9F A;  3AVA A;  1CXU A;  3QEV A;  5HRN A;  1RBV A;  4DTJ A;  2KQ2 A;  3PX4 A;  3O3G A;  4DTM A;  3F9K A;  1BQN A;  1A5V A;  3VQ9 A;  3C6T A;  4EP5 A;  3VQD A;  3TAR A;  4FJ9 A;  1KCF A;  4CGI A;  1VSE A;  4Z0U A;  3NE6 A;  3OS0 A;  2F8T A;  4B9N A;  3SZ2 A;  4CGH A;  2GV9 A;  3K59 A;  3JYT A;  2P1J A;  2ETJ A;  3H08 A;  4DFP A;  3QIP A;  1X9W A;  4RW7 A;  2QK9 A;  2Y1J A;  3SPY A;  4CF2 A;  4LD0 A;  3HK2 A;  1ASU A;  4DWI A;  2HMI A;  2HHQ A;  3OS1 A;  2GBZ A;  2A1R A;  1J9A A;  1UWB A;  1HPZ A;  4I9Q A;  2ZE2 A;  1KVA A;  2Z1I A;  5KGX A;  4OPJ A;  4K8X A;  2DFF A;  4I2P A;  4PUO A;  4OKJ A;  1S1V A;  1RTJ A;  4FLV A;  4OKK A;  2NUB A;  2PY5 A;  1S5J A;  5DK5 A;  2HHV A;  3LZJ A;  4NYN A;  1F21 A;  4DSF A;  4OLB A;  4W5R A;  3U3Y A;  1A5X A;  4ZHR A;  1WAF A;  4H4M A;  1TKZ A;  2DFH A;  4CK3 A;  4AH9 A;  4CJ4 A;  1S6P A;  1TL3 A;  4AHC A;  4W5O A;  2Y1I A;  3RMD A;  1U49 A;  3PY8 A;  1NK6 A;  3ZSR A;  4HTU A;  3TWH A;  1L3V A;  2I5J A;  3LP2 A;  4DSK A;  2HVI A;  5KRT A;  1QQC A;  1D5A A;  1VSL A;  4DQQ A;  1XI1 A;  1REV A;  3T19 A;  3CYM A;  3OYD A;  3SQ2 A;  1HJR A;  5KTQ A;  3EZ5 A;  1WNS A;  4W5T A;  3AVK A;  3P83 D;  4I2Q A;  1UA1 A;  4F2R A;  3LPU A;  2OYQ A;  4LH4 A;  2VWK A;  3KLE A;  1U04 A;  3NH0 A;  4NCA A;  2KFZ A;  3NHG A;  4B8C A;  1JLQ A;  3ZT3 A;  4O0I A;  2Q3S A;  2P5O A;  1GOB A;  3NF7 A;  4XIU A;  3KJV A;  4IBN A;  3VQA A;  1B92 A;  1XWL A;  3CG7 A;  4DU4 A;  4J2B A;  1JKH A;  1RDB A;  3ZT2 A;  4E7H A;  3SQ0 A;  4JS5 A;  5J2N A;  2KTQ A;  3VA3 A;  4G1Q A;  1QTM A;  3NGI A;  4EZ9 A;  1HYS A;  4M3R A;  3CM5 A;  1LWC A;  3CM6 A;  2E6M A;  2HW3 A;  1BL3 A;  1VSH A;  1RT1 A;  3QER A;  2G8F A;  4IFV A;  4HUG A;  1N5Y A;  4FK4 A;  4RW6 A;  3OYN A;  3HVR A;  2YHA A;  2QXF A;  4CEO A;  4E7L A;  4DSL A;  1LWF A;  4FZZ A;  4DFM A;  1J54 A;  4B9V A;  3SUO A;  1WSH A;  3L2U A;  1VSF A;  3KK2 A;  2P5G A;  1RTI A;  4DF4 A;  3NGY A;  4N76 A;  4QCL A;  4KB0 A;  1CZB A;  1WSG A;  3VQ7 A;  2AJQ A;  1T8E A;  2HNY A;  4FJK A;  3MXM A;  4FJX A;  3SUP A;  1NJX A;  2HHS A;  4Z4G A;  3S3O A;  3ZSZ A;  4KV8 A;  3MXI A;  3O3H A;  3RRG A;  4F3O A;  4M3T A;  3M8P A;  4ICL A;  1ITG A;  4AIL C;  1C0T A;  2YNI A;  3LZI A;  1JXE A;  1VSM A;  3K5L A;  1QSS A;  4FLY A;  2WOM A;  2YKN A;  4E19 A;  1S9E A;  4CK1 A;  3RMC A;  1LV5 A;  3ZSX A;  2P51 A;  1EP4 A;  3CFR A;  4CF1 A;  4CGD A;  4CJT A;  4Z4I A;  4F3T A;  3SNN A;  3SUN A;  1BI4 A;  1CXQ A;  4CFB A;  3SYZ A;  1C0M A;  1LAW A;  4CEA A;  4QOZ B;  2FC0 A;  4CGF A;  1NOZ A;  1RT6 A;  4IG3 A;  1NKE A;  2Z1J A;  4M45 A;  2QKK A;  3MXJ A;  2XY7 A;  1FXX A;  4CEB A;  1Z25 A;  1NK8 A;  4O0J A;  3IG1 A;  3MEG A;  4I7F A;  3AVN A;  5DMR A;  3ZSO A;  3HT3 A;  4FZX C;  4AHT A;  3OVN A;  3QES A;  5C25 A;  1YTU A;  1G15 A;  2EHG A;  3LWL A;  3QEX A;  4C8M A;  3RTV A;  1NJY A;  3OYE A;  5HRO A;  1RBS A;  4CJW A;  1NOY A;  1RT3 A;  2PZS A;  1KFD A;  5FRO A;  1YTA A;  3KK3 A;  1VSJ A;  1K6Y A;  4BDZ A;  4DTP A;  3QIO A;  3DLE A;  1T05 A;  3DLB A;  4CCH A;  1JLE A;  3AA3 A;  4CER A;  4FM0 A;  3PX0 A;  4FLZ A;  4DLG A;  1KLM A;  4E7K A;  4DS4 A;  4JS4 A;  3KLH A;  3HXM A;  4CJP A;  2RN2 A;  4DTS A;  2GUI A;  3OYF A;  4F4K A;  4OGC A;  4E3S A;  3LP3 A;  3NAE A;  3M8S A;  3PV8 A;  4DSI A;  5I42 A;  1SV5 A;  1SKW A;  3VQP A;  4FLX A;  5SZT A;  1BIS A;  4KRF A;  4B08 A;  3NH1 A;  1YT3 A;  2XHB A;  2EX3 A;  3O4Q A;  3SV3 A;  1QSL A;  2FBT A;  3V1Q A;  1JLA A;  5KGW A;  3ISN C;  4FLW A;  4LSL A;  2XY6 A;  4CED A;  3RRH A;  1WLJ A;  3S3M A;  3TAG A;  4BDP A;  5J2P A;  4DTU A;  1CLQ A;  1TGO A;  4DTR A;  2YNF A;  3VQ8 A;  4CIE A;  5CZ1 A;  3KKR A;  3SV4 A;  3TI0 A;  4KTQ A;  4CJV A;  3I0S A;  3I8D A;  2DTU A;  2YV0 X;  4C8N A;  3TAN A;  3K5M A;  5SWM A;  4FLT A;  1NK7 A;  4FJ5 A;  4L8R B;  3KTQ A;  2VG6 A;  1EX4 A;  3K58 A;  2ITG A;  4NCB A;  4OGE A;  3U3G A;  4UQG A;  1KVC A;  3THV A;  4DU1 A;  1TKD A;  3DRP A;  4ID1 A;  2IC3 A;  1KFS A;  1WN7 A;  3V81 A;  2IOC A;  2ATQ A;  4FJ8 A;  1L3T A;  3HL8 A;  1U48 A;  3LPT A;  4N47 A;  1WSJ A;  3S3N A;  1C1C A;  3AVG A;  3MEC A;  5HRR A;  3ZT1 A;  3TAQ A;  5C24 A;  1SKR A;  5KI6 A;  4DQP A;  4B9L A;  3TAP A;  1IH7 A;  1RNH A;  1WSI A;  1RTH A;  4OLA A;  4RW8 A;  3WNE A;  3AO5 A;  1NK9 A;  3ZSY A;  4R5P A;  1J5O A;  2OA8 A;  2QKB A;  3AO2 A;  4N56 A;  1L5U A;  1W0H A;  4ELT A;  1ZBH A;  3OYH A;  4B3O A;  1KRP A;  3HVT A;  4HCC A;  4E1N A;  3VQC A;  3LDS A;  1QHT A;  1S1X A;  3L8B A;  4ELV A;  4ELU A;  3D45 A;  3ZSW A;  1EET A;  1DLO A;  2HHX A;  1QE1 A;  4IFY A;  3OJU A;  1RT4 A;  3NDK A;  3HYF A;  1SKS A;  3NF9 A;  1HYV A;  5K14 A;  3ZSV A;  1ZBL A;  1C1A A;  3OYM A;  4CF0 A;  1Y97 A;  3A2F A;  3ULD A;  1NKB A;  1U47 A;  2D0B A;  4AHV A;  4JLH A;  4DQI A;  4KHQ A;  2FBY A;  4DLE A;  1RDA A;  3IRX A;  1JLG A;  3K5O A;  2IGI A;  4KO0 A;  4YFU A;  5FRN A;  3WNF A;  2KFN A;  3L2R A;  4BWM A;  3FFI A;  1VK0 A;  4FW1 A;  2O4G A;  4KRE A;  3ZT4 A;  3B6O A;  4FYD A;  4BDY A;  1LAV A;  3M8Q A;  3OYI A;  3OYG A;  1IKV A;  3RWU A;  1EXQ A;  3WNH A;  1WSE A;  3TAE A;  1JXB A;  1IO2 A;  3NH2 A;  4KKO A;  4B9M A;  3CFO A;  4HCB A;  4PY5 A;  4OVL A;  4CJU A;  3OYJ A;  1TK8 A;  3OYC A;  3DOL A;  4DQR A;  1YVU A;  1BHL A;  3VQQ A;  2HHW A;  2R7Y A;  3BGR A;  1RBT A;  3NGZ A;  4FJH A;  4Z4E A;  1NJW A;  1JLF A;  2VG7 A;  3HP9 A;  4DTN A;  4E0D A;  4PQU A;  2BDP A;  4M3W A;  4KHY A;  3T1A A;  4KHN A;  3ZSQ A;  5KRS A;  1NJZ A;  3RMA A;  1KVB A;  1TAQ A;  1ZBF A;  4DTO A;  4M3Z A;  2DY4 A;  2OZM A;  2HNZ A;  4M41 A;  4E1M A;  5J2M A;  5I3U A;  2O4I A;  4HUF A;  4DMN A;  1T03 A;  4KI4 A;  4N41 A;  2YHB A;  3G10 A;  3VQ4 A;  3M8R A;  4KTW A;  4GW6 A;  3LAM A;  3V1O A;  3UIQ A;  4KHS A;  4C8L A;  3LAL A;  4N5S A;  3K5N A;  2F8S A;  1DTT A;  2XRI A;  3DI6 A;  5HP1 A;  3L3U A;  4DG1 A;  1XC9 A;  1ZYQ A;  3VQ5 A;  4FK2 A;  3V9X A;  2G8V A;  2OPS A;  1B9F A;  2IAJ A;  3PX6 A;  1RDD A;  1RBR A;  4E7J A;  3TAF A;  4IDK A;  1L3S A;  1W9H A;  3TR8 A;  3AVI A;  1BCO A;  3O4N A;  4CEE A;  1CZ9 A;  1NK0 A;  2E6L A;  2D0C A; 
#chains in the Genus database with same CATH topology
 2Q97 A;  4ISG A;  3GDQ A;  1QQO A;  4DR5 K;  1LWE A;  2QXL A;  4GV3 A;  5EU7 A;  4BE0 A;  3VQE A;  2HBK A;  2XY8 A;  3CCV N;  2ZD1 A;  3V9U A;  3SUQ A;  2E88 A;  1KLN A;  4NCG A;  2QWL A;  4CE9 A;  4QAG A;  3DRS A;  4WE1 A;  3SK3 A;  3THX B;  3T7Z A;  4CHP A;  1DTQ A;  2G8U A;  3D2F A;  4DU3 A;  4CJS A;  3PUF A;  3ATU A;  5AQM A;  3AA2 A;  4JI5 K;  3OY9 A;  1JLB A;  4K8Z A;  3SAF A;  4CBU A;  4RW9 A;  2P9I A;  4BE1 A;  2HHU A;  1BI4 B;  4E89 A;  3CCS N;  3SQ1 A;  1U6Z A;  4MQ3 A;  4FWM A;  4H5N A;  1EQY A;  4GMJ B;  4RG8 A;  4A2B A;  3VET A;  4B8A B;  3QFU A;  3RMB A;  3LP1 A;  4J2D A;  1N36 K;  4HVJ A;  3AV9 A;  3FR0 A;  3J80 O;  3AVM A;  5AQL A;  1GLE G;  5CR4 A;  2NRX A;  3CCJ N;  4BAC A;  3KKS A;  4DR7 K;  4DSJ A;  4BE2 A;  3F73 A;  3AO3 A;  1XHX A;  3DMJ A;  4O4G A;  3K2P A;  5CYM A;  5FPD A;  4YNQ A;  4CHQ A;  4JRQ A;  3DXK A;  4DTX A;  3H1V X;  3LM9 A;  5D3G A;  2RE2 A;  4CHZ A;  3T69 A;  2IIR A;  3OYK A;  1RT5 A;  3BF3 A;  4ILH A;  1DT9 A;  4HHT A;  2P9L A;  2P9K B;  3L2Q A;  1VQN N;  1E3M A;  2ZJR L;  3I0R A;  4Q0B A;  3AVJ A;  1B9D A;  1IJJ A;  3IAY A;  2A6A A;  1VQ9 N;  2D0P A;  1HYZ A;  3CC2 N;  2HST A;  3LDL A;  1C6V A;  5FPM A;  3QET A;  1FK9 A;  4XH5 A;  3H45 C;  4FJM A;  3AO4 A;  4CJQ A;  1IKW A;  4CF8 A;  3V9W A;  5E26 A;  2NRR A;  5AQQ A;  3D2E A;  4CJR A;  3AVH A;  3CQ8 A;  3HPH A;  3SJH A;  1Q9Y A;  4E7I A;  3DLR A;  2QWP A;  2YNG A;  5FDL A;  1HNW K;  2RKI A;  3P4I A;  1TL1 A;  3ZT0 A;  1TK5 A;  1RDU A;  1JL2 A;  3MED A;  3C94 A;  1ZBI A;  1LW0 A;  4CJL A;  3DRR A;  1BIU A;  1BIZ A;  1ZBU A;  4BC2 A;  1C1B A;  1GLA G;  3HSC A;  4LF9 K;  3AVF A;  4CF9 A;  3QB0 A;  3O9S A;  4DTJ A;  2YHY A;  4DTM A;  1A5V A;  3VQ9 A;  3TAR A;  1T6D A;  4Z0U A;  4HTL A;  1V4T A;  1NM1 A;  2GV9 A;  3K59 A;  1ESV A;  1ATN A;  2BTF A;  2ETJ A;  4UY8 O;  4QS7 A;  4DFP A;  4RW7 A;  4JKH A;  3AGK A;  3I55 N;  4DV3 K;  3OS1 A;  2GBZ A;  2OAN A;  1J9A A;  4I9Q A;  1HPZ A;  2ZE2 A;  4OPJ A;  1TUY A;  4I2P A;  5FPE A;  3GBT A;  3CI5 A;  1YJ9 N;  1F21 A;  4W5R A;  1A5X A;  3UKR A;  4ZHR A;  1XMO K;  1VQ8 N;  3MN9 A;  4AH9 A;  4CJ4 A;  3CC4 N;  4AHC A;  4W5O A;  1U49 A;  1NK6 A;  4FWN A;  1L3V A;  4DSK A;  4FO0 A;  1N32 K;  1D5A A;  1XI1 A;  3OYD A;  3EZ5 A;  4JD2 B;  5AQO A;  1UA1 A;  3P83 D;  4I2Q A;  3L0Q A;  3KLE A;  4B1W B;  4B8C A;  3SBG A;  4O0I A;  2P5O A;  2Q3S A;  3BZK A;  3NF7 A;  3SMS A;  4IBN A;  3VQA A;  4J2B A;  3PIO L;  1RDB A;  3SQ0 A;  5J2N A;  3VA3 A;  4EZ9 A;  3QIC A;  1QTM A;  3C0B A;  3EE8 A;  2ASM A;  2HW3 A;  3KVG A;  3QER A;  3ZX3 A;  4IFV A;  5AQS A;  2H3G X;  4RW6 A;  4C1N K;  4DCH A;  1VSF A;  1WOQ A;  3KK2 A;  4N76 A;  3RVC A;  3E9L A;  4LFB K;  2QTD A;  4FJX A;  3K0S A;  3S3O A;  4NLC A;  1N34 K;  2J4R A;  1KC8 O;  1WBB A;  1YAG A;  3O3H A;  4AIL C;  2YNI A;  3LZI A;  3K5L A;  4EAH D;  2P9S B;  2WOM A;  2YKN A;  4E19 A;  3RMC A;  4PL7 A;  3CD6 N;  3ZSX A;  1TYQ A;  2P51 A;  4Z4I A;  4CJT A;  1C0M A;  2O8D A;  4QS8 A;  2FC0 A;  1VQ5 N;  4DR3 K;  4CEB A;  1Z25 A;  3GG4 A;  4N41 A;  5DMR A;  3LDN A;  3LDQ A;  3QES A;  5C25 A;  3QEX A;  3RTV A;  1NJY A;  3IKM A;  1RBS A;  1NOY A;  1RT3 A;  1KFD A;  5FRO A;  3VPZ A;  3DLB A;  3QIO A;  3PX0 A;  4FLZ A;  1ATR A;  4DS4 A;  1GLD G;  5LJW A;  4OGC A;  3AY9 A;  3I8B A;  2BH1 A;  3K9J A;  1SV5 A;  1SKW A;  1CZA N;  4KRF A;  4CJ7 A;  3HTV A;  3NH1 A;  4B1Z A;  3V1Q A;  2HMP A;  3ISN C;  3G25 A;  4LSL A;  2XY6 A;  3CQX A;  2UXC K;  4RWT A;  3RRH A;  4BDP A;  2HHH K;  1TGO A;  4DTR A;  3C7N A;  1RFQ A;  3KKR A;  3I0S A;  5EXW A;  1XQS C;  2I7N A;  3ZEU A;  3MDQ A;  4WQ4 A;  5AQX A;  3TAN A;  1NK7 A;  3WQU A;  2WUS A;  4H0V B;  4MO4 A;  4H0T B;  3WEE A;  4M63 C;  3K58 A;  2ITG A;  4BC3 A;  4DU1 A;  3DRP A;  4ID1 A;  2IC3 A;  4BRI A;  2WC9 A;  5MLC Q;  3V81 A;  2IOC A;  3KWG A;  4CZI A;  4FJ8 A;  2E2Q A;  1U48 A;  1DGK N;  2CH5 A;  1C1C A;  3MEC A;  3ZT1 A;  3TAP A;  1IH7 A;  2HBL A;  1WSI A;  1RTH A;  4OLA A;  1ZBS A;  3LDO A;  2QKB A;  2E5L K;  1L5U A;  4GV9 A;  1W0H A;  4E1N A;  3GE1 A;  3F9M A;  3L8B A;  4ELU A;  3D45 A;  4O5F A;  4IFY A;  1NU0 A;  1K73 O;  5JVH L;  2O8B B;  2V51 B;  4PKI A;  5K14 A;  3ZSV A;  2O8E A;  3H3O B;  3ULE A;  1U47 A;  4AHV A;  4KHQ A;  1YIT N;  3VTH A;  1OH6 A;  2IGI A;  1J5E K;  4H5V A;  2O4G A;  4FL9 A;  2QWQ A;  1IKV A;  3JXU A;  1WSE A;  3GOI A;  4Y0W A;  3TAE A;  3TSQ A;  4YDU A;  5BRE A;  1JXB A;  4KKO A;  4HCB A;  4PY5 A;  3DOL A;  4DHY A;  4DQR A;  2HBM A;  4DV4 K;  4X65 K;  1G99 A;  4PQU A;  4IO8 A;  3T1A A;  3RMA A;  1ATS A;  1U2V A;  3MWT A;  3FFK B;  5KPT A;  4WFB L;  2DY4 A;  4LFC K;  2HNZ A;  4E1M A;  3U9D A;  4YOU A;  1BWF O;  2NNW A;  3V1O A;  3QBW A;  3J8A A;  4N5S A;  4A5B A;  2F8S A;  1DTT A;  3P31 A;  5AQF A;  3L3U A;  3S41 A;  4DG1 A;  1ZYQ A;  3V9X A;  2G8V A;  3DAW A;  3WQT A;  1RBR A;  3O9R A;  3TAF A;  1W9H A;  1NK0 A;  3BUZ B;  3IMX A;  2OTL N;  2E6L A;  4IO9 L;  1EO1 A;  3B6P A;  3V9Z A;  4B9T A;  5KQ8 A;  2IDO A;  2D5R A;  3QO9 A;  4LSN A;  3KK7 A;  4JKB A;  1IBL K;  1Q9X A;  2KLA A;  2HBJ A;  4DFJ A;  4B1V A;  3M5R A;  4CZE A;  4BGB A;  4WQ5 C;  2OPR A;  3HI0 A;  3BEX A;  4FJI A;  4H0O A;  1BDG A;  5JLF A;  3D7E O;  3QNN A;  2YNH A;  5AQW A;  1VQM N;  1VSK A;  3DOK A;  3DXM A;  3D0P A;  3GL1 A;  2G8K A;  4J2A A;  4AHS A;  4B9Q A;  4GVM A;  4IWV A;  1WSF A;  3CIP A;  3QBX A;  4FWR A;  3VEV A;  2E1Y A;  4K43 A;  4BR4 A;  3VQ6 A;  2IS3 A;  4KI6 A;  1M1K O;  4H5R A;  4IOC L;  1MU2 A;  1VSI A;  3C65 A;  3DLG A;  4PA1 A;  1HNX K;  1Z26 A;  1EWR A;  3KLG A;  4Y1D A;  4CFA A;  3NVK A;  4DS5 A;  4FM1 A;  4W5Q A;  2P9N A;  5AZI B;  3PO5 A;  2YKM A;  5FRM A;  3KD5 E;  1NNE A;  2OZS A;  3E01 A;  1XC3 A;  3P1G A;  3VA0 A;  1RIL A;  4JYA K;  1BCM A;  5EY4 A;  3ITH A;  4CJ3 A;  3OBY A;  2OCE A;  1X3N A;  3M1F A;  1NK5 A;  3OYB A;  4DV7 K;  4H8K A;  3ZX2 A;  3LAK A;  3UKU B;  4F9O A;  4LH5 A;  3NCI A;  1C0G A;  4KHU A;  4ZTJ A;  1QHA A;  3L6Q A;  1X1P A;  3V9S A;  2PYJ A;  4FSV A;  5M1N A;  1KAX A;  3CJA A;  4H03 B;  3QNO A;  3QFP A;  2FSJ A;  3DYA A;  2ZWH A;  4BRL A;  4MO5 A;  4MFB A;  1IBM K;  3LM2 A;  3AO1 A;  3NBP A;  4IKF A;  4KPY A;  4FJJ A;  1UA0 A;  5C2D A;  4NXM K;  1BO5 O;  4U7B A;  5JS2 A;  4DUY K;  2X74 A;  3BDP A;  2VG5 A;  4GVE A;  2RPI A;  3AA4 A;  1L3U A;  1SS6 A;  1RCH A;  3U8X A;  4M7Y A;  5AFU A;  1UAX A;  4W5N A;  1ASV A;  3C6H A;  2HHT A;  3ZET B;  3VF4 A;  1K8K B;  2PYL A;  3NFA A;  4DB3 A;  2GWK A;  3VQB A;  2NRV A;  4CFD A;  3QLH A;  3EKU A;  3CER A;  3V4I A;  4WFA L;  4TSX A;  5CYQ A;  1BOT O;  3LP0 A;  3AVL A;  5C42 A;  2YHW A;  5EVZ A;  1KSP A;  1UOC A;  3THW B;  3JSM A;  2LSN A;  3M3Z A;  1QSY A;  3P5J A;  1RBU A;  1ASW A;  1Q18 A;  5IT9 O;  2FXU A;  3VGK A;  2W6L A;  4ZTF A;  4KH5 A;  4YOX A;  1WB9 A;  1XHZ A;  1D9D A;  4MLE A;  4PWD A;  3KIO A;  4AHU A;  3L3V A;  1NJI O;  3O9T A;  3L4Q A;  1VSD A;  4J2E A;  1D8Y A;  4CZL A;  4CHO A;  2KW4 A;  1WBD A;  1OVY A;  1Q8I A;  2O8C B;  1HMV A;  2HVH A;  3MN6 A;  1SL2 A;  1BGX T;  2OPQ A;  1M90 O;  2KZM A;  4MLH A;  3CFP A;  4CJK A;  3AVA A;  1CXU A;  2YI1 A;  3QEV A;  5HRN A;  1RBV A;  2KQ2 A;  3F9K A;  1E4F T;  3VQD A;  4IEI A;  1VSE A;  3NE6 A;  2F8T A;  3E9P A;  4B9N A;  2GEL A;  1YHQ N;  1VQK N;  3A0I X;  1Q82 O;  3H08 A;  3R6M A;  3QIP A;  5AR0 A;  3SPY A;  4LD0 A;  1ASU A;  3T1Y K;  2HHQ A;  3FZL A;  3OHR A;  2GUP A;  2YJF A;  2WTU A;  5AQU A;  4PKH A;  1KVA A;  2Z1I A;  4BR9 A;  3NMU A;  2NUB A;  2PY5 A;  1S5J A;  2HHV A;  4NYN A;  4OLB A;  3M6G A;  1TKZ A;  2DFH A;  3CHW A;  1S6P A;  1TL3 A;  3H1Q A;  2I5J A;  3LP2 A;  3N4Q A;  4A59 A;  2HVI A;  1QQC A;  5ADX A;  1OH7 A;  1VSL A;  1REV A;  3CYM A;  1HJR A;  1NGC A;  3VEO A;  1WNS A;  4W5T A;  4RCH A;  3AVK A;  4F2R A;  1HR0 K;  2VWK A;  3NH0 A;  3CJ7 A;  3SLC A;  3U9Z A;  1JLQ A;  3ZT3 A;  3CMA N;  3Q7B A;  5M1Q A;  3A5N C;  3R8E A;  3D2F B;  4A5A A;  4DU4 A;  3FE1 A;  3VTI A;  2KTQ A;  4JI8 K;  3ENB A;  4EHT A;  3NGI A;  5GAH P;  4ISE A;  1HYS A;  1ZC6 A;  4M3R A;  1LWC A;  4JEP A;  3F2K A;  4OPA A;  4IOA L;  3RSE A;  2P9I B;  4FK4 A;  3OYN A;  2QXF A;  4FZZ A;  3E1Y A;  4BRK A;  1WSH A;  3L2U A;  4KB0 A;  3VQ7 A;  1WSG A;  3ZLJ A;  2HNY A;  2D0O A;  1NJX A;  2HHS A;  4DR6 K;  3ATV A;  4H5T A;  3MXI A;  2VGM A;  4F3O A;  3M8P A;  5HOO A;  3VER A;  1QSS A;  2F9W A;  4AQY K;  5LJV A;  1JCE A;  3VES A;  1I94 K;  3A5M C;  1EP4 A;  1P8Z A;  5KQD A;  4CFB A;  4CGF A;  1RT6 A;  5F1X A;  2O8F A;  1HKC A;  1NK8 A;  4FZX C;  3AVN A;  5AQN A;  3ZSO A;  4AHT A;  1YTU A;  1G15 A;  2EHG A;  4DR4 K;  4L3Q A;  5HRO A;  4CJW A;  1DKG D;  3KK3 A;  4DTP A;  4CCH A;  4JHD A;  1JLE A;  4DLG A;  4JS4 A;  3HXM A;  4JI0 K;  2RN2 A;  3OTO K;  4F4K A;  4E3S A;  2QM1 A;  4HWI A;  3NAE A;  2P9L B;  3HZ6 A;  3VQP A;  4FLX A;  1NGA A;  1BIS A;  2XHB A;  2EX3 A;  1JLA A;  1DEJ A;  5BRH A;  4CED A;  1WLJ A;  4OO1 J;  2JWK A;  4WYB A;  3TI0 A;  5BR8 K;  4FWQ A;  2V52 B;  3IUC A;  3F5T A;  3R3L A;  4C8N A;  1NMD A;  3VEW A;  3K5M A;  3CJ1 A;  4V19 S;  3KTQ A;  1EX4 A;  4AF1 A;  4NCB A;  1NGF A;  3U3G A;  5BPL A;  1KVC A;  1YUW A;  3DLL L;  3THV A;  2UXD K;  2V7Z A;  4BR7 A;  3HL8 A;  3D2E B;  3LPT A;  3O1B A;  4YOR A;  4PHT X;  3AVG A;  1SKR A;  3EN9 A;  4DQP A;  5BPN A;  4RW8 A;  3WNE A;  3AO5 A;  2CH6 A;  3ZSY A;  4R5P A;  1J5O A;  3WXK A;  3OYH A;  5AQK A;  5ADX H;  1EET A;  2NRH A;  1VQL N;  1Y64 A;  2QWR A;  1QE1 A;  2HHX A;  5FLX O;  1RT4 A;  3HRG A;  4OPH A;  1SKS A;  2P9S A;  3MX5 A;  1HYV A;  5AQY A;  1YJW N;  4IOX A;  3VEY A;  4CF0 A;  3A2F A;  3ULD A;  1NKB A;  2D0B A;  1BA0 A;  4JLH A;  4DQI A;  3IRX A;  4K25 A;  5KPR A;  3K5O A;  3G71 N;  3CJC A;  4JNE A;  5FRN A;  2KFN A;  1HUX A;  2AA4 A;  4H0X B;  1LCU A;  1VK0 A;  3CF5 L;  4FW1 A;  4KRE A;  4A2A A;  3B6O A;  1LAV A;  1EXQ A;  4FWP A;  3WNH A;  4FWO A;  1IO2 A;  1NGI A;  4B9M A;  4OVL A;  1TK8 A;  4JV5 K;  3VQQ A;  2UUC K;  4FJH A;  3BGR A;  1RBT A;  4Z4E A;  4YHH K;  4CZH A;  3J7Y P;  2QWN A;  4DTN A;  1NG9 A;  2BDP A;  4M3W A;  3ZSQ A;  5AQZ A;  1KVB A;  1TAQ A;  1JCG A;  4M3Z A;  4BRN A;  3TTC A;  1K8A O;  3FZH A;  3UKR B;  5LMN K;  2O4I A;  4HUF A;  3O5B A;  4LC9 B;  3G10 A;  4KTW A;  4GW6 A;  4B3T K;  4KHS A;  3LAL A;  3WUH A;  3K5N A;  4YOW A;  3KWI A;  1W2B M;  1T6C A;  3VQ5 A;  1YI2 N;  3FZM A;  4XH1 A;  4EHU A;  1L3S A;  3TR8 A;  4CEE A;  1BCO A;  3C95 A;  1CZ9 A;  4LF6 K;  3A5L C;  4IZ9 A;  4M3Y A;  4BGA A;  4K41 A;  1HJO A;  4HUE A;  2F9T A;  4CBX A;  4YOV A;  2X6S A;  2HB5 A;  2B6A A;  5GIN A;  3FLC O;  2VWJ A;  4B3M K;  2YJE A;  4CVN E;  4GY2 B;  3O3F A;  1MWM A;  2GWJ A;  3TAM A;  3L2V A;  2Q1N A;  4JI6 K;  4CEZ A;  5AJ3 K;  3OS2 A;  2ZQB A;  3OW2 M;  1S1T A;  1KTQ A;  2G8H A;  5CZ2 A;  3AAR A;  2D4W A;  3E66 A;  4JI2 K;  5AQT A;  3AVC A;  5AQP A;  2E4L A;  1VQO N;  3QEI A;  4DV6 K;  4FW2 A;  4CJF A;  5BN8 A;  2HF4 A;  1LW2 A;  4IJA A;  3HO1 A;  4FZY A;  1TYQ B;  1Z05 A;  4CEF A;  3ZYY X;  3QEP A;  4E1J A;  4CEQ A;  3THY A;  2O8D B;  3RR7 A;  1S3X A;  4I9L A;  3SAH A;  4B3S K;  1FW6 A;  5J2Q A;  4CZF A;  2FBX A;  3LDP A;  4F8R A;  1NGB A;  1GOC A;  1QZ5 A;  3QEW A;  1VAZ A;  2EWS A;  1S1U A;  4LY7 A;  3MCP A;  1T3V A;  1VRT A;  1IKY A;  1SUQ A;  3ASM A;  2E20 A;  4NB4 A;  4F2S A;  1TUU A;  4DSE A;  5GIO A;  1N8R O;  2WON A;  3UB5 A;  1NGH A;  2B4J A;  3SQ4 A;  3H6E A;  2F96 A;  4M42 A;  1S9G A;  2YX6 A;  3W0L A;  3B8A X;  5AZJ A;  5E41 A;  4CIG A;  3RR8 A;  2G8W A;  3ZCM A;  5JIC A;  3CQY A;  4DKW A;  4O44 A;  1XMQ K;  1NK4 A;  4FJ7 A;  1TKT A;  2Z1G A;  4CGJ A;  1X9M A;  1QZ6 A;  2HND A;  1J6Z A;  4JN4 A;  1N6Q A;  1IG9 A;  3C7N B;  3DLH A;  1X3M A;  5ELZ A;  4AHR A;  3ZEU B;  4KTZ A;  4M7X A;  2V7Y A;  4DF8 A;  4O55 A;  4CEC A;  4BRA A;  3CC7 N;  2IVN A;  3WEE B;  5C2F A;  1HQU A;  3SCX A;  4B9U A;  1RDC A;  3LAN A;  1N33 K;  3DLK A;  4FVU A;  3ALY A;  4EIA A;  2BAN A;  1U45 A;  2ZJP L;  1VQ7 N;  3MK6 A;  1VHX A;  3MEE A;  1BUP A;  4B1Y B;  3HJF A;  4CGG A;  4NYF A;  4BWJ A;  4BR0 A;  4KAZ A;  1GOA A;  2BE2 A;  2KKZ A;  1HNZ K;  1LOT B;  2X78 A;  3T1H K;  4FCY A;  4RTF D;  1RT2 A;  4OKE A;  4JI4 K;  1OH8 A;  1U4B A;  5JLH A;  2O8E B;  1HRH A;  4DQS A;  2UUA K;  1JLC A;  4FJG A;  4GNI A;  3HPG A;  4FVM A;  4FOI A;  1MWK A;  3IDH A;  4CIF A;  2X6N A;  3EL2 A;  3JS6 A;  2A3Z A;  2Z1H A;  5BR9 A;  4LF4 K;  2XY5 A;  4M3U A;  1VQ4 N;  4BRE A;  4AM6 A;  1XNQ K;  4JKA A;  2A5X A;  4CES A;  5HBM A;  1FKP A;  2ZJQ L;  1J53 A;  4FXD A;  3HST B;  3AAP A;  2UUB K;  4IG0 A;  5C15 A;  4X64 K;  3VEZ A;  1EKE A;  3VN5 A;  3J7A P;  3HPO A;  2W40 A;  4O5B A;  1MDU B;  4BRH A;  4FM2 A;  1T7P A;  2WFB A;  1QVF M;  2AP1 A;  1C0U A;  2CGJ A;  2IVP A;  1S1W A;  2P9U A;  3TU5 A;  4KFB A;  4JI7 K;  1D9F A;  3PX4 A;  3O3G A;  1HKG A;  1U2V B;  1BQN A;  4EP5 A;  1OH5 A;  4BVO A;  4CGI A;  4JKG B;  3OS0 A;  4WCE L;  2E2P A;  5LL6 Z;  3SZ2 A;  4CGH A;  2P1J A;  5TKW A;  1X9W A;  2QK9 A;  2Y1J A;  4O8K A;  4GKJ K;  4BG8 A;  4BRD A;  3O4W A;  1SAZ A;  4PUO A;  1JCF A;  4OKJ A;  4FLV A;  4OKK A;  3LZJ A;  3VF2 A;  4DSF A;  2P9P A;  5EX5 A;  4H4M A;  3ZET A;  3G4S N;  2Y1I A;  3O08 A;  3RMD A;  3BY5 A;  3TWH A;  5C10 A;  4H5W A;  5KRT A;  3CCU N;  3SQ2 A;  5KTQ A;  4A62 A;  2A40 A;  2OYQ A;  4FPA A;  4BRG A;  3TSP A;  2YHX A;  1GOB A;  3KJV A;  3CG7 A;  1JKH A;  3W3D A;  4BQL A;  5AQJ A;  4JS5 A;  3CM6 A;  2E6M A;  3EKS A;  1BL3 A;  4XH4 A;  2G8F A;  4HUG A;  1N5Y A;  4E7L A;  3HVR A;  2YHA A;  3H3N O;  4CEO A;  4DSL A;  1LWF A;  1J54 A;  3N4P A;  2P5G A;  4B3R K;  1SZ2 A;  4QCL A;  3THX A;  1CZB A;  2E2N A;  4KH4 A;  3MXM A;  4EFH A;  3SUP A;  2JWL A;  2ASO A;  3EZW A;  1SQK A;  4KV8 A;  3BZC A;  1C0F A;  3RRG A;  1ITG A;  1C0T A;  1VSM A;  4GKK K;  4CK1 A;  1OVQ A;  4CGD A;  3SUN A;  1BI4 A;  3SYZ A;  1LAW A;  4CEA A;  5F0X A;  4MDA A;  1NKE A;  2Z1J A;  4M45 A;  2QKK A;  4DR2 K;  4CBW A;  4CD3 A;  2XY7 A;  4I7F A;  3MEG A;  3OVN A;  3CCQ N;  4C8M A;  4JK8 A;  3TTD A;  3HOS A;  2Q0R A;  3OYE A;  4I6M B;  2GEM A;  2VWB A;  2E8A A;  5BRF A;  1VSJ A;  4CZK A;  4DV2 K;  3AA3 A;  4FM0 A;  3CXC M;  3MN5 A;  4CJP A;  4DTS A;  2UXB K;  2GUI A;  3OYF A;  1Q7Y O;  1NGD A;  4KH6 A;  4DSI A;  2HOE A;  5SZT A;  4B08 A;  1KD1 O;  5AQH A;  3O4Q A;  1QSL A;  1VQP N;  5KGW A;  4FLW A;  4PL8 A;  3S3M A;  5J2P A;  4DTU A;  1CLQ A;  4KTQ A;  2YNF A;  4CJV A;  3I8D A;  2YV0 X;  4WQ5 A;  3TSU A;  4BRP A;  1YIJ N;  2P9K A;  4L8R B;  2VG6 A;  1HLU A;  1KFS A;  1WN7 A;  1BG3 A;  2ATQ A;  4N47 A;  2A41 A;  1BU6 O;  5HRR A;  1YF5 L;  3WT0 A;  1RNH A;  4BC5 A;  1MA9 B;  4JAX A;  3O80 A;  1NK9 A;  2OA8 A;  2HF3 A;  4N56 A;  1ZBH A;  1KRP A;  3HVT A;  3QDK A;  3LDS A;  2ZGY A;  1YVN A;  3SMP A;  3ZSW A;  3DWL A;  3OJU A;  3HYF A;  2UYT A;  1C1A A;  3C6A A;  3OYM A;  1Y97 A;  3P39 A;  4A57 A;  3CPW M;  2FBY A;  1RDA A;  3TPQ A;  4JKE A;  4KO0 A;  3WNF A;  3L2R A;  4BWM A;  4YY3 K;  3ZT4 A;  3KHY A;  3OYG A;  4LF8 K;  2FF3 B;  3ID8 A;  5AFU H;  3O6W A;  3CFO A;  3O8M A;  3EO3 A;  3OYC A;  1YVU A;  3FZF A;  3LL3 A;  3MN7 A;  2VG7 A;  3HBT A;  2PBD A;  1NJZ A;  2VYP A;  1GLF O;  1ZBF A;  2OZM A;  1HPM A;  5A2Q O;  4CD1 A;  5J2M A;  5I3U A;  4KI4 A;  4YOY A;  2YHB A;  4JI1 K;  3R1X A;  3UIQ A;  3BP8 A;  4BRO A;  4C8L A;  2XRI A;  4A61 A;  1Z6R A;  1XC9 A;  5AQG A;  1P90 A;  5C12 A;  5M1F A;  4FK2 A;  2OPS A;  2IAJ A;  3HM8 A;  2ZF5 O;  2YCH A;  3Q7C A;  4ISF A;  3AAQ A;  3O4N A;  3A5O C;  3NF6 A;  3SJJ A;  3DXK B;  3FGU A;  3CCR N;  4CK2 A;  4BRQ A;  4DQ8 A;  4FLU A;  1SL0 A;  3KK1 A;  3EEQ A;  2JGU A;  3EYZ A;  3OJS A;  4WQ4 C;  4CJ5 A;  1TV6 A;  1RDW X;  1I39 A;  5AQR A;  3H46 O;  3PSF A;  5HRP A;  4JD2 A;  3RSE B;  3T3F A;  4CJE A;  3NF8 A;  1TK0 A;  2BUP A;  2DFE A;  3LWM A;  3WXJ A;  4GV6 A;  5KPZ A;  1OKJ A;  1O1W A;  4CHY A;  4Z4F A;  5I9E B;  2CGL A;  3AA5 X;  3J7Z O;  1IG8 A;  5E84 A;  3MAQ A;  3K9K A;  2B5J A;  1R59 O;  3KD1 E;  2F7T A;  4OJR A;  3D6R A;  3DJC A;  1IKX A;  1VRU A;  3A8Y A;  4B9S A;  2RF2 A;  3U6F A;  2NZT A;  2NLX A;  2FSN A;  2D0A A;  3ID6 A;  4K42 A;  2KHO A;  3K57 A;  1RGI A;  3VGL A;  5LMU K;  4DUZ K;  1TVR A;  2A1S A;  2I7P A;  5CY4 A;  3OYL A;  3WXL A;  2O8F B;  1R0A A;  3HM9 A;  4Q5V A;  2QEX N;  4BVP A;  5DM6 L;  3R9P A;  3V6D A;  3VF6 A;  4Z4C A;  1TKX A;  4NXN K;  4JHD B;  4Z4H A;  3QIN A;  3OYA A;  4YDU C;  4JKD A;  4OPK A;  3SBT A;  1K9M O;  5HRS A;  4KHP K;  4CHN A;  5AQI A;  4ILG B;  1KAY A;  5CE3 A;  1BA1 A;  4C8O A;  3V1R A;  3SI6 A;  4B1X B;  5JS1 A;  4ILJ A;  3VGM A;  4FK0 A;  4NLB A;  2E2O A;  3AVB A;  4WFN L;  4ID5 A;  4H4O A;  2KZZ A;  5DM7 L;  5FPN A;  4KB1 A;  3S9H A;  3HP6 A;  3QML A;  2RHK A;  3DM2 A;  1HNV A;  4C8K A;  2JLE A;  3EY1 A;  3IFR A;  3TTF A;  3PIP L;  4M3X A;  3I33 A;  1HX1 A;  2VQF K;  2W6K A;  3J81 O;  2QWM A;  4FJN A;  2IVO A;  5IWA K;  3CCE N;  2DPN A;  1V4S A;  4FWL A;  4JRP A;  3SPZ A;  3NVM A;  1E4G T;  4EP4 A;  1FKO A;  4CFC A;  1NGJ A;  1HNI A;  2XO7 A;  1SL1 A;  1I3A A;  1S6Q A;  4DR1 K;  1RT7 A;  4CZJ A;  5J1E A;  4KBO A;  4BY9 C;  1NKC A;  1ZXO A;  5T7B A;  3KLF A;  2UU9 K;  5M1K A;  1RTD A;  4DV5 K;  3L2W A;  1TAU A;  3C6U A;  2Q31 A;  2FLO A;  1A5W A;  4Y1C A;  2ZGZ A;  3TAB A;  3AGR A;  1D4X A;  2WBN A;  3CJB A;  4FJL A;  5HLF A;  4DFK A;  1HQE A;  1KAZ A;  1IV0 A;  1JL1 A;  4EZ6 A;  4BR5 A;  4BQZ A;  4RW4 A;  1BQM A;  4FOE A;  3L4I A;  3PO4 A;  1WAJ A;  3VMF B;  4KHW A;  2FBV A;  4NO7 A;  4BRM A;  3ENH A;  1T44 A;  3WNG A;  3I56 N;  3HOT A;  1W7A A;  4X66 K;  4JKC A;  2O8B A;  1X9S A;  3VOV A;  2NRT A;  3WXI A;  3KLI A;  1QS4 A;  2DTU A;  2OPP A;  3G0Z A;  4IEE A;  2W42 A;  2BGG A;  2G8I A;  3IS9 A;  1Q86 O;  1S22 A;  4QS9 A;  2ZM6 K;  2W41 A;  3C6T A;  2QA4 N;  4FJ9 A;  1KCF A;  5GAE P;  3G6E N;  3JYT A;  5GIP A;  1WUA A;  4O8U A;  4WF9 L;  4R79 A;  4FPB A;  4CF2 A;  3HK2 A;  4DWI A;  4IJN A;  5M1P A;  2HMI A;  4IFE A;  2A1R A;  4BRF A;  1UWB A;  5C0Y A;  5KGX A;  4K8X A;  4IXC A;  2DFF A;  3P38 A;  4BRC A;  1XNR K;  1S1V A;  1RTJ A;  5BN9 A;  5DK5 A;  5F2R A;  5EOY A;  1Q81 O;  3U3Y A;  3EE9 A;  1WAF A;  2QWO A;  4CK3 A;  3PY8 A;  1ILY A;  3ZSR A;  3O1W A;  4CZM A;  4HTU A;  4IDH A;  2A42 A;  4DQQ A;  3T19 A;  3PLA A;  1YXQ A;  3LPU A;  3MWP A;  3MX2 A;  3O9Q A;  4J8F A;  4LH4 A;  4C23 A;  1EWQ A;  1U04 A;  2KFZ A;  4NCA A;  3NHG A;  4XIU A;  3SAG A;  1B92 A;  3BF1 A;  1XWL A;  4B1U B;  3ZT2 A;  4E7H A;  1JJ2 M;  2CGK A;  4BR2 A;  2FF6 A;  4G1Q A;  1O13 A;  3CM5 A;  2NRW A;  4CI6 A;  2Q36 A;  3CCM N;  1VSH A;  1RT1 A;  1S72 N;  4DFM A;  3THY B;  1NMN A;  2QW9 A;  3SUO A;  1KQS M;  4B9V A;  4BC4 A;  1RTI A;  4DF4 A;  3NGY A;  4FWK A;  2VQE K;  2AJQ A;  3KZB A;  1T8E A;  4FJK A;  4JKF A;  4Z4G A;  1H1V A;  1QQN A;  4DV0 K;  3ZSZ A;  1NWK A;  4M3T A;  3CJ9 A;  4ICL A;  4MDB A;  2OTJ N;  1JXE A;  4FLY A;  1S9E A;  4JKG A;  2Q2R A;  1LV5 A;  3CFR A;  4CF1 A;  3ULE B;  2ASP A;  3CME N;  3SNN A;  4F3T A;  1CXQ A;  1NGG A;  3PSI A;  4QOZ B;  1NOZ A;  4IG3 A;  4CW7 B;  3MXJ A;  3O9U A;  1FXX A;  2VCP A;  4O0J A;  3IG1 A;  5AZI A;  3HT3 A;  5AZJ B;  3LWL A;  4CZG A;  2PZS A;  4FWS A;  3VEX A;  1YTA A;  1K6Y A;  4BDZ A;  1T05 A;  3DLE A;  3OBW A;  4CER A;  1KLM A;  4E7K A;  3KLH A;  5M1O A;  4H0P A;  4PKG A;  4YOT A;  3LP3 A;  3M8S A;  3PV8 A;  5HL7 L;  3U4L A;  5I42 A;  3UKU A;  2FSK A;  3UE5 A;  2GTD A;  1YT3 A;  3SV3 A;  2FBT A;  5AQV A;  2QI2 A;  3TAG A;  4CIE A;  3VQ8 A;  3SV4 A;  5CZ1 A;  5GAG P;  1NLV A;  5SWM A;  4C1N I;  5CHI A;  4FLT A;  4JI3 K;  4FJ5 A;  4OGE A;  4UQG A;  1YJN N;  1TKD A;  2PFU A;  4XEI A;  1W97 L;  1L3T A;  3S3N A;  1WSJ A;  3TAQ A;  1VQ6 N;  5C24 A;  1HKB A;  5KI6 A;  3JAM O;  4B9L A;  4LF7 K;  3FZK A;  1K8K A;  3AO2 A;  4ELT A;  4B3O A;  4HCC A;  3VQC A;  1QHT A;  1S1X A;  4ELV A;  4G9Z A;  5JVG L;  1GLJ O;  5JMV A;  3VEN A;  1DLO A;  3OA9 A;  1QQM A;  4U67 L;  3NDK A;  2PAV A;  3DXM B;  3E9O A;  3ENO A;  4DV1 K;  3NF9 A;  4K0K K;  5BRD A;  3THW A;  4X62 K;  1ZBL A;  2D1K A;  5LY3 A;  2P9U B;  3MMV A;  3MCA B;  4DLE A;  3ZX0 A;  1JLG A;  5GAD P;  2ITM A;  4YFU A;  4Z94 A;  3FFI A;  4H0Y B;  3WXM B;  2Q0U A;  4FYD A;  4BDY A;  3M8Q A;  3OYI A;  3RWU A;  4I6M A;  1NGE A;  3NH2 A;  4LFA K;  3OYJ A;  4CJU A;  2VGN A;  4JK9 A;  1BHL A;  2HHW A;  2O8C A;  2R7Y A;  1QVG M;  3NGZ A;  4JK7 A;  1NJW A;  1JLF A;  3CET A;  2P9N B;  3HP9 A;  4E0D A;  1KXP A;  4KHY A;  2E1Z A;  4KHN A;  5KRS A;  4DTO A;  1XUP O;  1GLC G;  5B8H A;  1X9J A;  4M41 A;  2P9P B;  4AM7 A;  2F4V K;  1T03 A;  4DMN A;  4BG9 A;  3VQ4 A;  5H1S Q;  3M8R A;  5TKY A;  3LAM A;  1IBK K;  3CPE A;  2GX9 A;  3DI6 A;  5HP1 A;  2NRZ A;  1NBW A;  4LF5 K;  1B9F A;  3PX6 A;  1RDD A;  1FJG K;  1GLB G;  4E7J A;  3CCL N;  1GLL O;  4IDK A;  3AVI A;  4OX9 K;  5BPM A;  2D0C A; 
#chains in the Genus database with same CATH homology
 3NF6 A;  3B6P A;  3V9Z A;  3SJJ A;  4B9T A;  4M3Y A;  2IDO A;  2D5R A;  4HUE A;  1LWE A;  4CK2 A;  3QO9 A;  4LSN A;  2X6S A;  2HB5 A;  4FLU A;  5EU7 A;  4BE0 A;  1SL0 A;  1Q9X A;  3VQE A;  2B6A A;  4DFJ A;  2XY8 A;  2VWJ A;  3KK1 A;  2JGU A;  3EYZ A;  3OJS A;  3O3F A;  4CJ5 A;  2OPR A;  1TV6 A;  2ZD1 A;  3TAM A;  3V9U A;  3SUQ A;  3L2V A;  1I39 A;  4FJI A;  1KLN A;  4CEZ A;  4NCG A;  5HRP A;  3T3F A;  4CJE A;  3NF8 A;  3OS2 A;  2YNH A;  3QNN A;  1TK0 A;  2DFE A;  1VSK A;  3DOK A;  3LWM A;  4CE9 A;  3D0P A;  4QAG A;  2ZQB A;  3DRS A;  4WE1 A;  2G8K A;  1S1T A;  1O1W A;  4CHP A;  4CHY A;  1KTQ A;  1DTQ A;  2G8H A;  5CZ2 A;  3AA5 X;  2G8U A;  4J2A A;  4Z4F A;  4AHS A;  3MAQ A;  4GVM A;  2B5J A;  3AVC A;  4CJS A;  1WSF A;  4DU3 A;  3KD1 E;  3PUF A;  2E4L A;  4OJR A;  3QEI A;  3AA2 A;  1IKX A;  1VRU A;  4FW2 A;  4B9S A;  3OY9 A;  1JLB A;  4CJF A;  2RF2 A;  3U6F A;  4K8Z A;  2D0A A;  1LW2 A;  3VQ6 A;  2IS3 A;  4KI6 A;  4RW9 A;  3HO1 A;  4FZY A;  1MU2 A;  4CEF A;  3K57 A;  4BE1 A;  1VSI A;  3DLG A;  4PA1 A;  1Z26 A;  3KLG A;  3QEP A;  2HHU A;  1BI4 B;  4Y1D A;  4CEQ A;  4CFA A;  4E89 A;  3SQ1 A;  3RR7 A;  1TVR A;  2A1S A;  4I9L A;  4MQ3 A;  5CY4 A;  3OYL A;  4DS5 A;  5J2Q A;  4FM1 A;  4W5Q A;  1R0A A;  3HM9 A;  3PO5 A;  2FBX A;  2YKM A;  4Q5V A;  5FRM A;  4GMJ B;  4RG8 A;  4B8A B;  3KD5 E;  4F8R A;  3RMB A;  1GOC A;  3LP1 A;  2OZS A;  4J2D A;  3QEW A;  4HVJ A;  3V6D A;  3E01 A;  3P1G A;  3VA0 A;  1RIL A;  1S1U A;  3AV9 A;  4LY7 A;  1BCM A;  1TKX A;  1VRT A;  4Z4C A;  4Z4H A;  3ITH A;  1IKY A;  3QIN A;  1SUQ A;  3ASM A;  4CJ3 A;  3OYA A;  3C95 A;  4F2S A;  4OPK A;  3AVM A;  4DSE A;  2WON A;  2B4J A;  1NK5 A;  5HRS A;  4CHN A;  3SQ4 A;  3OYB A;  2F96 A;  4H8K A;  4C8O A;  3LAK A;  1S9G A;  3V1R A;  4BAC A;  3SI6 A;  4M42 A;  3KKS A;  5JS1 A;  4LH5 A;  4FK0 A;  4DSJ A;  3AVB A;  5E41 A;  3NCI A;  3F73 A;  4ID5 A;  4BE2 A;  4KHU A;  4H4O A;  4CIG A;  3AO3 A;  4ZTJ A;  2KZZ A;  1XHX A;  3DMJ A;  4O4G A;  3K2P A;  5CYM A;  3RR8 A;  2G8W A;  3ZCM A;  3S9H A;  4KB1 A;  3HP6 A;  1X1P A;  4YNQ A;  3V9S A;  2PYJ A;  4O44 A;  4CHQ A;  3DM2 A;  1NK4 A;  1TKT A;  4FJ7 A;  2Z1G A;  4CGJ A;  4JRQ A;  4DTX A;  1HNV A;  4C8K A;  1X9M A;  2JLE A;  2HND A;  3EY1 A;  3QNO A;  5D3G A;  4CHZ A;  1N6Q A;  1IG9 A;  4M3X A;  3DYA A;  3DLH A;  3OYK A;  4AHR A;  4MFB A;  1RT5 A;  4FJN A;  3AO1 A;  3NBP A;  4KTZ A;  4DF8 A;  4IKF A;  4O55 A;  4FJJ A;  4KPY A;  1UA0 A;  4CEC A;  4HHT A;  4JRP A;  3SPZ A;  3L2Q A;  3SCX A;  4EP4 A;  1HQU A;  1FKO A;  5JS2 A;  2X74 A;  4CFC A;  3BDP A;  2VG5 A;  1RDC A;  4B9U A;  3I0R A;  3LAN A;  1HNI A;  2RPI A;  3AA4 A;  3DLK A;  1L3U A;  4Q0B A;  1RCH A;  3AVJ A;  2XO7 A;  1B9D A;  3ALY A;  1SL1 A;  3IAY A;  1UAX A;  2BAN A;  1I3A A;  1ASV A;  1U45 A;  1S6Q A;  4W5N A;  1RT7 A;  2HHT A;  1HYZ A;  5J1E A;  3MEE A;  1NKC A;  5T7B A;  3HJF A;  4CGG A;  3KLF A;  1RTD A;  2PYL A;  3NFA A;  4NYF A;  3L2W A;  1C6V A;  3QET A;  1TAU A;  3C6U A;  4BWJ A;  4KAZ A;  1FK9 A;  1GOA A;  3VQB A;  2BE2 A;  1A5W A;  4CFD A;  4FJM A;  3QLH A;  4Y1C A;  3AO4 A;  3V4I A;  4CJQ A;  3TAB A;  1IKW A;  4TSX A;  5CYQ A;  2X78 A;  4FCY A;  3LP0 A;  3AVL A;  4CF8 A;  3V9W A;  5C42 A;  1RT2 A;  4FJL A;  1KSP A;  1UOC A;  4OKE A;  5HLF A;  1U4B A;  4DFK A;  1HRH A;  4DQS A;  1HQE A;  1JLC A;  3JSM A;  4CJR A;  4FJG A;  2LSN A;  3HPG A;  1QSY A;  1JL1 A;  3AVH A;  4FVM A;  3CQ8 A;  4EZ6 A;  3P5J A;  1RBU A;  3HPH A;  4RW4 A;  1ASW A;  4CIF A;  2X6N A;  1Q9Y A;  4E7I A;  1BQM A;  3DLR A;  4ZTF A;  3PO4 A;  2Z1H A;  1WAJ A;  2YNG A;  4KHW A;  2XY5 A;  4M3U A;  5FDL A;  2FBV A;  1XHZ A;  1D9D A;  2RKI A;  4CES A;  4PWD A;  1TL1 A;  5HBM A;  1FKP A;  3KIO A;  3WNG A;  4AHU A;  3L3V A;  1J53 A;  3ZT0 A;  1TK5 A;  4FXD A;  1JL2 A;  1VSD A;  3HST B;  3MED A;  1D8Y A;  4J2E A;  3C94 A;  4IG0 A;  1ZBI A;  1LW0 A;  1X9S A;  1EKE A;  3VN5 A;  4CHO A;  2KW4 A;  3KLI A;  3HPO A;  4CJL A;  3DRR A;  1QS4 A;  1Q8I A;  1BIU A;  2OPP A;  1HMV A;  4O5B A;  1BIZ A;  2HVH A;  1ZBU A;  4FM2 A;  1T7P A;  3G0Z A;  1SL2 A;  1BGX T;  2OPQ A;  1C0U A;  2W42 A;  1C1B A;  1S1W A;  2BGG A;  2KZM A;  3AVF A;  3CFP A;  4KFB A;  2G8I A;  3IS9 A;  4CF9 A;  4CJK A;  1D9F A;  3AVA A;  1CXU A;  3QEV A;  5HRN A;  1RBV A;  4DTJ A;  2KQ2 A;  3PX4 A;  3O3G A;  4DTM A;  3F9K A;  1BQN A;  1A5V A;  3VQ9 A;  3C6T A;  4EP5 A;  3VQD A;  3TAR A;  4FJ9 A;  1KCF A;  4CGI A;  1VSE A;  4Z0U A;  3NE6 A;  3OS0 A;  2F8T A;  4B9N A;  3SZ2 A;  4CGH A;  2GV9 A;  3K59 A;  3JYT A;  2P1J A;  2ETJ A;  3H08 A;  4DFP A;  3QIP A;  1X9W A;  4RW7 A;  2QK9 A;  2Y1J A;  3SPY A;  4CF2 A;  4LD0 A;  3HK2 A;  1ASU A;  4DWI A;  2HMI A;  2HHQ A;  3OS1 A;  2GBZ A;  2A1R A;  1J9A A;  1UWB A;  1HPZ A;  4I9Q A;  2ZE2 A;  1KVA A;  2Z1I A;  5KGX A;  4OPJ A;  4K8X A;  2DFF A;  4I2P A;  4PUO A;  4OKJ A;  1S1V A;  1RTJ A;  4FLV A;  4OKK A;  2NUB A;  2PY5 A;  1S5J A;  5DK5 A;  2HHV A;  3LZJ A;  4NYN A;  1F21 A;  4DSF A;  4OLB A;  4W5R A;  3U3Y A;  1A5X A;  4ZHR A;  1WAF A;  4H4M A;  1TKZ A;  2DFH A;  4CK3 A;  4AH9 A;  4CJ4 A;  1S6P A;  1TL3 A;  4AHC A;  4W5O A;  2Y1I A;  3RMD A;  1U49 A;  3PY8 A;  1NK6 A;  3ZSR A;  4HTU A;  3TWH A;  1L3V A;  2I5J A;  3LP2 A;  4DSK A;  2HVI A;  5KRT A;  1QQC A;  1D5A A;  1VSL A;  4DQQ A;  1XI1 A;  1REV A;  3T19 A;  3CYM A;  3OYD A;  3SQ2 A;  1HJR A;  5KTQ A;  3EZ5 A;  1WNS A;  4W5T A;  3AVK A;  3P83 D;  4I2Q A;  1UA1 A;  4F2R A;  3LPU A;  2OYQ A;  4LH4 A;  2VWK A;  3KLE A;  1U04 A;  3NH0 A;  4NCA A;  2KFZ A;  3NHG A;  4B8C A;  1JLQ A;  3ZT3 A;  4O0I A;  2Q3S A;  2P5O A;  1GOB A;  3NF7 A;  4XIU A;  3KJV A;  4IBN A;  3VQA A;  1B92 A;  1XWL A;  3CG7 A;  4DU4 A;  4J2B A;  1JKH A;  1RDB A;  3ZT2 A;  4E7H A;  3SQ0 A;  4JS5 A;  5J2N A;  2KTQ A;  3VA3 A;  4G1Q A;  1QTM A;  3NGI A;  4EZ9 A;  1HYS A;  4M3R A;  3CM5 A;  1LWC A;  3CM6 A;  2E6M A;  2HW3 A;  1BL3 A;  1VSH A;  1RT1 A;  3QER A;  2G8F A;  4IFV A;  4HUG A;  1N5Y A;  4FK4 A;  4RW6 A;  3OYN A;  3HVR A;  2YHA A;  2QXF A;  4CEO A;  4E7L A;  4DSL A;  1LWF A;  4FZZ A;  4DFM A;  1J54 A;  4B9V A;  3SUO A;  1WSH A;  3L2U A;  1VSF A;  3KK2 A;  2P5G A;  1RTI A;  4DF4 A;  3NGY A;  4N76 A;  4QCL A;  4KB0 A;  1CZB A;  1WSG A;  3VQ7 A;  2AJQ A;  1T8E A;  2HNY A;  4FJK A;  3MXM A;  4FJX A;  3SUP A;  1NJX A;  2HHS A;  4Z4G A;  3S3O A;  3ZSZ A;  4KV8 A;  3MXI A;  3O3H A;  3RRG A;  4F3O A;  4M3T A;  3M8P A;  4ICL A;  1ITG A;  4AIL C;  1C0T A;  2YNI A;  3LZI A;  1JXE A;  1VSM A;  3K5L A;  1QSS A;  4FLY A;  2WOM A;  2YKN A;  4E19 A;  1S9E A;  4CK1 A;  3RMC A;  1LV5 A;  3ZSX A;  2P51 A;  1EP4 A;  3CFR A;  4CF1 A;  4CGD A;  4CJT A;  4Z4I A;  4F3T A;  3SNN A;  3SUN A;  1BI4 A;  1CXQ A;  4CFB A;  3SYZ A;  1C0M A;  1LAW A;  4CEA A;  4QOZ B;  2FC0 A;  4CGF A;  1NOZ A;  1RT6 A;  4IG3 A;  1NKE A;  2Z1J A;  4M45 A;  2QKK A;  3MXJ A;  2XY7 A;  1FXX A;  4CEB A;  1Z25 A;  1NK8 A;  4O0J A;  3IG1 A;  3MEG A;  4I7F A;  3AVN A;  5DMR A;  3ZSO A;  3HT3 A;  4FZX C;  4AHT A;  3OVN A;  3QES A;  5C25 A;  1YTU A;  1G15 A;  2EHG A;  3LWL A;  3QEX A;  4C8M A;  3RTV A;  1NJY A;  3OYE A;  5HRO A;  1RBS A;  4CJW A;  1NOY A;  1RT3 A;  2PZS A;  1KFD A;  5FRO A;  1YTA A;  3KK3 A;  1VSJ A;  1K6Y A;  4BDZ A;  4DTP A;  3QIO A;  3DLE A;  1T05 A;  3DLB A;  4CCH A;  1JLE A;  3AA3 A;  4CER A;  4FM0 A;  3PX0 A;  4FLZ A;  4DLG A;  1KLM A;  4E7K A;  4DS4 A;  4JS4 A;  3KLH A;  3HXM A;  4CJP A;  2RN2 A;  4DTS A;  2GUI A;  3OYF A;  4F4K A;  4OGC A;  4E3S A;  3LP3 A;  3NAE A;  3M8S A;  3PV8 A;  4DSI A;  5I42 A;  1SV5 A;  1SKW A;  3VQP A;  4FLX A;  5SZT A;  1BIS A;  4KRF A;  4B08 A;  3NH1 A;  1YT3 A;  2XHB A;  2EX3 A;  3O4Q A;  3SV3 A;  1QSL A;  2FBT A;  3V1Q A;  1JLA A;  5KGW A;  3ISN C;  4FLW A;  4LSL A;  2XY6 A;  4CED A;  3RRH A;  1WLJ A;  3S3M A;  3TAG A;  4BDP A;  5J2P A;  4DTU A;  1CLQ A;  1TGO A;  4DTR A;  2YNF A;  3VQ8 A;  4CIE A;  5CZ1 A;  3KKR A;  3SV4 A;  3TI0 A;  4KTQ A;  4CJV A;  3I0S A;  3I8D A;  2DTU A;  2YV0 X;  4C8N A;  3TAN A;  3K5M A;  5SWM A;  4FLT A;  1NK7 A;  4FJ5 A;  4L8R B;  3KTQ A;  2VG6 A;  1EX4 A;  3K58 A;  2ITG A;  4NCB A;  4OGE A;  3U3G A;  4UQG A;  1KVC A;  3THV A;  4DU1 A;  1TKD A;  3DRP A;  4ID1 A;  2IC3 A;  1KFS A;  1WN7 A;  3V81 A;  2IOC A;  2ATQ A;  4FJ8 A;  1L3T A;  3HL8 A;  1U48 A;  3LPT A;  4N47 A;  1WSJ A;  3S3N A;  1C1C A;  3AVG A;  3MEC A;  5HRR A;  3ZT1 A;  3TAQ A;  5C24 A;  1SKR A;  5KI6 A;  4DQP A;  4B9L A;  3TAP A;  1IH7 A;  1RNH A;  1WSI A;  1RTH A;  4OLA A;  4RW8 A;  3WNE A;  3AO5 A;  1NK9 A;  3ZSY A;  4R5P A;  1J5O A;  2OA8 A;  2QKB A;  3AO2 A;  4N56 A;  1L5U A;  1W0H A;  4ELT A;  1ZBH A;  3OYH A;  4B3O A;  1KRP A;  3HVT A;  4HCC A;  4E1N A;  3VQC A;  3LDS A;  1QHT A;  1S1X A;  3L8B A;  4ELV A;  4ELU A;  3D45 A;  3ZSW A;  1EET A;  1DLO A;  2HHX A;  1QE1 A;  4IFY A;  3OJU A;  1RT4 A;  3NDK A;  3HYF A;  1SKS A;  3NF9 A;  1HYV A;  5K14 A;  3ZSV A;  1ZBL A;  1C1A A;  3OYM A;  4CF0 A;  1Y97 A;  3A2F A;  3ULD A;  1NKB A;  1U47 A;  2D0B A;  4AHV A;  4JLH A;  4DQI A;  4KHQ A;  2FBY A;  4DLE A;  1RDA A;  3IRX A;  1JLG A;  3K5O A;  2IGI A;  4KO0 A;  4YFU A;  5FRN A;  3WNF A;  2KFN A;  3L2R A;  4BWM A;  3FFI A;  1VK0 A;  4FW1 A;  2O4G A;  4KRE A;  3ZT4 A;  3B6O A;  4FYD A;  4BDY A;  1LAV A;  3M8Q A;  3OYI A;  3OYG A;  1IKV A;  3RWU A;  1EXQ A;  3WNH A;  1WSE A;  3TAE A;  1JXB A;  1IO2 A;  3NH2 A;  4KKO A;  4B9M A;  3CFO A;  4HCB A;  4PY5 A;  4OVL A;  4CJU A;  3OYJ A;  1TK8 A;  3OYC A;  3DOL A;  4DQR A;  1YVU A;  1BHL A;  3VQQ A;  2HHW A;  2R7Y A;  3BGR A;  1RBT A;  3NGZ A;  4FJH A;  4Z4E A;  1NJW A;  1JLF A;  2VG7 A;  3HP9 A;  4DTN A;  4E0D A;  4PQU A;  2BDP A;  4M3W A;  4KHY A;  3T1A A;  4KHN A;  3ZSQ A;  5KRS A;  1NJZ A;  3RMA A;  1KVB A;  1TAQ A;  1ZBF A;  4DTO A;  4M3Z A;  2DY4 A;  2OZM A;  2HNZ A;  4M41 A;  4E1M A;  5J2M A;  5I3U A;  2O4I A;  4HUF A;  4DMN A;  1T03 A;  4KI4 A;  4N41 A;  2YHB A;  3G10 A;  3VQ4 A;  3M8R A;  4KTW A;  4GW6 A;  3LAM A;  3V1O A;  3UIQ A;  4KHS A;  4C8L A;  3LAL A;  4N5S A;  3K5N A;  2F8S A;  1DTT A;  2XRI A;  3DI6 A;  5HP1 A;  3L3U A;  4DG1 A;  1XC9 A;  1ZYQ A;  3VQ5 A;  4FK2 A;  3V9X A;  2G8V A;  2OPS A;  1B9F A;  2IAJ A;  3PX6 A;  1RDD A;  1RBR A;  4E7J A;  3TAF A;  4IDK A;  1L3S A;  1W9H A;  3TR8 A;  3AVI A;  1BCO A;  3O4N A;  4CEE A;  1CZ9 A;  1NK0 A;  2E6L A;  2D0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...