4CGFA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 56
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cgfA00
3LZIA 1JLGA 2D0AA 4L8RB 1BL3A 2ZD1A 3DRPA 3OYEA 3VA0A 4KI6A 4Z4EA 3OS0A 2QKKA 2IS3A 4CCHA 4M3ZA 3D45A 3CFOA 4ID5A 4N76A 2G8KA 4B9VA 4KHYA 1RBUA 2BANA 2XRIA 3KLFA 1HQUA 4BE1A 1TKDA 4FZXC 3K2PA 4CJFA 3HL8A 1NK5A 3VQBA 1HYSA 3LPUA 4IG3A 3HT3A 1X9SA 4B3OA 1TKTA 4CF8A 1IKYA 4AHUA 3ULDA 3KLHA 4HUEA 4Q5VA 1RDDA 3K57A 4LSLA 5CZ1A 4W5TA 1F21A 1WAFA 1VSJA 3EZ5A 4Z4IA 4DTNA 4J2DA 4KHSA 3D0PA 2D5RA 4OLBA 3OYNA 3K5MA 3HXMA 5J1EA 4E7HA 1KVAA 3AA5X 4F3TA 2Z1JA 3K58A 3AVCA 5CYMA 4HCBA 3RRGA 1N6QA 2QKBA 1CLQA 4IKFA 1RT1A 4I2QA 4K8XA 3LP2A 5C24A 4OGCA 1XWLA 4M3WA 2BE2A 4B08A 2Y1JA 4FZZA 5KGXA 4G1QA 4CHNA 3SCXA 3MXIA 3PV8A 3C94A 4KTZA 1NK6A 2Q3SA 1D9DA 3OJSA 4NCBA 4FW1A 2F96A 1VSMA 1DLOA 2HMIA 4DQPA 5DMRA 3SQ2A 4FJ5A 2XY5A 1NJYA 3MXJA 4CEBA 3DLRA 3AO3A 4HVJA 3OYHA 2D0CA 4CFAA 5CZ2A 4FLXA 3MECA 3V9UA 3LWMA 4M42A 2A1RA 1KLNA 1D9FA 4C8MA 3NHGA 3U6FA 1BQNA 4DFJA 2Z1IA 1U45A 2PYLA 3AA2A 3VQQA 3DOKA 1IG9A 4O0IA 3MXMA 4DQSA 1TL3A 4OPJA 4DSIA 3V6DA 4OPKA 4LH4A 5SZTA 4KREA 3TAPA 1S6PA 4O0JA 1C1BA 3L2RA 3LZJA 3V1QA 1J9AA 2ETJA 3AO1A 3KK2A 3SZ2A 3AVFA 1RT2A 4CJSA 1RNHA 3LPTA 4LY7A 2XY7A 4CJEA 1RTIA 4W5QA 3OYCA 3IAYA 4KB0A 4KHUA 4M3UA 3VQCA 4OVLA 2OPPA 4CEAA 2RF2A 1C1AA 1JL1A 1RDBA 1VK0A 5FROA 4FJIA 4KPYA 4HUFA 3OS1A 4M3TA 4CFDA 3OYKA 2A1SA 1NK7A 4KO0A 4CHPA 3V9ZA 4DF4A 4KI4A 1O1WA 4B9TA 4DU1A 4I9QA 4Z4FA 1RT3A 5C42A 3NBPA 3QERA 1YVUA 4B8AB 1N5YA 4B9MA 4IBNA 4WE1A 4AHRA 3K5LA 4B9UA 1CXQA 2VWKA 4FJHA 4DSFA 4QCLA 1VSDA 3DLBA 3HP9A 1S5JA 3LANA 3HO1A 4O44A 3ISNC 1HYZA 3WNGA 4CEOA 4CIEA 4CHQA 3G10A 3HP6A 4E7IA 4CJ3A 4PUOA 3NF9A 3RRHA 4DSKA 3AO2A 3TAGA 2KFZA 3VQ8A 4BWMA 1BIUA 3M8PA 4YNQA 1J54A 3A2FA 3QESA 1EKEA 1C0TA 1RBSA 2B4JA 2VG7A 1RCHA 4DS5A 1NKBA 4NYFA 2G8HA 4CJTA 4DTSA 3TAFA 3ZSOA 3IS9A 1NJZA 2F8TA 1XC9A 1T05A 4E1NA 4KHNA 4DLEA 4Y1CA 2D0BA 4FLZA 3PO4A 3ZT2A 1LWCA 1XHZA 5K14A 1L3UA 1NJWA 3L2UA 4JS4A 1WN7A 1EP4A 3HYFA 3DLGA 3HM9A 1ZBUA 4E19A 4FLWA 5CYQA 3RTVA 3WNEA 3QNNA 1ZBLA 3LALA 1LAVA 4CJLA 4DQIA 3LP1A 2VG6A 4NCGA 4Y1DA 5KGWA 1X9MA 4KHWA 3NCIA 1MU2A 4KKOA 3VQ7A 2VG5A 1Q9YA 2LSNA 4CJPA 2HNYA 3OJUA 2YNGA 2DFEA 1TK5A 3M8SA 1RT5A 2YNHA 1S1VA 4FJ7A 4CHOA 3NH2A 1S1UA 5FRMA 4CEZA 1JXBA 3L2WA 4DSJA 4KB1A 1ZBIA 2E6MA 3SV4A 3AO5A 1B92A 4RG8A 1KTQA 1Z26A 4I9LA 3SUQA 3NDKA 2OPQA 1HJRA 1KVCA 3JYTA 1T7PA 1JLAA 3DRSA 3H08A 4CJUA 3DRRA 1FK9A 4O4GA 3SYZA 1IKWA 3O4QA 1GOAA 1KSPA 3K59A 3ITHA 4MFBA 4CEEA 4JLHA 4FJGA 4OLAA 2HHXA 3OYFA 3AVNA 2JLEA 3HVTA 4H4OA 5I3UA 1FXXA 1TV6A 3NH1A 4FK4A 4FJXA 1ITGA 1BI4A 4IFVA 4HHTA 1BHLA 1CZBA 2YNFA 4ELTA 3DM2A 4FJ9A 4RW4A 4Z0UA 4I7FA 2HNDA 4M3RA 3AO4A 4OGEA 3AV9A 4LH5A 1QE1A 1A5VA 1HMVA 2YHBA 3NF7A 3T19A 3SJJA 1SV5A 3O3FA 1LV5A 2YV0X 3I8DA 1C0UA 4FCYA 3QEIA 4M3YA 1QSYA 3L3VA 4O55A 3OVNA 3OY9A 3AVLA 4XIUA 4DTJA 1R0AA 1UA0A 5E41A 4BDZA 4B9NA 4QAGA 4N41A 4GVMA 1RTDA 3AVAA 3RMDA 2G8FA 2E6LA 1KCFA 3KIOA 2Z1HA 1HRHA 3KKRA 3VQ9A 2XY6A 4EZ9A 3RR8A 4BDYA 2HHQA 1GOCA 3NE6A 4NYNA 1W0HA 3FFIA 2HHSA 1CZ9A 4BE2A 4DU4A 1TAQA 2IDOA 1QQCA 4CGDA 3NAEA 2PYJA 1TGOA 2IGIA 3RWUA 4AHSA 4B8CA 1NOYA 4JRQA 4N47A 4CGJA 1FKOA 3TAMA 5J2MA 3EY1A 4DTPA 3G0ZA 1VSIA 4CJQA 3NGZA 4JS5A 4DTXA 3TARA 3THVA 1QSLA 2XY8A 3T1AA 4KTWA 5C25A 3SV3A 1LAWA 1Z25A 2FC0A 4DSEA 3P1GA 1L3SA 1QHTA 2GV9A 2E4LA 1TVRA 1HQEA 3DYAA 3QIPA 4CEFA 1WSFA 4CJ5A 1X9WA 2OZMA 2KZMA 1UWBA 2XO7A 1EX4A 1REVA 1RT7A 3CFPA 3QLHA 3T3FA 1SL2A 4PWDA 3WNHA 4DQRA 4CHZA 3C6TA 1RILA 4GW6A 1CXUA 5T7BA 1SL1A 4CE9A 3KLEA 4E7KA 3KD1E 1IKXA 1WSGA 1KVBA 3SUPA 4M41A 3QEVA 5CY4A 3F73A 2HB5A 3K5OA 4OKEA 1WLJA 4I2PA 5HBMA 3VQPA 4DMNA 3HPGA 1U48A 3AVHA 4PQUA 2HHUA 1LW0A 3HK2A 2WOMA 4RW6A 3SUOA 1A5WA 4CHYA 1YTUA 3RMCA 3V1RA 2F8SA 4FXDA 1ZBFA 3PX0A 2X6NA 2ATQA 2O4GA 1SKWA 1NK0A 4DF8A 1DTTA 3KD5E 5HRPA 2PZSA 4DFKA 4E3SA 2R7YA 4RW9A 1TK0A 3LAMA 5HLFA 2G8VA 1UOCA 3AA3A 4CGGA 1RDAA 4CF2A 1G15A 4C8LA 1JLCA 2QXFA 4DSLA 2GUIA 3MAQA 4HUGA 3CG7A 1WNSA 3ZT0A 3TWHA 3MEEA 5HRSA 4DQQA 1VSKA 3VQDA 5FDLA 1QSSA 3SPYA 1D5AA 4M3XA 4IDKA 1BCMA 3LAKA 4DS4A 4FJMA 1L3VA 4N56A 3OYDA 1BIZA 4CERA 3F9KA 3AVMA 4BWJA 4E1MA 4E0DA 1RBTA 1LWFA 1TKXA 2HHVA 4CGIA 1BCOA 2OZSA 4CJKA 4KTQA 5HRRA 5HRNA 1YTAA 3AVJA 3PX6A 1WSEA 1KRPA 1VSFA 2HNZA 2BDPA 4FLVA 3VN5A 4CJWA 3PUFA 3SI6A 1Q9XA 4CGFA 3RR7A 3L2QA 4CIFA 3PO5A 2HVHA 4HCCA 3RMAA 3NFAA 3DLHA 2OPRA 3VQ5A 4FJLA 3MEDA 3ZSVA 2YKNA 1VSHA 3ZT3A 3TI0A 4BACA 4BDPA 2DFFA 4ZTFA 3SQ4A 3C95A 3DLKA 4DTUA 4F2SA 3OYMA 3QEWA 2G8WA 4C8NA 2P5OA 2WONA 1WSJA 4AHVA 3TAEA 1KLMA 1BISA 3ZCMA 3DMJA 4KV8A 3L3UA 4FVMA 4HTUA 4M45A 2RN2A 5J2QA 1S6QA 2X78A 3HVRA 4O5BA 1J5OA 4YFUA 2G8IA 1IKVA 4CJRA 3DI6A 4OKKA 1NK9A 3ASMA 1I39A 3VA3A 4DFPA 3S3OA 1KFSA 1NOZA 2G8UA 3LP0A 3DLEA 3IG1A 3O4NA 1W9HA 4CJVA 1TK8A 1UA1A 3DOLA 2PY5A 3M8QA 2ITGA 4J2BA 5JS1A 3AA4A 3I0RA 2AJQA 2FBTA 1JLBA 5JS2A 5J2PA 1T8EA 2GBZA 2P51A 4F2RA 1JXEA 1JLQA 3KLGA 4DLGA 3ZSXA 4FJJA 3SQ0A 2IOCA 3QO9A 4FK0A 1BI4B 4FJNA 4CK1A 5DK5A 4B9LA 1LWEA 3V81A 4E7JA 2YNIA 4LSNA 4CESA 4ELUA 1ZYQA 2DY4A 3M8RA 2JGUA 1TL1A 3VQ6A 3KKSA 4CEQA 3RMBA 4AHTA 3KTQA 3HSTB 1HNIA 3HPHA 4CFBA 1SKRA 4FYDA 1S9GA 4W5NA 4CGHA 3AVBA 1YT3A 2IC3A 2Z1GA 4UQGA 3OS2A 1J53A 2KTQA 3UIQA 1IH7A 5HP1A 3OYAA 2RPIA 1QTMA 3TABA 5HROA 3EYZA 3LP3A 3CQ8A 3S9HA 1NK8A 1SKSA 4W5OA 5KI6A 1ASVA 4IG0A 1HPZA 2X74A 3E01A 1SUQA 3OYBA 2ZQBA 2VWJA 3ZT1A 3QEPA 3SQ1A 1ASWA 1JL2A 2DFHA 2FBYA 4DFMA 3ZSYA 3AVGA 3NH0A 3O3HA 4FZYA 2BGGA 3P83D 4ELVA 4DTMA 3ZSQA 3NF6A 1S1XA 3CYMA 3P5JA 4E89A 4FLYA 2Y1IA 4QOZB 4CIGA 1L5UA 4DG1A 4KAZA 1FKPA 4DTOA 3KLIA 3NF8A 4C8OA 3K5NA 3ZSRA 3QNOA 3QETA 1X1PA 3NGYA 3U3YA 3S3MA 3OYGA 1TKZA 4KRFA 4CK3A 3CM6A 2HHTA 1JKHA 1U49A 1Q8IA 3SPZA 3O3GA 1U4BA 2OYQA 2P1JA 4CFCA 2EX3A 1JLEA 4K8ZA 4CJ4A 1C0MA 5KRSA 2DTUA 1VRTA 4DTRA 4ICLA 1A5XA 3L2VA 2XHBA 5I42A 3V9WA 4E7LA 3BGRA 4F3OA 2HW3A 5EU7A 1S1WA 3V9SA 4Z4GA 1RT4A 2KW4A 2HVIA 2KFNA 4BE0A 2IAJA 1NKEA 1TAUA 3WNFA 1NKCA 3LWLA 3B6PA 4JRPA 1NJXA 3BDPA 4OJRA 4ID1A 4MQ3A 1S9EA 4AH9A 3VQEA 1WSHA 2RKIA 1ASUA 1D8YA 4FJ8A 4KHQA 1VSLA 3JSMA 1U47A 3MEGA 3OYJA 4PY5A 3S3NA 1KFDA 1WSIA 4EP5A 2FBXA 1C6VA 4CF0A 5J2NA 1T03A 4Q0BA 3V4IA 2B5JA 3VQAA 1HNVA 3QEXA 3TAQA 1JLFA 3C6UA 3OYIA 5KRTA 3ZT4A 3SNNA 4B9SA 2W42A 1LW2A 4TSXA 2QK9A 5SWMA 3IRXA 2O4IA 4RW8A 3B6OA 4GMJB 1DTQA 3TANA 5D3GA 1WAJA 3LDSA 3PX4A 4AHCA 4J2EA 2NUBA 2OA8A 1Y97A 4IFYA 4DWIA 1B9FA 5FRNA 1RDCA 1EETA 4FK2A 2KQ2A 4H4MA 4ZTJA 4CF1A 4R5PA 4N5SA 4FM0A 2P5GA 1K6YA 3ZSZA 4ZHRA 1RT6A 1HYVA 4F4KA 1IO2A 4Z4CA 1U04A 1S1TA 1XHXA 3OYLA 4EP4A 3V1OA 3PY8A 1B9DA 1L3TA 3KJVA 3CFRA 1VRUA 1C1CA 3U3GA 4W5RA 1GOBA 3CM5A 3I0SA 3VQ4A 2ZE2A 1RTHA 4LD0A 1VSEA 4FJKA 4DU3A 1XI1A 3QINA 4RW7A 1QS4A 3AVKA 4PA1A 3NGIA 1NK4A 4H8KA 1RBRA 4CEDA 4FLTA 4C8KA 1ZBHA 4J2AA 3AVIA 3HJFA 2B6AA 1I3AA 3KK3A 3L8BA 3SUNA 4FW2A 2I5JA 4FM1A 4F8RA 2KZZA 5KTQA 1SL0A 4EZ6A 4KFBA 3HPOA 3ALYA 1EXQA 4CK2A 2FBVA 3QIOA 4CF9A 3KK1A 3TR8A 4FM2A 1BQMA 3V9XA 4OKJA 1BGXT 2X6SA 4FLUA 2EHGA 4AILC 1RBVA 3ZSWA 2OPSA 2YKMA 4NCAA 1RTJA 1UAXA 2YHAA 4CECA 4Z4HA 2HHWA
chains in the Genus database with same CATH superfamily
2IVNA 3DRPA 3VA0A 4KI6A 1Q18A 2WTUA 2IS3A 4M3ZA 4RWTA 3P4IA 4FO0A 4KHYA 5BR8K 4BE1A 2XRIA 1WBBA 2O8EA 3VQBA 1HYSA 2A40A 3LPUA 2UUAK 1R59O 4LSLA 4Z4IA 4J2DA 4K0KK 2IIRA 4FWKA 4H5NA 4YOUA 3OYNA 1E4FT 4E7HA 4YDUA 5AQJA 1OH8A 3NVMA 4IKFA 4MO4A 5C24A 4RTFD 2BE2A 3FLCO 4FZZA 3GG4A 1Q82O 4KTZA 2Q3SA 1QVGM 5AFUH 1SAZA 1DLOA 2HMIA 4DQPA 4AM7A 3SQ2A 3JAMO 4IO9L 3DLRA 2D0CA 5CZ2A 3LWMA 1GLCG 3FGUA 4C8MA 3U6FA 3EO3A 1BQNA 4ISFA 1HNZK 2QEXN 1TL3A 3UKRB 3V6DA 3C65A 3FZKA 4OPKA 4BRDA 2YJFA 3V1QA 4LFAK 3R8EA 3KK2A 3AO1A 4FWMA 3LPTA 1NJIO 4LY7A 3VMFB 2XY7A 4YOWA 4KHUA 4W5QA 5AQUA 4H0OA 2RF2A 5FROA 4FJIA 4X64K 1WB9A 2A1SA 1NK7A 4KO0A 3V9ZA 4DF4A 1O1WA 4I9QA 5C42A 1N5YA 2HHTA 3ENBA 4B9UA 1CXQA 1KAXA 1T44A 2VWKA 3CJAA 4DSFA 3HP9A 3HO1A 3ISNC 2I7NA 3IDHA 2KFZA 4E7IA 2O8CB 4DSKA 3TAGA 4JEPA 4BWMA 1P8ZA 4YNQA 1J54A 3A2FA 1EKEA 1C0TA 3MK6A 4BRAA 2YJEA 2CGKA 3L4QA 1NJZA 4JI1K 3E9LA 4UY8O 2VWBA 1T05A 3SBGA 4KHNA 4GV6A 4FLZA 4IJAA 3GE1A 3ZT2A 1BA0A 1XHZA 2A5XA 3VTHA 5BRHA 4YORA 3HM9A 2ZJRL 3QNNA 5CYQA 1LAVA 4CJLA 3LP1A 4B3RK 3CC2N 4Y1DA 4MDBA 5KGWA 4KHWA 3NCIA 4KKOA 3WEEB 2VG5A 4IXCA 3D2EB 2DFEA 4KH5A 5BPNA 1RT5A 4FJ7A 1W7AA 1S1UA 1YIJN 2GELA 4CEZA 5DM6L 3L2WA 4KB1A 1ZBIA 3EE9A 5TKWA 2P9IA 3THWA 2E6MA 3SV4A 3AO5A 1KTQA 1Z26A 3CC4N 2OPQA 5AR0A 3DRSA 3H08A 1IKWA 4MLHA 4X65K 2E1YA 4OLAA 3OYFA 3AVNA 3VTIA 5C10A 3AGKA 3NH1A 2J4RA 3WXKA 1BI4A 1GLDG 1TYQA 5AQNA 4LFCK 4Z0UA 3A8YA 2HNDA 2P9LB 3UKUB 1A5VA 2YHBA 3C7NA 3NF7A 4HTLA 4BC3A 4JD2A 2YV0X 3KVGA 3CJCA 2PBDA 1HR0K 3AVLA 1UA0A 1G99A 3C6HA 4QAGA 1KCFA 3KIOA 1NU0A 2Z1HA 1HRHA 1N8RO 4NO7A 2XY6A 4EZ9A 2HHQA 3FFIA 4FL9A 3GL1A 3NAEA 1NWKA 3RWUA 4B8CA 2E2OA 3G0ZA 3Q7BA 3SV3A 1Q7YO 1Z25A 2ZJQL 2UU9K 3TTDA 2E4LA 3ID8A 1HQEA 4CEFA 4CJ5A 2XO7A 1EX4A 1RT7A 4DV4K 3CCSN 4GW6A 1CXUA 5T7BA 4BVOA 4CJ7A 5ELZA 4EHTA 3SUPA 2WFBA 4WQ5A 3F73A 2XY5A 2HB5A 2E2PA 4I2PA 3U8XA 3VQPA 1S72N 1U48A 2QW9A 1SQKA 4PQUA 3ZX0A 3IKMA 3EN9A 4A2AA 4CZEA 2ATQA 3TPQA 3HTVA 4AQYK 1DTTA 2NRVA 4BRNA 2R7YA 2G8VA 3CJ9A 1G15A 2QXFA 3TSQA 4DSLA 2GUIA 1WNSA 3E1YA 5HRSA 1VSKA 4KH6A 1QSSA 1SZ2A 3VGKA 4BRMA 1E4GT 5F2RA 5LJVA 3F9KA 3KHYA 4BWJA 1TKXA 1BCOA 5IWAK 1WSEA 4WYBA 2HNZA 4BREA 2BDPA 1EO1A 4FLVA 3PUFA 1Q9XA 3LDOA 3FZMA 3CCVN 2YKNA 3ZT3A 1RDWX 4BDPA 3CC7N 3SQ4A 3DLKA 4DTUA 5AJ3K 4K25A 4DR4K 1WSJA 3DMJA 4JI8K 3L3UA 1YUWA 4O5BA 3O4WA 3JXUA 4CJRA 3DI6A 1DGKN 2RHKA 3ASMA 3VA3A 3QFPA 4KH4A 2G8UA 3O8MA 1W9HA 1UA1A 4JI3K 3AA4A 1JLBA 2Q36A 5AQOA 3CQYA 4FWLA 2GBZA 4ILJA 2P51A 4F2RA 3LDNA 1JXEA 3ZSXA 4FJJA 2P9PA 2IOCA 2PFUA 1YHQN 2YNIA 4CESA 3VQ6A 1TL1A 3RMBA 4FYDA 3CQXA 1HNIA 5C0YA 1S9GA 3AVBA 1HNWK 3HOSA 2FSNA 1HKGA 4UQGA 3LDLA 3F5TA 1LCUA 3THXA 3EYZA 1D4XA 3CQ8A 4W5OA 5KI6A 1SUQA 4FWNA 3ZT1A 5BPMA 5AQQA 3J81O 3SQ1A 1IV0A 1JL2A 3D6RA 3L4IA 3L0QA 3ZSYA 2KKZA 2ZWHA 1ATNA 3ZSQA 3VENA 2Y1IA 4BRKA 3CJ1A 3ULEA 1GLLO 4DTOA 3KLIA 1ZC6A 4B1VA 3NGYA 5EVZA 3S3MA 3ZX2A 4KRFA 4CZHA 2EX3A 4Z4GA 2HVIA 4BRHA 3WT0A 4DR1K 1XNQK 1S9EA 3CCEN 1SS6A 2IVPA 1S3XA 5DM7L 1VQ9N 1D8YA 3WXMB 1U47A 3MEGA 3RSEB 4Q0BA 2B5JA 1HNVA 3QEXA 4LF9K 3OYIA 1RFQA 3SNNA 2QK9A 1T6CA 3OHRA 3AAPA 4RW8A 4J2EA 2E8AA 4IFYA 1EETA 4FK2A 3JS6A 2A42A 3PY8A 1B9DA 5C2FA 5KQ8A 1VRUA 1GOBA 5KPTA 3I0SA 1VSEA 2YHXA 4FJKA 3T69A 3QINA 4JI6K 4EIAA 2JWKA 1KQSM 2Q97A 1NK4A 4IO8A 4WQ4C 3VF6A 1ZBHA 4JKGB 3HJFA 3KK3A 3L8BA 3A5MC 2I5JA 4F8RA 5KTQA 4EZ6A 3ALYA 1EXQA 4CK2A 1VQ8N 3V9XA 4OKJA 3WUHA 4AILC 1WUAA 3ATVA 1UAXA 2YHAA 4NB4A 2HHWA 1JLGA 2HHHK 3OS0A 2EWSA 4CCHA 4GVEA 1K73O 4ID5A 3LM2A 4DKWA 4ILHA 4B9VA 1RBUA 3WXIA 3HL8A 2UXCK 3HT3A 1TKTA 4AHUA 3ULDA 3KLHA 4HUEA 5CZ1A 4W5TA 1F21A 1VSJA 4DTNA 4KHSA 4U67L 3D0PA 1IBKK 2QWPA 3HXMA 1KVAA 5HL7L 3AA5X 4IDHA 3AVCA 3EZWA 4FPAA 4M63C 4CZFA 3RRGA 4HCBA 1N6QA 2QKBA 1RT1A 4M3WA 4B08A 3MX5A 4G1QA 4CHNA 2ZGZA 3C94A 3OJSA 4NCBA 2F96A 1N33K 1NGDA 5AQGA 3TSUA 3MXJA 1XNRK 3A5LC 4H5RA 5AQFA 3MECA 2A1RA 4Y0WA 5FLXO 4I6MA 4DFJA 2Z1IA 1U45A 2IVOA 3VQQA 1RDUA 1IBMK 3O9QA 3P31A 3MN5A 5AQLA 4OPJA 1DT9A 4LH4A 5SZTA 1NBWA 3TAPA 1S6PA 4O0JA 3L2RA 1KD1O 4JN4A 4FOIA 3EKSA 2PAVA 5AQSA 4BRIA 3IAYA 4KB0A 3VQCA 1HKBA 1C1AA 1JL1A 1BUPA 1RDBA 3T7ZA 5BR9A 4HUFA 4M3TA 3OYKA 3CCMN 4CHPA 2DY4A 4IOXA 4B8AB 4B9MA 1TAUA 4WE1A 3K5LA 4FJHA 1HX1A 3LANA 4CHQA 3HP6A 4CIEA 4PUOA 3HM8A 3NF9A 2QTDA 4JK9A 1BIUA 1RBSA 4NYFA 4CJTA 3TAFA 3ZSOA 4A5BA 2I7PA 5FPMA 2F8TA 5BREA 1U6ZA 4E1NA 4Y1CA 1EQYA 1L3UA 1NJWA 3L2UA 4JHDA 1WN7A 3DLGA 3LM9A 2YHYA 1ZBLA 4JI4K 3LALA 4NCGA 4JNEA 3K9KA 3VQ7A 1Q81O 4CJPA 1VAZA 1TK5A 2QWNA 2NRRA 3SUQA 3VPZA 3GOIA 4CJUA 1FK9A 4O4GA 3VF2A 4FJGA 2JLEA 1FXXA 1TV6A 1BHLA 3CERA 4Z94A 4JI0K 4CZGA 4I7FA 4LH5A 4H03B 5EX5A 3SJJA 2HBKA 3O3FA 4OPHA 3I8DA 5C15A 4FCYA 3CI5A 1NG9A 2O8EB 2FSJA 3L3VA 1QSYA 1LOTB 5E41A 4BDZA 4B9NA 1VQ6N 4N41A 1RTDA 1OH6A 3KKRA 3RR8A 1GLBG 4NYNA 3LL3A 1W0HA 5E84A 3C6AA 2HHSA 1O13A 2GWKA 3CMAN 2IGIA 4JRQA 1Q86O 1FKOA 4DTPA 4JS5A 4DTXA 3T1AA 1EWRA 2NZTA 3HZ6A 4LF7K 1X9WA 3QIPA 4C23A 1WSFA 2OZMA 4PKHA 1REVA 3CFPA 3T3FA 3QLHA 1M1KO 5JICA 1RILA 3KLEA 1KVBA 2P9KA 5CY4A 3K5OA 4DMNA 3R6MA 2CGJA 3AVHA 4B3SK 2HHUA 2HBJA 2YCHA 2WOMA 4RW6A 5AQPA 3V1RA 2F8SA 5C12A 4GV3A 5JLFA 1M90O 3CMEN 5GIOA 4PL8A 3E66A 4FWPA 1ZBSA 3KD5E 1V4TA 3O1WA 3LAMA 3AA3A 1RDAA 1JLCA 2HSTA 1KC8O 4HUGA 3TWHA 4DQQA 3VQDA 1HUXA 3SPYA 4M3XA 4IDKA 3H1VX 1L3VA 1NGIA 4CERA 4E0DA 2HHVA 4L3QA 4CGIA 4KTQA 5HRRA 4F9OA 5HRNA 3AVJA 3PX6A 1KRPA 2QI2A 2O8FA 4CJWA 5TKYA 3L2QA 3C0BA 4CIFA 2HVHA 4HCCA 2UXDK 4FJLA 3H46O 2HF4A 3MEDA 3ZSVA 1GLJO 3I8BA 1I94K 3CCRN 3QEWA 4C8NA 4B1UB 2P5OA 3TAEA 1BISA 4KV8A 1XC3A 2RN2A 4K43A 1S6QA 3HVRA 2E88A 4OKKA 1NK9A 4IEEA 4DFPA 1KFSA 1NOZA 3THWB 2P9IB 4JKHA 3O4NA 4JK8A 1TK8A 3VGMA 3M8QA 3HI0A 4CZIA 3R1XA 1Y64A 1W2BM 4H0XB 3KLGA 2QM1A 2O8BA 3HOTA 3SQ0A 4BR7A 1BI4B 2A6AA 4FVUA 4B9LA 5DK5A 3DWLA 1TYQB 4E7JA 4K41A 5BN8A 3M8RA 4CEQA 3CJBA 3KTQA 3HPHA 4CFBA 3SJHA 3C7NB 4JD2B 3OS2A 1IH7A 1Z05A 3OYAA 1QTMA 3TU5A 1TUUA 1SKSA 3LP3A 4CZJA 3PIPL 1ASVA 5MLCQ 3E01A 3ZETA 1ASWA 2DFHA 1YI2N 4MLEA 1BOTO 2HF3A 3NH0A 2BGGA 3E9OA 3P83D 4BROA 3NF6A 1S1XA 4E89A 3QMLA 4KAZA 4C8OA 3K5NA 2VCPA 1JCFA 3ZSRA 3QNOA 3QETA 1X1PA 3VESA 1TKZA 3CM6A 1U49A 5BRFA 3PIOL 2E20A 2W40A 3O3GA 2P1JA 1JJ2M 3CJ7A 2DPNA 2HOEA 1YJNN 1VQLN 4CJ4A 4B3MK 2DTUA 1VRTA 4ICLA 5I42A 2XHBA 4F3OA 4JKAA 5EU7A 1S1WA 4XH5A 2KW4A 2KFNA 1NKEA 3WNFA 3LWLA 3B6PA 1NM1A 2WC9A 2NRWA 3L6QA 1NJXA 2E2NA 4MQ3A 4B9QA 4JKBA 3MN9A 1C0GA 4FWSA 1WSHA 1C0FA 2RKIA 4H0TB 1ASUA 4KHQA 3JSMA 3VF4A 3F2KA 2FBXA 4ISEA 4R79A 2HBMA 1NLVA 2VGMA 3C6UA 3TTCA 2W42A 3VGLA 4XEIA 3IRXA 3B6OA 4DR3K 3TANA 3LDSA 4BR2A 4BR5A 1Y97A 4DWIA 4BC5A 5FPEA 5M1PA 5FRNA 4CD3A 5CHIA 3ZSZA 1ATSA 4ZHRA 1XHXA 3BZKA 4EP4A 3KJVA 3U3GA 1C1CA 4DCHA 3VQ4A 4E1JA 4DU3A 3MX2A 2A3ZA 1QS4A 3AVKA 4PA1A 3NGIA 1NGCA 1RBRA 4HWIA 4C8KA 1I3AA 5M1NA 4FM1A 1E3MA 1WOQA 4FM2A 4CF9A 1OVYA 3TR8A 2X6SA 2NNWA 5AZIA 4FLUA 1RBVA 2OPSA 5EOYA 1KAZA 2F4VK 4NCAA 3O6WA 1RTJA 3AAQA 3LZIA 4MDAA 1BL3A 2ZD1A 4IEIA 2FF3B 4N76A 3G25A 2G8KA 3ID6A 1V4SA 1NGAA 4FZXC 3K2PA 4CVNE 1NK5A 3I55N 4IG3A 3KK7A 3CCUN 4DHYA 4CF8A 3PLAA 1BWFO 3OW2M 4IZ9A 3EZ5A 2ZJPL 2D5RA 3A0IX 3K5MA 4OLBA 5J1EA 2P9PB 1HPMA 2Z1JA 1NGGA 5CYMA 3VERA 2NRHA 4OGCA 3NMUA 5KGXA 3SCXA 3PV8A 1MA9B 2FF6A 4A57A 5JVGL 3A5NC 3ENOA 1VSMA 3B8AX 2P9NA 2QXLA 1HNXK 4IWVA 3AO3A 2ASMA 4HVJA 3OYHA 3THXB 4M42A 3V9UA 1KLNA 4WCEL 1D9FA 4GKJK 2ZGYA 3ZYYX 2PYLA 4YOVA 3AA2A 4PHTX 5HOOA 3DJCA 3AY9A 2NRTA 4DSIA 4KREA 1C1BA 1QQMA 1MDUB 1J9AA 2WUSA 2ETJA 3ULEB 3SZ2A 1BG3A 1RT2A 3AVFA 4CJEA 1RTIA 3OA9A 3PSIA 4M3UA 3KWIA 4FWOA 1W97L 4BC4A 4OVLA 5AQMA 4ISGA 1VK0A 4H0YB 4KPYA 3D2FA 4CFDA 3U9ZA 1YF5L 1YVNA 3VEOA 2GTDA 4KI4A 4B9TA 1RT3A 3NBPA 4IBNA 4QCLA 3O9TA 1S5JA 4WFBL 4O44A 1HYZA 3G10A 4CJ3A 4NXNK 3I33A 4PKIA 3VQ8A 3ZEUA 3M8PA 3D2FB 2B4JA 2VG7A 1NKBA 5AQKA 2G8HA 1XC9A 1KXPA 2D0BA 1LWCA 2YHWA 2VQEK 5K14A 2E1ZA 3IFRA 1GLAG 1EP4A 4JS4A 4E19A 4DQIA 3WNEA 3UE5A 3DXMA 3IUCA 3SLCA 3HBTA 3E9PA 2LSNA 4OPAA 3OJUA 4YOTA 4BRFA 3M8SA 2YNHA 4BC2A 1NGJA 5JMVA 5FRMA 3SMPA 1GLFO 1B92A 1HJRA 1KVCA 3JYTA 4FSVA 4DUYK 4EAHD 1JLAA 3SYZA 1K8KA 1KSPA 3O4QA 1GOAA 4M7XA 3BY5A 3THYA 4CEEA 4JLHA 3HVTA 4GKKK 2F7TA 2BUPA 4FJXA 1RGIA 3I56N 4DV5K 1QHAA 4IFVA 3OBWA 4HHTA 1CZBA 1NMNA 2YNFA 4ELTA 3DM2A 4H0VB 4FJ9A 3S41A 3AO4A 4JAXA 1QE1A 2FSKA 1SV5A 4H5TA 1C0UA 4BQLA 1NNEA 4M3YA 4O55A 5EY4A 3EKUA 1NGBA 2UYTA 3AVAA 3QBWA 4O5FA 4OX9K 3VQ9A 4BDYA 1GOCA 3NE6A 4K42A 3BF1A 3W3DA 1TAQA 2ASPA 1QQCA 4CGDA 1TGOA 4A61A 1HKCA 3VEZA 3MCPA 1NOYA 4N47A 4CGJA 3G4SN 3TAMA 3N4PA 5J2MA 3EY1A 3BEXA 1QSLA 1VSIA 4YOYA 2XY8A 4KTWA 3AARA 5C25A 1LAWA 4DSEA 1QHTA 2GV9A 3H3NO 3DYAA 2KZMA 2D0OA 1UWBA 4I6MB 4C1NI 4DQRA 1U2VA 4CHZA 3C6TA 2O8DA 4CE9A 1XQSC 1DEJA 3KD1E 1IKXA 5JVHL 3CF5L 4M41A 3QEVA 3P38A 5HBMA 4YDUC 3LDQA 3SBTA 1QZ5A 3ZX3A 1LW0A 3VEXA 3HK2A 4GV9A 4IOCL 1A5WA 1YTUA 3RMCA 4H5VA 1ZBFA 4FPBA 3PX0A 2X6NA 1H1VA 2O8DB 4WQ4A 3SAHA 4O8UA 1BU6O 2BTFA 1SKWA 4BQZA 3CPEA 2AP1A 3ZLJA 4DFKA 4E3SA 3AGRA 5AZJA 4CGGA 4CF2A 5AQWA 1MWMA 4C8LA 4DV6K 3CG7A 3MEEA 3J7ZO 1D5AA 1BCMA 4FJMA 4N56A 2QWMA 3OYDA 3AVMA 2P9UA 1XMQK 3T1YK 2E2QA 2QA4N 2E5LK 2OZSA 3R9PA 1YTAA 3GDQA 5AQVA 1VSFA 3MN6A 2V52B 3SI6A 4CGFA 4B1XB 3RMAA 3DLHA 4JHDB 5BN9A 4DV1K 4ZTFA 3CCLN 3C95A 4IJNA 1QVFM 4AHVA 1KLMA 4NLCA 1CZAN 4CZMA 2F9TA 4FVMA 2P9SA 3LDPA 2OTJN 5J2QA 2X78A 5M1QA 1J5OA 4YFUA 2UUCK 2G8IA 1OH5A 4JKEA 3LP0A 3IG1A 1ESVA 4J2BA 1S22A 3DOLA 2PY5A 5JS1A 2ITGA 4OO1J 3K9JA 3I0RA 2AJQA 4X62K 5JS2A 5J2PA 4LC9B 5M1FA 1T8EA 1J6ZA 4EHUA 4DLGA 2OANA 1XUPO 3NVKA 3QO9A 4CK1A 3V81A 3BP8A 4EFHA 4LSNA 4ELUA 1QQNA 1ZYQA 3HRGA 2JGUA 4AHTA 4IFEA 1SKRA 4FWRA 3TSPA 4CGHA 1WBDA 3MWPA 2IC3A 2Z1GA 1J53A 3O9UA 5JLHA 5EXWA 3TABA 5HROA 2AA4A 3S9HA 1YJ9N 4BG8A 4IG0A 3OYBA 2X74A 4GY2B 3M1FA 2VWJA 3P39A 2FBYA 4YOXA 3W0LA 3UKRA 5F1XA 3O3HA 4FZYA 4ELVA 1TUYA 2QWQA 3O9SA 3CYMA 3P5JA 4FLYA 3SMSA 1GLEG 4CIGA 1L5UA 3FE1A 3HSCA 4DG1A 5GINA 3MWTA 1FKPA 4PL7A 3NF8A 2F9WA 3J7AP 3U3YA 4JV5K 3H3OB 2QWRA 3OYGA 4CK3A 5LY3A 4B1WB 1Q8IA 1U4BA 5M1KA 4CFCA 3QDKA 3H45C 2CH6A 3L2VA 3V9WA 3R3LA 2HW3A 4WFNL 3FR0A 4BE0A 2IAJA 3J8AA 1QQOA 2O8CA 4JRPA 2P9KB 3BDPA 4OJRA 3MN7A 2UUBK 3M5RA 5AQRA 4FJ8A 1VSLA 3OYJA 4PY5A 1KFDA 1WSIA 1C6VA 3TAQA 3U4LA 5ADXA 1JLFA 4B9SA 1LW2A 4GNIA 4BVPA 2Q0UA 4LF4K 2O4IA 1VHXA 1VQON 5D3GA 1DTQA 2W41A 3PX4A 4AHCA 4U7BA 2NUBA 3FFKB 4KBOA 5E26A 2OA8A 3WEEA 5BPLA 1RDCA 2KQ2A 4ZTJA 3D2EA 4FM0A 4DR7K 1K6YA 1HYVA 4Z4CA 4A5AA 2NLXA 3OYLA 4WQ5C 3V1OA 2FXUA 1VQKN 1L3TA 4W5RA 4CBUA 1VQMN 1RTHA 5M1OA 2O8FB 1X3MA 2GEMA 1BO5O 4QS9A 4FLTA 3WQTA 2YI1A 4J2AA 3AVIA 2B6AA 4FW2A 4LF5K 1SL0A 4KFBA 3PO5A 3QIOA 3CD6N 1BQMA 1X3NA 5C2DA 3ZSWA 2YKMA 4QS7A 2UXBK 2P9LA 4CECA 4Z4HA 3UKUA 2Q0RA 4L8RB 2D0AA 4Z4EA 3OYEA 2QKKA 3SAFA 3D45A 3CFOA 5AQIA 3DAWA 3IMXA 2ITMA 2BANA 3KLFA 1HQUA 1TKDA 4CJFA 1X9SA 4B3OA 1IKYA 1XMOK 4Q5VA 1RDDA 3K57A 1WAFA 4BG9A 3H1QA 2O8BB 4F3TA 3CETA 3K58A 3M3ZA 3O08A 1CLQA 5AQZA 4I2QA 5ADXH 3LP2A 4K8XA 1XWLA 2Y1JA 1NGEA 3KWGA 3MXIA 3EE8A 1NK6A 2D0PA 3SK3A 1D9DA 4FW1A 2QWOA 4BY9C 4FJ5A 5DMRA 1NJYA 4CEBA 3OTOK 4CFAA 3CPWM 4FLXA 1EWQA 4X66K 3NHGA 2YX6A 3ZETB 5BRDA 3DOKA 3FZLA 1IG9A 4O0IA 3MXMA 4G9ZA 4DQSA 2Q2RA 1YAGA 3Q7CA 4DV0K 3ENHA 4B3TK 3LZJA 5I9EB 1VQPN 4CJSA 1RNHA 4BRQA 4CBXA 2W6LA 3O9RA 3OYCA 4KHPK 3D7EO 4H5WA 2HMPA 2OPPA 4CEAA 4J8FA 2D4WA 4QS8A 4B1ZA 4DV3K 3OS1A 4DV7K 5IT9O 4DU1A 4Z4FA 1BDGA 3QERA 1YVUA 3DXKA 4AHRA 2NRXA 1VSDA 3DLBA 4CD1A 3WNGA 4CEOA 3RRHA 3AO2A 5GADP 1IJJA 3QESA 3CXCM 1RCHA 4DS5A 3CIPA 4YY3K 4DTSA 4BR9A 3DXKB 4WFAL 4DLEA 1VQNN 3PO4A 1NGHA 3HYFA 1ZBUA 4FLWA 3RTVA 1ATRA 4DR2K 1HLUA 5H1SQ 2JWLA 3VEWA 2VG6A 3O5BA 1X9MA 3MMVA 1MU2A 2CGLA 1Q9YA 4CI6A 2HNYA 2YNGA 3G71N 1JCGA 2ZM6K 1N32K 1S1VA 4CHOA 3NH2A 1JXBA 4FWQA 4DSJA 3MCAB 4RG8A 4I9LA 3NDKA 2VYPA 5AQTA 1T7PA 3DRRA 3UB5A 5F0XA 5CE3A 3K59A 3ITHA 4MFBA 2HHXA 3QFUA 4CBWA 4H4OA 5I3UA 1FW6A 3PSFA 4FK4A 3J80O 1ITGA 3VEVA 1NMDA 5AZIB 3FZFA 2V7YA 4RW4A 4JI5K 5LJWA 4M3RA 2GWJA 4OGEA 4YHHK 3AV9A 1HMVA 3BUZB 4B1YB 3T19A 1BA1A 3SAGA 3G6EN 1LV5A 3FZHA 2ZF5O 3QEIA 3OVNA 3OY9A 1VQ5N 4XIUA 4DTJA 4BGBA 1R0AA 4NLBA 4GVMA 3RMDA 2G8FA 2E6LA 2V51B 4AF1A 4JK7A 3MDQA 3N4QA 3U9DA 1OVQA 1J5EK 1CZ9A 4BE2A 4DU4A 2IDOA 2PYJA 4AHSA 4DV2K 2V7ZA 3TARA 4CJQA 3NGZA 3THVA 1IBLK 2FC0A 1L3SA 2HBLA 2VGNA 3P1GA 2P9NB 1TVRA 1X9JA 2Q31A 5LMUK 1K9MO 1T6DA 1SL2A 4PWDA 4A2BA 4JI7K 3WNHA 1SL1A 3GBTA 4E7KA 1WSGA 2RE2A 4OKEA 4DQ8A 1WLJA 4XH4A 3HPGA 3K0SA 4BGAA 5GIPA 4A62A 4RCHA 3A5OC 4DR5K 3SUOA 4CHYA 3KZBA 3RSEA 4FXDA 2D1KA 1YITN 2O4GA 1NK0A 2CH5A 4DF8A 1OH7A 1HJOA 5HRPA 5KQDA 2PZSA 4V19S 4JKFA 4RW9A 1TK0A 2KLAA 5HLFA 1UOCA 3DLLL 2Q1NA 4M7YA 3WXJA 3H6EA 5LMNK 5AQYA 3MAQA 3ZT0A 5FDLA 3LAKA 4DS4A 1BIZA 3ZEUB 4ILGB 4E1MA 1RBTA 1LWFA 4CJKA 2OCEA 3WXLA 4WF9L 3VN5A 3RR7A 1OKJA 3NFAA 2OPRA 4JKGA 3VQ5A 4JKCA 1VSHA 4BRPA 3TI0A 4BACA 2DFFA 4F2SA 3OYMA 2G8WA 3DXMB 1ILYA 2WONA 3ZCMA 2OTLN 3VOVA 4HTUA 4C1NK 4M45A 4CZLA 1IKVA 5GAHP 1ZXOA 3S3OA 1I39A 3OBYA 5A2QO 5FPNA 3DLEA 4CJVA 3BF3A 3VETA 5KPZA 1IG8A 2FLOA 2FBTA 1K8KB 3THYB 5CR4A 3WQUA 2ASOA 2NRZA 1JLQA 4BRCA 4MO5A 5KPRA 4FK0A 4DB3A 5GAGP 5FPDA 1K8AO 4FJNA 1LWEA 1DKGD 1T3VA 2VQFK 5AQXA 4DUZK 3KKSA 4F4KA 4JI2K 4A59A 3EEQA 3HSTB 2BH1A 4W5NA 4CZKA 4DR6K 1YT3A 4NXMK 3VEYA 2KTQA 3UIQA 5HP1A 4O8KA 2RPIA 1NK8A 1HPZA 1VQ4N 2ZQBA 3QEPA 4DFMA 3T1HK 3AVGA 3TTFA 4FOEA 4DTMA 1JCEA 1NGFA 3M6GA 4QOZB 1MWKA 4BRLA 1YXQA 3F9MA 2A41A 3BZCA 3CCJN 1JKHA 3QBXA 3SPZA 2W6KA 2OYQA 1JLEA 5B8HA 4K8ZA 1C0MA 5KRSA 3QB0A 4DTRA 1A5XA 1U2VB 4E7LA 3BGRA 3V9SA 1RT4A 4XH1A 4BR4A 4CW7B 1P90A 1NKCA 1Z6RA 1FJGK 4ID1A 4AH9A 3VQEA 2KHOA 3RVCA 3EL2A 3S3NA 4EP5A 1N34K 5J2NA 4CF0A 1T03A 3V4IA 3VQAA 5GAEP 4LF6K 4BR0A 5KRTA 3ZT4A 4LFBK 1N36K 5LL6Z 4TSXA 5SWMA 3O80A 1KAYA 4GMJB 1WAJA 2QWLA 5AZJB 5AFUA 5AQHA 4IOAL 1B9FA 4H4MA 4CF1A 4R5PA 4H0PA 4N5SA 2P5GA 4BRGA 1YJWN 1RT6A 2H3GX 3CCQN 1IO2A 2GX9A 1U04A 1S1TA 2P9UB 3O1BA 2GUPA 3CHWA 3CFRA 1VQ7N 3CM5A 2ZE2A 4LD0A 1XI1A 4RW7A 3QICA 4JYAK 4H8KA 4CEDA 4PKGA 3J7YP 3SUNA 4JKDA 2KZZA 3HPOA 4LF8K 3KK1A 2FBVA 2WBNA 1BGXT 1QZ6A 4AM6A 2EHGA 2P9SB 3ATUA 3IS9A
chains in the Genus database with same CATH topology
3LZIA 1JLGA 2D0AA 4L8RB 1BL3A 2ZD1A 3DRPA 3OYEA 3VA0A 4KI6A 4Z4EA 3OS0A 2QKKA 2IS3A 4CCHA 4M3ZA 3D45A 3CFOA 4ID5A 4N76A 2G8KA 4B9VA 4KHYA 1RBUA 2BANA 2XRIA 3KLFA 1HQUA 4BE1A 1TKDA 4FZXC 3K2PA 4CJFA 3HL8A 1NK5A 3VQBA 1HYSA 3LPUA 4IG3A 3HT3A 1X9SA 4B3OA 1TKTA 4CF8A 1IKYA 4AHUA 3ULDA 3KLHA 4HUEA 4Q5VA 1RDDA 3K57A 4LSLA 5CZ1A 4W5TA 1F21A 1WAFA 1VSJA 3EZ5A 4Z4IA 4DTNA 4J2DA 4KHSA 3D0PA 2D5RA 4OLBA 3OYNA 3K5MA 3HXMA 5J1EA 4E7HA 1KVAA 3AA5X 4F3TA 2Z1JA 3K58A 3AVCA 5CYMA 4HCBA 3RRGA 1N6QA 2QKBA 1CLQA 4IKFA 1RT1A 4I2QA 4K8XA 3LP2A 5C24A 4OGCA 1XWLA 4M3WA 2BE2A 4B08A 2Y1JA 4FZZA 5KGXA 4G1QA 4CHNA 3SCXA 3MXIA 3PV8A 3C94A 4KTZA 1NK6A 2Q3SA 1D9DA 3OJSA 4NCBA 4FW1A 2F96A 1VSMA 1DLOA 2HMIA 4DQPA 5DMRA 3SQ2A 4FJ5A 2XY5A 1NJYA 3MXJA 4CEBA 3DLRA 3AO3A 4HVJA 3OYHA 2D0CA 4CFAA 5CZ2A 4FLXA 3MECA 3V9UA 3LWMA 4M42A 2A1RA 1KLNA 1D9FA 4C8MA 3NHGA 3U6FA 1BQNA 4DFJA 2Z1IA 1U45A 2PYLA 3AA2A 3VQQA 3DOKA 1IG9A 4O0IA 3MXMA 4DQSA 1TL3A 4OPJA 4DSIA 3V6DA 4OPKA 4LH4A 5SZTA 4KREA 3TAPA 1S6PA 4O0JA 1C1BA 3L2RA 3LZJA 3V1QA 1J9AA 2ETJA 3AO1A 3KK2A 3SZ2A 3AVFA 1RT2A 4CJSA 1RNHA 3LPTA 4LY7A 2XY7A 4CJEA 1RTIA 4W5QA 3OYCA 3IAYA 4KB0A 4KHUA 4M3UA 3VQCA 4OVLA 2OPPA 4CEAA 2RF2A 1C1AA 1JL1A 1RDBA 1VK0A 5FROA 4FJIA 4KPYA 4HUFA 3OS1A 4M3TA 4CFDA 3OYKA 2A1SA 1NK7A 4KO0A 4CHPA 3V9ZA 4DF4A 4KI4A 1O1WA 4B9TA 4DU1A 4I9QA 4Z4FA 1RT3A 5C42A 3NBPA 3QERA 1YVUA 4B8AB 1N5YA 4B9MA 4IBNA 4WE1A 4AHRA 3K5LA 4B9UA 1CXQA 2VWKA 4FJHA 4DSFA 4QCLA 1VSDA 3DLBA 3HP9A 1S5JA 3LANA 3HO1A 4O44A 3ISNC 1HYZA 3WNGA 4CEOA 4CIEA 4CHQA 3G10A 3HP6A 4E7IA 4CJ3A 4PUOA 3NF9A 3RRHA 4DSKA 3AO2A 3TAGA 2KFZA 3VQ8A 4BWMA 1BIUA 3M8PA 4YNQA 1J54A 3A2FA 3QESA 1EKEA 1C0TA 1RBSA 2B4JA 2VG7A 1RCHA 4DS5A 1NKBA 4NYFA 2G8HA 4CJTA 4DTSA 3TAFA 3ZSOA 3IS9A 1NJZA 2F8TA 1XC9A 1T05A 4E1NA 4KHNA 4DLEA 4Y1CA 2D0BA 4FLZA 3PO4A 3ZT2A 1LWCA 1XHZA 5K14A 1L3UA 1NJWA 3L2UA 4JS4A 1WN7A 1EP4A 3HYFA 3DLGA 3HM9A 1ZBUA 4E19A 4FLWA 5CYQA 3RTVA 3WNEA 3QNNA 1ZBLA 3LALA 1LAVA 4CJLA 4DQIA 3LP1A 2VG6A 4NCGA 4Y1DA 5KGWA 1X9MA 4KHWA 3NCIA 1MU2A 4KKOA 3VQ7A 2VG5A 1Q9YA 2LSNA 4CJPA 2HNYA 3OJUA 2YNGA 2DFEA 1TK5A 3M8SA 1RT5A 2YNHA 1S1VA 4FJ7A 4CHOA 3NH2A 1S1UA 5FRMA 4CEZA 1JXBA 3L2WA 4DSJA 4KB1A 1ZBIA 2E6MA 3SV4A 3AO5A 1B92A 4RG8A 1KTQA 1Z26A 4I9LA 3SUQA 3NDKA 2OPQA 1HJRA 1KVCA 3JYTA 1T7PA 1JLAA 3DRSA 3H08A 4CJUA 3DRRA 1FK9A 4O4GA 3SYZA 1IKWA 3O4QA 1GOAA 1KSPA 3K59A 3ITHA 4MFBA 4CEEA 4JLHA 4FJGA 4OLAA 2HHXA 3OYFA 3AVNA 2JLEA 3HVTA 4H4OA 5I3UA 1FXXA 1TV6A 3NH1A 4FK4A 4FJXA 1ITGA 1BI4A 4IFVA 4HHTA 1BHLA 1CZBA 2YNFA 4ELTA 3DM2A 4FJ9A 4RW4A 4Z0UA 4I7FA 2HNDA 4M3RA 3AO4A 4OGEA 3AV9A 4LH5A 1QE1A 1A5VA 1HMVA 2YHBA 3NF7A 3T19A 3SJJA 1SV5A 3O3FA 1LV5A 2YV0X 3I8DA 1C0UA 4FCYA 3QEIA 4M3YA 1QSYA 3L3VA 4O55A 3OVNA 3OY9A 3AVLA 4XIUA 4DTJA 1R0AA 1UA0A 5E41A 4BDZA 4B9NA 4QAGA 4N41A 4GVMA 1RTDA 3AVAA 3RMDA 2G8FA 2E6LA 1KCFA 3KIOA 2Z1HA 1HRHA 3KKRA 3VQ9A 2XY6A 4EZ9A 3RR8A 4BDYA 2HHQA 1GOCA 3NE6A 4NYNA 1W0HA 3FFIA 2HHSA 1CZ9A 4BE2A 4DU4A 1TAQA 2IDOA 1QQCA 4CGDA 3NAEA 2PYJA 1TGOA 2IGIA 3RWUA 4AHSA 4B8CA 1NOYA 4JRQA 4N47A 4CGJA 1FKOA 3TAMA 5J2MA 3EY1A 4DTPA 3G0ZA 1VSIA 4CJQA 3NGZA 4JS5A 4DTXA 3TARA 3THVA 1QSLA 2XY8A 3T1AA 4KTWA 5C25A 3SV3A 1LAWA 1Z25A 2FC0A 4DSEA 3P1GA 1L3SA 1QHTA 2GV9A 2E4LA 1TVRA 1HQEA 3DYAA 3QIPA 4CEFA 1WSFA 4CJ5A 1X9WA 2OZMA 2KZMA 1UWBA 2XO7A 1EX4A 1REVA 1RT7A 3CFPA 3QLHA 3T3FA 1SL2A 4PWDA 3WNHA 4DQRA 4CHZA 3C6TA 1RILA 4GW6A 1CXUA 5T7BA 1SL1A 4CE9A 3KLEA 4E7KA 3KD1E 1IKXA 1WSGA 1KVBA 3SUPA 4M41A 3QEVA 5CY4A 3F73A 2HB5A 3K5OA 4OKEA 1WLJA 4I2PA 5HBMA 3VQPA 4DMNA 3HPGA 1U48A 3AVHA 4PQUA 2HHUA 1LW0A 3HK2A 2WOMA 4RW6A 3SUOA 1A5WA 4CHYA 1YTUA 3RMCA 3V1RA 2F8SA 4FXDA 1ZBFA 3PX0A 2X6NA 2ATQA 2O4GA 1SKWA 1NK0A 4DF8A 1DTTA 3KD5E 5HRPA 2PZSA 4DFKA 4E3SA 2R7YA 4RW9A 1TK0A 3LAMA 5HLFA 2G8VA 1UOCA 3AA3A 4CGGA 1RDAA 4CF2A 1G15A 4C8LA 1JLCA 2QXFA 4DSLA 2GUIA 3MAQA 4HUGA 3CG7A 1WNSA 3ZT0A 3TWHA 3MEEA 5HRSA 4DQQA 1VSKA 3VQDA 5FDLA 1QSSA 3SPYA 1D5AA 4M3XA 4IDKA 1BCMA 3LAKA 4DS4A 4FJMA 1L3VA 4N56A 3OYDA 1BIZA 4CERA 3F9KA 3AVMA 4BWJA 4E1MA 4E0DA 1RBTA 1LWFA 1TKXA 2HHVA 4CGIA 1BCOA 2OZSA 4CJKA 4KTQA 5HRRA 5HRNA 1YTAA 3AVJA 3PX6A 1WSEA 1KRPA 1VSFA 2HNZA 2BDPA 4FLVA 3VN5A 4CJWA 3PUFA 3SI6A 1Q9XA 4CGFA 3RR7A 3L2QA 4CIFA 3PO5A 2HVHA 4HCCA 3RMAA 3NFAA 3DLHA 2OPRA 3VQ5A 4FJLA 3MEDA 3ZSVA 2YKNA 1VSHA 3ZT3A 3TI0A 4BACA 4BDPA 2DFFA 4ZTFA 3SQ4A 3C95A 3DLKA 4DTUA 4F2SA 3OYMA 3QEWA 2G8WA 4C8NA 2P5OA 2WONA 1WSJA 4AHVA 3TAEA 1KLMA 1BISA 3ZCMA 3DMJA 4KV8A 3L3UA 4FVMA 4HTUA 4M45A 2RN2A 5J2QA 1S6QA 2X78A 3HVRA 4O5BA 1J5OA 4YFUA 2G8IA 1IKVA 4CJRA 3DI6A 4OKKA 1NK9A 3ASMA 1I39A 3VA3A 4DFPA 3S3OA 1KFSA 1NOZA 2G8UA 3LP0A 3DLEA 3IG1A 3O4NA 1W9HA 4CJVA 1TK8A 1UA1A 3DOLA 2PY5A 3M8QA 2ITGA 4J2BA 5JS1A 3AA4A 3I0RA 2AJQA 2FBTA 1JLBA 5JS2A 5J2PA 1T8EA 2GBZA 2P51A 4F2RA 1JXEA 1JLQA 3KLGA 4DLGA 3ZSXA 4FJJA 3SQ0A 2IOCA 3QO9A 4FK0A 1BI4B 4FJNA 4CK1A 5DK5A 4B9LA 1LWEA 3V81A 4E7JA 2YNIA 4LSNA 4CESA 4ELUA 1ZYQA 2DY4A 3M8RA 2JGUA 1TL1A 3VQ6A 3KKSA 4CEQA 3RMBA 4AHTA 3KTQA 3HSTB 1HNIA 3HPHA 4CFBA 1SKRA 4FYDA 1S9GA 4W5NA 4CGHA 3AVBA 1YT3A 2IC3A 2Z1GA 4UQGA 3OS2A 1J53A 2KTQA 3UIQA 1IH7A 5HP1A 3OYAA 2RPIA 1QTMA 3TABA 5HROA 3EYZA 3LP3A 3CQ8A 3S9HA 1NK8A 1SKSA 4W5OA 5KI6A 1ASVA 4IG0A 1HPZA 2X74A 3E01A 1SUQA 3OYBA 2ZQBA 2VWJA 3ZT1A 3QEPA 3SQ1A 1ASWA 1JL2A 2DFHA 2FBYA 4DFMA 3ZSYA 3AVGA 3NH0A 3O3HA 4FZYA 2BGGA 3P83D 4ELVA 4DTMA 3ZSQA 3NF6A 1S1XA 3CYMA 3P5JA 4E89A 4FLYA 2Y1IA 4QOZB 4CIGA 1L5UA 4DG1A 4KAZA 1FKPA 4DTOA 3KLIA 3NF8A 4C8OA 3K5NA 3ZSRA 3QNOA 3QETA 1X1PA 3NGYA 3U3YA 3S3MA 3OYGA 1TKZA 4KRFA 4CK3A 3CM6A 2HHTA 1JKHA 1U49A 1Q8IA 3SPZA 3O3GA 1U4BA 2OYQA 2P1JA 4CFCA 2EX3A 1JLEA 4K8ZA 4CJ4A 1C0MA 5KRSA 2DTUA 1VRTA 4DTRA 4ICLA 1A5XA 3L2VA 2XHBA 5I42A 3V9WA 4E7LA 3BGRA 4F3OA 2HW3A 5EU7A 1S1WA 3V9SA 4Z4GA 1RT4A 2KW4A 2HVIA 2KFNA 4BE0A 2IAJA 1NKEA 1TAUA 3WNFA 1NKCA 3LWLA 3B6PA 4JRPA 1NJXA 3BDPA 4OJRA 4ID1A 4MQ3A 1S9EA 4AH9A 3VQEA 1WSHA 2RKIA 1ASUA 1D8YA 4FJ8A 4KHQA 1VSLA 3JSMA 1U47A 3MEGA 3OYJA 4PY5A 3S3NA 1KFDA 1WSIA 4EP5A 2FBXA 1C6VA 4CF0A 5J2NA 1T03A 4Q0BA 3V4IA 2B5JA 3VQAA 1HNVA 3QEXA 3TAQA 1JLFA 3C6UA 3OYIA 5KRTA 3ZT4A 3SNNA 4B9SA 2W42A 1LW2A 4TSXA 2QK9A 5SWMA 3IRXA 2O4IA 4RW8A 3B6OA 4GMJB 1DTQA 3TANA 5D3GA 1WAJA 3LDSA 3PX4A 4AHCA 4J2EA 2NUBA 2OA8A 1Y97A 4IFYA 4DWIA 1B9FA 5FRNA 1RDCA 1EETA 4FK2A 2KQ2A 4H4MA 4ZTJA 4CF1A 4R5PA 4N5SA 4FM0A 2P5GA 1K6YA 3ZSZA 4ZHRA 1RT6A 1HYVA 4F4KA 1IO2A 4Z4CA 1U04A 1S1TA 1XHXA 3OYLA 4EP4A 3V1OA 3PY8A 1B9DA 1L3TA 3KJVA 3CFRA 1VRUA 1C1CA 3U3GA 4W5RA 1GOBA 3CM5A 3I0SA 3VQ4A 2ZE2A 1RTHA 4LD0A 1VSEA 4FJKA 4DU3A 1XI1A 3QINA 4RW7A 1QS4A 3AVKA 4PA1A 3NGIA 1NK4A 4H8KA 1RBRA 4CEDA 4FLTA 4C8KA 1ZBHA 4J2AA 3AVIA 3HJFA 2B6AA 1I3AA 3KK3A 3L8BA 3SUNA 4FW2A 2I5JA 4FM1A 4F8RA 2KZZA 5KTQA 1SL0A 4EZ6A 4KFBA 3HPOA 3ALYA 1EXQA 4CK2A 2FBVA 3QIOA 4CF9A 3KK1A 3TR8A 4FM2A 1BQMA 3V9XA 4OKJA 1BGXT 2X6SA 4FLUA 2EHGA 4AILC 1RBVA 3ZSWA 2OPSA 2YKMA 4NCAA 1RTJA 1UAXA 2YHAA 4CECA 4Z4HA 2HHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LZI A;  1JLG A;  2D0A A;  4L8R B;  1BL3 A;  2ZD1 A;  3DRP A;  3OYE A;  3VA0 A;  4KI6 A;  4Z4E A;  3OS0 A;  2QKK A;  2IS3 A;  4CCH A;  4M3Z A;  3D45 A;  3CFO A;  4ID5 A;  4N76 A;  2G8K A;  4B9V A;  4KHY A;  1RBU A;  2BAN A;  2XRI A;  3KLF A;  1HQU A;  4BE1 A;  1TKD A;  4FZX C;  3K2P A;  4CJF A;  3HL8 A;  1NK5 A;  3VQB A;  1HYS A;  3LPU A;  4IG3 A;  3HT3 A;  1X9S A;  4B3O A;  1TKT A;  4CF8 A;  1IKY A;  4AHU A;  3ULD A;  3KLH A;  4HUE A;  4Q5V A;  1RDD A;  3K57 A;  4LSL A;  5CZ1 A;  4W5T A;  1F21 A;  1WAF A;  1VSJ A;  3EZ5 A;  4Z4I A;  4DTN A;  4J2D A;  4KHS A;  3D0P A;  2D5R A;  4OLB A;  3OYN A;  3K5M A;  3HXM A;  5J1E A;  4E7H A;  1KVA A;  3AA5 X;  4F3T A;  2Z1J A;  3K58 A;  3AVC A;  5CYM A;  4HCB A;  3RRG A;  1N6Q A;  2QKB A;  1CLQ A;  4IKF A;  1RT1 A;  4I2Q A;  4K8X A;  3LP2 A;  5C24 A;  4OGC A;  1XWL A;  4M3W A;  2BE2 A;  4B08 A;  2Y1J A;  4FZZ A;  5KGX A;  4G1Q A;  4CHN A;  3SCX A;  3MXI A;  3PV8 A;  3C94 A;  4KTZ A;  1NK6 A;  2Q3S A;  1D9D A;  3OJS A;  4NCB A;  4FW1 A;  2F96 A;  1VSM A;  1DLO A;  2HMI A;  4DQP A;  5DMR A;  3SQ2 A;  4FJ5 A;  2XY5 A;  1NJY A;  3MXJ A;  4CEB A;  3DLR A;  3AO3 A;  4HVJ A;  3OYH A;  2D0C A;  4CFA A;  5CZ2 A;  4FLX A;  3MEC A;  3V9U A;  3LWM A;  4M42 A;  2A1R A;  1KLN A;  1D9F A;  4C8M A;  3NHG A;  3U6F A;  1BQN A;  4DFJ A;  2Z1I A;  1U45 A;  2PYL A;  3AA2 A;  3VQQ A;  3DOK A;  1IG9 A;  4O0I A;  3MXM A;  4DQS A;  1TL3 A;  4OPJ A;  4DSI A;  3V6D A;  4OPK A;  4LH4 A;  5SZT A;  4KRE A;  3TAP A;  1S6P A;  4O0J A;  1C1B A;  3L2R A;  3LZJ A;  3V1Q A;  1J9A A;  2ETJ A;  3AO1 A;  3KK2 A;  3SZ2 A;  3AVF A;  1RT2 A;  4CJS A;  1RNH A;  3LPT A;  4LY7 A;  2XY7 A;  4CJE A;  1RTI A;  4W5Q A;  3OYC A;  3IAY A;  4KB0 A;  4KHU A;  4M3U A;  3VQC A;  4OVL A;  2OPP A;  4CEA A;  2RF2 A;  1C1A A;  1JL1 A;  1RDB A;  1VK0 A;  5FRO A;  4FJI A;  4KPY A;  4HUF A;  3OS1 A;  4M3T A;  4CFD A;  3OYK A;  2A1S A;  1NK7 A;  4KO0 A;  4CHP A;  3V9Z A;  4DF4 A;  4KI4 A;  1O1W A;  4B9T A;  4DU1 A;  4I9Q A;  4Z4F A;  1RT3 A;  5C42 A;  3NBP A;  3QER A;  1YVU A;  4B8A B;  1N5Y A;  4B9M A;  4IBN A;  4WE1 A;  4AHR A;  3K5L A;  4B9U A;  1CXQ A;  2VWK A;  4FJH A;  4DSF A;  4QCL A;  1VSD A;  3DLB A;  3HP9 A;  1S5J A;  3LAN A;  3HO1 A;  4O44 A;  3ISN C;  1HYZ A;  3WNG A;  4CEO A;  4CIE A;  4CHQ A;  3G10 A;  3HP6 A;  4E7I A;  4CJ3 A;  4PUO A;  3NF9 A;  3RRH A;  4DSK A;  3AO2 A;  3TAG A;  2KFZ A;  3VQ8 A;  4BWM A;  1BIU A;  3M8P A;  4YNQ A;  1J54 A;  3A2F A;  3QES A;  1EKE A;  1C0T A;  1RBS A;  2B4J A;  2VG7 A;  1RCH A;  4DS5 A;  1NKB A;  4NYF A;  2G8H A;  4CJT A;  4DTS A;  3TAF A;  3ZSO A;  3IS9 A;  1NJZ A;  2F8T A;  1XC9 A;  1T05 A;  4E1N A;  4KHN A;  4DLE A;  4Y1C A;  2D0B A;  4FLZ A;  3PO4 A;  3ZT2 A;  1LWC A;  1XHZ A;  5K14 A;  1L3U A;  1NJW A;  3L2U A;  4JS4 A;  1WN7 A;  1EP4 A;  3HYF A;  3DLG A;  3HM9 A;  1ZBU A;  4E19 A;  4FLW A;  5CYQ A;  3RTV A;  3WNE A;  3QNN A;  1ZBL A;  3LAL A;  1LAV A;  4CJL A;  4DQI A;  3LP1 A;  2VG6 A;  4NCG A;  4Y1D A;  5KGW A;  1X9M A;  4KHW A;  3NCI A;  1MU2 A;  4KKO A;  3VQ7 A;  2VG5 A;  1Q9Y A;  2LSN A;  4CJP A;  2HNY A;  3OJU A;  2YNG A;  2DFE A;  1TK5 A;  3M8S A;  1RT5 A;  2YNH A;  1S1V A;  4FJ7 A;  4CHO A;  3NH2 A;  1S1U A;  5FRM A;  4CEZ A;  1JXB A;  3L2W A;  4DSJ A;  4KB1 A;  1ZBI A;  2E6M A;  3SV4 A;  3AO5 A;  1B92 A;  4RG8 A;  1KTQ A;  1Z26 A;  4I9L A;  3SUQ A;  3NDK A;  2OPQ A;  1HJR A;  1KVC A;  3JYT A;  1T7P A;  1JLA A;  3DRS A;  3H08 A;  4CJU A;  3DRR A;  1FK9 A;  4O4G A;  3SYZ A;  1IKW A;  3O4Q A;  1GOA A;  1KSP A;  3K59 A;  3ITH A;  4MFB A;  4CEE A;  4JLH A;  4FJG A;  4OLA A;  2HHX A;  3OYF A;  3AVN A;  2JLE A;  3HVT A;  4H4O A;  5I3U A;  1FXX A;  1TV6 A;  3NH1 A;  4FK4 A;  4FJX A;  1ITG A;  1BI4 A;  4IFV A;  4HHT A;  1BHL A;  1CZB A;  2YNF A;  4ELT A;  3DM2 A;  4FJ9 A;  4RW4 A;  4Z0U A;  4I7F A;  2HND A;  4M3R A;  3AO4 A;  4OGE A;  3AV9 A;  4LH5 A;  1QE1 A;  1A5V A;  1HMV A;  2YHB A;  3NF7 A;  3T19 A;  3SJJ A;  1SV5 A;  3O3F A;  1LV5 A;  2YV0 X;  3I8D A;  1C0U A;  4FCY A;  3QEI A;  4M3Y A;  1QSY A;  3L3V A;  4O55 A;  3OVN A;  3OY9 A;  3AVL A;  4XIU A;  4DTJ A;  1R0A A;  1UA0 A;  5E41 A;  4BDZ A;  4B9N A;  4QAG A;  4N41 A;  4GVM A;  1RTD A;  3AVA A;  3RMD A;  2G8F A;  2E6L A;  1KCF A;  3KIO A;  2Z1H A;  1HRH A;  3KKR A;  3VQ9 A;  2XY6 A;  4EZ9 A;  3RR8 A;  4BDY A;  2HHQ A;  1GOC A;  3NE6 A;  4NYN A;  1W0H A;  3FFI A;  2HHS A;  1CZ9 A;  4BE2 A;  4DU4 A;  1TAQ A;  2IDO A;  1QQC A;  4CGD A;  3NAE A;  2PYJ A;  1TGO A;  2IGI A;  3RWU A;  4AHS A;  4B8C A;  1NOY A;  4JRQ A;  4N47 A;  4CGJ A;  1FKO A;  3TAM A;  5J2M A;  3EY1 A;  4DTP A;  3G0Z A;  1VSI A;  4CJQ A;  3NGZ A;  4JS5 A;  4DTX A;  3TAR A;  3THV A;  1QSL A;  2XY8 A;  3T1A A;  4KTW A;  5C25 A;  3SV3 A;  1LAW A;  1Z25 A;  2FC0 A;  4DSE A;  3P1G A;  1L3S A;  1QHT A;  2GV9 A;  2E4L A;  1TVR A;  1HQE A;  3DYA A;  3QIP A;  4CEF A;  1WSF A;  4CJ5 A;  1X9W A;  2OZM A;  2KZM A;  1UWB A;  2XO7 A;  1EX4 A;  1REV A;  1RT7 A;  3CFP A;  3QLH A;  3T3F A;  1SL2 A;  4PWD A;  3WNH A;  4DQR A;  4CHZ A;  3C6T A;  1RIL A;  4GW6 A;  1CXU A;  5T7B A;  1SL1 A;  4CE9 A;  3KLE A;  4E7K A;  3KD1 E;  1IKX A;  1WSG A;  1KVB A;  3SUP A;  4M41 A;  3QEV A;  5CY4 A;  3F73 A;  2HB5 A;  3K5O A;  4OKE A;  1WLJ A;  4I2P A;  5HBM A;  3VQP A;  4DMN A;  3HPG A;  1U48 A;  3AVH A;  4PQU A;  2HHU A;  1LW0 A;  3HK2 A;  2WOM A;  4RW6 A;  3SUO A;  1A5W A;  4CHY A;  1YTU A;  3RMC A;  3V1R A;  2F8S A;  4FXD A;  1ZBF A;  3PX0 A;  2X6N A;  2ATQ A;  2O4G A;  1SKW A;  1NK0 A;  4DF8 A;  1DTT A;  3KD5 E;  5HRP A;  2PZS A;  4DFK A;  4E3S A;  2R7Y A;  4RW9 A;  1TK0 A;  3LAM A;  5HLF A;  2G8V A;  1UOC A;  3AA3 A;  4CGG A;  1RDA A;  4CF2 A;  1G15 A;  4C8L A;  1JLC A;  2QXF A;  4DSL A;  2GUI A;  3MAQ A;  4HUG A;  3CG7 A;  1WNS A;  3ZT0 A;  3TWH A;  3MEE A;  5HRS A;  4DQQ A;  1VSK A;  3VQD A;  5FDL A;  1QSS A;  3SPY A;  1D5A A;  4M3X A;  4IDK A;  1BCM A;  3LAK A;  4DS4 A;  4FJM A;  1L3V A;  4N56 A;  3OYD A;  1BIZ A;  4CER A;  3F9K A;  3AVM A;  4BWJ A;  4E1M A;  4E0D A;  1RBT A;  1LWF A;  1TKX A;  2HHV A;  4CGI A;  1BCO A;  2OZS A;  4CJK A;  4KTQ A;  5HRR A;  5HRN A;  1YTA A;  3AVJ A;  3PX6 A;  1WSE A;  1KRP A;  1VSF A;  2HNZ A;  2BDP A;  4FLV A;  3VN5 A;  4CJW A;  3PUF A;  3SI6 A;  1Q9X A;  4CGF A;  3RR7 A;  3L2Q A;  4CIF A;  3PO5 A;  2HVH A;  4HCC A;  3RMA A;  3NFA A;  3DLH A;  2OPR A;  3VQ5 A;  4FJL A;  3MED A;  3ZSV A;  2YKN A;  1VSH A;  3ZT3 A;  3TI0 A;  4BAC A;  4BDP A;  2DFF A;  4ZTF A;  3SQ4 A;  3C95 A;  3DLK A;  4DTU A;  4F2S A;  3OYM A;  3QEW A;  2G8W A;  4C8N A;  2P5O A;  2WON A;  1WSJ A;  4AHV A;  3TAE A;  1KLM A;  1BIS A;  3ZCM A;  3DMJ A;  4KV8 A;  3L3U A;  4FVM A;  4HTU A;  4M45 A;  2RN2 A;  5J2Q A;  1S6Q A;  2X78 A;  3HVR A;  4O5B A;  1J5O A;  4YFU A;  2G8I A;  1IKV A;  4CJR A;  3DI6 A;  4OKK A;  1NK9 A;  3ASM A;  1I39 A;  3VA3 A;  4DFP A;  3S3O A;  1KFS A;  1NOZ A;  2G8U A;  3LP0 A;  3DLE A;  3IG1 A;  3O4N A;  1W9H A;  4CJV A;  1TK8 A;  1UA1 A;  3DOL A;  2PY5 A;  3M8Q A;  2ITG A;  4J2B A;  5JS1 A;  3AA4 A;  3I0R A;  2AJQ A;  2FBT A;  1JLB A;  5JS2 A;  5J2P A;  1T8E A;  2GBZ A;  2P51 A;  4F2R A;  1JXE A;  1JLQ A;  3KLG A;  4DLG A;  3ZSX A;  4FJJ A;  3SQ0 A;  2IOC A;  3QO9 A;  4FK0 A;  1BI4 B;  4FJN A;  4CK1 A;  5DK5 A;  4B9L A;  1LWE A;  3V81 A;  4E7J A;  2YNI A;  4LSN A;  4CES A;  4ELU A;  1ZYQ A;  2DY4 A;  3M8R A;  2JGU A;  1TL1 A;  3VQ6 A;  3KKS A;  4CEQ A;  3RMB A;  4AHT A;  3KTQ A;  3HST B;  1HNI A;  3HPH A;  4CFB A;  1SKR A;  4FYD A;  1S9G A;  4W5N A;  4CGH A;  3AVB A;  1YT3 A;  2IC3 A;  2Z1G A;  4UQG A;  3OS2 A;  1J53 A;  2KTQ A;  3UIQ A;  1IH7 A;  5HP1 A;  3OYA A;  2RPI A;  1QTM A;  3TAB A;  5HRO A;  3EYZ A;  3LP3 A;  3CQ8 A;  3S9H A;  1NK8 A;  1SKS A;  4W5O A;  5KI6 A;  1ASV A;  4IG0 A;  1HPZ A;  2X74 A;  3E01 A;  1SUQ A;  3OYB A;  2ZQB A;  2VWJ A;  3ZT1 A;  3QEP A;  3SQ1 A;  1ASW A;  1JL2 A;  2DFH A;  2FBY A;  4DFM A;  3ZSY A;  3AVG A;  3NH0 A;  3O3H A;  4FZY A;  2BGG A;  3P83 D;  4ELV A;  4DTM A;  3ZSQ A;  3NF6 A;  1S1X A;  3CYM A;  3P5J A;  4E89 A;  4FLY A;  2Y1I A;  4QOZ B;  4CIG A;  1L5U A;  4DG1 A;  4KAZ A;  1FKP A;  4DTO A;  3KLI A;  3NF8 A;  4C8O A;  3K5N A;  3ZSR A;  3QNO A;  3QET A;  1X1P A;  3NGY A;  3U3Y A;  3S3M A;  3OYG A;  1TKZ A;  4KRF A;  4CK3 A;  3CM6 A;  2HHT A;  1JKH A;  1U49 A;  1Q8I A;  3SPZ A;  3O3G A;  1U4B A;  2OYQ A;  2P1J A;  4CFC A;  2EX3 A;  1JLE A;  4K8Z A;  4CJ4 A;  1C0M A;  5KRS A;  2DTU A;  1VRT A;  4DTR A;  4ICL A;  1A5X A;  3L2V A;  2XHB A;  5I42 A;  3V9W A;  4E7L A;  3BGR A;  4F3O A;  2HW3 A;  5EU7 A;  1S1W A;  3V9S A;  4Z4G A;  1RT4 A;  2KW4 A;  2HVI A;  2KFN A;  4BE0 A;  2IAJ A;  1NKE A;  1TAU A;  3WNF A;  1NKC A;  3LWL A;  3B6P A;  4JRP A;  1NJX A;  3BDP A;  4OJR A;  4ID1 A;  4MQ3 A;  1S9E A;  4AH9 A;  3VQE A;  1WSH A;  2RKI A;  1ASU A;  1D8Y A;  4FJ8 A;  4KHQ A;  1VSL A;  3JSM A;  1U47 A;  3MEG A;  3OYJ A;  4PY5 A;  3S3N A;  1KFD A;  1WSI A;  4EP5 A;  2FBX A;  1C6V A;  4CF0 A;  5J2N A;  1T03 A;  4Q0B A;  3V4I A;  2B5J A;  3VQA A;  1HNV A;  3QEX A;  3TAQ A;  1JLF A;  3C6U A;  3OYI A;  5KRT A;  3ZT4 A;  3SNN A;  4B9S A;  2W42 A;  1LW2 A;  4TSX A;  2QK9 A;  5SWM A;  3IRX A;  2O4I A;  4RW8 A;  3B6O A;  4GMJ B;  1DTQ A;  3TAN A;  5D3G A;  1WAJ A;  3LDS A;  3PX4 A;  4AHC A;  4J2E A;  2NUB A;  2OA8 A;  1Y97 A;  4IFY A;  4DWI A;  1B9F A;  5FRN A;  1RDC A;  1EET A;  4FK2 A;  2KQ2 A;  4H4M A;  4ZTJ A;  4CF1 A;  4R5P A;  4N5S A;  4FM0 A;  2P5G A;  1K6Y A;  3ZSZ A;  4ZHR A;  1RT6 A;  1HYV A;  4F4K A;  1IO2 A;  4Z4C A;  1U04 A;  1S1T A;  1XHX A;  3OYL A;  4EP4 A;  3V1O A;  3PY8 A;  1B9D A;  1L3T A;  3KJV A;  3CFR A;  1VRU A;  1C1C A;  3U3G A;  4W5R A;  1GOB A;  3CM5 A;  3I0S A;  3VQ4 A;  2ZE2 A;  1RTH A;  4LD0 A;  1VSE A;  4FJK A;  4DU3 A;  1XI1 A;  3QIN A;  4RW7 A;  1QS4 A;  3AVK A;  4PA1 A;  3NGI A;  1NK4 A;  4H8K A;  1RBR A;  4CED A;  4FLT A;  4C8K A;  1ZBH A;  4J2A A;  3AVI A;  3HJF A;  2B6A A;  1I3A A;  3KK3 A;  3L8B A;  3SUN A;  4FW2 A;  2I5J A;  4FM1 A;  4F8R A;  2KZZ A;  5KTQ A;  1SL0 A;  4EZ6 A;  4KFB A;  3HPO A;  3ALY A;  1EXQ A;  4CK2 A;  2FBV A;  3QIO A;  4CF9 A;  3KK1 A;  3TR8 A;  4FM2 A;  1BQM A;  3V9X A;  4OKJ A;  1BGX T;  2X6S A;  4FLU A;  2EHG A;  4AIL C;  1RBV A;  3ZSW A;  2OPS A;  2YKM A;  4NCA A;  1RTJ A;  1UAX A;  2YHA A;  4CEC A;  4Z4H A;  2HHW A; 
#chains in the Genus database with same CATH topology
 2IVN A;  3DRP A;  3VA0 A;  4KI6 A;  1Q18 A;  2WTU A;  2IS3 A;  4M3Z A;  4RWT A;  3P4I A;  4FO0 A;  4KHY A;  5BR8 K;  4BE1 A;  2XRI A;  1WBB A;  2O8E A;  3VQB A;  1HYS A;  2A40 A;  3LPU A;  2UUA K;  1R59 O;  4LSL A;  4Z4I A;  4J2D A;  4K0K K;  2IIR A;  4FWK A;  4H5N A;  4YOU A;  3OYN A;  1E4F T;  4E7H A;  4YDU A;  5AQJ A;  1OH8 A;  3NVM A;  4IKF A;  4MO4 A;  5C24 A;  4RTF D;  2BE2 A;  3FLC O;  4FZZ A;  3GG4 A;  1Q82 O;  4KTZ A;  2Q3S A;  1QVG M;  5AFU H;  1SAZ A;  1DLO A;  2HMI A;  4DQP A;  4AM7 A;  3SQ2 A;  3JAM O;  4IO9 L;  3DLR A;  2D0C A;  5CZ2 A;  3LWM A;  1GLC G;  3FGU A;  4C8M A;  3U6F A;  3EO3 A;  1BQN A;  4ISF A;  1HNZ K;  2QEX N;  1TL3 A;  3UKR B;  3V6D A;  3C65 A;  3FZK A;  4OPK A;  4BRD A;  2YJF A;  3V1Q A;  4LFA K;  3R8E A;  3KK2 A;  3AO1 A;  4FWM A;  3LPT A;  1NJI O;  4LY7 A;  3VMF B;  2XY7 A;  4YOW A;  4KHU A;  4W5Q A;  5AQU A;  4H0O A;  2RF2 A;  5FRO A;  4FJI A;  4X64 K;  1WB9 A;  2A1S A;  1NK7 A;  4KO0 A;  3V9Z A;  4DF4 A;  1O1W A;  4I9Q A;  5C42 A;  1N5Y A;  2HHT A;  3ENB A;  4B9U A;  1CXQ A;  1KAX A;  1T44 A;  2VWK A;  3CJA A;  4DSF A;  3HP9 A;  3HO1 A;  3ISN C;  2I7N A;  3IDH A;  2KFZ A;  4E7I A;  2O8C B;  4DSK A;  3TAG A;  4JEP A;  4BWM A;  1P8Z A;  4YNQ A;  1J54 A;  3A2F A;  1EKE A;  1C0T A;  3MK6 A;  4BRA A;  2YJE A;  2CGK A;  3L4Q A;  1NJZ A;  4JI1 K;  3E9L A;  4UY8 O;  2VWB A;  1T05 A;  3SBG A;  4KHN A;  4GV6 A;  4FLZ A;  4IJA A;  3GE1 A;  3ZT2 A;  1BA0 A;  1XHZ A;  2A5X A;  3VTH A;  5BRH A;  4YOR A;  3HM9 A;  2ZJR L;  3QNN A;  5CYQ A;  1LAV A;  4CJL A;  3LP1 A;  4B3R K;  3CC2 N;  4Y1D A;  4MDB A;  5KGW A;  4KHW A;  3NCI A;  4KKO A;  3WEE B;  2VG5 A;  4IXC A;  3D2E B;  2DFE A;  4KH5 A;  5BPN A;  1RT5 A;  4FJ7 A;  1W7A A;  1S1U A;  1YIJ N;  2GEL A;  4CEZ A;  5DM6 L;  3L2W A;  4KB1 A;  1ZBI A;  3EE9 A;  5TKW A;  2P9I A;  3THW A;  2E6M A;  3SV4 A;  3AO5 A;  1KTQ A;  1Z26 A;  3CC4 N;  2OPQ A;  5AR0 A;  3DRS A;  3H08 A;  1IKW A;  4MLH A;  4X65 K;  2E1Y A;  4OLA A;  3OYF A;  3AVN A;  3VTI A;  5C10 A;  3AGK A;  3NH1 A;  2J4R A;  3WXK A;  1BI4 A;  1GLD G;  1TYQ A;  5AQN A;  4LFC K;  4Z0U A;  3A8Y A;  2HND A;  2P9L B;  3UKU B;  1A5V A;  2YHB A;  3C7N A;  3NF7 A;  4HTL A;  4BC3 A;  4JD2 A;  2YV0 X;  3KVG A;  3CJC A;  2PBD A;  1HR0 K;  3AVL A;  1UA0 A;  1G99 A;  3C6H A;  4QAG A;  1KCF A;  3KIO A;  1NU0 A;  2Z1H A;  1HRH A;  1N8R O;  4NO7 A;  2XY6 A;  4EZ9 A;  2HHQ A;  3FFI A;  4FL9 A;  3GL1 A;  3NAE A;  1NWK A;  3RWU A;  4B8C A;  2E2O A;  3G0Z A;  3Q7B A;  3SV3 A;  1Q7Y O;  1Z25 A;  2ZJQ L;  2UU9 K;  3TTD A;  2E4L A;  3ID8 A;  1HQE A;  4CEF A;  4CJ5 A;  2XO7 A;  1EX4 A;  1RT7 A;  4DV4 K;  3CCS N;  4GW6 A;  1CXU A;  5T7B A;  4BVO A;  4CJ7 A;  5ELZ A;  4EHT A;  3SUP A;  2WFB A;  4WQ5 A;  3F73 A;  2XY5 A;  2HB5 A;  2E2P A;  4I2P A;  3U8X A;  3VQP A;  1S72 N;  1U48 A;  2QW9 A;  1SQK A;  4PQU A;  3ZX0 A;  3IKM A;  3EN9 A;  4A2A A;  4CZE A;  2ATQ A;  3TPQ A;  3HTV A;  4AQY K;  1DTT A;  2NRV A;  4BRN A;  2R7Y A;  2G8V A;  3CJ9 A;  1G15 A;  2QXF A;  3TSQ A;  4DSL A;  2GUI A;  1WNS A;  3E1Y A;  5HRS A;  1VSK A;  4KH6 A;  1QSS A;  1SZ2 A;  3VGK A;  4BRM A;  1E4G T;  5F2R A;  5LJV A;  3F9K A;  3KHY A;  4BWJ A;  1TKX A;  1BCO A;  5IWA K;  1WSE A;  4WYB A;  2HNZ A;  4BRE A;  2BDP A;  1EO1 A;  4FLV A;  3PUF A;  1Q9X A;  3LDO A;  3FZM A;  3CCV N;  2YKN A;  3ZT3 A;  1RDW X;  4BDP A;  3CC7 N;  3SQ4 A;  3DLK A;  4DTU A;  5AJ3 K;  4K25 A;  4DR4 K;  1WSJ A;  3DMJ A;  4JI8 K;  3L3U A;  1YUW A;  4O5B A;  3O4W A;  3JXU A;  4CJR A;  3DI6 A;  1DGK N;  2RHK A;  3ASM A;  3VA3 A;  3QFP A;  4KH4 A;  2G8U A;  3O8M A;  1W9H A;  1UA1 A;  4JI3 K;  3AA4 A;  1JLB A;  2Q36 A;  5AQO A;  3CQY A;  4FWL A;  2GBZ A;  4ILJ A;  2P51 A;  4F2R A;  3LDN A;  1JXE A;  3ZSX A;  4FJJ A;  2P9P A;  2IOC A;  2PFU A;  1YHQ N;  2YNI A;  4CES A;  3VQ6 A;  1TL1 A;  3RMB A;  4FYD A;  3CQX A;  1HNI A;  5C0Y A;  1S9G A;  3AVB A;  1HNW K;  3HOS A;  2FSN A;  1HKG A;  4UQG A;  3LDL A;  3F5T A;  1LCU A;  3THX A;  3EYZ A;  1D4X A;  3CQ8 A;  4W5O A;  5KI6 A;  1SUQ A;  4FWN A;  3ZT1 A;  5BPM A;  5AQQ A;  3J81 O;  3SQ1 A;  1IV0 A;  1JL2 A;  3D6R A;  3L4I A;  3L0Q A;  3ZSY A;  2KKZ A;  2ZWH A;  1ATN A;  3ZSQ A;  3VEN A;  2Y1I A;  4BRK A;  3CJ1 A;  3ULE A;  1GLL O;  4DTO A;  3KLI A;  1ZC6 A;  4B1V A;  3NGY A;  5EVZ A;  3S3M A;  3ZX2 A;  4KRF A;  4CZH A;  2EX3 A;  4Z4G A;  2HVI A;  4BRH A;  3WT0 A;  4DR1 K;  1XNQ K;  1S9E A;  3CCE N;  1SS6 A;  2IVP A;  1S3X A;  5DM7 L;  1VQ9 N;  1D8Y A;  3WXM B;  1U47 A;  3MEG A;  3RSE B;  4Q0B A;  2B5J A;  1HNV A;  3QEX A;  4LF9 K;  3OYI A;  1RFQ A;  3SNN A;  2QK9 A;  1T6C A;  3OHR A;  3AAP A;  4RW8 A;  4J2E A;  2E8A A;  4IFY A;  1EET A;  4FK2 A;  3JS6 A;  2A42 A;  3PY8 A;  1B9D A;  5C2F A;  5KQ8 A;  1VRU A;  1GOB A;  5KPT A;  3I0S A;  1VSE A;  2YHX A;  4FJK A;  3T69 A;  3QIN A;  4JI6 K;  4EIA A;  2JWK A;  1KQS M;  2Q97 A;  1NK4 A;  4IO8 A;  4WQ4 C;  3VF6 A;  1ZBH A;  4JKG B;  3HJF A;  3KK3 A;  3L8B A;  3A5M C;  2I5J A;  4F8R A;  5KTQ A;  4EZ6 A;  3ALY A;  1EXQ A;  4CK2 A;  1VQ8 N;  3V9X A;  4OKJ A;  3WUH A;  4AIL C;  1WUA A;  3ATV A;  1UAX A;  2YHA A;  4NB4 A;  2HHW A;  1JLG A;  2HHH K;  3OS0 A;  2EWS A;  4CCH A;  4GVE A;  1K73 O;  4ID5 A;  3LM2 A;  4DKW A;  4ILH A;  4B9V A;  1RBU A;  3WXI A;  3HL8 A;  2UXC K;  3HT3 A;  1TKT A;  4AHU A;  3ULD A;  3KLH A;  4HUE A;  5CZ1 A;  4W5T A;  1F21 A;  1VSJ A;  4DTN A;  4KHS A;  4U67 L;  3D0P A;  1IBK K;  2QWP A;  3HXM A;  1KVA A;  5HL7 L;  3AA5 X;  4IDH A;  3AVC A;  3EZW A;  4FPA A;  4M63 C;  4CZF A;  3RRG A;  4HCB A;  1N6Q A;  2QKB A;  1RT1 A;  4M3W A;  4B08 A;  3MX5 A;  4G1Q A;  4CHN A;  2ZGZ A;  3C94 A;  3OJS A;  4NCB A;  2F96 A;  1N33 K;  1NGD A;  5AQG A;  3TSU A;  3MXJ A;  1XNR K;  3A5L C;  4H5R A;  5AQF A;  3MEC A;  2A1R A;  4Y0W A;  5FLX O;  4I6M A;  4DFJ A;  2Z1I A;  1U45 A;  2IVO A;  3VQQ A;  1RDU A;  1IBM K;  3O9Q A;  3P31 A;  3MN5 A;  5AQL A;  4OPJ A;  1DT9 A;  4LH4 A;  5SZT A;  1NBW A;  3TAP A;  1S6P A;  4O0J A;  3L2R A;  1KD1 O;  4JN4 A;  4FOI A;  3EKS A;  2PAV A;  5AQS A;  4BRI A;  3IAY A;  4KB0 A;  3VQC A;  1HKB A;  1C1A A;  1JL1 A;  1BUP A;  1RDB A;  3T7Z A;  5BR9 A;  4HUF A;  4M3T A;  3OYK A;  3CCM N;  4CHP A;  2DY4 A;  4IOX A;  4B8A B;  4B9M A;  1TAU A;  4WE1 A;  3K5L A;  4FJH A;  1HX1 A;  3LAN A;  4CHQ A;  3HP6 A;  4CIE A;  4PUO A;  3HM8 A;  3NF9 A;  2QTD A;  4JK9 A;  1BIU A;  1RBS A;  4NYF A;  4CJT A;  3TAF A;  3ZSO A;  4A5B A;  2I7P A;  5FPM A;  2F8T A;  5BRE A;  1U6Z A;  4E1N A;  4Y1C A;  1EQY A;  1L3U A;  1NJW A;  3L2U A;  4JHD A;  1WN7 A;  3DLG A;  3LM9 A;  2YHY A;  1ZBL A;  4JI4 K;  3LAL A;  4NCG A;  4JNE A;  3K9K A;  3VQ7 A;  1Q81 O;  4CJP A;  1VAZ A;  1TK5 A;  2QWN A;  2NRR A;  3SUQ A;  3VPZ A;  3GOI A;  4CJU A;  1FK9 A;  4O4G A;  3VF2 A;  4FJG A;  2JLE A;  1FXX A;  1TV6 A;  1BHL A;  3CER A;  4Z94 A;  4JI0 K;  4CZG A;  4I7F A;  4LH5 A;  4H03 B;  5EX5 A;  3SJJ A;  2HBK A;  3O3F A;  4OPH A;  3I8D A;  5C15 A;  4FCY A;  3CI5 A;  1NG9 A;  2O8E B;  2FSJ A;  3L3V A;  1QSY A;  1LOT B;  5E41 A;  4BDZ A;  4B9N A;  1VQ6 N;  4N41 A;  1RTD A;  1OH6 A;  3KKR A;  3RR8 A;  1GLB G;  4NYN A;  3LL3 A;  1W0H A;  5E84 A;  3C6A A;  2HHS A;  1O13 A;  2GWK A;  3CMA N;  2IGI A;  4JRQ A;  1Q86 O;  1FKO A;  4DTP A;  4JS5 A;  4DTX A;  3T1A A;  1EWR A;  2NZT A;  3HZ6 A;  4LF7 K;  1X9W A;  3QIP A;  4C23 A;  1WSF A;  2OZM A;  4PKH A;  1REV A;  3CFP A;  3T3F A;  3QLH A;  1M1K O;  5JIC A;  1RIL A;  3KLE A;  1KVB A;  2P9K A;  5CY4 A;  3K5O A;  4DMN A;  3R6M A;  2CGJ A;  3AVH A;  4B3S K;  2HHU A;  2HBJ A;  2YCH A;  2WOM A;  4RW6 A;  5AQP A;  3V1R A;  2F8S A;  5C12 A;  4GV3 A;  5JLF A;  1M90 O;  3CME N;  5GIO A;  4PL8 A;  3E66 A;  4FWP A;  1ZBS A;  3KD5 E;  1V4T A;  3O1W A;  3LAM A;  3AA3 A;  1RDA A;  1JLC A;  2HST A;  1KC8 O;  4HUG A;  3TWH A;  4DQQ A;  3VQD A;  1HUX A;  3SPY A;  4M3X A;  4IDK A;  3H1V X;  1L3V A;  1NGI A;  4CER A;  4E0D A;  2HHV A;  4L3Q A;  4CGI A;  4KTQ A;  5HRR A;  4F9O A;  5HRN A;  3AVJ A;  3PX6 A;  1KRP A;  2QI2 A;  2O8F A;  4CJW A;  5TKY A;  3L2Q A;  3C0B A;  4CIF A;  2HVH A;  4HCC A;  2UXD K;  4FJL A;  3H46 O;  2HF4 A;  3MED A;  3ZSV A;  1GLJ O;  3I8B A;  1I94 K;  3CCR N;  3QEW A;  4C8N A;  4B1U B;  2P5O A;  3TAE A;  1BIS A;  4KV8 A;  1XC3 A;  2RN2 A;  4K43 A;  1S6Q A;  3HVR A;  2E88 A;  4OKK A;  1NK9 A;  4IEE A;  4DFP A;  1KFS A;  1NOZ A;  3THW B;  2P9I B;  4JKH A;  3O4N A;  4JK8 A;  1TK8 A;  3VGM A;  3M8Q A;  3HI0 A;  4CZI A;  3R1X A;  1Y64 A;  1W2B M;  4H0X B;  3KLG A;  2QM1 A;  2O8B A;  3HOT A;  3SQ0 A;  4BR7 A;  1BI4 B;  2A6A A;  4FVU A;  4B9L A;  5DK5 A;  3DWL A;  1TYQ B;  4E7J A;  4K41 A;  5BN8 A;  3M8R A;  4CEQ A;  3CJB A;  3KTQ A;  3HPH A;  4CFB A;  3SJH A;  3C7N B;  4JD2 B;  3OS2 A;  1IH7 A;  1Z05 A;  3OYA A;  1QTM A;  3TU5 A;  1TUU A;  1SKS A;  3LP3 A;  4CZJ A;  3PIP L;  1ASV A;  5MLC Q;  3E01 A;  3ZET A;  1ASW A;  2DFH A;  1YI2 N;  4MLE A;  1BOT O;  2HF3 A;  3NH0 A;  2BGG A;  3E9O A;  3P83 D;  4BRO A;  3NF6 A;  1S1X A;  4E89 A;  3QML A;  4KAZ A;  4C8O A;  3K5N A;  2VCP A;  1JCF A;  3ZSR A;  3QNO A;  3QET A;  1X1P A;  3VES A;  1TKZ A;  3CM6 A;  1U49 A;  5BRF A;  3PIO L;  2E20 A;  2W40 A;  3O3G A;  2P1J A;  1JJ2 M;  3CJ7 A;  2DPN A;  2HOE A;  1YJN N;  1VQL N;  4CJ4 A;  4B3M K;  2DTU A;  1VRT A;  4ICL A;  5I42 A;  2XHB A;  4F3O A;  4JKA A;  5EU7 A;  1S1W A;  4XH5 A;  2KW4 A;  2KFN A;  1NKE A;  3WNF A;  3LWL A;  3B6P A;  1NM1 A;  2WC9 A;  2NRW A;  3L6Q A;  1NJX A;  2E2N A;  4MQ3 A;  4B9Q A;  4JKB A;  3MN9 A;  1C0G A;  4FWS A;  1WSH A;  1C0F A;  2RKI A;  4H0T B;  1ASU A;  4KHQ A;  3JSM A;  3VF4 A;  3F2K A;  2FBX A;  4ISE A;  4R79 A;  2HBM A;  1NLV A;  2VGM A;  3C6U A;  3TTC A;  2W42 A;  3VGL A;  4XEI A;  3IRX A;  3B6O A;  4DR3 K;  3TAN A;  3LDS A;  4BR2 A;  4BR5 A;  1Y97 A;  4DWI A;  4BC5 A;  5FPE A;  5M1P A;  5FRN A;  4CD3 A;  5CHI A;  3ZSZ A;  1ATS A;  4ZHR A;  1XHX A;  3BZK A;  4EP4 A;  3KJV A;  3U3G A;  1C1C A;  4DCH A;  3VQ4 A;  4E1J A;  4DU3 A;  3MX2 A;  2A3Z A;  1QS4 A;  3AVK A;  4PA1 A;  3NGI A;  1NGC A;  1RBR A;  4HWI A;  4C8K A;  1I3A A;  5M1N A;  4FM1 A;  1E3M A;  1WOQ A;  4FM2 A;  4CF9 A;  1OVY A;  3TR8 A;  2X6S A;  2NNW A;  5AZI A;  4FLU A;  1RBV A;  2OPS A;  5EOY A;  1KAZ A;  2F4V K;  4NCA A;  3O6W A;  1RTJ A;  3AAQ A;  3LZI A;  4MDA A;  1BL3 A;  2ZD1 A;  4IEI A;  2FF3 B;  4N76 A;  3G25 A;  2G8K A;  3ID6 A;  1V4S A;  1NGA A;  4FZX C;  3K2P A;  4CVN E;  1NK5 A;  3I55 N;  4IG3 A;  3KK7 A;  3CCU N;  4DHY A;  4CF8 A;  3PLA A;  1BWF O;  3OW2 M;  4IZ9 A;  3EZ5 A;  2ZJP L;  2D5R A;  3A0I X;  3K5M A;  4OLB A;  5J1E A;  2P9P B;  1HPM A;  2Z1J A;  1NGG A;  5CYM A;  3VER A;  2NRH A;  4OGC A;  3NMU A;  5KGX A;  3SCX A;  3PV8 A;  1MA9 B;  2FF6 A;  4A57 A;  5JVG L;  3A5N C;  3ENO A;  1VSM A;  3B8A X;  2P9N A;  2QXL A;  1HNX K;  4IWV A;  3AO3 A;  2ASM A;  4HVJ A;  3OYH A;  3THX B;  4M42 A;  3V9U A;  1KLN A;  4WCE L;  1D9F A;  4GKJ K;  2ZGY A;  3ZYY X;  2PYL A;  4YOV A;  3AA2 A;  4PHT X;  5HOO A;  3DJC A;  3AY9 A;  2NRT A;  4DSI A;  4KRE A;  1C1B A;  1QQM A;  1MDU B;  1J9A A;  2WUS A;  2ETJ A;  3ULE B;  3SZ2 A;  1BG3 A;  1RT2 A;  3AVF A;  4CJE A;  1RTI A;  3OA9 A;  3PSI A;  4M3U A;  3KWI A;  4FWO A;  1W97 L;  4BC4 A;  4OVL A;  5AQM A;  4ISG A;  1VK0 A;  4H0Y B;  4KPY A;  3D2F A;  4CFD A;  3U9Z A;  1YF5 L;  1YVN A;  3VEO A;  2GTD A;  4KI4 A;  4B9T A;  1RT3 A;  3NBP A;  4IBN A;  4QCL A;  3O9T A;  1S5J A;  4WFB L;  4O44 A;  1HYZ A;  3G10 A;  4CJ3 A;  4NXN K;  3I33 A;  4PKI A;  3VQ8 A;  3ZEU A;  3M8P A;  3D2F B;  2B4J A;  2VG7 A;  1NKB A;  5AQK A;  2G8H A;  1XC9 A;  1KXP A;  2D0B A;  1LWC A;  2YHW A;  2VQE K;  5K14 A;  2E1Z A;  3IFR A;  1GLA G;  1EP4 A;  4JS4 A;  4E19 A;  4DQI A;  3WNE A;  3UE5 A;  3DXM A;  3IUC A;  3SLC A;  3HBT A;  3E9P A;  2LSN A;  4OPA A;  3OJU A;  4YOT A;  4BRF A;  3M8S A;  2YNH A;  4BC2 A;  1NGJ A;  5JMV A;  5FRM A;  3SMP A;  1GLF O;  1B92 A;  1HJR A;  1KVC A;  3JYT A;  4FSV A;  4DUY K;  4EAH D;  1JLA A;  3SYZ A;  1K8K A;  1KSP A;  3O4Q A;  1GOA A;  4M7X A;  3BY5 A;  3THY A;  4CEE A;  4JLH A;  3HVT A;  4GKK K;  2F7T A;  2BUP A;  4FJX A;  1RGI A;  3I56 N;  4DV5 K;  1QHA A;  4IFV A;  3OBW A;  4HHT A;  1CZB A;  1NMN A;  2YNF A;  4ELT A;  3DM2 A;  4H0V B;  4FJ9 A;  3S41 A;  3AO4 A;  4JAX A;  1QE1 A;  2FSK A;  1SV5 A;  4H5T A;  1C0U A;  4BQL A;  1NNE A;  4M3Y A;  4O55 A;  5EY4 A;  3EKU A;  1NGB A;  2UYT A;  3AVA A;  3QBW A;  4O5F A;  4OX9 K;  3VQ9 A;  4BDY A;  1GOC A;  3NE6 A;  4K42 A;  3BF1 A;  3W3D A;  1TAQ A;  2ASP A;  1QQC A;  4CGD A;  1TGO A;  4A61 A;  1HKC A;  3VEZ A;  3MCP A;  1NOY A;  4N47 A;  4CGJ A;  3G4S N;  3TAM A;  3N4P A;  5J2M A;  3EY1 A;  3BEX A;  1QSL A;  1VSI A;  4YOY A;  2XY8 A;  4KTW A;  3AAR A;  5C25 A;  1LAW A;  4DSE A;  1QHT A;  2GV9 A;  3H3N O;  3DYA A;  2KZM A;  2D0O A;  1UWB A;  4I6M B;  4C1N I;  4DQR A;  1U2V A;  4CHZ A;  3C6T A;  2O8D A;  4CE9 A;  1XQS C;  1DEJ A;  3KD1 E;  1IKX A;  5JVH L;  3CF5 L;  4M41 A;  3QEV A;  3P38 A;  5HBM A;  4YDU C;  3LDQ A;  3SBT A;  1QZ5 A;  3ZX3 A;  1LW0 A;  3VEX A;  3HK2 A;  4GV9 A;  4IOC L;  1A5W A;  1YTU A;  3RMC A;  4H5V A;  1ZBF A;  4FPB A;  3PX0 A;  2X6N A;  1H1V A;  2O8D B;  4WQ4 A;  3SAH A;  4O8U A;  1BU6 O;  2BTF A;  1SKW A;  4BQZ A;  3CPE A;  2AP1 A;  3ZLJ A;  4DFK A;  4E3S A;  3AGR A;  5AZJ A;  4CGG A;  4CF2 A;  5AQW A;  1MWM A;  4C8L A;  4DV6 K;  3CG7 A;  3MEE A;  3J7Z O;  1D5A A;  1BCM A;  4FJM A;  4N56 A;  2QWM A;  3OYD A;  3AVM A;  2P9U A;  1XMQ K;  3T1Y K;  2E2Q A;  2QA4 N;  2E5L K;  2OZS A;  3R9P A;  1YTA A;  3GDQ A;  5AQV A;  1VSF A;  3MN6 A;  2V52 B;  3SI6 A;  4CGF A;  4B1X B;  3RMA A;  3DLH A;  4JHD B;  5BN9 A;  4DV1 K;  4ZTF A;  3CCL N;  3C95 A;  4IJN A;  1QVF M;  4AHV A;  1KLM A;  4NLC A;  1CZA N;  4CZM A;  2F9T A;  4FVM A;  2P9S A;  3LDP A;  2OTJ N;  5J2Q A;  2X78 A;  5M1Q A;  1J5O A;  4YFU A;  2UUC K;  2G8I A;  1OH5 A;  4JKE A;  3LP0 A;  3IG1 A;  1ESV A;  4J2B A;  1S22 A;  3DOL A;  2PY5 A;  5JS1 A;  2ITG A;  4OO1 J;  3K9J A;  3I0R A;  2AJQ A;  4X62 K;  5JS2 A;  5J2P A;  4LC9 B;  5M1F A;  1T8E A;  1J6Z A;  4EHU A;  4DLG A;  2OAN A;  1XUP O;  3NVK A;  3QO9 A;  4CK1 A;  3V81 A;  3BP8 A;  4EFH A;  4LSN A;  4ELU A;  1QQN A;  1ZYQ A;  3HRG A;  2JGU A;  4AHT A;  4IFE A;  1SKR A;  4FWR A;  3TSP A;  4CGH A;  1WBD A;  3MWP A;  2IC3 A;  2Z1G A;  1J53 A;  3O9U A;  5JLH A;  5EXW A;  3TAB A;  5HRO A;  2AA4 A;  3S9H A;  1YJ9 N;  4BG8 A;  4IG0 A;  3OYB A;  2X74 A;  4GY2 B;  3M1F A;  2VWJ A;  3P39 A;  2FBY A;  4YOX A;  3W0L A;  3UKR A;  5F1X A;  3O3H A;  4FZY A;  4ELV A;  1TUY A;  2QWQ A;  3O9S A;  3CYM A;  3P5J A;  4FLY A;  3SMS A;  1GLE G;  4CIG A;  1L5U A;  3FE1 A;  3HSC A;  4DG1 A;  5GIN A;  3MWT A;  1FKP A;  4PL7 A;  3NF8 A;  2F9W A;  3J7A P;  3U3Y A;  4JV5 K;  3H3O B;  2QWR A;  3OYG A;  4CK3 A;  5LY3 A;  4B1W B;  1Q8I A;  1U4B A;  5M1K A;  4CFC A;  3QDK A;  3H45 C;  2CH6 A;  3L2V A;  3V9W A;  3R3L A;  2HW3 A;  4WFN L;  3FR0 A;  4BE0 A;  2IAJ A;  3J8A A;  1QQO A;  2O8C A;  4JRP A;  2P9K B;  3BDP A;  4OJR A;  3MN7 A;  2UUB K;  3M5R A;  5AQR A;  4FJ8 A;  1VSL A;  3OYJ A;  4PY5 A;  1KFD A;  1WSI A;  1C6V A;  3TAQ A;  3U4L A;  5ADX A;  1JLF A;  4B9S A;  1LW2 A;  4GNI A;  4BVP A;  2Q0U A;  4LF4 K;  2O4I A;  1VHX A;  1VQO N;  5D3G A;  1DTQ A;  2W41 A;  3PX4 A;  4AHC A;  4U7B A;  2NUB A;  3FFK B;  4KBO A;  5E26 A;  2OA8 A;  3WEE A;  5BPL A;  1RDC A;  2KQ2 A;  4ZTJ A;  3D2E A;  4FM0 A;  4DR7 K;  1K6Y A;  1HYV A;  4Z4C A;  4A5A A;  2NLX A;  3OYL A;  4WQ5 C;  3V1O A;  2FXU A;  1VQK N;  1L3T A;  4W5R A;  4CBU A;  1VQM N;  1RTH A;  5M1O A;  2O8F B;  1X3M A;  2GEM A;  1BO5 O;  4QS9 A;  4FLT A;  3WQT A;  2YI1 A;  4J2A A;  3AVI A;  2B6A A;  4FW2 A;  4LF5 K;  1SL0 A;  4KFB A;  3PO5 A;  3QIO A;  3CD6 N;  1BQM A;  1X3N A;  5C2D A;  3ZSW A;  2YKM A;  4QS7 A;  2UXB K;  2P9L A;  4CEC A;  4Z4H A;  3UKU A;  2Q0R A;  4L8R B;  2D0A A;  4Z4E A;  3OYE A;  2QKK A;  3SAF A;  3D45 A;  3CFO A;  5AQI A;  3DAW A;  3IMX A;  2ITM A;  2BAN A;  3KLF A;  1HQU A;  1TKD A;  4CJF A;  1X9S A;  4B3O A;  1IKY A;  1XMO K;  4Q5V A;  1RDD A;  3K57 A;  1WAF A;  4BG9 A;  3H1Q A;  2O8B B;  4F3T A;  3CET A;  3K58 A;  3M3Z A;  3O08 A;  1CLQ A;  5AQZ A;  4I2Q A;  5ADX H;  3LP2 A;  4K8X A;  1XWL A;  2Y1J A;  1NGE A;  3KWG A;  3MXI A;  3EE8 A;  1NK6 A;  2D0P A;  3SK3 A;  1D9D A;  4FW1 A;  2QWO A;  4BY9 C;  4FJ5 A;  5DMR A;  1NJY A;  4CEB A;  3OTO K;  4CFA A;  3CPW M;  4FLX A;  1EWQ A;  4X66 K;  3NHG A;  2YX6 A;  3ZET B;  5BRD A;  3DOK A;  3FZL A;  1IG9 A;  4O0I A;  3MXM A;  4G9Z A;  4DQS A;  2Q2R A;  1YAG A;  3Q7C A;  4DV0 K;  3ENH A;  4B3T K;  3LZJ A;  5I9E B;  1VQP N;  4CJS A;  1RNH A;  4BRQ A;  4CBX A;  2W6L A;  3O9R A;  3OYC A;  4KHP K;  3D7E O;  4H5W A;  2HMP A;  2OPP A;  4CEA A;  4J8F A;  2D4W A;  4QS8 A;  4B1Z A;  4DV3 K;  3OS1 A;  4DV7 K;  5IT9 O;  4DU1 A;  4Z4F A;  1BDG A;  3QER A;  1YVU A;  3DXK A;  4AHR A;  2NRX A;  1VSD A;  3DLB A;  4CD1 A;  3WNG A;  4CEO A;  3RRH A;  3AO2 A;  5GAD P;  1IJJ A;  3QES A;  3CXC M;  1RCH A;  4DS5 A;  3CIP A;  4YY3 K;  4DTS A;  4BR9 A;  3DXK B;  4WFA L;  4DLE A;  1VQN N;  3PO4 A;  1NGH A;  3HYF A;  1ZBU A;  4FLW A;  3RTV A;  1ATR A;  4DR2 K;  1HLU A;  5H1S Q;  2JWL A;  3VEW A;  2VG6 A;  3O5B A;  1X9M A;  3MMV A;  1MU2 A;  2CGL A;  1Q9Y A;  4CI6 A;  2HNY A;  2YNG A;  3G71 N;  1JCG A;  2ZM6 K;  1N32 K;  1S1V A;  4CHO A;  3NH2 A;  1JXB A;  4FWQ A;  4DSJ A;  3MCA B;  4RG8 A;  4I9L A;  3NDK A;  2VYP A;  5AQT A;  1T7P A;  3DRR A;  3UB5 A;  5F0X A;  5CE3 A;  3K59 A;  3ITH A;  4MFB A;  2HHX A;  3QFU A;  4CBW A;  4H4O A;  5I3U A;  1FW6 A;  3PSF A;  4FK4 A;  3J80 O;  1ITG A;  3VEV A;  1NMD A;  5AZI B;  3FZF A;  2V7Y A;  4RW4 A;  4JI5 K;  5LJW A;  4M3R A;  2GWJ A;  4OGE A;  4YHH K;  3AV9 A;  1HMV A;  3BUZ B;  4B1Y B;  3T19 A;  1BA1 A;  3SAG A;  3G6E N;  1LV5 A;  3FZH A;  2ZF5 O;  3QEI A;  3OVN A;  3OY9 A;  1VQ5 N;  4XIU A;  4DTJ A;  4BGB A;  1R0A A;  4NLB A;  4GVM A;  3RMD A;  2G8F A;  2E6L A;  2V51 B;  4AF1 A;  4JK7 A;  3MDQ A;  3N4Q A;  3U9D A;  1OVQ A;  1J5E K;  1CZ9 A;  4BE2 A;  4DU4 A;  2IDO A;  2PYJ A;  4AHS A;  4DV2 K;  2V7Z A;  3TAR A;  4CJQ A;  3NGZ A;  3THV A;  1IBL K;  2FC0 A;  1L3S A;  2HBL A;  2VGN A;  3P1G A;  2P9N B;  1TVR A;  1X9J A;  2Q31 A;  5LMU K;  1K9M O;  1T6D A;  1SL2 A;  4PWD A;  4A2B A;  4JI7 K;  3WNH A;  1SL1 A;  3GBT A;  4E7K A;  1WSG A;  2RE2 A;  4OKE A;  4DQ8 A;  1WLJ A;  4XH4 A;  3HPG A;  3K0S A;  4BGA A;  5GIP A;  4A62 A;  4RCH A;  3A5O C;  4DR5 K;  3SUO A;  4CHY A;  3KZB A;  3RSE A;  4FXD A;  2D1K A;  1YIT N;  2O4G A;  1NK0 A;  2CH5 A;  4DF8 A;  1OH7 A;  1HJO A;  5HRP A;  5KQD A;  2PZS A;  4V19 S;  4JKF A;  4RW9 A;  1TK0 A;  2KLA A;  5HLF A;  1UOC A;  3DLL L;  2Q1N A;  4M7Y A;  3WXJ A;  3H6E A;  5LMN K;  5AQY A;  3MAQ A;  3ZT0 A;  5FDL A;  3LAK A;  4DS4 A;  1BIZ A;  3ZEU B;  4ILG B;  4E1M A;  1RBT A;  1LWF A;  4CJK A;  2OCE A;  3WXL A;  4WF9 L;  3VN5 A;  3RR7 A;  1OKJ A;  3NFA A;  2OPR A;  4JKG A;  3VQ5 A;  4JKC A;  1VSH A;  4BRP A;  3TI0 A;  4BAC A;  2DFF A;  4F2S A;  3OYM A;  2G8W A;  3DXM B;  1ILY A;  2WON A;  3ZCM A;  2OTL N;  3VOV A;  4HTU A;  4C1N K;  4M45 A;  4CZL A;  1IKV A;  5GAH P;  1ZXO A;  3S3O A;  1I39 A;  3OBY A;  5A2Q O;  5FPN A;  3DLE A;  4CJV A;  3BF3 A;  3VET A;  5KPZ A;  1IG8 A;  2FLO A;  2FBT A;  1K8K B;  3THY B;  5CR4 A;  3WQU A;  2ASO A;  2NRZ A;  1JLQ A;  4BRC A;  4MO5 A;  5KPR A;  4FK0 A;  4DB3 A;  5GAG P;  5FPD A;  1K8A O;  4FJN A;  1LWE A;  1DKG D;  1T3V A;  2VQF K;  5AQX A;  4DUZ K;  3KKS A;  4F4K A;  4JI2 K;  4A59 A;  3EEQ A;  3HST B;  2BH1 A;  4W5N A;  4CZK A;  4DR6 K;  1YT3 A;  4NXM K;  3VEY A;  2KTQ A;  3UIQ A;  5HP1 A;  4O8K A;  2RPI A;  1NK8 A;  1HPZ A;  1VQ4 N;  2ZQB A;  3QEP A;  4DFM A;  3T1H K;  3AVG A;  3TTF A;  4FOE A;  4DTM A;  1JCE A;  1NGF A;  3M6G A;  4QOZ B;  1MWK A;  4BRL A;  1YXQ A;  3F9M A;  2A41 A;  3BZC A;  3CCJ N;  1JKH A;  3QBX A;  3SPZ A;  2W6K A;  2OYQ A;  1JLE A;  5B8H A;  4K8Z A;  1C0M A;  5KRS A;  3QB0 A;  4DTR A;  1A5X A;  1U2V B;  4E7L A;  3BGR A;  3V9S A;  1RT4 A;  4XH1 A;  4BR4 A;  4CW7 B;  1P90 A;  1NKC A;  1Z6R A;  1FJG K;  4ID1 A;  4AH9 A;  3VQE A;  2KHO A;  3RVC A;  3EL2 A;  3S3N A;  4EP5 A;  1N34 K;  5J2N A;  4CF0 A;  1T03 A;  3V4I A;  3VQA A;  5GAE P;  4LF6 K;  4BR0 A;  5KRT A;  3ZT4 A;  4LFB K;  1N36 K;  5LL6 Z;  4TSX A;  5SWM A;  3O80 A;  1KAY A;  4GMJ B;  1WAJ A;  2QWL A;  5AZJ B;  5AFU A;  5AQH A;  4IOA L;  1B9F A;  4H4M A;  4CF1 A;  4R5P A;  4H0P A;  4N5S A;  2P5G A;  4BRG A;  1YJW N;  1RT6 A;  2H3G X;  3CCQ N;  1IO2 A;  2GX9 A;  1U04 A;  1S1T A;  2P9U B;  3O1B A;  2GUP A;  3CHW A;  3CFR A;  1VQ7 N;  3CM5 A;  2ZE2 A;  4LD0 A;  1XI1 A;  4RW7 A;  3QIC A;  4JYA K;  4H8K A;  4CED A;  4PKG A;  3J7Y P;  3SUN A;  4JKD A;  2KZZ A;  3HPO A;  4LF8 K;  3KK1 A;  2FBV A;  2WBN A;  1BGX T;  1QZ6 A;  4AM6 A;  2EHG A;  2P9S B;  3ATU A;  3IS9 A; 
#chains in the Genus database with same CATH homology
 3LZI A;  1JLG A;  2D0A A;  4L8R B;  1BL3 A;  2ZD1 A;  3DRP A;  3OYE A;  3VA0 A;  4KI6 A;  4Z4E A;  3OS0 A;  2QKK A;  2IS3 A;  4CCH A;  4M3Z A;  3D45 A;  3CFO A;  4ID5 A;  4N76 A;  2G8K A;  4B9V A;  4KHY A;  1RBU A;  2BAN A;  2XRI A;  3KLF A;  1HQU A;  4BE1 A;  1TKD A;  4FZX C;  3K2P A;  4CJF A;  3HL8 A;  1NK5 A;  3VQB A;  1HYS A;  3LPU A;  4IG3 A;  3HT3 A;  1X9S A;  4B3O A;  1TKT A;  4CF8 A;  1IKY A;  4AHU A;  3ULD A;  3KLH A;  4HUE A;  4Q5V A;  1RDD A;  3K57 A;  4LSL A;  5CZ1 A;  4W5T A;  1F21 A;  1WAF A;  1VSJ A;  3EZ5 A;  4Z4I A;  4DTN A;  4J2D A;  4KHS A;  3D0P A;  2D5R A;  4OLB A;  3OYN A;  3K5M A;  3HXM A;  5J1E A;  4E7H A;  1KVA A;  3AA5 X;  4F3T A;  2Z1J A;  3K58 A;  3AVC A;  5CYM A;  4HCB A;  3RRG A;  1N6Q A;  2QKB A;  1CLQ A;  4IKF A;  1RT1 A;  4I2Q A;  4K8X A;  3LP2 A;  5C24 A;  4OGC A;  1XWL A;  4M3W A;  2BE2 A;  4B08 A;  2Y1J A;  4FZZ A;  5KGX A;  4G1Q A;  4CHN A;  3SCX A;  3MXI A;  3PV8 A;  3C94 A;  4KTZ A;  1NK6 A;  2Q3S A;  1D9D A;  3OJS A;  4NCB A;  4FW1 A;  2F96 A;  1VSM A;  1DLO A;  2HMI A;  4DQP A;  5DMR A;  3SQ2 A;  4FJ5 A;  2XY5 A;  1NJY A;  3MXJ A;  4CEB A;  3DLR A;  3AO3 A;  4HVJ A;  3OYH A;  2D0C A;  4CFA A;  5CZ2 A;  4FLX A;  3MEC A;  3V9U A;  3LWM A;  4M42 A;  2A1R A;  1KLN A;  1D9F A;  4C8M A;  3NHG A;  3U6F A;  1BQN A;  4DFJ A;  2Z1I A;  1U45 A;  2PYL A;  3AA2 A;  3VQQ A;  3DOK A;  1IG9 A;  4O0I A;  3MXM A;  4DQS A;  1TL3 A;  4OPJ A;  4DSI A;  3V6D A;  4OPK A;  4LH4 A;  5SZT A;  4KRE A;  3TAP A;  1S6P A;  4O0J A;  1C1B A;  3L2R A;  3LZJ A;  3V1Q A;  1J9A A;  2ETJ A;  3AO1 A;  3KK2 A;  3SZ2 A;  3AVF A;  1RT2 A;  4CJS A;  1RNH A;  3LPT A;  4LY7 A;  2XY7 A;  4CJE A;  1RTI A;  4W5Q A;  3OYC A;  3IAY A;  4KB0 A;  4KHU A;  4M3U A;  3VQC A;  4OVL A;  2OPP A;  4CEA A;  2RF2 A;  1C1A A;  1JL1 A;  1RDB A;  1VK0 A;  5FRO A;  4FJI A;  4KPY A;  4HUF A;  3OS1 A;  4M3T A;  4CFD A;  3OYK A;  2A1S A;  1NK7 A;  4KO0 A;  4CHP A;  3V9Z A;  4DF4 A;  4KI4 A;  1O1W A;  4B9T A;  4DU1 A;  4I9Q A;  4Z4F A;  1RT3 A;  5C42 A;  3NBP A;  3QER A;  1YVU A;  4B8A B;  1N5Y A;  4B9M A;  4IBN A;  4WE1 A;  4AHR A;  3K5L A;  4B9U A;  1CXQ A;  2VWK A;  4FJH A;  4DSF A;  4QCL A;  1VSD A;  3DLB A;  3HP9 A;  1S5J A;  3LAN A;  3HO1 A;  4O44 A;  3ISN C;  1HYZ A;  3WNG A;  4CEO A;  4CIE A;  4CHQ A;  3G10 A;  3HP6 A;  4E7I A;  4CJ3 A;  4PUO A;  3NF9 A;  3RRH A;  4DSK A;  3AO2 A;  3TAG A;  2KFZ A;  3VQ8 A;  4BWM A;  1BIU A;  3M8P A;  4YNQ A;  1J54 A;  3A2F A;  3QES A;  1EKE A;  1C0T A;  1RBS A;  2B4J A;  2VG7 A;  1RCH A;  4DS5 A;  1NKB A;  4NYF A;  2G8H A;  4CJT A;  4DTS A;  3TAF A;  3ZSO A;  3IS9 A;  1NJZ A;  2F8T A;  1XC9 A;  1T05 A;  4E1N A;  4KHN A;  4DLE A;  4Y1C A;  2D0B A;  4FLZ A;  3PO4 A;  3ZT2 A;  1LWC A;  1XHZ A;  5K14 A;  1L3U A;  1NJW A;  3L2U A;  4JS4 A;  1WN7 A;  1EP4 A;  3HYF A;  3DLG A;  3HM9 A;  1ZBU A;  4E19 A;  4FLW A;  5CYQ A;  3RTV A;  3WNE A;  3QNN A;  1ZBL A;  3LAL A;  1LAV A;  4CJL A;  4DQI A;  3LP1 A;  2VG6 A;  4NCG A;  4Y1D A;  5KGW A;  1X9M A;  4KHW A;  3NCI A;  1MU2 A;  4KKO A;  3VQ7 A;  2VG5 A;  1Q9Y A;  2LSN A;  4CJP A;  2HNY A;  3OJU A;  2YNG A;  2DFE A;  1TK5 A;  3M8S A;  1RT5 A;  2YNH A;  1S1V A;  4FJ7 A;  4CHO A;  3NH2 A;  1S1U A;  5FRM A;  4CEZ A;  1JXB A;  3L2W A;  4DSJ A;  4KB1 A;  1ZBI A;  2E6M A;  3SV4 A;  3AO5 A;  1B92 A;  4RG8 A;  1KTQ A;  1Z26 A;  4I9L A;  3SUQ A;  3NDK A;  2OPQ A;  1HJR A;  1KVC A;  3JYT A;  1T7P A;  1JLA A;  3DRS A;  3H08 A;  4CJU A;  3DRR A;  1FK9 A;  4O4G A;  3SYZ A;  1IKW A;  3O4Q A;  1GOA A;  1KSP A;  3K59 A;  3ITH A;  4MFB A;  4CEE A;  4JLH A;  4FJG A;  4OLA A;  2HHX A;  3OYF A;  3AVN A;  2JLE A;  3HVT A;  4H4O A;  5I3U A;  1FXX A;  1TV6 A;  3NH1 A;  4FK4 A;  4FJX A;  1ITG A;  1BI4 A;  4IFV A;  4HHT A;  1BHL A;  1CZB A;  2YNF A;  4ELT A;  3DM2 A;  4FJ9 A;  4RW4 A;  4Z0U A;  4I7F A;  2HND A;  4M3R A;  3AO4 A;  4OGE A;  3AV9 A;  4LH5 A;  1QE1 A;  1A5V A;  1HMV A;  2YHB A;  3NF7 A;  3T19 A;  3SJJ A;  1SV5 A;  3O3F A;  1LV5 A;  2YV0 X;  3I8D A;  1C0U A;  4FCY A;  3QEI A;  4M3Y A;  1QSY A;  3L3V A;  4O55 A;  3OVN A;  3OY9 A;  3AVL A;  4XIU A;  4DTJ A;  1R0A A;  1UA0 A;  5E41 A;  4BDZ A;  4B9N A;  4QAG A;  4N41 A;  4GVM A;  1RTD A;  3AVA A;  3RMD A;  2G8F A;  2E6L A;  1KCF A;  3KIO A;  2Z1H A;  1HRH A;  3KKR A;  3VQ9 A;  2XY6 A;  4EZ9 A;  3RR8 A;  4BDY A;  2HHQ A;  1GOC A;  3NE6 A;  4NYN A;  1W0H A;  3FFI A;  2HHS A;  1CZ9 A;  4BE2 A;  4DU4 A;  1TAQ A;  2IDO A;  1QQC A;  4CGD A;  3NAE A;  2PYJ A;  1TGO A;  2IGI A;  3RWU A;  4AHS A;  4B8C A;  1NOY A;  4JRQ A;  4N47 A;  4CGJ A;  1FKO A;  3TAM A;  5J2M A;  3EY1 A;  4DTP A;  3G0Z A;  1VSI A;  4CJQ A;  3NGZ A;  4JS5 A;  4DTX A;  3TAR A;  3THV A;  1QSL A;  2XY8 A;  3T1A A;  4KTW A;  5C25 A;  3SV3 A;  1LAW A;  1Z25 A;  2FC0 A;  4DSE A;  3P1G A;  1L3S A;  1QHT A;  2GV9 A;  2E4L A;  1TVR A;  1HQE A;  3DYA A;  3QIP A;  4CEF A;  1WSF A;  4CJ5 A;  1X9W A;  2OZM A;  2KZM A;  1UWB A;  2XO7 A;  1EX4 A;  1REV A;  1RT7 A;  3CFP A;  3QLH A;  3T3F A;  1SL2 A;  4PWD A;  3WNH A;  4DQR A;  4CHZ A;  3C6T A;  1RIL A;  4GW6 A;  1CXU A;  5T7B A;  1SL1 A;  4CE9 A;  3KLE A;  4E7K A;  3KD1 E;  1IKX A;  1WSG A;  1KVB A;  3SUP A;  4M41 A;  3QEV A;  5CY4 A;  3F73 A;  2HB5 A;  3K5O A;  4OKE A;  1WLJ A;  4I2P A;  5HBM A;  3VQP A;  4DMN A;  3HPG A;  1U48 A;  3AVH A;  4PQU A;  2HHU A;  1LW0 A;  3HK2 A;  2WOM A;  4RW6 A;  3SUO A;  1A5W A;  4CHY A;  1YTU A;  3RMC A;  3V1R A;  2F8S A;  4FXD A;  1ZBF A;  3PX0 A;  2X6N A;  2ATQ A;  2O4G A;  1SKW A;  1NK0 A;  4DF8 A;  1DTT A;  3KD5 E;  5HRP A;  2PZS A;  4DFK A;  4E3S A;  2R7Y A;  4RW9 A;  1TK0 A;  3LAM A;  5HLF A;  2G8V A;  1UOC A;  3AA3 A;  4CGG A;  1RDA A;  4CF2 A;  1G15 A;  4C8L A;  1JLC A;  2QXF A;  4DSL A;  2GUI A;  3MAQ A;  4HUG A;  3CG7 A;  1WNS A;  3ZT0 A;  3TWH A;  3MEE A;  5HRS A;  4DQQ A;  1VSK A;  3VQD A;  5FDL A;  1QSS A;  3SPY A;  1D5A A;  4M3X A;  4IDK A;  1BCM A;  3LAK A;  4DS4 A;  4FJM A;  1L3V A;  4N56 A;  3OYD A;  1BIZ A;  4CER A;  3F9K A;  3AVM A;  4BWJ A;  4E1M A;  4E0D A;  1RBT A;  1LWF A;  1TKX A;  2HHV A;  4CGI A;  1BCO A;  2OZS A;  4CJK A;  4KTQ A;  5HRR A;  5HRN A;  1YTA A;  3AVJ A;  3PX6 A;  1WSE A;  1KRP A;  1VSF A;  2HNZ A;  2BDP A;  4FLV A;  3VN5 A;  4CJW A;  3PUF A;  3SI6 A;  1Q9X A;  4CGF A;  3RR7 A;  3L2Q A;  4CIF A;  3PO5 A;  2HVH A;  4HCC A;  3RMA A;  3NFA A;  3DLH A;  2OPR A;  3VQ5 A;  4FJL A;  3MED A;  3ZSV A;  2YKN A;  1VSH A;  3ZT3 A;  3TI0 A;  4BAC A;  4BDP A;  2DFF A;  4ZTF A;  3SQ4 A;  3C95 A;  3DLK A;  4DTU A;  4F2S A;  3OYM A;  3QEW A;  2G8W A;  4C8N A;  2P5O A;  2WON A;  1WSJ A;  4AHV A;  3TAE A;  1KLM A;  1BIS A;  3ZCM A;  3DMJ A;  4KV8 A;  3L3U A;  4FVM A;  4HTU A;  4M45 A;  2RN2 A;  5J2Q A;  1S6Q A;  2X78 A;  3HVR A;  4O5B A;  1J5O A;  4YFU A;  2G8I A;  1IKV A;  4CJR A;  3DI6 A;  4OKK A;  1NK9 A;  3ASM A;  1I39 A;  3VA3 A;  4DFP A;  3S3O A;  1KFS A;  1NOZ A;  2G8U A;  3LP0 A;  3DLE A;  3IG1 A;  3O4N A;  1W9H A;  4CJV A;  1TK8 A;  1UA1 A;  3DOL A;  2PY5 A;  3M8Q A;  2ITG A;  4J2B A;  5JS1 A;  3AA4 A;  3I0R A;  2AJQ A;  2FBT A;  1JLB A;  5JS2 A;  5J2P A;  1T8E A;  2GBZ A;  2P51 A;  4F2R A;  1JXE A;  1JLQ A;  3KLG A;  4DLG A;  3ZSX A;  4FJJ A;  3SQ0 A;  2IOC A;  3QO9 A;  4FK0 A;  1BI4 B;  4FJN A;  4CK1 A;  5DK5 A;  4B9L A;  1LWE A;  3V81 A;  4E7J A;  2YNI A;  4LSN A;  4CES A;  4ELU A;  1ZYQ A;  2DY4 A;  3M8R A;  2JGU A;  1TL1 A;  3VQ6 A;  3KKS A;  4CEQ A;  3RMB A;  4AHT A;  3KTQ A;  3HST B;  1HNI A;  3HPH A;  4CFB A;  1SKR A;  4FYD A;  1S9G A;  4W5N A;  4CGH A;  3AVB A;  1YT3 A;  2IC3 A;  2Z1G A;  4UQG A;  3OS2 A;  1J53 A;  2KTQ A;  3UIQ A;  1IH7 A;  5HP1 A;  3OYA A;  2RPI A;  1QTM A;  3TAB A;  5HRO A;  3EYZ A;  3LP3 A;  3CQ8 A;  3S9H A;  1NK8 A;  1SKS A;  4W5O A;  5KI6 A;  1ASV A;  4IG0 A;  1HPZ A;  2X74 A;  3E01 A;  1SUQ A;  3OYB A;  2ZQB A;  2VWJ A;  3ZT1 A;  3QEP A;  3SQ1 A;  1ASW A;  1JL2 A;  2DFH A;  2FBY A;  4DFM A;  3ZSY A;  3AVG A;  3NH0 A;  3O3H A;  4FZY A;  2BGG A;  3P83 D;  4ELV A;  4DTM A;  3ZSQ A;  3NF6 A;  1S1X A;  3CYM A;  3P5J A;  4E89 A;  4FLY A;  2Y1I A;  4QOZ B;  4CIG A;  1L5U A;  4DG1 A;  4KAZ A;  1FKP A;  4DTO A;  3KLI A;  3NF8 A;  4C8O A;  3K5N A;  3ZSR A;  3QNO A;  3QET A;  1X1P A;  3NGY A;  3U3Y A;  3S3M A;  3OYG A;  1TKZ A;  4KRF A;  4CK3 A;  3CM6 A;  2HHT A;  1JKH A;  1U49 A;  1Q8I A;  3SPZ A;  3O3G A;  1U4B A;  2OYQ A;  2P1J A;  4CFC A;  2EX3 A;  1JLE A;  4K8Z A;  4CJ4 A;  1C0M A;  5KRS A;  2DTU A;  1VRT A;  4DTR A;  4ICL A;  1A5X A;  3L2V A;  2XHB A;  5I42 A;  3V9W A;  4E7L A;  3BGR A;  4F3O A;  2HW3 A;  5EU7 A;  1S1W A;  3V9S A;  4Z4G A;  1RT4 A;  2KW4 A;  2HVI A;  2KFN A;  4BE0 A;  2IAJ A;  1NKE A;  1TAU A;  3WNF A;  1NKC A;  3LWL A;  3B6P A;  4JRP A;  1NJX A;  3BDP A;  4OJR A;  4ID1 A;  4MQ3 A;  1S9E A;  4AH9 A;  3VQE A;  1WSH A;  2RKI A;  1ASU A;  1D8Y A;  4FJ8 A;  4KHQ A;  1VSL A;  3JSM A;  1U47 A;  3MEG A;  3OYJ A;  4PY5 A;  3S3N A;  1KFD A;  1WSI A;  4EP5 A;  2FBX A;  1C6V A;  4CF0 A;  5J2N A;  1T03 A;  4Q0B A;  3V4I A;  2B5J A;  3VQA A;  1HNV A;  3QEX A;  3TAQ A;  1JLF A;  3C6U A;  3OYI A;  5KRT A;  3ZT4 A;  3SNN A;  4B9S A;  2W42 A;  1LW2 A;  4TSX A;  2QK9 A;  5SWM A;  3IRX A;  2O4I A;  4RW8 A;  3B6O A;  4GMJ B;  1DTQ A;  3TAN A;  5D3G A;  1WAJ A;  3LDS A;  3PX4 A;  4AHC A;  4J2E A;  2NUB A;  2OA8 A;  1Y97 A;  4IFY A;  4DWI A;  1B9F A;  5FRN A;  1RDC A;  1EET A;  4FK2 A;  2KQ2 A;  4H4M A;  4ZTJ A;  4CF1 A;  4R5P A;  4N5S A;  4FM0 A;  2P5G A;  1K6Y A;  3ZSZ A;  4ZHR A;  1RT6 A;  1HYV A;  4F4K A;  1IO2 A;  4Z4C A;  1U04 A;  1S1T A;  1XHX A;  3OYL A;  4EP4 A;  3V1O A;  3PY8 A;  1B9D A;  1L3T A;  3KJV A;  3CFR A;  1VRU A;  1C1C A;  3U3G A;  4W5R A;  1GOB A;  3CM5 A;  3I0S A;  3VQ4 A;  2ZE2 A;  1RTH A;  4LD0 A;  1VSE A;  4FJK A;  4DU3 A;  1XI1 A;  3QIN A;  4RW7 A;  1QS4 A;  3AVK A;  4PA1 A;  3NGI A;  1NK4 A;  4H8K A;  1RBR A;  4CED A;  4FLT A;  4C8K A;  1ZBH A;  4J2A A;  3AVI A;  3HJF A;  2B6A A;  1I3A A;  3KK3 A;  3L8B A;  3SUN A;  4FW2 A;  2I5J A;  4FM1 A;  4F8R A;  2KZZ A;  5KTQ A;  1SL0 A;  4EZ6 A;  4KFB A;  3HPO A;  3ALY A;  1EXQ A;  4CK2 A;  2FBV A;  3QIO A;  4CF9 A;  3KK1 A;  3TR8 A;  4FM2 A;  1BQM A;  3V9X A;  4OKJ A;  1BGX T;  2X6S A;  4FLU A;  2EHG A;  4AIL C;  1RBV A;  3ZSW A;  2OPS A;  2YKM A;  4NCA A;  1RTJ A;  1UAX A;  2YHA A;  4CEC A;  4Z4H A;  2HHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...