4CGIA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
154
structure length
150
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 53
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cgiA00
4CFAA 4KPYA 4I7FA 4CJ4A 2DTUA 4CF0A 4BE2A 1B9FA 3SV4A 4WE1A 4H4OA 3G0ZA 3ZSQA 3AA5X 2FBVA 3AVNA 4M45A 3UIQA 3LP2A 1FXXA 4HUEA 3SQ2A 3M8PA 5K14A 1XHXA 4OLBA 2G8KA 4FVMA 3BDPA 4CK3A 2NUBA 3PY8A 1NK0A 4OKKA 4CJTA 5J2QA 1EX4A 2W42A 2BANA 3OYFA 4KRFA 3MECA 4AHUA 4NCAA 1TAUA 1NJWA 1RT1A 1C1AA 4KB0A 1RILA 1WSHA 3OJSA 1L3TA 4I2PA 1QE1A 4Z0UA 3TWHA 2Q3SA 3CFRA 4FM0A 2YNFA 3VQPA 4DTJA 3QERA 4KHWA 2Z1HA 2F8SA 4RW7A 4B9UA 3BGRA 1CXUA 1RBSA 4OVLA 1NK4A 3NF6A 3KKSA 3P5JA 3K5NA 4CHZA 4FZYA 2IS3A 5CY4A 4B9MA 1ZBIA 3DRRA 3WNEA 4FM1A 2B5JA 2YNGA 4FZXC 4TSXA 1EKEA 1T8EA 2YNIA 3OYCA 5C24A 1HRHA 1TKDA 4CJQA 3NHGA 3E01A 1U48A 1SL0A 3D0PA 1QQCA 4CGDA 1NOZA 4CGIA 1ASWA 5KGXA 2D5RA 4O55A 4DTPA 4ZTJA 1RBTA 1U47A 3ZT0A 2KTQA 4Z4EA 3OS2A 2X74A 4DTRA 3K5LA 4M42A 2VG5A 2DY4A 3LP0A 1NJXA 5CZ2A 4O5BA 2YHBA 3IS9A 1JLBA 3OYHA 3JYTA 3SQ1A 4QOZB 3NBPA 1KCFA 1VSIA 3HVRA 4DQPA 3TI0A 1LWCA 2ITGA 3MAQA 1NKCA 4DSIA 2VWJA 4CHYA 1BHLA 1S1WA 4MQ3A 1YVUA 3NGZA 2XY5A 4FJ7A 3RTVA 4DU1A 3L2UA 1VSDA 3VQ6A 4HCCA 5J1EA 3ISNC 4FLZA 3HP6A 3V9UA 4JRPA 3V1QA 4O44A 3QESA 1SKWA 4N47A 2IAJA 1CZBA 2VG6A 2KW4A 4KHSA 4DTUA 3QLHA 3C6UA 3ZT3A 4B9LA 4CJLA 2HB5A 3KK1A 4DQQA 2I5JA 1WAFA 4C8MA 1ZYQA 1HQEA 2HHTA 3RRHA 1TAQA 2YHAA 2IDOA 4M3WA 4FJ8A 3TAMA 4NYFA 4AHTA 5KRTA 4FJMA 3HL8A 2HNZA 3AO4A 4B8CA 1NOYA 5SWMA 1VSKA 1C1CA 4W5QA 1S9EA 3AA2A 3I8DA 4M3ZA 4DSLA 3DOLA 4E89A 1T03A 2G8WA 4OPKA 3KLEA 1A5XA 4JLHA 3WNFA 4R5PA 1JLGA 3MEGA 4W5TA 4E3SA 3AVHA 2PYLA 4DQIA 3VQCA 2IGIA 4DWIA 1X9SA 3OYEA 1QSLA 4C8KA 5J2PA 4IKFA 3NF8A 3SUPA 4CJPA 2ZE2A 3DLGA 4FJKA 2FBXA 4FLUA 3RWUA 4J2BA 4QCLA 3C95A 1VRTA 4E7HA 1C6VA 3U3GA 3AVBA 3HT3A 5HROA 1RT6A 3ZT2A 5E41A 2B4JA 2XRIA 4Y1DA 2G8FA 2YKNA 4I2QA 4DLGA 1L3UA 4OGCA 4CFCA 3KTQA 4ELVA 1DTQA 3CG7A 1YTAA 4Y1CA 1HYVA 4CFDA 4KO0A 1FKOA 2BE2A 4B9VA 4B08A 1FK9A 2X6SA 2KZZA 1S6PA 4KI6A 1YT3A 1BGXT 1S1TA 2JLEA 1S1UA 3V4IA 2D0CA 1SUQA 4KTWA 3ZT1A 4CEDA 1JLCA 1LWFA 4AILC 4FYDA 3T3FA 1RDDA 2PZSA 4PWDA 3WNGA 2KFNA 3T19A 4CJFA 1G15A 3LAMA 3PUFA 4ID5A 1NK7A 4KHNA 1WAJA 1WNSA 3OYDA 1RBUA 4EP5A 1KVAA 3KLGA 5FRMA 1HYZA 2RN2A 4E1NA 4O0IA 1VRUA 3CQ8A 4PQUA 1HMVA 2XY8A 4LD0A 3VQ4A 3P1GA 4DQRA 2Y1JA 1D9DA 4Q5VA 1C0UA 4DSEA 4RG8A 5J2NA 4FJ5A 2OYQA 2GUIA 1RT5A 1RBRA 1VSJA 3MEDA 3NCIA 4NCGA 5C25A 4IFVA 3TR8A 1Z26A 1TVRA 1XC9A 3MXJA 1HNIA 1KVCA 1L5UA 2EHGA 3CYMA 4HCBA 4NCBA 3ZSXA 1X1PA 1NKBA 1S1VA 4H8KA 1S9GA 1WSEA 3P83D 3KD1E 3B6PA 4C8LA 4DF8A 1Q9XA 1KSPA 2P51A 1EXQA 2DFFA 3LPTA 1WN7A 1C0TA 4YFUA 3L8BA 4DFMA 2O4IA 3O4NA 2FBTA 4IG0A 3ZSWA 1GOCA 4AHSA 3RR7A 2P1JA 2ZD1A 2HNYA 4DFPA 4FJGA 3OS1A 2X6NA 4JRQA 5HRRA 3DLKA 3HVTA 4DMNA 3ZSRA 5KI6A 1NK8A 2HNDA 2IOCA 2YV0X 2G8UA 1ZBHA 3V1OA 3V81A 4J2AA 1J9AA 4ZTFA 1I39A 3OYJA 1IO2A 4CHPA 4Z4FA 3DOKA 5FDLA 4CERA 4CJ5A 2O4GA 3EY1A 2R7YA 3SPZA 4KHQA 4N56A 3IAYA 5DMRA 3QEWA 1RDCA 2YKMA 3IG1A 2HMIA 4FJJA 4I9QA 4MFBA 1UA1A 2G8VA 2OPPA 3LANA 1BI4B 3LP1A 1ZBLA 2Z1IA 1IKWA 1RBVA 4M41A 3SQ4A 4J2EA 3F73A 3AO3A 3AVIA 4CEQA 3PX4A 3MXIA 1UA0A 4KAZA 2OPRA 4OPJA 4KFBA 1KVBA 4BACA 4C8OA 4BWMA 1CLQA 3VQ8A 1C1BA 2LSNA 5KTQA 1BQMA 4XIUA 4KTZA 2XY6A 4FXDA 3PO5A 1RDBA 2ZQBA 1SV5A 4CEBA 1XHZA 3QIPA 2HHWA 3OY9A 3SNNA 3OS0A 3PX6A 4AHVA 1T7PA 1QS4A 1VSHA 4RW8A 3ASMA 4B8AB 4RW9A 1BCOA 4E7LA 3HK2A 3RRGA 1VSLA 2WONA 3A2FA 3AVGA 4CF9A 4FJHA 2RPIA 4E7KA 1TGOA 3AVKA 4M3TA 2HW3A 4G1QA 4KHYA 1U4BA 3KKRA 5EU7A 3DM2A 2FC0A 3VQBA 3QNOA 1X9WA 5JS1A 3VQ9A 3SCXA 2IC3A 2WOMA 3NFAA 5HRNA 1Q9YA 5SZTA 3NE6A 4FW2A 4GW6A 4DU4A 4N76A 1RTHA 4ELUA 4LSLA 4QAGA 3ZSVA 4KHUA 2Y1IA 2G8HA 2OZSA 3K59A 1GOBA 3S3OA 1WSJA 4BWJA 4PA1A 1JLAA 2VWKA 3THVA 1LAWA 4CIEA 3V9WA 3KD5E 4K8ZA 4PUOA 3B6OA 5JS2A 3L2RA 3LWMA 2OA8A 1VSFA 3WNHA 1RTDA 3S3NA 2F8TA 4KB1A 3NF9A 3V1RA 1UOCA 4DQSA 4IG3A 3S9HA 2G8IA 4FJIA 3NGYA 3NH2A 3OYMA 5CZ1A 4CEAA 4FK2A 3DI6A 1REVA 3ALYA 2VG7A 5HRPA 4CFBA 4BDPA 1IH7A 4DSFA 4AH9A 3DLHA 2D0BA 1QTMA 4N41A 1RT2A 2OPSA 4Q0BA 1XWLA 1TL3A 2QKBA 3OYGA 3AVMA 5J2MA 3U3YA 1JKHA 4DG1A 4HHTA 4FM2A 4DFKA 2JGUA 3LPUA 1QHTA 1NJZA 1WSIA 4LY7A 4JS5A 1CZ9A 3V9ZA 2X78A 2RKIA 3SUOA 3TANA 3SYZA 4RW4A 3TAFA 1RT3A 1NK6A 3I0RA 3MEEA 1B92A 4DLEA 4JS4A 4DS4A 1NJYA 4W5RA 1B9DA 5CYQA 1J53A 4EZ9A 3QO9A 3AVFA 3KJVA 5HBMA 1KLNA 3KIOA 5C42A 1D9FA 1VK0A 2F96A 3SI6A 2BDPA 1HQUA 3NH1A 1QSYA 3CFPA 1W0HA 3AO5A 1EETA 5I42A 1GOAA 1EP4A 3LZJA 3DLRA 4CCHA 1LWEA 2KZMA 1HYSA 1TKZA 5HP1A 4I9LA 2HHQA 3C94A 4ICLA 1HPZA 1W9HA 3KK3A 4FK0A 3V6DA 3RR8A 3KLIA 4CK1A 4F4KA 1ZBUA 1MU2A 3V9SA 3AA4A 3K58A 3HP9A 1RTIA 1HNVA 4O0JA 4CIFA 3OYIA 1SKSA 1JXEA 2XHBA 4M3YA 1BL3A 4N5SA 1TK0A 3O3HA 3QEIA 3QNNA 2HHUA 2Z1GA 3SUQA 4HVJA 3PV8A 1N6QA 3TABA 4NYNA 4DFJA 4BDZA 1X9MA 1JL1A 3ZT4A 3VQQA 3PX0A 1IKYA 4FZZA 4OLAA 1BIZA 2XO7A 1U45A 1TK5A 2HHXA 4DTXA 3VN5A 4CGGA 1RCHA 2E6LA 5DK5A 4CF8A 3NAEA 4W5OA 2KFZA 2QKKA 3LZIA 4CEZA 1SL2A 3PO4A 4CF1A 3OJUA 1RT7A 3AVLA 4DF4A 5KGWA 4DTMA 2HHSA 4CIGA 4LH4A 3NDKA 3DRSA 4K8XA 1Q8IA 4HUFA 1DTTA 4L8RB 3HPGA 3HSTB 2A1SA 3AVCA 4DU3A 4E19A 1RNHA 1T05A 3ZSYA 3LAKA 2GBZA 4E1MA 4CEOA 4HUGA 4F8RA 1TKTA 3OVNA 4LH5A 2AJQA 4KREA 3VQ5A 4F2RA 1HJRA 3C6TA 4CJ3A 3JSMA 3M8QA 4CK2A 3SQ0A 3QEVA 1R0AA 4ELTA 2D0AA 3F9KA 5CYMA 1I3AA 1ZBFA 3QIOA 1IKVA 2KQ2A 3QINA 4BE1A 4GVMA 3L2QA 1K6YA 3ZSZA 3VQDA 4LSNA 2Z1JA 3KLFA 1D8YA 4F3TA 1S6QA 3G10A 3RMCA 4BE0A 1ASVA 1RTJA 2OZMA 3MXMA 4W5NA 3L2VA 1IKXA 1S1XA 3CM6A 3KK2A 1KFDA 3H08A 3NF7A 1QSSA 3VQEA 1UWBA 3QEPA 3D45A 3U6FA 4PY5A 3AO1A 1CXQA 3VQAA 3QETA 4HTUA 3O4QA 3LDSA 1BIUA 4CJWA 4EP4A 3O3GA 3M8SA 5FRNA 3EZ5A 1YTUA 3VQ7A 3K57A 3OYAA 3VA0A 1Y97A 4CJVA 2HHVA 2BGGA 3RMAA 2E4LA 4FLWA 1JLFA 3KLHA 3SUNA 5D3GA 4B3OA 1WLJA 3TAEA 3CFOA 4IDKA 3HXMA 4CJRA 3OYKA 3HM9A 4M3UA 1A5WA 4M3RA 4F3OA 1BCMA 2DFHA 2DFEA 4KKOA 3ITHA 2E6MA 1VSEA 5KRSA 3DLBA 4B9SA 4CJSA 4AHCA 2ATQA 3EYZA 3NGIA 4RW6A 1NKEA 3AVAA 2EX3A 4B9NA 4UQGA 3RMDA 4AHRA 1J5OA 3I0SA 1N5YA 2QK9A 1LW2A 1TK8A 2OPQA 1U49A 4CHQA 1WSGA 3SZ2A 1UAXA 2B6AA 4OJRA 1C0MA 2P5GA 1IG9A 3V9XA 4KTQA 3LP3A 3IRXA 1LAVA 2XY7A 1RDAA 4BDYA 3SJJA 3LWLA 4OKJA 4CGHA 4FJXA 4FK4A 4DTOA 4FLVA 3SPYA 3QEXA 4B9TA 3ZCMA 1S5JA 4FLYA 1JL2A 1BI4A 1RT4A 4IBNA 3K5OA 1VSMA 3M8RA 1NK5A 3TARA 4CJUA 2PYJA 3RMBA 4F2SA 5T7BA 3T1AA 3TAQA 4E7JA 1KLMA 3DLEA 4FJLA 5I3UA 1L3SA 4CECA 4CF2A 1TL1A 1L3VA 1O1WA 3HPHA 4DTSA 1SKRA 4M3XA 1LV5A 4CESA 3AVJA 4KI4A 1A5VA 1D5AA 4FJ9A 3HO1A 4CE9A 2GV9A 4Z4HA 4FLTA 4ZHRA 3O3FA 3LALA 1J54A 1BQNA 3DYAA 3DMJA 4O4GA 1JLEA 3S3MA 1BISA 4Z4GA 3ULDA 1XI1A 3L3UA 5HRSA 3FFIA 4DSJA 3AA3A 4CJEA 1JXBA 3AO2A 3DRPA 4YNQA 4CGFA 2A1RA 3HYFA 3CM5A 4J2DA 1KRPA 4CEFA 4FJNA 4KV8A 3NH0A 3OYBA 4GMJB 1DLOA 1FKPA 4CEEA 4CGJA 4ID1A 4FCYA 1KFSA 1U04A 4E0DA 4OKEA 3L2WA 4C8NA 3OYNA 2QXFA 3K5MA 4E7IA 1TKXA 3ZSOA 5HLFA 3L3VA 2RF2A 2FBYA 3HPOA 4IFYA 3HJFA 4Z4CA 1SL1A 1ITGA 1JLQA 1TV6A 3OYLA 4DS5A 2YNHA 2P5OA 4CHOA 1WSFA 4H4MA 4CJKA 2ETJA 3K2PA 4OGEA 4Z4IA 4FLXA 3TAPA 3TAGA 1KTQA 4DSKA 1NK9A 1LW0A 4CHNA 2HVHA 4DTNA 3VA3A 1ASUA 1Z25A 2PY5A 2HVIA 5FROA 1F21A 4EZ6A 3AV9A 3SV3A 4FW1A
chains in the Genus database with same CATH superfamily
3LDOA 5B8HA 4CF0A 3AAQA 3CJAA 3AVNA 3UIQA 4BR4A 5FPEA 4LF8K 4NXNK 2QWOA 1VHXA 4CK3A 3KK7A 4IJNA 5AQMA 2YI1A 4BRLA 3OYFA 3AAPA 4BQZA 1Q82O 4KB0A 4FM0A 3ZEUA 5AQFA 2QW9A 4KHWA 3A5MC 5DM7L 1CXUA 2E5LK 2D0OA 3KVGA 1ZBIA 2HMPA 2W6KA 2YNIA 5C24A 1TKDA 3CPWM 4GKKK 3NHGA 4AM6A 4WQ5A 5KGXA 4W5NA 1ASWA 2KTQA 4LF9K 3OS2A 3ZX2A 3HRGA 3K5LA 2ASPA 2DY4A 1LOTB 1NLVA 3IS9A 1JLBA 3NBPA 4MDAA 3MAQA 4F9OA 1BHLA 1S1WA 2VCPA 2E2PA 5JLHA 1VSDA 4AF1A 3VESA 3BP8A 5J1EA 4FLZA 1IBLK 3VEXA 3CCLN 2HF3A 2KW4A 4DTUA 2WC9A 3KK1A 2HB5A 2V52B 2I5JA 1WAFA 1ZYQA 1X3NA 2HHTA 2YHAA 4AHTA 4FJMA 3AO4A 3SBTA 1NOYA 3CJ1A 5LL6Z 4BR5A 2KHOA 2ZJQL 4R5PA 3WQTA 4H0TB 1HNZK 4DWIA 4B3MK 2AP1A 2ITMA 3E9PA 3NMUA 4CJPA 3C6HA 4QS7A 3DLGA 2E2NA 1QQNA 4A5BA 4FJKA 3EO3A 3D2EA 3RWUA 1DKGD 2PFUA 1VRTA 5C12A 3AVBA 3HT3A 3ZT2A 5E41A 2B4JA 1VQ5N 3TSPA 4JYAK 2YKNA 1NM1A 2CGKA 2UXDK 1YVNA 4I6MA 1FKOA 2BE2A 4B08A 1RGIA 1FK9A 1S6PA 4JHDA 1S1UA 1SUQA 4KTWA 4ILHA 2VGMA 3T19A 4U67L 4CJFA 4KHNA 2O8EB 4BC2A 1T6CA 2P9LB 1RBUA 3LDLA 4EP5A 5I9EB 4O0IA 4PQUA 1HMVA 3VQ4A 1C0GA 1Q86O 1C0UA 3ZX3A 2OYQA 2GUIA 1RT5A 4X64K 5C25A 4IFVA 3TR8A 3VEZA 1TVRA 2QI2A 3MXJA 4CJ7A 1XC9A 3J7AP 2HBJA 3O4WA 4B1WB 3C0BA 3P83D 3QDKA 3VF4A 3KD1E 4C8LA 1NBWA 2P51A 2P9NB 5FPDA 1ESVA 1WN7A 3THWA 3RR7A 4AHSA 4BGAA 4FJGA 4DFPA 3VERA 2X6NA 4JRQA 5HRRA 4DMNA 1EWQA 3ZSRA 5FPNA 3VF2A 4J2AA 4JKGB 4FOIA 4EFHA 4CHPA 3ULEB 5FDLA 2O4GA 3RSEA 3SPZA 3IAYA 5DMRA 4IJAA 1YF5L 1RDCA 2E20A 1X3MA 2HMIA 1UA1A 1BI4B 1NGCA 3LP1A 1ZBLA 1W2BM 4YOVA 1IKWA 1RBVA 1K8KA 3AVIA 4KAZA 1M90O 4OPJA 4BACA 1CLQA 4C8OA 4BWMA 2LSNA 4XIUA 2V7ZA 2ZQBA 4FL9A 1SV5A 4NB4A 3PO5A 3OS0A 4CBXA 1QS4A 3D2FA 2UUBK 4RW9A 4E7LA 4BQLA 4DHYA 4CBUA 2V7YA 1GLCG 4YORA 4FJHA 4B1VA 3K9JA 1X9WA 4JAXA 2WOMA 5HRNA 4N76A 2PBDA 4Y0WA 2Y1IA 2G8HA 1U6ZA 5BR9A 3S3OA 3IMXA 3CCMN 4BWJA 3VGMA 2VWKA 1LAWA 4CIEA 1OVYA 4JI4K 5JS2A 3L2RA 1XQSC 1IBKK 2QTDA 1TYQA 2F8TA 3S3NA 1OVQA 1UOCA 3E1YA 5BPNA 3NH2A 3OYMA 4DV0K 2VG7A 1IH7A 3HM8A 4BRIA 4AH9A 3QFPA 4DV7K 5TKYA 4DG1A 3GG4A 5M1FA 4B1XB 3SUOA 3TANA 4RW4A 1RT3A 3GBTA 4BVOA 1B92A 1ZC6A 3L6QA 4DLEA 1NJYA 5GAGP 4EZ9A 5D3GA 1HKBA 3QO9A 4BRNA 2F96A 4OPHA 2QWLA 2RHKA 1QSYA 3NH1A 2BDPA 1W0HA 3MDQA 4GNIA 1EETA 4CZGA 3HOTA 3DLRA 4CCHA 3BEXA 5HP1A 5GIOA 4IEIA 1HPZA 2IIRA 4B1YB 3KK3A 3V6DA 3RR8A 4CK1A 1GLBG 3AA4A 4XH1A 1HNVA 4H5VA 1SKSA 1JXEA 4M3YA 3K9KA 1BL3A 2J4RA 1SS6A 4WFAL 2NNWA 5AJ3K 1NGDA 4NYNA 4BDZA 3PX0A 1IKYA 3CCRN 4B9QA 1TK5A 2HHXA 3VN5A 3HBTA 2OTLN 4W5OA 3PO4A 1SL2A 3MCAB 1RT7A 4CIGA 1U2VB 3HPGA 3ZSYA 4E1MA 4HUGA 3TU5A 4JI5K 3C6TA 3JSMA 2UU9K 4ELTA 1YITN 2KQ2A 3QINA 4GVMA 3L2QA 1K6YA 3VQDA 1VAZA 2HF4A 3CERA 5EVZA 4F3TA 1ASVA 1RTJA 5AQUA 4MLEA 4BG8A 3VGLA 3CM6A 5IWAK 3L2VA 3DLLL 1M1KO 3H08A 1I94K 4A61A 2E2QA 3EE9A 3AO1A 4CJWA 5KPRA 3EZ5A 4RTFD 3VQ7A 3MK6A 3OYAA 1NNEA 3VA0A 2VWBA 3CCSN 4EHUA 1Q18A 3C7NA 3TTFA 4FLWA 1WLJA 3TAEA 2ZJPL 1DEJA 3HXMA 3OYKA 4FWSA 3ITHA 4FVUA 4AM7A 3DLBA 2YJEA 4YOTA 3BY5A 2EX3A 4IDHA 2W40A 4XH4A 4JKGA 1U49A 3H6EA 2BTFA 5CR4A 3Q7CA 3NVKA 2OTJN 1BG3A 1GLDG 2XY7A 2AA4A 3OTOK 4CGHA 4FJXA 3SPYA 3ZETA 5KPTA 2NZTA 1BDGA 4FLYA 1BI4A 1NK5A 1VSMA 3M8RA 4CZFA 3A5LC 5C10A 3TARA 5T7BA 4DUZK 3DLEA 4DUYK 5MLCQ 1L3SA 4BRGA 4CF2A 1L3VA 4DTSA 4M3XA 3FZLA 5C2DA 3J8AA 4KI4A 4FJ9A 1D5AA 3HO1A 4V19S 4FLTA 3O3FA 3EZWA 3FZHA 1J54A 1BQNA 1JCEA 4JKHA 3DYAA 3DMJA 3JAMO 3ULDA 1XI1A 3FFIA 4DSJA 3AA3A 1JXBA 4YNQA 2A1RA 1KRPA 4IOXA 4FJNA 4KV8A 5ELZA 3NH0A 1N8RO 1FKPA 5F0XA 2GX9A 4ID1A 4OKEA 3K5MA 3SLCA 1TKXA 4JI3K 3C65A 1JLQA 2ZF5O 2YNHA 2P5OA 1WSFA 4LFAK 3MMVA 2VQEK 2QM1A 4BVPA 4OGEA 4FLXA 1KTQA 3VA3A 2JWKA 1ASUA 3SK3A 5FROA 1JCGA 2QWNA 4FOEA 3SV3A 4CFAA 4I7FA 4BE2A 4JI7K 4FWMA 4WE1A 4H0XB 4M45A 3AY9A 1T44A 2CGLA 4C1NI 4HUEA 3SQ2A 5K14A 2G8KA 3BDPA 3FR0A 2NUBA 4OKKA 5J2QA 2BANA 4ISFA 4AHUA 1TAUA 1C1AA 1WSHA 1QE1A 1VQKN 3RVCA 3VTIA 4JK7A 3QERA 3O8MA 4DR3K 4YOYA 2F8SA 5AR0A 4OVLA 3K5NA 5CY4A 5BREA 3DRRA 4MDBA 1EKEA 3CHWA 1BU6O 4OX9K 2NRTA 3KZBA 4A62A 4H03B 1QQCA 4KBOA 3QICA 4CGDA 4CGIA 4DTPA 2D5RA 1GLLO 4KH6A 5CZ2A 3ATUA 3SQ1A 5GADP 1LWCA 4DSIA 2VWJA 2XY5A 1U2VA 3L2UA 3I55N 4JKBA 4BREA 4G9ZA 3V9UA 5LJVA 3HP6A 4JRPA 2WBNA 4BG9A 3V1QA 4O44A 4DV3K 3E9OA 2IAJA 1CZBA 1S3XA 4B9LA 4BC4A 4DQQA 3A0IX 1TAQA 3BF3A 4JN4A 4B8CA 3I56N 4DB3A 1VSKA 1SZ2A 3S41A 1C1CA 4W5QA 1S9EA 3AA2A 5AQZA 4M3ZA 4DSLA 4BRHA 4E89A 1T03A 2HBKA 4OPKA 1A5XA 4E3SA 3QFUA 5AZJB 4JV5K 2O8CB 3OYEA 1QSLA 1YIJN 3SUPA 3W0LA 2ZE2A 1ILYA 4FLUA 4QCLA 4BC5A 4H5NA 2GWJA 2CH6A 1C6VA 5BN8A 4PL8A 5E26A 2XRIA 4FWNA 1GLAG 1L3UA 1T3VA 2OCEA 3KTQA 1YTAA 4GY2B 4WQ5C 4CFDA 3UKRA 3FGUA 1QHAA 1OH5A 2JLEA 3V4IA 3J7YP 1XNRK 2D0CA 3ZT1A 1JLCA 1LWFA 5AQRA 2PZSA 1E3MA 4PWDA 1Q7YO 2P9PB 1WAJA 1HYZA 4DQRA 4LD0A 2Y1JA 3P1GA 1D9DA 4Q5VA 4DSEA 1X9JA 4RG8A 5F2RA 1IV0A 1RBRA 1VSJA 2HSTA 2Q0UA 4CZKA 3VOVA 1KVCA 4RCHA 1L5UA 3CF5L 1Z6RA 3CYMA 4HCBA 4NCBA 4CW7B 1NKBA 2F9WA 1WSEA 5E84A 3O4NA 2FBTA 4IG0A 1NGJA 2HNYA 3R8EA 3KHYA 2G8UA 3V1OA 1J9AA 3OYJA 4Z4FA 4CJ5A 2R7YA 4KHQA 5AQLA 4LFCK 4A2AA 3IKMA 1VQLN 2G8VA 3LANA 2YJFA 1V4TA 3F73A 3AO3A 3DXKB 1W7AA 4BROA 1XNQK 2OPRA 3VQ8A 1C1BA 2XY6A 1RDBA 4CEBA 1XHZA 3QIPA 4XEIA 3O1WA 2HHWA 4MO4A 3PX6A 4AHVA 1T7PA 3A5OC 1VSHA 3ASMA 2WUSA 4B8AB 3RRGA 2WONA 3VPZA 4E7KA 4M3TA 5EU7A 3VQBA 2FC0A 4LF7K 1EO1A 4BRDA 3NFAA 1XMQK 5SZTA 4DU4A 4GW6A 1RTHA 3TSQA 3P31A 4LSLA 4QAGA 2A6AA 3WXLA 1YAGA 2PAVA 3U9DA 4K8ZA 3V9WA 1KXPA 2Q0RA 5KQ8A 3FLCO 4CBWA 5H1SQ 4KB1A 1QZ6A 4IG3A 4FJIA 2NRZA 2FLOA 4FK2A 1REVA 4YDUC 5HRPA 3P4IA 3DLHA 4N41A 4Q0BA 2OPSA 4OPAA 2QKBA 4HTLA 4EAHD 3HOSA 1XC3A 1KC8O 4IOCL 2JGUA 3LPUA 1WSIA 3OW2M 4Z94A 4W5RA 5CYQA 4EHTA 1KLNA 5HBMA 1D9FA 3KIOA 5C42A 5JMVA 3VEOA 1OH8A 3SI6A 1HQUA 3AARA 3T7ZA 1VQ7N 2Q36A 4JKFA 2KZMA 2YHWA 1TKZA 2FSJA 2Q1NA 4ICLA 1W9HA 3KLIA 1ZBUA 2NRHA 4IXCA 3IFRA 3G4SN 3OYIA 3SMPA 3SAGA 4JI1K 2GTDA 5BRFA 2GELA 3H1QA 1XUPO 1NGAA 1W97L 3SUQA 3VMFB 4DFJA 4NO7A 4OO1J 1JL1A 3CJ9A 3ZT4A 2O8DB 3ID6A 1BIZA 5M1NA 5AZJA 4DTXA 1JJ2M 1RCHA 5AZIB 5DK5A 3LZIA 4DF4A 3O6WA 4YDUA 4DTMA 4BRKA 3NDKA 4K8XA 3DAWA 4L8RB 1BUPA 3MN6A 3T1HK 3AVCA 1RNHA 1T05A 2GBZA 3N4PA 4FWRA 4F8RA 3THXB 4LH5A 2AJQA 5JVHL 3PIOL 3VQ5A 1HX1A 2D0AA 4M7XA 5CYMA 3QIOA 1TUYA 1HR0K 1KQSM 1VQPN 3KLFA 4WFBL 3G10A 3RMCA 4BE0A 2OZMA 1IKXA 1S1XA 2P9PA 3AGRA 4FWQA 1QSSA 3C6AA 3H46O 3D45A 4FWOA 3VQAA 3QETA 4HTUA 3LDSA 1BIUA 3M8SA 3O9SA 1YTUA 2CGJA 3MN9A 2HHVA 4CJVA 4BGBA 4YOXA 1JLFA 4B3OA 3CQYA 4WQ4C 2ASMA 4F3OA 1BCMA 2DFHA 4KKOA 5KRSA 2F9TA 4DKWA 4A59A 4CJSA 5BR8K 3H1VX 2IVOA 3T69A 3F9MA 3L0QA 1N33K 3I0SA 2HHHK 4PKIA 5DM6L 1UAXA 2NRVA 3PLAA 1IG9A 4O8UA 1LAVA 1RDAA 3R9PA 3LWLA 4CD1A 4GV3A 4LFBK 4FLVA 3ZCMA 3M3ZA 4H0PA 1S5JA 1SQKA 3K5OA 3DXKA 2NRXA 3TAQA 4DCHA 4LF5K 4FSVA 3I8BA 4FJLA 5I3UA 5BPMA 1TL1A 2IVNA 1O1WA 1SKRA 2A42A 1LV5A 2ZJRL 4IOAL 4CE9A 2GV9A 3N4QA 4Z4HA 2NRRA 3LALA 4H5WA 4Z4GA 4PL7A 4HWIA 5A2QO 3DRPA 3BUZB 1IG8A 1E4FT 3HYFA 3O5BA 4GMJB 3OBWA 1KFSA 4O8KA 3L2WA 1K8AO 3B8AX 3OYNA 3QBXA 2FXUA 4WQ4A 5HLFA 3L3VA 4U7BA 4Z4CA 1SL1A 3SAHA 1ITGA 1TV6A 3EKSA 1NGBA 4CHOA 4BRMA 1VQ4N 3WXJA 2F7TA 5M1QA 4NLBA 2PY5A 4EZ6A 3CPEA 3E9LA 4FW1A 2DTUA 3CC7N 3WEEB 4H4OA 3G0ZA 3AA5X 5AQQA 3HTVA 1N32K 5EY4A 4JKCA 4CZHA 3CJCA 4OLBA 4FVMA 1H1VA 3PY8A 4CJTA 1EX4A 5JICA 5GIPA 5AQIA 1BOTO 3TPQA 1NJWA 1RT1A 3U4LA 1P8ZA 1RILA 3OJSA 1L3TA 4I2PA 4DTJA 2Q3SA 4JKDA 5AQHA 2YNFA 3VQPA 3CCUN 3WUHA 2Z1HA 4B9UA 2O8EA 3EE8A 5AQKA 2P9LA 3W3DA 1NU0A 3NF6A 3KKSA 3P5JA 5AQVA 4CHZA 4FZYA 3G25A 2IS3A 2O8FB 4B9MA 4CZMA 4LC9B 2B5JA 2YNGA 4FZXC 3MN5A 4TSXA 1T8EA 4JI0K 4CJQA 1LCUA 5AQXA 3OBYA 1U48A 1NOZA 2BH1A 4ZTJA 1U47A 4O55A 3ZT0A 4Z4EA 3ENHA 3PIPL 4DTRA 2O8DA 1GLEG 4M42A 3LL3A 3LP0A 1NJXA 2YHBA 2P9NA 3DXMB 3MX2A 3LM9A 5AZIA 1KCFA 1VSIA 3HVRA 3TI0A 2ITGA 1NKCA 2UXCK 5AQPA 4FJ7A 3NGZA 1YVUA 3VQ6A 3CETA 4HCCA 3ISNC 3ULEA 3EN9A 1VQON 4H0OA 3CCJN 3QESA 4N47A 1SKWA 2O8BB 3C6UA 3ZT3A 3THXA 3RRHA 4M3WA 2IDOA 1YJ9N 4NYFA 3HL8A 3MCPA 3I8DA 3DWLA 2QWRA 5IT9O 3CCQN 3WNFA 1EWRA 4DQ8A 3MEGA 4W5TA 4DV6K 2DPNA 3AVHA 4C23A 2PYLA 4CI6A 2P9UB 4C8KA 5J2PA 4AQYK 1WUAA 1BA0A 1KAXA 2FBXA 4J2BA 2HBMA 1GLJO 4YOUA 3C95A 4E7HA 3U3GA 3EKUA 5GAHP 1YHQN 1RT6A 1YJWN 1FJGK 3FZMA 4DV4K 4JI6K 2G8FA 2VQFK 1KAZA 4CD3A 1IBMK 4ELVA 1DTQA 3CG7A 4Y1CA 4BR2A 1HYVA 4KO0A 1HJOA 3QB0A 3A8YA 2GWKA 3J80O 3PSIA 3O08A 4GV9A 4A5AA 4KI6A 1BGXT 1S1TA 5AQOA 4K43A 5LY3A 4AILC 4FYDA 3T3FA 1RDDA 3WNGA 1G15A 1NK7A 4K42A 3OYDA 1KVAA 5FRMA 2RN2A 3ATVA 5J2NA 4FJ5A 4NLCA 1ATSA 1WB9A 3MN7A 4BR9A 3NCIA 4NCGA 2W6LA 4H0YB 3VETA 3ZX0A 4H8KA 1S9GA 4DF8A 1KSPA 1EXQA 2DFFA 1JCFA 3WT0A 4WFNL 2O4IA 3ZSWA 2P1JA 2ZD1A 2NRWA 1ZBHA 5KI6A 2HNDA 2IOCA 2YV0X 1I39A 5M1PA 2WTUA 2A3ZA 5ADXA 4N56A 3J81O 4I9QA 2OPPA 2Z1IA 2E1ZA 4J2EA 3MXIA 4CEQA 1UA0A 2I7PA 3FZKA 3KWIA 4KFBA 1KVBA 4JEPA 3FFKB 4EIAA 1BQMA 4KTZA 4FXDA 4C1NK 3OY9A 3SNNA 4MLHA 3CD6N 2F4VK 1BCOA 1VSLA 1BA1A 3D2EB 2RPIA 3MWTA 1TGOA 2HW3A 2D0PA 2GEMA 1U4BA 3QNOA 5JS1A 3VQ9A 3M1FA 1Q9YA 3NE6A 4FW2A 3CMAN 4YY3K 3ZSVA 1GLFO 4XH5A 4I6MB 2OZSA 3K59A 4FPAA 4JNEA 3KD5E 4JHDB 3B6OA 3LWMA 5BN9A 3FZFA 5AQNA 3V1RA 4H5RA 4DQSA 2G8IA 1VQNN 3NGYA 4B1ZA 5CZ1A 4CEAA 3DI6A 3ALYA 2O8FA 4CFBA 4BDPA 4DSFA 2D0BA 1TL3A 3OYGA 3U3YA 1JKHA 2HBLA 3QBWA 4HHTA 1QHTA 1NJZA 5LJWA 4LY7A 1VQ9N 3ZLJA 1NMDA 4KH4A 4JS5A 1CZ9A 3V9ZA 2RKIA 2W41A 3TAFA 1NK6A 3I0RA 3MEEA 4A57A 1K73O 3DXMA 4DS4A 3THWB 3AVFA 3KJVA 4BRFA 3GE1A 5AQSA 3CFPA 4GKJK 1EP4A 4DR4K 4I9LA 2UUCK 3C94A 5M1KA 3RSEB 1MU2A 3V9SA 2GUPA 1Q81O 3HP9A 4CIFA 3CJ7A 2XHBA 4DV2K 4DR5K 1NG9A 3UKUB 3PV8A 3GL1A 1N6QA 1X9MA 4M63C 3LM2A 3P39A 1NGEA 3D2FB 1NJIO 3NAEA 4PKGA 3IUCA 3CI5A 3D7EO 3OJUA 3CC4N 2HHSA 4LH4A 1OH7A 3DRSA 1Q8IA 4HUFA 1DTTA 3HSCA 3HSTB 2A1SA 4DU3A 2V51B 4E19A 4LF4K 3LAKA 5CHIA 4CEOA 4DR7K 4IEEA 1TKTA 4KREA 2Q97A 3GDQA 4H0VB 3M8QA 4CK2A 3SQ0A 3F9KA 1I3AA 1IKVA 4BE1A 5BRDA 3ZSZA 1TYQB 1VQMN 1S6QA 4YHHK 5AQYA 3HI0A 3KK2A 3DJCA 1UWBA 4BR0A 1CXQA 4ISEA 4NXMK 5BPLA 3O4QA 1HLUA 3IDHA 4EP4A 5FRNA 2BUPA 2E4LA 3KLHA 3SUNA 1NGHA 4H5TA 4M3UA 1A5WA 4K41A 2I7NA 1YUWA 4AHCA 2ATQA 4MO5A 3NGIA 4RW6A 4QS8A 1NKEA 3H3NO 1J5OA 2FSNA 4BRCA 1TK8A 2OPQA 1V4SA 4ILGB 2P5GA 4KTQA 3IRXA 5AFUH 3LDQA 3F2KA 4DTOA 3SJHA 3QEXA 4B9TA 2P9IB 5AQTA 1RT4A 4IBNA 1QZ5A 3I33A 2PYJA 4CJUA 3RMBA 1HKCA 4E7JA 1KLMA 1HNWK 3HPHA 3TSUA 4CESA 3AVJA 1NGFA 1A5VA 4M7YA 5EXWA 3MWPA 4O4GA 1JLEA 3S3MA 3O9RA 5HRSA 5JVGL 1KD1O 3AO2A 4CGFA 2FSKA 3BF1A 4J2DA 1SAZA 4CEFA 3OYBA 4X62K 4E0DA 4QS9A 5GAEP 4C8NA 3VEVA 3M6GA 2QXFA 4E7IA 3VGKA 2QWMA 3HPOA 3HJFA 2FBYA 4IO8A 4JKAA 3OYLA 1BWFO 4CJKA 5FPMA 3CCVN 3K2PA 4Z4IA 4PHTX 4ILJA 4BRQA 3TAPA 2O8CA 4DSKA 4GV6A 1NK9A 1LW0A 4CHNA 4DTNA 3O9QA 3H3OB 2QXLA 2HVIA 1MWMA 3AV9A 1QVFM 1MWKA 2OANA 4KPYA 2A41A 4CJ4A 1B9FA 3SV4A 4X66K 3C7NB 3ZSQA 2P9SB 2FBVA 3CQXA 3LP2A 1FXXA 3M8PA 1ATRA 1XHXA 3KWGA 4KH5A 3VF6A 1NK0A 2W42A 4X65K 4KRFA 3MECA 4NCAA 3TWHA 4Z0UA 4YOWA 3CFRA 5GINA 3D6RA 5CE3A 4JK8A 4RW7A 3O80A 3BGRA 4ISGA 1RBSA 2YHYA 2YHXA 1NK4A 1YXQA 1EQYA 2QWQA 4BY9C 3UE5A 4FM1A 3WNEA 1ZXOA 3ZETB 3U8XA 3ENOA 3OYCA 1HRHA 4GVEA 2NLXA 3E01A 3UKUA 1KAYA 1SL0A 3D0PA 1RBTA 3L4IA 4BRPA 2X74A 2VG5A 5M1OA 4O5BA 3JYTA 1J5EK 3OYHA 4QOZB 2VYPA 1VQ8N 3AGKA 4DQPA 4JKEA 2E1YA 3Q7BA 4CHYA 4MQ3A 2UXBK 5EOYA 3RTVA 4DU1A 1K9MO 1NGGA 2VG6A 4KHSA 3QLHA 2BGGA 2A40A 4CJLA 3L4QA 4C8MA 1NMNA 1HQEA 4FJ8A 3TAMA 5KRTA 1HNXK 2HNZA 5LMNK 4DV5K 3CC2N 5SWMA 3PSFA 1TUUA 3DOLA 2G8WA 1OKJA 3KLEA 4JLHA 4DQIA 1JLGA 4BRAA 3VQCA 2IGIA 1X9SA 4WF9L 1FW6A 4IKFA 2FF3B 3NF8A 4BR7A 1WOQA 2QWPA 5AQJA 3T1YK 5HROA 4FWPA 1S72N 4IFEA 4Y1DA 1QQOA 3K0SA 4I2QA 4DLGA 4OGCA 4CFCA 1N36K 3OA9A 1XMOK 5AFUA 1E4GT 4B9VA 2X6SA 1O13A 2ASOA 1ZBSA 2KZZA 1YT3A 4IWVA 2QEXN 4CEDA 5ADXH 2KFNA 1R59O 3LAMA 2ZGYA 3PUFA 4ID5A 1WNSA 1VQ6N 3KLGA 3CQ8A 4E1NA 1VRUA 3FE1A 2XY8A 3VENA 1QQMA 2IVPA 1ATNA 2P9IA 3MEDA 1N34K 1Z26A 1HNIA 2EHGA 3ZSXA 1X1PA 3BZKA 1S1VA 3VEWA 3B6PA 3G6EN 1Q9XA 4CVNE 3LPTA 4YFUA 1C0TA 3L8BA 4DFMA 3H45C 5AQWA 1RDUA 1GOCA 3OS1A 4IO9L 2QA4N 1S22A 3DLKA 3HVTA 5F1XA 1NK8A 2KKZA 3V81A 4ZTFA 4B3SK 3ENBA 1IO2A 4FPBA 3DOKA 4CERA 3EY1A 1Z05A 4R79A 3SAFA 1T6DA 3QEWA 3ID8A 3R3LA 2UUAK 4B1UB 2YKMA 1P90A 3IG1A 4FJJA 1HPMA 4MFBA 3OHRA 4M41A 3SQ4A 1HUXA 2KLAA 3PX4A 4E1JA 1WBDA 5KTQA 4FWKA 4JK9A 3G71N 2YCHA 4RW8A 4JD2B 1QVGM 2WFBA 3A2FA 4J8FA 3AVGA 4CF9A 3AVKA 2H3GX 4G1QA 4KHYA 3KKRA 2ZGZA 3O9TA 2ZWHA 3DM2A 2P9SA 3SCXA 2IC3A 3WXMB 4O5FA 4K0KK 3THYB 4ELUA 4KHUA 5BRHA 5HL7L 3UKRB 2HOEA 3TTDA 1GOBA 2VGNA 2JWLA 1WSJA 4FO0A 4PA1A 1JLAA 2P9KB 4CZIA 2ZM6K 3THVA 4PUOA 1HKGA 2OA8A 4UY8O 1DGKN 1VSFA 1Y64A 3VTHA 3WNHA 1RTDA 3QMLA 3NF9A 3S9HA 3CMEN 1J6ZA 3SBGA 4A2BA 4KHPK 2D1KA 3E66A 1QTMA 1RT2A 1XWLA 3HK2A 3AVMA 5J2MA 4FM2A 4DFKA 1MA9B 1YJNN 3ZYYX 1NGIA 2X78A 5EX5A 3SYZA 3GOIA 4CZEA 4CZJA 4JS4A 1B9DA 1J53A 1OH6A 1VK0A 2Q31A 3AO5A 5I42A 1GOAA 3LZJA 3ZEUB 1LWEA 3VEYA 1HYSA 2HHQA 4FK0A 4F4KA 3K58A 1DT9A 3BZCA 3CJBA 1RTIA 4O0JA 5LMUK 5AQGA 3EEQA 4N5SA 1TK0A 3O3HA 4K25A 3QEIA 3QNNA 2HHUA 3HZ6A 2Z1GA 4HVJA 3TABA 4IZ9A 3VQQA 4OLAA 3JS6A 2XO7A 1U45A 1YI2N 4CGGA 2E6LA 4CF8A 4RWTA 2QKKA 2KFZA 4CZLA 4CEZA 5KQDA 4CF1A 4L3QA 3AVLA 5KGWA 2E88A 5KPZA 3J7ZO 4WYBA 2UYTA 4BC3A 3SMSA 3OVNA 4F2RA 5HOOA 1HJRA 4CJ3A 3O9UA 3QEVA 1R0AA 2D4WA 1ZBFA 2Q2RA 4LSNA 2Z1JA 1D8YA 5TKWA 3MXMA 1KFDA 4WCEL 3NF7A 4LF6K 3VQEA 3QEPA 1RDWX 3M5RA 3U6FA 4PY5A 3O3GA 3JXUA 4JI8K 3K57A 1Y97A 2CH5A 3P38A 3RMAA 3WEEA 3A5NC 3CFOA 4IDKA 5C0YA 4CJRA 5C15A 3WQUA 3HM9A 4M3RA 2DFEA 3CCEN 2E6MA 1VSEA 3R6MA 4B9SA 3EYZA 1IJJA 2E2OA 3AVAA 4B9NA 4UQGA 3RMDA 4AHRA 1N5YA 2QK9A 1LW2A 3U9ZA 4CHQA 1WSGA 3SZ2A 2B6AA 4OJRA 1C0MA 2EWSA 4FWLA 3V9XA 3LP3A 4JI2K 3WXKA 4BDYA 4DV1K 3SJJA 4OKJA 4FK4A 1RFQA 1JL2A 2RE2A 1NWKA 3EL2A 5FLXO 4F2SA 3T1AA 3LDPA 4CECA 3F5TA 1C0FA 4JD2A 3CIPA 3NVMA 4ZHRA 4PKHA 2YX6A 1BISA 4B3TK 3L3UA 4CJEA 2A5XA 2FF6A 3LDNA 3O1BA 3CM5A 1WBBA 2O8BA 1MDUB 4FZZA 1DLOA 4CEEA 4CGJA 2E8AA 4FCYA 3THYA 1D4XA 1U04A 5C2FA 3UB5A 5JLFA 3ZSOA 4DR2K 2P9KA 1K8KB 2RF2A 4IFYA 4DR6K 4DS5A 1G99A 3CXCM 4H4MA 4B3RK 2ETJA 1CZAN 3TTCA 3R1XA 2P9UA 3TAGA 3WXIA 2HVHA 1Z25A 1BO5O 4DR1K 1F21A 3MX5A
chains in the Genus database with same CATH topology
4CFAA 4KPYA 4I7FA 4CJ4A 2DTUA 4CF0A 4BE2A 1B9FA 3SV4A 4WE1A 4H4OA 3G0ZA 3ZSQA 3AA5X 2FBVA 3AVNA 4M45A 3UIQA 3LP2A 1FXXA 4HUEA 3SQ2A 3M8PA 5K14A 1XHXA 4OLBA 2G8KA 4FVMA 3BDPA 4CK3A 2NUBA 3PY8A 1NK0A 4OKKA 4CJTA 5J2QA 1EX4A 2W42A 2BANA 3OYFA 4KRFA 3MECA 4AHUA 4NCAA 1TAUA 1NJWA 1RT1A 1C1AA 4KB0A 1RILA 1WSHA 3OJSA 1L3TA 4I2PA 1QE1A 4Z0UA 3TWHA 2Q3SA 3CFRA 4FM0A 2YNFA 3VQPA 4DTJA 3QERA 4KHWA 2Z1HA 2F8SA 4RW7A 4B9UA 3BGRA 1CXUA 1RBSA 4OVLA 1NK4A 3NF6A 3KKSA 3P5JA 3K5NA 4CHZA 4FZYA 2IS3A 5CY4A 4B9MA 1ZBIA 3DRRA 3WNEA 4FM1A 2B5JA 2YNGA 4FZXC 4TSXA 1EKEA 1T8EA 2YNIA 3OYCA 5C24A 1HRHA 1TKDA 4CJQA 3NHGA 3E01A 1U48A 1SL0A 3D0PA 1QQCA 4CGDA 1NOZA 4CGIA 1ASWA 5KGXA 2D5RA 4O55A 4DTPA 4ZTJA 1RBTA 1U47A 3ZT0A 2KTQA 4Z4EA 3OS2A 2X74A 4DTRA 3K5LA 4M42A 2VG5A 2DY4A 3LP0A 1NJXA 5CZ2A 4O5BA 2YHBA 3IS9A 1JLBA 3OYHA 3JYTA 3SQ1A 4QOZB 3NBPA 1KCFA 1VSIA 3HVRA 4DQPA 3TI0A 1LWCA 2ITGA 3MAQA 1NKCA 4DSIA 2VWJA 4CHYA 1BHLA 1S1WA 4MQ3A 1YVUA 3NGZA 2XY5A 4FJ7A 3RTVA 4DU1A 3L2UA 1VSDA 3VQ6A 4HCCA 5J1EA 3ISNC 4FLZA 3HP6A 3V9UA 4JRPA 3V1QA 4O44A 3QESA 1SKWA 4N47A 2IAJA 1CZBA 2VG6A 2KW4A 4KHSA 4DTUA 3QLHA 3C6UA 3ZT3A 4B9LA 4CJLA 2HB5A 3KK1A 4DQQA 2I5JA 1WAFA 4C8MA 1ZYQA 1HQEA 2HHTA 3RRHA 1TAQA 2YHAA 2IDOA 4M3WA 4FJ8A 3TAMA 4NYFA 4AHTA 5KRTA 4FJMA 3HL8A 2HNZA 3AO4A 4B8CA 1NOYA 5SWMA 1VSKA 1C1CA 4W5QA 1S9EA 3AA2A 3I8DA 4M3ZA 4DSLA 3DOLA 4E89A 1T03A 2G8WA 4OPKA 3KLEA 1A5XA 4JLHA 3WNFA 4R5PA 1JLGA 3MEGA 4W5TA 4E3SA 3AVHA 2PYLA 4DQIA 3VQCA 2IGIA 4DWIA 1X9SA 3OYEA 1QSLA 4C8KA 5J2PA 4IKFA 3NF8A 3SUPA 4CJPA 2ZE2A 3DLGA 4FJKA 2FBXA 4FLUA 3RWUA 4J2BA 4QCLA 3C95A 1VRTA 4E7HA 1C6VA 3U3GA 3AVBA 3HT3A 5HROA 1RT6A 3ZT2A 5E41A 2B4JA 2XRIA 4Y1DA 2G8FA 2YKNA 4I2QA 4DLGA 1L3UA 4OGCA 4CFCA 3KTQA 4ELVA 1DTQA 3CG7A 1YTAA 4Y1CA 1HYVA 4CFDA 4KO0A 1FKOA 2BE2A 4B9VA 4B08A 1FK9A 2X6SA 2KZZA 1S6PA 4KI6A 1YT3A 1BGXT 1S1TA 2JLEA 1S1UA 3V4IA 2D0CA 1SUQA 4KTWA 3ZT1A 4CEDA 1JLCA 1LWFA 4AILC 4FYDA 3T3FA 1RDDA 2PZSA 4PWDA 3WNGA 2KFNA 3T19A 4CJFA 1G15A 3LAMA 3PUFA 4ID5A 1NK7A 4KHNA 1WAJA 1WNSA 3OYDA 1RBUA 4EP5A 1KVAA 3KLGA 5FRMA 1HYZA 2RN2A 4E1NA 4O0IA 1VRUA 3CQ8A 4PQUA 1HMVA 2XY8A 4LD0A 3VQ4A 3P1GA 4DQRA 2Y1JA 1D9DA 4Q5VA 1C0UA 4DSEA 4RG8A 5J2NA 4FJ5A 2OYQA 2GUIA 1RT5A 1RBRA 1VSJA 3MEDA 3NCIA 4NCGA 5C25A 4IFVA 3TR8A 1Z26A 1TVRA 1XC9A 3MXJA 1HNIA 1KVCA 1L5UA 2EHGA 3CYMA 4HCBA 4NCBA 3ZSXA 1X1PA 1NKBA 1S1VA 4H8KA 1S9GA 1WSEA 3P83D 3KD1E 3B6PA 4C8LA 4DF8A 1Q9XA 1KSPA 2P51A 1EXQA 2DFFA 3LPTA 1WN7A 1C0TA 4YFUA 3L8BA 4DFMA 2O4IA 3O4NA 2FBTA 4IG0A 3ZSWA 1GOCA 4AHSA 3RR7A 2P1JA 2ZD1A 2HNYA 4DFPA 4FJGA 3OS1A 2X6NA 4JRQA 5HRRA 3DLKA 3HVTA 4DMNA 3ZSRA 5KI6A 1NK8A 2HNDA 2IOCA 2YV0X 2G8UA 1ZBHA 3V1OA 3V81A 4J2AA 1J9AA 4ZTFA 1I39A 3OYJA 1IO2A 4CHPA 4Z4FA 3DOKA 5FDLA 4CERA 4CJ5A 2O4GA 3EY1A 2R7YA 3SPZA 4KHQA 4N56A 3IAYA 5DMRA 3QEWA 1RDCA 2YKMA 3IG1A 2HMIA 4FJJA 4I9QA 4MFBA 1UA1A 2G8VA 2OPPA 3LANA 1BI4B 3LP1A 1ZBLA 2Z1IA 1IKWA 1RBVA 4M41A 3SQ4A 4J2EA 3F73A 3AO3A 3AVIA 4CEQA 3PX4A 3MXIA 1UA0A 4KAZA 2OPRA 4OPJA 4KFBA 1KVBA 4BACA 4C8OA 4BWMA 1CLQA 3VQ8A 1C1BA 2LSNA 5KTQA 1BQMA 4XIUA 4KTZA 2XY6A 4FXDA 3PO5A 1RDBA 2ZQBA 1SV5A 4CEBA 1XHZA 3QIPA 2HHWA 3OY9A 3SNNA 3OS0A 3PX6A 4AHVA 1T7PA 1QS4A 1VSHA 4RW8A 3ASMA 4B8AB 4RW9A 1BCOA 4E7LA 3HK2A 3RRGA 1VSLA 2WONA 3A2FA 3AVGA 4CF9A 4FJHA 2RPIA 4E7KA 1TGOA 3AVKA 4M3TA 2HW3A 4G1QA 4KHYA 1U4BA 3KKRA 5EU7A 3DM2A 2FC0A 3VQBA 3QNOA 1X9WA 5JS1A 3VQ9A 3SCXA 2IC3A 2WOMA 3NFAA 5HRNA 1Q9YA 5SZTA 3NE6A 4FW2A 4GW6A 4DU4A 4N76A 1RTHA 4ELUA 4LSLA 4QAGA 3ZSVA 4KHUA 2Y1IA 2G8HA 2OZSA 3K59A 1GOBA 3S3OA 1WSJA 4BWJA 4PA1A 1JLAA 2VWKA 3THVA 1LAWA 4CIEA 3V9WA 3KD5E 4K8ZA 4PUOA 3B6OA 5JS2A 3L2RA 3LWMA 2OA8A 1VSFA 3WNHA 1RTDA 3S3NA 2F8TA 4KB1A 3NF9A 3V1RA 1UOCA 4DQSA 4IG3A 3S9HA 2G8IA 4FJIA 3NGYA 3NH2A 3OYMA 5CZ1A 4CEAA 4FK2A 3DI6A 1REVA 3ALYA 2VG7A 5HRPA 4CFBA 4BDPA 1IH7A 4DSFA 4AH9A 3DLHA 2D0BA 1QTMA 4N41A 1RT2A 2OPSA 4Q0BA 1XWLA 1TL3A 2QKBA 3OYGA 3AVMA 5J2MA 3U3YA 1JKHA 4DG1A 4HHTA 4FM2A 4DFKA 2JGUA 3LPUA 1QHTA 1NJZA 1WSIA 4LY7A 4JS5A 1CZ9A 3V9ZA 2X78A 2RKIA 3SUOA 3TANA 3SYZA 4RW4A 3TAFA 1RT3A 1NK6A 3I0RA 3MEEA 1B92A 4DLEA 4JS4A 4DS4A 1NJYA 4W5RA 1B9DA 5CYQA 1J53A 4EZ9A 3QO9A 3AVFA 3KJVA 5HBMA 1KLNA 3KIOA 5C42A 1D9FA 1VK0A 2F96A 3SI6A 2BDPA 1HQUA 3NH1A 1QSYA 3CFPA 1W0HA 3AO5A 1EETA 5I42A 1GOAA 1EP4A 3LZJA 3DLRA 4CCHA 1LWEA 2KZMA 1HYSA 1TKZA 5HP1A 4I9LA 2HHQA 3C94A 4ICLA 1HPZA 1W9HA 3KK3A 4FK0A 3V6DA 3RR8A 3KLIA 4CK1A 4F4KA 1ZBUA 1MU2A 3V9SA 3AA4A 3K58A 3HP9A 1RTIA 1HNVA 4O0JA 4CIFA 3OYIA 1SKSA 1JXEA 2XHBA 4M3YA 1BL3A 4N5SA 1TK0A 3O3HA 3QEIA 3QNNA 2HHUA 2Z1GA 3SUQA 4HVJA 3PV8A 1N6QA 3TABA 4NYNA 4DFJA 4BDZA 1X9MA 1JL1A 3ZT4A 3VQQA 3PX0A 1IKYA 4FZZA 4OLAA 1BIZA 2XO7A 1U45A 1TK5A 2HHXA 4DTXA 3VN5A 4CGGA 1RCHA 2E6LA 5DK5A 4CF8A 3NAEA 4W5OA 2KFZA 2QKKA 3LZIA 4CEZA 1SL2A 3PO4A 4CF1A 3OJUA 1RT7A 3AVLA 4DF4A 5KGWA 4DTMA 2HHSA 4CIGA 4LH4A 3NDKA 3DRSA 4K8XA 1Q8IA 4HUFA 1DTTA 4L8RB 3HPGA 3HSTB 2A1SA 3AVCA 4DU3A 4E19A 1RNHA 1T05A 3ZSYA 3LAKA 2GBZA 4E1MA 4CEOA 4HUGA 4F8RA 1TKTA 3OVNA 4LH5A 2AJQA 4KREA 3VQ5A 4F2RA 1HJRA 3C6TA 4CJ3A 3JSMA 3M8QA 4CK2A 3SQ0A 3QEVA 1R0AA 4ELTA 2D0AA 3F9KA 5CYMA 1I3AA 1ZBFA 3QIOA 1IKVA 2KQ2A 3QINA 4BE1A 4GVMA 3L2QA 1K6YA 3ZSZA 3VQDA 4LSNA 2Z1JA 3KLFA 1D8YA 4F3TA 1S6QA 3G10A 3RMCA 4BE0A 1ASVA 1RTJA 2OZMA 3MXMA 4W5NA 3L2VA 1IKXA 1S1XA 3CM6A 3KK2A 1KFDA 3H08A 3NF7A 1QSSA 3VQEA 1UWBA 3QEPA 3D45A 3U6FA 4PY5A 3AO1A 1CXQA 3VQAA 3QETA 4HTUA 3O4QA 3LDSA 1BIUA 4CJWA 4EP4A 3O3GA 3M8SA 5FRNA 3EZ5A 1YTUA 3VQ7A 3K57A 3OYAA 3VA0A 1Y97A 4CJVA 2HHVA 2BGGA 3RMAA 2E4LA 4FLWA 1JLFA 3KLHA 3SUNA 5D3GA 4B3OA 1WLJA 3TAEA 3CFOA 4IDKA 3HXMA 4CJRA 3OYKA 3HM9A 4M3UA 1A5WA 4M3RA 4F3OA 1BCMA 2DFHA 2DFEA 4KKOA 3ITHA 2E6MA 1VSEA 5KRSA 3DLBA 4B9SA 4CJSA 4AHCA 2ATQA 3EYZA 3NGIA 4RW6A 1NKEA 3AVAA 2EX3A 4B9NA 4UQGA 3RMDA 4AHRA 1J5OA 3I0SA 1N5YA 2QK9A 1LW2A 1TK8A 2OPQA 1U49A 4CHQA 1WSGA 3SZ2A 1UAXA 2B6AA 4OJRA 1C0MA 2P5GA 1IG9A 3V9XA 4KTQA 3LP3A 3IRXA 1LAVA 2XY7A 1RDAA 4BDYA 3SJJA 3LWLA 4OKJA 4CGHA 4FJXA 4FK4A 4DTOA 4FLVA 3SPYA 3QEXA 4B9TA 3ZCMA 1S5JA 4FLYA 1JL2A 1BI4A 1RT4A 4IBNA 3K5OA 1VSMA 3M8RA 1NK5A 3TARA 4CJUA 2PYJA 3RMBA 4F2SA 5T7BA 3T1AA 3TAQA 4E7JA 1KLMA 3DLEA 4FJLA 5I3UA 1L3SA 4CECA 4CF2A 1TL1A 1L3VA 1O1WA 3HPHA 4DTSA 1SKRA 4M3XA 1LV5A 4CESA 3AVJA 4KI4A 1A5VA 1D5AA 4FJ9A 3HO1A 4CE9A 2GV9A 4Z4HA 4FLTA 4ZHRA 3O3FA 3LALA 1J54A 1BQNA 3DYAA 3DMJA 4O4GA 1JLEA 3S3MA 1BISA 4Z4GA 3ULDA 1XI1A 3L3UA 5HRSA 3FFIA 4DSJA 3AA3A 4CJEA 1JXBA 3AO2A 3DRPA 4YNQA 4CGFA 2A1RA 3HYFA 3CM5A 4J2DA 1KRPA 4CEFA 4FJNA 4KV8A 3NH0A 3OYBA 4GMJB 1DLOA 1FKPA 4CEEA 4CGJA 4ID1A 4FCYA 1KFSA 1U04A 4E0DA 4OKEA 3L2WA 4C8NA 3OYNA 2QXFA 3K5MA 4E7IA 1TKXA 3ZSOA 5HLFA 3L3VA 2RF2A 2FBYA 3HPOA 4IFYA 3HJFA 4Z4CA 1SL1A 1ITGA 1JLQA 1TV6A 3OYLA 4DS5A 2YNHA 2P5OA 4CHOA 1WSFA 4H4MA 4CJKA 2ETJA 3K2PA 4OGEA 4Z4IA 4FLXA 3TAPA 3TAGA 1KTQA 4DSKA 1NK9A 1LW0A 4CHNA 2HVHA 4DTNA 3VA3A 1ASUA 1Z25A 2PY5A 2HVIA 5FROA 1F21A 4EZ6A 3AV9A 3SV3A 4FW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CFA A;  4KPY A;  4I7F A;  4CJ4 A;  2DTU A;  4CF0 A;  4BE2 A;  1B9F A;  3SV4 A;  4WE1 A;  4H4O A;  3G0Z A;  3ZSQ A;  3AA5 X;  2FBV A;  3AVN A;  4M45 A;  3UIQ A;  3LP2 A;  1FXX A;  4HUE A;  3SQ2 A;  3M8P A;  5K14 A;  1XHX A;  4OLB A;  2G8K A;  4FVM A;  3BDP A;  4CK3 A;  2NUB A;  3PY8 A;  1NK0 A;  4OKK A;  4CJT A;  5J2Q A;  1EX4 A;  2W42 A;  2BAN A;  3OYF A;  4KRF A;  3MEC A;  4AHU A;  4NCA A;  1TAU A;  1NJW A;  1RT1 A;  1C1A A;  4KB0 A;  1RIL A;  1WSH A;  3OJS A;  1L3T A;  4I2P A;  1QE1 A;  4Z0U A;  3TWH A;  2Q3S A;  3CFR A;  4FM0 A;  2YNF A;  3VQP A;  4DTJ A;  3QER A;  4KHW A;  2Z1H A;  2F8S A;  4RW7 A;  4B9U A;  3BGR A;  1CXU A;  1RBS A;  4OVL A;  1NK4 A;  3NF6 A;  3KKS A;  3P5J A;  3K5N A;  4CHZ A;  4FZY A;  2IS3 A;  5CY4 A;  4B9M A;  1ZBI A;  3DRR A;  3WNE A;  4FM1 A;  2B5J A;  2YNG A;  4FZX C;  4TSX A;  1EKE A;  1T8E A;  2YNI A;  3OYC A;  5C24 A;  1HRH A;  1TKD A;  4CJQ A;  3NHG A;  3E01 A;  1U48 A;  1SL0 A;  3D0P A;  1QQC A;  4CGD A;  1NOZ A;  4CGI A;  1ASW A;  5KGX A;  2D5R A;  4O55 A;  4DTP A;  4ZTJ A;  1RBT A;  1U47 A;  3ZT0 A;  2KTQ A;  4Z4E A;  3OS2 A;  2X74 A;  4DTR A;  3K5L A;  4M42 A;  2VG5 A;  2DY4 A;  3LP0 A;  1NJX A;  5CZ2 A;  4O5B A;  2YHB A;  3IS9 A;  1JLB A;  3OYH A;  3JYT A;  3SQ1 A;  4QOZ B;  3NBP A;  1KCF A;  1VSI A;  3HVR A;  4DQP A;  3TI0 A;  1LWC A;  2ITG A;  3MAQ A;  1NKC A;  4DSI A;  2VWJ A;  4CHY A;  1BHL A;  1S1W A;  4MQ3 A;  1YVU A;  3NGZ A;  2XY5 A;  4FJ7 A;  3RTV A;  4DU1 A;  3L2U A;  1VSD A;  3VQ6 A;  4HCC A;  5J1E A;  3ISN C;  4FLZ A;  3HP6 A;  3V9U A;  4JRP A;  3V1Q A;  4O44 A;  3QES A;  1SKW A;  4N47 A;  2IAJ A;  1CZB A;  2VG6 A;  2KW4 A;  4KHS A;  4DTU A;  3QLH A;  3C6U A;  3ZT3 A;  4B9L A;  4CJL A;  2HB5 A;  3KK1 A;  4DQQ A;  2I5J A;  1WAF A;  4C8M A;  1ZYQ A;  1HQE A;  2HHT A;  3RRH A;  1TAQ A;  2YHA A;  2IDO A;  4M3W A;  4FJ8 A;  3TAM A;  4NYF A;  4AHT A;  5KRT A;  4FJM A;  3HL8 A;  2HNZ A;  3AO4 A;  4B8C A;  1NOY A;  5SWM A;  1VSK A;  1C1C A;  4W5Q A;  1S9E A;  3AA2 A;  3I8D A;  4M3Z A;  4DSL A;  3DOL A;  4E89 A;  1T03 A;  2G8W A;  4OPK A;  3KLE A;  1A5X A;  4JLH A;  3WNF A;  4R5P A;  1JLG A;  3MEG A;  4W5T A;  4E3S A;  3AVH A;  2PYL A;  4DQI A;  3VQC A;  2IGI A;  4DWI A;  1X9S A;  3OYE A;  1QSL A;  4C8K A;  5J2P A;  4IKF A;  3NF8 A;  3SUP A;  4CJP A;  2ZE2 A;  3DLG A;  4FJK A;  2FBX A;  4FLU A;  3RWU A;  4J2B A;  4QCL A;  3C95 A;  1VRT A;  4E7H A;  1C6V A;  3U3G A;  3AVB A;  3HT3 A;  5HRO A;  1RT6 A;  3ZT2 A;  5E41 A;  2B4J A;  2XRI A;  4Y1D A;  2G8F A;  2YKN A;  4I2Q A;  4DLG A;  1L3U A;  4OGC A;  4CFC A;  3KTQ A;  4ELV A;  1DTQ A;  3CG7 A;  1YTA A;  4Y1C A;  1HYV A;  4CFD A;  4KO0 A;  1FKO A;  2BE2 A;  4B9V A;  4B08 A;  1FK9 A;  2X6S A;  2KZZ A;  1S6P A;  4KI6 A;  1YT3 A;  1BGX T;  1S1T A;  2JLE A;  1S1U A;  3V4I A;  2D0C A;  1SUQ A;  4KTW A;  3ZT1 A;  4CED A;  1JLC A;  1LWF A;  4AIL C;  4FYD A;  3T3F A;  1RDD A;  2PZS A;  4PWD A;  3WNG A;  2KFN A;  3T19 A;  4CJF A;  1G15 A;  3LAM A;  3PUF A;  4ID5 A;  1NK7 A;  4KHN A;  1WAJ A;  1WNS A;  3OYD A;  1RBU A;  4EP5 A;  1KVA A;  3KLG A;  5FRM A;  1HYZ A;  2RN2 A;  4E1N A;  4O0I A;  1VRU A;  3CQ8 A;  4PQU A;  1HMV A;  2XY8 A;  4LD0 A;  3VQ4 A;  3P1G A;  4DQR A;  2Y1J A;  1D9D A;  4Q5V A;  1C0U A;  4DSE A;  4RG8 A;  5J2N A;  4FJ5 A;  2OYQ A;  2GUI A;  1RT5 A;  1RBR A;  1VSJ A;  3MED A;  3NCI A;  4NCG A;  5C25 A;  4IFV A;  3TR8 A;  1Z26 A;  1TVR A;  1XC9 A;  3MXJ A;  1HNI A;  1KVC A;  1L5U A;  2EHG A;  3CYM A;  4HCB A;  4NCB A;  3ZSX A;  1X1P A;  1NKB A;  1S1V A;  4H8K A;  1S9G A;  1WSE A;  3P83 D;  3KD1 E;  3B6P A;  4C8L A;  4DF8 A;  1Q9X A;  1KSP A;  2P51 A;  1EXQ A;  2DFF A;  3LPT A;  1WN7 A;  1C0T A;  4YFU A;  3L8B A;  4DFM A;  2O4I A;  3O4N A;  2FBT A;  4IG0 A;  3ZSW A;  1GOC A;  4AHS A;  3RR7 A;  2P1J A;  2ZD1 A;  2HNY A;  4DFP A;  4FJG A;  3OS1 A;  2X6N A;  4JRQ A;  5HRR A;  3DLK A;  3HVT A;  4DMN A;  3ZSR A;  5KI6 A;  1NK8 A;  2HND A;  2IOC A;  2YV0 X;  2G8U A;  1ZBH A;  3V1O A;  3V81 A;  4J2A A;  1J9A A;  4ZTF A;  1I39 A;  3OYJ A;  1IO2 A;  4CHP A;  4Z4F A;  3DOK A;  5FDL A;  4CER A;  4CJ5 A;  2O4G A;  3EY1 A;  2R7Y A;  3SPZ A;  4KHQ A;  4N56 A;  3IAY A;  5DMR A;  3QEW A;  1RDC A;  2YKM A;  3IG1 A;  2HMI A;  4FJJ A;  4I9Q A;  4MFB A;  1UA1 A;  2G8V A;  2OPP A;  3LAN A;  1BI4 B;  3LP1 A;  1ZBL A;  2Z1I A;  1IKW A;  1RBV A;  4M41 A;  3SQ4 A;  4J2E A;  3F73 A;  3AO3 A;  3AVI A;  4CEQ A;  3PX4 A;  3MXI A;  1UA0 A;  4KAZ A;  2OPR A;  4OPJ A;  4KFB A;  1KVB A;  4BAC A;  4C8O A;  4BWM A;  1CLQ A;  3VQ8 A;  1C1B A;  2LSN A;  5KTQ A;  1BQM A;  4XIU A;  4KTZ A;  2XY6 A;  4FXD A;  3PO5 A;  1RDB A;  2ZQB A;  1SV5 A;  4CEB A;  1XHZ A;  3QIP A;  2HHW A;  3OY9 A;  3SNN A;  3OS0 A;  3PX6 A;  4AHV A;  1T7P A;  1QS4 A;  1VSH A;  4RW8 A;  3ASM A;  4B8A B;  4RW9 A;  1BCO A;  4E7L A;  3HK2 A;  3RRG A;  1VSL A;  2WON A;  3A2F A;  3AVG A;  4CF9 A;  4FJH A;  2RPI A;  4E7K A;  1TGO A;  3AVK A;  4M3T A;  2HW3 A;  4G1Q A;  4KHY A;  1U4B A;  3KKR A;  5EU7 A;  3DM2 A;  2FC0 A;  3VQB A;  3QNO A;  1X9W A;  5JS1 A;  3VQ9 A;  3SCX A;  2IC3 A;  2WOM A;  3NFA A;  5HRN A;  1Q9Y A;  5SZT A;  3NE6 A;  4FW2 A;  4GW6 A;  4DU4 A;  4N76 A;  1RTH A;  4ELU A;  4LSL A;  4QAG A;  3ZSV A;  4KHU A;  2Y1I A;  2G8H A;  2OZS A;  3K59 A;  1GOB A;  3S3O A;  1WSJ A;  4BWJ A;  4PA1 A;  1JLA A;  2VWK A;  3THV A;  1LAW A;  4CIE A;  3V9W A;  3KD5 E;  4K8Z A;  4PUO A;  3B6O A;  5JS2 A;  3L2R A;  3LWM A;  2OA8 A;  1VSF A;  3WNH A;  1RTD A;  3S3N A;  2F8T A;  4KB1 A;  3NF9 A;  3V1R A;  1UOC A;  4DQS A;  4IG3 A;  3S9H A;  2G8I A;  4FJI A;  3NGY A;  3NH2 A;  3OYM A;  5CZ1 A;  4CEA A;  4FK2 A;  3DI6 A;  1REV A;  3ALY A;  2VG7 A;  5HRP A;  4CFB A;  4BDP A;  1IH7 A;  4DSF A;  4AH9 A;  3DLH A;  2D0B A;  1QTM A;  4N41 A;  1RT2 A;  2OPS A;  4Q0B A;  1XWL A;  1TL3 A;  2QKB A;  3OYG A;  3AVM A;  5J2M A;  3U3Y A;  1JKH A;  4DG1 A;  4HHT A;  4FM2 A;  4DFK A;  2JGU A;  3LPU A;  1QHT A;  1NJZ A;  1WSI A;  4LY7 A;  4JS5 A;  1CZ9 A;  3V9Z A;  2X78 A;  2RKI A;  3SUO A;  3TAN A;  3SYZ A;  4RW4 A;  3TAF A;  1RT3 A;  1NK6 A;  3I0R A;  3MEE A;  1B92 A;  4DLE A;  4JS4 A;  4DS4 A;  1NJY A;  4W5R A;  1B9D A;  5CYQ A;  1J53 A;  4EZ9 A;  3QO9 A;  3AVF A;  3KJV A;  5HBM A;  1KLN A;  3KIO A;  5C42 A;  1D9F A;  1VK0 A;  2F96 A;  3SI6 A;  2BDP A;  1HQU A;  3NH1 A;  1QSY A;  3CFP A;  1W0H A;  3AO5 A;  1EET A;  5I42 A;  1GOA A;  1EP4 A;  3LZJ A;  3DLR A;  4CCH A;  1LWE A;  2KZM A;  1HYS A;  1TKZ A;  5HP1 A;  4I9L A;  2HHQ A;  3C94 A;  4ICL A;  1HPZ A;  1W9H A;  3KK3 A;  4FK0 A;  3V6D A;  3RR8 A;  3KLI A;  4CK1 A;  4F4K A;  1ZBU A;  1MU2 A;  3V9S A;  3AA4 A;  3K58 A;  3HP9 A;  1RTI A;  1HNV A;  4O0J A;  4CIF A;  3OYI A;  1SKS A;  1JXE A;  2XHB A;  4M3Y A;  1BL3 A;  4N5S A;  1TK0 A;  3O3H A;  3QEI A;  3QNN A;  2HHU A;  2Z1G A;  3SUQ A;  4HVJ A;  3PV8 A;  1N6Q A;  3TAB A;  4NYN A;  4DFJ A;  4BDZ A;  1X9M A;  1JL1 A;  3ZT4 A;  3VQQ A;  3PX0 A;  1IKY A;  4FZZ A;  4OLA A;  1BIZ A;  2XO7 A;  1U45 A;  1TK5 A;  2HHX A;  4DTX A;  3VN5 A;  4CGG A;  1RCH A;  2E6L A;  5DK5 A;  4CF8 A;  3NAE A;  4W5O A;  2KFZ A;  2QKK A;  3LZI A;  4CEZ A;  1SL2 A;  3PO4 A;  4CF1 A;  3OJU A;  1RT7 A;  3AVL A;  4DF4 A;  5KGW A;  4DTM A;  2HHS A;  4CIG A;  4LH4 A;  3NDK A;  3DRS A;  4K8X A;  1Q8I A;  4HUF A;  1DTT A;  4L8R B;  3HPG A;  3HST B;  2A1S A;  3AVC A;  4DU3 A;  4E19 A;  1RNH A;  1T05 A;  3ZSY A;  3LAK A;  2GBZ A;  4E1M A;  4CEO A;  4HUG A;  4F8R A;  1TKT A;  3OVN A;  4LH5 A;  2AJQ A;  4KRE A;  3VQ5 A;  4F2R A;  1HJR A;  3C6T A;  4CJ3 A;  3JSM A;  3M8Q A;  4CK2 A;  3SQ0 A;  3QEV A;  1R0A A;  4ELT A;  2D0A A;  3F9K A;  5CYM A;  1I3A A;  1ZBF A;  3QIO A;  1IKV A;  2KQ2 A;  3QIN A;  4BE1 A;  4GVM A;  3L2Q A;  1K6Y A;  3ZSZ A;  3VQD A;  4LSN A;  2Z1J A;  3KLF A;  1D8Y A;  4F3T A;  1S6Q A;  3G10 A;  3RMC A;  4BE0 A;  1ASV A;  1RTJ A;  2OZM A;  3MXM A;  4W5N A;  3L2V A;  1IKX A;  1S1X A;  3CM6 A;  3KK2 A;  1KFD A;  3H08 A;  3NF7 A;  1QSS A;  3VQE A;  1UWB A;  3QEP A;  3D45 A;  3U6F A;  4PY5 A;  3AO1 A;  1CXQ A;  3VQA A;  3QET A;  4HTU A;  3O4Q A;  3LDS A;  1BIU A;  4CJW A;  4EP4 A;  3O3G A;  3M8S A;  5FRN A;  3EZ5 A;  1YTU A;  3VQ7 A;  3K57 A;  3OYA A;  3VA0 A;  1Y97 A;  4CJV A;  2HHV A;  2BGG A;  3RMA A;  2E4L A;  4FLW A;  1JLF A;  3KLH A;  3SUN A;  5D3G A;  4B3O A;  1WLJ A;  3TAE A;  3CFO A;  4IDK A;  3HXM A;  4CJR A;  3OYK A;  3HM9 A;  4M3U A;  1A5W A;  4M3R A;  4F3O A;  1BCM A;  2DFH A;  2DFE A;  4KKO A;  3ITH A;  2E6M A;  1VSE A;  5KRS A;  3DLB A;  4B9S A;  4CJS A;  4AHC A;  2ATQ A;  3EYZ A;  3NGI A;  4RW6 A;  1NKE A;  3AVA A;  2EX3 A;  4B9N A;  4UQG A;  3RMD A;  4AHR A;  1J5O A;  3I0S A;  1N5Y A;  2QK9 A;  1LW2 A;  1TK8 A;  2OPQ A;  1U49 A;  4CHQ A;  1WSG A;  3SZ2 A;  1UAX A;  2B6A A;  4OJR A;  1C0M A;  2P5G A;  1IG9 A;  3V9X A;  4KTQ A;  3LP3 A;  3IRX A;  1LAV A;  2XY7 A;  1RDA A;  4BDY A;  3SJJ A;  3LWL A;  4OKJ A;  4CGH A;  4FJX A;  4FK4 A;  4DTO A;  4FLV A;  3SPY A;  3QEX A;  4B9T A;  3ZCM A;  1S5J A;  4FLY A;  1JL2 A;  1BI4 A;  1RT4 A;  4IBN A;  3K5O A;  1VSM A;  3M8R A;  1NK5 A;  3TAR A;  4CJU A;  2PYJ A;  3RMB A;  4F2S A;  5T7B A;  3T1A A;  3TAQ A;  4E7J A;  1KLM A;  3DLE A;  4FJL A;  5I3U A;  1L3S A;  4CEC A;  4CF2 A;  1TL1 A;  1L3V A;  1O1W A;  3HPH A;  4DTS A;  1SKR A;  4M3X A;  1LV5 A;  4CES A;  3AVJ A;  4KI4 A;  1A5V A;  1D5A A;  4FJ9 A;  3HO1 A;  4CE9 A;  2GV9 A;  4Z4H A;  4FLT A;  4ZHR A;  3O3F A;  3LAL A;  1J54 A;  1BQN A;  3DYA A;  3DMJ A;  4O4G A;  1JLE A;  3S3M A;  1BIS A;  4Z4G A;  3ULD A;  1XI1 A;  3L3U A;  5HRS A;  3FFI A;  4DSJ A;  3AA3 A;  4CJE A;  1JXB A;  3AO2 A;  3DRP A;  4YNQ A;  4CGF A;  2A1R A;  3HYF A;  3CM5 A;  4J2D A;  1KRP A;  4CEF A;  4FJN A;  4KV8 A;  3NH0 A;  3OYB A;  4GMJ B;  1DLO A;  1FKP A;  4CEE A;  4CGJ A;  4ID1 A;  4FCY A;  1KFS A;  1U04 A;  4E0D A;  4OKE A;  3L2W A;  4C8N A;  3OYN A;  2QXF A;  3K5M A;  4E7I A;  1TKX A;  3ZSO A;  5HLF A;  3L3V A;  2RF2 A;  2FBY A;  3HPO A;  4IFY A;  3HJF A;  4Z4C A;  1SL1 A;  1ITG A;  1JLQ A;  1TV6 A;  3OYL A;  4DS5 A;  2YNH A;  2P5O A;  4CHO A;  1WSF A;  4H4M A;  4CJK A;  2ETJ A;  3K2P A;  4OGE A;  4Z4I A;  4FLX A;  3TAP A;  3TAG A;  1KTQ A;  4DSK A;  1NK9 A;  1LW0 A;  4CHN A;  2HVH A;  4DTN A;  3VA3 A;  1ASU A;  1Z25 A;  2PY5 A;  2HVI A;  5FRO A;  1F21 A;  4EZ6 A;  3AV9 A;  3SV3 A;  4FW1 A; 
#chains in the Genus database with same CATH topology
 3LDO A;  5B8H A;  4CF0 A;  3AAQ A;  3CJA A;  3AVN A;  3UIQ A;  4BR4 A;  5FPE A;  4LF8 K;  4NXN K;  2QWO A;  1VHX A;  4CK3 A;  3KK7 A;  4IJN A;  5AQM A;  2YI1 A;  4BRL A;  3OYF A;  3AAP A;  4BQZ A;  1Q82 O;  4KB0 A;  4FM0 A;  3ZEU A;  5AQF A;  2QW9 A;  4KHW A;  3A5M C;  5DM7 L;  1CXU A;  2E5L K;  2D0O A;  3KVG A;  1ZBI A;  2HMP A;  2W6K A;  2YNI A;  5C24 A;  1TKD A;  3CPW M;  4GKK K;  3NHG A;  4AM6 A;  4WQ5 A;  5KGX A;  4W5N A;  1ASW A;  2KTQ A;  4LF9 K;  3OS2 A;  3ZX2 A;  3HRG A;  3K5L A;  2ASP A;  2DY4 A;  1LOT B;  1NLV A;  3IS9 A;  1JLB A;  3NBP A;  4MDA A;  3MAQ A;  4F9O A;  1BHL A;  1S1W A;  2VCP A;  2E2P A;  5JLH A;  1VSD A;  4AF1 A;  3VES A;  3BP8 A;  5J1E A;  4FLZ A;  1IBL K;  3VEX A;  3CCL N;  2HF3 A;  2KW4 A;  4DTU A;  2WC9 A;  3KK1 A;  2HB5 A;  2V52 B;  2I5J A;  1WAF A;  1ZYQ A;  1X3N A;  2HHT A;  2YHA A;  4AHT A;  4FJM A;  3AO4 A;  3SBT A;  1NOY A;  3CJ1 A;  5LL6 Z;  4BR5 A;  2KHO A;  2ZJQ L;  4R5P A;  3WQT A;  4H0T B;  1HNZ K;  4DWI A;  4B3M K;  2AP1 A;  2ITM A;  3E9P A;  3NMU A;  4CJP A;  3C6H A;  4QS7 A;  3DLG A;  2E2N A;  1QQN A;  4A5B A;  4FJK A;  3EO3 A;  3D2E A;  3RWU A;  1DKG D;  2PFU A;  1VRT A;  5C12 A;  3AVB A;  3HT3 A;  3ZT2 A;  5E41 A;  2B4J A;  1VQ5 N;  3TSP A;  4JYA K;  2YKN A;  1NM1 A;  2CGK A;  2UXD K;  1YVN A;  4I6M A;  1FKO A;  2BE2 A;  4B08 A;  1RGI A;  1FK9 A;  1S6P A;  4JHD A;  1S1U A;  1SUQ A;  4KTW A;  4ILH A;  2VGM A;  3T19 A;  4U67 L;  4CJF A;  4KHN A;  2O8E B;  4BC2 A;  1T6C A;  2P9L B;  1RBU A;  3LDL A;  4EP5 A;  5I9E B;  4O0I A;  4PQU A;  1HMV A;  3VQ4 A;  1C0G A;  1Q86 O;  1C0U A;  3ZX3 A;  2OYQ A;  2GUI A;  1RT5 A;  4X64 K;  5C25 A;  4IFV A;  3TR8 A;  3VEZ A;  1TVR A;  2QI2 A;  3MXJ A;  4CJ7 A;  1XC9 A;  3J7A P;  2HBJ A;  3O4W A;  4B1W B;  3C0B A;  3P83 D;  3QDK A;  3VF4 A;  3KD1 E;  4C8L A;  1NBW A;  2P51 A;  2P9N B;  5FPD A;  1ESV A;  1WN7 A;  3THW A;  3RR7 A;  4AHS A;  4BGA A;  4FJG A;  4DFP A;  3VER A;  2X6N A;  4JRQ A;  5HRR A;  4DMN A;  1EWQ A;  3ZSR A;  5FPN A;  3VF2 A;  4J2A A;  4JKG B;  4FOI A;  4EFH A;  4CHP A;  3ULE B;  5FDL A;  2O4G A;  3RSE A;  3SPZ A;  3IAY A;  5DMR A;  4IJA A;  1YF5 L;  1RDC A;  2E20 A;  1X3M A;  2HMI A;  1UA1 A;  1BI4 B;  1NGC A;  3LP1 A;  1ZBL A;  1W2B M;  4YOV A;  1IKW A;  1RBV A;  1K8K A;  3AVI A;  4KAZ A;  1M90 O;  4OPJ A;  4BAC A;  1CLQ A;  4C8O A;  4BWM A;  2LSN A;  4XIU A;  2V7Z A;  2ZQB A;  4FL9 A;  1SV5 A;  4NB4 A;  3PO5 A;  3OS0 A;  4CBX A;  1QS4 A;  3D2F A;  2UUB K;  4RW9 A;  4E7L A;  4BQL A;  4DHY A;  4CBU A;  2V7Y A;  1GLC G;  4YOR A;  4FJH A;  4B1V A;  3K9J A;  1X9W A;  4JAX A;  2WOM A;  5HRN A;  4N76 A;  2PBD A;  4Y0W A;  2Y1I A;  2G8H A;  1U6Z A;  5BR9 A;  3S3O A;  3IMX A;  3CCM N;  4BWJ A;  3VGM A;  2VWK A;  1LAW A;  4CIE A;  1OVY A;  4JI4 K;  5JS2 A;  3L2R A;  1XQS C;  1IBK K;  2QTD A;  1TYQ A;  2F8T A;  3S3N A;  1OVQ A;  1UOC A;  3E1Y A;  5BPN A;  3NH2 A;  3OYM A;  4DV0 K;  2VG7 A;  1IH7 A;  3HM8 A;  4BRI A;  4AH9 A;  3QFP A;  4DV7 K;  5TKY A;  4DG1 A;  3GG4 A;  5M1F A;  4B1X B;  3SUO A;  3TAN A;  4RW4 A;  1RT3 A;  3GBT A;  4BVO A;  1B92 A;  1ZC6 A;  3L6Q A;  4DLE A;  1NJY A;  5GAG P;  4EZ9 A;  5D3G A;  1HKB A;  3QO9 A;  4BRN A;  2F96 A;  4OPH A;  2QWL A;  2RHK A;  1QSY A;  3NH1 A;  2BDP A;  1W0H A;  3MDQ A;  4GNI A;  1EET A;  4CZG A;  3HOT A;  3DLR A;  4CCH A;  3BEX A;  5HP1 A;  5GIO A;  4IEI A;  1HPZ A;  2IIR A;  4B1Y B;  3KK3 A;  3V6D A;  3RR8 A;  4CK1 A;  1GLB G;  3AA4 A;  4XH1 A;  1HNV A;  4H5V A;  1SKS A;  1JXE A;  4M3Y A;  3K9K A;  1BL3 A;  2J4R A;  1SS6 A;  4WFA L;  2NNW A;  5AJ3 K;  1NGD A;  4NYN A;  4BDZ A;  3PX0 A;  1IKY A;  3CCR N;  4B9Q A;  1TK5 A;  2HHX A;  3VN5 A;  3HBT A;  2OTL N;  4W5O A;  3PO4 A;  1SL2 A;  3MCA B;  1RT7 A;  4CIG A;  1U2V B;  3HPG A;  3ZSY A;  4E1M A;  4HUG A;  3TU5 A;  4JI5 K;  3C6T A;  3JSM A;  2UU9 K;  4ELT A;  1YIT N;  2KQ2 A;  3QIN A;  4GVM A;  3L2Q A;  1K6Y A;  3VQD A;  1VAZ A;  2HF4 A;  3CER A;  5EVZ A;  4F3T A;  1ASV A;  1RTJ A;  5AQU A;  4MLE A;  4BG8 A;  3VGL A;  3CM6 A;  5IWA K;  3L2V A;  3DLL L;  1M1K O;  3H08 A;  1I94 K;  4A61 A;  2E2Q A;  3EE9 A;  3AO1 A;  4CJW A;  5KPR A;  3EZ5 A;  4RTF D;  3VQ7 A;  3MK6 A;  3OYA A;  1NNE A;  3VA0 A;  2VWB A;  3CCS N;  4EHU A;  1Q18 A;  3C7N A;  3TTF A;  4FLW A;  1WLJ A;  3TAE A;  2ZJP L;  1DEJ A;  3HXM A;  3OYK A;  4FWS A;  3ITH A;  4FVU A;  4AM7 A;  3DLB A;  2YJE A;  4YOT A;  3BY5 A;  2EX3 A;  4IDH A;  2W40 A;  4XH4 A;  4JKG A;  1U49 A;  3H6E A;  2BTF A;  5CR4 A;  3Q7C A;  3NVK A;  2OTJ N;  1BG3 A;  1GLD G;  2XY7 A;  2AA4 A;  3OTO K;  4CGH A;  4FJX A;  3SPY A;  3ZET A;  5KPT A;  2NZT A;  1BDG A;  4FLY A;  1BI4 A;  1NK5 A;  1VSM A;  3M8R A;  4CZF A;  3A5L C;  5C10 A;  3TAR A;  5T7B A;  4DUZ K;  3DLE A;  4DUY K;  5MLC Q;  1L3S A;  4BRG A;  4CF2 A;  1L3V A;  4DTS A;  4M3X A;  3FZL A;  5C2D A;  3J8A A;  4KI4 A;  4FJ9 A;  1D5A A;  3HO1 A;  4V19 S;  4FLT A;  3O3F A;  3EZW A;  3FZH A;  1J54 A;  1BQN A;  1JCE A;  4JKH A;  3DYA A;  3DMJ A;  3JAM O;  3ULD A;  1XI1 A;  3FFI A;  4DSJ A;  3AA3 A;  1JXB A;  4YNQ A;  2A1R A;  1KRP A;  4IOX A;  4FJN A;  4KV8 A;  5ELZ A;  3NH0 A;  1N8R O;  1FKP A;  5F0X A;  2GX9 A;  4ID1 A;  4OKE A;  3K5M A;  3SLC A;  1TKX A;  4JI3 K;  3C65 A;  1JLQ A;  2ZF5 O;  2YNH A;  2P5O A;  1WSF A;  4LFA K;  3MMV A;  2VQE K;  2QM1 A;  4BVP A;  4OGE A;  4FLX A;  1KTQ A;  3VA3 A;  2JWK A;  1ASU A;  3SK3 A;  5FRO A;  1JCG A;  2QWN A;  4FOE A;  3SV3 A;  4CFA A;  4I7F A;  4BE2 A;  4JI7 K;  4FWM A;  4WE1 A;  4H0X B;  4M45 A;  3AY9 A;  1T44 A;  2CGL A;  4C1N I;  4HUE A;  3SQ2 A;  5K14 A;  2G8K A;  3BDP A;  3FR0 A;  2NUB A;  4OKK A;  5J2Q A;  2BAN A;  4ISF A;  4AHU A;  1TAU A;  1C1A A;  1WSH A;  1QE1 A;  1VQK N;  3RVC A;  3VTI A;  4JK7 A;  3QER A;  3O8M A;  4DR3 K;  4YOY A;  2F8S A;  5AR0 A;  4OVL A;  3K5N A;  5CY4 A;  5BRE A;  3DRR A;  4MDB A;  1EKE A;  3CHW A;  1BU6 O;  4OX9 K;  2NRT A;  3KZB A;  4A62 A;  4H03 B;  1QQC A;  4KBO A;  3QIC A;  4CGD A;  4CGI A;  4DTP A;  2D5R A;  1GLL O;  4KH6 A;  5CZ2 A;  3ATU A;  3SQ1 A;  5GAD P;  1LWC A;  4DSI A;  2VWJ A;  2XY5 A;  1U2V A;  3L2U A;  3I55 N;  4JKB A;  4BRE A;  4G9Z A;  3V9U A;  5LJV A;  3HP6 A;  4JRP A;  2WBN A;  4BG9 A;  3V1Q A;  4O44 A;  4DV3 K;  3E9O A;  2IAJ A;  1CZB A;  1S3X A;  4B9L A;  4BC4 A;  4DQQ A;  3A0I X;  1TAQ A;  3BF3 A;  4JN4 A;  4B8C A;  3I56 N;  4DB3 A;  1VSK A;  1SZ2 A;  3S41 A;  1C1C A;  4W5Q A;  1S9E A;  3AA2 A;  5AQZ A;  4M3Z A;  4DSL A;  4BRH A;  4E89 A;  1T03 A;  2HBK A;  4OPK A;  1A5X A;  4E3S A;  3QFU A;  5AZJ B;  4JV5 K;  2O8C B;  3OYE A;  1QSL A;  1YIJ N;  3SUP A;  3W0L A;  2ZE2 A;  1ILY A;  4FLU A;  4QCL A;  4BC5 A;  4H5N A;  2GWJ A;  2CH6 A;  1C6V A;  5BN8 A;  4PL8 A;  5E26 A;  2XRI A;  4FWN A;  1GLA G;  1L3U A;  1T3V A;  2OCE A;  3KTQ A;  1YTA A;  4GY2 B;  4WQ5 C;  4CFD A;  3UKR A;  3FGU A;  1QHA A;  1OH5 A;  2JLE A;  3V4I A;  3J7Y P;  1XNR K;  2D0C A;  3ZT1 A;  1JLC A;  1LWF A;  5AQR A;  2PZS A;  1E3M A;  4PWD A;  1Q7Y O;  2P9P B;  1WAJ A;  1HYZ A;  4DQR A;  4LD0 A;  2Y1J A;  3P1G A;  1D9D A;  4Q5V A;  4DSE A;  1X9J A;  4RG8 A;  5F2R A;  1IV0 A;  1RBR A;  1VSJ A;  2HST A;  2Q0U A;  4CZK A;  3VOV A;  1KVC A;  4RCH A;  1L5U A;  3CF5 L;  1Z6R A;  3CYM A;  4HCB A;  4NCB A;  4CW7 B;  1NKB A;  2F9W A;  1WSE A;  5E84 A;  3O4N A;  2FBT A;  4IG0 A;  1NGJ A;  2HNY A;  3R8E A;  3KHY A;  2G8U A;  3V1O A;  1J9A A;  3OYJ A;  4Z4F A;  4CJ5 A;  2R7Y A;  4KHQ A;  5AQL A;  4LFC K;  4A2A A;  3IKM A;  1VQL N;  2G8V A;  3LAN A;  2YJF A;  1V4T A;  3F73 A;  3AO3 A;  3DXK B;  1W7A A;  4BRO A;  1XNQ K;  2OPR A;  3VQ8 A;  1C1B A;  2XY6 A;  1RDB A;  4CEB A;  1XHZ A;  3QIP A;  4XEI A;  3O1W A;  2HHW A;  4MO4 A;  3PX6 A;  4AHV A;  1T7P A;  3A5O C;  1VSH A;  3ASM A;  2WUS A;  4B8A B;  3RRG A;  2WON A;  3VPZ A;  4E7K A;  4M3T A;  5EU7 A;  3VQB A;  2FC0 A;  4LF7 K;  1EO1 A;  4BRD A;  3NFA A;  1XMQ K;  5SZT A;  4DU4 A;  4GW6 A;  1RTH A;  3TSQ A;  3P31 A;  4LSL A;  4QAG A;  2A6A A;  3WXL A;  1YAG A;  2PAV A;  3U9D A;  4K8Z A;  3V9W A;  1KXP A;  2Q0R A;  5KQ8 A;  3FLC O;  4CBW A;  5H1S Q;  4KB1 A;  1QZ6 A;  4IG3 A;  4FJI A;  2NRZ A;  2FLO A;  4FK2 A;  1REV A;  4YDU C;  5HRP A;  3P4I A;  3DLH A;  4N41 A;  4Q0B A;  2OPS A;  4OPA A;  2QKB A;  4HTL A;  4EAH D;  3HOS A;  1XC3 A;  1KC8 O;  4IOC L;  2JGU A;  3LPU A;  1WSI A;  3OW2 M;  4Z94 A;  4W5R A;  5CYQ A;  4EHT A;  1KLN A;  5HBM A;  1D9F A;  3KIO A;  5C42 A;  5JMV A;  3VEO A;  1OH8 A;  3SI6 A;  1HQU A;  3AAR A;  3T7Z A;  1VQ7 N;  2Q36 A;  4JKF A;  2KZM A;  2YHW A;  1TKZ A;  2FSJ A;  2Q1N A;  4ICL A;  1W9H A;  3KLI A;  1ZBU A;  2NRH A;  4IXC A;  3IFR A;  3G4S N;  3OYI A;  3SMP A;  3SAG A;  4JI1 K;  2GTD A;  5BRF A;  2GEL A;  3H1Q A;  1XUP O;  1NGA A;  1W97 L;  3SUQ A;  3VMF B;  4DFJ A;  4NO7 A;  4OO1 J;  1JL1 A;  3CJ9 A;  3ZT4 A;  2O8D B;  3ID6 A;  1BIZ A;  5M1N A;  5AZJ A;  4DTX A;  1JJ2 M;  1RCH A;  5AZI B;  5DK5 A;  3LZI A;  4DF4 A;  3O6W A;  4YDU A;  4DTM A;  4BRK A;  3NDK A;  4K8X A;  3DAW A;  4L8R B;  1BUP A;  3MN6 A;  3T1H K;  3AVC A;  1RNH A;  1T05 A;  2GBZ A;  3N4P A;  4FWR A;  4F8R A;  3THX B;  4LH5 A;  2AJQ A;  5JVH L;  3PIO L;  3VQ5 A;  1HX1 A;  2D0A A;  4M7X A;  5CYM A;  3QIO A;  1TUY A;  1HR0 K;  1KQS M;  1VQP N;  3KLF A;  4WFB L;  3G10 A;  3RMC A;  4BE0 A;  2OZM A;  1IKX A;  1S1X A;  2P9P A;  3AGR A;  4FWQ A;  1QSS A;  3C6A A;  3H46 O;  3D45 A;  4FWO A;  3VQA A;  3QET A;  4HTU A;  3LDS A;  1BIU A;  3M8S A;  3O9S A;  1YTU A;  2CGJ A;  3MN9 A;  2HHV A;  4CJV A;  4BGB A;  4YOX A;  1JLF A;  4B3O A;  3CQY A;  4WQ4 C;  2ASM A;  4F3O A;  1BCM A;  2DFH A;  4KKO A;  5KRS A;  2F9T A;  4DKW A;  4A59 A;  4CJS A;  5BR8 K;  3H1V X;  2IVO A;  3T69 A;  3F9M A;  3L0Q A;  1N33 K;  3I0S A;  2HHH K;  4PKI A;  5DM6 L;  1UAX A;  2NRV A;  3PLA A;  1IG9 A;  4O8U A;  1LAV A;  1RDA A;  3R9P A;  3LWL A;  4CD1 A;  4GV3 A;  4LFB K;  4FLV A;  3ZCM A;  3M3Z A;  4H0P A;  1S5J A;  1SQK A;  3K5O A;  3DXK A;  2NRX A;  3TAQ A;  4DCH A;  4LF5 K;  4FSV A;  3I8B A;  4FJL A;  5I3U A;  5BPM A;  1TL1 A;  2IVN A;  1O1W A;  1SKR A;  2A42 A;  1LV5 A;  2ZJR L;  4IOA L;  4CE9 A;  2GV9 A;  3N4Q A;  4Z4H A;  2NRR A;  3LAL A;  4H5W A;  4Z4G A;  4PL7 A;  4HWI A;  5A2Q O;  3DRP A;  3BUZ B;  1IG8 A;  1E4F T;  3HYF A;  3O5B A;  4GMJ B;  3OBW A;  1KFS A;  4O8K A;  3L2W A;  1K8A O;  3B8A X;  3OYN A;  3QBX A;  2FXU A;  4WQ4 A;  5HLF A;  3L3V A;  4U7B A;  4Z4C A;  1SL1 A;  3SAH A;  1ITG A;  1TV6 A;  3EKS A;  1NGB A;  4CHO A;  4BRM A;  1VQ4 N;  3WXJ A;  2F7T A;  5M1Q A;  4NLB A;  2PY5 A;  4EZ6 A;  3CPE A;  3E9L A;  4FW1 A;  2DTU A;  3CC7 N;  3WEE B;  4H4O A;  3G0Z A;  3AA5 X;  5AQQ A;  3HTV A;  1N32 K;  5EY4 A;  4JKC A;  4CZH A;  3CJC A;  4OLB A;  4FVM A;  1H1V A;  3PY8 A;  4CJT A;  1EX4 A;  5JIC A;  5GIP A;  5AQI A;  1BOT O;  3TPQ A;  1NJW A;  1RT1 A;  3U4L A;  1P8Z A;  1RIL A;  3OJS A;  1L3T A;  4I2P A;  4DTJ A;  2Q3S A;  4JKD A;  5AQH A;  2YNF A;  3VQP A;  3CCU N;  3WUH A;  2Z1H A;  4B9U A;  2O8E A;  3EE8 A;  5AQK A;  2P9L A;  3W3D A;  1NU0 A;  3NF6 A;  3KKS A;  3P5J A;  5AQV A;  4CHZ A;  4FZY A;  3G25 A;  2IS3 A;  2O8F B;  4B9M A;  4CZM A;  4LC9 B;  2B5J A;  2YNG A;  4FZX C;  3MN5 A;  4TSX A;  1T8E A;  4JI0 K;  4CJQ A;  1LCU A;  5AQX A;  3OBY A;  1U48 A;  1NOZ A;  2BH1 A;  4ZTJ A;  1U47 A;  4O55 A;  3ZT0 A;  4Z4E A;  3ENH A;  3PIP L;  4DTR A;  2O8D A;  1GLE G;  4M42 A;  3LL3 A;  3LP0 A;  1NJX A;  2YHB A;  2P9N A;  3DXM B;  3MX2 A;  3LM9 A;  5AZI A;  1KCF A;  1VSI A;  3HVR A;  3TI0 A;  2ITG A;  1NKC A;  2UXC K;  5AQP A;  4FJ7 A;  3NGZ A;  1YVU A;  3VQ6 A;  3CET A;  4HCC A;  3ISN C;  3ULE A;  3EN9 A;  1VQO N;  4H0O A;  3CCJ N;  3QES A;  4N47 A;  1SKW A;  2O8B B;  3C6U A;  3ZT3 A;  3THX A;  3RRH A;  4M3W A;  2IDO A;  1YJ9 N;  4NYF A;  3HL8 A;  3MCP A;  3I8D A;  3DWL A;  2QWR A;  5IT9 O;  3CCQ N;  3WNF A;  1EWR A;  4DQ8 A;  3MEG A;  4W5T A;  4DV6 K;  2DPN A;  3AVH A;  4C23 A;  2PYL A;  4CI6 A;  2P9U B;  4C8K A;  5J2P A;  4AQY K;  1WUA A;  1BA0 A;  1KAX A;  2FBX A;  4J2B A;  2HBM A;  1GLJ O;  4YOU A;  3C95 A;  4E7H A;  3U3G A;  3EKU A;  5GAH P;  1YHQ N;  1RT6 A;  1YJW N;  1FJG K;  3FZM A;  4DV4 K;  4JI6 K;  2G8F A;  2VQF K;  1KAZ A;  4CD3 A;  1IBM K;  4ELV A;  1DTQ A;  3CG7 A;  4Y1C A;  4BR2 A;  1HYV A;  4KO0 A;  1HJO A;  3QB0 A;  3A8Y A;  2GWK A;  3J80 O;  3PSI A;  3O08 A;  4GV9 A;  4A5A A;  4KI6 A;  1BGX T;  1S1T A;  5AQO A;  4K43 A;  5LY3 A;  4AIL C;  4FYD A;  3T3F A;  1RDD A;  3WNG A;  1G15 A;  1NK7 A;  4K42 A;  3OYD A;  1KVA A;  5FRM A;  2RN2 A;  3ATV A;  5J2N A;  4FJ5 A;  4NLC A;  1ATS A;  1WB9 A;  3MN7 A;  4BR9 A;  3NCI A;  4NCG A;  2W6L A;  4H0Y B;  3VET A;  3ZX0 A;  4H8K A;  1S9G A;  4DF8 A;  1KSP A;  1EXQ A;  2DFF A;  1JCF A;  3WT0 A;  4WFN L;  2O4I A;  3ZSW A;  2P1J A;  2ZD1 A;  2NRW A;  1ZBH A;  5KI6 A;  2HND A;  2IOC A;  2YV0 X;  1I39 A;  5M1P A;  2WTU A;  2A3Z A;  5ADX A;  4N56 A;  3J81 O;  4I9Q A;  2OPP A;  2Z1I A;  2E1Z A;  4J2E A;  3MXI A;  4CEQ A;  1UA0 A;  2I7P A;  3FZK A;  3KWI A;  4KFB A;  1KVB A;  4JEP A;  3FFK B;  4EIA A;  1BQM A;  4KTZ A;  4FXD A;  4C1N K;  3OY9 A;  3SNN A;  4MLH A;  3CD6 N;  2F4V K;  1BCO A;  1VSL A;  1BA1 A;  3D2E B;  2RPI A;  3MWT A;  1TGO A;  2HW3 A;  2D0P A;  2GEM A;  1U4B A;  3QNO A;  5JS1 A;  3VQ9 A;  3M1F A;  1Q9Y A;  3NE6 A;  4FW2 A;  3CMA N;  4YY3 K;  3ZSV A;  1GLF O;  4XH5 A;  4I6M B;  2OZS A;  3K59 A;  4FPA A;  4JNE A;  3KD5 E;  4JHD B;  3B6O A;  3LWM A;  5BN9 A;  3FZF A;  5AQN A;  3V1R A;  4H5R A;  4DQS A;  2G8I A;  1VQN N;  3NGY A;  4B1Z A;  5CZ1 A;  4CEA A;  3DI6 A;  3ALY A;  2O8F A;  4CFB A;  4BDP A;  4DSF A;  2D0B A;  1TL3 A;  3OYG A;  3U3Y A;  1JKH A;  2HBL A;  3QBW A;  4HHT A;  1QHT A;  1NJZ A;  5LJW A;  4LY7 A;  1VQ9 N;  3ZLJ A;  1NMD A;  4KH4 A;  4JS5 A;  1CZ9 A;  3V9Z A;  2RKI A;  2W41 A;  3TAF A;  1NK6 A;  3I0R A;  3MEE A;  4A57 A;  1K73 O;  3DXM A;  4DS4 A;  3THW B;  3AVF A;  3KJV A;  4BRF A;  3GE1 A;  5AQS A;  3CFP A;  4GKJ K;  1EP4 A;  4DR4 K;  4I9L A;  2UUC K;  3C94 A;  5M1K A;  3RSE B;  1MU2 A;  3V9S A;  2GUP A;  1Q81 O;  3HP9 A;  4CIF A;  3CJ7 A;  2XHB A;  4DV2 K;  4DR5 K;  1NG9 A;  3UKU B;  3PV8 A;  3GL1 A;  1N6Q A;  1X9M A;  4M63 C;  3LM2 A;  3P39 A;  1NGE A;  3D2F B;  1NJI O;  3NAE A;  4PKG A;  3IUC A;  3CI5 A;  3D7E O;  3OJU A;  3CC4 N;  2HHS A;  4LH4 A;  1OH7 A;  3DRS A;  1Q8I A;  4HUF A;  1DTT A;  3HSC A;  3HST B;  2A1S A;  4DU3 A;  2V51 B;  4E19 A;  4LF4 K;  3LAK A;  5CHI A;  4CEO A;  4DR7 K;  4IEE A;  1TKT A;  4KRE A;  2Q97 A;  3GDQ A;  4H0V B;  3M8Q A;  4CK2 A;  3SQ0 A;  3F9K A;  1I3A A;  1IKV A;  4BE1 A;  5BRD A;  3ZSZ A;  1TYQ B;  1VQM N;  1S6Q A;  4YHH K;  5AQY A;  3HI0 A;  3KK2 A;  3DJC A;  1UWB A;  4BR0 A;  1CXQ A;  4ISE A;  4NXM K;  5BPL A;  3O4Q A;  1HLU A;  3IDH A;  4EP4 A;  5FRN A;  2BUP A;  2E4L A;  3KLH A;  3SUN A;  1NGH A;  4H5T A;  4M3U A;  1A5W A;  4K41 A;  2I7N A;  1YUW A;  4AHC A;  2ATQ A;  4MO5 A;  3NGI A;  4RW6 A;  4QS8 A;  1NKE A;  3H3N O;  1J5O A;  2FSN A;  4BRC A;  1TK8 A;  2OPQ A;  1V4S A;  4ILG B;  2P5G A;  4KTQ A;  3IRX A;  5AFU H;  3LDQ A;  3F2K A;  4DTO A;  3SJH A;  3QEX A;  4B9T A;  2P9I B;  5AQT A;  1RT4 A;  4IBN A;  1QZ5 A;  3I33 A;  2PYJ A;  4CJU A;  3RMB A;  1HKC A;  4E7J A;  1KLM A;  1HNW K;  3HPH A;  3TSU A;  4CES A;  3AVJ A;  1NGF A;  1A5V A;  4M7Y A;  5EXW A;  3MWP A;  4O4G A;  1JLE A;  3S3M A;  3O9R A;  5HRS A;  5JVG L;  1KD1 O;  3AO2 A;  4CGF A;  2FSK A;  3BF1 A;  4J2D A;  1SAZ A;  4CEF A;  3OYB A;  4X62 K;  4E0D A;  4QS9 A;  5GAE P;  4C8N A;  3VEV A;  3M6G A;  2QXF A;  4E7I A;  3VGK A;  2QWM A;  3HPO A;  3HJF A;  2FBY A;  4IO8 A;  4JKA A;  3OYL A;  1BWF O;  4CJK A;  5FPM A;  3CCV N;  3K2P A;  4Z4I A;  4PHT X;  4ILJ A;  4BRQ A;  3TAP A;  2O8C A;  4DSK A;  4GV6 A;  1NK9 A;  1LW0 A;  4CHN A;  4DTN A;  3O9Q A;  3H3O B;  2QXL A;  2HVI A;  1MWM A;  3AV9 A;  1QVF M;  1MWK A;  2OAN A;  4KPY A;  2A41 A;  4CJ4 A;  1B9F A;  3SV4 A;  4X66 K;  3C7N B;  3ZSQ A;  2P9S B;  2FBV A;  3CQX A;  3LP2 A;  1FXX A;  3M8P A;  1ATR A;  1XHX A;  3KWG A;  4KH5 A;  3VF6 A;  1NK0 A;  2W42 A;  4X65 K;  4KRF A;  3MEC A;  4NCA A;  3TWH A;  4Z0U A;  4YOW A;  3CFR A;  5GIN A;  3D6R A;  5CE3 A;  4JK8 A;  4RW7 A;  3O80 A;  3BGR A;  4ISG A;  1RBS A;  2YHY A;  2YHX A;  1NK4 A;  1YXQ A;  1EQY A;  2QWQ A;  4BY9 C;  3UE5 A;  4FM1 A;  3WNE A;  1ZXO A;  3ZET B;  3U8X A;  3ENO A;  3OYC A;  1HRH A;  4GVE A;  2NLX A;  3E01 A;  3UKU A;  1KAY A;  1SL0 A;  3D0P A;  1RBT A;  3L4I A;  4BRP A;  2X74 A;  2VG5 A;  5M1O A;  4O5B A;  3JYT A;  1J5E K;  3OYH A;  4QOZ B;  2VYP A;  1VQ8 N;  3AGK A;  4DQP A;  4JKE A;  2E1Y A;  3Q7B A;  4CHY A;  4MQ3 A;  2UXB K;  5EOY A;  3RTV A;  4DU1 A;  1K9M O;  1NGG A;  2VG6 A;  4KHS A;  3QLH A;  2BGG A;  2A40 A;  4CJL A;  3L4Q A;  4C8M A;  1NMN A;  1HQE A;  4FJ8 A;  3TAM A;  5KRT A;  1HNX K;  2HNZ A;  5LMN K;  4DV5 K;  3CC2 N;  5SWM A;  3PSF A;  1TUU A;  3DOL A;  2G8W A;  1OKJ A;  3KLE A;  4JLH A;  4DQI A;  1JLG A;  4BRA A;  3VQC A;  2IGI A;  1X9S A;  4WF9 L;  1FW6 A;  4IKF A;  2FF3 B;  3NF8 A;  4BR7 A;  1WOQ A;  2QWP A;  5AQJ A;  3T1Y K;  5HRO A;  4FWP A;  1S72 N;  4IFE A;  4Y1D A;  1QQO A;  3K0S A;  4I2Q A;  4DLG A;  4OGC A;  4CFC A;  1N36 K;  3OA9 A;  1XMO K;  5AFU A;  1E4G T;  4B9V A;  2X6S A;  1O13 A;  2ASO A;  1ZBS A;  2KZZ A;  1YT3 A;  4IWV A;  2QEX N;  4CED A;  5ADX H;  2KFN A;  1R59 O;  3LAM A;  2ZGY A;  3PUF A;  4ID5 A;  1WNS A;  1VQ6 N;  3KLG A;  3CQ8 A;  4E1N A;  1VRU A;  3FE1 A;  2XY8 A;  3VEN A;  1QQM A;  2IVP A;  1ATN A;  2P9I A;  3MED A;  1N34 K;  1Z26 A;  1HNI A;  2EHG A;  3ZSX A;  1X1P A;  3BZK A;  1S1V A;  3VEW A;  3B6P A;  3G6E N;  1Q9X A;  4CVN E;  3LPT A;  4YFU A;  1C0T A;  3L8B A;  4DFM A;  3H45 C;  5AQW A;  1RDU A;  1GOC A;  3OS1 A;  4IO9 L;  2QA4 N;  1S22 A;  3DLK A;  3HVT A;  5F1X A;  1NK8 A;  2KKZ A;  3V81 A;  4ZTF A;  4B3S K;  3ENB A;  1IO2 A;  4FPB A;  3DOK A;  4CER A;  3EY1 A;  1Z05 A;  4R79 A;  3SAF A;  1T6D A;  3QEW A;  3ID8 A;  3R3L A;  2UUA K;  4B1U B;  2YKM A;  1P90 A;  3IG1 A;  4FJJ A;  1HPM A;  4MFB A;  3OHR A;  4M41 A;  3SQ4 A;  1HUX A;  2KLA A;  3PX4 A;  4E1J A;  1WBD A;  5KTQ A;  4FWK A;  4JK9 A;  3G71 N;  2YCH A;  4RW8 A;  4JD2 B;  1QVG M;  2WFB A;  3A2F A;  4J8F A;  3AVG A;  4CF9 A;  3AVK A;  2H3G X;  4G1Q A;  4KHY A;  3KKR A;  2ZGZ A;  3O9T A;  2ZWH A;  3DM2 A;  2P9S A;  3SCX A;  2IC3 A;  3WXM B;  4O5F A;  4K0K K;  3THY B;  4ELU A;  4KHU A;  5BRH A;  5HL7 L;  3UKR B;  2HOE A;  3TTD A;  1GOB A;  2VGN A;  2JWL A;  1WSJ A;  4FO0 A;  4PA1 A;  1JLA A;  2P9K B;  4CZI A;  2ZM6 K;  3THV A;  4PUO A;  1HKG A;  2OA8 A;  4UY8 O;  1DGK N;  1VSF A;  1Y64 A;  3VTH A;  3WNH A;  1RTD A;  3QML A;  3NF9 A;  3S9H A;  3CME N;  1J6Z A;  3SBG A;  4A2B A;  4KHP K;  2D1K A;  3E66 A;  1QTM A;  1RT2 A;  1XWL A;  3HK2 A;  3AVM A;  5J2M A;  4FM2 A;  4DFK A;  1MA9 B;  1YJN N;  3ZYY X;  1NGI A;  2X78 A;  5EX5 A;  3SYZ A;  3GOI A;  4CZE A;  4CZJ A;  4JS4 A;  1B9D A;  1J53 A;  1OH6 A;  1VK0 A;  2Q31 A;  3AO5 A;  5I42 A;  1GOA A;  3LZJ A;  3ZEU B;  1LWE A;  3VEY A;  1HYS A;  2HHQ A;  4FK0 A;  4F4K A;  3K58 A;  1DT9 A;  3BZC A;  3CJB A;  1RTI A;  4O0J A;  5LMU K;  5AQG A;  3EEQ A;  4N5S A;  1TK0 A;  3O3H A;  4K25 A;  3QEI A;  3QNN A;  2HHU A;  3HZ6 A;  2Z1G A;  4HVJ A;  3TAB A;  4IZ9 A;  3VQQ A;  4OLA A;  3JS6 A;  2XO7 A;  1U45 A;  1YI2 N;  4CGG A;  2E6L A;  4CF8 A;  4RWT A;  2QKK A;  2KFZ A;  4CZL A;  4CEZ A;  5KQD A;  4CF1 A;  4L3Q A;  3AVL A;  5KGW A;  2E88 A;  5KPZ A;  3J7Z O;  4WYB A;  2UYT A;  4BC3 A;  3SMS A;  3OVN A;  4F2R A;  5HOO A;  1HJR A;  4CJ3 A;  3O9U A;  3QEV A;  1R0A A;  2D4W A;  1ZBF A;  2Q2R A;  4LSN A;  2Z1J A;  1D8Y A;  5TKW A;  3MXM A;  1KFD A;  4WCE L;  3NF7 A;  4LF6 K;  3VQE A;  3QEP A;  1RDW X;  3M5R A;  3U6F A;  4PY5 A;  3O3G A;  3JXU A;  4JI8 K;  3K57 A;  1Y97 A;  2CH5 A;  3P38 A;  3RMA A;  3WEE A;  3A5N C;  3CFO A;  4IDK A;  5C0Y A;  4CJR A;  5C15 A;  3WQU A;  3HM9 A;  4M3R A;  2DFE A;  3CCE N;  2E6M A;  1VSE A;  3R6M A;  4B9S A;  3EYZ A;  1IJJ A;  2E2O A;  3AVA A;  4B9N A;  4UQG A;  3RMD A;  4AHR A;  1N5Y A;  2QK9 A;  1LW2 A;  3U9Z A;  4CHQ A;  1WSG A;  3SZ2 A;  2B6A A;  4OJR A;  1C0M A;  2EWS A;  4FWL A;  3V9X A;  3LP3 A;  4JI2 K;  3WXK A;  4BDY A;  4DV1 K;  3SJJ A;  4OKJ A;  4FK4 A;  1RFQ A;  1JL2 A;  2RE2 A;  1NWK A;  3EL2 A;  5FLX O;  4F2S A;  3T1A A;  3LDP A;  4CEC A;  3F5T A;  1C0F A;  4JD2 A;  3CIP A;  3NVM A;  4ZHR A;  4PKH A;  2YX6 A;  1BIS A;  4B3T K;  3L3U A;  4CJE A;  2A5X A;  2FF6 A;  3LDN A;  3O1B A;  3CM5 A;  1WBB A;  2O8B A;  1MDU B;  4FZZ A;  1DLO A;  4CEE A;  4CGJ A;  2E8A A;  4FCY A;  3THY A;  1D4X A;  1U04 A;  5C2F A;  3UB5 A;  5JLF A;  3ZSO A;  4DR2 K;  2P9K A;  1K8K B;  2RF2 A;  4IFY A;  4DR6 K;  4DS5 A;  1G99 A;  3CXC M;  4H4M A;  4B3R K;  2ETJ A;  1CZA N;  3TTC A;  3R1X A;  2P9U A;  3TAG A;  3WXI A;  2HVH A;  1Z25 A;  1BO5 O;  4DR1 K;  1F21 A;  3MX5 A; 
#chains in the Genus database with same CATH homology
 4CFA A;  4KPY A;  4I7F A;  4CJ4 A;  2DTU A;  4CF0 A;  4BE2 A;  1B9F A;  3SV4 A;  4WE1 A;  4H4O A;  3G0Z A;  3ZSQ A;  3AA5 X;  2FBV A;  3AVN A;  4M45 A;  3UIQ A;  3LP2 A;  1FXX A;  4HUE A;  3SQ2 A;  3M8P A;  5K14 A;  1XHX A;  4OLB A;  2G8K A;  4FVM A;  3BDP A;  4CK3 A;  2NUB A;  3PY8 A;  1NK0 A;  4OKK A;  4CJT A;  5J2Q A;  1EX4 A;  2W42 A;  2BAN A;  3OYF A;  4KRF A;  3MEC A;  4AHU A;  4NCA A;  1TAU A;  1NJW A;  1RT1 A;  1C1A A;  4KB0 A;  1RIL A;  1WSH A;  3OJS A;  1L3T A;  4I2P A;  1QE1 A;  4Z0U A;  3TWH A;  2Q3S A;  3CFR A;  4FM0 A;  2YNF A;  3VQP A;  4DTJ A;  3QER A;  4KHW A;  2Z1H A;  2F8S A;  4RW7 A;  4B9U A;  3BGR A;  1CXU A;  1RBS A;  4OVL A;  1NK4 A;  3NF6 A;  3KKS A;  3P5J A;  3K5N A;  4CHZ A;  4FZY A;  2IS3 A;  5CY4 A;  4B9M A;  1ZBI A;  3DRR A;  3WNE A;  4FM1 A;  2B5J A;  2YNG A;  4FZX C;  4TSX A;  1EKE A;  1T8E A;  2YNI A;  3OYC A;  5C24 A;  1HRH A;  1TKD A;  4CJQ A;  3NHG A;  3E01 A;  1U48 A;  1SL0 A;  3D0P A;  1QQC A;  4CGD A;  1NOZ A;  4CGI A;  1ASW A;  5KGX A;  2D5R A;  4O55 A;  4DTP A;  4ZTJ A;  1RBT A;  1U47 A;  3ZT0 A;  2KTQ A;  4Z4E A;  3OS2 A;  2X74 A;  4DTR A;  3K5L A;  4M42 A;  2VG5 A;  2DY4 A;  3LP0 A;  1NJX A;  5CZ2 A;  4O5B A;  2YHB A;  3IS9 A;  1JLB A;  3OYH A;  3JYT A;  3SQ1 A;  4QOZ B;  3NBP A;  1KCF A;  1VSI A;  3HVR A;  4DQP A;  3TI0 A;  1LWC A;  2ITG A;  3MAQ A;  1NKC A;  4DSI A;  2VWJ A;  4CHY A;  1BHL A;  1S1W A;  4MQ3 A;  1YVU A;  3NGZ A;  2XY5 A;  4FJ7 A;  3RTV A;  4DU1 A;  3L2U A;  1VSD A;  3VQ6 A;  4HCC A;  5J1E A;  3ISN C;  4FLZ A;  3HP6 A;  3V9U A;  4JRP A;  3V1Q A;  4O44 A;  3QES A;  1SKW A;  4N47 A;  2IAJ A;  1CZB A;  2VG6 A;  2KW4 A;  4KHS A;  4DTU A;  3QLH A;  3C6U A;  3ZT3 A;  4B9L A;  4CJL A;  2HB5 A;  3KK1 A;  4DQQ A;  2I5J A;  1WAF A;  4C8M A;  1ZYQ A;  1HQE A;  2HHT A;  3RRH A;  1TAQ A;  2YHA A;  2IDO A;  4M3W A;  4FJ8 A;  3TAM A;  4NYF A;  4AHT A;  5KRT A;  4FJM A;  3HL8 A;  2HNZ A;  3AO4 A;  4B8C A;  1NOY A;  5SWM A;  1VSK A;  1C1C A;  4W5Q A;  1S9E A;  3AA2 A;  3I8D A;  4M3Z A;  4DSL A;  3DOL A;  4E89 A;  1T03 A;  2G8W A;  4OPK A;  3KLE A;  1A5X A;  4JLH A;  3WNF A;  4R5P A;  1JLG A;  3MEG A;  4W5T A;  4E3S A;  3AVH A;  2PYL A;  4DQI A;  3VQC A;  2IGI A;  4DWI A;  1X9S A;  3OYE A;  1QSL A;  4C8K A;  5J2P A;  4IKF A;  3NF8 A;  3SUP A;  4CJP A;  2ZE2 A;  3DLG A;  4FJK A;  2FBX A;  4FLU A;  3RWU A;  4J2B A;  4QCL A;  3C95 A;  1VRT A;  4E7H A;  1C6V A;  3U3G A;  3AVB A;  3HT3 A;  5HRO A;  1RT6 A;  3ZT2 A;  5E41 A;  2B4J A;  2XRI A;  4Y1D A;  2G8F A;  2YKN A;  4I2Q A;  4DLG A;  1L3U A;  4OGC A;  4CFC A;  3KTQ A;  4ELV A;  1DTQ A;  3CG7 A;  1YTA A;  4Y1C A;  1HYV A;  4CFD A;  4KO0 A;  1FKO A;  2BE2 A;  4B9V A;  4B08 A;  1FK9 A;  2X6S A;  2KZZ A;  1S6P A;  4KI6 A;  1YT3 A;  1BGX T;  1S1T A;  2JLE A;  1S1U A;  3V4I A;  2D0C A;  1SUQ A;  4KTW A;  3ZT1 A;  4CED A;  1JLC A;  1LWF A;  4AIL C;  4FYD A;  3T3F A;  1RDD A;  2PZS A;  4PWD A;  3WNG A;  2KFN A;  3T19 A;  4CJF A;  1G15 A;  3LAM A;  3PUF A;  4ID5 A;  1NK7 A;  4KHN A;  1WAJ A;  1WNS A;  3OYD A;  1RBU A;  4EP5 A;  1KVA A;  3KLG A;  5FRM A;  1HYZ A;  2RN2 A;  4E1N A;  4O0I A;  1VRU A;  3CQ8 A;  4PQU A;  1HMV A;  2XY8 A;  4LD0 A;  3VQ4 A;  3P1G A;  4DQR A;  2Y1J A;  1D9D A;  4Q5V A;  1C0U A;  4DSE A;  4RG8 A;  5J2N A;  4FJ5 A;  2OYQ A;  2GUI A;  1RT5 A;  1RBR A;  1VSJ A;  3MED A;  3NCI A;  4NCG A;  5C25 A;  4IFV A;  3TR8 A;  1Z26 A;  1TVR A;  1XC9 A;  3MXJ A;  1HNI A;  1KVC A;  1L5U A;  2EHG A;  3CYM A;  4HCB A;  4NCB A;  3ZSX A;  1X1P A;  1NKB A;  1S1V A;  4H8K A;  1S9G A;  1WSE A;  3P83 D;  3KD1 E;  3B6P A;  4C8L A;  4DF8 A;  1Q9X A;  1KSP A;  2P51 A;  1EXQ A;  2DFF A;  3LPT A;  1WN7 A;  1C0T A;  4YFU A;  3L8B A;  4DFM A;  2O4I A;  3O4N A;  2FBT A;  4IG0 A;  3ZSW A;  1GOC A;  4AHS A;  3RR7 A;  2P1J A;  2ZD1 A;  2HNY A;  4DFP A;  4FJG A;  3OS1 A;  2X6N A;  4JRQ A;  5HRR A;  3DLK A;  3HVT A;  4DMN A;  3ZSR A;  5KI6 A;  1NK8 A;  2HND A;  2IOC A;  2YV0 X;  2G8U A;  1ZBH A;  3V1O A;  3V81 A;  4J2A A;  1J9A A;  4ZTF A;  1I39 A;  3OYJ A;  1IO2 A;  4CHP A;  4Z4F A;  3DOK A;  5FDL A;  4CER A;  4CJ5 A;  2O4G A;  3EY1 A;  2R7Y A;  3SPZ A;  4KHQ A;  4N56 A;  3IAY A;  5DMR A;  3QEW A;  1RDC A;  2YKM A;  3IG1 A;  2HMI A;  4FJJ A;  4I9Q A;  4MFB A;  1UA1 A;  2G8V A;  2OPP A;  3LAN A;  1BI4 B;  3LP1 A;  1ZBL A;  2Z1I A;  1IKW A;  1RBV A;  4M41 A;  3SQ4 A;  4J2E A;  3F73 A;  3AO3 A;  3AVI A;  4CEQ A;  3PX4 A;  3MXI A;  1UA0 A;  4KAZ A;  2OPR A;  4OPJ A;  4KFB A;  1KVB A;  4BAC A;  4C8O A;  4BWM A;  1CLQ A;  3VQ8 A;  1C1B A;  2LSN A;  5KTQ A;  1BQM A;  4XIU A;  4KTZ A;  2XY6 A;  4FXD A;  3PO5 A;  1RDB A;  2ZQB A;  1SV5 A;  4CEB A;  1XHZ A;  3QIP A;  2HHW A;  3OY9 A;  3SNN A;  3OS0 A;  3PX6 A;  4AHV A;  1T7P A;  1QS4 A;  1VSH A;  4RW8 A;  3ASM A;  4B8A B;  4RW9 A;  1BCO A;  4E7L A;  3HK2 A;  3RRG A;  1VSL A;  2WON A;  3A2F A;  3AVG A;  4CF9 A;  4FJH A;  2RPI A;  4E7K A;  1TGO A;  3AVK A;  4M3T A;  2HW3 A;  4G1Q A;  4KHY A;  1U4B A;  3KKR A;  5EU7 A;  3DM2 A;  2FC0 A;  3VQB A;  3QNO A;  1X9W A;  5JS1 A;  3VQ9 A;  3SCX A;  2IC3 A;  2WOM A;  3NFA A;  5HRN A;  1Q9Y A;  5SZT A;  3NE6 A;  4FW2 A;  4GW6 A;  4DU4 A;  4N76 A;  1RTH A;  4ELU A;  4LSL A;  4QAG A;  3ZSV A;  4KHU A;  2Y1I A;  2G8H A;  2OZS A;  3K59 A;  1GOB A;  3S3O A;  1WSJ A;  4BWJ A;  4PA1 A;  1JLA A;  2VWK A;  3THV A;  1LAW A;  4CIE A;  3V9W A;  3KD5 E;  4K8Z A;  4PUO A;  3B6O A;  5JS2 A;  3L2R A;  3LWM A;  2OA8 A;  1VSF A;  3WNH A;  1RTD A;  3S3N A;  2F8T A;  4KB1 A;  3NF9 A;  3V1R A;  1UOC A;  4DQS A;  4IG3 A;  3S9H A;  2G8I A;  4FJI A;  3NGY A;  3NH2 A;  3OYM A;  5CZ1 A;  4CEA A;  4FK2 A;  3DI6 A;  1REV A;  3ALY A;  2VG7 A;  5HRP A;  4CFB A;  4BDP A;  1IH7 A;  4DSF A;  4AH9 A;  3DLH A;  2D0B A;  1QTM A;  4N41 A;  1RT2 A;  2OPS A;  4Q0B A;  1XWL A;  1TL3 A;  2QKB A;  3OYG A;  3AVM A;  5J2M A;  3U3Y A;  1JKH A;  4DG1 A;  4HHT A;  4FM2 A;  4DFK A;  2JGU A;  3LPU A;  1QHT A;  1NJZ A;  1WSI A;  4LY7 A;  4JS5 A;  1CZ9 A;  3V9Z A;  2X78 A;  2RKI A;  3SUO A;  3TAN A;  3SYZ A;  4RW4 A;  3TAF A;  1RT3 A;  1NK6 A;  3I0R A;  3MEE A;  1B92 A;  4DLE A;  4JS4 A;  4DS4 A;  1NJY A;  4W5R A;  1B9D A;  5CYQ A;  1J53 A;  4EZ9 A;  3QO9 A;  3AVF A;  3KJV A;  5HBM A;  1KLN A;  3KIO A;  5C42 A;  1D9F A;  1VK0 A;  2F96 A;  3SI6 A;  2BDP A;  1HQU A;  3NH1 A;  1QSY A;  3CFP A;  1W0H A;  3AO5 A;  1EET A;  5I42 A;  1GOA A;  1EP4 A;  3LZJ A;  3DLR A;  4CCH A;  1LWE A;  2KZM A;  1HYS A;  1TKZ A;  5HP1 A;  4I9L A;  2HHQ A;  3C94 A;  4ICL A;  1HPZ A;  1W9H A;  3KK3 A;  4FK0 A;  3V6D A;  3RR8 A;  3KLI A;  4CK1 A;  4F4K A;  1ZBU A;  1MU2 A;  3V9S A;  3AA4 A;  3K58 A;  3HP9 A;  1RTI A;  1HNV A;  4O0J A;  4CIF A;  3OYI A;  1SKS A;  1JXE A;  2XHB A;  4M3Y A;  1BL3 A;  4N5S A;  1TK0 A;  3O3H A;  3QEI A;  3QNN A;  2HHU A;  2Z1G A;  3SUQ A;  4HVJ A;  3PV8 A;  1N6Q A;  3TAB A;  4NYN A;  4DFJ A;  4BDZ A;  1X9M A;  1JL1 A;  3ZT4 A;  3VQQ A;  3PX0 A;  1IKY A;  4FZZ A;  4OLA A;  1BIZ A;  2XO7 A;  1U45 A;  1TK5 A;  2HHX A;  4DTX A;  3VN5 A;  4CGG A;  1RCH A;  2E6L A;  5DK5 A;  4CF8 A;  3NAE A;  4W5O A;  2KFZ A;  2QKK A;  3LZI A;  4CEZ A;  1SL2 A;  3PO4 A;  4CF1 A;  3OJU A;  1RT7 A;  3AVL A;  4DF4 A;  5KGW A;  4DTM A;  2HHS A;  4CIG A;  4LH4 A;  3NDK A;  3DRS A;  4K8X A;  1Q8I A;  4HUF A;  1DTT A;  4L8R B;  3HPG A;  3HST B;  2A1S A;  3AVC A;  4DU3 A;  4E19 A;  1RNH A;  1T05 A;  3ZSY A;  3LAK A;  2GBZ A;  4E1M A;  4CEO A;  4HUG A;  4F8R A;  1TKT A;  3OVN A;  4LH5 A;  2AJQ A;  4KRE A;  3VQ5 A;  4F2R A;  1HJR A;  3C6T A;  4CJ3 A;  3JSM A;  3M8Q A;  4CK2 A;  3SQ0 A;  3QEV A;  1R0A A;  4ELT A;  2D0A A;  3F9K A;  5CYM A;  1I3A A;  1ZBF A;  3QIO A;  1IKV A;  2KQ2 A;  3QIN A;  4BE1 A;  4GVM A;  3L2Q A;  1K6Y A;  3ZSZ A;  3VQD A;  4LSN A;  2Z1J A;  3KLF A;  1D8Y A;  4F3T A;  1S6Q A;  3G10 A;  3RMC A;  4BE0 A;  1ASV A;  1RTJ A;  2OZM A;  3MXM A;  4W5N A;  3L2V A;  1IKX A;  1S1X A;  3CM6 A;  3KK2 A;  1KFD A;  3H08 A;  3NF7 A;  1QSS A;  3VQE A;  1UWB A;  3QEP A;  3D45 A;  3U6F A;  4PY5 A;  3AO1 A;  1CXQ A;  3VQA A;  3QET A;  4HTU A;  3O4Q A;  3LDS A;  1BIU A;  4CJW A;  4EP4 A;  3O3G A;  3M8S A;  5FRN A;  3EZ5 A;  1YTU A;  3VQ7 A;  3K57 A;  3OYA A;  3VA0 A;  1Y97 A;  4CJV A;  2HHV A;  2BGG A;  3RMA A;  2E4L A;  4FLW A;  1JLF A;  3KLH A;  3SUN A;  5D3G A;  4B3O A;  1WLJ A;  3TAE A;  3CFO A;  4IDK A;  3HXM A;  4CJR A;  3OYK A;  3HM9 A;  4M3U A;  1A5W A;  4M3R A;  4F3O A;  1BCM A;  2DFH A;  2DFE A;  4KKO A;  3ITH A;  2E6M A;  1VSE A;  5KRS A;  3DLB A;  4B9S A;  4CJS A;  4AHC A;  2ATQ A;  3EYZ A;  3NGI A;  4RW6 A;  1NKE A;  3AVA A;  2EX3 A;  4B9N A;  4UQG A;  3RMD A;  4AHR A;  1J5O A;  3I0S A;  1N5Y A;  2QK9 A;  1LW2 A;  1TK8 A;  2OPQ A;  1U49 A;  4CHQ A;  1WSG A;  3SZ2 A;  1UAX A;  2B6A A;  4OJR A;  1C0M A;  2P5G A;  1IG9 A;  3V9X A;  4KTQ A;  3LP3 A;  3IRX A;  1LAV A;  2XY7 A;  1RDA A;  4BDY A;  3SJJ A;  3LWL A;  4OKJ A;  4CGH A;  4FJX A;  4FK4 A;  4DTO A;  4FLV A;  3SPY A;  3QEX A;  4B9T A;  3ZCM A;  1S5J A;  4FLY A;  1JL2 A;  1BI4 A;  1RT4 A;  4IBN A;  3K5O A;  1VSM A;  3M8R A;  1NK5 A;  3TAR A;  4CJU A;  2PYJ A;  3RMB A;  4F2S A;  5T7B A;  3T1A A;  3TAQ A;  4E7J A;  1KLM A;  3DLE A;  4FJL A;  5I3U A;  1L3S A;  4CEC A;  4CF2 A;  1TL1 A;  1L3V A;  1O1W A;  3HPH A;  4DTS A;  1SKR A;  4M3X A;  1LV5 A;  4CES A;  3AVJ A;  4KI4 A;  1A5V A;  1D5A A;  4FJ9 A;  3HO1 A;  4CE9 A;  2GV9 A;  4Z4H A;  4FLT A;  4ZHR A;  3O3F A;  3LAL A;  1J54 A;  1BQN A;  3DYA A;  3DMJ A;  4O4G A;  1JLE A;  3S3M A;  1BIS A;  4Z4G A;  3ULD A;  1XI1 A;  3L3U A;  5HRS A;  3FFI A;  4DSJ A;  3AA3 A;  4CJE A;  1JXB A;  3AO2 A;  3DRP A;  4YNQ A;  4CGF A;  2A1R A;  3HYF A;  3CM5 A;  4J2D A;  1KRP A;  4CEF A;  4FJN A;  4KV8 A;  3NH0 A;  3OYB A;  4GMJ B;  1DLO A;  1FKP A;  4CEE A;  4CGJ A;  4ID1 A;  4FCY A;  1KFS A;  1U04 A;  4E0D A;  4OKE A;  3L2W A;  4C8N A;  3OYN A;  2QXF A;  3K5M A;  4E7I A;  1TKX A;  3ZSO A;  5HLF A;  3L3V A;  2RF2 A;  2FBY A;  3HPO A;  4IFY A;  3HJF A;  4Z4C A;  1SL1 A;  1ITG A;  1JLQ A;  1TV6 A;  3OYL A;  4DS5 A;  2YNH A;  2P5O A;  4CHO A;  1WSF A;  4H4M A;  4CJK A;  2ETJ A;  3K2P A;  4OGE A;  4Z4I A;  4FLX A;  3TAP A;  3TAG A;  1KTQ A;  4DSK A;  1NK9 A;  1LW0 A;  4CHN A;  2HVH A;  4DTN A;  3VA3 A;  1ASU A;  1Z25 A;  2PY5 A;  2HVI A;  5FRO A;  1F21 A;  4EZ6 A;  3AV9 A;  3SV3 A;  4FW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...