4CGIA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
154
structure length
150
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 53
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cgiA00
5HP1A 3SQ4A 1JL1A 4B3OA 3ZSZA 3ZSXA 3LZJA 4JRQA 5I42A 2PZSA 1JL2A 5EU7A 4FJXA 4CJQA 4NCAA 5J2NA 4KHUA 2HHSA 4CHPA 3LPTA 3SUNA 1XWLA 3DMJA 3S3MA 4DSFA 3SJJA 2D5RA 1VSDA 4O5BA 1REVA 4HCCA 3DLKA 2HNZA 1NK4A 3RMDA 1VSEA 4N47A 3AA2A 1Q8IA 3KD5E 2ZE2A 4ID1A 1C1AA 4QAGA 5DMRA 1JLCA 3QEIA 3HT3A 4FZYA 4E7IA 1JLGA 1SV5A 4NCBA 3AO2A 2KFZA 4F2SA 4O0IA 3U3YA 1RT1A 4PWDA 1ASWA 4B9LA 4FZXC 3HPOA 3LDSA 2O4GA 1KRPA 4Z4HA 3OYKA 2OPSA 3SZ2A 1WSJA 4RW9A 3AA5X 3ZCMA 4DTXA 3AO5A 4FJ5A 1KTQA 3RRGA 2P5GA 3L2UA 3VQQA 4C8KA 4KI6A 1CZ9A 1ITGA 1TKZA 3G0ZA 1S6PA 3WNGA 3ZT2A 3M8RA 4CEEA 4CF9A 1RT5A 4CIEA 4C8OA 4RW6A 4BDPA 1QSYA 2XY6A 3AVLA 5KI6A 3RWUA 3C94A 4CECA 4I9LA 2FBXA 3LWLA 1J5OA 2ITGA 4L8RB 4CJRA 4FJJA 3OYBA 1FKOA 3T19A 3LALA 3S3OA 4CJWA 1F21A 3ZSYA 4OPKA 3K5MA 3LANA 4CGIA 3RMAA 1X9MA 4HUGA 1SL2A 4NYFA 1BHLA 3HL8A 4BE0A 2ATQA 1NK8A 4I9QA 2AJQA 1VSJA 2FC0A 3ALYA 3KLIA 3K58A 5HLFA 2OPRA 4JRPA 1IH7A 4Q5VA 1GOBA 1QE1A 3LAMA 3K5OA 4FJKA 4FYDA 4DTRA 2VWKA 1S1XA 4B9NA 1BIZA 1WSIA 5JS2A 4ELTA 1U04A 4I7FA 4F4KA 2HB5A 2XY7A 4FZZA 4KHWA 2HHTA 1RDDA 1A5XA 4I2PA 4FM1A 3D0PA 1NKEA 2YV0X 5DK5A 4BDYA 3PUFA 1ZBLA 1D9DA 1BI4A 3NGZA 4J2DA 5SZTA 3VQ9A 2G8UA 4W5QA 4LH4A 1BISA 4KHSA 1J54A 1NK7A 4CCHA 1T03A 4M45A 3K57A 4CF1A 3QIPA 1B92A 5HRRA 3OY9A 1R0AA 3K2PA 4J2BA 4CJLA 3BDPA 4FLUA 4DTNA 4E19A 2HMIA 1Z25A 3KJVA 2XRIA 3SUQA 3RMCA 1U48A 3PO5A 1VRUA 4Q0BA 1VSIA 4GVMA 3CFOA 5KRSA 3KLFA 4DTSA 4EZ6A 2VG5A 3NF6A 4DLEA 2FBVA 1NOYA 4DTJA 3ISNC 4OGEA 1J53A 1MU2A 4MFBA 3DOLA 4O55A 3TAGA 3HO1A 4CJPA 4FK4A 1WSGA 3HJFA 4Y1DA 3OYHA 1J9AA 1EETA 3NCIA 3AO4A 4CJ4A 1UWBA 2B4JA 1U4BA 2VG6A 5J2MA 4KB0A 4E89A 2DY4A 1B9DA 3TABA 2OZSA 4AHCA 1YTAA 3OYEA 1WAFA 1GOCA 4AILC 4KREA 2YNHA 3IRXA 3KLHA 3AVJA 4CJ5A 3JSMA 4YNQA 2PY5A 4CE9A 4M3XA 1EX4A 1S1TA 4RW4A 1JLAA 4FLVA 4FJ7A 1IKWA 4CIGA 4W5OA 3MEDA 3OS0A 2KFNA 3KTQA 3L2QA 1RNHA 1RTHA 1JLQA 4FW2A 4PA1A 4B08A 2F8TA 1N5YA 3AVGA 4LD0A 2HHXA 3AA3A 3QLHA 4OVLA 4E7KA 4JLHA 3OYNA 1TK8A 3FFIA 2KTQA 5KRTA 1UA1A 2F96A 4KI4A 1RBRA 3OS2A 1TKDA 4M42A 4QCLA 3SCXA 4Z4GA 4DQSA 4H4MA 4DWIA 4HCBA 4AHTA 2HHUA 1LWEA 3A2FA 1SKWA 4DSKA 4ELUA 3OYJA 4FM0A 4KKOA 2IS3A 4ZTFA 4CEQA 3DRRA 4KRFA 1JLEA 3ZT3A 3TI0A 4DQPA 3AO3A 2HHWA 2D0CA 3IS9A 3RR8A 3HPHA 2O4IA 1HJRA 2DFEA 3I0SA 3OYMA 3V1QA 1TK5A 4IKFA 1TAUA 3VQBA 1VSMA 2HNDA 1JXEA 2XY8A 1FK9A 1LAWA 3KKRA 1VSFA 4DSIA 4FK2A 4BDZA 3BGRA 3DLRA 4NCGA 2KW4A 3NHGA 2BANA 2YHBA 4HUEA 4B9SA 3O3FA 3QIOA 1KFDA 2WONA 4CEFA 3DLBA 4AH9A 1JLFA 2GBZA 4W5TA 4PQUA 1TL1A 3L2RA 3B6OA 3KK2A 3AVHA 3ZSOA 2YHAA 3CQ8A 4UQGA 2I5JA 1LWFA 3QINA 4R5PA 4AHVA 3TAQA 5J1EA 2G8KA 3QERA 3HK2A 3OVNA 1LWCA 4CESA 4ICLA 4WE1A 4FLWA 1XI1A 3VQ7A 1U47A 2XO7A 1GOAA 4NYNA 3TAMA 1RDCA 3AVIA 5CYQA 1TL3A 3LP1A 1NK9A 3RR7A 4E7JA 5HROA 3NF8A 4OKEA 1BGXT 2E4LA 1T7PA 5JS1A 3V9XA 3LP2A 4IG3A 1Y97A 2YNGA 1WN7A 1DLOA 3QESA 2ETJA 3OYCA 4B9TA 3V9SA 1EP4A 1HNVA 4DLGA 1C0UA 3MXIA 1RBUA 3PO4A 1TKXA 1HRHA 3SUOA 2E6MA 1NK6A 4DU4A 1L3VA 1KFSA 4J2AA 4RW7A 4FJ9A 1S1WA 1CZBA 1C0TA 4CEBA 4N41A 1VRTA 4IBNA 1TVRA 2IDOA 3SPYA 1TV6A 3QO9A 1C1CA 3ASMA 4HHTA 3NDKA 4CF2A 4DFPA 1RT7A 3DOKA 4GMJB 3P5JA 4CIFA 4M3YA 1LW2A 1KVCA 4KPYA 1W9HA 4CGHA 3DRPA 4KTQA 2LSNA 4W5RA 4PUOA 5D3GA 2HHVA 4FJIA 3MXJA 4F3OA 3DLGA 3OYGA 3I0RA 1NK0A 4ZHRA 4B9VA 1A5WA 4AHSA 1RCHA 3HP9A 3VQ4A 3VQEA 4M3UA 4FLZA 1RT4A 3U6FA 4OLBA 4ELVA 5CY4A 1D8YA 1T8EA 1D9FA 2NUBA 3HVTA 2GV9A 3ZT1A 1U45A 3IAYA 4B8CA 3SUPA 3OYFA 1ASUA 2IGIA 5C24A 1HQEA 5K14A 3NH1A 3SV4A 3AVFA 1NJZA 1RTJA 2OYQA 1LAVA 2QK9A 2KZZA 1HMVA 3OJUA 1KVAA 2YKMA 2XY5A 3HPGA 3L2VA 3TAEA 4Y1CA 4IG0A 1RBVA 3M8SA 2DTUA 3SI6A 3I8DA 4KO0A 5SWMA 1TKTA 4CEOA 1T05A 4DTOA 4JS5A 4DU1A 3SNNA 3NF9A 4BWMA 1TAQA 1QS4A 4CEAA 1RT6A 4LH5A 3NAEA 1O1WA 3OYIA 4FJ8A 1S6QA 1SL0A 1EKEA 2OPPA 1YVUA 3F73A 1K6YA 2Q3SA 4CEDA 1NKCA 3V9ZA 3CYMA 4IFYA 4EP4A 3DLHA 4BWJA 3CG7A 2HNYA 5C42A 1CXUA 4B9UA 1S1VA 3AVBA 1U49A 2G8HA 2Y1JA 1HNIA 4I2QA 4H8KA 3PX6A 1WSEA 1DTQA 1IO2A 2Z1GA 2ZD1A 3SYZA 2OA8A 4KFBA 1S5JA 3AVNA 2G8FA 3VQPA 1CLQA 3DM2A 3F9KA 3K5LA 1BI4B 1ZBIA 3U3GA 3KKSA 3NF7A 4CGJA 4FK0A 4CHOA 4J2EA 2X6NA 3L3UA 1S1UA 5J2QA 4FJNA 3QNOA 4M3TA 3V81A 2Z1HA 1Z26A 3M8PA 1SL1A 4G1QA 2X78A 3QETA 5KGXA 3MXMA 1KCFA 1S9EA 2Z1JA 3ITHA 1N6QA 3L8BA 1RT2A 3V4IA 4CF8A 1ASVA 3CM6A 4BACA 1VSKA 4FVMA 4E1MA 4DTPA 5HRNA 4EP5A 5T7BA 3CM5A 4OKJA 4DF4A 2QXFA 4RW8A 3KIOA 3RTVA 4DS5A 1UA0A 3O4NA 5J2PA 4KHYA 3AVMA 3ZSRA 3P1GA 3QNNA 4ZTJA 1L5UA 4F2RA 4FLXA 3TAFA 1YT3A 4CERA 3S9HA 4YFUA 2ZQBA 3HVRA 4O4GA 2B5JA 3KLEA 4DFKA 4DMNA 3CFRA 3EY1A 3KD1E 4H4OA 2YKNA 1IG9A 1SKRA 4F3TA 4CJFA 1EXQA 1RBTA 2RPIA 2P5OA 3OYAA 3SPZA 4EZ9A 3B6PA 5FRMA 3QEPA 4FXDA 3MEGA 4AHRA 1NJXA 4N56A 3DRSA 3LPUA 4CHQA 4K8XA 2G8IA 1ZBHA 5CZ1A 1Q9YA 1NKBA 1QSSA 4IDKA 4KHQA 1QQCA 4DU3A 2KQ2A 5FDLA 3VQ8A 3V6DA 2IOCA 4JS4A 2A1SA 3DYAA 4CJTA 4DG1A 4KB1A 3O3HA 3QEWA 2A1RA 1TGOA 3WNFA 1L3UA 5FROA 1WSHA 5HBMA 4Z4IA 3RMBA 1G15A 4DTMA 3MAQA 3AVKA 3V1RA 3OS1A 1S9GA 4CK1A 3P83D 3HM9A 3RRHA 3D45A 1NJYA 3AV9A 3ZSVA 3ZT0A 4QOZB 1TK0A 1BCMA 4LSNA 1I3AA 3O4QA 4FW1A 4CEZA 1RTIA 1X9SA 3HP6A 5KGWA 3SQ0A 1WAJA 2GUIA 3DLEA 1RDAA 4M3ZA 3ULDA 1HPZA 2HVHA 1I39A 3NE6A 3SQ2A 1HYVA 4E3SA 3G10A 3VA3A 4CHNA 4AHUA 4DS4A 3E01A 3NH2A 3NH0A 1RT3A 2G8VA 2Y1IA 1QTMA 2DFHA 5CYMA 2YNFA 3MECA 2EHGA 2PYLA 2R7YA 1XC9A 1UAXA 3KLGA 1FXXA 1ZBFA 2VG7A 4KTZA 2OPQA 2QKKA 2PYJA 4F8RA 3C95A 4K8ZA 3TAPA 4CK2A 2RF2A 1L3TA 2JGUA 3EZ5A 3THVA 3AO1A 5E41A 4DSLA 1C0MA 5I3UA 1KVBA 3M8QA 4TSXA 1JXBA 4Z0UA 3VQDA 1BQNA 2P51A 4CJKA 4CJSA 3NGIA 4DFMA 1A5VA 3QEXA 1KLNA 5HRPA 3ZSQA 4FJMA 4DQRA 1RILA 1QSLA 3ZSWA 3NFAA 4PY5A 3TWHA 1SUQA 4C8MA 3LP3A 4OLAA 4E7LA 1UOCA 1VSHA 1BL3A 3V1OA 4CFAA 2B6AA 4E7HA 1WNSA 1KLMA 4CHYA 4N5SA 4FJLA 4M41A 3HXMA 4E0DA 3CFPA 4CGGA 4IFVA 5HRSA 1YTUA 1QHTA 4E1NA 3QEVA 1WSFA 3ZT4A 4DTUA 3H08A 3OYLA 3EYZA 4DF8A 1KSPA 4FLYA 2HHQA 3NGYA 4CJ3A 3K5NA 2EX3A 1C6VA 3LP0A 4CFDA 4BE2A 3OYDA 1WLJA 3V9UA 3SQ1A 2X74A 2RN2A 3UIQA 4LY7A 2D0BA 3VQ6A 1RBSA 2VWJA 1XHZA 4CGFA 3KK3A 4W5NA 1DTTA 4MQ3A 3T1AA 1NK5A 4N76A 1IKVA 2IAJA 3C6UA 4KV8A 1L3SA 4M3WA 1B9FA 3AA4A 3WNHA 2Z1IA 2XHBA 4FJGA 2F8SA 4CK3A 4O0JA 1HYSA 4C8NA 4CJUA 2W42A 4DQQA 2QKBA 1NOZA 1LW0A 1BQMA 5FRNA 4OGCA 2FBYA 1NJWA 4KAZA 1RDBA 1HYZA 2DFFA 3K59A 4B8AB 4DSJA 4KTWA 1JLBA 3AVAA 2HW3A 2BGGA 3MEEA 3PX0A 4C8LA 2D0AA 3L3VA 2G8WA 2BDPA 3PY8A 1VK0A 4FJHA 1FKPA 2RKIA 4B9MA 1SKSA 1BCOA 4OPJA 1BIUA 1X1PA 3T3FA 3VN5A 3V9WA 3O3GA 3WNEA 2IC3A 3VQ5A 5C25A 3TANA 2P1JA 2FBTA 4DSEA 4HVJA 4HUFA 1XHXA 4O44A 3C6TA 4ID5A 3KK1A 4GW6A 4CGDA 4FM2A 4FLTA 3TR8A 3OJSA 1IKYA 1HQUA 3VQAA 4Z4FA 2HVIA 3HYFA 4DFJA 3S3NA 4XIUA 3LWMA 4LSLA 4Z4CA 1C1BA 5CZ2A 3SV3A 1ZBUA 4DQIA 4Z4EA 4RG8A 2BE2A 3LZIA 2E6LA 2JLEA 1X9WA 4CFCA 1RTDA 4CHZA 1LV5A 1JKHA 3HSTB 4M3RA 2YNIA 1ZYQA 1VSLA 3PX4A 1CXQA 3DI6A 4OJRA 3VA0A 3PV8A 4BE1A 4CFBA 4FCYA 3VQCA 2OZMA 4HTUA 1W0HA 4CF0A 2KZMA 3JYTA 4CJVA 1Q9XA 3TARA 5KTQA 3AVCA 4OKKA 4CJEA 1D5AA 2WOMA 3LAKA 1IKXA 3IG1A 3L2WA 4KHNA 3NBPA 2X6SA
chains in the Genus database with same CATH superfamily
3H1QA 4B3MK 1K9MO 1JL1A 4B3OA 2HF4A 3LZJA 2PZSA 5AQTA 4KHUA 4CJQA 5J2NA 3LPTA 1XWLA 4DSFA 5C10A 4B3RK 1IG8A 2HNZA 3AA2A 2P9PB 1Q8IA 5JVGL 1O13A 1YIJN 1SV5A 1XQSC 1KC8O 3O1WA 4F2SA 3EE8A 4FZXC 1DEJA 3SZ2A 1WSJA 1IJJA 3ZCMA 3RRGA 4KI6A 3SMPA 1ITGA 1S6PA 1FJGK 3ULEA 3WNGA 3ZT2A 3M8RA 5EOYA 4RW6A 4BDPA 2XY6A 3AVLA 1T6CA 3RWUA 3MCPA 3QB0A 4BR9A 3WT0A 4CJRA 4H5VA 1FKOA 4LF7K 2QI2A 3EZWA 3LANA 3T7ZA 1BHLA 1VSJA 1NG9A 1TYQA 1QE1A 4FYDA 4DTRA 1BIZA 1WSIA 3FZKA 5JS2A 4I7FA 4KHWA 3H3NO 3D0PA 1NKEA 2YV0X 1D9DA 2W6LA 3NGZA 4LH4A 2QTDA 4LFCK 1BISA 1J54A 4MLHA 3DLLL 3GBTA 3S41A 4FPAA 3D2FA 1Z25A 3J7ZO 3P39A 3NF6A 4DLEA 1MU2A 3ID6A 3NCIA 3LM9A 4KH4A 4AHCA 3OYEA 4JKGB 2YNHA 4DR1K 2UUAK 2Q97A 4CE9A 1T44A 3TPQA 4K0KK 1IV0A 4RW4A 4FLVA 4FJ7A 3K9KA 2KFNA 3KTQA 2D0PA 3DXMB 3AVGA 5DM7L 4IEEA 3O5BA 4JLHA 4DV5K 4DB3A 3SJHA 1TKDA 1YUWA 4H4MA 5AJ3K 4B1VA 4ELUA 4GV6A 2P9PA 4LF5K 4CEQA 3DRRA 4DQPA 3LDNA 3RR8A 1HJRA 2DFEA 3I0SA 3U8XA 1HR0K 1FK9A 4FK2A 4DSIA 4NCGA 3NHGA 2YHBA 3O3FA 4DR6K 1VQ8N 3MN9A 3HI0A 3DLBA 5F2RA 5AQZA 3ID8A 3BF1A 3L2RA 4H0XB 4CD1A 3ZSOA 2YHAA 5HOOA 2I5JA 3TAQA 1N36K 3QERA 4CD3A 1T3VA 1XC3A 5LL6Z 1LWCA 3VOVA 1U47A 3VQ7A 2QA4N 5CYQA 3LP1A 4A2AA 4E7JA 2A6AA 3LP2A 1Y97A 1V4TA 3OYCA 4B9TA 1MA9B 1HNVA 4DLGA 3MXIA 4BRPA 3H45C 1TKXA 2NRXA 4CBWA 4AF1A 5BPNA 4N41A 1ESVA 3NDKA 4CF2A 4CZLA 4WF9L 1LW2A 4KPYA 1W9HA 5AZIA 5BR8K 2HHVA 2Q2RA 4FJIA 4F3OA 3DLGA 1A5WA 3OHRA 4AHSA 3CCRN 3VQEA 4FLZA 3U6FA 1D9FA 1N33K 1U45A 2IGIA 5C24A 2P9LB 3AVFA 2OYQA 4G9ZA 2KZZA 1HMVA 3L2VA 4MDBA 4IG0A 2HBKA 2DTUA 4QS7A 2YJEA 1T05A 3CC7N 4JS5A 2E20A 4DU1A 2E2OA 2P9SB 1EQYA 4CEAA 4DR3K 4JI8K 1KXPA 1DKGD 3G25A 1YVUA 5C12A 1K6YA 5BPMA 3CG7A 2F7TA 2HNYA 5AQKA 4JK8A 3U4LA 3L0QA 4FL9A 4B9UA 1S1VA 4OO1J 1DTQA 3J81O 1VQ4N 2G8FA 2YHYA 2Q31A 5TKWA 3K5LA 3SK3A 1ZBIA 3U3GA 2FSKA 4QS8A 3WXMB 3CCUN 3L3UA 1S1UA 2UYTA 1YI2N 2P9UB 3V81A 1KD1O 2Z1HA 4G1QA 4EAHD 3M3ZA 3ZETB 3TSUA 3ENOA 2ZJPL 4BACA 1HPMA 4FVMA 4DTPA 5HRNA 5T7BA 1H1VA 4JI7K 3MDQA 5FLXO 5J2PA 3ZSRA 3QNNA 5BRFA 5AFUA 3S9HA 4DR2K 3HVRA 4O4GA 3CFRA 1NJIO 2A5XA 5KPZA 2EWSA 4CJFA 5FPDA 4JKEA 4JD2A 2VWBA 3PIPL 2WTUA 3J8AA 3MEGA 5HL7L 1NJXA 1V4SA 3B8AX 3DRSA 4BRIA 4CHQA 4K8XA 2G8IA 1Q9YA 1NKBA 4IDKA 3VPZA 2HF3A 4FWNA 4PL8A 4B1YB 2QW9A 4DG1A 5I9EB 3O3HA 1TGOA 3NVKA 5FROA 3R3LA 2ASMA 1G15A 3N4PA 1CZAN 3HM9A 4I6MB 3AV9A 3ZT0A 1TK0A 4GNIA 3O4QA 2CH5A 1HJOA 3K9JA 3SQ0A 1WAJA 3ULDA 1HPZA 3NE6A 4E3SA 1NLVA 4CHNA 2G8VA 3CERA 5CYMA 3MECA 2R7YA 4DV4K 1ZBFA 4JKCA 2OPQA 3U9ZA 2PYJA 4CZKA 2RF2A 2JGUA 4DUYK 2P9SA 1C0MA 5JVHL 1KVBA 1JXBA 3A8YA 5MLCQ 3D6RA 3WXLA 2YCHA 4C8MA 3LP3A 4OLAA 1VQKN 3CJ7A 3V1OA 3IUCA 4E7HA 1WNSA 4N5SA 3OW2M 4BY9C 4NLBA 1SQKA 1QHTA 1NGJA 3ZT4A 3H08A 3OYLA 4DF8A 2HHQA 4CJ3A 3GL1A 4BRDA 1MWMA 1C6VA 2EX3A 3LP0A 3K5NA 3OYDA 1WLJA 2RN2A 3UIQA 5AQUA 2O8CA 2VWJA 1XHZA 5IT9O 3T1AA 3N4QA 2VCPA 1HKCA 2Z1IA 4H5WA 1HYSA 4C23A 3H46O 1N32K 1JCFA 4RTFD 4DQQA 2QKBA 1BQMA 5M1FA 4B8AB 1VQ7N 4CI6A 2D0AA 2RKIA 4IOCL 1BCOA 3GDQA 4FO0A 1K73O 3VERA 3O3GA 3WNEA 3VQ5A 3TANA 2P1JA 2FBTA 4HVJA 4ID5A 4BR7A 4CGDA 2UXDK 4FLTA 3TR8A 1YJWN 4Z4FA 1HQUA 3E66A 3HYFA 3VEWA 4YOWA 3S3NA 4LSLA 4Z4CA 1C1BA 4A59A 2IIRA 3LZIA 2JLEA 5M1KA 3LDOA 4CFCA 4F9OA 2HBLA 3OTOK 3WXKA 1ZYQA 2VGMA 3PX4A 4GKJK 3CCLN 3VA0A 1M1KO 3KK7A 2OZMA 3VQCA 4DV1K 1W0HA 4I6MA 4CF0A 5CE3A 3JYTA 3LAKA 3Q7BA 5GAGP 4KHNA 3ZLJA 3QLHA 3NBPA 2X6SA 3LDPA 4JI1K 3ZSXA 4JRQA 5I42A 4EIAA 4FJXA 1LOTB 4UY8O 4LF9K 4CHPA 3DMJA 4YOYA 3S3MA 3SJJA 1REVA 4ILGB 5A2QO 3DLKA 1NK4A 1VSEA 5BN8A 4NLCA 3HT3A 4FZYA 3VTIA 4BR2A 1JLGA 4NCBA 3AO2A 2FSJA 3U3YA 1RT1A 4BR5A 4B9LA 4E1JA 2O4GA 5BR9A 4YOTA 4WQ4C 1P8ZA 2JWKA 4RW9A 2P5GA 3CCSN 3L2UA 4C8KA 3RSEB 1CZ9A 3C6HA 4CEEA 4C8OA 1OKJA 1BA1A 2GELA 3CQXA 1R59O 3C94A 4CECA 4I9LA 2FBXA 3LWLA 2HHHK 4CJWA 1ZC6A 4OPKA 4CGIA 1Q7YO 4BE0A 3HL8A 2ATQA 2E2QA 3VEZA 2NRRA 2OPRA 4OPHA 4JRPA 4Q5VA 3T1YK 3K5OA 3NVMA 3VGKA 3T1HK 4B9NA 4ELTA 4F4KA 4M63C 4FZZA 2IVOA 4FM1A 4I2PA 4C1NI 5DK5A 1NGGA 2A41A 2NRHA 5EXWA 3VQ9A 4KHSA 1X3NA 3UKRA 4CCHA 1VQNN 1T03A 3K57A 1B92A 5HRRA 1R0AA 4FWRA 4J2BA 2WFBA 3A5OC 3CCQN 4E19A 1DT9A 2XRIA 3PO5A 5EY4A 4Q0BA 4GVMA 1NOYA 4DTJA 4PY5A 4CJPA 4FK4A 1BWFO 4Y1DA 3OYHA 3AO4A 4FOEA 1T6DA 1UWBA 5J2MA 4KB0A 5KPRA 3CIPA 2OZSA 1YTAA 1WAFA 1GOCA 2RE2A 1IBMK 4KREA 1Q81O 3IRXA 4CJ5A 3JSMA 5E26A 4YNQA 2PY5A 4M3XA 1EX4A 2HOEA 5GADP 1IKWA 3OS0A 1BO5O 1RNHA 4LF6K 1RTHA 4FW2A 4GKKK 3AA3A 4OVLA 4E7KA 4FWPA 3THWB 4K43A 2QWQA 1TK8A 4JI0K 4A61A 2KTQA 2F96A 3MWTA 1OVYA 4CW7B 1HKBA 5ELZA 2VGNA 5M1QA 4DWIA 4HCBA 2NZTA 2HHUA 1SKWA 2O8FB 4FM0A 4KKOA 5BPLA 2IS3A 4JI3K 4KRFA 3TI0A 2O4IA 3PSIA 1TAUA 1VSMA 2HNDA 1JXEA 2PAVA 3F2KA 3ZEUB 4BDZA 3BGRA 1QQMA 1X3MA 2KW4A 1VQLN 2WONA 4WFAL 4CEFA 1JLFA 4W5TA 1KAZA 3B6OA 3KK2A 1RDWX 1RDUA 4R5PA 3THXB 4AHVA 4DV3K 4BQLA 3EO3A 4CESA 4FLWA 4O5FA 4NYNA 1RDCA 3AVIA 2YHWA 1TL3A 1GLDG 4OKEA 1BGXT 2E4LA 1T7PA 3MK6A 3V9XA 5JS1A 2YNGA 1OH7A 3CC4N 1DLOA 4CZMA 5ADXA 2ETJA 1IBLK 3V9SA 4CZGA 3E9OA 1HKGA 3PO4A 1HRHA 1L3VA 1K8KA 1NK6A 4DU4A 4FWKA 4J2AA 4FJ9A 4RW7A 1C0TA 2OTLN 4IBNA 4L3QA 3SPYA 3QO9A 1C1CA 3EL2A 4YOUA 4DFPA 1RT7A 3DOKA 4CGHA 4BRHA 1U2VA 4CVNE 4PUOA 4W5RA 3OYGA 3I0RA 4BRKA 4IO9L 3VQ4A 2NLXA 2KHOA 2AP1A 1T8EA 2NUBA 3IAYA 4YDUA 3FLCO 4RCHA 3OYFA 1ASUA 3UKUB 3SV4A 5K14A 4JAXA 3OJUA 2YKMA 4KH5A 4JNEA 1RBVA 2PBDA 3SI6A 4KO0A 2VYPA 4HTLA 1TKTA 3CMEN 1EWRA 1VQON 3TSPA 3SNNA 2GX9A 3NF9A 1EWQA 1RT6A 1J6ZA 2Q36A 3PIOL 2JWLA 1YHQN 2Q3SA 3DLHA 1NKCA 3CYMA 4IFYA 4NXMK 5C42A 3FR0A 2I7PA 4YHHK 3O80A 4IFEA 2Z1GA 3MMVA 3THYB 3M1FA 2O8FA 1S5JA 2GUPA 1Q82O 4KHPK 1BI4B 1GLCG 4AQYK 4FK0A 4X62K 4CHOA 4J2EA 1Y64A 3HOTA 1W7AA 4GV3A 4FJNA 1NBWA 1YVNA 3M8PA 2P9IB 3QETA 5KGXA 3MXMA 3EKUA 4B1XB 2Z1JA 3ITHA 1ASVA 3QMLA 4IZ9A 4DF4A 1VQPN 3KIOA 4DS5A 3O4NA 4F2RA 3TAFA 4CERA 1JJ2M 2ZQBA 2B5JA 2A40A 3KLEA 4DFKA 4DMNA 3EY1A 2ZJQL 1IG9A 4F3TA 3D2EB 5FRMA 1NMDA 4B1WB 1JCEA 1HNWK 4MO5A 5BRHA 1ZBHA 5FPEA 4KHQA 5DM6L 4DU3A 3EEQA 2UXCK 2KQ2A 5AQXA 4ISFA 4H5TA 4KB1A 3DYAA 4IOAL 3QEWA 2A1RA 3WNFA 5HBMA 5M1NA 4BRGA 4CK1A 3P83D 3D45A 2E88A 2ZJRL 5AQHA 3R9PA 5JLFA 3CJCA 2FSNA 3HZ6A 3O9TA 4Y0WA 3UKUA 1I39A 3VGLA 5C15A 3IKMA 1BUPA 2Y1IA 1QTMA 2YNFA 1TUUA 4B3SK 1XC9A 2VG7A 2QKKA 3LL3A 3C95A 3TAPA 2E5LK 1L3TA 3EZ5A 2HSTA 5E41A 5I3UA 5KQDA 4JKBA 2CGJA 3CCEN 4DFMA 1YAGA 4CJSA 3QEXA 4FJMA 3TTFA 4EFHA 2PFUA 4JKGA 3TWHA 1SUQA 4FWMA 3VENA 3CJ9A 1BL3A 2V51B 2B6AA 4CFAA 4FJLA 4CHYA 1YXQA 1G99A 3HXMA 4E0DA 4K25A 3THYA 5HRSA 2UXBK 2QWPA 1WSFA 4DTUA 4ISEA 1YITN 4PHTX 3SQ4A 4CFDA 3DXMA 4BE2A 3SQ1A 3V9UA 4JI4K 4LY7A 4CGFA 3KK3A 2WC9A 4MQ3A 1XMOK 4W5NA 1NK5A 4KV8A 4M3WA 1ATSA 2F8SA 4M7YA 4CK3A 4CJUA 1LW0A 4ISGA 5FRNA 3KWIA 4WFBL 3BP8A 4JI2K 1RDBA 1HYZA 4NB4A 4DQ8A 2DFFA 1FW6A 3WQUA 3AVAA 1WBBA 2E2NA 3L3VA 1BU6O 1EO1A 1NGFA 5AQYA 3V9WA 2E1YA 4DSEA 4HUFA 1XHXA 3C6TA 1KAYA 4KBOA 4FM2A 3OJSA 3VQAA 2HVIA 3WXIA 3LDLA 4BR4A 3SV3A 1RGIA 2BE2A 1W2BM 4JEPA 1MWKA 4H5RA 5AR0A 3L4IA 3BZCA 3PV8A 5BN9A 5TKYA 4DHYA 3O8MA 4AM7A 4HTUA 3TARA 1IBKK 3QFPA 5KTQA 4CJEA 1IKXA 3IG1A 5GAEP 4CJKA 4BRLA 3A5LC 5EU7A 4BG8A 4A62A 2HHSA 4AM6A 4JHDB 3SUNA 2QWOA 1I94K 4YORA 4LF8K 2NRZA 2D5RA 3HTVA 1VSDA 4O5BA 3TSQA 3UE5A 3R1XA 3MWPA 4HCCA 4N47A 2ZE2A 4ID1A 5DMRA 1JLCA 3E9PA 3R6MA 2D0OA 2A42A 2KFZA 2NRVA 4O0IA 1ASWA 4YOXA 3HPOA 3W3DA 5C0YA 2P9LA 4DTXA 1KTQA 3VQQA 5GIOA 1TKZA 3OBWA 1S22A 4CF9A 1RT5A 4BVOA 1QSYA 5KI6A 3VF6A 4DV0K 1J5OA 3E9LA 4L8RB 3AAPA 3JXUA 3T19A 3I55N 3S3OA 1F21A 3BUZB 3ZSYA 3K5MA 5AQIA 1X9MA 2HHWA 1SL2A 4WFNL 3ALYA 5AQVA 2YHXA 5HLFA 5AFUH 4FJKA 2VWKA 1S1XA 4BQZA 2HHTA 1NM1A 5M1PA 1QHAA 1A5XA 4DV2K 1VQ5N 4J2DA 4BDYA 3PUFA 1ZBLA 5SZTA 4IXCA 3JAMO 4JKHA 2P9UA 3TU5A 4M45A 3O1BA 4CF1A 4GV9A 3QIPA 1VQ6N 4Z94A 3K2PA 4BVPA 1Q86O 2WBNA 3ZETA 2F9WA 3HSCA 3KJVA 1U48A 2HMIA 3RMCA 1VRUA 1VSIA 3KLFA 3CFOA 2FBVA 3RVCA 4OGEA 4MFBA 4O55A 3TAGA 3HO1A 1WOQA 3UB5A 3HJFA 1GLJO 4CJ4A 2VG6A 2DY4A 1B9DA 3TABA 4AILC 1YJ9N 3AVJA 1S1TA 3DXKB 1JLAA 4H0TB 1ILYA 1KAXA 3A5MC 4CIGA 4W5OA 3QBWA 3L2QA 2P9KB 2WUSA 4PA1A 5LJWA 3OBYA 4LD0A 4O8KA 4LFBK 3OYNA 1SAZA 3CCJN 5KRTA 3O6WA 4JHDA 1RBRA 4B3TK 4BC5A 3A5NC 4QCLA 3IMXA 3KWGA 4DQSA 3A2FA 4DSKA 3C65A 4ZTFA 3ZT3A 4XEIA 4A5BA 1N34K 3AO3A 2D0CA 3IS9A 5AQQA 5F1XA 3V1QA 1TK5A 2Q0UA 3I8BA 4IKFA 3KKRA 2XY8A 5LY3A 1VSFA 3DLRA 4H0YB 4FWLA 4B9SA 2CGKA 3J7YP 4DR4K 1TL1A 1LWFA 2G8KA 1QZ6A 1HNZK 5J1EA 3HK2A 3OVNA 4M7XA 2V7ZA 4ICLA 4WE1A 2XO7A 4DV7K 1GOAA 5JICA 3K0SA 2ZWHA 5C2FA 1NK9A 3F9MA 3RR7A 3CJBA 3NF8A 3AARA 5JLHA 1NGDA 1WN7A 3QESA 4JKDA 4KH6A 1EP4A 3QICA 1C0UA 4BGAA 3SUOA 1KFSA 2E2PA 1S1WA 4BRAA 5AQFA 1TVRA 2IDOA 3IFRA 3ASMA 3LM2A 2UUCK 3KZBA 4LC9B 3P5JA 4M3YA 2Q0RA 1KVCA 1XNQK 4KTQA 2LSNA 5D3GA 3MXJA 4CZHA 4ZHRA 4BC4A 2AA4A 3CPEA 5E84A 3VESA 1RCHA 4M3UA 3PSFA 1RT4A 4ELVA 5CY4A 1D8YA 3HVTA 3CJ1A 4ILHA 3ZT1A 3SUPA 1NJZA 1RTJA 2QK9A 2BTFA 1KVAA 2XY5A 1BDGA 3HPGA 3TAEA 3G71N 4Y1CA 1ATNA 4CZJA 3DXKA 3J80O 2YJFA 3O9UA 4FPBA 1WBDA 4CEOA 4DTOA 4R79A 4BWMA 1TAQA 3VEOA 3H1VX 4A57A 3NAEA 3ZX2A 3CPWM 1NMNA 1S6QA 1XMQK 4FJ8A 1SL0A 3CCVN 1EKEA 2NRTA 2OPPA 5KQ8A 3F73A 4IJAA 3V9ZA 4EP4A 4BWJA 3VMFB 3O9RA 2FXUA 2GWJA 3AVBA 1U49A 3R8EA 2G8HA 3CQYA 2ZF5O 2Y1JA 1HNIA 4I2QA 4H8KA 1TYQB 3PX6A 1OH5A 1IO2A 2QWRA 2ZD1A 4KFBA 3VQPA 3DM2A 3F9KA 3KKSA 3NF7A 3TTCA 4CGJA 4FSVA 4WQ4A 2X6NA 5J2QA 3QNOA 4M3TA 3GE1A 2O8EB 1QQOA 2X78A 1BA0A 4PKGA 3L8BA 1RT2A 2BUPA 2KLAA 5EX5A 3CM6A 1NGIA 3SBGA 5FPMA 3P38A 4EP5A 3CM5A 2OANA 3P31A 3DWLA 2QXFA 3RTVA 1UA0A 1NWKA 4KHYA 3AVMA 4O8UA 3P1GA 1L5UA 4ZTJA 1YT3A 2QXLA 2DPNA 3KD1E 3RSEA 2YKNA 4BC3A 3FZHA 3HOSA 1RBTA 2RPIA 2P5OA 3B6PA 3QEPA 1QSSA 2QWMA 5FDLA 4ILJA 3VQ8A 3V6DA 2IOCA 2A1SA 4CJTA 1L3UA 1WSHA 4Z4IA 3RMBA 5AQSA 3AVKA 3H6EA 3OS1A 1BCMA 2GWKA 2Q1NA 4LSNA 1QQNA 5KPTA 1S72N 2W6KA 3F5TA 4CEZA 1RTIA 4GVEA 3HP6A 5KGWA 3VF2A 2GUIA 3DLEA 3ZYYX 2O8DB 4M3ZA 4XH4A 3DJCA 3SQ2A 3VA3A 3KVGA 4AHUA 1KQSM 3NH2A 4OX9K 2PYLA 4CBXA 4CBUA 1UAXA 3KLGA 1FXXA 4IO8A 4KTZA 4F8RA 2VQEK 4CK2A 1QVFM 3THVA 5M1OA 4DSLA 5GAHP 3VTHA 3M8QA 3WQTA 4Z0UA 3PLAA 2P51A 3NGIA 1YJNN 3ZSQA 1WB9A 1RILA 3ZSWA 3NFAA 1HNXK 3VGMA 1VSHA 2F4VK 5AZJB 4M41A 3ENBA 4IJNA 3CFPA 4H5NA 4IFVA 4CGGA 1YTUA 4CZIA 4B9QA 2QEXN 4RWTA 4DR5K 3THWA 1DTTA 5H1SQ 1L3SA 1RFQA 2O8EA 3LDQA 2ZM6K 4O0JA 4FVUA 1GLBG 4C8NA 5AZIB 1NOZA 1QZ5A 5JMVA 5ADXH 3MEEA 3O9QA 1DGKN 2BDPA 1OVQA 4JI6K 2G8WA 3PY8A 2F9TA 4FJHA 1FKPA 4B9MA 3ZEUA 1SKSA 3T3FA 1BIUA 1X1PA 3VN5A 2IC3A 4H0VB 1NGBA 4JI5K 5IWAK 1GLFO 1IKYA 3C0BA 4DFJA 4XIUA 3LWMA 3THXA 1ZBUA 4DQIA 1OH6A 4B1UB 4RG8A 2E6LA 3G6EN 1X9WA 1JKHA 3HSTB 5CHIA 4BGBA 3CJAA 3MN5A 2YNIA 1BOTO 1CXQA 3DI6A 4OJRA 1GLAG 4WQ5C 4FCYA 4H03B 2KZMA 3FZMA 4CJVA 3AVCA 3CI5A 4OKKA 1D5AA 2WOMA 3P4IA 3L2WA 5B8HA 1XUPO 5HP1A 4DKWA 3CF5L 3ZSZA 4J8FA 3M5RA 1JL2A 4NCAA 1GLEG 1Z05A 4JK7A 4MLEA 2O8DA 4BRNA 3CETA 3SMSA 1P90A 1Z6RA 3RMDA 3KD5E 1C1AA 4QAGA 5AQRA 4LFAK 3QEIA 2FLOA 4A2BA 3EN9A 4E7IA 4QS9A 3FZLA 4BROA 3AGRA 4CZFA 4PWDA 2YX6A 3LDSA 1KRPA 4Z4HA 3OYKA 2OPSA 3AA5X 3AO5A 4FJ5A 5AZJA 3G0ZA 5FPNA 2I7NA 4CIEA 5GINA 4JD2B 2W40A 3M6GA 3MN6A 2ITGA 3EE9A 3ZX3A 4FJJA 3OYBA 2IVNA 4HWIA 4IDHA 3LALA 4V19S 3RMAA 4K42A 4HUGA 4NYFA 4I9QA 1NK8A 1S3XA 2AJQA 2FC0A 3KLIA 3K58A 1IH7A 1C0GA 1GOBA 3LAMA 2HMPA 2HBJA 3CMAN 2HBMA 2H3GX 1U04A 2HB5A 2XY7A 2IVPA 3MX2A 1RDDA 3QFUA 2D1KA 1BI4A 2G8UA 4W5QA 4DR7K 1NK7A 4WQ5A 3OY9A 2P9IA 3VF4A 4JN4A 4CJLA 3L6QA 4JKAA 3BDPA 4FLUA 4DTNA 3SUQA 5KRSA 1E4FT 5F0XA 4DTSA 2VG5A 4EZ6A 2KKZA 3ENHA 4YY3K 1E4GT 3ISNC 1J53A 3DOLA 1WSGA 3SLCA 1J9AA 1EETA 4IOXA 5AQOA 2B4JA 1U4BA 4E89A 3KLHA 2GTDA 3VEVA 3NMUA 3MEDA 5AQPA 3ZX0A 1U6ZA 3D2EA 1JLQA 4B08A 2F8TA 2CGLA 1N5YA 4FOIA 2HHXA 2O8CB 1NGAA 3FE1A 3FFIA 3MCAB 1N8RO 1SS6A 2P9NB 1OH8A 1UA1A 4KI4A 3OS2A 4M42A 3SCXA 4Z4GA 4AHTA 1LWEA 3TTDA 5AQWA 4BRQA 3OYJA 1LCUA 3A0IX 4CZEA 1JLEA 3O4WA 1TUYA 3HPHA 5AQMA 1VHXA 3OYMA 3VQBA 3AAQA 1LAWA 2OTJN 4HUEA 2BANA 4CJ7A 3QIOA 4OPAA 1KFDA 3JS6A 2J4RA 4BG9A 2BH1A 4AH9A 2GBZA 4PQUA 3J7AP 3AVHA 3CQ8A 4UQGA 3QINA 4DUZK 2ASPA 4MDAA 2ITMA 4FWSA 4IWVA 1XI1A 3TAMA 3SAHA 1W97L 2QWLA 5HROA 4H0OA 3MN7A 4FWQA 4IG3A 2FF3B 4BRFA 1RBUA 2FF6A 2E6MA 5BRDA 5EVZA 1CZBA 5C2DA 2RHKA 4CEBA 1NU0A 1VRTA 3BZKA 3GOIA 1TV6A 4BRCA 4HHTA 3C7NB 4GMJB 4CIFA 3DRPA 3ATUA 2OCEA 1NK0A 4B9VA 3MX5A 2CH6A 3HP9A 4MO4A 4NO7A 2UU9K 4OLBA 5AQGA 2GV9A 4B8CA 3I56N 4DV6K 3NH1A 1HQEA 1WUAA 4K41A 1LAVA 3AY9A 1MDUB 4WCEL 3M8SA 3I8DA 4YOVA 3CC2N 4EHTA 5SWMA 3SBTA 4X66K 1QS4A 1J5EK 4LH5A 1O1WA 3OYIA 4JKFA 2QWNA 5LMUK 2UUBK 4H0PA 1HLUA 2P9NA 4CEDA 1YF5L 1CXUA 1WSEA 3SYZA 1QVGM 2OA8A 3AVNA 4A5AA 3SAFA 1CLQA 1X9JA 1VQMN 3H3OB 1NGHA 4C1NK 3WEEB 3UKRB 3VEYA 2A3ZA 1Z26A 1SL1A 4JK9A 1KCFA 1S9EA 1N6QA 3V4IA 4CF8A 1VSKA 4B1ZA 4FWOA 4E1MA 2O8BB 4OKJA 4PKIA 4RW8A 1JCGA 1C0FA 1ATRA 2GEMA 3CXCM 1HX1A 3FFKB 4FLXA 4YFUA 3HRGA 1ZBSA 2E1ZA 4H4OA 1SKRA 1EXQA 1NGEA 3QBXA 3WUHA 4PKHA 3OYAA 3CCMN 3SPZA 4EZ9A 4FXDA 4JV5K 3EKSA 4AHRA 2ASOA 4U67L 3QDKA 4N56A 3LPUA 5LMNK 3WXJA 5CZ1A 1BG3A 1QQCA 1HUXA 4BREA 4JS4A 3C7NA 5BREA 4X64K 1E3MA 3SAGA 4DTMA 3MAQA 3RRHA 3V1RA 1NJYA 1S9GA 1M90O 3ZSVA 3BEXA 3Q7CA 4QOZB 1I3AA 4FW1A 1X9SA 3OA9A 4PL7A 1RDAA 2HVHA 3W0LA 4X65K 1HYVA 3T69A 3G10A 4DS4A 2QM1A 3E01A 3NH0A 1RT3A 2VQFK 2DFHA 2EHGA 1D4XA 1SZ2A 4K8ZA 1Q18A 5AQJA 2ZGYA 3AO1A 3E1YA 4TSXA 3IDHA 3VQDA 1BQNA 1KLNA 1A5VA 5HRPA 4DQRA 1QSLA 3BF3A 3L4QA 3G4SN 2NNWA 4E7LA 1UOCA 1KLMA 1NGCA 3ULEB 3KHYA 4E1NA 3QEVA 1KSPA 3EYZA 5GIPA 4FLYA 2P9KA 3NGYA 4BC2A 1K8KB 2W41A 2X74A 3DAWA 2D0BA 3VQ6A 1RBSA 4N76A 3WEEA 1K8AO 1IKVA 2IAJA 3C6UA 4BR0A 1B9FA 3AA4A 3WNHA 2XHBA 4FJGA 4EHUA 1U2VB 1NNEA 2W42A 5AQNA 3HBTA 2NRWA 3D7EO 4OGCA 2FBYA 1NJWA 5CR4A 4KAZA 3BY5A 3O9SA 3K59A 4DSJA 4KTWA 1JLBA 2O8BA 2HW3A 4WYBA 3PX0A 2BGGA 3FGUA 4C8LA 4JYAK 2D4WA 1VK0A 2ZGZA 3I33A 3U9DA 2E8AA 4OPJA 5LJVA 5AQLA 2V7YA 3AGKA 4XH5A 5C25A 4U7BA 3D2FB 4DCHA 4BRMA 4O44A 1VQ9N 3KK1A 4GW6A 1XNRK 2V52B 4NXNK 4LF4K 4IEIA 3FZFA 3GG4A 2YI1A 3CHWA 5CZ2A 3CD6N 3O08A 3C6AA 4Z4EA 1RTDA 4CHZA 1ZXOA 1LV5A 4YDUC 4M3RA 1VAZA 1VSLA 4XH1A 4BE1A 1GLLO 4CFBA 3VETA 3ATVA 3HM8A 4GY2B 3VEXA 1Q9XA
chains in the Genus database with same CATH topology
5HP1A 3SQ4A 1JL1A 4B3OA 3ZSZA 3ZSXA 3LZJA 4JRQA 5I42A 2PZSA 1JL2A 5EU7A 4FJXA 4CJQA 4NCAA 5J2NA 4KHUA 2HHSA 4CHPA 3LPTA 3SUNA 1XWLA 3DMJA 3S3MA 4DSFA 3SJJA 2D5RA 1VSDA 4O5BA 1REVA 4HCCA 3DLKA 2HNZA 1NK4A 3RMDA 1VSEA 4N47A 3AA2A 1Q8IA 3KD5E 2ZE2A 4ID1A 1C1AA 4QAGA 5DMRA 1JLCA 3QEIA 3HT3A 4FZYA 4E7IA 1JLGA 1SV5A 4NCBA 3AO2A 2KFZA 4F2SA 4O0IA 3U3YA 1RT1A 4PWDA 1ASWA 4B9LA 4FZXC 3HPOA 3LDSA 2O4GA 1KRPA 4Z4HA 3OYKA 2OPSA 3SZ2A 1WSJA 4RW9A 3AA5X 3ZCMA 4DTXA 3AO5A 4FJ5A 1KTQA 3RRGA 2P5GA 3L2UA 3VQQA 4C8KA 4KI6A 1CZ9A 1ITGA 1TKZA 3G0ZA 1S6PA 3WNGA 3ZT2A 3M8RA 4CEEA 4CF9A 1RT5A 4CIEA 4C8OA 4RW6A 4BDPA 1QSYA 2XY6A 3AVLA 5KI6A 3RWUA 3C94A 4CECA 4I9LA 2FBXA 3LWLA 1J5OA 2ITGA 4L8RB 4CJRA 4FJJA 3OYBA 1FKOA 3T19A 3LALA 3S3OA 4CJWA 1F21A 3ZSYA 4OPKA 3K5MA 3LANA 4CGIA 3RMAA 1X9MA 4HUGA 1SL2A 4NYFA 1BHLA 3HL8A 4BE0A 2ATQA 1NK8A 4I9QA 2AJQA 1VSJA 2FC0A 3ALYA 3KLIA 3K58A 5HLFA 2OPRA 4JRPA 1IH7A 4Q5VA 1GOBA 1QE1A 3LAMA 3K5OA 4FJKA 4FYDA 4DTRA 2VWKA 1S1XA 4B9NA 1BIZA 1WSIA 5JS2A 4ELTA 1U04A 4I7FA 4F4KA 2HB5A 2XY7A 4FZZA 4KHWA 2HHTA 1RDDA 1A5XA 4I2PA 4FM1A 3D0PA 1NKEA 2YV0X 5DK5A 4BDYA 3PUFA 1ZBLA 1D9DA 1BI4A 3NGZA 4J2DA 5SZTA 3VQ9A 2G8UA 4W5QA 4LH4A 1BISA 4KHSA 1J54A 1NK7A 4CCHA 1T03A 4M45A 3K57A 4CF1A 3QIPA 1B92A 5HRRA 3OY9A 1R0AA 3K2PA 4J2BA 4CJLA 3BDPA 4FLUA 4DTNA 4E19A 2HMIA 1Z25A 3KJVA 2XRIA 3SUQA 3RMCA 1U48A 3PO5A 1VRUA 4Q0BA 1VSIA 4GVMA 3CFOA 5KRSA 3KLFA 4DTSA 4EZ6A 2VG5A 3NF6A 4DLEA 2FBVA 1NOYA 4DTJA 3ISNC 4OGEA 1J53A 1MU2A 4MFBA 3DOLA 4O55A 3TAGA 3HO1A 4CJPA 4FK4A 1WSGA 3HJFA 4Y1DA 3OYHA 1J9AA 1EETA 3NCIA 3AO4A 4CJ4A 1UWBA 2B4JA 1U4BA 2VG6A 5J2MA 4KB0A 4E89A 2DY4A 1B9DA 3TABA 2OZSA 4AHCA 1YTAA 3OYEA 1WAFA 1GOCA 4AILC 4KREA 2YNHA 3IRXA 3KLHA 3AVJA 4CJ5A 3JSMA 4YNQA 2PY5A 4CE9A 4M3XA 1EX4A 1S1TA 4RW4A 1JLAA 4FLVA 4FJ7A 1IKWA 4CIGA 4W5OA 3MEDA 3OS0A 2KFNA 3KTQA 3L2QA 1RNHA 1RTHA 1JLQA 4FW2A 4PA1A 4B08A 2F8TA 1N5YA 3AVGA 4LD0A 2HHXA 3AA3A 3QLHA 4OVLA 4E7KA 4JLHA 3OYNA 1TK8A 3FFIA 2KTQA 5KRTA 1UA1A 2F96A 4KI4A 1RBRA 3OS2A 1TKDA 4M42A 4QCLA 3SCXA 4Z4GA 4DQSA 4H4MA 4DWIA 4HCBA 4AHTA 2HHUA 1LWEA 3A2FA 1SKWA 4DSKA 4ELUA 3OYJA 4FM0A 4KKOA 2IS3A 4ZTFA 4CEQA 3DRRA 4KRFA 1JLEA 3ZT3A 3TI0A 4DQPA 3AO3A 2HHWA 2D0CA 3IS9A 3RR8A 3HPHA 2O4IA 1HJRA 2DFEA 3I0SA 3OYMA 3V1QA 1TK5A 4IKFA 1TAUA 3VQBA 1VSMA 2HNDA 1JXEA 2XY8A 1FK9A 1LAWA 3KKRA 1VSFA 4DSIA 4FK2A 4BDZA 3BGRA 3DLRA 4NCGA 2KW4A 3NHGA 2BANA 2YHBA 4HUEA 4B9SA 3O3FA 3QIOA 1KFDA 2WONA 4CEFA 3DLBA 4AH9A 1JLFA 2GBZA 4W5TA 4PQUA 1TL1A 3L2RA 3B6OA 3KK2A 3AVHA 3ZSOA 2YHAA 3CQ8A 4UQGA 2I5JA 1LWFA 3QINA 4R5PA 4AHVA 3TAQA 5J1EA 2G8KA 3QERA 3HK2A 3OVNA 1LWCA 4CESA 4ICLA 4WE1A 4FLWA 1XI1A 3VQ7A 1U47A 2XO7A 1GOAA 4NYNA 3TAMA 1RDCA 3AVIA 5CYQA 1TL3A 3LP1A 1NK9A 3RR7A 4E7JA 5HROA 3NF8A 4OKEA 1BGXT 2E4LA 1T7PA 5JS1A 3V9XA 3LP2A 4IG3A 1Y97A 2YNGA 1WN7A 1DLOA 3QESA 2ETJA 3OYCA 4B9TA 3V9SA 1EP4A 1HNVA 4DLGA 1C0UA 3MXIA 1RBUA 3PO4A 1TKXA 1HRHA 3SUOA 2E6MA 1NK6A 4DU4A 1L3VA 1KFSA 4J2AA 4RW7A 4FJ9A 1S1WA 1CZBA 1C0TA 4CEBA 4N41A 1VRTA 4IBNA 1TVRA 2IDOA 3SPYA 1TV6A 3QO9A 1C1CA 3ASMA 4HHTA 3NDKA 4CF2A 4DFPA 1RT7A 3DOKA 4GMJB 3P5JA 4CIFA 4M3YA 1LW2A 1KVCA 4KPYA 1W9HA 4CGHA 3DRPA 4KTQA 2LSNA 4W5RA 4PUOA 5D3GA 2HHVA 4FJIA 3MXJA 4F3OA 3DLGA 3OYGA 3I0RA 1NK0A 4ZHRA 4B9VA 1A5WA 4AHSA 1RCHA 3HP9A 3VQ4A 3VQEA 4M3UA 4FLZA 1RT4A 3U6FA 4OLBA 4ELVA 5CY4A 1D8YA 1T8EA 1D9FA 2NUBA 3HVTA 2GV9A 3ZT1A 1U45A 3IAYA 4B8CA 3SUPA 3OYFA 1ASUA 2IGIA 5C24A 1HQEA 5K14A 3NH1A 3SV4A 3AVFA 1NJZA 1RTJA 2OYQA 1LAVA 2QK9A 2KZZA 1HMVA 3OJUA 1KVAA 2YKMA 2XY5A 3HPGA 3L2VA 3TAEA 4Y1CA 4IG0A 1RBVA 3M8SA 2DTUA 3SI6A 3I8DA 4KO0A 5SWMA 1TKTA 4CEOA 1T05A 4DTOA 4JS5A 4DU1A 3SNNA 3NF9A 4BWMA 1TAQA 1QS4A 4CEAA 1RT6A 4LH5A 3NAEA 1O1WA 3OYIA 4FJ8A 1S6QA 1SL0A 1EKEA 2OPPA 1YVUA 3F73A 1K6YA 2Q3SA 4CEDA 1NKCA 3V9ZA 3CYMA 4IFYA 4EP4A 3DLHA 4BWJA 3CG7A 2HNYA 5C42A 1CXUA 4B9UA 1S1VA 3AVBA 1U49A 2G8HA 2Y1JA 1HNIA 4I2QA 4H8KA 3PX6A 1WSEA 1DTQA 1IO2A 2Z1GA 2ZD1A 3SYZA 2OA8A 4KFBA 1S5JA 3AVNA 2G8FA 3VQPA 1CLQA 3DM2A 3F9KA 3K5LA 1BI4B 1ZBIA 3U3GA 3KKSA 3NF7A 4CGJA 4FK0A 4CHOA 4J2EA 2X6NA 3L3UA 1S1UA 5J2QA 4FJNA 3QNOA 4M3TA 3V81A 2Z1HA 1Z26A 3M8PA 1SL1A 4G1QA 2X78A 3QETA 5KGXA 3MXMA 1KCFA 1S9EA 2Z1JA 3ITHA 1N6QA 3L8BA 1RT2A 3V4IA 4CF8A 1ASVA 3CM6A 4BACA 1VSKA 4FVMA 4E1MA 4DTPA 5HRNA 4EP5A 5T7BA 3CM5A 4OKJA 4DF4A 2QXFA 4RW8A 3KIOA 3RTVA 4DS5A 1UA0A 3O4NA 5J2PA 4KHYA 3AVMA 3ZSRA 3P1GA 3QNNA 4ZTJA 1L5UA 4F2RA 4FLXA 3TAFA 1YT3A 4CERA 3S9HA 4YFUA 2ZQBA 3HVRA 4O4GA 2B5JA 3KLEA 4DFKA 4DMNA 3CFRA 3EY1A 3KD1E 4H4OA 2YKNA 1IG9A 1SKRA 4F3TA 4CJFA 1EXQA 1RBTA 2RPIA 2P5OA 3OYAA 3SPZA 4EZ9A 3B6PA 5FRMA 3QEPA 4FXDA 3MEGA 4AHRA 1NJXA 4N56A 3DRSA 3LPUA 4CHQA 4K8XA 2G8IA 1ZBHA 5CZ1A 1Q9YA 1NKBA 1QSSA 4IDKA 4KHQA 1QQCA 4DU3A 2KQ2A 5FDLA 3VQ8A 3V6DA 2IOCA 4JS4A 2A1SA 3DYAA 4CJTA 4DG1A 4KB1A 3O3HA 3QEWA 2A1RA 1TGOA 3WNFA 1L3UA 5FROA 1WSHA 5HBMA 4Z4IA 3RMBA 1G15A 4DTMA 3MAQA 3AVKA 3V1RA 3OS1A 1S9GA 4CK1A 3P83D 3HM9A 3RRHA 3D45A 1NJYA 3AV9A 3ZSVA 3ZT0A 4QOZB 1TK0A 1BCMA 4LSNA 1I3AA 3O4QA 4FW1A 4CEZA 1RTIA 1X9SA 3HP6A 5KGWA 3SQ0A 1WAJA 2GUIA 3DLEA 1RDAA 4M3ZA 3ULDA 1HPZA 2HVHA 1I39A 3NE6A 3SQ2A 1HYVA 4E3SA 3G10A 3VA3A 4CHNA 4AHUA 4DS4A 3E01A 3NH2A 3NH0A 1RT3A 2G8VA 2Y1IA 1QTMA 2DFHA 5CYMA 2YNFA 3MECA 2EHGA 2PYLA 2R7YA 1XC9A 1UAXA 3KLGA 1FXXA 1ZBFA 2VG7A 4KTZA 2OPQA 2QKKA 2PYJA 4F8RA 3C95A 4K8ZA 3TAPA 4CK2A 2RF2A 1L3TA 2JGUA 3EZ5A 3THVA 3AO1A 5E41A 4DSLA 1C0MA 5I3UA 1KVBA 3M8QA 4TSXA 1JXBA 4Z0UA 3VQDA 1BQNA 2P51A 4CJKA 4CJSA 3NGIA 4DFMA 1A5VA 3QEXA 1KLNA 5HRPA 3ZSQA 4FJMA 4DQRA 1RILA 1QSLA 3ZSWA 3NFAA 4PY5A 3TWHA 1SUQA 4C8MA 3LP3A 4OLAA 4E7LA 1UOCA 1VSHA 1BL3A 3V1OA 4CFAA 2B6AA 4E7HA 1WNSA 1KLMA 4CHYA 4N5SA 4FJLA 4M41A 3HXMA 4E0DA 3CFPA 4CGGA 4IFVA 5HRSA 1YTUA 1QHTA 4E1NA 3QEVA 1WSFA 3ZT4A 4DTUA 3H08A 3OYLA 3EYZA 4DF8A 1KSPA 4FLYA 2HHQA 3NGYA 4CJ3A 3K5NA 2EX3A 1C6VA 3LP0A 4CFDA 4BE2A 3OYDA 1WLJA 3V9UA 3SQ1A 2X74A 2RN2A 3UIQA 4LY7A 2D0BA 3VQ6A 1RBSA 2VWJA 1XHZA 4CGFA 3KK3A 4W5NA 1DTTA 4MQ3A 3T1AA 1NK5A 4N76A 1IKVA 2IAJA 3C6UA 4KV8A 1L3SA 4M3WA 1B9FA 3AA4A 3WNHA 2Z1IA 2XHBA 4FJGA 2F8SA 4CK3A 4O0JA 1HYSA 4C8NA 4CJUA 2W42A 4DQQA 2QKBA 1NOZA 1LW0A 1BQMA 5FRNA 4OGCA 2FBYA 1NJWA 4KAZA 1RDBA 1HYZA 2DFFA 3K59A 4B8AB 4DSJA 4KTWA 1JLBA 3AVAA 2HW3A 2BGGA 3MEEA 3PX0A 4C8LA 2D0AA 3L3VA 2G8WA 2BDPA 3PY8A 1VK0A 4FJHA 1FKPA 2RKIA 4B9MA 1SKSA 1BCOA 4OPJA 1BIUA 1X1PA 3T3FA 3VN5A 3V9WA 3O3GA 3WNEA 2IC3A 3VQ5A 5C25A 3TANA 2P1JA 2FBTA 4DSEA 4HVJA 4HUFA 1XHXA 4O44A 3C6TA 4ID5A 3KK1A 4GW6A 4CGDA 4FM2A 4FLTA 3TR8A 3OJSA 1IKYA 1HQUA 3VQAA 4Z4FA 2HVIA 3HYFA 4DFJA 3S3NA 4XIUA 3LWMA 4LSLA 4Z4CA 1C1BA 5CZ2A 3SV3A 1ZBUA 4DQIA 4Z4EA 4RG8A 2BE2A 3LZIA 2E6LA 2JLEA 1X9WA 4CFCA 1RTDA 4CHZA 1LV5A 1JKHA 3HSTB 4M3RA 2YNIA 1ZYQA 1VSLA 3PX4A 1CXQA 3DI6A 4OJRA 3VA0A 3PV8A 4BE1A 4CFBA 4FCYA 3VQCA 2OZMA 4HTUA 1W0HA 4CF0A 2KZMA 3JYTA 4CJVA 1Q9XA 3TARA 5KTQA 3AVCA 4OKKA 4CJEA 1D5AA 2WOMA 3LAKA 1IKXA 3IG1A 3L2WA 4KHNA 3NBPA 2X6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HP1 A;  3SQ4 A;  1JL1 A;  4B3O A;  3ZSZ A;  3ZSX A;  3LZJ A;  4JRQ A;  5I42 A;  2PZS A;  1JL2 A;  5EU7 A;  4FJX A;  4CJQ A;  4NCA A;  5J2N A;  4KHU A;  2HHS A;  4CHP A;  3LPT A;  3SUN A;  1XWL A;  3DMJ A;  3S3M A;  4DSF A;  3SJJ A;  2D5R A;  1VSD A;  4O5B A;  1REV A;  4HCC A;  3DLK A;  2HNZ A;  1NK4 A;  3RMD A;  1VSE A;  4N47 A;  3AA2 A;  1Q8I A;  3KD5 E;  2ZE2 A;  4ID1 A;  1C1A A;  4QAG A;  5DMR A;  1JLC A;  3QEI A;  3HT3 A;  4FZY A;  4E7I A;  1JLG A;  1SV5 A;  4NCB A;  3AO2 A;  2KFZ A;  4F2S A;  4O0I A;  3U3Y A;  1RT1 A;  4PWD A;  1ASW A;  4B9L A;  4FZX C;  3HPO A;  3LDS A;  2O4G A;  1KRP A;  4Z4H A;  3OYK A;  2OPS A;  3SZ2 A;  1WSJ A;  4RW9 A;  3AA5 X;  3ZCM A;  4DTX A;  3AO5 A;  4FJ5 A;  1KTQ A;  3RRG A;  2P5G A;  3L2U A;  3VQQ A;  4C8K A;  4KI6 A;  1CZ9 A;  1ITG A;  1TKZ A;  3G0Z A;  1S6P A;  3WNG A;  3ZT2 A;  3M8R A;  4CEE A;  4CF9 A;  1RT5 A;  4CIE A;  4C8O A;  4RW6 A;  4BDP A;  1QSY A;  2XY6 A;  3AVL A;  5KI6 A;  3RWU A;  3C94 A;  4CEC A;  4I9L A;  2FBX A;  3LWL A;  1J5O A;  2ITG A;  4L8R B;  4CJR A;  4FJJ A;  3OYB A;  1FKO A;  3T19 A;  3LAL A;  3S3O A;  4CJW A;  1F21 A;  3ZSY A;  4OPK A;  3K5M A;  3LAN A;  4CGI A;  3RMA A;  1X9M A;  4HUG A;  1SL2 A;  4NYF A;  1BHL A;  3HL8 A;  4BE0 A;  2ATQ A;  1NK8 A;  4I9Q A;  2AJQ A;  1VSJ A;  2FC0 A;  3ALY A;  3KLI A;  3K58 A;  5HLF A;  2OPR A;  4JRP A;  1IH7 A;  4Q5V A;  1GOB A;  1QE1 A;  3LAM A;  3K5O A;  4FJK A;  4FYD A;  4DTR A;  2VWK A;  1S1X A;  4B9N A;  1BIZ A;  1WSI A;  5JS2 A;  4ELT A;  1U04 A;  4I7F A;  4F4K A;  2HB5 A;  2XY7 A;  4FZZ A;  4KHW A;  2HHT A;  1RDD A;  1A5X A;  4I2P A;  4FM1 A;  3D0P A;  1NKE A;  2YV0 X;  5DK5 A;  4BDY A;  3PUF A;  1ZBL A;  1D9D A;  1BI4 A;  3NGZ A;  4J2D A;  5SZT A;  3VQ9 A;  2G8U A;  4W5Q A;  4LH4 A;  1BIS A;  4KHS A;  1J54 A;  1NK7 A;  4CCH A;  1T03 A;  4M45 A;  3K57 A;  4CF1 A;  3QIP A;  1B92 A;  5HRR A;  3OY9 A;  1R0A A;  3K2P A;  4J2B A;  4CJL A;  3BDP A;  4FLU A;  4DTN A;  4E19 A;  2HMI A;  1Z25 A;  3KJV A;  2XRI A;  3SUQ A;  3RMC A;  1U48 A;  3PO5 A;  1VRU A;  4Q0B A;  1VSI A;  4GVM A;  3CFO A;  5KRS A;  3KLF A;  4DTS A;  4EZ6 A;  2VG5 A;  3NF6 A;  4DLE A;  2FBV A;  1NOY A;  4DTJ A;  3ISN C;  4OGE A;  1J53 A;  1MU2 A;  4MFB A;  3DOL A;  4O55 A;  3TAG A;  3HO1 A;  4CJP A;  4FK4 A;  1WSG A;  3HJF A;  4Y1D A;  3OYH A;  1J9A A;  1EET A;  3NCI A;  3AO4 A;  4CJ4 A;  1UWB A;  2B4J A;  1U4B A;  2VG6 A;  5J2M A;  4KB0 A;  4E89 A;  2DY4 A;  1B9D A;  3TAB A;  2OZS A;  4AHC A;  1YTA A;  3OYE A;  1WAF A;  1GOC A;  4AIL C;  4KRE A;  2YNH A;  3IRX A;  3KLH A;  3AVJ A;  4CJ5 A;  3JSM A;  4YNQ A;  2PY5 A;  4CE9 A;  4M3X A;  1EX4 A;  1S1T A;  4RW4 A;  1JLA A;  4FLV A;  4FJ7 A;  1IKW A;  4CIG A;  4W5O A;  3MED A;  3OS0 A;  2KFN A;  3KTQ A;  3L2Q A;  1RNH A;  1RTH A;  1JLQ A;  4FW2 A;  4PA1 A;  4B08 A;  2F8T A;  1N5Y A;  3AVG A;  4LD0 A;  2HHX A;  3AA3 A;  3QLH A;  4OVL A;  4E7K A;  4JLH A;  3OYN A;  1TK8 A;  3FFI A;  2KTQ A;  5KRT A;  1UA1 A;  2F96 A;  4KI4 A;  1RBR A;  3OS2 A;  1TKD A;  4M42 A;  4QCL A;  3SCX A;  4Z4G A;  4DQS A;  4H4M A;  4DWI A;  4HCB A;  4AHT A;  2HHU A;  1LWE A;  3A2F A;  1SKW A;  4DSK A;  4ELU A;  3OYJ A;  4FM0 A;  4KKO A;  2IS3 A;  4ZTF A;  4CEQ A;  3DRR A;  4KRF A;  1JLE A;  3ZT3 A;  3TI0 A;  4DQP A;  3AO3 A;  2HHW A;  2D0C A;  3IS9 A;  3RR8 A;  3HPH A;  2O4I A;  1HJR A;  2DFE A;  3I0S A;  3OYM A;  3V1Q A;  1TK5 A;  4IKF A;  1TAU A;  3VQB A;  1VSM A;  2HND A;  1JXE A;  2XY8 A;  1FK9 A;  1LAW A;  3KKR A;  1VSF A;  4DSI A;  4FK2 A;  4BDZ A;  3BGR A;  3DLR A;  4NCG A;  2KW4 A;  3NHG A;  2BAN A;  2YHB A;  4HUE A;  4B9S A;  3O3F A;  3QIO A;  1KFD A;  2WON A;  4CEF A;  3DLB A;  4AH9 A;  1JLF A;  2GBZ A;  4W5T A;  4PQU A;  1TL1 A;  3L2R A;  3B6O A;  3KK2 A;  3AVH A;  3ZSO A;  2YHA A;  3CQ8 A;  4UQG A;  2I5J A;  1LWF A;  3QIN A;  4R5P A;  4AHV A;  3TAQ A;  5J1E A;  2G8K A;  3QER A;  3HK2 A;  3OVN A;  1LWC A;  4CES A;  4ICL A;  4WE1 A;  4FLW A;  1XI1 A;  3VQ7 A;  1U47 A;  2XO7 A;  1GOA A;  4NYN A;  3TAM A;  1RDC A;  3AVI A;  5CYQ A;  1TL3 A;  3LP1 A;  1NK9 A;  3RR7 A;  4E7J A;  5HRO A;  3NF8 A;  4OKE A;  1BGX T;  2E4L A;  1T7P A;  5JS1 A;  3V9X A;  3LP2 A;  4IG3 A;  1Y97 A;  2YNG A;  1WN7 A;  1DLO A;  3QES A;  2ETJ A;  3OYC A;  4B9T A;  3V9S A;  1EP4 A;  1HNV A;  4DLG A;  1C0U A;  3MXI A;  1RBU A;  3PO4 A;  1TKX A;  1HRH A;  3SUO A;  2E6M A;  1NK6 A;  4DU4 A;  1L3V A;  1KFS A;  4J2A A;  4RW7 A;  4FJ9 A;  1S1W A;  1CZB A;  1C0T A;  4CEB A;  4N41 A;  1VRT A;  4IBN A;  1TVR A;  2IDO A;  3SPY A;  1TV6 A;  3QO9 A;  1C1C A;  3ASM A;  4HHT A;  3NDK A;  4CF2 A;  4DFP A;  1RT7 A;  3DOK A;  4GMJ B;  3P5J A;  4CIF A;  4M3Y A;  1LW2 A;  1KVC A;  4KPY A;  1W9H A;  4CGH A;  3DRP A;  4KTQ A;  2LSN A;  4W5R A;  4PUO A;  5D3G A;  2HHV A;  4FJI A;  3MXJ A;  4F3O A;  3DLG A;  3OYG A;  3I0R A;  1NK0 A;  4ZHR A;  4B9V A;  1A5W A;  4AHS A;  1RCH A;  3HP9 A;  3VQ4 A;  3VQE A;  4M3U A;  4FLZ A;  1RT4 A;  3U6F A;  4OLB A;  4ELV A;  5CY4 A;  1D8Y A;  1T8E A;  1D9F A;  2NUB A;  3HVT A;  2GV9 A;  3ZT1 A;  1U45 A;  3IAY A;  4B8C A;  3SUP A;  3OYF A;  1ASU A;  2IGI A;  5C24 A;  1HQE A;  5K14 A;  3NH1 A;  3SV4 A;  3AVF A;  1NJZ A;  1RTJ A;  2OYQ A;  1LAV A;  2QK9 A;  2KZZ A;  1HMV A;  3OJU A;  1KVA A;  2YKM A;  2XY5 A;  3HPG A;  3L2V A;  3TAE A;  4Y1C A;  4IG0 A;  1RBV A;  3M8S A;  2DTU A;  3SI6 A;  3I8D A;  4KO0 A;  5SWM A;  1TKT A;  4CEO A;  1T05 A;  4DTO A;  4JS5 A;  4DU1 A;  3SNN A;  3NF9 A;  4BWM A;  1TAQ A;  1QS4 A;  4CEA A;  1RT6 A;  4LH5 A;  3NAE A;  1O1W A;  3OYI A;  4FJ8 A;  1S6Q A;  1SL0 A;  1EKE A;  2OPP A;  1YVU A;  3F73 A;  1K6Y A;  2Q3S A;  4CED A;  1NKC A;  3V9Z A;  3CYM A;  4IFY A;  4EP4 A;  3DLH A;  4BWJ A;  3CG7 A;  2HNY A;  5C42 A;  1CXU A;  4B9U A;  1S1V A;  3AVB A;  1U49 A;  2G8H A;  2Y1J A;  1HNI A;  4I2Q A;  4H8K A;  3PX6 A;  1WSE A;  1DTQ A;  1IO2 A;  2Z1G A;  2ZD1 A;  3SYZ A;  2OA8 A;  4KFB A;  1S5J A;  3AVN A;  2G8F A;  3VQP A;  1CLQ A;  3DM2 A;  3F9K A;  3K5L A;  1BI4 B;  1ZBI A;  3U3G A;  3KKS A;  3NF7 A;  4CGJ A;  4FK0 A;  4CHO A;  4J2E A;  2X6N A;  3L3U A;  1S1U A;  5J2Q A;  4FJN A;  3QNO A;  4M3T A;  3V81 A;  2Z1H A;  1Z26 A;  3M8P A;  1SL1 A;  4G1Q A;  2X78 A;  3QET A;  5KGX A;  3MXM A;  1KCF A;  1S9E A;  2Z1J A;  3ITH A;  1N6Q A;  3L8B A;  1RT2 A;  3V4I A;  4CF8 A;  1ASV A;  3CM6 A;  4BAC A;  1VSK A;  4FVM A;  4E1M A;  4DTP A;  5HRN A;  4EP5 A;  5T7B A;  3CM5 A;  4OKJ A;  4DF4 A;  2QXF A;  4RW8 A;  3KIO A;  3RTV A;  4DS5 A;  1UA0 A;  3O4N A;  5J2P A;  4KHY A;  3AVM A;  3ZSR A;  3P1G A;  3QNN A;  4ZTJ A;  1L5U A;  4F2R A;  4FLX A;  3TAF A;  1YT3 A;  4CER A;  3S9H A;  4YFU A;  2ZQB A;  3HVR A;  4O4G A;  2B5J A;  3KLE A;  4DFK A;  4DMN A;  3CFR A;  3EY1 A;  3KD1 E;  4H4O A;  2YKN A;  1IG9 A;  1SKR A;  4F3T A;  4CJF A;  1EXQ A;  1RBT A;  2RPI A;  2P5O A;  3OYA A;  3SPZ A;  4EZ9 A;  3B6P A;  5FRM A;  3QEP A;  4FXD A;  3MEG A;  4AHR A;  1NJX A;  4N56 A;  3DRS A;  3LPU A;  4CHQ A;  4K8X A;  2G8I A;  1ZBH A;  5CZ1 A;  1Q9Y A;  1NKB A;  1QSS A;  4IDK A;  4KHQ A;  1QQC A;  4DU3 A;  2KQ2 A;  5FDL A;  3VQ8 A;  3V6D A;  2IOC A;  4JS4 A;  2A1S A;  3DYA A;  4CJT A;  4DG1 A;  4KB1 A;  3O3H A;  3QEW A;  2A1R A;  1TGO A;  3WNF A;  1L3U A;  5FRO A;  1WSH A;  5HBM A;  4Z4I A;  3RMB A;  1G15 A;  4DTM A;  3MAQ A;  3AVK A;  3V1R A;  3OS1 A;  1S9G A;  4CK1 A;  3P83 D;  3HM9 A;  3RRH A;  3D45 A;  1NJY A;  3AV9 A;  3ZSV A;  3ZT0 A;  4QOZ B;  1TK0 A;  1BCM A;  4LSN A;  1I3A A;  3O4Q A;  4FW1 A;  4CEZ A;  1RTI A;  1X9S A;  3HP6 A;  5KGW A;  3SQ0 A;  1WAJ A;  2GUI A;  3DLE A;  1RDA A;  4M3Z A;  3ULD A;  1HPZ A;  2HVH A;  1I39 A;  3NE6 A;  3SQ2 A;  1HYV A;  4E3S A;  3G10 A;  3VA3 A;  4CHN A;  4AHU A;  4DS4 A;  3E01 A;  3NH2 A;  3NH0 A;  1RT3 A;  2G8V A;  2Y1I A;  1QTM A;  2DFH A;  5CYM A;  2YNF A;  3MEC A;  2EHG A;  2PYL A;  2R7Y A;  1XC9 A;  1UAX A;  3KLG A;  1FXX A;  1ZBF A;  2VG7 A;  4KTZ A;  2OPQ A;  2QKK A;  2PYJ A;  4F8R A;  3C95 A;  4K8Z A;  3TAP A;  4CK2 A;  2RF2 A;  1L3T A;  2JGU A;  3EZ5 A;  3THV A;  3AO1 A;  5E41 A;  4DSL A;  1C0M A;  5I3U A;  1KVB A;  3M8Q A;  4TSX A;  1JXB A;  4Z0U A;  3VQD A;  1BQN A;  2P51 A;  4CJK A;  4CJS A;  3NGI A;  4DFM A;  1A5V A;  3QEX A;  1KLN A;  5HRP A;  3ZSQ A;  4FJM A;  4DQR A;  1RIL A;  1QSL A;  3ZSW A;  3NFA A;  4PY5 A;  3TWH A;  1SUQ A;  4C8M A;  3LP3 A;  4OLA A;  4E7L A;  1UOC A;  1VSH A;  1BL3 A;  3V1O A;  4CFA A;  2B6A A;  4E7H A;  1WNS A;  1KLM A;  4CHY A;  4N5S A;  4FJL A;  4M41 A;  3HXM A;  4E0D A;  3CFP A;  4CGG A;  4IFV A;  5HRS A;  1YTU A;  1QHT A;  4E1N A;  3QEV A;  1WSF A;  3ZT4 A;  4DTU A;  3H08 A;  3OYL A;  3EYZ A;  4DF8 A;  1KSP A;  4FLY A;  2HHQ A;  3NGY A;  4CJ3 A;  3K5N A;  2EX3 A;  1C6V A;  3LP0 A;  4CFD A;  4BE2 A;  3OYD A;  1WLJ A;  3V9U A;  3SQ1 A;  2X74 A;  2RN2 A;  3UIQ A;  4LY7 A;  2D0B A;  3VQ6 A;  1RBS A;  2VWJ A;  1XHZ A;  4CGF A;  3KK3 A;  4W5N A;  1DTT A;  4MQ3 A;  3T1A A;  1NK5 A;  4N76 A;  1IKV A;  2IAJ A;  3C6U A;  4KV8 A;  1L3S A;  4M3W A;  1B9F A;  3AA4 A;  3WNH A;  2Z1I A;  2XHB A;  4FJG A;  2F8S A;  4CK3 A;  4O0J A;  1HYS A;  4C8N A;  4CJU A;  2W42 A;  4DQQ A;  2QKB A;  1NOZ A;  1LW0 A;  1BQM A;  5FRN A;  4OGC A;  2FBY A;  1NJW A;  4KAZ A;  1RDB A;  1HYZ A;  2DFF A;  3K59 A;  4B8A B;  4DSJ A;  4KTW A;  1JLB A;  3AVA A;  2HW3 A;  2BGG A;  3MEE A;  3PX0 A;  4C8L A;  2D0A A;  3L3V A;  2G8W A;  2BDP A;  3PY8 A;  1VK0 A;  4FJH A;  1FKP A;  2RKI A;  4B9M A;  1SKS A;  1BCO A;  4OPJ A;  1BIU A;  1X1P A;  3T3F A;  3VN5 A;  3V9W A;  3O3G A;  3WNE A;  2IC3 A;  3VQ5 A;  5C25 A;  3TAN A;  2P1J A;  2FBT A;  4DSE A;  4HVJ A;  4HUF A;  1XHX A;  4O44 A;  3C6T A;  4ID5 A;  3KK1 A;  4GW6 A;  4CGD A;  4FM2 A;  4FLT A;  3TR8 A;  3OJS A;  1IKY A;  1HQU A;  3VQA A;  4Z4F A;  2HVI A;  3HYF A;  4DFJ A;  3S3N A;  4XIU A;  3LWM A;  4LSL A;  4Z4C A;  1C1B A;  5CZ2 A;  3SV3 A;  1ZBU A;  4DQI A;  4Z4E A;  4RG8 A;  2BE2 A;  3LZI A;  2E6L A;  2JLE A;  1X9W A;  4CFC A;  1RTD A;  4CHZ A;  1LV5 A;  1JKH A;  3HST B;  4M3R A;  2YNI A;  1ZYQ A;  1VSL A;  3PX4 A;  1CXQ A;  3DI6 A;  4OJR A;  3VA0 A;  3PV8 A;  4BE1 A;  4CFB A;  4FCY A;  3VQC A;  2OZM A;  4HTU A;  1W0H A;  4CF0 A;  2KZM A;  3JYT A;  4CJV A;  1Q9X A;  3TAR A;  5KTQ A;  3AVC A;  4OKK A;  4CJE A;  1D5A A;  2WOM A;  3LAK A;  1IKX A;  3IG1 A;  3L2W A;  4KHN A;  3NBP A;  2X6S A; 
#chains in the Genus database with same CATH topology
 3H1Q A;  4B3M K;  1K9M O;  1JL1 A;  4B3O A;  2HF4 A;  3LZJ A;  2PZS A;  5AQT A;  4KHU A;  4CJQ A;  5J2N A;  3LPT A;  1XWL A;  4DSF A;  5C10 A;  4B3R K;  1IG8 A;  2HNZ A;  3AA2 A;  2P9P B;  1Q8I A;  5JVG L;  1O13 A;  1YIJ N;  1SV5 A;  1XQS C;  1KC8 O;  3O1W A;  4F2S A;  3EE8 A;  4FZX C;  1DEJ A;  3SZ2 A;  1WSJ A;  1IJJ A;  3ZCM A;  3RRG A;  4KI6 A;  3SMP A;  1ITG A;  1S6P A;  1FJG K;  3ULE A;  3WNG A;  3ZT2 A;  3M8R A;  5EOY A;  4RW6 A;  4BDP A;  2XY6 A;  3AVL A;  1T6C A;  3RWU A;  3MCP A;  3QB0 A;  4BR9 A;  3WT0 A;  4CJR A;  4H5V A;  1FKO A;  4LF7 K;  2QI2 A;  3EZW A;  3LAN A;  3T7Z A;  1BHL A;  1VSJ A;  1NG9 A;  1TYQ A;  1QE1 A;  4FYD A;  4DTR A;  1BIZ A;  1WSI A;  3FZK A;  5JS2 A;  4I7F A;  4KHW A;  3H3N O;  3D0P A;  1NKE A;  2YV0 X;  1D9D A;  2W6L A;  3NGZ A;  4LH4 A;  2QTD A;  4LFC K;  1BIS A;  1J54 A;  4MLH A;  3DLL L;  3GBT A;  3S41 A;  4FPA A;  3D2F A;  1Z25 A;  3J7Z O;  3P39 A;  3NF6 A;  4DLE A;  1MU2 A;  3ID6 A;  3NCI A;  3LM9 A;  4KH4 A;  4AHC A;  3OYE A;  4JKG B;  2YNH A;  4DR1 K;  2UUA K;  2Q97 A;  4CE9 A;  1T44 A;  3TPQ A;  4K0K K;  1IV0 A;  4RW4 A;  4FLV A;  4FJ7 A;  3K9K A;  2KFN A;  3KTQ A;  2D0P A;  3DXM B;  3AVG A;  5DM7 L;  4IEE A;  3O5B A;  4JLH A;  4DV5 K;  4DB3 A;  3SJH A;  1TKD A;  1YUW A;  4H4M A;  5AJ3 K;  4B1V A;  4ELU A;  4GV6 A;  2P9P A;  4LF5 K;  4CEQ A;  3DRR A;  4DQP A;  3LDN A;  3RR8 A;  1HJR A;  2DFE A;  3I0S A;  3U8X A;  1HR0 K;  1FK9 A;  4FK2 A;  4DSI A;  4NCG A;  3NHG A;  2YHB A;  3O3F A;  4DR6 K;  1VQ8 N;  3MN9 A;  3HI0 A;  3DLB A;  5F2R A;  5AQZ A;  3ID8 A;  3BF1 A;  3L2R A;  4H0X B;  4CD1 A;  3ZSO A;  2YHA A;  5HOO A;  2I5J A;  3TAQ A;  1N36 K;  3QER A;  4CD3 A;  1T3V A;  1XC3 A;  5LL6 Z;  1LWC A;  3VOV A;  1U47 A;  3VQ7 A;  2QA4 N;  5CYQ A;  3LP1 A;  4A2A A;  4E7J A;  2A6A A;  3LP2 A;  1Y97 A;  1V4T A;  3OYC A;  4B9T A;  1MA9 B;  1HNV A;  4DLG A;  3MXI A;  4BRP A;  3H45 C;  1TKX A;  2NRX A;  4CBW A;  4AF1 A;  5BPN A;  4N41 A;  1ESV A;  3NDK A;  4CF2 A;  4CZL A;  4WF9 L;  1LW2 A;  4KPY A;  1W9H A;  5AZI A;  5BR8 K;  2HHV A;  2Q2R A;  4FJI A;  4F3O A;  3DLG A;  1A5W A;  3OHR A;  4AHS A;  3CCR N;  3VQE A;  4FLZ A;  3U6F A;  1D9F A;  1N33 K;  1U45 A;  2IGI A;  5C24 A;  2P9L B;  3AVF A;  2OYQ A;  4G9Z A;  2KZZ A;  1HMV A;  3L2V A;  4MDB A;  4IG0 A;  2HBK A;  2DTU A;  4QS7 A;  2YJE A;  1T05 A;  3CC7 N;  4JS5 A;  2E20 A;  4DU1 A;  2E2O A;  2P9S B;  1EQY A;  4CEA A;  4DR3 K;  4JI8 K;  1KXP A;  1DKG D;  3G25 A;  1YVU A;  5C12 A;  1K6Y A;  5BPM A;  3CG7 A;  2F7T A;  2HNY A;  5AQK A;  4JK8 A;  3U4L A;  3L0Q A;  4FL9 A;  4B9U A;  1S1V A;  4OO1 J;  1DTQ A;  3J81 O;  1VQ4 N;  2G8F A;  2YHY A;  2Q31 A;  5TKW A;  3K5L A;  3SK3 A;  1ZBI A;  3U3G A;  2FSK A;  4QS8 A;  3WXM B;  3CCU N;  3L3U A;  1S1U A;  2UYT A;  1YI2 N;  2P9U B;  3V81 A;  1KD1 O;  2Z1H A;  4G1Q A;  4EAH D;  3M3Z A;  3ZET B;  3TSU A;  3ENO A;  2ZJP L;  4BAC A;  1HPM A;  4FVM A;  4DTP A;  5HRN A;  5T7B A;  1H1V A;  4JI7 K;  3MDQ A;  5FLX O;  5J2P A;  3ZSR A;  3QNN A;  5BRF A;  5AFU A;  3S9H A;  4DR2 K;  3HVR A;  4O4G A;  3CFR A;  1NJI O;  2A5X A;  5KPZ A;  2EWS A;  4CJF A;  5FPD A;  4JKE A;  4JD2 A;  2VWB A;  3PIP L;  2WTU A;  3J8A A;  3MEG A;  5HL7 L;  1NJX A;  1V4S A;  3B8A X;  3DRS A;  4BRI A;  4CHQ A;  4K8X A;  2G8I A;  1Q9Y A;  1NKB A;  4IDK A;  3VPZ A;  2HF3 A;  4FWN A;  4PL8 A;  4B1Y B;  2QW9 A;  4DG1 A;  5I9E B;  3O3H A;  1TGO A;  3NVK A;  5FRO A;  3R3L A;  2ASM A;  1G15 A;  3N4P A;  1CZA N;  3HM9 A;  4I6M B;  3AV9 A;  3ZT0 A;  1TK0 A;  4GNI A;  3O4Q A;  2CH5 A;  1HJO A;  3K9J A;  3SQ0 A;  1WAJ A;  3ULD A;  1HPZ A;  3NE6 A;  4E3S A;  1NLV A;  4CHN A;  2G8V A;  3CER A;  5CYM A;  3MEC A;  2R7Y A;  4DV4 K;  1ZBF A;  4JKC A;  2OPQ A;  3U9Z A;  2PYJ A;  4CZK A;  2RF2 A;  2JGU A;  4DUY K;  2P9S A;  1C0M A;  5JVH L;  1KVB A;  1JXB A;  3A8Y A;  5MLC Q;  3D6R A;  3WXL A;  2YCH A;  4C8M A;  3LP3 A;  4OLA A;  1VQK N;  3CJ7 A;  3V1O A;  3IUC A;  4E7H A;  1WNS A;  4N5S A;  3OW2 M;  4BY9 C;  4NLB A;  1SQK A;  1QHT A;  1NGJ A;  3ZT4 A;  3H08 A;  3OYL A;  4DF8 A;  2HHQ A;  4CJ3 A;  3GL1 A;  4BRD A;  1MWM A;  1C6V A;  2EX3 A;  3LP0 A;  3K5N A;  3OYD A;  1WLJ A;  2RN2 A;  3UIQ A;  5AQU A;  2O8C A;  2VWJ A;  1XHZ A;  5IT9 O;  3T1A A;  3N4Q A;  2VCP A;  1HKC A;  2Z1I A;  4H5W A;  1HYS A;  4C23 A;  3H46 O;  1N32 K;  1JCF A;  4RTF D;  4DQQ A;  2QKB A;  1BQM A;  5M1F A;  4B8A B;  1VQ7 N;  4CI6 A;  2D0A A;  2RKI A;  4IOC L;  1BCO A;  3GDQ A;  4FO0 A;  1K73 O;  3VER A;  3O3G A;  3WNE A;  3VQ5 A;  3TAN A;  2P1J A;  2FBT A;  4HVJ A;  4ID5 A;  4BR7 A;  4CGD A;  2UXD K;  4FLT A;  3TR8 A;  1YJW N;  4Z4F A;  1HQU A;  3E66 A;  3HYF A;  3VEW A;  4YOW A;  3S3N A;  4LSL A;  4Z4C A;  1C1B A;  4A59 A;  2IIR A;  3LZI A;  2JLE A;  5M1K A;  3LDO A;  4CFC A;  4F9O A;  2HBL A;  3OTO K;  3WXK A;  1ZYQ A;  2VGM A;  3PX4 A;  4GKJ K;  3CCL N;  3VA0 A;  1M1K O;  3KK7 A;  2OZM A;  3VQC A;  4DV1 K;  1W0H A;  4I6M A;  4CF0 A;  5CE3 A;  3JYT A;  3LAK A;  3Q7B A;  5GAG P;  4KHN A;  3ZLJ A;  3QLH A;  3NBP A;  2X6S A;  3LDP A;  4JI1 K;  3ZSX A;  4JRQ A;  5I42 A;  4EIA A;  4FJX A;  1LOT B;  4UY8 O;  4LF9 K;  4CHP A;  3DMJ A;  4YOY A;  3S3M A;  3SJJ A;  1REV A;  4ILG B;  5A2Q O;  3DLK A;  1NK4 A;  1VSE A;  5BN8 A;  4NLC A;  3HT3 A;  4FZY A;  3VTI A;  4BR2 A;  1JLG A;  4NCB A;  3AO2 A;  2FSJ A;  3U3Y A;  1RT1 A;  4BR5 A;  4B9L A;  4E1J A;  2O4G A;  5BR9 A;  4YOT A;  4WQ4 C;  1P8Z A;  2JWK A;  4RW9 A;  2P5G A;  3CCS N;  3L2U A;  4C8K A;  3RSE B;  1CZ9 A;  3C6H A;  4CEE A;  4C8O A;  1OKJ A;  1BA1 A;  2GEL A;  3CQX A;  1R59 O;  3C94 A;  4CEC A;  4I9L A;  2FBX A;  3LWL A;  2HHH K;  4CJW A;  1ZC6 A;  4OPK A;  4CGI A;  1Q7Y O;  4BE0 A;  3HL8 A;  2ATQ A;  2E2Q A;  3VEZ A;  2NRR A;  2OPR A;  4OPH A;  4JRP A;  4Q5V A;  3T1Y K;  3K5O A;  3NVM A;  3VGK A;  3T1H K;  4B9N A;  4ELT A;  4F4K A;  4M63 C;  4FZZ A;  2IVO A;  4FM1 A;  4I2P A;  4C1N I;  5DK5 A;  1NGG A;  2A41 A;  2NRH A;  5EXW A;  3VQ9 A;  4KHS A;  1X3N A;  3UKR A;  4CCH A;  1VQN N;  1T03 A;  3K57 A;  1B92 A;  5HRR A;  1R0A A;  4FWR A;  4J2B A;  2WFB A;  3A5O C;  3CCQ N;  4E19 A;  1DT9 A;  2XRI A;  3PO5 A;  5EY4 A;  4Q0B A;  4GVM A;  1NOY A;  4DTJ A;  4PY5 A;  4CJP A;  4FK4 A;  1BWF O;  4Y1D A;  3OYH A;  3AO4 A;  4FOE A;  1T6D A;  1UWB A;  5J2M A;  4KB0 A;  5KPR A;  3CIP A;  2OZS A;  1YTA A;  1WAF A;  1GOC A;  2RE2 A;  1IBM K;  4KRE A;  1Q81 O;  3IRX A;  4CJ5 A;  3JSM A;  5E26 A;  4YNQ A;  2PY5 A;  4M3X A;  1EX4 A;  2HOE A;  5GAD P;  1IKW A;  3OS0 A;  1BO5 O;  1RNH A;  4LF6 K;  1RTH A;  4FW2 A;  4GKK K;  3AA3 A;  4OVL A;  4E7K A;  4FWP A;  3THW B;  4K43 A;  2QWQ A;  1TK8 A;  4JI0 K;  4A61 A;  2KTQ A;  2F96 A;  3MWT A;  1OVY A;  4CW7 B;  1HKB A;  5ELZ A;  2VGN A;  5M1Q A;  4DWI A;  4HCB A;  2NZT A;  2HHU A;  1SKW A;  2O8F B;  4FM0 A;  4KKO A;  5BPL A;  2IS3 A;  4JI3 K;  4KRF A;  3TI0 A;  2O4I A;  3PSI A;  1TAU A;  1VSM A;  2HND A;  1JXE A;  2PAV A;  3F2K A;  3ZEU B;  4BDZ A;  3BGR A;  1QQM A;  1X3M A;  2KW4 A;  1VQL N;  2WON A;  4WFA L;  4CEF A;  1JLF A;  4W5T A;  1KAZ A;  3B6O A;  3KK2 A;  1RDW X;  1RDU A;  4R5P A;  3THX B;  4AHV A;  4DV3 K;  4BQL A;  3EO3 A;  4CES A;  4FLW A;  4O5F A;  4NYN A;  1RDC A;  3AVI A;  2YHW A;  1TL3 A;  1GLD G;  4OKE A;  1BGX T;  2E4L A;  1T7P A;  3MK6 A;  3V9X A;  5JS1 A;  2YNG A;  1OH7 A;  3CC4 N;  1DLO A;  4CZM A;  5ADX A;  2ETJ A;  1IBL K;  3V9S A;  4CZG A;  3E9O A;  1HKG A;  3PO4 A;  1HRH A;  1L3V A;  1K8K A;  1NK6 A;  4DU4 A;  4FWK A;  4J2A A;  4FJ9 A;  4RW7 A;  1C0T A;  2OTL N;  4IBN A;  4L3Q A;  3SPY A;  3QO9 A;  1C1C A;  3EL2 A;  4YOU A;  4DFP A;  1RT7 A;  3DOK A;  4CGH A;  4BRH A;  1U2V A;  4CVN E;  4PUO A;  4W5R A;  3OYG A;  3I0R A;  4BRK A;  4IO9 L;  3VQ4 A;  2NLX A;  2KHO A;  2AP1 A;  1T8E A;  2NUB A;  3IAY A;  4YDU A;  3FLC O;  4RCH A;  3OYF A;  1ASU A;  3UKU B;  3SV4 A;  5K14 A;  4JAX A;  3OJU A;  2YKM A;  4KH5 A;  4JNE A;  1RBV A;  2PBD A;  3SI6 A;  4KO0 A;  2VYP A;  4HTL A;  1TKT A;  3CME N;  1EWR A;  1VQO N;  3TSP A;  3SNN A;  2GX9 A;  3NF9 A;  1EWQ A;  1RT6 A;  1J6Z A;  2Q36 A;  3PIO L;  2JWL A;  1YHQ N;  2Q3S A;  3DLH A;  1NKC A;  3CYM A;  4IFY A;  4NXM K;  5C42 A;  3FR0 A;  2I7P A;  4YHH K;  3O80 A;  4IFE A;  2Z1G A;  3MMV A;  3THY B;  3M1F A;  2O8F A;  1S5J A;  2GUP A;  1Q82 O;  4KHP K;  1BI4 B;  1GLC G;  4AQY K;  4FK0 A;  4X62 K;  4CHO A;  4J2E A;  1Y64 A;  3HOT A;  1W7A A;  4GV3 A;  4FJN A;  1NBW A;  1YVN A;  3M8P A;  2P9I B;  3QET A;  5KGX A;  3MXM A;  3EKU A;  4B1X B;  2Z1J A;  3ITH A;  1ASV A;  3QML A;  4IZ9 A;  4DF4 A;  1VQP N;  3KIO A;  4DS5 A;  3O4N A;  4F2R A;  3TAF A;  4CER A;  1JJ2 M;  2ZQB A;  2B5J A;  2A40 A;  3KLE A;  4DFK A;  4DMN A;  3EY1 A;  2ZJQ L;  1IG9 A;  4F3T A;  3D2E B;  5FRM A;  1NMD A;  4B1W B;  1JCE A;  1HNW K;  4MO5 A;  5BRH A;  1ZBH A;  5FPE A;  4KHQ A;  5DM6 L;  4DU3 A;  3EEQ A;  2UXC K;  2KQ2 A;  5AQX A;  4ISF A;  4H5T A;  4KB1 A;  3DYA A;  4IOA L;  3QEW A;  2A1R A;  3WNF A;  5HBM A;  5M1N A;  4BRG A;  4CK1 A;  3P83 D;  3D45 A;  2E88 A;  2ZJR L;  5AQH A;  3R9P A;  5JLF A;  3CJC A;  2FSN A;  3HZ6 A;  3O9T A;  4Y0W A;  3UKU A;  1I39 A;  3VGL A;  5C15 A;  3IKM A;  1BUP A;  2Y1I A;  1QTM A;  2YNF A;  1TUU A;  4B3S K;  1XC9 A;  2VG7 A;  2QKK A;  3LL3 A;  3C95 A;  3TAP A;  2E5L K;  1L3T A;  3EZ5 A;  2HST A;  5E41 A;  5I3U A;  5KQD A;  4JKB A;  2CGJ A;  3CCE N;  4DFM A;  1YAG A;  4CJS A;  3QEX A;  4FJM A;  3TTF A;  4EFH A;  2PFU A;  4JKG A;  3TWH A;  1SUQ A;  4FWM A;  3VEN A;  3CJ9 A;  1BL3 A;  2V51 B;  2B6A A;  4CFA A;  4FJL A;  4CHY A;  1YXQ A;  1G99 A;  3HXM A;  4E0D A;  4K25 A;  3THY A;  5HRS A;  2UXB K;  2QWP A;  1WSF A;  4DTU A;  4ISE A;  1YIT N;  4PHT X;  3SQ4 A;  4CFD A;  3DXM A;  4BE2 A;  3SQ1 A;  3V9U A;  4JI4 K;  4LY7 A;  4CGF A;  3KK3 A;  2WC9 A;  4MQ3 A;  1XMO K;  4W5N A;  1NK5 A;  4KV8 A;  4M3W A;  1ATS A;  2F8S A;  4M7Y A;  4CK3 A;  4CJU A;  1LW0 A;  4ISG A;  5FRN A;  3KWI A;  4WFB L;  3BP8 A;  4JI2 K;  1RDB A;  1HYZ A;  4NB4 A;  4DQ8 A;  2DFF A;  1FW6 A;  3WQU A;  3AVA A;  1WBB A;  2E2N A;  3L3V A;  1BU6 O;  1EO1 A;  1NGF A;  5AQY A;  3V9W A;  2E1Y A;  4DSE A;  4HUF A;  1XHX A;  3C6T A;  1KAY A;  4KBO A;  4FM2 A;  3OJS A;  3VQA A;  2HVI A;  3WXI A;  3LDL A;  4BR4 A;  3SV3 A;  1RGI A;  2BE2 A;  1W2B M;  4JEP A;  1MWK A;  4H5R A;  5AR0 A;  3L4I A;  3BZC A;  3PV8 A;  5BN9 A;  5TKY A;  4DHY A;  3O8M A;  4AM7 A;  4HTU A;  3TAR A;  1IBK K;  3QFP A;  5KTQ A;  4CJE A;  1IKX A;  3IG1 A;  5GAE P;  4CJK A;  4BRL A;  3A5L C;  5EU7 A;  4BG8 A;  4A62 A;  2HHS A;  4AM6 A;  4JHD B;  3SUN A;  2QWO A;  1I94 K;  4YOR A;  4LF8 K;  2NRZ A;  2D5R A;  3HTV A;  1VSD A;  4O5B A;  3TSQ A;  3UE5 A;  3R1X A;  3MWP A;  4HCC A;  4N47 A;  2ZE2 A;  4ID1 A;  5DMR A;  1JLC A;  3E9P A;  3R6M A;  2D0O A;  2A42 A;  2KFZ A;  2NRV A;  4O0I A;  1ASW A;  4YOX A;  3HPO A;  3W3D A;  5C0Y A;  2P9L A;  4DTX A;  1KTQ A;  3VQQ A;  5GIO A;  1TKZ A;  3OBW A;  1S22 A;  4CF9 A;  1RT5 A;  4BVO A;  1QSY A;  5KI6 A;  3VF6 A;  4DV0 K;  1J5O A;  3E9L A;  4L8R B;  3AAP A;  3JXU A;  3T19 A;  3I55 N;  3S3O A;  1F21 A;  3BUZ B;  3ZSY A;  3K5M A;  5AQI A;  1X9M A;  2HHW A;  1SL2 A;  4WFN L;  3ALY A;  5AQV A;  2YHX A;  5HLF A;  5AFU H;  4FJK A;  2VWK A;  1S1X A;  4BQZ A;  2HHT A;  1NM1 A;  5M1P A;  1QHA A;  1A5X A;  4DV2 K;  1VQ5 N;  4J2D A;  4BDY A;  3PUF A;  1ZBL A;  5SZT A;  4IXC A;  3JAM O;  4JKH A;  2P9U A;  3TU5 A;  4M45 A;  3O1B A;  4CF1 A;  4GV9 A;  3QIP A;  1VQ6 N;  4Z94 A;  3K2P A;  4BVP A;  1Q86 O;  2WBN A;  3ZET A;  2F9W A;  3HSC A;  3KJV A;  1U48 A;  2HMI A;  3RMC A;  1VRU A;  1VSI A;  3KLF A;  3CFO A;  2FBV A;  3RVC A;  4OGE A;  4MFB A;  4O55 A;  3TAG A;  3HO1 A;  1WOQ A;  3UB5 A;  3HJF A;  1GLJ O;  4CJ4 A;  2VG6 A;  2DY4 A;  1B9D A;  3TAB A;  4AIL C;  1YJ9 N;  3AVJ A;  1S1T A;  3DXK B;  1JLA A;  4H0T B;  1ILY A;  1KAX A;  3A5M C;  4CIG A;  4W5O A;  3QBW A;  3L2Q A;  2P9K B;  2WUS A;  4PA1 A;  5LJW A;  3OBY A;  4LD0 A;  4O8K A;  4LFB K;  3OYN A;  1SAZ A;  3CCJ N;  5KRT A;  3O6W A;  4JHD A;  1RBR A;  4B3T K;  4BC5 A;  3A5N C;  4QCL A;  3IMX A;  3KWG A;  4DQS A;  3A2F A;  4DSK A;  3C65 A;  4ZTF A;  3ZT3 A;  4XEI A;  4A5B A;  1N34 K;  3AO3 A;  2D0C A;  3IS9 A;  5AQQ A;  5F1X A;  3V1Q A;  1TK5 A;  2Q0U A;  3I8B A;  4IKF A;  3KKR A;  2XY8 A;  5LY3 A;  1VSF A;  3DLR A;  4H0Y B;  4FWL A;  4B9S A;  2CGK A;  3J7Y P;  4DR4 K;  1TL1 A;  1LWF A;  2G8K A;  1QZ6 A;  1HNZ K;  5J1E A;  3HK2 A;  3OVN A;  4M7X A;  2V7Z A;  4ICL A;  4WE1 A;  2XO7 A;  4DV7 K;  1GOA A;  5JIC A;  3K0S A;  2ZWH A;  5C2F A;  1NK9 A;  3F9M A;  3RR7 A;  3CJB A;  3NF8 A;  3AAR A;  5JLH A;  1NGD A;  1WN7 A;  3QES A;  4JKD A;  4KH6 A;  1EP4 A;  3QIC A;  1C0U A;  4BGA A;  3SUO A;  1KFS A;  2E2P A;  1S1W A;  4BRA A;  5AQF A;  1TVR A;  2IDO A;  3IFR A;  3ASM A;  3LM2 A;  2UUC K;  3KZB A;  4LC9 B;  3P5J A;  4M3Y A;  2Q0R A;  1KVC A;  1XNQ K;  4KTQ A;  2LSN A;  5D3G A;  3MXJ A;  4CZH A;  4ZHR A;  4BC4 A;  2AA4 A;  3CPE A;  5E84 A;  3VES A;  1RCH A;  4M3U A;  3PSF A;  1RT4 A;  4ELV A;  5CY4 A;  1D8Y A;  3HVT A;  3CJ1 A;  4ILH A;  3ZT1 A;  3SUP A;  1NJZ A;  1RTJ A;  2QK9 A;  2BTF A;  1KVA A;  2XY5 A;  1BDG A;  3HPG A;  3TAE A;  3G71 N;  4Y1C A;  1ATN A;  4CZJ A;  3DXK A;  3J80 O;  2YJF A;  3O9U A;  4FPB A;  1WBD A;  4CEO A;  4DTO A;  4R79 A;  4BWM A;  1TAQ A;  3VEO A;  3H1V X;  4A57 A;  3NAE A;  3ZX2 A;  3CPW M;  1NMN A;  1S6Q A;  1XMQ K;  4FJ8 A;  1SL0 A;  3CCV N;  1EKE A;  2NRT A;  2OPP A;  5KQ8 A;  3F73 A;  4IJA A;  3V9Z A;  4EP4 A;  4BWJ A;  3VMF B;  3O9R A;  2FXU A;  2GWJ A;  3AVB A;  1U49 A;  3R8E A;  2G8H A;  3CQY A;  2ZF5 O;  2Y1J A;  1HNI A;  4I2Q A;  4H8K A;  1TYQ B;  3PX6 A;  1OH5 A;  1IO2 A;  2QWR A;  2ZD1 A;  4KFB A;  3VQP A;  3DM2 A;  3F9K A;  3KKS A;  3NF7 A;  3TTC A;  4CGJ A;  4FSV A;  4WQ4 A;  2X6N A;  5J2Q A;  3QNO A;  4M3T A;  3GE1 A;  2O8E B;  1QQO A;  2X78 A;  1BA0 A;  4PKG A;  3L8B A;  1RT2 A;  2BUP A;  2KLA A;  5EX5 A;  3CM6 A;  1NGI A;  3SBG A;  5FPM A;  3P38 A;  4EP5 A;  3CM5 A;  2OAN A;  3P31 A;  3DWL A;  2QXF A;  3RTV A;  1UA0 A;  1NWK A;  4KHY A;  3AVM A;  4O8U A;  3P1G A;  1L5U A;  4ZTJ A;  1YT3 A;  2QXL A;  2DPN A;  3KD1 E;  3RSE A;  2YKN A;  4BC3 A;  3FZH A;  3HOS A;  1RBT A;  2RPI A;  2P5O A;  3B6P A;  3QEP A;  1QSS A;  2QWM A;  5FDL A;  4ILJ A;  3VQ8 A;  3V6D A;  2IOC A;  2A1S A;  4CJT A;  1L3U A;  1WSH A;  4Z4I A;  3RMB A;  5AQS A;  3AVK A;  3H6E A;  3OS1 A;  1BCM A;  2GWK A;  2Q1N A;  4LSN A;  1QQN A;  5KPT A;  1S72 N;  2W6K A;  3F5T A;  4CEZ A;  1RTI A;  4GVE A;  3HP6 A;  5KGW A;  3VF2 A;  2GUI A;  3DLE A;  3ZYY X;  2O8D B;  4M3Z A;  4XH4 A;  3DJC A;  3SQ2 A;  3VA3 A;  3KVG A;  4AHU A;  1KQS M;  3NH2 A;  4OX9 K;  2PYL A;  4CBX A;  4CBU A;  1UAX A;  3KLG A;  1FXX A;  4IO8 A;  4KTZ A;  4F8R A;  2VQE K;  4CK2 A;  1QVF M;  3THV A;  5M1O A;  4DSL A;  5GAH P;  3VTH A;  3M8Q A;  3WQT A;  4Z0U A;  3PLA A;  2P51 A;  3NGI A;  1YJN N;  3ZSQ A;  1WB9 A;  1RIL A;  3ZSW A;  3NFA A;  1HNX K;  3VGM A;  1VSH A;  2F4V K;  5AZJ B;  4M41 A;  3ENB A;  4IJN A;  3CFP A;  4H5N A;  4IFV A;  4CGG A;  1YTU A;  4CZI A;  4B9Q A;  2QEX N;  4RWT A;  4DR5 K;  3THW A;  1DTT A;  5H1S Q;  1L3S A;  1RFQ A;  2O8E A;  3LDQ A;  2ZM6 K;  4O0J A;  4FVU A;  1GLB G;  4C8N A;  5AZI B;  1NOZ A;  1QZ5 A;  5JMV A;  5ADX H;  3MEE A;  3O9Q A;  1DGK N;  2BDP A;  1OVQ A;  4JI6 K;  2G8W A;  3PY8 A;  2F9T A;  4FJH A;  1FKP A;  4B9M A;  3ZEU A;  1SKS A;  3T3F A;  1BIU A;  1X1P A;  3VN5 A;  2IC3 A;  4H0V B;  1NGB A;  4JI5 K;  5IWA K;  1GLF O;  1IKY A;  3C0B A;  4DFJ A;  4XIU A;  3LWM A;  3THX A;  1ZBU A;  4DQI A;  1OH6 A;  4B1U B;  4RG8 A;  2E6L A;  3G6E N;  1X9W A;  1JKH A;  3HST B;  5CHI A;  4BGB A;  3CJA A;  3MN5 A;  2YNI A;  1BOT O;  1CXQ A;  3DI6 A;  4OJR A;  1GLA G;  4WQ5 C;  4FCY A;  4H03 B;  2KZM A;  3FZM A;  4CJV A;  3AVC A;  3CI5 A;  4OKK A;  1D5A A;  2WOM A;  3P4I A;  3L2W A;  5B8H A;  1XUP O;  5HP1 A;  4DKW A;  3CF5 L;  3ZSZ A;  4J8F A;  3M5R A;  1JL2 A;  4NCA A;  1GLE G;  1Z05 A;  4JK7 A;  4MLE A;  2O8D A;  4BRN A;  3CET A;  3SMS A;  1P90 A;  1Z6R A;  3RMD A;  3KD5 E;  1C1A A;  4QAG A;  5AQR A;  4LFA K;  3QEI A;  2FLO A;  4A2B A;  3EN9 A;  4E7I A;  4QS9 A;  3FZL A;  4BRO A;  3AGR A;  4CZF A;  4PWD A;  2YX6 A;  3LDS A;  1KRP A;  4Z4H A;  3OYK A;  2OPS A;  3AA5 X;  3AO5 A;  4FJ5 A;  5AZJ A;  3G0Z A;  5FPN A;  2I7N A;  4CIE A;  5GIN A;  4JD2 B;  2W40 A;  3M6G A;  3MN6 A;  2ITG A;  3EE9 A;  3ZX3 A;  4FJJ A;  3OYB A;  2IVN A;  4HWI A;  4IDH A;  3LAL A;  4V19 S;  3RMA A;  4K42 A;  4HUG A;  4NYF A;  4I9Q A;  1NK8 A;  1S3X A;  2AJQ A;  2FC0 A;  3KLI A;  3K58 A;  1IH7 A;  1C0G A;  1GOB A;  3LAM A;  2HMP A;  2HBJ A;  3CMA N;  2HBM A;  2H3G X;  1U04 A;  2HB5 A;  2XY7 A;  2IVP A;  3MX2 A;  1RDD A;  3QFU A;  2D1K A;  1BI4 A;  2G8U A;  4W5Q A;  4DR7 K;  1NK7 A;  4WQ5 A;  3OY9 A;  2P9I A;  3VF4 A;  4JN4 A;  4CJL A;  3L6Q A;  4JKA A;  3BDP A;  4FLU A;  4DTN A;  3SUQ A;  5KRS A;  1E4F T;  5F0X A;  4DTS A;  2VG5 A;  4EZ6 A;  2KKZ A;  3ENH A;  4YY3 K;  1E4G T;  3ISN C;  1J53 A;  3DOL A;  1WSG A;  3SLC A;  1J9A A;  1EET A;  4IOX A;  5AQO A;  2B4J A;  1U4B A;  4E89 A;  3KLH A;  2GTD A;  3VEV A;  3NMU A;  3MED A;  5AQP A;  3ZX0 A;  1U6Z A;  3D2E A;  1JLQ A;  4B08 A;  2F8T A;  2CGL A;  1N5Y A;  4FOI A;  2HHX A;  2O8C B;  1NGA A;  3FE1 A;  3FFI A;  3MCA B;  1N8R O;  1SS6 A;  2P9N B;  1OH8 A;  1UA1 A;  4KI4 A;  3OS2 A;  4M42 A;  3SCX A;  4Z4G A;  4AHT A;  1LWE A;  3TTD A;  5AQW A;  4BRQ A;  3OYJ A;  1LCU A;  3A0I X;  4CZE A;  1JLE A;  3O4W A;  1TUY A;  3HPH A;  5AQM A;  1VHX A;  3OYM A;  3VQB A;  3AAQ A;  1LAW A;  2OTJ N;  4HUE A;  2BAN A;  4CJ7 A;  3QIO A;  4OPA A;  1KFD A;  3JS6 A;  2J4R A;  4BG9 A;  2BH1 A;  4AH9 A;  2GBZ A;  4PQU A;  3J7A P;  3AVH A;  3CQ8 A;  4UQG A;  3QIN A;  4DUZ K;  2ASP A;  4MDA A;  2ITM A;  4FWS A;  4IWV A;  1XI1 A;  3TAM A;  3SAH A;  1W97 L;  2QWL A;  5HRO A;  4H0O A;  3MN7 A;  4FWQ A;  4IG3 A;  2FF3 B;  4BRF A;  1RBU A;  2FF6 A;  2E6M A;  5BRD A;  5EVZ A;  1CZB A;  5C2D A;  2RHK A;  4CEB A;  1NU0 A;  1VRT A;  3BZK A;  3GOI A;  1TV6 A;  4BRC A;  4HHT A;  3C7N B;  4GMJ B;  4CIF A;  3DRP A;  3ATU A;  2OCE A;  1NK0 A;  4B9V A;  3MX5 A;  2CH6 A;  3HP9 A;  4MO4 A;  4NO7 A;  2UU9 K;  4OLB A;  5AQG A;  2GV9 A;  4B8C A;  3I56 N;  4DV6 K;  3NH1 A;  1HQE A;  1WUA A;  4K41 A;  1LAV A;  3AY9 A;  1MDU B;  4WCE L;  3M8S A;  3I8D A;  4YOV A;  3CC2 N;  4EHT A;  5SWM A;  3SBT A;  4X66 K;  1QS4 A;  1J5E K;  4LH5 A;  1O1W A;  3OYI A;  4JKF A;  2QWN A;  5LMU K;  2UUB K;  4H0P A;  1HLU A;  2P9N A;  4CED A;  1YF5 L;  1CXU A;  1WSE A;  3SYZ A;  1QVG M;  2OA8 A;  3AVN A;  4A5A A;  3SAF A;  1CLQ A;  1X9J A;  1VQM N;  3H3O B;  1NGH A;  4C1N K;  3WEE B;  3UKR B;  3VEY A;  2A3Z A;  1Z26 A;  1SL1 A;  4JK9 A;  1KCF A;  1S9E A;  1N6Q A;  3V4I A;  4CF8 A;  1VSK A;  4B1Z A;  4FWO A;  4E1M A;  2O8B B;  4OKJ A;  4PKI A;  4RW8 A;  1JCG A;  1C0F A;  1ATR A;  2GEM A;  3CXC M;  1HX1 A;  3FFK B;  4FLX A;  4YFU A;  3HRG A;  1ZBS A;  2E1Z A;  4H4O A;  1SKR A;  1EXQ A;  1NGE A;  3QBX A;  3WUH A;  4PKH A;  3OYA A;  3CCM N;  3SPZ A;  4EZ9 A;  4FXD A;  4JV5 K;  3EKS A;  4AHR A;  2ASO A;  4U67 L;  3QDK A;  4N56 A;  3LPU A;  5LMN K;  3WXJ A;  5CZ1 A;  1BG3 A;  1QQC A;  1HUX A;  4BRE A;  4JS4 A;  3C7N A;  5BRE A;  4X64 K;  1E3M A;  3SAG A;  4DTM A;  3MAQ A;  3RRH A;  3V1R A;  1NJY A;  1S9G A;  1M90 O;  3ZSV A;  3BEX A;  3Q7C A;  4QOZ B;  1I3A A;  4FW1 A;  1X9S A;  3OA9 A;  4PL7 A;  1RDA A;  2HVH A;  3W0L A;  4X65 K;  1HYV A;  3T69 A;  3G10 A;  4DS4 A;  2QM1 A;  3E01 A;  3NH0 A;  1RT3 A;  2VQF K;  2DFH A;  2EHG A;  1D4X A;  1SZ2 A;  4K8Z A;  1Q18 A;  5AQJ A;  2ZGY A;  3AO1 A;  3E1Y A;  4TSX A;  3IDH A;  3VQD A;  1BQN A;  1KLN A;  1A5V A;  5HRP A;  4DQR A;  1QSL A;  3BF3 A;  3L4Q A;  3G4S N;  2NNW A;  4E7L A;  1UOC A;  1KLM A;  1NGC A;  3ULE B;  3KHY A;  4E1N A;  3QEV A;  1KSP A;  3EYZ A;  5GIP A;  4FLY A;  2P9K A;  3NGY A;  4BC2 A;  1K8K B;  2W41 A;  2X74 A;  3DAW A;  2D0B A;  3VQ6 A;  1RBS A;  4N76 A;  3WEE A;  1K8A O;  1IKV A;  2IAJ A;  3C6U A;  4BR0 A;  1B9F A;  3AA4 A;  3WNH A;  2XHB A;  4FJG A;  4EHU A;  1U2V B;  1NNE A;  2W42 A;  5AQN A;  3HBT A;  2NRW A;  3D7E O;  4OGC A;  2FBY A;  1NJW A;  5CR4 A;  4KAZ A;  3BY5 A;  3O9S A;  3K59 A;  4DSJ A;  4KTW A;  1JLB A;  2O8B A;  2HW3 A;  4WYB A;  3PX0 A;  2BGG A;  3FGU A;  4C8L A;  4JYA K;  2D4W A;  1VK0 A;  2ZGZ A;  3I33 A;  3U9D A;  2E8A A;  4OPJ A;  5LJV A;  5AQL A;  2V7Y A;  3AGK A;  4XH5 A;  5C25 A;  4U7B A;  3D2F B;  4DCH A;  4BRM A;  4O44 A;  1VQ9 N;  3KK1 A;  4GW6 A;  1XNR K;  2V52 B;  4NXN K;  4LF4 K;  4IEI A;  3FZF A;  3GG4 A;  2YI1 A;  3CHW A;  5CZ2 A;  3CD6 N;  3O08 A;  3C6A A;  4Z4E A;  1RTD A;  4CHZ A;  1ZXO A;  1LV5 A;  4YDU C;  4M3R A;  1VAZ A;  1VSL A;  4XH1 A;  4BE1 A;  1GLL O;  4CFB A;  3VET A;  3ATV A;  3HM8 A;  4GY2 B;  3VEX A;  1Q9X A; 
#chains in the Genus database with same CATH homology
 5HP1 A;  3SQ4 A;  1JL1 A;  4B3O A;  3ZSZ A;  3ZSX A;  3LZJ A;  4JRQ A;  5I42 A;  2PZS A;  1JL2 A;  5EU7 A;  4FJX A;  4CJQ A;  4NCA A;  5J2N A;  4KHU A;  2HHS A;  4CHP A;  3LPT A;  3SUN A;  1XWL A;  3DMJ A;  3S3M A;  4DSF A;  3SJJ A;  2D5R A;  1VSD A;  4O5B A;  1REV A;  4HCC A;  3DLK A;  2HNZ A;  1NK4 A;  3RMD A;  1VSE A;  4N47 A;  3AA2 A;  1Q8I A;  3KD5 E;  2ZE2 A;  4ID1 A;  1C1A A;  4QAG A;  5DMR A;  1JLC A;  3QEI A;  3HT3 A;  4FZY A;  4E7I A;  1JLG A;  1SV5 A;  4NCB A;  3AO2 A;  2KFZ A;  4F2S A;  4O0I A;  3U3Y A;  1RT1 A;  4PWD A;  1ASW A;  4B9L A;  4FZX C;  3HPO A;  3LDS A;  2O4G A;  1KRP A;  4Z4H A;  3OYK A;  2OPS A;  3SZ2 A;  1WSJ A;  4RW9 A;  3AA5 X;  3ZCM A;  4DTX A;  3AO5 A;  4FJ5 A;  1KTQ A;  3RRG A;  2P5G A;  3L2U A;  3VQQ A;  4C8K A;  4KI6 A;  1CZ9 A;  1ITG A;  1TKZ A;  3G0Z A;  1S6P A;  3WNG A;  3ZT2 A;  3M8R A;  4CEE A;  4CF9 A;  1RT5 A;  4CIE A;  4C8O A;  4RW6 A;  4BDP A;  1QSY A;  2XY6 A;  3AVL A;  5KI6 A;  3RWU A;  3C94 A;  4CEC A;  4I9L A;  2FBX A;  3LWL A;  1J5O A;  2ITG A;  4L8R B;  4CJR A;  4FJJ A;  3OYB A;  1FKO A;  3T19 A;  3LAL A;  3S3O A;  4CJW A;  1F21 A;  3ZSY A;  4OPK A;  3K5M A;  3LAN A;  4CGI A;  3RMA A;  1X9M A;  4HUG A;  1SL2 A;  4NYF A;  1BHL A;  3HL8 A;  4BE0 A;  2ATQ A;  1NK8 A;  4I9Q A;  2AJQ A;  1VSJ A;  2FC0 A;  3ALY A;  3KLI A;  3K58 A;  5HLF A;  2OPR A;  4JRP A;  1IH7 A;  4Q5V A;  1GOB A;  1QE1 A;  3LAM A;  3K5O A;  4FJK A;  4FYD A;  4DTR A;  2VWK A;  1S1X A;  4B9N A;  1BIZ A;  1WSI A;  5JS2 A;  4ELT A;  1U04 A;  4I7F A;  4F4K A;  2HB5 A;  2XY7 A;  4FZZ A;  4KHW A;  2HHT A;  1RDD A;  1A5X A;  4I2P A;  4FM1 A;  3D0P A;  1NKE A;  2YV0 X;  5DK5 A;  4BDY A;  3PUF A;  1ZBL A;  1D9D A;  1BI4 A;  3NGZ A;  4J2D A;  5SZT A;  3VQ9 A;  2G8U A;  4W5Q A;  4LH4 A;  1BIS A;  4KHS A;  1J54 A;  1NK7 A;  4CCH A;  1T03 A;  4M45 A;  3K57 A;  4CF1 A;  3QIP A;  1B92 A;  5HRR A;  3OY9 A;  1R0A A;  3K2P A;  4J2B A;  4CJL A;  3BDP A;  4FLU A;  4DTN A;  4E19 A;  2HMI A;  1Z25 A;  3KJV A;  2XRI A;  3SUQ A;  3RMC A;  1U48 A;  3PO5 A;  1VRU A;  4Q0B A;  1VSI A;  4GVM A;  3CFO A;  5KRS A;  3KLF A;  4DTS A;  4EZ6 A;  2VG5 A;  3NF6 A;  4DLE A;  2FBV A;  1NOY A;  4DTJ A;  3ISN C;  4OGE A;  1J53 A;  1MU2 A;  4MFB A;  3DOL A;  4O55 A;  3TAG A;  3HO1 A;  4CJP A;  4FK4 A;  1WSG A;  3HJF A;  4Y1D A;  3OYH A;  1J9A A;  1EET A;  3NCI A;  3AO4 A;  4CJ4 A;  1UWB A;  2B4J A;  1U4B A;  2VG6 A;  5J2M A;  4KB0 A;  4E89 A;  2DY4 A;  1B9D A;  3TAB A;  2OZS A;  4AHC A;  1YTA A;  3OYE A;  1WAF A;  1GOC A;  4AIL C;  4KRE A;  2YNH A;  3IRX A;  3KLH A;  3AVJ A;  4CJ5 A;  3JSM A;  4YNQ A;  2PY5 A;  4CE9 A;  4M3X A;  1EX4 A;  1S1T A;  4RW4 A;  1JLA A;  4FLV A;  4FJ7 A;  1IKW A;  4CIG A;  4W5O A;  3MED A;  3OS0 A;  2KFN A;  3KTQ A;  3L2Q A;  1RNH A;  1RTH A;  1JLQ A;  4FW2 A;  4PA1 A;  4B08 A;  2F8T A;  1N5Y A;  3AVG A;  4LD0 A;  2HHX A;  3AA3 A;  3QLH A;  4OVL A;  4E7K A;  4JLH A;  3OYN A;  1TK8 A;  3FFI A;  2KTQ A;  5KRT A;  1UA1 A;  2F96 A;  4KI4 A;  1RBR A;  3OS2 A;  1TKD A;  4M42 A;  4QCL A;  3SCX A;  4Z4G A;  4DQS A;  4H4M A;  4DWI A;  4HCB A;  4AHT A;  2HHU A;  1LWE A;  3A2F A;  1SKW A;  4DSK A;  4ELU A;  3OYJ A;  4FM0 A;  4KKO A;  2IS3 A;  4ZTF A;  4CEQ A;  3DRR A;  4KRF A;  1JLE A;  3ZT3 A;  3TI0 A;  4DQP A;  3AO3 A;  2HHW A;  2D0C A;  3IS9 A;  3RR8 A;  3HPH A;  2O4I A;  1HJR A;  2DFE A;  3I0S A;  3OYM A;  3V1Q A;  1TK5 A;  4IKF A;  1TAU A;  3VQB A;  1VSM A;  2HND A;  1JXE A;  2XY8 A;  1FK9 A;  1LAW A;  3KKR A;  1VSF A;  4DSI A;  4FK2 A;  4BDZ A;  3BGR A;  3DLR A;  4NCG A;  2KW4 A;  3NHG A;  2BAN A;  2YHB A;  4HUE A;  4B9S A;  3O3F A;  3QIO A;  1KFD A;  2WON A;  4CEF A;  3DLB A;  4AH9 A;  1JLF A;  2GBZ A;  4W5T A;  4PQU A;  1TL1 A;  3L2R A;  3B6O A;  3KK2 A;  3AVH A;  3ZSO A;  2YHA A;  3CQ8 A;  4UQG A;  2I5J A;  1LWF A;  3QIN A;  4R5P A;  4AHV A;  3TAQ A;  5J1E A;  2G8K A;  3QER A;  3HK2 A;  3OVN A;  1LWC A;  4CES A;  4ICL A;  4WE1 A;  4FLW A;  1XI1 A;  3VQ7 A;  1U47 A;  2XO7 A;  1GOA A;  4NYN A;  3TAM A;  1RDC A;  3AVI A;  5CYQ A;  1TL3 A;  3LP1 A;  1NK9 A;  3RR7 A;  4E7J A;  5HRO A;  3NF8 A;  4OKE A;  1BGX T;  2E4L A;  1T7P A;  5JS1 A;  3V9X A;  3LP2 A;  4IG3 A;  1Y97 A;  2YNG A;  1WN7 A;  1DLO A;  3QES A;  2ETJ A;  3OYC A;  4B9T A;  3V9S A;  1EP4 A;  1HNV A;  4DLG A;  1C0U A;  3MXI A;  1RBU A;  3PO4 A;  1TKX A;  1HRH A;  3SUO A;  2E6M A;  1NK6 A;  4DU4 A;  1L3V A;  1KFS A;  4J2A A;  4RW7 A;  4FJ9 A;  1S1W A;  1CZB A;  1C0T A;  4CEB A;  4N41 A;  1VRT A;  4IBN A;  1TVR A;  2IDO A;  3SPY A;  1TV6 A;  3QO9 A;  1C1C A;  3ASM A;  4HHT A;  3NDK A;  4CF2 A;  4DFP A;  1RT7 A;  3DOK A;  4GMJ B;  3P5J A;  4CIF A;  4M3Y A;  1LW2 A;  1KVC A;  4KPY A;  1W9H A;  4CGH A;  3DRP A;  4KTQ A;  2LSN A;  4W5R A;  4PUO A;  5D3G A;  2HHV A;  4FJI A;  3MXJ A;  4F3O A;  3DLG A;  3OYG A;  3I0R A;  1NK0 A;  4ZHR A;  4B9V A;  1A5W A;  4AHS A;  1RCH A;  3HP9 A;  3VQ4 A;  3VQE A;  4M3U A;  4FLZ A;  1RT4 A;  3U6F A;  4OLB A;  4ELV A;  5CY4 A;  1D8Y A;  1T8E A;  1D9F A;  2NUB A;  3HVT A;  2GV9 A;  3ZT1 A;  1U45 A;  3IAY A;  4B8C A;  3SUP A;  3OYF A;  1ASU A;  2IGI A;  5C24 A;  1HQE A;  5K14 A;  3NH1 A;  3SV4 A;  3AVF A;  1NJZ A;  1RTJ A;  2OYQ A;  1LAV A;  2QK9 A;  2KZZ A;  1HMV A;  3OJU A;  1KVA A;  2YKM A;  2XY5 A;  3HPG A;  3L2V A;  3TAE A;  4Y1C A;  4IG0 A;  1RBV A;  3M8S A;  2DTU A;  3SI6 A;  3I8D A;  4KO0 A;  5SWM A;  1TKT A;  4CEO A;  1T05 A;  4DTO A;  4JS5 A;  4DU1 A;  3SNN A;  3NF9 A;  4BWM A;  1TAQ A;  1QS4 A;  4CEA A;  1RT6 A;  4LH5 A;  3NAE A;  1O1W A;  3OYI A;  4FJ8 A;  1S6Q A;  1SL0 A;  1EKE A;  2OPP A;  1YVU A;  3F73 A;  1K6Y A;  2Q3S A;  4CED A;  1NKC A;  3V9Z A;  3CYM A;  4IFY A;  4EP4 A;  3DLH A;  4BWJ A;  3CG7 A;  2HNY A;  5C42 A;  1CXU A;  4B9U A;  1S1V A;  3AVB A;  1U49 A;  2G8H A;  2Y1J A;  1HNI A;  4I2Q A;  4H8K A;  3PX6 A;  1WSE A;  1DTQ A;  1IO2 A;  2Z1G A;  2ZD1 A;  3SYZ A;  2OA8 A;  4KFB A;  1S5J A;  3AVN A;  2G8F A;  3VQP A;  1CLQ A;  3DM2 A;  3F9K A;  3K5L A;  1BI4 B;  1ZBI A;  3U3G A;  3KKS A;  3NF7 A;  4CGJ A;  4FK0 A;  4CHO A;  4J2E A;  2X6N A;  3L3U A;  1S1U A;  5J2Q A;  4FJN A;  3QNO A;  4M3T A;  3V81 A;  2Z1H A;  1Z26 A;  3M8P A;  1SL1 A;  4G1Q A;  2X78 A;  3QET A;  5KGX A;  3MXM A;  1KCF A;  1S9E A;  2Z1J A;  3ITH A;  1N6Q A;  3L8B A;  1RT2 A;  3V4I A;  4CF8 A;  1ASV A;  3CM6 A;  4BAC A;  1VSK A;  4FVM A;  4E1M A;  4DTP A;  5HRN A;  4EP5 A;  5T7B A;  3CM5 A;  4OKJ A;  4DF4 A;  2QXF A;  4RW8 A;  3KIO A;  3RTV A;  4DS5 A;  1UA0 A;  3O4N A;  5J2P A;  4KHY A;  3AVM A;  3ZSR A;  3P1G A;  3QNN A;  4ZTJ A;  1L5U A;  4F2R A;  4FLX A;  3TAF A;  1YT3 A;  4CER A;  3S9H A;  4YFU A;  2ZQB A;  3HVR A;  4O4G A;  2B5J A;  3KLE A;  4DFK A;  4DMN A;  3CFR A;  3EY1 A;  3KD1 E;  4H4O A;  2YKN A;  1IG9 A;  1SKR A;  4F3T A;  4CJF A;  1EXQ A;  1RBT A;  2RPI A;  2P5O A;  3OYA A;  3SPZ A;  4EZ9 A;  3B6P A;  5FRM A;  3QEP A;  4FXD A;  3MEG A;  4AHR A;  1NJX A;  4N56 A;  3DRS A;  3LPU A;  4CHQ A;  4K8X A;  2G8I A;  1ZBH A;  5CZ1 A;  1Q9Y A;  1NKB A;  1QSS A;  4IDK A;  4KHQ A;  1QQC A;  4DU3 A;  2KQ2 A;  5FDL A;  3VQ8 A;  3V6D A;  2IOC A;  4JS4 A;  2A1S A;  3DYA A;  4CJT A;  4DG1 A;  4KB1 A;  3O3H A;  3QEW A;  2A1R A;  1TGO A;  3WNF A;  1L3U A;  5FRO A;  1WSH A;  5HBM A;  4Z4I A;  3RMB A;  1G15 A;  4DTM A;  3MAQ A;  3AVK A;  3V1R A;  3OS1 A;  1S9G A;  4CK1 A;  3P83 D;  3HM9 A;  3RRH A;  3D45 A;  1NJY A;  3AV9 A;  3ZSV A;  3ZT0 A;  4QOZ B;  1TK0 A;  1BCM A;  4LSN A;  1I3A A;  3O4Q A;  4FW1 A;  4CEZ A;  1RTI A;  1X9S A;  3HP6 A;  5KGW A;  3SQ0 A;  1WAJ A;  2GUI A;  3DLE A;  1RDA A;  4M3Z A;  3ULD A;  1HPZ A;  2HVH A;  1I39 A;  3NE6 A;  3SQ2 A;  1HYV A;  4E3S A;  3G10 A;  3VA3 A;  4CHN A;  4AHU A;  4DS4 A;  3E01 A;  3NH2 A;  3NH0 A;  1RT3 A;  2G8V A;  2Y1I A;  1QTM A;  2DFH A;  5CYM A;  2YNF A;  3MEC A;  2EHG A;  2PYL A;  2R7Y A;  1XC9 A;  1UAX A;  3KLG A;  1FXX A;  1ZBF A;  2VG7 A;  4KTZ A;  2OPQ A;  2QKK A;  2PYJ A;  4F8R A;  3C95 A;  4K8Z A;  3TAP A;  4CK2 A;  2RF2 A;  1L3T A;  2JGU A;  3EZ5 A;  3THV A;  3AO1 A;  5E41 A;  4DSL A;  1C0M A;  5I3U A;  1KVB A;  3M8Q A;  4TSX A;  1JXB A;  4Z0U A;  3VQD A;  1BQN A;  2P51 A;  4CJK A;  4CJS A;  3NGI A;  4DFM A;  1A5V A;  3QEX A;  1KLN A;  5HRP A;  3ZSQ A;  4FJM A;  4DQR A;  1RIL A;  1QSL A;  3ZSW A;  3NFA A;  4PY5 A;  3TWH A;  1SUQ A;  4C8M A;  3LP3 A;  4OLA A;  4E7L A;  1UOC A;  1VSH A;  1BL3 A;  3V1O A;  4CFA A;  2B6A A;  4E7H A;  1WNS A;  1KLM A;  4CHY A;  4N5S A;  4FJL A;  4M41 A;  3HXM A;  4E0D A;  3CFP A;  4CGG A;  4IFV A;  5HRS A;  1YTU A;  1QHT A;  4E1N A;  3QEV A;  1WSF A;  3ZT4 A;  4DTU A;  3H08 A;  3OYL A;  3EYZ A;  4DF8 A;  1KSP A;  4FLY A;  2HHQ A;  3NGY A;  4CJ3 A;  3K5N A;  2EX3 A;  1C6V A;  3LP0 A;  4CFD A;  4BE2 A;  3OYD A;  1WLJ A;  3V9U A;  3SQ1 A;  2X74 A;  2RN2 A;  3UIQ A;  4LY7 A;  2D0B A;  3VQ6 A;  1RBS A;  2VWJ A;  1XHZ A;  4CGF A;  3KK3 A;  4W5N A;  1DTT A;  4MQ3 A;  3T1A A;  1NK5 A;  4N76 A;  1IKV A;  2IAJ A;  3C6U A;  4KV8 A;  1L3S A;  4M3W A;  1B9F A;  3AA4 A;  3WNH A;  2Z1I A;  2XHB A;  4FJG A;  2F8S A;  4CK3 A;  4O0J A;  1HYS A;  4C8N A;  4CJU A;  2W42 A;  4DQQ A;  2QKB A;  1NOZ A;  1LW0 A;  1BQM A;  5FRN A;  4OGC A;  2FBY A;  1NJW A;  4KAZ A;  1RDB A;  1HYZ A;  2DFF A;  3K59 A;  4B8A B;  4DSJ A;  4KTW A;  1JLB A;  3AVA A;  2HW3 A;  2BGG A;  3MEE A;  3PX0 A;  4C8L A;  2D0A A;  3L3V A;  2G8W A;  2BDP A;  3PY8 A;  1VK0 A;  4FJH A;  1FKP A;  2RKI A;  4B9M A;  1SKS A;  1BCO A;  4OPJ A;  1BIU A;  1X1P A;  3T3F A;  3VN5 A;  3V9W A;  3O3G A;  3WNE A;  2IC3 A;  3VQ5 A;  5C25 A;  3TAN A;  2P1J A;  2FBT A;  4DSE A;  4HVJ A;  4HUF A;  1XHX A;  4O44 A;  3C6T A;  4ID5 A;  3KK1 A;  4GW6 A;  4CGD A;  4FM2 A;  4FLT A;  3TR8 A;  3OJS A;  1IKY A;  1HQU A;  3VQA A;  4Z4F A;  2HVI A;  3HYF A;  4DFJ A;  3S3N A;  4XIU A;  3LWM A;  4LSL A;  4Z4C A;  1C1B A;  5CZ2 A;  3SV3 A;  1ZBU A;  4DQI A;  4Z4E A;  4RG8 A;  2BE2 A;  3LZI A;  2E6L A;  2JLE A;  1X9W A;  4CFC A;  1RTD A;  4CHZ A;  1LV5 A;  1JKH A;  3HST B;  4M3R A;  2YNI A;  1ZYQ A;  1VSL A;  3PX4 A;  1CXQ A;  3DI6 A;  4OJR A;  3VA0 A;  3PV8 A;  4BE1 A;  4CFB A;  4FCY A;  3VQC A;  2OZM A;  4HTU A;  1W0H A;  4CF0 A;  2KZM A;  3JYT A;  4CJV A;  1Q9X A;  3TAR A;  5KTQ A;  3AVC A;  4OKK A;  4CJE A;  1D5A A;  2WOM A;  3LAK A;  1IKX A;  3IG1 A;  3L2W A;  4KHN A;  3NBP A;  2X6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...