4CGIA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
154
structure length
150
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 53
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cgiA00
2EHGA 4DMNA 4E1MA 1DTTA 3ASMA 3PO5A 3KD5E 3VQ9A 3OYFA 4DQQA 1XI1A 4MFBA 1WN7A 4H4MA 3ZSVA 4C8NA 1VSKA 1DTQA 4FJJA 2IGIA 1CLQA 3V81A 1CZBA 3VQEA 1QSLA 4KI4A 2DTUA 2F8TA 4B9LA 4LD0A 2QKBA 2A1SA 4CJKA 4CF1A 3OYJA 3V9WA 1RCHA 1YVUA 4EP4A 1LAVA 3OJSA 2VWJA 1BL3A 2IDOA 3LPTA 1TKXA 1VSDA 1WSHA 3NAEA 1NOZA 1YTUA 4DTMA 4BE0A 3LWLA 2B5JA 3OS1A 3O4NA 4ICLA 4FXDA 4ELVA 4DSFA 2QKKA 2DFFA 1VRTA 1NK4A 3MXMA 5HRNA 1ZBLA 3AVAA 1N5YA 4LH5A 4B9VA 4CGHA 4CJWA 1IKVA 1JLBA 1X9MA 4NCAA 1QSYA 2Z1IA 4OKKA 1C0TA 3TAQA 3VQBA 4RW8A 4AHVA 3AO4A 3OYCA 1VRUA 3SQ4A 1JLQA 1C1AA 3ITHA 2GUIA 1T05A 3AO3A 4FJNA 3LZIA 3DOLA 4E7IA 1Z25A 3ZT0A 2AJQA 4CFCA 1RT2A 3B6PA 4W5NA 2FBXA 2YNHA 3HYFA 1C0MA 4JRPA 4ZTFA 1XWLA 5KRSA 2YKNA 1ASVA 4W5TA 4NCGA 4BE1A 3TWHA 4IFVA 4M3WA 4NYFA 5CZ2A 1VK0A 3OYKA 4OVLA 4DSLA 1J9AA 1TV6A 4KHUA 4FM2A 1LV5A 1QSSA 4FM0A 2FBVA 1LWEA 4AILC 1D9FA 4B8AB 3KKRA 2NUBA 4CJUA 1LAWA 3SI6A 4CF9A 2PYJA 4M3UA 1O1WA 4H4OA 3OYEA 4KHWA 4EP5A 4OKEA 2GV9A 4DTJA 3C95A 4W5QA 3KJVA 1SUQA 4J2EA 1VSFA 2B4JA 5CZ1A 4DS4A 3U3YA 2O4GA 3K5MA 2D0CA 4CF8A 2G8VA 3WNHA 1RBRA 3LP1A 4FVMA 3LDSA 4LY7A 4DSJA 4ZHRA 3S3NA 3QERA 3G10A 3SUNA 3RMCA 1FKPA 3QNOA 1S5JA 3VQ4A 4N56A 3LANA 4FJIA 4FW2A 5C24A 1BIUA 1NK9A 3DRPA 3I0RA 1NK7A 3RMBA 1BIZA 2HHTA 2D0BA 2YNIA 2GBZA 1NOYA 1RTIA 4QOZB 3RRHA 4KB0A 3LP0A 4UQGA 4BDZA 4KHNA 4Z4IA 4BACA 1GOCA 3C94A 4DFPA 4DQPA 5HP1A 3T3FA 2WOMA 2F8SA 4CJTA 4CEBA 4AHTA 2IS3A 5FROA 4DU3A 4FYDA 3WNGA 3OYAA 1TKZA 4E7KA 3QNNA 3QIOA 3ZT2A 1X1PA 4M3RA 5KRTA 1WSJA 1UWBA 3B6OA 3SQ2A 4KTQA 3IS9A 3KLIA 4KPYA 1RILA 5HRSA 5E41A 4N5SA 3THVA 5FRMA 4Z4EA 4Y1DA 2XY5A 2HNZA 1JXBA 4PQUA 4KTWA 1KLNA 3VN5A 4LSLA 2FBTA 4IBNA 1T7PA 2VWKA 3HSTB 5I42A 3HPOA 3AVIA 2RPIA 3CYMA 3MAQA 4IG0A 2WONA 3HPGA 4I2PA 4O0IA 1TK0A 1ITGA 1XC9A 3AO2A 1WAJA 1BHLA 1TVRA 3L3VA 3F9KA 1U48A 4Q0BA 3AVBA 4N47A 4KHSA 1RBTA 4OGEA 1WLJA 4DF8A 3OYHA 1QE1A 3AVJA 4FCYA 1RDAA 4I9LA 2ITGA 4IG3A 3V1OA 4FJHA 3U3GA 4M3TA 1XHZA 4Z4GA 2HNYA 1RNHA 4W5RA 4DTNA 3OYMA 1GOBA 1KVAA 4O55A 4F2RA 3UIQA 1NJWA 3QIPA 1NJXA 3RRGA 3AO5A 4QCLA 5JS1A 5DMRA 3P1GA 2ETJA 2VG5A 4E3SA 4O5BA 3OYNA 3M8PA 3HJFA 1KFSA 1ZBUA 2KQ2A 3KK3A 1F21A 2BE2A 4OJRA 5HRRA 1IKXA 1S1UA 1S1TA 2RF2A 3VQ7A 3VQPA 4CJPA 1J53A 1FXXA 3DLRA 4DQRA 3DOKA 4CHQA 2KZMA 4I9QA 1RDDA 2I5JA 3BDPA 2LSNA 4CECA 4ID1A 4Z4CA 5FRNA 3L2RA 1I3AA 4AHUA 2JLEA 4W5OA 1S9GA 3L2QA 1WSFA 3LPUA 3KLFA 3NE6A 2HVIA 3ZSRA 1U49A 3SUOA 2IOCA 4RW4A 3K59A 4IKFA 3OS2A 4CJ3A 4KB1A 3S9HA 5JS2A 2PYLA 1VSHA 4M41A 3RTVA 4BDPA 4ELUA 1D8YA 3SQ1A 4OKJA 2HW3A 1JLFA 4Q5VA 1L3VA 2Q3SA 1GOAA 5CYMA 2D0AA 1JL1A 2A1RA 4C8KA 3D0PA 4FLTA 2OPQA 3AVKA 1BI4A 4K8XA 3NF8A 1HRHA 3S3MA 3KD1E 4GMJB 3MECA 2FC0A 4DLGA 4CHZA 4KV8A 4CEQA 4KRFA 3CG7A 3DM2A 1LWFA 3KK1A 2YKMA 4C8OA 4R5PA 2VG7A 4CESA 2G8UA 1WSEA 3SUQA 2IC3A 1S1VA 1FKOA 2D5RA 2OZMA 3NH0A 2ZD1A 2KTQA 4I2QA 3HXMA 1CZ9A 3JYTA 4XIUA 1HNIA 1ZBHA 1ASUA 2E6MA 1A5WA 3DLBA 4DQIA 3AV9A 3I0SA 1RBSA 4GVMA 1J54A 4RW6A 2P5OA 3L2WA 1LW2A 1MU2A 5SWMA 1VSIA 4FLXA 4Z4FA 3WNFA 4KTZA 2RKIA 3HVRA 1I39A 4F2SA 2KFNA 3CFOA 4OPKA 3HO1A 3AVGA 3AA2A 2OPSA 3TARA 1U04A 3AVCA 3SPZA 5DK5A 4ZTJA 4HCBA 1IG9A 3OYLA 1HJRA 3P5JA 4CHOA 4O44A 4KO0A 3T19A 4DSIA 3S3OA 2HHXA 3TANA 3H08A 4CJVA 2DFEA 3TABA 4HVJA 4M42A 2W42A 1RTDA 1NK6A 2P51A 4DG1A 3M8SA 2YHBA 3V1QA 4Z4HA 3CFRA 3K57A 4CGJA 4FZXC 5SZTA 2HHWA 2XO7A 4LH4A 3ULDA 3IRXA 1R0AA 4LSNA 3CFPA 1WNSA 3SQ0A 4AH9A 1G15A 4OLBA 2F96A 3OYBA 4FZYA 2YV0X 3LZJA 1FK9A 1JL2A 2HHSA 1VSLA 3C6UA 5HRPA 1JLCA 3DYAA 3OY9A 3KLHA 3DLEA 3I8DA 2PZSA 5T7BA 4DFJA 4J2DA 5CY4A 1C1BA 2HB5A 4CCHA 4FZZA 4MQ3A 1ZBFA 3VQ5A 5FDLA 1WSIA 3KLEA 4PY5A 4AHCA 3EYZA 4FJLA 2ZE2A 4I7FA 3RWUA 1RT1A 1REVA 2ZQBA 3QINA 4E7LA 1LW0A 3RMAA 1A5VA 4CEOA 3AVLA 3SNNA 4KAZA 4BWJA 4CE9A 4BE2A 4HTUA 1HQUA 3DMJA 4CHNA 2FBYA 4RG8A 1HYSA 1KTQA 3V6DA 4CK1A 4FJ5A 3RR8A 3MXIA 3PV8A 4NYNA 3V4IA 4EZ6A 4N76A 4NCBA 1RTJA 4HUEA 4B9UA 4FK2A 3K5NA 3V9ZA 2G8HA 1HYZA 4KHQA 3HVTA 3ZSQA 1QHTA 3OYIA 2QK9A 4CEZA 2KFZA 1NKBA 3HPHA 1TKDA 4DFKA 5J2QA 4CEDA 5KI6A 4B9TA 4F4KA 2OA8A 2PY5A 3ZSWA 1Z26A 1DLOA 5J1EA 3VQQA 1UAXA 1A5XA 2KW4A 3OJUA 4FLUA 2HMIA 4H8KA 3NH1A 2OZSA 3AO1A 4J2AA 4CF0A 4K8ZA 2P1JA 3IAYA 3DI6A 2HHVA 1TL3A 2Z1GA 3L2UA 1L3UA 4HHTA 3TAPA 4DU4A 4CEAA 5HBMA 1RT4A 3DRSA 4FLVA 2DFHA 2G8IA 4E89A 1VSMA 4C8MA 4JS4A 3SPYA 3RR7A 3MXJA 3PX0A 1QTMA 1ASWA 1B92A 4DU1A 2X6NA 4FJXA 3QEWA 1RTHA 4DTOA 4DFMA 1TAQA 4B8CA 3O4QA 1UA0A 3VA0A 1SL0A 3HT3A 4CIFA 2JGUA 1RT3A 2RN2A 3VQ8A 4FLYA 4DTPA 3TAGA 1RT5A 3NGYA 4O0JA 4BDYA 4L8RB 3KIOA 3OS0A 3K5LA 3NGZA 1VSJA 4FJ7A 1KFDA 2XHBA 3PY8A 1RDBA 4CJ4A 3ZT3A 1YTAA 1QS4A 4DWIA 3PO4A 4CGGA 4Z0UA 3T1AA 1C0UA 1BCOA 3V1RA 3L2VA 1Q9YA 3OVNA 3HK2A 2HNDA 4E19A 1EKEA 4B3OA 5J2NA 3ZT4A 1C1CA 3VQAA 1TK5A 4E7HA 1TGOA 1EX4A 1B9FA 1TK8A 4E0DA 1X9SA 4QAGA 2E6LA 4FJ8A 1QQCA 3ZSYA 2X78A 1NJYA 2XRIA 3SZ2A 3K5OA 3EY1A 4WE1A 4DLEA 1ZYQA 4M3XA 3NCIA 1BISA 3SYZA 3LALA 3MEGA 1T03A 1SL2A 3NH2A 3A2FA 3SV4A 4CGFA 5HLFA 4F3TA 1TAUA 4OGCA 3PX6A 1NJZA 1CXUA 3TR8A 4FJKA 2HHUA 4HUFA 3LAMA 3SUPA 1K6YA 1B9DA 4DTUA 1CXQA 2XY6A 1UA1A 2Y1JA 3K2PA 4FK0A 3ZSZA 3ISNC 1JXEA 3PUFA 4F8RA 4FJMA 4PWDA 2XY8A 2R7YA 4KHYA 1XHXA 4CFBA 4CK3A 4DS5A 3QEIA 1RT7A 4FW1A 4Y1CA 2G8WA 4C8LA 1KVBA 3SCXA 3VQDA 1KCFA 2X6SA 3TAFA 1RDCA 3TI0A 1SKRA 1ZBIA 3CQ8A 3D45A 1HMVA 1BQMA 1HPZA 1Q8IA 4CERA 4FLZA 3U6FA 1BCMA 1N6QA 3KK2A 3ALYA 3BGRA 5K14A 4DTXA 3KLGA 3C6TA 3L8BA 4CHYA 2YHAA 4FM1A 2BGGA 3HL8A 1SV5A 1SKWA 4F3OA 4KREA 3P83D 1EXQA 2OPPA 1L3TA 1BI4B 2YNFA 2X74A 1RBVA 3NF9A 4CJSA 4E7JA 4CEEA 5C42A 4BWMA 4JS5A 3O3FA 4DQSA 2ATQA 4O4GA 3JSMA 3ZCMA 4M3YA 2Z1HA 2B6AA 5I3UA 1KSPA 1RBUA 2VG6A 4B08A 4DTSA 3O3HA 2E4LA 5EU7A 3QEPA 1HYVA 3QESA 4J2BA 4DF4A 5J2PA 1S1WA 2G8FA 1HNVA 1EETA 3V9XA 3AVNA 3DLGA 1HQEA 1IO2A 4CJLA 3HP6A 3M8RA 4B9NA 1TKTA 3HP9A 4CF2A 3MEEA 1S6PA 3NHGA 3V9UA 2G8KA 3LP3A 1KRPA 3CM6A 1S1XA 3NF7A 4RW9A 4CIEA 3TAEA 2DY4A 3DLHA 4M3ZA 1C6VA 1LWCA 4YFUA 4JLHA 1Y97A 4IDKA 2Y1IA 3LP2A 3LAKA 4N41A 1JLAA 4M45A 1W0HA 4CGIA 5KTQA 3LWMA 1U45A 1JKHA 2Z1JA 4TSXA 4CK2A 3OYGA 3FFIA 4KI6A 4EZ9A 3AA4A 1NK5A 1WSGA 2YNGA 4KFBA 1NKEA 2EX3A 4OPJA 1L5UA 3ZSOA 4CEFA 4HCCA 1D5AA 4E1NA 2IAJA 3O3GA 3NGIA 1SKSA 4YNQA 4FJGA 4B9MA 3KKSA 1NK0A 4FJ9A 3DLKA 3G0ZA 3L3UA 4FLWA 5HROA 4CJEA 1WAFA 4CIGA 2HVHA 2BDPA 1KLMA 5D3GA 4DSEA 1JLEA 2P5GA 3AVFA 1U47A 3VQCA 3RMDA 3K58A 2QXFA 1IH7A 1S9EA 1BGXT 3MEDA 3IG1A 4CJRA 3EZ5A 4ID5A 4CGDA 3NFAA 2OYQA 4CJFA 2XY7A 1D9DA 4FK4A 4B9SA 3TAMA 4OLAA 3V9SA 1EP4A 3SV3A 2BANA 3HM9A 4AHSA 3AA5X 4DSKA 5KGXA 1JLGA 1SL1A 3AA3A 4DTRA 3SJJA 5CYQA 1L3SA 1TL1A 3F73A 3QLHA 4GW6A 1IKYA 1NKCA 3QEXA 2KZZA 4PUOA 1BQNA 4CHPA 1Q9XA 3KTQA 5KGWA 4PA1A 5J2MA 4ELTA 2O4IA 1IKWA 3ZT1A 5C25A 2HHQA 3OYDA 3ZSXA 1X9WA 3NF6A 3VQ6A 4HUGA 3QEVA 3DRRA 4CFDA 4RW7A 3E01A 3NBPA 3AVHA 4CJ5A 3CM5A 4CFAA 3VA3A 3QETA 1RT6A 1KVCA 1UOCA 3AVMA 4JRQA 3WNEA 3M8QA 1NK8A 1S6QA 4G1QA 2OPRA 4KKOA 1J5OA 1W9HA 1YT3A 4AHRA 4CJQA 3NDKA 3QO9A 1T8EA 1VSEA 1U4BA 3PX4A 4IFYA
chains in the Genus database with same CATH superfamily
2UUCK 1BDGA 4H4MA 1VSKA 2IGIA 2NLXA 4MO4A 1CZBA 2VGNA 2I7PA 1QSLA 4B3MK 4KI4A 3O9UA 2P9KB 2ASMA 3GDQA 2O8CB 2P9SA 3OYJA 3V9WA 2OTLN 1RCHA 1LAVA 2D4WA 4BRHA 1XUPO 3MN6A 2QA4N 3NAEA 3IMXA 4DTMA 3CQXA 3SBTA 3O1BA 2QKKA 2DFFA 1NK4A 3MXMA 3GBTA 4B9VA 4CGHA 4NCAA 2O8EB 4KHPK 4RW8A 3AO4A 4KH6A 1VRUA 4DV1K 1T05A 3NVKA 4FJNA 3AO3A 1YJNN 3LZIA 1N32K 4JD2A 3DOLA 4MDBA 4E7IA 4CZGA 3SK3A 3IDHA 2GWJA 4ZTFA 2WFBA 5FPEA 3TTFA 1XWLA 4WFBL 4X64K 4BE1A 3MN9A 1VAZA 5HL7L 2Q2RA 3OW2M 1VK0A 1J9AA 3VMFB 4FM2A 4FOEA 4FM0A 2FBVA 1LWEA 3U8XA 4M3UA 1O1WA 4YY3K 2HMPA 5AQZA 4EP5A 3C95A 3WXKA 1QVFM 1VSFA 1YAGA 2D0CA 4EIAA 4LY7A 1N33K 2F9TA 3SUNA 3RMCA 4YHHK 2KHOA 4DUYK 2HF4A 3O80A 3DRPA 1NK7A 1NGHA 1NOYA 4WQ4A 1BO5O 3M5RA 1GOCA 4DFPA 4DQPA 1NM1A 2WOMA 2F8SA 4FYDA 3OYAA 1TKZA 4PL7A 4DV2K 4KPYA 4BRGA 5FRMA 3THVA 4PKIA 3G4SN 4Y1DA 1JXBA 2NZTA 4KTWA 4DV7K 3VN5A 4IBNA 1QZ5A 5C12A 5IT9O 3MAQA 4IG0A 4X62K 1ITGA 1XC9A 1WAJA 1ZC6A 2JWKA 2HBMA 3L3VA 5JLFA 1U48A 3MWPA 4I9LA 4FJHA 2HNYA 1RNHA 5AQJA 5AZJB 1GOBA 1KVAA 2HSTA 2UXBK 3ID6A 5DMRA 2VG5A 4O5BA 1F21A 4QS9A 4BR9A 2RF2A 4YDUC 4CJPA 5LMNK 1RDDA 3M1FA 1HX1A 1S72N 3EL2A 4W5OA 1WB9A 4MDAA 1WSFA 2AP1A 2HVIA 3TSPA 3SUOA 3K59A 2YHXA 4ILJA 4CJ3A 2HW3A 1VSHA 4M41A 3RTVA 2A1RA 1JL1A 2OPQA 3AVKA 4K8XA 3S3MA 4GMJB 3J7YP 1Q86O 2FC0A 4DLGA 4CHZA 4KRFA 2E2OA 3CCVN 3DM2A 3CMEN 3DXMB 1LWFA 3KK1A 4IJNA 2Q36A 2D5RA 1QQMA 4K25A 4B3SK 3HXMA 2IVNA 5GAEP 4DQIA 4WCEL 2P5OA 1BA0A 1LW2A 5SWMA 3O9RA 4FLXA 4JKGA 3WNFA 3HVRA 2RKIA 1WBDA 1D4XA 3AVGA 3AA2A 3TARA 2HF3A 5DK5A 3OYLA 3EEQA 3T19A 3TABA 4DG1A 1VQ9N 3V1QA 4FZXC 5SZTA 3ULDA 3MWTA 3A5MC 5EX5A 3C7NA 3CFPA 1WNSA 4CW7B 4OLBA 3BUZB 4FZYA 3KK7A 5HRPA 3DLLL 3DYAA 3OY9A 3NVMA 3C6AA 2V7YA 3ZYYX 2P9NB 3DLEA 3I8DA 4JHDB 5CY4A 5FDLA 4FJLA 4I7FA 1RDUA 1RT1A 2ZQBA 4K42A 2QWPA 3D7EO 3RMAA 3ATVA 2Q0UA 3KWGA 2FBYA 3J80O 3VTHA 3CCEN 4XEIA 5HOOA 3V6DA 3MXIA 4A2AA 4NYNA 1W97L 2HBKA 1HPMA 3H46O 3THYA 3M6GA 3OYIA 4CEZA 2KFZA 1NKBA 4CVNE 2OA8A 2PY5A 1DLOA 3QBXA 3OJUA 4LF8K 4FLUA 4H8KA 4LF7K 3DI6A 2HHVA 3C6HA 4FL9A 4I6MA 4L3QA 3CETA 1RT4A 4JS4A 5AQNA 4HCCA 4X65K 3QEWA 3VETA 4CBXA 4NB4A 4JN4A 4B8CA 3BY5A 3VA0A 3HT3A 4I6MB 4YORA 3TAGA 3VQ8A 1NGDA 3F5TA 3SAHA 3OBYA 3U9DA 3OS0A 4FWPA 4FJ7A 1RDBA 1QZ6A 4CGGA 3T1AA 1SS6A 3QICA 2VWBA 3VQAA 4MO5A 1EX4A 5M1FA 1X9SA 4H5TA 4K0KK 3GE1A 3ZETB 4DLEA 4M3XA 3NCIA 3F9MA 3THWB 4BRPA 1T03A 1FJGK 4OGCA 4JI5K 3TR8A 3ULEA 3SJHA 4FJKA 1BOTO 4DTUA 1UA1A 2XY6A 4FK0A 3OBWA 3ZSZA 1YI2N 2IIRA 3SAFA 2NRWA 2X6SA 3VF6A 3ZEUA 3KK2A 1HNWK 3KVGA 3THWA 2NRVA 4GKKK 4FM1A 3HL8A 3P83D 3G71N 2HHHK 3J8AA 1VQON 5C42A 1DT9A 4DQSA 4O4GA 3JSMA 3ZCMA 2Z1HA 4H0YB 2E5LK 4PL8A 1K73O 3O3HA 2E4LA 3H6EA 3VEYA 1BU6O 1YJ9N 2WBNA 4FWNA 5J2PA 3V9XA 4A59A 1K8AO 3AVNA 1IO2A 1QVGM 3HP6A 3M8RA 1ATNA 3HK2A 3NHGA 4CF2A 3MEEA 1S6PA 3CC7N 3EZWA 4B9UA 2DY4A 4CIEA 3K9JA 5FPMA 3O08A 1C6VA 2E2PA 3O4WA 4YFUA 4N41A 1GLEG 4DV4K 1JKHA 3OYGA 1NK5A 4BRNA 2YNGA 5BPNA 1TUYA 4YNQA 3KKSA 4BR4A 1NK0A 4FJ9A 3VEZA 4CIGA 2HVHA 2BDPA 1KLMA 1HUXA 5D3GA 1U6ZA 4CZFA 2P5GA 5EXWA 3K58A 2QXFA 4AF1A 2ZJPL 4MLEA 1X3MA 2GEMA 1E3MA 4JKFA 3QFUA 3ATUA 4CJFA 1D9DA 4OLAA 2QTDA 3V9SA 2E2QA 3QBWA 4WFAL 4IO9L 3HM9A 3VERA 4BG8A 1NBWA 2F9WA 1XC3A 2NRRA 4AM6A 5J2MA 4WFNL 4C1NI 1DGKN 3OYDA 4JK9A 1X9WA 3QEVA 3H1QA 4RW7A 5GIPA 4CJ5A 4A5BA 4JRQA 3WT0A 4JEPA 1S6QA 1Q81O 1W9HA 3UB5A 1E4FT 3PX4A 5GIOA 4DMNA 4E1MA 4NO7A 1DTTA 1N8RO 3ASMA 3OYFA 1XI1A 4ISGA 4MFBA 1WN7A 3ZSVA 2ASOA 3V81A 2IVPA 2GELA 4CJKA 5BR9A 1BL3A 1QQOA 1TKXA 1TYQB 4H0PA 2ZGYA 2QWRA 3O4NA 1NMNA 4LC9B 5AQQA 5A2QO 4DSFA 1N5YA 3AVAA 1X9MA 1IKVA 3T1YK 1C0TA 3VQBA 3PLAA 4AHVA 3OTOK 5B8HA 2GUIA 1T6DA 1IBLK 1Z25A 1RT2A 1IBKK 2FBXA 1OVQA 2YKNA 3CMAN 4NCGA 5C2FA 3LM9A 4M3WA 4NYFA 1VHXA 2P9PA 4DSLA 1EQYA 4KHUA 3L4QA 1QSSA 2NRTA 4A2BA 4CJUA 2NUBA 1LAWA 2GX9A 3KJVA 1SUQA 5JICA 4DS4A 2NNWA 2O4GA 5AQSA 3K5MA 4CF8A 2G8VA 3LP1A 3VESA 1SAZA 4FVMA 3LDSA 4DSJA 3QERA 3KHYA 4QS7A 3IKMA 1FKPA 3QNOA 1S5JA 5E84A 2QWMA 3VQ4A 4N56A 4B1YB 4FW2A 1BIUA 4XH1A 3RMBA 5FPDA 2D0BA 5BRDA 3A5LC 4QOZB 4BDZA 3S41A 3RSEA 3T69A 5HP1A 3T3FA 4BR2A 2E2NA 4Z94A 5AFUH 4AHTA 4CEBA 3MMVA 4DR4K 1K8KA 1WSJA 4GV6A 3SQ2A 5GAGP 4PQUA 2V52B 4LSLA 2FBTA 3PIPL 1XNQK 5I42A 2RPIA 1I94K 4DV5K 4O0IA 1YITN 4H03B 1TK0A 3O5BA 4BG9A 3AY9A 3AAQA 2V51B 1JCGA 1RBTA 5DM6L 1RDAA 2ITGA 4Z4GA 4W5RA 3WXMB 3UIQA 1NJWA 3QIPA 3RRGA 3AO5A 3P1GA 2ETJA 4E3SA 2CGKA 3OYNA 3M8PA 1ATSA 3I56N 1ZBUA 2KQ2A 2YHYA 2BE2A 2OZMA 1S1TA 4FPBA 4EHUA 2LSNA 4CECA 5FRNA 3W3DA 5CR4A 4B1XB 1U49A 1HNZK 3D6RA 3R3LA 3OS2A 2PYLA 4JI6K 1VQ8N 4ELUA 1D8YA 3CF5L 4RCHA 1HJOA 4H0TB 1L3VA 2ASPA 3FZFA 5JLHA 4YOUA 3KD1E 4BRQA 4KV8A 3CG7A 4DR1K 2VG7A 1WSEA 4WYBA 3NH0A 4ILGB 3CCRN 1CZ9A 3AGRA 3JYTA 2O8DB 2D1KA 1ZBHA 3I0SA 1RBSA 1J54A 1MU2A 1VSIA 4KTZA 1I39A 2KFNA 3CFOA 2QI2A 3HO1A 5KPZA 1BG3A 4LF9K 4HCBA 4RWTA 1RDWX 1HJRA 4O44A 3WXJA 4A57A 2HHXA 2O8CA 4BGAA 4NLBA 4FWKA 1NK6A 2P51A 2YHBA 4Z4HA 3CXCM 1U2VB 4CGJA 4FWLA 3CC4N 1WBBA 4B3RK 3IRXA 4BC2A 3A5OC 4K41A 1NGIA 3MN7A 4BQZA 3SQ0A 4DR7K 1V4TA 4IOCL 4B1VA 2GTDA 2RE2A 3OYBA 3HBTA 1FK9A 1JL2A 4A5AA 1VSLA 3KLHA 4H0XB 3VGLA 4BR5A 5T7BA 4DFJA 4J2DA 1C1BA 4MQ3A 1OH6A 1WSIA 4RTFD 3EYZA 2ZE2A 1REVA 3R9PA 4KBOA 1NGCA 4E7LA 1OH5A 1LW0A 4M63C 1A5VA 5C15A 5LY3A 5EVZA 4CE9A 4BE2A 1VQ7N 4CHNA 4RG8A 1HYSA 3B8AX 3LDOA 4FJ5A 4CK1A 3JS6A 4NCBA 3LDQA 1NU0A 4FK2A 5AQGA 1MWKA 5ADXA 5GINA 3ZSQA 1QHTA 4FWSA 1C0FA 4DFKA 4JK7A 3VGKA 5M1NA 1HNXK 5BRHA 1YF5L 1A5XA 3HI0A 4FSVA 2HMIA 4JKAA 3AO1A 4CF0A 3TPQA 5I9EB 3TSQA 3IAYA 3L2UA 1L3UA 4HHTA 2I7NA 4CEAA 2DFHA 2G8IA 4C8MA 1K8KB 4DU1A 3QB0A 3VF2A 3D2FB 3FE1A 4BRCA 1UA0A 1OH8A 1H1VA 2FSJA 2JGUA 1RT3A 2OTJN 4DTPA 4FLYA 4O0JA 4BDYA 2ZWHA 3P31A 3WEEB 1E4GT 3K5LA 4CJ4A 4ISFA 3PO4A 4Z0UA 3NMUA 3L2VA 4JKDA 3OVNA 5M1PA 4B3OA 5J2NA 1TK5A 1TGOA 4FJ8A 3ZSYA 1NJYA 2O8FB 2XRIA 4GKJK 3SZ2A 4WE1A 4IOAL 1SL2A 4BRKA 3A2FA 4BRLA 3NH2A 3SV4A 3ZEUB 4BRDA 1NJZA 3R6MA 1CXUA 3H3OB 2HHUA 3LAMA 1B9DA 2Y1JA 3K2PA 5AQKA 4PKGA 3VEXA 4PWDA 2OANA 1MWMA 3QEIA 4DS5A 1RT7A 4Y1CA 3VQDA 1KCFA 4ISEA 1IJJA 1RDCA 3H45C 1SKRA 2UUBK 1ZBIA 3D45A 1HMVA 1BQMA 4DB3A 1BCMA 3DXMA 3ALYA 3KLGA 3C6TA 3L8BA 4KREA 3NF9A 2X74A 4CJSA 4CEEA 4BWMA 4JS5A 2ATQA 4CD3A 4M3YA 2B6AA 1KSPA 4V19S 4B08A 1IG8A 3TU5A 4J2BA 4H0VB 2HBLA 5TKYA 1ATRA 4E1JA 2QWOA 1OVYA 4B9NA 3HP9A 4B3TK 2G8KA 1KRPA 3LP3A 3NF7A 3TAEA 1VQ6N 1LOTB 2D0OA 1Q82O 3LAKA 2QW9A 1W0HA 4NXMK 1V4SA 1U45A 2Z1JA 4TSXA 3FFIA 4EZ9A 4JI0K 3AA4A 1WSGA 3L0QA 1NKEA 4WQ4C 3SBGA 4OPJA 1KAYA 1VQNN 1IBMK 5AQHA 3BF3A 4CEFA 3UE5A 4B1WB 1D5AA 4E1NA 5CHIA 2IAJA 3QFPA 3CIPA 3E1YA 3DLKA 3L3UA 3A8YA 4DSEA 4LF5K 3E9PA 3IG1A 4CGDA 3NFAA 2OYQA 3RVCA 4FK4A 4FWOA 1JLGA 1SL1A 4LFCK 2AA4A 5CYQA 4B9QA 5M1OA 2NRXA 3QLHA 4GW6A 1IKYA 2KZZA 2UYTA 3PSFA 2E1ZA 1Q9XA 4PA1A 3P4IA 4X66K 4ELTA 3ZT1A 4GV3A 2KLAA 3NF6A 3GL1A 3DRRA 4CFDA 3E01A 5MLCQ 3NBPA 3AVHA 3CM5A 4CFAA 1RT6A 1KVCA 4H5NA 4IOXA 5ADXH 3TSUA 4G1QA 2OPRA 4AHRA 1GLBG 1VSEA 1KAXA 3LDLA 4NLCA 1TUUA 4DR6K 3FZHA 4BRMA 1DTQA 4CZMA 1CLQA 3VQEA 5AQOA 2A42A 3LL3A 4OPHA 3VF4A 5C0YA 4B9LA 2JWLA 4LD0A 3VEWA 2QKBA 4BC5A 2A1SA 4CF1A 3FZKA 3OJSA 4IJAA 2P9UB 3ENBA 4JK8A 4LFAK 4FWRA 1WSHA 1NOZA 3R1XA 4WQ5A 4DKWA 1YTUA 5JVGL 3OS1A 4ICLA 3P38A 4FXDA 1GLLO 4CZHA 4ELVA 1VRTA 1ZBLA 3CCLN 1QSYA 4OKKA 3OYCA 3SQ4A 1JLQA 2O8EA 1VQKN 4CFCA 3B6PA 1Z6RA 3SMSA 2YNHA 3N4QA 5JMVA 4DR3K 4CBUA 1KQSM 5KRSA 1BA1A 4W5TA 5CZ2A 3OYKA 4OVLA 5AQRA 1LV5A 2Q97A 2W6KA 4AILC 4B8AB 3KKRA 1HLUA 2PYJA 3SI6A 4CF9A 4H4OA 2GV9A 4DTJA 4W5QA 3H1VX 4J2EA 2B4JA 5CZ1A 3U3YA 1RBRA 3S3NA 3G10A 4WF9L 3LANA 4FJIA 5BREA 5C24A 1NK9A 3I0RA 2PAVA 2HHTA 2GBZA 5AQWA 4KHNA 4Z4IA 4KH4A 4BACA 3C94A 4JNEA 2W6LA 3CQYA 4CJTA 3BF1A 4E7KA 4M3RA 2A3ZA 3SLCA 4A61A 5KRTA 3GG4A 3KLIA 5E41A 3DJCA 2HNZA 1XMOK 3VEOA 2V7ZA 2WONA 3HPGA 2VQEK 3A0IX 4Q0BA 1TVRA 5AQYA 5M1QA 1WLJA 1YUWA 1QE1A 3AVJA 4FCYA 2BH1A 1HKCA 4IG3A 1Z05A 4M3TA 3OYMA 4F2RA 2Q31A 1YIJN 1NJXA 1M90O 1NGGA 3HJFA 4BROA 3J81O 1KFSA 3KK3A 2A41A 1S1UA 3J7ZO 1L3SA 2KZMA 1J53A 1FXXA 3DOKA 4IEIA 4JKEA 2I5JA 3BDPA 3SAGA 4JHDA 1I3AA 4AHUA 1S9GA 3L2QA 4YOYA 1S22A 2QWLA 3KLFA 2A6AA 2IOCA 1KXPA 4IKFA 1EWRA 4KB1A 4BDPA 5JS2A 3KWIA 4Q5VA 3HZ6A 1GOAA 2D0AA 4C8KA 5BPLA 1HRHA 1J6ZA 1YVNA 2YKMA 3MK6A 4CZIA 2G8UA 4LF6K 1NNEA 1S1VA 4I2QA 4JI8K 3UKRB 2E6MA 4BVOA 1A5WA 3LDPA 3EKSA 3L2WA 3AAPA 2QWQA 1VQ5N 3ZLJA 2Q0RA 4F2SA 4OPKA 3CCSN 3CPWM 2OPSA 3AVCA 3P5JA 1NJIO 3W0LA 4KO0A 3ULEB 1ILYA 4U7BA 1XQSC 2P9KA 4M42A 2W42A 1RTDA 3M8SA 3CFRA 5AQLA 2HHWA 5AR0A 2XO7A 4LH4A 1NLVA 3Q7BA 1R0AA 3HM8A 3UKUB 4AH9A 3I8BA 3O1WA 2F96A 3ZX0A 2F4VK 3C6UA 3QMLA 1JLCA 2PZSA 3FFKB 4JI1K 5BR8K 4BRIA 3WEEA 4JKGB 4H5VA 4AHCA 1P90A 2BUPA 2CGJA 3EO3A 3SNNA 4BWJA 4EAHD 4IEEA 3DMJA 1YJWN 4NXNK 5AZJA 3RR8A 4N76A 3V4IA 2D0PA 3D2EB 1G99A 1RTJA 4HUEA 5AQFA 2G8HA 3V9ZA 4KHQA 4OX9K 3HVTA 4BVPA 3G25A 5J2QA 5KI6A 3BP8A 3ZSWA 1Z26A 2QWNA 3VQQA 1UAXA 3L6QA 2Z1GA 5AQIA 4J8FA 3TAPA 1VSMA 3SPYA 3MXJA 3PX0A 1QTMA 4YDUA 1B92A 1RTHA 4DFMA 4BRAA 1MDUB 1ZBSA 3J7AP 5C2DA 3O8MA 4CIFA 2RN2A 3WQTA 1RT5A 3NGYA 4L8RB 2WC9A 3KIOA 4U67L 3JXUA 3NGZA 1VSJA 5F2RA 2XHBA 3PY8A 3KZBA 1S3XA 4M7XA 1QS4A 4DWIA 5GADP 4FOIA 1BCOA 1Q9YA 2HNDA 4E19A 1EKEA 3ZT4A 5LJVA 3F2KA 3ZETA 2P9IA 4H5RA 4QAGA 3O9SA 3I55N 3C65A 1U2VA 3SYZA 4GV9A 1TAUA 4F3TA 3HOSA 5TKWA 1GLAG 1WOQA 3SUPA 4JV5K 1K6YA 4YOVA 1CXQA 1NGJA 1JXEA 3ISNC 4JI7K 2NRZA 2XY8A 2R7YA 1Q7YO 4KHYA 3CCQN 4CFBA 4CK3A 4C8LA 3IUCA 3TI0A 3CJ9A 3CQ8A 1HPZA 4JD2B 1Q8IA 4CERA 1N6QA 2QEXN 1SKWA 2BTFA 4CI6A 1EXQA 1HKGA 1L3TA 1BI4B 2YNFA 1RBVA 4JYAK 3O3FA 4HTLA 3CC2N 1RBUA 2VG6A 2ZJQL 5EU7A 4C1NK 1HYVA 3CJAA 3EN9A 5F1XA 3QESA 1ZXOA 4H5WA 2G8FA 1S1WA 1HNVA 1EETA 1DEJA 2UXCK 3DLGA 1M1KO 1HQEA 4CJLA 1S1XA 3DLHA 3C0BA 3UKRA 3LP2A 1T6CA 4M45A 4CK2A 3WQUA 4DCHA 2VCPA 4O5FA 4KI6A 4KFBA 2EX3A 5IWAK 3HTVA 3NGIA 1P8ZA 1GLFO 2A40A 4B9MA 5GAHP 3G0ZA 3ZX3A 4FLWA 4O8UA 5HROA 3U9ZA 1NGEA 2HOEA 3O9QA 2YI1A 1JLEA 4YOTA 3VQCA 4DR2K 1IH7A 1S9EA 1VQPN 1BGXT 2P9SB 3LDNA 4ID5A 3D2EA 3VTIA 1QHAA 2FLOA 3TAMA 3SV3A 2BANA 1C0GA 4AHSA 4DSKA 1GLDG 2GUPA 3AA3A 3SJJA 3IFRA 1TL1A 3F73A 4IZ9A 3BZKA 2PFUA 3QEXA 3CI5A 1BQNA 4CHPA 3KTQA 5KGWA 2GWKA 1IKWA 1OH7A 3ZSXA 4EFHA 3QDKA 4IDHA 3THXA 2OCEA 3AVMA 3WNEA 1NK8A 5AQXA 4XH4A 4KKOA 4DV6K 1YT3A 1J5OA 4FPAA 1U4BA 2P9LB 4IFYA 2EHGA 1OKJA 3KD5E 3PO5A 3VQ9A 4DUZK 4DQQA 4C8NA 4FJJA 3GOIA 1ESVA 2DTUA 2F8TA 3CJBA 1CZAN 3CCUN 1YVUA 4EP4A 2VWJA 3RSEB 2IDOA 3LPTA 1VSDA 2P9PB 3CD6N 4JI4K 4BE0A 3LWLA 3P39A 2B5JA 1NG9A 3HOTA 5HRNA 4YOWA 4LH5A 4CJWA 1JLBA 2Z1IA 3TAQA 4BR0A 4DV0K 3ITHA 1C1AA 4GY2B 3ZT0A 2AJQA 3VGMA 3FZMA 3BZCA 4W5NA 3DXKB 3HYFA 1C0MA 4JRPA 2IVOA 1ASVA 4KH5A 3TWHA 4IFVA 2ZGZA 2P9UA 4K43A 5CE3A 1TV6A 5KQDA 2DPNA 1QQNA 1Y64A 4BREA 3Q7CA 1D9FA 3E66A 3R8EA 3OYEA 4KHWA 4CJ7A 4OKEA 2ZM6K 4IWVA 2PBDA 5AFUA 3WNHA 3VPZA 5EOYA 4ZHRA 2CGLA 2RHKA 5BPMA 5AZIA 1RGIA 3ID8A 2UU9K 1YXQA 3MCPA 1BIZA 1T44A 1VQ4N 2YNIA 1RTIA 3RRHA 1TYQA 3LP0A 4JKHA 1X3NA 4UQGA 1XNRK 2UXDK 2IS3A 5FROA 4DU3A 3WNGA 3QNNA 2CH6A 3QIOA 3ZT2A 1NGAA 1X1PA 1VQLN 4KTQA 1UWBA 3B6OA 3IS9A 4Y0WA 1RILA 5HRSA 4N5SA 4Z4EA 5BN9A 2XY5A 4HWIA 1KLNA 4DV3K 1T7PA 3CHWA 2VWKA 3HSTB 4G9ZA 3HPOA 3AVIA 5KPRA 3CYMA 2WTUA 2YJFA 4I2PA 5AQMA 1WUAA 3MX2A 3EE9A 4FWMA 3AO2A 1BHLA 1LCUA 3F9KA 4BC3A 3CCJN 3AVBA 3SMPA 4N47A 4KHSA 4OGEA 4DF8A 3OYHA 1K9MO 5E26A 3V1OA 3L4IA 3U3GA 5AZIB 1XHZA 4EHTA 4DTNA 2H3GX 4O55A 2FXUA 4QCLA 2EWSA 5JS1A 4R79A 1IV0A 5HRRA 4HVJA 4OJRA 3VQPA 1IKXA 3VQ7A 4KB0A 4BR7A 4DQRA 3DLRA 4CHQA 4I9QA 3E9LA 5C10A 4ID1A 1GLJO 4Z4CA 3L2RA 2W40A 2JLEA 4JI3K 3LPUA 2P9NA 3NE6A 3ZSRA 3PSIA 5AQUA 4RW4A 3T7ZA 2ZF5O 3S9HA 1XMQK 3PIOL 3SQ1A 4OKJA 1JLFA 3DWLA 2FF3B 2Q3SA 5CYMA 2A5XA 2VGMA 3D0PA 4FLTA 1BI4A 5ELZA 3NF8A 4B1UB 2W41A 4BC4A 3OHRA 3MECA 3VOVA 4CEQA 5AJ3K 4C8OA 4R5PA 4CESA 3EKUA 4FO0A 4ILHA 3SUQA 5LMUK 2IC3A 1FKOA 2ZD1A 2KTQA 3FLCO 3AGKA 4XIUA 1HNIA 1ASUA 3DLBA 3WUHA 3AV9A 4CBWA 4GVMA 4RW6A 2E20A 1O13A 3EE8A 3FR0A 4Z4FA 3K9KA 4FWQA 2ZJRL 4IXCA 4LF4K 3HSCA 5FLXO 1U04A 3SPZA 4ZTJA 1IG9A 3CERA 4CHOA 1JCEA 4WQ5C 4DSIA 3S3OA 3TANA 3H08A 4CJVA 2DFEA 1J5EK 2FSNA 3E9OA 3CJ1A 4CZJA 3K57A 2J4RA 2P9IB 1KAZA 1BUPA 4M7YA 2NRHA 2YHWA 4OPAA 2P9LA 4LSNA 1G15A 3K0SA 2YV0X 3DAWA 4H0OA 3LZJA 2HHSA 3THXB 2YCHA 2HBJA 3TTCA 2HB5A 4CCHA 3WXLA 4FZZA 5AQVA 1ZBFA 3VQ5A 4O8KA 3KLEA 4PY5A 2QXLA 3D2FA 1W2BM 3RWUA 3QINA 4CEOA 3AVLA 3MDQA 4KAZA 1N36K 4HTUA 2FF6A 1HQUA 3VEVA 1KTQA 4DQ8A 3PV8A 4EZ6A 3U4LA 5KQ8A 1JCFA 3G6EN 3K5NA 1HYZA 4FVUA 2QK9A 3HPHA 1TKDA 4CEDA 1DKGD 4B9TA 4F4KA 5KPTA 3AARA 5J1EA 1X9JA 4PKHA 3C7NB 2KW4A 2OZSA 4J2AA 3NH1A 2ITMA 3VENA 4K8ZA 2P1JA 2F7TA 1TL3A 3OA9A 2KKZA 3M3ZA 3THYB 3O9TA 3ZX2A 4DU4A 1KC8O 5HBMA 4FLVA 3DRSA 4JKBA 5AQPA 4A62A 4E89A 3RR7A 4FJXA 1ASWA 2X6NA 5FPNA 4DTOA 4UY8O 2Q1NA 5AQTA 1TAQA 3O4QA 4JAXA 1SL0A 2CH5A 2VQFK 4BGBA 1MA9B 1KFDA 3ZT3A 1YTAA 1C0UA 3V1RA 3UKUA 3ENOA 1C1CA 4E0DA 4E7HA 1B9FA 1RFQA 1TK8A 1T3VA 2E6LA 1QQCA 2X78A 4LFBK 3K5OA 3EY1A 1ZYQA 1EO1A 1BISA 3LALA 3MEGA 5HLFA 4CGFA 3PX6A 2E1YA 3A5NC 4HUFA 2WUSA 4DR5K 4DHYA 4AQYK 4QS8A 4JKCA 1KD1O 5H1SQ 3PUFA 4FJMA 4F8RA 1NWKA 4IO8A 3TTDA 4AM7A 3MCAB 1XHXA 2O8DA 1VQMN 3FGUA 4FW1A 1HR0K 3DXKA 1N34K 2G8WA 1GLCG 5DM7L 1KVBA 3SCXA 3TAFA 2QM1A 4FLZA 3U6FA 5BN8A 3BGRA 5K14A 4DTXA 4CZKA 5F0XA 4GNIA 2YHAA 4CHYA 2BGGA 4OO1J 1SV5A 4F3OA 2OPPA 3ENHA 2O8FA 4E7JA 4PHTX 5LL6Z 5LJWA 1FW6A 1SZ2A 5I3UA 3BEXA 3CCMN 4GVEA 4DTSA 3QEPA 1W7AA 3T1HK 4DF4A 2E88A 3WXIA 4CD1A 1TKTA 3V9UA 2E8AA 3CM6A 4RW9A 1HKBA 4CZEA 4M3ZA 1LWCA 4JLHA 1Y97A 4IDKA 2Y1IA 4IFEA 3JAMO 1JLAA 4CGIA 5KTQA 3LWMA 4BY9C 4B1ZA 3CJ7A 1JJ2M 1R59O 2YJEA 3I33A 3FZLA 4YOXA 1L5UA 3ZSOA 2VYPA 2O8BB 3O3GA 1SKSA 4FJGA 2FSKA 3MX5A 4CJEA 1NGFA 1WAFA 1NMDA 3LM2A 2UUAK 4MLHA 3AVFA 4C23A 1U47A 3RMDA 3HRGA 4BRFA 3CJCA 3MEDA 4CJRA 3EZ5A 4F9OA 2XY7A 1YHQN 3H3NO 4CZLA 4B9SA 1EP4A 4BQLA 3AA5X 4XH5A 5KGXA 2YX6A 4DTRA 3O6WA 3MN5A 5BRFA 1NKCA 3CPEA 4PUOA 2O4IA 5C25A 2HHQA 5M1KA 1NGBA 3VQ6A 1BWFO 5EY4A 4HUGA 1EWQA 3N4PA 2O8BA 3VA3A 3QETA 1UOCA 1Q18A 1SQKA 3M8QA 4JI2K 1T8EA 4CJQA 3NDKA 3QO9A 5JVHL
chains in the Genus database with same CATH topology
2EHGA 4DMNA 4E1MA 1DTTA 3ASMA 3PO5A 3KD5E 3VQ9A 3OYFA 4DQQA 1XI1A 4MFBA 1WN7A 4H4MA 3ZSVA 4C8NA 1VSKA 1DTQA 4FJJA 2IGIA 1CLQA 3V81A 1CZBA 3VQEA 1QSLA 4KI4A 2DTUA 2F8TA 4B9LA 4LD0A 2QKBA 2A1SA 4CJKA 4CF1A 3OYJA 3V9WA 1RCHA 1YVUA 4EP4A 1LAVA 3OJSA 2VWJA 1BL3A 2IDOA 3LPTA 1TKXA 1VSDA 1WSHA 3NAEA 1NOZA 1YTUA 4DTMA 4BE0A 3LWLA 2B5JA 3OS1A 3O4NA 4ICLA 4FXDA 4ELVA 4DSFA 2QKKA 2DFFA 1VRTA 1NK4A 3MXMA 5HRNA 1ZBLA 3AVAA 1N5YA 4LH5A 4B9VA 4CGHA 4CJWA 1IKVA 1JLBA 1X9MA 4NCAA 1QSYA 2Z1IA 4OKKA 1C0TA 3TAQA 3VQBA 4RW8A 4AHVA 3AO4A 3OYCA 1VRUA 3SQ4A 1JLQA 1C1AA 3ITHA 2GUIA 1T05A 3AO3A 4FJNA 3LZIA 3DOLA 4E7IA 1Z25A 3ZT0A 2AJQA 4CFCA 1RT2A 3B6PA 4W5NA 2FBXA 2YNHA 3HYFA 1C0MA 4JRPA 4ZTFA 1XWLA 5KRSA 2YKNA 1ASVA 4W5TA 4NCGA 4BE1A 3TWHA 4IFVA 4M3WA 4NYFA 5CZ2A 1VK0A 3OYKA 4OVLA 4DSLA 1J9AA 1TV6A 4KHUA 4FM2A 1LV5A 1QSSA 4FM0A 2FBVA 1LWEA 4AILC 1D9FA 4B8AB 3KKRA 2NUBA 4CJUA 1LAWA 3SI6A 4CF9A 2PYJA 4M3UA 1O1WA 4H4OA 3OYEA 4KHWA 4EP5A 4OKEA 2GV9A 4DTJA 3C95A 4W5QA 3KJVA 1SUQA 4J2EA 1VSFA 2B4JA 5CZ1A 4DS4A 3U3YA 2O4GA 3K5MA 2D0CA 4CF8A 2G8VA 3WNHA 1RBRA 3LP1A 4FVMA 3LDSA 4LY7A 4DSJA 4ZHRA 3S3NA 3QERA 3G10A 3SUNA 3RMCA 1FKPA 3QNOA 1S5JA 3VQ4A 4N56A 3LANA 4FJIA 4FW2A 5C24A 1BIUA 1NK9A 3DRPA 3I0RA 1NK7A 3RMBA 1BIZA 2HHTA 2D0BA 2YNIA 2GBZA 1NOYA 1RTIA 4QOZB 3RRHA 4KB0A 3LP0A 4UQGA 4BDZA 4KHNA 4Z4IA 4BACA 1GOCA 3C94A 4DFPA 4DQPA 5HP1A 3T3FA 2WOMA 2F8SA 4CJTA 4CEBA 4AHTA 2IS3A 5FROA 4DU3A 4FYDA 3WNGA 3OYAA 1TKZA 4E7KA 3QNNA 3QIOA 3ZT2A 1X1PA 4M3RA 5KRTA 1WSJA 1UWBA 3B6OA 3SQ2A 4KTQA 3IS9A 3KLIA 4KPYA 1RILA 5HRSA 5E41A 4N5SA 3THVA 5FRMA 4Z4EA 4Y1DA 2XY5A 2HNZA 1JXBA 4PQUA 4KTWA 1KLNA 3VN5A 4LSLA 2FBTA 4IBNA 1T7PA 2VWKA 3HSTB 5I42A 3HPOA 3AVIA 2RPIA 3CYMA 3MAQA 4IG0A 2WONA 3HPGA 4I2PA 4O0IA 1TK0A 1ITGA 1XC9A 3AO2A 1WAJA 1BHLA 1TVRA 3L3VA 3F9KA 1U48A 4Q0BA 3AVBA 4N47A 4KHSA 1RBTA 4OGEA 1WLJA 4DF8A 3OYHA 1QE1A 3AVJA 4FCYA 1RDAA 4I9LA 2ITGA 4IG3A 3V1OA 4FJHA 3U3GA 4M3TA 1XHZA 4Z4GA 2HNYA 1RNHA 4W5RA 4DTNA 3OYMA 1GOBA 1KVAA 4O55A 4F2RA 3UIQA 1NJWA 3QIPA 1NJXA 3RRGA 3AO5A 4QCLA 5JS1A 5DMRA 3P1GA 2ETJA 2VG5A 4E3SA 4O5BA 3OYNA 3M8PA 3HJFA 1KFSA 1ZBUA 2KQ2A 3KK3A 1F21A 2BE2A 4OJRA 5HRRA 1IKXA 1S1UA 1S1TA 2RF2A 3VQ7A 3VQPA 4CJPA 1J53A 1FXXA 3DLRA 4DQRA 3DOKA 4CHQA 2KZMA 4I9QA 1RDDA 2I5JA 3BDPA 2LSNA 4CECA 4ID1A 4Z4CA 5FRNA 3L2RA 1I3AA 4AHUA 2JLEA 4W5OA 1S9GA 3L2QA 1WSFA 3LPUA 3KLFA 3NE6A 2HVIA 3ZSRA 1U49A 3SUOA 2IOCA 4RW4A 3K59A 4IKFA 3OS2A 4CJ3A 4KB1A 3S9HA 5JS2A 2PYLA 1VSHA 4M41A 3RTVA 4BDPA 4ELUA 1D8YA 3SQ1A 4OKJA 2HW3A 1JLFA 4Q5VA 1L3VA 2Q3SA 1GOAA 5CYMA 2D0AA 1JL1A 2A1RA 4C8KA 3D0PA 4FLTA 2OPQA 3AVKA 1BI4A 4K8XA 3NF8A 1HRHA 3S3MA 3KD1E 4GMJB 3MECA 2FC0A 4DLGA 4CHZA 4KV8A 4CEQA 4KRFA 3CG7A 3DM2A 1LWFA 3KK1A 2YKMA 4C8OA 4R5PA 2VG7A 4CESA 2G8UA 1WSEA 3SUQA 2IC3A 1S1VA 1FKOA 2D5RA 2OZMA 3NH0A 2ZD1A 2KTQA 4I2QA 3HXMA 1CZ9A 3JYTA 4XIUA 1HNIA 1ZBHA 1ASUA 2E6MA 1A5WA 3DLBA 4DQIA 3AV9A 3I0SA 1RBSA 4GVMA 1J54A 4RW6A 2P5OA 3L2WA 1LW2A 1MU2A 5SWMA 1VSIA 4FLXA 4Z4FA 3WNFA 4KTZA 2RKIA 3HVRA 1I39A 4F2SA 2KFNA 3CFOA 4OPKA 3HO1A 3AVGA 3AA2A 2OPSA 3TARA 1U04A 3AVCA 3SPZA 5DK5A 4ZTJA 4HCBA 1IG9A 3OYLA 1HJRA 3P5JA 4CHOA 4O44A 4KO0A 3T19A 4DSIA 3S3OA 2HHXA 3TANA 3H08A 4CJVA 2DFEA 3TABA 4HVJA 4M42A 2W42A 1RTDA 1NK6A 2P51A 4DG1A 3M8SA 2YHBA 3V1QA 4Z4HA 3CFRA 3K57A 4CGJA 4FZXC 5SZTA 2HHWA 2XO7A 4LH4A 3ULDA 3IRXA 1R0AA 4LSNA 3CFPA 1WNSA 3SQ0A 4AH9A 1G15A 4OLBA 2F96A 3OYBA 4FZYA 2YV0X 3LZJA 1FK9A 1JL2A 2HHSA 1VSLA 3C6UA 5HRPA 1JLCA 3DYAA 3OY9A 3KLHA 3DLEA 3I8DA 2PZSA 5T7BA 4DFJA 4J2DA 5CY4A 1C1BA 2HB5A 4CCHA 4FZZA 4MQ3A 1ZBFA 3VQ5A 5FDLA 1WSIA 3KLEA 4PY5A 4AHCA 3EYZA 4FJLA 2ZE2A 4I7FA 3RWUA 1RT1A 1REVA 2ZQBA 3QINA 4E7LA 1LW0A 3RMAA 1A5VA 4CEOA 3AVLA 3SNNA 4KAZA 4BWJA 4CE9A 4BE2A 4HTUA 1HQUA 3DMJA 4CHNA 2FBYA 4RG8A 1HYSA 1KTQA 3V6DA 4CK1A 4FJ5A 3RR8A 3MXIA 3PV8A 4NYNA 3V4IA 4EZ6A 4N76A 4NCBA 1RTJA 4HUEA 4B9UA 4FK2A 3K5NA 3V9ZA 2G8HA 1HYZA 4KHQA 3HVTA 3ZSQA 1QHTA 3OYIA 2QK9A 4CEZA 2KFZA 1NKBA 3HPHA 1TKDA 4DFKA 5J2QA 4CEDA 5KI6A 4B9TA 4F4KA 2OA8A 2PY5A 3ZSWA 1Z26A 1DLOA 5J1EA 3VQQA 1UAXA 1A5XA 2KW4A 3OJUA 4FLUA 2HMIA 4H8KA 3NH1A 2OZSA 3AO1A 4J2AA 4CF0A 4K8ZA 2P1JA 3IAYA 3DI6A 2HHVA 1TL3A 2Z1GA 3L2UA 1L3UA 4HHTA 3TAPA 4DU4A 4CEAA 5HBMA 1RT4A 3DRSA 4FLVA 2DFHA 2G8IA 4E89A 1VSMA 4C8MA 4JS4A 3SPYA 3RR7A 3MXJA 3PX0A 1QTMA 1ASWA 1B92A 4DU1A 2X6NA 4FJXA 3QEWA 1RTHA 4DTOA 4DFMA 1TAQA 4B8CA 3O4QA 1UA0A 3VA0A 1SL0A 3HT3A 4CIFA 2JGUA 1RT3A 2RN2A 3VQ8A 4FLYA 4DTPA 3TAGA 1RT5A 3NGYA 4O0JA 4BDYA 4L8RB 3KIOA 3OS0A 3K5LA 3NGZA 1VSJA 4FJ7A 1KFDA 2XHBA 3PY8A 1RDBA 4CJ4A 3ZT3A 1YTAA 1QS4A 4DWIA 3PO4A 4CGGA 4Z0UA 3T1AA 1C0UA 1BCOA 3V1RA 3L2VA 1Q9YA 3OVNA 3HK2A 2HNDA 4E19A 1EKEA 4B3OA 5J2NA 3ZT4A 1C1CA 3VQAA 1TK5A 4E7HA 1TGOA 1EX4A 1B9FA 1TK8A 4E0DA 1X9SA 4QAGA 2E6LA 4FJ8A 1QQCA 3ZSYA 2X78A 1NJYA 2XRIA 3SZ2A 3K5OA 3EY1A 4WE1A 4DLEA 1ZYQA 4M3XA 3NCIA 1BISA 3SYZA 3LALA 3MEGA 1T03A 1SL2A 3NH2A 3A2FA 3SV4A 4CGFA 5HLFA 4F3TA 1TAUA 4OGCA 3PX6A 1NJZA 1CXUA 3TR8A 4FJKA 2HHUA 4HUFA 3LAMA 3SUPA 1K6YA 1B9DA 4DTUA 1CXQA 2XY6A 1UA1A 2Y1JA 3K2PA 4FK0A 3ZSZA 3ISNC 1JXEA 3PUFA 4F8RA 4FJMA 4PWDA 2XY8A 2R7YA 4KHYA 1XHXA 4CFBA 4CK3A 4DS5A 3QEIA 1RT7A 4FW1A 4Y1CA 2G8WA 4C8LA 1KVBA 3SCXA 3VQDA 1KCFA 2X6SA 3TAFA 1RDCA 3TI0A 1SKRA 1ZBIA 3CQ8A 3D45A 1HMVA 1BQMA 1HPZA 1Q8IA 4CERA 4FLZA 3U6FA 1BCMA 1N6QA 3KK2A 3ALYA 3BGRA 5K14A 4DTXA 3KLGA 3C6TA 3L8BA 4CHYA 2YHAA 4FM1A 2BGGA 3HL8A 1SV5A 1SKWA 4F3OA 4KREA 3P83D 1EXQA 2OPPA 1L3TA 1BI4B 2YNFA 2X74A 1RBVA 3NF9A 4CJSA 4E7JA 4CEEA 5C42A 4BWMA 4JS5A 3O3FA 4DQSA 2ATQA 4O4GA 3JSMA 3ZCMA 4M3YA 2Z1HA 2B6AA 5I3UA 1KSPA 1RBUA 2VG6A 4B08A 4DTSA 3O3HA 2E4LA 5EU7A 3QEPA 1HYVA 3QESA 4J2BA 4DF4A 5J2PA 1S1WA 2G8FA 1HNVA 1EETA 3V9XA 3AVNA 3DLGA 1HQEA 1IO2A 4CJLA 3HP6A 3M8RA 4B9NA 1TKTA 3HP9A 4CF2A 3MEEA 1S6PA 3NHGA 3V9UA 2G8KA 3LP3A 1KRPA 3CM6A 1S1XA 3NF7A 4RW9A 4CIEA 3TAEA 2DY4A 3DLHA 4M3ZA 1C6VA 1LWCA 4YFUA 4JLHA 1Y97A 4IDKA 2Y1IA 3LP2A 3LAKA 4N41A 1JLAA 4M45A 1W0HA 4CGIA 5KTQA 3LWMA 1U45A 1JKHA 2Z1JA 4TSXA 4CK2A 3OYGA 3FFIA 4KI6A 4EZ9A 3AA4A 1NK5A 1WSGA 2YNGA 4KFBA 1NKEA 2EX3A 4OPJA 1L5UA 3ZSOA 4CEFA 4HCCA 1D5AA 4E1NA 2IAJA 3O3GA 3NGIA 1SKSA 4YNQA 4FJGA 4B9MA 3KKSA 1NK0A 4FJ9A 3DLKA 3G0ZA 3L3UA 4FLWA 5HROA 4CJEA 1WAFA 4CIGA 2HVHA 2BDPA 1KLMA 5D3GA 4DSEA 1JLEA 2P5GA 3AVFA 1U47A 3VQCA 3RMDA 3K58A 2QXFA 1IH7A 1S9EA 1BGXT 3MEDA 3IG1A 4CJRA 3EZ5A 4ID5A 4CGDA 3NFAA 2OYQA 4CJFA 2XY7A 1D9DA 4FK4A 4B9SA 3TAMA 4OLAA 3V9SA 1EP4A 3SV3A 2BANA 3HM9A 4AHSA 3AA5X 4DSKA 5KGXA 1JLGA 1SL1A 3AA3A 4DTRA 3SJJA 5CYQA 1L3SA 1TL1A 3F73A 3QLHA 4GW6A 1IKYA 1NKCA 3QEXA 2KZZA 4PUOA 1BQNA 4CHPA 1Q9XA 3KTQA 5KGWA 4PA1A 5J2MA 4ELTA 2O4IA 1IKWA 3ZT1A 5C25A 2HHQA 3OYDA 3ZSXA 1X9WA 3NF6A 3VQ6A 4HUGA 3QEVA 3DRRA 4CFDA 4RW7A 3E01A 3NBPA 3AVHA 4CJ5A 3CM5A 4CFAA 3VA3A 3QETA 1RT6A 1KVCA 1UOCA 3AVMA 4JRQA 3WNEA 3M8QA 1NK8A 1S6QA 4G1QA 2OPRA 4KKOA 1J5OA 1W9HA 1YT3A 4AHRA 4CJQA 3NDKA 3QO9A 1T8EA 1VSEA 1U4BA 3PX4A 4IFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EHG A;  4DMN A;  4E1M A;  1DTT A;  3ASM A;  3PO5 A;  3KD5 E;  3VQ9 A;  3OYF A;  4DQQ A;  1XI1 A;  4MFB A;  1WN7 A;  4H4M A;  3ZSV A;  4C8N A;  1VSK A;  1DTQ A;  4FJJ A;  2IGI A;  1CLQ A;  3V81 A;  1CZB A;  3VQE A;  1QSL A;  4KI4 A;  2DTU A;  2F8T A;  4B9L A;  4LD0 A;  2QKB A;  2A1S A;  4CJK A;  4CF1 A;  3OYJ A;  3V9W A;  1RCH A;  1YVU A;  4EP4 A;  1LAV A;  3OJS A;  2VWJ A;  1BL3 A;  2IDO A;  3LPT A;  1TKX A;  1VSD A;  1WSH A;  3NAE A;  1NOZ A;  1YTU A;  4DTM A;  4BE0 A;  3LWL A;  2B5J A;  3OS1 A;  3O4N A;  4ICL A;  4FXD A;  4ELV A;  4DSF A;  2QKK A;  2DFF A;  1VRT A;  1NK4 A;  3MXM A;  5HRN A;  1ZBL A;  3AVA A;  1N5Y A;  4LH5 A;  4B9V A;  4CGH A;  4CJW A;  1IKV A;  1JLB A;  1X9M A;  4NCA A;  1QSY A;  2Z1I A;  4OKK A;  1C0T A;  3TAQ A;  3VQB A;  4RW8 A;  4AHV A;  3AO4 A;  3OYC A;  1VRU A;  3SQ4 A;  1JLQ A;  1C1A A;  3ITH A;  2GUI A;  1T05 A;  3AO3 A;  4FJN A;  3LZI A;  3DOL A;  4E7I A;  1Z25 A;  3ZT0 A;  2AJQ A;  4CFC A;  1RT2 A;  3B6P A;  4W5N A;  2FBX A;  2YNH A;  3HYF A;  1C0M A;  4JRP A;  4ZTF A;  1XWL A;  5KRS A;  2YKN A;  1ASV A;  4W5T A;  4NCG A;  4BE1 A;  3TWH A;  4IFV A;  4M3W A;  4NYF A;  5CZ2 A;  1VK0 A;  3OYK A;  4OVL A;  4DSL A;  1J9A A;  1TV6 A;  4KHU A;  4FM2 A;  1LV5 A;  1QSS A;  4FM0 A;  2FBV A;  1LWE A;  4AIL C;  1D9F A;  4B8A B;  3KKR A;  2NUB A;  4CJU A;  1LAW A;  3SI6 A;  4CF9 A;  2PYJ A;  4M3U A;  1O1W A;  4H4O A;  3OYE A;  4KHW A;  4EP5 A;  4OKE A;  2GV9 A;  4DTJ A;  3C95 A;  4W5Q A;  3KJV A;  1SUQ A;  4J2E A;  1VSF A;  2B4J A;  5CZ1 A;  4DS4 A;  3U3Y A;  2O4G A;  3K5M A;  2D0C A;  4CF8 A;  2G8V A;  3WNH A;  1RBR A;  3LP1 A;  4FVM A;  3LDS A;  4LY7 A;  4DSJ A;  4ZHR A;  3S3N A;  3QER A;  3G10 A;  3SUN A;  3RMC A;  1FKP A;  3QNO A;  1S5J A;  3VQ4 A;  4N56 A;  3LAN A;  4FJI A;  4FW2 A;  5C24 A;  1BIU A;  1NK9 A;  3DRP A;  3I0R A;  1NK7 A;  3RMB A;  1BIZ A;  2HHT A;  2D0B A;  2YNI A;  2GBZ A;  1NOY A;  1RTI A;  4QOZ B;  3RRH A;  4KB0 A;  3LP0 A;  4UQG A;  4BDZ A;  4KHN A;  4Z4I A;  4BAC A;  1GOC A;  3C94 A;  4DFP A;  4DQP A;  5HP1 A;  3T3F A;  2WOM A;  2F8S A;  4CJT A;  4CEB A;  4AHT A;  2IS3 A;  5FRO A;  4DU3 A;  4FYD A;  3WNG A;  3OYA A;  1TKZ A;  4E7K A;  3QNN A;  3QIO A;  3ZT2 A;  1X1P A;  4M3R A;  5KRT A;  1WSJ A;  1UWB A;  3B6O A;  3SQ2 A;  4KTQ A;  3IS9 A;  3KLI A;  4KPY A;  1RIL A;  5HRS A;  5E41 A;  4N5S A;  3THV A;  5FRM A;  4Z4E A;  4Y1D A;  2XY5 A;  2HNZ A;  1JXB A;  4PQU A;  4KTW A;  1KLN A;  3VN5 A;  4LSL A;  2FBT A;  4IBN A;  1T7P A;  2VWK A;  3HST B;  5I42 A;  3HPO A;  3AVI A;  2RPI A;  3CYM A;  3MAQ A;  4IG0 A;  2WON A;  3HPG A;  4I2P A;  4O0I A;  1TK0 A;  1ITG A;  1XC9 A;  3AO2 A;  1WAJ A;  1BHL A;  1TVR A;  3L3V A;  3F9K A;  1U48 A;  4Q0B A;  3AVB A;  4N47 A;  4KHS A;  1RBT A;  4OGE A;  1WLJ A;  4DF8 A;  3OYH A;  1QE1 A;  3AVJ A;  4FCY A;  1RDA A;  4I9L A;  2ITG A;  4IG3 A;  3V1O A;  4FJH A;  3U3G A;  4M3T A;  1XHZ A;  4Z4G A;  2HNY A;  1RNH A;  4W5R A;  4DTN A;  3OYM A;  1GOB A;  1KVA A;  4O55 A;  4F2R A;  3UIQ A;  1NJW A;  3QIP A;  1NJX A;  3RRG A;  3AO5 A;  4QCL A;  5JS1 A;  5DMR A;  3P1G A;  2ETJ A;  2VG5 A;  4E3S A;  4O5B A;  3OYN A;  3M8P A;  3HJF A;  1KFS A;  1ZBU A;  2KQ2 A;  3KK3 A;  1F21 A;  2BE2 A;  4OJR A;  5HRR A;  1IKX A;  1S1U A;  1S1T A;  2RF2 A;  3VQ7 A;  3VQP A;  4CJP A;  1J53 A;  1FXX A;  3DLR A;  4DQR A;  3DOK A;  4CHQ A;  2KZM A;  4I9Q A;  1RDD A;  2I5J A;  3BDP A;  2LSN A;  4CEC A;  4ID1 A;  4Z4C A;  5FRN A;  3L2R A;  1I3A A;  4AHU A;  2JLE A;  4W5O A;  1S9G A;  3L2Q A;  1WSF A;  3LPU A;  3KLF A;  3NE6 A;  2HVI A;  3ZSR A;  1U49 A;  3SUO A;  2IOC A;  4RW4 A;  3K59 A;  4IKF A;  3OS2 A;  4CJ3 A;  4KB1 A;  3S9H A;  5JS2 A;  2PYL A;  1VSH A;  4M41 A;  3RTV A;  4BDP A;  4ELU A;  1D8Y A;  3SQ1 A;  4OKJ A;  2HW3 A;  1JLF A;  4Q5V A;  1L3V A;  2Q3S A;  1GOA A;  5CYM A;  2D0A A;  1JL1 A;  2A1R A;  4C8K A;  3D0P A;  4FLT A;  2OPQ A;  3AVK A;  1BI4 A;  4K8X A;  3NF8 A;  1HRH A;  3S3M A;  3KD1 E;  4GMJ B;  3MEC A;  2FC0 A;  4DLG A;  4CHZ A;  4KV8 A;  4CEQ A;  4KRF A;  3CG7 A;  3DM2 A;  1LWF A;  3KK1 A;  2YKM A;  4C8O A;  4R5P A;  2VG7 A;  4CES A;  2G8U A;  1WSE A;  3SUQ A;  2IC3 A;  1S1V A;  1FKO A;  2D5R A;  2OZM A;  3NH0 A;  2ZD1 A;  2KTQ A;  4I2Q A;  3HXM A;  1CZ9 A;  3JYT A;  4XIU A;  1HNI A;  1ZBH A;  1ASU A;  2E6M A;  1A5W A;  3DLB A;  4DQI A;  3AV9 A;  3I0S A;  1RBS A;  4GVM A;  1J54 A;  4RW6 A;  2P5O A;  3L2W A;  1LW2 A;  1MU2 A;  5SWM A;  1VSI A;  4FLX A;  4Z4F A;  3WNF A;  4KTZ A;  2RKI A;  3HVR A;  1I39 A;  4F2S A;  2KFN A;  3CFO A;  4OPK A;  3HO1 A;  3AVG A;  3AA2 A;  2OPS A;  3TAR A;  1U04 A;  3AVC A;  3SPZ A;  5DK5 A;  4ZTJ A;  4HCB A;  1IG9 A;  3OYL A;  1HJR A;  3P5J A;  4CHO A;  4O44 A;  4KO0 A;  3T19 A;  4DSI A;  3S3O A;  2HHX A;  3TAN A;  3H08 A;  4CJV A;  2DFE A;  3TAB A;  4HVJ A;  4M42 A;  2W42 A;  1RTD A;  1NK6 A;  2P51 A;  4DG1 A;  3M8S A;  2YHB A;  3V1Q A;  4Z4H A;  3CFR A;  3K57 A;  4CGJ A;  4FZX C;  5SZT A;  2HHW A;  2XO7 A;  4LH4 A;  3ULD A;  3IRX A;  1R0A A;  4LSN A;  3CFP A;  1WNS A;  3SQ0 A;  4AH9 A;  1G15 A;  4OLB A;  2F96 A;  3OYB A;  4FZY A;  2YV0 X;  3LZJ A;  1FK9 A;  1JL2 A;  2HHS A;  1VSL A;  3C6U A;  5HRP A;  1JLC A;  3DYA A;  3OY9 A;  3KLH A;  3DLE A;  3I8D A;  2PZS A;  5T7B A;  4DFJ A;  4J2D A;  5CY4 A;  1C1B A;  2HB5 A;  4CCH A;  4FZZ A;  4MQ3 A;  1ZBF A;  3VQ5 A;  5FDL A;  1WSI A;  3KLE A;  4PY5 A;  4AHC A;  3EYZ A;  4FJL A;  2ZE2 A;  4I7F A;  3RWU A;  1RT1 A;  1REV A;  2ZQB A;  3QIN A;  4E7L A;  1LW0 A;  3RMA A;  1A5V A;  4CEO A;  3AVL A;  3SNN A;  4KAZ A;  4BWJ A;  4CE9 A;  4BE2 A;  4HTU A;  1HQU A;  3DMJ A;  4CHN A;  2FBY A;  4RG8 A;  1HYS A;  1KTQ A;  3V6D A;  4CK1 A;  4FJ5 A;  3RR8 A;  3MXI A;  3PV8 A;  4NYN A;  3V4I A;  4EZ6 A;  4N76 A;  4NCB A;  1RTJ A;  4HUE A;  4B9U A;  4FK2 A;  3K5N A;  3V9Z A;  2G8H A;  1HYZ A;  4KHQ A;  3HVT A;  3ZSQ A;  1QHT A;  3OYI A;  2QK9 A;  4CEZ A;  2KFZ A;  1NKB A;  3HPH A;  1TKD A;  4DFK A;  5J2Q A;  4CED A;  5KI6 A;  4B9T A;  4F4K A;  2OA8 A;  2PY5 A;  3ZSW A;  1Z26 A;  1DLO A;  5J1E A;  3VQQ A;  1UAX A;  1A5X A;  2KW4 A;  3OJU A;  4FLU A;  2HMI A;  4H8K A;  3NH1 A;  2OZS A;  3AO1 A;  4J2A A;  4CF0 A;  4K8Z A;  2P1J A;  3IAY A;  3DI6 A;  2HHV A;  1TL3 A;  2Z1G A;  3L2U A;  1L3U A;  4HHT A;  3TAP A;  4DU4 A;  4CEA A;  5HBM A;  1RT4 A;  3DRS A;  4FLV A;  2DFH A;  2G8I A;  4E89 A;  1VSM A;  4C8M A;  4JS4 A;  3SPY A;  3RR7 A;  3MXJ A;  3PX0 A;  1QTM A;  1ASW A;  1B92 A;  4DU1 A;  2X6N A;  4FJX A;  3QEW A;  1RTH A;  4DTO A;  4DFM A;  1TAQ A;  4B8C A;  3O4Q A;  1UA0 A;  3VA0 A;  1SL0 A;  3HT3 A;  4CIF A;  2JGU A;  1RT3 A;  2RN2 A;  3VQ8 A;  4FLY A;  4DTP A;  3TAG A;  1RT5 A;  3NGY A;  4O0J A;  4BDY A;  4L8R B;  3KIO A;  3OS0 A;  3K5L A;  3NGZ A;  1VSJ A;  4FJ7 A;  1KFD A;  2XHB A;  3PY8 A;  1RDB A;  4CJ4 A;  3ZT3 A;  1YTA A;  1QS4 A;  4DWI A;  3PO4 A;  4CGG A;  4Z0U A;  3T1A A;  1C0U A;  1BCO A;  3V1R A;  3L2V A;  1Q9Y A;  3OVN A;  3HK2 A;  2HND A;  4E19 A;  1EKE A;  4B3O A;  5J2N A;  3ZT4 A;  1C1C A;  3VQA A;  1TK5 A;  4E7H A;  1TGO A;  1EX4 A;  1B9F A;  1TK8 A;  4E0D A;  1X9S A;  4QAG A;  2E6L A;  4FJ8 A;  1QQC A;  3ZSY A;  2X78 A;  1NJY A;  2XRI A;  3SZ2 A;  3K5O A;  3EY1 A;  4WE1 A;  4DLE A;  1ZYQ A;  4M3X A;  3NCI A;  1BIS A;  3SYZ A;  3LAL A;  3MEG A;  1T03 A;  1SL2 A;  3NH2 A;  3A2F A;  3SV4 A;  4CGF A;  5HLF A;  4F3T A;  1TAU A;  4OGC A;  3PX6 A;  1NJZ A;  1CXU A;  3TR8 A;  4FJK A;  2HHU A;  4HUF A;  3LAM A;  3SUP A;  1K6Y A;  1B9D A;  4DTU A;  1CXQ A;  2XY6 A;  1UA1 A;  2Y1J A;  3K2P A;  4FK0 A;  3ZSZ A;  3ISN C;  1JXE A;  3PUF A;  4F8R A;  4FJM A;  4PWD A;  2XY8 A;  2R7Y A;  4KHY A;  1XHX A;  4CFB A;  4CK3 A;  4DS5 A;  3QEI A;  1RT7 A;  4FW1 A;  4Y1C A;  2G8W A;  4C8L A;  1KVB A;  3SCX A;  3VQD A;  1KCF A;  2X6S A;  3TAF A;  1RDC A;  3TI0 A;  1SKR A;  1ZBI A;  3CQ8 A;  3D45 A;  1HMV A;  1BQM A;  1HPZ A;  1Q8I A;  4CER A;  4FLZ A;  3U6F A;  1BCM A;  1N6Q A;  3KK2 A;  3ALY A;  3BGR A;  5K14 A;  4DTX A;  3KLG A;  3C6T A;  3L8B A;  4CHY A;  2YHA A;  4FM1 A;  2BGG A;  3HL8 A;  1SV5 A;  1SKW A;  4F3O A;  4KRE A;  3P83 D;  1EXQ A;  2OPP A;  1L3T A;  1BI4 B;  2YNF A;  2X74 A;  1RBV A;  3NF9 A;  4CJS A;  4E7J A;  4CEE A;  5C42 A;  4BWM A;  4JS5 A;  3O3F A;  4DQS A;  2ATQ A;  4O4G A;  3JSM A;  3ZCM A;  4M3Y A;  2Z1H A;  2B6A A;  5I3U A;  1KSP A;  1RBU A;  2VG6 A;  4B08 A;  4DTS A;  3O3H A;  2E4L A;  5EU7 A;  3QEP A;  1HYV A;  3QES A;  4J2B A;  4DF4 A;  5J2P A;  1S1W A;  2G8F A;  1HNV A;  1EET A;  3V9X A;  3AVN A;  3DLG A;  1HQE A;  1IO2 A;  4CJL A;  3HP6 A;  3M8R A;  4B9N A;  1TKT A;  3HP9 A;  4CF2 A;  3MEE A;  1S6P A;  3NHG A;  3V9U A;  2G8K A;  3LP3 A;  1KRP A;  3CM6 A;  1S1X A;  3NF7 A;  4RW9 A;  4CIE A;  3TAE A;  2DY4 A;  3DLH A;  4M3Z A;  1C6V A;  1LWC A;  4YFU A;  4JLH A;  1Y97 A;  4IDK A;  2Y1I A;  3LP2 A;  3LAK A;  4N41 A;  1JLA A;  4M45 A;  1W0H A;  4CGI A;  5KTQ A;  3LWM A;  1U45 A;  1JKH A;  2Z1J A;  4TSX A;  4CK2 A;  3OYG A;  3FFI A;  4KI6 A;  4EZ9 A;  3AA4 A;  1NK5 A;  1WSG A;  2YNG A;  4KFB A;  1NKE A;  2EX3 A;  4OPJ A;  1L5U A;  3ZSO A;  4CEF A;  4HCC A;  1D5A A;  4E1N A;  2IAJ A;  3O3G A;  3NGI A;  1SKS A;  4YNQ A;  4FJG A;  4B9M A;  3KKS A;  1NK0 A;  4FJ9 A;  3DLK A;  3G0Z A;  3L3U A;  4FLW A;  5HRO A;  4CJE A;  1WAF A;  4CIG A;  2HVH A;  2BDP A;  1KLM A;  5D3G A;  4DSE A;  1JLE A;  2P5G A;  3AVF A;  1U47 A;  3VQC A;  3RMD A;  3K58 A;  2QXF A;  1IH7 A;  1S9E A;  1BGX T;  3MED A;  3IG1 A;  4CJR A;  3EZ5 A;  4ID5 A;  4CGD A;  3NFA A;  2OYQ A;  4CJF A;  2XY7 A;  1D9D A;  4FK4 A;  4B9S A;  3TAM A;  4OLA A;  3V9S A;  1EP4 A;  3SV3 A;  2BAN A;  3HM9 A;  4AHS A;  3AA5 X;  4DSK A;  5KGX A;  1JLG A;  1SL1 A;  3AA3 A;  4DTR A;  3SJJ A;  5CYQ A;  1L3S A;  1TL1 A;  3F73 A;  3QLH A;  4GW6 A;  1IKY A;  1NKC A;  3QEX A;  2KZZ A;  4PUO A;  1BQN A;  4CHP A;  1Q9X A;  3KTQ A;  5KGW A;  4PA1 A;  5J2M A;  4ELT A;  2O4I A;  1IKW A;  3ZT1 A;  5C25 A;  2HHQ A;  3OYD A;  3ZSX A;  1X9W A;  3NF6 A;  3VQ6 A;  4HUG A;  3QEV A;  3DRR A;  4CFD A;  4RW7 A;  3E01 A;  3NBP A;  3AVH A;  4CJ5 A;  3CM5 A;  4CFA A;  3VA3 A;  3QET A;  1RT6 A;  1KVC A;  1UOC A;  3AVM A;  4JRQ A;  3WNE A;  3M8Q A;  1NK8 A;  1S6Q A;  4G1Q A;  2OPR A;  4KKO A;  1J5O A;  1W9H A;  1YT3 A;  4AHR A;  4CJQ A;  3NDK A;  3QO9 A;  1T8E A;  1VSE A;  1U4B A;  3PX4 A;  4IFY A; 
#chains in the Genus database with same CATH topology
 2UUC K;  1BDG A;  4H4M A;  1VSK A;  2IGI A;  2NLX A;  4MO4 A;  1CZB A;  2VGN A;  2I7P A;  1QSL A;  4B3M K;  4KI4 A;  3O9U A;  2P9K B;  2ASM A;  3GDQ A;  2O8C B;  2P9S A;  3OYJ A;  3V9W A;  2OTL N;  1RCH A;  1LAV A;  2D4W A;  4BRH A;  1XUP O;  3MN6 A;  2QA4 N;  3NAE A;  3IMX A;  4DTM A;  3CQX A;  3SBT A;  3O1B A;  2QKK A;  2DFF A;  1NK4 A;  3MXM A;  3GBT A;  4B9V A;  4CGH A;  4NCA A;  2O8E B;  4KHP K;  4RW8 A;  3AO4 A;  4KH6 A;  1VRU A;  4DV1 K;  1T05 A;  3NVK A;  4FJN A;  3AO3 A;  1YJN N;  3LZI A;  1N32 K;  4JD2 A;  3DOL A;  4MDB A;  4E7I A;  4CZG A;  3SK3 A;  3IDH A;  2GWJ A;  4ZTF A;  2WFB A;  5FPE A;  3TTF A;  1XWL A;  4WFB L;  4X64 K;  4BE1 A;  3MN9 A;  1VAZ A;  5HL7 L;  2Q2R A;  3OW2 M;  1VK0 A;  1J9A A;  3VMF B;  4FM2 A;  4FOE A;  4FM0 A;  2FBV A;  1LWE A;  3U8X A;  4M3U A;  1O1W A;  4YY3 K;  2HMP A;  5AQZ A;  4EP5 A;  3C95 A;  3WXK A;  1QVF M;  1VSF A;  1YAG A;  2D0C A;  4EIA A;  4LY7 A;  1N33 K;  2F9T A;  3SUN A;  3RMC A;  4YHH K;  2KHO A;  4DUY K;  2HF4 A;  3O80 A;  3DRP A;  1NK7 A;  1NGH A;  1NOY A;  4WQ4 A;  1BO5 O;  3M5R A;  1GOC A;  4DFP A;  4DQP A;  1NM1 A;  2WOM A;  2F8S A;  4FYD A;  3OYA A;  1TKZ A;  4PL7 A;  4DV2 K;  4KPY A;  4BRG A;  5FRM A;  3THV A;  4PKI A;  3G4S N;  4Y1D A;  1JXB A;  2NZT A;  4KTW A;  4DV7 K;  3VN5 A;  4IBN A;  1QZ5 A;  5C12 A;  5IT9 O;  3MAQ A;  4IG0 A;  4X62 K;  1ITG A;  1XC9 A;  1WAJ A;  1ZC6 A;  2JWK A;  2HBM A;  3L3V A;  5JLF A;  1U48 A;  3MWP A;  4I9L A;  4FJH A;  2HNY A;  1RNH A;  5AQJ A;  5AZJ B;  1GOB A;  1KVA A;  2HST A;  2UXB K;  3ID6 A;  5DMR A;  2VG5 A;  4O5B A;  1F21 A;  4QS9 A;  4BR9 A;  2RF2 A;  4YDU C;  4CJP A;  5LMN K;  1RDD A;  3M1F A;  1HX1 A;  1S72 N;  3EL2 A;  4W5O A;  1WB9 A;  4MDA A;  1WSF A;  2AP1 A;  2HVI A;  3TSP A;  3SUO A;  3K59 A;  2YHX A;  4ILJ A;  4CJ3 A;  2HW3 A;  1VSH A;  4M41 A;  3RTV A;  2A1R A;  1JL1 A;  2OPQ A;  3AVK A;  4K8X A;  3S3M A;  4GMJ B;  3J7Y P;  1Q86 O;  2FC0 A;  4DLG A;  4CHZ A;  4KRF A;  2E2O A;  3CCV N;  3DM2 A;  3CME N;  3DXM B;  1LWF A;  3KK1 A;  4IJN A;  2Q36 A;  2D5R A;  1QQM A;  4K25 A;  4B3S K;  3HXM A;  2IVN A;  5GAE P;  4DQI A;  4WCE L;  2P5O A;  1BA0 A;  1LW2 A;  5SWM A;  3O9R A;  4FLX A;  4JKG A;  3WNF A;  3HVR A;  2RKI A;  1WBD A;  1D4X A;  3AVG A;  3AA2 A;  3TAR A;  2HF3 A;  5DK5 A;  3OYL A;  3EEQ A;  3T19 A;  3TAB A;  4DG1 A;  1VQ9 N;  3V1Q A;  4FZX C;  5SZT A;  3ULD A;  3MWT A;  3A5M C;  5EX5 A;  3C7N A;  3CFP A;  1WNS A;  4CW7 B;  4OLB A;  3BUZ B;  4FZY A;  3KK7 A;  5HRP A;  3DLL L;  3DYA A;  3OY9 A;  3NVM A;  3C6A A;  2V7Y A;  3ZYY X;  2P9N B;  3DLE A;  3I8D A;  4JHD B;  5CY4 A;  5FDL A;  4FJL A;  4I7F A;  1RDU A;  1RT1 A;  2ZQB A;  4K42 A;  2QWP A;  3D7E O;  3RMA A;  3ATV A;  2Q0U A;  3KWG A;  2FBY A;  3J80 O;  3VTH A;  3CCE N;  4XEI A;  5HOO A;  3V6D A;  3MXI A;  4A2A A;  4NYN A;  1W97 L;  2HBK A;  1HPM A;  3H46 O;  3THY A;  3M6G A;  3OYI A;  4CEZ A;  2KFZ A;  1NKB A;  4CVN E;  2OA8 A;  2PY5 A;  1DLO A;  3QBX A;  3OJU A;  4LF8 K;  4FLU A;  4H8K A;  4LF7 K;  3DI6 A;  2HHV A;  3C6H A;  4FL9 A;  4I6M A;  4L3Q A;  3CET A;  1RT4 A;  4JS4 A;  5AQN A;  4HCC A;  4X65 K;  3QEW A;  3VET A;  4CBX A;  4NB4 A;  4JN4 A;  4B8C A;  3BY5 A;  3VA0 A;  3HT3 A;  4I6M B;  4YOR A;  3TAG A;  3VQ8 A;  1NGD A;  3F5T A;  3SAH A;  3OBY A;  3U9D A;  3OS0 A;  4FWP A;  4FJ7 A;  1RDB A;  1QZ6 A;  4CGG A;  3T1A A;  1SS6 A;  3QIC A;  2VWB A;  3VQA A;  4MO5 A;  1EX4 A;  5M1F A;  1X9S A;  4H5T A;  4K0K K;  3GE1 A;  3ZET B;  4DLE A;  4M3X A;  3NCI A;  3F9M A;  3THW B;  4BRP A;  1T03 A;  1FJG K;  4OGC A;  4JI5 K;  3TR8 A;  3ULE A;  3SJH A;  4FJK A;  1BOT O;  4DTU A;  1UA1 A;  2XY6 A;  4FK0 A;  3OBW A;  3ZSZ A;  1YI2 N;  2IIR A;  3SAF A;  2NRW A;  2X6S A;  3VF6 A;  3ZEU A;  3KK2 A;  1HNW K;  3KVG A;  3THW A;  2NRV A;  4GKK K;  4FM1 A;  3HL8 A;  3P83 D;  3G71 N;  2HHH K;  3J8A A;  1VQO N;  5C42 A;  1DT9 A;  4DQS A;  4O4G A;  3JSM A;  3ZCM A;  2Z1H A;  4H0Y B;  2E5L K;  4PL8 A;  1K73 O;  3O3H A;  2E4L A;  3H6E A;  3VEY A;  1BU6 O;  1YJ9 N;  2WBN A;  4FWN A;  5J2P A;  3V9X A;  4A59 A;  1K8A O;  3AVN A;  1IO2 A;  1QVG M;  3HP6 A;  3M8R A;  1ATN A;  3HK2 A;  3NHG A;  4CF2 A;  3MEE A;  1S6P A;  3CC7 N;  3EZW A;  4B9U A;  2DY4 A;  4CIE A;  3K9J A;  5FPM A;  3O08 A;  1C6V A;  2E2P A;  3O4W A;  4YFU A;  4N41 A;  1GLE G;  4DV4 K;  1JKH A;  3OYG A;  1NK5 A;  4BRN A;  2YNG A;  5BPN A;  1TUY A;  4YNQ A;  3KKS A;  4BR4 A;  1NK0 A;  4FJ9 A;  3VEZ A;  4CIG A;  2HVH A;  2BDP A;  1KLM A;  1HUX A;  5D3G A;  1U6Z A;  4CZF A;  2P5G A;  5EXW A;  3K58 A;  2QXF A;  4AF1 A;  2ZJP L;  4MLE A;  1X3M A;  2GEM A;  1E3M A;  4JKF A;  3QFU A;  3ATU A;  4CJF A;  1D9D A;  4OLA A;  2QTD A;  3V9S A;  2E2Q A;  3QBW A;  4WFA L;  4IO9 L;  3HM9 A;  3VER A;  4BG8 A;  1NBW A;  2F9W A;  1XC3 A;  2NRR A;  4AM6 A;  5J2M A;  4WFN L;  4C1N I;  1DGK N;  3OYD A;  4JK9 A;  1X9W A;  3QEV A;  3H1Q A;  4RW7 A;  5GIP A;  4CJ5 A;  4A5B A;  4JRQ A;  3WT0 A;  4JEP A;  1S6Q A;  1Q81 O;  1W9H A;  3UB5 A;  1E4F T;  3PX4 A;  5GIO A;  4DMN A;  4E1M A;  4NO7 A;  1DTT A;  1N8R O;  3ASM A;  3OYF A;  1XI1 A;  4ISG A;  4MFB A;  1WN7 A;  3ZSV A;  2ASO A;  3V81 A;  2IVP A;  2GEL A;  4CJK A;  5BR9 A;  1BL3 A;  1QQO A;  1TKX A;  1TYQ B;  4H0P A;  2ZGY A;  2QWR A;  3O4N A;  1NMN A;  4LC9 B;  5AQQ A;  5A2Q O;  4DSF A;  1N5Y A;  3AVA A;  1X9M A;  1IKV A;  3T1Y K;  1C0T A;  3VQB A;  3PLA A;  4AHV A;  3OTO K;  5B8H A;  2GUI A;  1T6D A;  1IBL K;  1Z25 A;  1RT2 A;  1IBK K;  2FBX A;  1OVQ A;  2YKN A;  3CMA N;  4NCG A;  5C2F A;  3LM9 A;  4M3W A;  4NYF A;  1VHX A;  2P9P A;  4DSL A;  1EQY A;  4KHU A;  3L4Q A;  1QSS A;  2NRT A;  4A2B A;  4CJU A;  2NUB A;  1LAW A;  2GX9 A;  3KJV A;  1SUQ A;  5JIC A;  4DS4 A;  2NNW A;  2O4G A;  5AQS A;  3K5M A;  4CF8 A;  2G8V A;  3LP1 A;  3VES A;  1SAZ A;  4FVM A;  3LDS A;  4DSJ A;  3QER A;  3KHY A;  4QS7 A;  3IKM A;  1FKP A;  3QNO A;  1S5J A;  5E84 A;  2QWM A;  3VQ4 A;  4N56 A;  4B1Y B;  4FW2 A;  1BIU A;  4XH1 A;  3RMB A;  5FPD A;  2D0B A;  5BRD A;  3A5L C;  4QOZ B;  4BDZ A;  3S41 A;  3RSE A;  3T69 A;  5HP1 A;  3T3F A;  4BR2 A;  2E2N A;  4Z94 A;  5AFU H;  4AHT A;  4CEB A;  3MMV A;  4DR4 K;  1K8K A;  1WSJ A;  4GV6 A;  3SQ2 A;  5GAG P;  4PQU A;  2V52 B;  4LSL A;  2FBT A;  3PIP L;  1XNQ K;  5I42 A;  2RPI A;  1I94 K;  4DV5 K;  4O0I A;  1YIT N;  4H03 B;  1TK0 A;  3O5B A;  4BG9 A;  3AY9 A;  3AAQ A;  2V51 B;  1JCG A;  1RBT A;  5DM6 L;  1RDA A;  2ITG A;  4Z4G A;  4W5R A;  3WXM B;  3UIQ A;  1NJW A;  3QIP A;  3RRG A;  3AO5 A;  3P1G A;  2ETJ A;  4E3S A;  2CGK A;  3OYN A;  3M8P A;  1ATS A;  3I56 N;  1ZBU A;  2KQ2 A;  2YHY A;  2BE2 A;  2OZM A;  1S1T A;  4FPB A;  4EHU A;  2LSN A;  4CEC A;  5FRN A;  3W3D A;  5CR4 A;  4B1X B;  1U49 A;  1HNZ K;  3D6R A;  3R3L A;  3OS2 A;  2PYL A;  4JI6 K;  1VQ8 N;  4ELU A;  1D8Y A;  3CF5 L;  4RCH A;  1HJO A;  4H0T B;  1L3V A;  2ASP A;  3FZF A;  5JLH A;  4YOU A;  3KD1 E;  4BRQ A;  4KV8 A;  3CG7 A;  4DR1 K;  2VG7 A;  1WSE A;  4WYB A;  3NH0 A;  4ILG B;  3CCR N;  1CZ9 A;  3AGR A;  3JYT A;  2O8D B;  2D1K A;  1ZBH A;  3I0S A;  1RBS A;  1J54 A;  1MU2 A;  1VSI A;  4KTZ A;  1I39 A;  2KFN A;  3CFO A;  2QI2 A;  3HO1 A;  5KPZ A;  1BG3 A;  4LF9 K;  4HCB A;  4RWT A;  1RDW X;  1HJR A;  4O44 A;  3WXJ A;  4A57 A;  2HHX A;  2O8C A;  4BGA A;  4NLB A;  4FWK A;  1NK6 A;  2P51 A;  2YHB A;  4Z4H A;  3CXC M;  1U2V B;  4CGJ A;  4FWL A;  3CC4 N;  1WBB A;  4B3R K;  3IRX A;  4BC2 A;  3A5O C;  4K41 A;  1NGI A;  3MN7 A;  4BQZ A;  3SQ0 A;  4DR7 K;  1V4T A;  4IOC L;  4B1V A;  2GTD A;  2RE2 A;  3OYB A;  3HBT A;  1FK9 A;  1JL2 A;  4A5A A;  1VSL A;  3KLH A;  4H0X B;  3VGL A;  4BR5 A;  5T7B A;  4DFJ A;  4J2D A;  1C1B A;  4MQ3 A;  1OH6 A;  1WSI A;  4RTF D;  3EYZ A;  2ZE2 A;  1REV A;  3R9P A;  4KBO A;  1NGC A;  4E7L A;  1OH5 A;  1LW0 A;  4M63 C;  1A5V A;  5C15 A;  5LY3 A;  5EVZ A;  4CE9 A;  4BE2 A;  1VQ7 N;  4CHN A;  4RG8 A;  1HYS A;  3B8A X;  3LDO A;  4FJ5 A;  4CK1 A;  3JS6 A;  4NCB A;  3LDQ A;  1NU0 A;  4FK2 A;  5AQG A;  1MWK A;  5ADX A;  5GIN A;  3ZSQ A;  1QHT A;  4FWS A;  1C0F A;  4DFK A;  4JK7 A;  3VGK A;  5M1N A;  1HNX K;  5BRH A;  1YF5 L;  1A5X A;  3HI0 A;  4FSV A;  2HMI A;  4JKA A;  3AO1 A;  4CF0 A;  3TPQ A;  5I9E B;  3TSQ A;  3IAY A;  3L2U A;  1L3U A;  4HHT A;  2I7N A;  4CEA A;  2DFH A;  2G8I A;  4C8M A;  1K8K B;  4DU1 A;  3QB0 A;  3VF2 A;  3D2F B;  3FE1 A;  4BRC A;  1UA0 A;  1OH8 A;  1H1V A;  2FSJ A;  2JGU A;  1RT3 A;  2OTJ N;  4DTP A;  4FLY A;  4O0J A;  4BDY A;  2ZWH A;  3P31 A;  3WEE B;  1E4G T;  3K5L A;  4CJ4 A;  4ISF A;  3PO4 A;  4Z0U A;  3NMU A;  3L2V A;  4JKD A;  3OVN A;  5M1P A;  4B3O A;  5J2N A;  1TK5 A;  1TGO A;  4FJ8 A;  3ZSY A;  1NJY A;  2O8F B;  2XRI A;  4GKJ K;  3SZ2 A;  4WE1 A;  4IOA L;  1SL2 A;  4BRK A;  3A2F A;  4BRL A;  3NH2 A;  3SV4 A;  3ZEU B;  4BRD A;  1NJZ A;  3R6M A;  1CXU A;  3H3O B;  2HHU A;  3LAM A;  1B9D A;  2Y1J A;  3K2P A;  5AQK A;  4PKG A;  3VEX A;  4PWD A;  2OAN A;  1MWM A;  3QEI A;  4DS5 A;  1RT7 A;  4Y1C A;  3VQD A;  1KCF A;  4ISE A;  1IJJ A;  1RDC A;  3H45 C;  1SKR A;  2UUB K;  1ZBI A;  3D45 A;  1HMV A;  1BQM A;  4DB3 A;  1BCM A;  3DXM A;  3ALY A;  3KLG A;  3C6T A;  3L8B A;  4KRE A;  3NF9 A;  2X74 A;  4CJS A;  4CEE A;  4BWM A;  4JS5 A;  2ATQ A;  4CD3 A;  4M3Y A;  2B6A A;  1KSP A;  4V19 S;  4B08 A;  1IG8 A;  3TU5 A;  4J2B A;  4H0V B;  2HBL A;  5TKY A;  1ATR A;  4E1J A;  2QWO A;  1OVY A;  4B9N A;  3HP9 A;  4B3T K;  2G8K A;  1KRP A;  3LP3 A;  3NF7 A;  3TAE A;  1VQ6 N;  1LOT B;  2D0O A;  1Q82 O;  3LAK A;  2QW9 A;  1W0H A;  4NXM K;  1V4S A;  1U45 A;  2Z1J A;  4TSX A;  3FFI A;  4EZ9 A;  4JI0 K;  3AA4 A;  1WSG A;  3L0Q A;  1NKE A;  4WQ4 C;  3SBG A;  4OPJ A;  1KAY A;  1VQN N;  1IBM K;  5AQH A;  3BF3 A;  4CEF A;  3UE5 A;  4B1W B;  1D5A A;  4E1N A;  5CHI A;  2IAJ A;  3QFP A;  3CIP A;  3E1Y A;  3DLK A;  3L3U A;  3A8Y A;  4DSE A;  4LF5 K;  3E9P A;  3IG1 A;  4CGD A;  3NFA A;  2OYQ A;  3RVC A;  4FK4 A;  4FWO A;  1JLG A;  1SL1 A;  4LFC K;  2AA4 A;  5CYQ A;  4B9Q A;  5M1O A;  2NRX A;  3QLH A;  4GW6 A;  1IKY A;  2KZZ A;  2UYT A;  3PSF A;  2E1Z A;  1Q9X A;  4PA1 A;  3P4I A;  4X66 K;  4ELT A;  3ZT1 A;  4GV3 A;  2KLA A;  3NF6 A;  3GL1 A;  3DRR A;  4CFD A;  3E01 A;  5MLC Q;  3NBP A;  3AVH A;  3CM5 A;  4CFA A;  1RT6 A;  1KVC A;  4H5N A;  4IOX A;  5ADX H;  3TSU A;  4G1Q A;  2OPR A;  4AHR A;  1GLB G;  1VSE A;  1KAX A;  3LDL A;  4NLC A;  1TUU A;  4DR6 K;  3FZH A;  4BRM A;  1DTQ A;  4CZM A;  1CLQ A;  3VQE A;  5AQO A;  2A42 A;  3LL3 A;  4OPH A;  3VF4 A;  5C0Y A;  4B9L A;  2JWL A;  4LD0 A;  3VEW A;  2QKB A;  4BC5 A;  2A1S A;  4CF1 A;  3FZK A;  3OJS A;  4IJA A;  2P9U B;  3ENB A;  4JK8 A;  4LFA K;  4FWR A;  1WSH A;  1NOZ A;  3R1X A;  4WQ5 A;  4DKW A;  1YTU A;  5JVG L;  3OS1 A;  4ICL A;  3P38 A;  4FXD A;  1GLL O;  4CZH A;  4ELV A;  1VRT A;  1ZBL A;  3CCL N;  1QSY A;  4OKK A;  3OYC A;  3SQ4 A;  1JLQ A;  2O8E A;  1VQK N;  4CFC A;  3B6P A;  1Z6R A;  3SMS A;  2YNH A;  3N4Q A;  5JMV A;  4DR3 K;  4CBU A;  1KQS M;  5KRS A;  1BA1 A;  4W5T A;  5CZ2 A;  3OYK A;  4OVL A;  5AQR A;  1LV5 A;  2Q97 A;  2W6K A;  4AIL C;  4B8A B;  3KKR A;  1HLU A;  2PYJ A;  3SI6 A;  4CF9 A;  4H4O A;  2GV9 A;  4DTJ A;  4W5Q A;  3H1V X;  4J2E A;  2B4J A;  5CZ1 A;  3U3Y A;  1RBR A;  3S3N A;  3G10 A;  4WF9 L;  3LAN A;  4FJI A;  5BRE A;  5C24 A;  1NK9 A;  3I0R A;  2PAV A;  2HHT A;  2GBZ A;  5AQW A;  4KHN A;  4Z4I A;  4KH4 A;  4BAC A;  3C94 A;  4JNE A;  2W6L A;  3CQY A;  4CJT A;  3BF1 A;  4E7K A;  4M3R A;  2A3Z A;  3SLC A;  4A61 A;  5KRT A;  3GG4 A;  3KLI A;  5E41 A;  3DJC A;  2HNZ A;  1XMO K;  3VEO A;  2V7Z A;  2WON A;  3HPG A;  2VQE K;  3A0I X;  4Q0B A;  1TVR A;  5AQY A;  5M1Q A;  1WLJ A;  1YUW A;  1QE1 A;  3AVJ A;  4FCY A;  2BH1 A;  1HKC A;  4IG3 A;  1Z05 A;  4M3T A;  3OYM A;  4F2R A;  2Q31 A;  1YIJ N;  1NJX A;  1M90 O;  1NGG A;  3HJF A;  4BRO A;  3J81 O;  1KFS A;  3KK3 A;  2A41 A;  1S1U A;  3J7Z O;  1L3S A;  2KZM A;  1J53 A;  1FXX A;  3DOK A;  4IEI A;  4JKE A;  2I5J A;  3BDP A;  3SAG A;  4JHD A;  1I3A A;  4AHU A;  1S9G A;  3L2Q A;  4YOY A;  1S22 A;  2QWL A;  3KLF A;  2A6A A;  2IOC A;  1KXP A;  4IKF A;  1EWR A;  4KB1 A;  4BDP A;  5JS2 A;  3KWI A;  4Q5V A;  3HZ6 A;  1GOA A;  2D0A A;  4C8K A;  5BPL A;  1HRH A;  1J6Z A;  1YVN A;  2YKM A;  3MK6 A;  4CZI A;  2G8U A;  4LF6 K;  1NNE A;  1S1V A;  4I2Q A;  4JI8 K;  3UKR B;  2E6M A;  4BVO A;  1A5W A;  3LDP A;  3EKS A;  3L2W A;  3AAP A;  2QWQ A;  1VQ5 N;  3ZLJ A;  2Q0R A;  4F2S A;  4OPK A;  3CCS N;  3CPW M;  2OPS A;  3AVC A;  3P5J A;  1NJI O;  3W0L A;  4KO0 A;  3ULE B;  1ILY A;  4U7B A;  1XQS C;  2P9K A;  4M42 A;  2W42 A;  1RTD A;  3M8S A;  3CFR A;  5AQL A;  2HHW A;  5AR0 A;  2XO7 A;  4LH4 A;  1NLV A;  3Q7B A;  1R0A A;  3HM8 A;  3UKU B;  4AH9 A;  3I8B A;  3O1W A;  2F96 A;  3ZX0 A;  2F4V K;  3C6U A;  3QML A;  1JLC A;  2PZS A;  3FFK B;  4JI1 K;  5BR8 K;  4BRI A;  3WEE A;  4JKG B;  4H5V A;  4AHC A;  1P90 A;  2BUP A;  2CGJ A;  3EO3 A;  3SNN A;  4BWJ A;  4EAH D;  4IEE A;  3DMJ A;  1YJW N;  4NXN K;  5AZJ A;  3RR8 A;  4N76 A;  3V4I A;  2D0P A;  3D2E B;  1G99 A;  1RTJ A;  4HUE A;  5AQF A;  2G8H A;  3V9Z A;  4KHQ A;  4OX9 K;  3HVT A;  4BVP A;  3G25 A;  5J2Q A;  5KI6 A;  3BP8 A;  3ZSW A;  1Z26 A;  2QWN A;  3VQQ A;  1UAX A;  3L6Q A;  2Z1G A;  5AQI A;  4J8F A;  3TAP A;  1VSM A;  3SPY A;  3MXJ A;  3PX0 A;  1QTM A;  4YDU A;  1B92 A;  1RTH A;  4DFM A;  4BRA A;  1MDU B;  1ZBS A;  3J7A P;  5C2D A;  3O8M A;  4CIF A;  2RN2 A;  3WQT A;  1RT5 A;  3NGY A;  4L8R B;  2WC9 A;  3KIO A;  4U67 L;  3JXU A;  3NGZ A;  1VSJ A;  5F2R A;  2XHB A;  3PY8 A;  3KZB A;  1S3X A;  4M7X A;  1QS4 A;  4DWI A;  5GAD P;  4FOI A;  1BCO A;  1Q9Y A;  2HND A;  4E19 A;  1EKE A;  3ZT4 A;  5LJV A;  3F2K A;  3ZET A;  2P9I A;  4H5R A;  4QAG A;  3O9S A;  3I55 N;  3C65 A;  1U2V A;  3SYZ A;  4GV9 A;  1TAU A;  4F3T A;  3HOS A;  5TKW A;  1GLA G;  1WOQ A;  3SUP A;  4JV5 K;  1K6Y A;  4YOV A;  1CXQ A;  1NGJ A;  1JXE A;  3ISN C;  4JI7 K;  2NRZ A;  2XY8 A;  2R7Y A;  1Q7Y O;  4KHY A;  3CCQ N;  4CFB A;  4CK3 A;  4C8L A;  3IUC A;  3TI0 A;  3CJ9 A;  3CQ8 A;  1HPZ A;  4JD2 B;  1Q8I A;  4CER A;  1N6Q A;  2QEX N;  1SKW A;  2BTF A;  4CI6 A;  1EXQ A;  1HKG A;  1L3T A;  1BI4 B;  2YNF A;  1RBV A;  4JYA K;  3O3F A;  4HTL A;  3CC2 N;  1RBU A;  2VG6 A;  2ZJQ L;  5EU7 A;  4C1N K;  1HYV A;  3CJA A;  3EN9 A;  5F1X A;  3QES A;  1ZXO A;  4H5W A;  2G8F A;  1S1W A;  1HNV A;  1EET A;  1DEJ A;  2UXC K;  3DLG A;  1M1K O;  1HQE A;  4CJL A;  1S1X A;  3DLH A;  3C0B A;  3UKR A;  3LP2 A;  1T6C A;  4M45 A;  4CK2 A;  3WQU A;  4DCH A;  2VCP A;  4O5F A;  4KI6 A;  4KFB A;  2EX3 A;  5IWA K;  3HTV A;  3NGI A;  1P8Z A;  1GLF O;  2A40 A;  4B9M A;  5GAH P;  3G0Z A;  3ZX3 A;  4FLW A;  4O8U A;  5HRO A;  3U9Z A;  1NGE A;  2HOE A;  3O9Q A;  2YI1 A;  1JLE A;  4YOT A;  3VQC A;  4DR2 K;  1IH7 A;  1S9E A;  1VQP N;  1BGX T;  2P9S B;  3LDN A;  4ID5 A;  3D2E A;  3VTI A;  1QHA A;  2FLO A;  3TAM A;  3SV3 A;  2BAN A;  1C0G A;  4AHS A;  4DSK A;  1GLD G;  2GUP A;  3AA3 A;  3SJJ A;  3IFR A;  1TL1 A;  3F73 A;  4IZ9 A;  3BZK A;  2PFU A;  3QEX A;  3CI5 A;  1BQN A;  4CHP A;  3KTQ A;  5KGW A;  2GWK A;  1IKW A;  1OH7 A;  3ZSX A;  4EFH A;  3QDK A;  4IDH A;  3THX A;  2OCE A;  3AVM A;  3WNE A;  1NK8 A;  5AQX A;  4XH4 A;  4KKO A;  4DV6 K;  1YT3 A;  1J5O A;  4FPA A;  1U4B A;  2P9L B;  4IFY A;  2EHG A;  1OKJ A;  3KD5 E;  3PO5 A;  3VQ9 A;  4DUZ K;  4DQQ A;  4C8N A;  4FJJ A;  3GOI A;  1ESV A;  2DTU A;  2F8T A;  3CJB A;  1CZA N;  3CCU N;  1YVU A;  4EP4 A;  2VWJ A;  3RSE B;  2IDO A;  3LPT A;  1VSD A;  2P9P B;  3CD6 N;  4JI4 K;  4BE0 A;  3LWL A;  3P39 A;  2B5J A;  1NG9 A;  3HOT A;  5HRN A;  4YOW A;  4LH5 A;  4CJW A;  1JLB A;  2Z1I A;  3TAQ A;  4BR0 A;  4DV0 K;  3ITH A;  1C1A A;  4GY2 B;  3ZT0 A;  2AJQ A;  3VGM A;  3FZM A;  3BZC A;  4W5N A;  3DXK B;  3HYF A;  1C0M A;  4JRP A;  2IVO A;  1ASV A;  4KH5 A;  3TWH A;  4IFV A;  2ZGZ A;  2P9U A;  4K43 A;  5CE3 A;  1TV6 A;  5KQD A;  2DPN A;  1QQN A;  1Y64 A;  4BRE A;  3Q7C A;  1D9F A;  3E66 A;  3R8E A;  3OYE A;  4KHW A;  4CJ7 A;  4OKE A;  2ZM6 K;  4IWV A;  2PBD A;  5AFU A;  3WNH A;  3VPZ A;  5EOY A;  4ZHR A;  2CGL A;  2RHK A;  5BPM A;  5AZI A;  1RGI A;  3ID8 A;  2UU9 K;  1YXQ A;  3MCP A;  1BIZ A;  1T44 A;  1VQ4 N;  2YNI A;  1RTI A;  3RRH A;  1TYQ A;  3LP0 A;  4JKH A;  1X3N A;  4UQG A;  1XNR K;  2UXD K;  2IS3 A;  5FRO A;  4DU3 A;  3WNG A;  3QNN A;  2CH6 A;  3QIO A;  3ZT2 A;  1NGA A;  1X1P A;  1VQL N;  4KTQ A;  1UWB A;  3B6O A;  3IS9 A;  4Y0W A;  1RIL A;  5HRS A;  4N5S A;  4Z4E A;  5BN9 A;  2XY5 A;  4HWI A;  1KLN A;  4DV3 K;  1T7P A;  3CHW A;  2VWK A;  3HST B;  4G9Z A;  3HPO A;  3AVI A;  5KPR A;  3CYM A;  2WTU A;  2YJF A;  4I2P A;  5AQM A;  1WUA A;  3MX2 A;  3EE9 A;  4FWM A;  3AO2 A;  1BHL A;  1LCU A;  3F9K A;  4BC3 A;  3CCJ N;  3AVB A;  3SMP A;  4N47 A;  4KHS A;  4OGE A;  4DF8 A;  3OYH A;  1K9M O;  5E26 A;  3V1O A;  3L4I A;  3U3G A;  5AZI B;  1XHZ A;  4EHT A;  4DTN A;  2H3G X;  4O55 A;  2FXU A;  4QCL A;  2EWS A;  5JS1 A;  4R79 A;  1IV0 A;  5HRR A;  4HVJ A;  4OJR A;  3VQP A;  1IKX A;  3VQ7 A;  4KB0 A;  4BR7 A;  4DQR A;  3DLR A;  4CHQ A;  4I9Q A;  3E9L A;  5C10 A;  4ID1 A;  1GLJ O;  4Z4C A;  3L2R A;  2W40 A;  2JLE A;  4JI3 K;  3LPU A;  2P9N A;  3NE6 A;  3ZSR A;  3PSI A;  5AQU A;  4RW4 A;  3T7Z A;  2ZF5 O;  3S9H A;  1XMQ K;  3PIO L;  3SQ1 A;  4OKJ A;  1JLF A;  3DWL A;  2FF3 B;  2Q3S A;  5CYM A;  2A5X A;  2VGM A;  3D0P A;  4FLT A;  1BI4 A;  5ELZ A;  3NF8 A;  4B1U B;  2W41 A;  4BC4 A;  3OHR A;  3MEC A;  3VOV A;  4CEQ A;  5AJ3 K;  4C8O A;  4R5P A;  4CES A;  3EKU A;  4FO0 A;  4ILH A;  3SUQ A;  5LMU K;  2IC3 A;  1FKO A;  2ZD1 A;  2KTQ A;  3FLC O;  3AGK A;  4XIU A;  1HNI A;  1ASU A;  3DLB A;  3WUH A;  3AV9 A;  4CBW A;  4GVM A;  4RW6 A;  2E20 A;  1O13 A;  3EE8 A;  3FR0 A;  4Z4F A;  3K9K A;  4FWQ A;  2ZJR L;  4IXC A;  4LF4 K;  3HSC A;  5FLX O;  1U04 A;  3SPZ A;  4ZTJ A;  1IG9 A;  3CER A;  4CHO A;  1JCE A;  4WQ5 C;  4DSI A;  3S3O A;  3TAN A;  3H08 A;  4CJV A;  2DFE A;  1J5E K;  2FSN A;  3E9O A;  3CJ1 A;  4CZJ A;  3K57 A;  2J4R A;  2P9I B;  1KAZ A;  1BUP A;  4M7Y A;  2NRH A;  2YHW A;  4OPA A;  2P9L A;  4LSN A;  1G15 A;  3K0S A;  2YV0 X;  3DAW A;  4H0O A;  3LZJ A;  2HHS A;  3THX B;  2YCH A;  2HBJ A;  3TTC A;  2HB5 A;  4CCH A;  3WXL A;  4FZZ A;  5AQV A;  1ZBF A;  3VQ5 A;  4O8K A;  3KLE A;  4PY5 A;  2QXL A;  3D2F A;  1W2B M;  3RWU A;  3QIN A;  4CEO A;  3AVL A;  3MDQ A;  4KAZ A;  1N36 K;  4HTU A;  2FF6 A;  1HQU A;  3VEV A;  1KTQ A;  4DQ8 A;  3PV8 A;  4EZ6 A;  3U4L A;  5KQ8 A;  1JCF A;  3G6E N;  3K5N A;  1HYZ A;  4FVU A;  2QK9 A;  3HPH A;  1TKD A;  4CED A;  1DKG D;  4B9T A;  4F4K A;  5KPT A;  3AAR A;  5J1E A;  1X9J A;  4PKH A;  3C7N B;  2KW4 A;  2OZS A;  4J2A A;  3NH1 A;  2ITM A;  3VEN A;  4K8Z A;  2P1J A;  2F7T A;  1TL3 A;  3OA9 A;  2KKZ A;  3M3Z A;  3THY B;  3O9T A;  3ZX2 A;  4DU4 A;  1KC8 O;  5HBM A;  4FLV A;  3DRS A;  4JKB A;  5AQP A;  4A62 A;  4E89 A;  3RR7 A;  4FJX A;  1ASW A;  2X6N A;  5FPN A;  4DTO A;  4UY8 O;  2Q1N A;  5AQT A;  1TAQ A;  3O4Q A;  4JAX A;  1SL0 A;  2CH5 A;  2VQF K;  4BGB A;  1MA9 B;  1KFD A;  3ZT3 A;  1YTA A;  1C0U A;  3V1R A;  3UKU A;  3ENO A;  1C1C A;  4E0D A;  4E7H A;  1B9F A;  1RFQ A;  1TK8 A;  1T3V A;  2E6L A;  1QQC A;  2X78 A;  4LFB K;  3K5O A;  3EY1 A;  1ZYQ A;  1EO1 A;  1BIS A;  3LAL A;  3MEG A;  5HLF A;  4CGF A;  3PX6 A;  2E1Y A;  3A5N C;  4HUF A;  2WUS A;  4DR5 K;  4DHY A;  4AQY K;  4QS8 A;  4JKC A;  1KD1 O;  5H1S Q;  3PUF A;  4FJM A;  4F8R A;  1NWK A;  4IO8 A;  3TTD A;  4AM7 A;  3MCA B;  1XHX A;  2O8D A;  1VQM N;  3FGU A;  4FW1 A;  1HR0 K;  3DXK A;  1N34 K;  2G8W A;  1GLC G;  5DM7 L;  1KVB A;  3SCX A;  3TAF A;  2QM1 A;  4FLZ A;  3U6F A;  5BN8 A;  3BGR A;  5K14 A;  4DTX A;  4CZK A;  5F0X A;  4GNI A;  2YHA A;  4CHY A;  2BGG A;  4OO1 J;  1SV5 A;  4F3O A;  2OPP A;  3ENH A;  2O8F A;  4E7J A;  4PHT X;  5LL6 Z;  5LJW A;  1FW6 A;  1SZ2 A;  5I3U A;  3BEX A;  3CCM N;  4GVE A;  4DTS A;  3QEP A;  1W7A A;  3T1H K;  4DF4 A;  2E88 A;  3WXI A;  4CD1 A;  1TKT A;  3V9U A;  2E8A A;  3CM6 A;  4RW9 A;  1HKB A;  4CZE A;  4M3Z A;  1LWC A;  4JLH A;  1Y97 A;  4IDK A;  2Y1I A;  4IFE A;  3JAM O;  1JLA A;  4CGI A;  5KTQ A;  3LWM A;  4BY9 C;  4B1Z A;  3CJ7 A;  1JJ2 M;  1R59 O;  2YJE A;  3I33 A;  3FZL A;  4YOX A;  1L5U A;  3ZSO A;  2VYP A;  2O8B B;  3O3G A;  1SKS A;  4FJG A;  2FSK A;  3MX5 A;  4CJE A;  1NGF A;  1WAF A;  1NMD A;  3LM2 A;  2UUA K;  4MLH A;  3AVF A;  4C23 A;  1U47 A;  3RMD A;  3HRG A;  4BRF A;  3CJC A;  3MED A;  4CJR A;  3EZ5 A;  4F9O A;  2XY7 A;  1YHQ N;  3H3N O;  4CZL A;  4B9S A;  1EP4 A;  4BQL A;  3AA5 X;  4XH5 A;  5KGX A;  2YX6 A;  4DTR A;  3O6W A;  3MN5 A;  5BRF A;  1NKC A;  3CPE A;  4PUO A;  2O4I A;  5C25 A;  2HHQ A;  5M1K A;  1NGB A;  3VQ6 A;  1BWF O;  5EY4 A;  4HUG A;  1EWQ A;  3N4P A;  2O8B A;  3VA3 A;  3QET A;  1UOC A;  1Q18 A;  1SQK A;  3M8Q A;  4JI2 K;  1T8E A;  4CJQ A;  3NDK A;  3QO9 A;  5JVH L; 
#chains in the Genus database with same CATH homology
 2EHG A;  4DMN A;  4E1M A;  1DTT A;  3ASM A;  3PO5 A;  3KD5 E;  3VQ9 A;  3OYF A;  4DQQ A;  1XI1 A;  4MFB A;  1WN7 A;  4H4M A;  3ZSV A;  4C8N A;  1VSK A;  1DTQ A;  4FJJ A;  2IGI A;  1CLQ A;  3V81 A;  1CZB A;  3VQE A;  1QSL A;  4KI4 A;  2DTU A;  2F8T A;  4B9L A;  4LD0 A;  2QKB A;  2A1S A;  4CJK A;  4CF1 A;  3OYJ A;  3V9W A;  1RCH A;  1YVU A;  4EP4 A;  1LAV A;  3OJS A;  2VWJ A;  1BL3 A;  2IDO A;  3LPT A;  1TKX A;  1VSD A;  1WSH A;  3NAE A;  1NOZ A;  1YTU A;  4DTM A;  4BE0 A;  3LWL A;  2B5J A;  3OS1 A;  3O4N A;  4ICL A;  4FXD A;  4ELV A;  4DSF A;  2QKK A;  2DFF A;  1VRT A;  1NK4 A;  3MXM A;  5HRN A;  1ZBL A;  3AVA A;  1N5Y A;  4LH5 A;  4B9V A;  4CGH A;  4CJW A;  1IKV A;  1JLB A;  1X9M A;  4NCA A;  1QSY A;  2Z1I A;  4OKK A;  1C0T A;  3TAQ A;  3VQB A;  4RW8 A;  4AHV A;  3AO4 A;  3OYC A;  1VRU A;  3SQ4 A;  1JLQ A;  1C1A A;  3ITH A;  2GUI A;  1T05 A;  3AO3 A;  4FJN A;  3LZI A;  3DOL A;  4E7I A;  1Z25 A;  3ZT0 A;  2AJQ A;  4CFC A;  1RT2 A;  3B6P A;  4W5N A;  2FBX A;  2YNH A;  3HYF A;  1C0M A;  4JRP A;  4ZTF A;  1XWL A;  5KRS A;  2YKN A;  1ASV A;  4W5T A;  4NCG A;  4BE1 A;  3TWH A;  4IFV A;  4M3W A;  4NYF A;  5CZ2 A;  1VK0 A;  3OYK A;  4OVL A;  4DSL A;  1J9A A;  1TV6 A;  4KHU A;  4FM2 A;  1LV5 A;  1QSS A;  4FM0 A;  2FBV A;  1LWE A;  4AIL C;  1D9F A;  4B8A B;  3KKR A;  2NUB A;  4CJU A;  1LAW A;  3SI6 A;  4CF9 A;  2PYJ A;  4M3U A;  1O1W A;  4H4O A;  3OYE A;  4KHW A;  4EP5 A;  4OKE A;  2GV9 A;  4DTJ A;  3C95 A;  4W5Q A;  3KJV A;  1SUQ A;  4J2E A;  1VSF A;  2B4J A;  5CZ1 A;  4DS4 A;  3U3Y A;  2O4G A;  3K5M A;  2D0C A;  4CF8 A;  2G8V A;  3WNH A;  1RBR A;  3LP1 A;  4FVM A;  3LDS A;  4LY7 A;  4DSJ A;  4ZHR A;  3S3N A;  3QER A;  3G10 A;  3SUN A;  3RMC A;  1FKP A;  3QNO A;  1S5J A;  3VQ4 A;  4N56 A;  3LAN A;  4FJI A;  4FW2 A;  5C24 A;  1BIU A;  1NK9 A;  3DRP A;  3I0R A;  1NK7 A;  3RMB A;  1BIZ A;  2HHT A;  2D0B A;  2YNI A;  2GBZ A;  1NOY A;  1RTI A;  4QOZ B;  3RRH A;  4KB0 A;  3LP0 A;  4UQG A;  4BDZ A;  4KHN A;  4Z4I A;  4BAC A;  1GOC A;  3C94 A;  4DFP A;  4DQP A;  5HP1 A;  3T3F A;  2WOM A;  2F8S A;  4CJT A;  4CEB A;  4AHT A;  2IS3 A;  5FRO A;  4DU3 A;  4FYD A;  3WNG A;  3OYA A;  1TKZ A;  4E7K A;  3QNN A;  3QIO A;  3ZT2 A;  1X1P A;  4M3R A;  5KRT A;  1WSJ A;  1UWB A;  3B6O A;  3SQ2 A;  4KTQ A;  3IS9 A;  3KLI A;  4KPY A;  1RIL A;  5HRS A;  5E41 A;  4N5S A;  3THV A;  5FRM A;  4Z4E A;  4Y1D A;  2XY5 A;  2HNZ A;  1JXB A;  4PQU A;  4KTW A;  1KLN A;  3VN5 A;  4LSL A;  2FBT A;  4IBN A;  1T7P A;  2VWK A;  3HST B;  5I42 A;  3HPO A;  3AVI A;  2RPI A;  3CYM A;  3MAQ A;  4IG0 A;  2WON A;  3HPG A;  4I2P A;  4O0I A;  1TK0 A;  1ITG A;  1XC9 A;  3AO2 A;  1WAJ A;  1BHL A;  1TVR A;  3L3V A;  3F9K A;  1U48 A;  4Q0B A;  3AVB A;  4N47 A;  4KHS A;  1RBT A;  4OGE A;  1WLJ A;  4DF8 A;  3OYH A;  1QE1 A;  3AVJ A;  4FCY A;  1RDA A;  4I9L A;  2ITG A;  4IG3 A;  3V1O A;  4FJH A;  3U3G A;  4M3T A;  1XHZ A;  4Z4G A;  2HNY A;  1RNH A;  4W5R A;  4DTN A;  3OYM A;  1GOB A;  1KVA A;  4O55 A;  4F2R A;  3UIQ A;  1NJW A;  3QIP A;  1NJX A;  3RRG A;  3AO5 A;  4QCL A;  5JS1 A;  5DMR A;  3P1G A;  2ETJ A;  2VG5 A;  4E3S A;  4O5B A;  3OYN A;  3M8P A;  3HJF A;  1KFS A;  1ZBU A;  2KQ2 A;  3KK3 A;  1F21 A;  2BE2 A;  4OJR A;  5HRR A;  1IKX A;  1S1U A;  1S1T A;  2RF2 A;  3VQ7 A;  3VQP A;  4CJP A;  1J53 A;  1FXX A;  3DLR A;  4DQR A;  3DOK A;  4CHQ A;  2KZM A;  4I9Q A;  1RDD A;  2I5J A;  3BDP A;  2LSN A;  4CEC A;  4ID1 A;  4Z4C A;  5FRN A;  3L2R A;  1I3A A;  4AHU A;  2JLE A;  4W5O A;  1S9G A;  3L2Q A;  1WSF A;  3LPU A;  3KLF A;  3NE6 A;  2HVI A;  3ZSR A;  1U49 A;  3SUO A;  2IOC A;  4RW4 A;  3K59 A;  4IKF A;  3OS2 A;  4CJ3 A;  4KB1 A;  3S9H A;  5JS2 A;  2PYL A;  1VSH A;  4M41 A;  3RTV A;  4BDP A;  4ELU A;  1D8Y A;  3SQ1 A;  4OKJ A;  2HW3 A;  1JLF A;  4Q5V A;  1L3V A;  2Q3S A;  1GOA A;  5CYM A;  2D0A A;  1JL1 A;  2A1R A;  4C8K A;  3D0P A;  4FLT A;  2OPQ A;  3AVK A;  1BI4 A;  4K8X A;  3NF8 A;  1HRH A;  3S3M A;  3KD1 E;  4GMJ B;  3MEC A;  2FC0 A;  4DLG A;  4CHZ A;  4KV8 A;  4CEQ A;  4KRF A;  3CG7 A;  3DM2 A;  1LWF A;  3KK1 A;  2YKM A;  4C8O A;  4R5P A;  2VG7 A;  4CES A;  2G8U A;  1WSE A;  3SUQ A;  2IC3 A;  1S1V A;  1FKO A;  2D5R A;  2OZM A;  3NH0 A;  2ZD1 A;  2KTQ A;  4I2Q A;  3HXM A;  1CZ9 A;  3JYT A;  4XIU A;  1HNI A;  1ZBH A;  1ASU A;  2E6M A;  1A5W A;  3DLB A;  4DQI A;  3AV9 A;  3I0S A;  1RBS A;  4GVM A;  1J54 A;  4RW6 A;  2P5O A;  3L2W A;  1LW2 A;  1MU2 A;  5SWM A;  1VSI A;  4FLX A;  4Z4F A;  3WNF A;  4KTZ A;  2RKI A;  3HVR A;  1I39 A;  4F2S A;  2KFN A;  3CFO A;  4OPK A;  3HO1 A;  3AVG A;  3AA2 A;  2OPS A;  3TAR A;  1U04 A;  3AVC A;  3SPZ A;  5DK5 A;  4ZTJ A;  4HCB A;  1IG9 A;  3OYL A;  1HJR A;  3P5J A;  4CHO A;  4O44 A;  4KO0 A;  3T19 A;  4DSI A;  3S3O A;  2HHX A;  3TAN A;  3H08 A;  4CJV A;  2DFE A;  3TAB A;  4HVJ A;  4M42 A;  2W42 A;  1RTD A;  1NK6 A;  2P51 A;  4DG1 A;  3M8S A;  2YHB A;  3V1Q A;  4Z4H A;  3CFR A;  3K57 A;  4CGJ A;  4FZX C;  5SZT A;  2HHW A;  2XO7 A;  4LH4 A;  3ULD A;  3IRX A;  1R0A A;  4LSN A;  3CFP A;  1WNS A;  3SQ0 A;  4AH9 A;  1G15 A;  4OLB A;  2F96 A;  3OYB A;  4FZY A;  2YV0 X;  3LZJ A;  1FK9 A;  1JL2 A;  2HHS A;  1VSL A;  3C6U A;  5HRP A;  1JLC A;  3DYA A;  3OY9 A;  3KLH A;  3DLE A;  3I8D A;  2PZS A;  5T7B A;  4DFJ A;  4J2D A;  5CY4 A;  1C1B A;  2HB5 A;  4CCH A;  4FZZ A;  4MQ3 A;  1ZBF A;  3VQ5 A;  5FDL A;  1WSI A;  3KLE A;  4PY5 A;  4AHC A;  3EYZ A;  4FJL A;  2ZE2 A;  4I7F A;  3RWU A;  1RT1 A;  1REV A;  2ZQB A;  3QIN A;  4E7L A;  1LW0 A;  3RMA A;  1A5V A;  4CEO A;  3AVL A;  3SNN A;  4KAZ A;  4BWJ A;  4CE9 A;  4BE2 A;  4HTU A;  1HQU A;  3DMJ A;  4CHN A;  2FBY A;  4RG8 A;  1HYS A;  1KTQ A;  3V6D A;  4CK1 A;  4FJ5 A;  3RR8 A;  3MXI A;  3PV8 A;  4NYN A;  3V4I A;  4EZ6 A;  4N76 A;  4NCB A;  1RTJ A;  4HUE A;  4B9U A;  4FK2 A;  3K5N A;  3V9Z A;  2G8H A;  1HYZ A;  4KHQ A;  3HVT A;  3ZSQ A;  1QHT A;  3OYI A;  2QK9 A;  4CEZ A;  2KFZ A;  1NKB A;  3HPH A;  1TKD A;  4DFK A;  5J2Q A;  4CED A;  5KI6 A;  4B9T A;  4F4K A;  2OA8 A;  2PY5 A;  3ZSW A;  1Z26 A;  1DLO A;  5J1E A;  3VQQ A;  1UAX A;  1A5X A;  2KW4 A;  3OJU A;  4FLU A;  2HMI A;  4H8K A;  3NH1 A;  2OZS A;  3AO1 A;  4J2A A;  4CF0 A;  4K8Z A;  2P1J A;  3IAY A;  3DI6 A;  2HHV A;  1TL3 A;  2Z1G A;  3L2U A;  1L3U A;  4HHT A;  3TAP A;  4DU4 A;  4CEA A;  5HBM A;  1RT4 A;  3DRS A;  4FLV A;  2DFH A;  2G8I A;  4E89 A;  1VSM A;  4C8M A;  4JS4 A;  3SPY A;  3RR7 A;  3MXJ A;  3PX0 A;  1QTM A;  1ASW A;  1B92 A;  4DU1 A;  2X6N A;  4FJX A;  3QEW A;  1RTH A;  4DTO A;  4DFM A;  1TAQ A;  4B8C A;  3O4Q A;  1UA0 A;  3VA0 A;  1SL0 A;  3HT3 A;  4CIF A;  2JGU A;  1RT3 A;  2RN2 A;  3VQ8 A;  4FLY A;  4DTP A;  3TAG A;  1RT5 A;  3NGY A;  4O0J A;  4BDY A;  4L8R B;  3KIO A;  3OS0 A;  3K5L A;  3NGZ A;  1VSJ A;  4FJ7 A;  1KFD A;  2XHB A;  3PY8 A;  1RDB A;  4CJ4 A;  3ZT3 A;  1YTA A;  1QS4 A;  4DWI A;  3PO4 A;  4CGG A;  4Z0U A;  3T1A A;  1C0U A;  1BCO A;  3V1R A;  3L2V A;  1Q9Y A;  3OVN A;  3HK2 A;  2HND A;  4E19 A;  1EKE A;  4B3O A;  5J2N A;  3ZT4 A;  1C1C A;  3VQA A;  1TK5 A;  4E7H A;  1TGO A;  1EX4 A;  1B9F A;  1TK8 A;  4E0D A;  1X9S A;  4QAG A;  2E6L A;  4FJ8 A;  1QQC A;  3ZSY A;  2X78 A;  1NJY A;  2XRI A;  3SZ2 A;  3K5O A;  3EY1 A;  4WE1 A;  4DLE A;  1ZYQ A;  4M3X A;  3NCI A;  1BIS A;  3SYZ A;  3LAL A;  3MEG A;  1T03 A;  1SL2 A;  3NH2 A;  3A2F A;  3SV4 A;  4CGF A;  5HLF A;  4F3T A;  1TAU A;  4OGC A;  3PX6 A;  1NJZ A;  1CXU A;  3TR8 A;  4FJK A;  2HHU A;  4HUF A;  3LAM A;  3SUP A;  1K6Y A;  1B9D A;  4DTU A;  1CXQ A;  2XY6 A;  1UA1 A;  2Y1J A;  3K2P A;  4FK0 A;  3ZSZ A;  3ISN C;  1JXE A;  3PUF A;  4F8R A;  4FJM A;  4PWD A;  2XY8 A;  2R7Y A;  4KHY A;  1XHX A;  4CFB A;  4CK3 A;  4DS5 A;  3QEI A;  1RT7 A;  4FW1 A;  4Y1C A;  2G8W A;  4C8L A;  1KVB A;  3SCX A;  3VQD A;  1KCF A;  2X6S A;  3TAF A;  1RDC A;  3TI0 A;  1SKR A;  1ZBI A;  3CQ8 A;  3D45 A;  1HMV A;  1BQM A;  1HPZ A;  1Q8I A;  4CER A;  4FLZ A;  3U6F A;  1BCM A;  1N6Q A;  3KK2 A;  3ALY A;  3BGR A;  5K14 A;  4DTX A;  3KLG A;  3C6T A;  3L8B A;  4CHY A;  2YHA A;  4FM1 A;  2BGG A;  3HL8 A;  1SV5 A;  1SKW A;  4F3O A;  4KRE A;  3P83 D;  1EXQ A;  2OPP A;  1L3T A;  1BI4 B;  2YNF A;  2X74 A;  1RBV A;  3NF9 A;  4CJS A;  4E7J A;  4CEE A;  5C42 A;  4BWM A;  4JS5 A;  3O3F A;  4DQS A;  2ATQ A;  4O4G A;  3JSM A;  3ZCM A;  4M3Y A;  2Z1H A;  2B6A A;  5I3U A;  1KSP A;  1RBU A;  2VG6 A;  4B08 A;  4DTS A;  3O3H A;  2E4L A;  5EU7 A;  3QEP A;  1HYV A;  3QES A;  4J2B A;  4DF4 A;  5J2P A;  1S1W A;  2G8F A;  1HNV A;  1EET A;  3V9X A;  3AVN A;  3DLG A;  1HQE A;  1IO2 A;  4CJL A;  3HP6 A;  3M8R A;  4B9N A;  1TKT A;  3HP9 A;  4CF2 A;  3MEE A;  1S6P A;  3NHG A;  3V9U A;  2G8K A;  3LP3 A;  1KRP A;  3CM6 A;  1S1X A;  3NF7 A;  4RW9 A;  4CIE A;  3TAE A;  2DY4 A;  3DLH A;  4M3Z A;  1C6V A;  1LWC A;  4YFU A;  4JLH A;  1Y97 A;  4IDK A;  2Y1I A;  3LP2 A;  3LAK A;  4N41 A;  1JLA A;  4M45 A;  1W0H A;  4CGI A;  5KTQ A;  3LWM A;  1U45 A;  1JKH A;  2Z1J A;  4TSX A;  4CK2 A;  3OYG A;  3FFI A;  4KI6 A;  4EZ9 A;  3AA4 A;  1NK5 A;  1WSG A;  2YNG A;  4KFB A;  1NKE A;  2EX3 A;  4OPJ A;  1L5U A;  3ZSO A;  4CEF A;  4HCC A;  1D5A A;  4E1N A;  2IAJ A;  3O3G A;  3NGI A;  1SKS A;  4YNQ A;  4FJG A;  4B9M A;  3KKS A;  1NK0 A;  4FJ9 A;  3DLK A;  3G0Z A;  3L3U A;  4FLW A;  5HRO A;  4CJE A;  1WAF A;  4CIG A;  2HVH A;  2BDP A;  1KLM A;  5D3G A;  4DSE A;  1JLE A;  2P5G A;  3AVF A;  1U47 A;  3VQC A;  3RMD A;  3K58 A;  2QXF A;  1IH7 A;  1S9E A;  1BGX T;  3MED A;  3IG1 A;  4CJR A;  3EZ5 A;  4ID5 A;  4CGD A;  3NFA A;  2OYQ A;  4CJF A;  2XY7 A;  1D9D A;  4FK4 A;  4B9S A;  3TAM A;  4OLA A;  3V9S A;  1EP4 A;  3SV3 A;  2BAN A;  3HM9 A;  4AHS A;  3AA5 X;  4DSK A;  5KGX A;  1JLG A;  1SL1 A;  3AA3 A;  4DTR A;  3SJJ A;  5CYQ A;  1L3S A;  1TL1 A;  3F73 A;  3QLH A;  4GW6 A;  1IKY A;  1NKC A;  3QEX A;  2KZZ A;  4PUO A;  1BQN A;  4CHP A;  1Q9X A;  3KTQ A;  5KGW A;  4PA1 A;  5J2M A;  4ELT A;  2O4I A;  1IKW A;  3ZT1 A;  5C25 A;  2HHQ A;  3OYD A;  3ZSX A;  1X9W A;  3NF6 A;  3VQ6 A;  4HUG A;  3QEV A;  3DRR A;  4CFD A;  4RW7 A;  3E01 A;  3NBP A;  3AVH A;  4CJ5 A;  3CM5 A;  4CFA A;  3VA3 A;  3QET A;  1RT6 A;  1KVC A;  1UOC A;  3AVM A;  4JRQ A;  3WNE A;  3M8Q A;  1NK8 A;  1S6Q A;  4G1Q A;  2OPR A;  4KKO A;  1J5O A;  1W9H A;  1YT3 A;  4AHR A;  4CJQ A;  3NDK A;  3QO9 A;  1T8E A;  1VSE A;  1U4B A;  3PX4 A;  4IFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...