4CGIA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
154
structure length
150
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 53
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cgiA00
1IKWA 1KVAA 2FBVA 4I7FA 1LW2A 3AO2A 4E7HA 4DSFA 4M3XA 4E7LA 3EY1A 2IC3A 1I3AA 3VQ8A 4K8ZA 3QEPA 3HT3A 3IRXA 1HPZA 2HHUA 4LH5A 4PA1A 3L2VA 1C0TA 3LZJA 3IAYA 2PYJA 4Q5VA 4CJUA 1CZBA 1VSHA 1X1PA 2BANA 2HNZA 3AVHA 4DG1A 3T19A 1TGOA 2OYQA 3C6UA 3D0PA 4AH9A 2OA8A 1QS4A 5CZ1A 3E01A 2HHTA 2DFEA 1KLNA 4C8MA 4M42A 1Z25A 1NJZA 2O4GA 1X9SA 3LP0A 3EYZA 1LWCA 4DTUA 3AVMA 1DLOA 1BIUA 2B6AA 5CY4A 1W9HA 3QETA 4DMNA 3PX0A 4KV8A 4JS4A 4Z0UA 3VQAA 1T03A 4NCBA 4DWIA 3MXIA 4FK2A 2HHWA 4FZZA 5CZ2A 4AILC 1WSIA 1JXBA 4CK1A 4F2RA 5J2PA 1N6QA 3P1GA 4KTWA 1BL3A 5E41A 3SUQA 2HHXA 3CM6A 2XHBA 1WN7A 4UQGA 2D0AA 3L3VA 2YKMA 3NAEA 3KD1E 3V1RA 3SV3A 1B9DA 3AO3A 1BCOA 3M8QA 4FJ7A 2EHGA 3V6DA 3QEXA 3ISNC 1VRTA 5KRSA 1ASWA 3NH0A 4L8RB 3O3HA 4KTQA 3LPTA 1SUQA 3NF9A 4CIFA 1TAUA 4OKKA 3LANA 1XHXA 3AVGA 1JLGA 1J53A 3HPOA 4FCYA 4BDYA 4DTSA 3DMJA 2OZMA 5HP1A 1C6VA 1UAXA 2O4IA 4CEFA 2F8TA 4BWJA 1FKPA 3ZSQA 2RF2A 1FK9A 1S1VA 2HNDA 2BE2A 3IG1A 3LAMA 3AA3A 1WNSA 4CECA 3I0SA 3QNNA 4FVMA 1JKHA 1DTQA 1GOBA 3V9WA 1ZBUA 4FLZA 1TKDA 3HVTA 5HRRA 4KHNA 3NHGA 1S1UA 3SQ0A 4CHZA 1IKXA 3KK3A 5HRNA 3WNGA 3ZCMA 1SKSA 2IGIA 3OYHA 3RRGA 3T3FA 4KPYA 3CFOA 2OPRA 1EXQA 2YV0X 1UA1A 4NCGA 4NYNA 2OZSA 4KAZA 3FFIA 1X9MA 2QKBA 4FLWA 4YNQA 4CCHA 2X6NA 1C0MA 5KRTA 1JL2A 4CJ4A 3S3OA 2HHQA 1LV5A 4CHPA 4CJTA 4CF8A 3ZT4A 3MAQA 2A1RA 1D8YA 3HO1A 3ZSYA 3ZT3A 3RRHA 4KREA 3LWLA 4DSLA 2D5RA 3KK1A 2RKIA 3OYKA 3QEWA 4J2EA 2RN2A 3SUNA 4DFMA 2XY7A 3TANA 5HRSA 3VA0A 4HCBA 4KTZA 3T1AA 2WONA 2AJQA 1A5VA 4M3WA 1QE1A 1LWFA 2F96A 3TI0A 1RBUA 4QOZB 4DU4A 4DTRA 1XWLA 3C94A 4B9SA 2QKKA 1U48A 4N5SA 1NKEA 1YTUA 3JYTA 3OVNA 4CEEA 4W5QA 1IG9A 3QEIA 4E19A 1LW0A 3L2RA 1NK7A 4BDPA 3IS9A 3VQBA 1NKCA 1B9FA 4ICLA 1BCMA 1S6PA 2OPQA 3QO9A 1WAFA 4E0DA 1VSLA 2IOCA 4AHRA 3OYGA 1ITGA 1G15A 2P5GA 1LAWA 3K59A 1QSYA 3DRRA 4FLYA 3RMBA 4F8RA 1Q9YA 4JRQA 1KSPA 1J5OA 1XC9A 2XY8A 4M41A 3DRPA 1BI4B 3AVIA 1A5WA 1NK4A 4GMJB 2LSNA 4CJFA 3DLKA 2YNGA 1EKEA 3NF8A 2HHVA 3PUFA 3AVNA 4AHTA 1WAJA 1VSDA 3AA2A 3DI6A 3KKRA 1KLMA 4Y1CA 1QSSA 4DQPA 4EZ9A 2YNFA 4CE9A 1KVCA 4CJLA 4CJPA 4DSIA 1RTHA 2IAJA 3VQ4A 3TAEA 2YNHA 2XY6A 4ZHRA 4CF2A 3DLHA 2WOMA 4OLBA 4KO0A 4CEZA 1Q9XA 2G8KA 2HHSA 1JLBA 1TAQA 1WSGA 2HVHA 2VG5A 4EP4A 3G0ZA 3S9HA 1BGXT 1EETA 4BACA 1EX4A 4N76A 4O0JA 1S6QA 1TKXA 4CFCA 3QERA 2ZQBA 4CFDA 1TK8A 3A2FA 4M3ZA 5C25A 1KFDA 2KZZA 3K58A 4FZXC 3THVA 2G8HA 1GOCA 1TKTA 3RR7A 4W5OA 3NCIA 1HYVA 1Q8IA 1TL3A 1VSFA 4E1MA 4E7JA 4FJ8A 2ZD1A 1WLJA 4DQQA 1LAVA 1UOCA 2Y1IA 1HJRA 4QAGA 4GVMA 3LAKA 1C1BA 5J2QA 1L3TA 4KHQA 2KFNA 3TAQA 4CJVA 3SNNA 1GOAA 4I9QA 5KTQA 4FJHA 1J54A 4KHWA 4M3YA 1VK0A 1JLQA 4CGFA 2KTQA 1D9FA 4CHQA 4FJXA 4FXDA 3RMDA 4BWMA 4B9UA 4R5PA 4B08A 4DQIA 1NJYA 5FRMA 2BDPA 2Q3SA 4O44A 3ULDA 4QCLA 4E89A 1L3SA 3PO4A 1DTTA 4CJ3A 3OYLA 3PV8A 3AV9A 1U04A 3RTVA 5I42A 3OYDA 1T7PA 2PYLA 2NUBA 3HYFA 4FK0A 3ZSOA 4FJMA 1JLEA 3MXJA 1BIZA 1Z26A 4JS5A 4MFBA 3SYZA 1UWBA 2YHAA 1TKZA 4DTJA 1SV5A 3M8PA 4FJGA 2IDOA 3OJUA 1C1AA 4PQUA 4CEAA 2DTUA 4CEQA 1CLQA 4Z4CA 4DTNA 4F3TA 1RNHA 1U49A 1HYZA 4B8AB 4ZTFA 1RILA 1S1TA 4FJNA 3I8DA 4F2SA 1KTQA 1YT3A 4KHYA 1RT2A 2Z1GA 3S3NA 1FKOA 3QNOA 3V81A 4J2BA 1KCFA 2E6MA 5KGWA 3VQDA 3H08A 4C8NA 4CFBA 2XY5A 1QSLA 3MEGA 4CJ5A 4E1NA 1WSHA 1L5UA 4I2QA 4CJQA 1FXXA 3HP9A 3VQPA 4DF4A 5KI6A 1VSMA 1J9AA 1O1WA 3OS0A 4FLTA 3RMAA 1NJWA 4FJJA 3KIOA 3VQEA 4RG8A 4J2DA 2G8IA 1ASUA 2Z1JA 1S9GA 4CJEA 3L2QA 4CHNA 1JLFA 1RT4A 4ID1A 2GV9A 4RW6A 3ZT2A 4HVJA 2YNIA 1C0UA 1S1WA 2VWKA 1KVBA 3OYMA 3MXMA 1UA0A 1ZBHA 5SWMA 4CK3A 1VSEA 4IG0A 3ZSXA 3OY9A 3KJVA 1NOYA 5D3GA 4FLUA 2RPIA 3OYIA 3TWHA 4RW4A 3OS2A 2A1SA 4AHCA 1ZBIA 1ZBFA 3HVRA 3ASMA 2FBXA 3QINA 2HW3A 4IFVA 4DTXA 4I2PA 4BE0A 2KQ2A 3LPUA 3L2WA 1JLCA 4M3TA 4PY5A 3C6TA 3O3GA 3V9UA 1WSEA 3SQ4A 1TV6A 5CYMA 1K6YA 2HMIA 4JLHA 3QIPA 4RW9A 1VSKA 1ASVA 4CF9A 4FW2A 3VQ9A 1U4BA 4CIGA 3DOLA 4F3OA 4KB1A 4PUOA 2FBYA 4Y1DA 3DLGA 1HYSA 1HNIA 1YTAA 3PX6A 4DSKA 1SL0A 2DFHA 1ZBLA 1TK0A 3VQCA 3M8SA 4CGGA 3LALA 1W0HA 4FLXA 3VN5A 4KHSA 2YHBA 4KKOA 2X6SA 4OJRA 1JXEA 4GW6A 3AVAA 4XIUA 4E7IA 3TARA 2G8UA 1CZ9A 2HB5A 1BHLA 1RDAA 3ZSVA 3OS1A 1WSFA 3NH2A 4E7KA 5DK5A 3VQ5A 4FM2A 3DRSA 2I5JA 3V1OA 3LP1A 3RWUA 4NYFA 4DSJA 3KTQA 4J2AA 4KHUA 1RDCA 1B92A 3LZIA 1ZYQA 4FJ9A 2VG6A 3LP3A 4CJWA 3TAPA 2VG7A 3HL8A 2PZSA 2PY5A 1KFSA 2QXFA 2D0BA 1RCHA 4LSLA 1NK8A 1JL1A 3TAGA 1CXQA 4FYDA 4OVLA 2KW4A 5EU7A 1TL1A 1RBRA 2DFFA 5C24A 3ITHA 3OYAA 2R7YA 1RBSA 1RTIA 1KRPA 1NOZA 4Z4FA 3DLRA 1HMVA 4O5BA 1IKYA 4RW7A 3LP2A 4K8XA 4DF8A 3VA3A 4Z4GA 1LWEA 1NK6A 5J2NA 4CEOA 3PY8A 5JS1A 3B6PA 3WNHA 3S3MA 1U47A 3DLEA 4I9LA 4B9TA 3NGYA 2OPSA 4CJKA 3RMCA 4CF1A 1BI4A 2W42A 3L8BA 3NF7A 4ELUA 3QEVA 1RT6A 3QIOA 3WNEA 3VQ7A 4KRFA 4B8CA 4DQSA 3PO5A 5FRNA 3MEEA 4CJSA 3OJSA 4E3SA 4CF0A 4H8KA 4ELVA 2KZMA 2P51A 1BQMA 1RBTA 3KLIA 1RT7A 4OPKA 2VWJA 4DU3A 2FBTA 4BE2A 5J1EA 2X78A 4O55A 4B9VA 3KLFA 3HJFA 3HSTB 4Z4HA 1SKRA 3U3GA 3NE6A 3ZSRA 2Z1IA 2XRIA 3MECA 1SL2A 1I39A 3TAMA 2HNYA 2Y1JA 1EP4A 3AA5X 3ZT1A 4O0IA 3SPZA 4HCCA 1TVRA 3CFRA 4O4GA 5HLFA 4CK2A 4OPJA 4C8KA 1WSJA 4EZ6A 3HK2A 3B6OA 3OYNA 3ZSZA 3SPYA 3VQQA 3AA4A 2X74A 4CGIA 4H4MA 3DLBA 4ZTJA 1BISA 2IS3A 4OGEA 4H4OA 3DYAA 1RT5A 3SV4A 4HUGA 3K2PA 3P83D 1RT1A 3OYBA 2FC0A 3SI6A 4C8LA 1HQEA 4N47A 5HRPA 4W5NA 2JLEA 3NBPA 4FM1A 1HQUA 4F4KA 1XHZA 1L3VA 1QTMA 3QLHA 4OKEA 1T05A 4W5TA 3KD5E 5JS2A 1F21A 1IO2A 1S5JA 4TSXA 3SUPA 3BGRA 1S1XA 1T8EA 3L2UA 3EZ5A 2HVIA 3P5JA 1IH7A 1NK9A 1VRUA 3V9ZA 2P1JA 2ZE2A 3CM5A 3CQ8A 2EX3A 3NFAA 3MEDA 3NGIA 4FJKA 1NJXA 1RTDA 3OYFA 4CHYA 4CGJA 3F9KA 3OYCA 4FJ5A 4ELTA 1U45A 5KGXA 4KI6A 1RT3A 3V9SA 3UIQA 3F73A 4AHUA 3OYJA 3AVKA 2KFZA 1RDBA 1VSJA 4Z4EA 3ALYA 4MQ3A 3TABA 3WNFA 4DLGA 4LH4A 1QQCA 1MU2A 2ETJA 4JRPA 1R0AA 4FJIA 1RBVA 4B9NA 4FK4A 2ITGA 1N5YA 2F8SA 4HHTA 4CJRA 1HNVA 3O4QA 1NK0A 3AVLA 2G8FA 4YFUA 3HPHA 4B9MA 4BE1A 3KLHA 3NF6A 3VQ6A 3SUOA 1XI1A 2G8VA 1IKVA 2P5OA 4N41A 3G10A 5CYQA 3KLGA 4CHOA 4LY7A 4IG3A 3TAFA 5HBMA 2G8WA 4DU1A 3QESA 4DTPA 3JSMA 3AO5A 5I3UA 4OLAA 2Z1HA 4B3OA 1D5AA 3K5NA 4AHVA 5DMRA 2JGUA 4KB0A 4Q0BA 4FLVA 4WE1A 2QK9A 4W5RA 4CEBA 5FDLA 4CEDA 3DM2A 2B4JA 2XO7A 4ID5A 4HUFA 3NDKA 4DTMA 1SKWA 4FJLA 4OKJA 2ATQA 3AVBA 2DY4A 4LD0A 4HUEA 3K5LA 3AVJA 3I0RA 2YKNA 3AO1A 1SL1A 4C8OA 1RDDA 4DTOA 3HPGA 4IFYA 4KI4A 1NK5A 3C95A 4G1QA 4AHSA 4RW8A 3RR8A 3LDSA 4M45A 3ZSWA 1X9WA 2E4LA 4FM0A 3CG7A 4LSNA 3HP6A 1C1CA 3ZT0A 5SZTA 2B5JA 3M8RA 3K57A 3U3YA 3AO4A 3KK2A 3HXMA 4BDZA 1REVA 3V9XA 4DQRA 4CESA 1S9EA 3NGZA 1CXUA 3O4NA 4DFJA 3SQ1A 3LWMA 2GUIA 5FROA 3OYEA 4CGDA 4M3UA 3K5OA 1Y97A 3SZ2A 3TR8A 3CFPA 3U6FA 4Z4IA 3SJJA 1QHTA 4KFBA 1RTJA 4OGCA 5T7BA 4IDKA 3BDPA 4N56A 1YVUA 3KLEA 2BGGA 4FW1A 4CFAA 1A5XA 3SCXA 1L3UA 4IKFA 1JLAA 4PWDA 3O3FA 4DLEA 4IBNA 4FZYA 3PX4A 4DS4A 3KKSA 3D45A 4EP5A 4DSEA 4DFKA 3AVCA 1TK5A 1BQNA 4CIEA 3NH1A 1NKBA 4B9LA 1VSIA 4M3RA 4DFPA 2GBZA 3V4IA 2E6LA 3SQ2A 5K14A 4NCAA 2OPPA 3CYMA 4CERA 5J2MA 1HRHA 3AVFA 3K5MA 5HROA 1D9DA 4HTUA 5C42A 4DS5A 2D0CA 3HM9A 3V1QA 4CGHA 3L3UA 3DOKA
chains in the Genus database with same CATH superfamily
1KVAA 4JKGB 4BQZA 3HM8A 4I7FA 3MX5A 3AO2A 4PL8A 4YDUA 3VQ8A 1Q7YO 3G4SN 3QEPA 3PSIA 4PA1A 2YI1A 2QWPA 4CJUA 1X1PA 2HNZA 2BANA 4DG1A 3T19A 4JI0K 3N4QA 1BDGA 1QS4A 4C8MA 1D4XA 4EIAA 4RWTA 2F9TA 1DLOA 3A8YA 3VETA 5CY4A 1W9HA 3CJAA 3VOVA 3PX0A 4BROA 3PSFA 1VQON 5C12A 3W3DA 2W40A 1OH8A 4B3RK 4FK2A 3DLLL 2HBLA 3JS6A 1WSIA 4Z94A 4AILC 4CK1A 1KQSM 4F2RA 4YOTA 1K8KA 1N6QA 2QWMA 3P1GA 4KTWA 2NLXA 3L3VA 3NAEA 5AZJA 4CI6A 5KRSA 1ASWA 5KQDA 4L8RB 1W2BM 1IBMK 4IXCA 1J53A 1JLGA 1BA1A 3DMJA 5GIPA 1OH7A 2O4IA 4CEFA 1Z05A 2F8TA 3ZSQA 2RF2A 2BE2A 4EHUA 4DUYK 3I0SA 2ITMA 3QNNA 3CCLN 1DTQA 4BRCA 1S1UA 4DV6K 1SKSA 3ZCMA 4B3MK 1XNQK 3OYHA 3CCVN 1VQMN 3B8AX 2OPRA 3A5NC 2OZSA 4KAZA 4FOIA 4FLWA 2X6NA 1C0MA 1JL2A 3P4IA 2HHQA 1ZXOA 4DSLA 2RKIA 3EEQA 3TANA 2XY7A 4HCBA 4M3WA 2F96A 3T1HK 3LL3A 3C94A 4B9SA 2QKKA 1NKEA 1YTUA 3BP8A 3JYTA 1IG9A 3JXUA 4BDPA 3IS9A 2JWLA 1BCMA 4U67L 1VSLA 3TTDA 4AHRA 4PKHA 1LAWA 2OTLN 4JKBA 4H03B 1NU0A 4FPAA 4IO9L 5M1QA 3VF2A 2CGKA 1J5OA 1XC9A 4M41A 3CHWA 3HZ6A 1A5WA 5IWAK 4HWIA 5AQOA 1WAJA 3CJ9A 3DI6A 4EZ9A 3NMUA 4DSIA 4CZGA 3VQ4A 3LDQA 1XNRK 4DCHA 4OLBA 2P9NB 4KO0A 1Q9XA 2G8KA 5HL7L 2OTJN 3G0ZA 2NRXA 1BGXT 4BRFA 4K0KK 3SBGA 4A5AA 4N76A 1S6QA 1RDWX 4FL9A 1N36K 2IVOA 2ZQBA 3MCAB 2AP1A 4IWVA 3K58A 1HYVA 4E1MA 1VQPN 2Y1IA 4YOXA 5KPRA 3LAKA 5J2QA 3SNNA 1J54A 2KTQA 4CGFA 4IDHA 2NRWA 4GVEA 3E9OA 2VWBA 1NJYA 4EAHD 4DR7K 5KPZA 1XC3A 1L3SA 3PV8A 3OYLA 3AV9A 2E2NA 2PYLA 5AQVA 3OW2M 3ATVA 1JLEA 1Z26A 4NLCA 1IG8A 4MFBA 3SYZA 4WFNL 1SV5A 3M8PA 4FJGA 1C1AA 4CEAA 5BRFA 4DTNA 3O8MA 1U49A 1S1TA 4KHYA 3HOTA 3MK6A 4Y0WA 3AARA 5GAHP 3VQDA 1QSLA 4C8NA 3SAHA 2P9KA 1EWRA 4WCEL 1OKJA 5LJVA 3E9LA 3VQPA 2EWSA 1J9AA 4FLTA 4FJJA 4RG8A 4NO7A 4CJEA 4ID1A 1UA0A 5BN9A 5BR9A 4A62A 3ZSXA 1NOYA 4JD2A 3OYIA 4RW4A 3OS2A 1ZBFA 3O9SA 2HW3A 1IV0A 2E8AA 4BE0A 1JLCA 4JAXA 3O3GA 3V9UA 1WSEA 1TV6A 5LL6Z 3HTVA 3QIPA 1VSKA 1ASVA 4CF9A 5BPLA 4PL7A 4YY3K 3DOLA 3DLGA 2W6KA 5ADXH 2DFHA 1ZBLA 5LY3A 4FLXA 2X6SA 2G8UA 1CZ9A 1BHLA 3QBWA 3ZX3A 2WFBA 2I5JA 1N34K 3RWUA 2O8DB 4CW7B 3VTHA 3LZIA 1YXQA 3LP3A 2PY5A 3UKRA 4LSLA 5EU7A 1X3NA 3ITHA 3T7ZA 1RTIA 4Z4FA 3DLRA 3Q7BA 2UU9K 3LP2A 4K8XA 4Z4GA 5J2NA 3DLEA 4B9TA 2P9PA 4CJKA 1BI4A 2W42A 4ELUA 4B9QA 4KRFA 3PO5A 4DQSA 4H5WA 4B1YB 3ID8A 4H8KA 4ELVA 2Q0UA 4ILGB 1BQMA 4FWOA 5CHIA 3WEEB 5J1EA 4BE2A 3ENBA 4B9VA 3HSTB 4Z4HA 1SKRA 4FPBA 4JK9A 3U3GA 1YHQN 1Q82O 2Z1IA 3MECA 1YUWA 1SL2A 1I39A 1EP4A 3AA5X 5AQKA 4HCCA 4O0IA 3NVKA 4O4GA 4EZ6A 1WSJA 1GLEG 3SPYA 3SAGA 5AFUH 3KWIA 4JEPA 4OGEA 1BISA 4DR3K 1EO1A 3EKSA 5JS2A 2AA4A 3Q7CA 1W7AA 4UY8O 4X65K 4AF1A 1HNZK 2P1JA 3CQ8A 3O4WA 2FLOA 3D2FB 3MEDA 3NFAA 1NJIO 1RTDA 4FJKA 1HUXA 3F9KA 3ID6A 3OYCA 3CMAN 1RT3A 2ZM6K 4Z4EA 3T1YK 3TTCA 3J7ZO 1MU2A 1R0AA 4FJIA 2ITGA 2F8SA 4LF9K 3HPHA 1XI1A 1IKVA 4N41A 5F0XA 3BY5A 4LY7A 5HBMA 3K9KA 5I3UA 2PFUA 1QQOA 2QK9A 4W5RA 3PLAA 4KH5A 3DM2A 2P9IA 2HF4A 2XO7A 4FJLA 1TYQB 1GLFO 4LD0A 3UKRB 5M1KA 2HHHK 2ASOA 5M1PA 5JLHA 4DTOA 1NK5A 4EHTA 2HOEA 3TU5A 5C10A 2E4LA 4FM0A 3CG7A 4LSNA 3ZT0A 5SZTA 3M8RA 3HXMA 4JI8K 2Q36A 3V9XA 3O4NA 4JKGA 4BRDA 5BREA 5FROA 4PKGA 4M3UA 4M7YA 5M1FA 3THWB 3SZ2A 1QHTA 4KFBA 4BVOA 2WBNA 3TPQA 4JI5K 2BGGA 1JLAA 3GL1A 3O3FA 4LF4K 3VMFB 4DFKA 5C2FA 3AVCA 1TK5A 1BQNA 3NH1A 4M3RA 3MN9A 2GBZA 3V4IA 2O8CA 3P38A 3TSUA 2VQFK 3HM9A 3DOKA 1ZBUA 5GINA 4E7LA 1IBKK 4B1WB 1NGIA 2E2OA 1RFQA 4ISFA 3L2VA 3LZJA 2PYJA 3U9DA 3L4IA 1VSHA 3UB5A 1TGOA 4AH9A 5CZ1A 2NRZA 4BG9A 2HHTA 4M42A 2O4GA 4K42A 1X9SA 1LWCA 5LMUK 4DTUA 3AVMA 4M63C 1DKGD 2QW9A 4DMNA 2ZWHA 4WQ4A 3O9UA 4DWIA 3M1FA 3MXIA 3I55N 4FZZA 3M3ZA 2I7PA 4CZHA 4WQ5C 4JN4A 1WOQA 4BRQA 3KD1E 3MX2A 4DR2K 3KVGA 4KTQA 4CIFA 3NF9A 2KLAA 4YORA 3LANA 3AVGA 4L3QA 5HP1A 2QWNA 4BRHA 1UAXA 1Q81O 1FK9A 2HNDA 3IG1A 4FSVA 4CECA 4B3TK 4FVMA 1TKDA 4KHNA 3NHGA 2F9WA 3KK3A 1J5EK 3WNGA 3SMPA 4WQ4C 4IOCL 4A2AA 1BO5O 3T3FA 3CFOA 1EXQA 1UA1A 5AQIA 4ILHA 3FFIA 4YNQA 2GX9A 1LOTB 2O8CB 3WQTA 1NGFA 2A1RA 3HO1A 3ZSYA 3ZT3A 4J8FA 4DQ8A 2D5RA 4J2EA 3OYKA 1T6CA 4DFMA 5AZJB 4KTZA 5FPMA 1QE1A 2QWOA 4M7XA 1YVNA 3QEIA 4E19A 1LW0A 1NK7A 4A61A 3IDHA 4ICLA 1S6PA 2OPQA 4DV7K 1TYQA 1WAFA 2IOCA 3OYGA 3F5TA 3GE1A 2P5GA 3K59A 2E1ZA 3DRRA 3RMBA 3UE5A 3R8EA 3VEOA 5F1XA 3AVIA 2E5LK 3IFRA 1NK4A 2LSNA 4CBUA 1W97L 2YNGA 1EKEA 4IZ9A 4LFBK 2HHVA 3PUFA 3TSPA 4DQPA 4CE9A 4CJLA 4CJPA 4JI1K 4CF2A 3CCMN 1NLVA 3S41A 1HR0K 3CCJN 1WSGA 2HVHA 2VG5A 4EP4A 3F2KA 1EETA 1ZBSA 3FR0A 4BACA 4JV5K 1EX4A 4CFDA 1TK8A 3A2FA 2KZZA 3THXB 4FWNA 3THVA 2G8HA 1GOCA 1TKTA 3RR7A 3NCIA 1Q8IA 4E7JA 4IJNA 4BC5A 1BWFO 3QFPA 1HJRA 4A2BA 1C1BA 3MWPA 4BR4A 2KFNA 2E88A 4CJVA 2A41A 4I9QA 2QWQA 5KTQA 4YHHK 1JLQA 4CHQA 3CETA 4FJXA 3CMEN 4BR0A 2QWRA 2VCPA 2Q3SA 4QCLA 1YIJN 5EY4A 3PO4A 4RCHA 1DTTA 4BY9C 4CJ3A 1J6ZA 3SBTA 1U04A 2IVNA 2UXBK 4CD3A 4FK0A 4FJMA 3WQUA 3H1VX 3ZX2A 4JS5A 4O5FA 1UWBA 2YHAA 4PQUA 2IDOA 3DWLA 2E20A 4O8KA 2QWLA 3FFKB 3R9PA 4CEQA 3J80O 3I33A 4F3TA 4ZTFA 1Q18A 3WXJA 1RT2A 3WXMB 5LJWA 2V7YA 1KCFA 3EE8A 3H08A 4CFBA 3CCEN 4I2QA 3HP9A 2VQEK 1BA0A 3C65A 1NJWA 3AAPA 1N8RO 4J2DA 1QZ6A 3UKUB 1NWKA 2Z1JA 1S9GA 3NVMA 5AQLA 5LMNK 4CHNA 1JLFA 4RW6A 2E1YA 2GV9A 3ZT2A 4BC3A 1YJNN 4CK3A 4IG0A 1NNEA 5TKYA 2RPIA 1IJJA 1C0FA 2A1SA 3DJCA 1SS6A 3ASMA 3MN6A 3QB0A 2A6AA 2KQ2A 3L2WA 4M3TA 4PY5A 4BR7A 3FZMA 3C6TA 1MWMA 3SQ4A 4BRNA 3VENA 3VQ9A 1U4BA 2ZJQL 4FVUA 4Y1DA 1HNIA 4DSKA 3PX6A 1SL0A 3MWTA 4MDAA 3VQCA 3M8SA 3LALA 5M1NA 4OJRA 4XIUA 2H3GX 4NLBA 2HB5A 3CJCA 4OPHA 3NH2A 4NYFA 5AQRA 4J2AA 4KHUA 3P39A 1H1VA 4FWRA 4BRIA 2VG6A 3TAPA 2QXFA 2D0BA 3TAGA 1CXQA 4FYDA 3THYB 1TL1A 2DFFA 2R7YA 1RBSA 1KRPA 4B1UB 3VA3A 1LWEA 2NRTA 4CEOA 3PY8A 5JS1A 3CQXA 1U47A 2YCHA 3BF3A 4YOYA 1E4GT 3CQYA 3WNEA 3MEEA 1JJ2M 4E3SA 5FPNA 5CE3A 2KZMA 2P51A 3BZKA 3KLIA 1RT7A 3CJBA 5AQPA 4O55A 1KC8O 3KLFA 1KAZA 3WUHA 2XRIA 2HNYA 3ZT1A 1TVRA 3HK2A 3OYNA 3ZSZA 1EWQA 3VQQA 2F4VK 2WC9A 3DLBA 4H4MA 4FWPA 4ZTJA 3SV4A 3DYAA 1X9JA 4HUGA 3P83D 3J81O 4C8LA 1HQEA 4N47A 5C0YA 4W5NA 4CD1A 2UXDK 1V4SA 3CC4N 1T05A 2NRHA 1E4FT 2Q97A 4BRMA 3L2UA 1WBBA 3ATUA 3P5JA 1IH7A 1NK9A 4OX9K 4CVNE 2QM1A 2EX3A 3SAFA 2UYTA 2BTFA 4CHYA 4KI6A 4ELTA 2O8FB 3L0QA 3AVKA 1HJOA 2P9NA 3HI0A 3ZETA 1N33K 4B1VA 3CJ7A 4DV0K 3SLCA 2ETJA 3BEXA 4LF8K 1N5YA 1HNVA 3O4QA 1NK0A 4RTFD 4YFUA 4GV9A 3H3OB 3VQ6A 3SUOA 2G8VA 5JVHL 1SAZA 3QESA 4DTPA 1XMQK 3AO5A 2IVPA 3LDPA 2QTDA 4OLAA 3EO3A 1D5AA 5AQQA 2JGUA 4KB0A 4H0VB 1HKGA 4CEDA 3ZLJA 2B4JA 1SKWA 4HUFA 4OKJA 3H3NO 3QICA 3AVJA 3I0RA 2V7ZA 4C8OA 1RDDA 3KWGA 5AQMA 2O8EA 4KI4A 2D4WA 4G1QA 2Q31A 4RW8A 2GUPA 3LDSA 1HNWK 4M45A 5HOOA 4F9OA 2B5JA 4HTLA 4YOUA 4DQRA 2UUAK 1S9EA 1CXUA 5GAEP 4JI3K 1JCEA 3A5OC 2GTDA 5C2DA 4Z4IA 3SJJA 5F2RA 3VESA 1RTJA 3C6AA 5KPTA 3KLEA 3SCXA 1A5XA 3R1XA 4PWDA 4DLEA 1BOTO 4DS4A 3KKSA 3SQ2A 1EQYA 4CERA 5HROA 3EZWA 3AVFA 1D9DA 2CH6A 1NJZA 3IKMA 3L3UA 4H0YB 4MO5A 4E7HA 4M3XA 2HBMA 1K8KB 3HT3A 1NGGA 4BRAA 2HHUA 4LH5A 3IAYA 1GLLO 2A3ZA 4Q5VA 4DUZK 4XH5A 4BG8A 3AVHA 3C6UA 2OA8A 3E01A 3CCUN 2DFEA 1OVYA 3EYZA 1YI2N 3CF5L 2B6AA 4XH4A 4CBXA 5CR4A 4WFAL 4JS4A 5AR0A 4Z0UA 3VQAA 2D1KA 4KH4A 2P9KB 2ZF5O 5CZ2A 1JXBA 2NZTA 4CZIA 1BG3A 1BL3A 5E41A 2P9SA 4FWMA 2XHBA 1WN7A 4UQGA 2D0AA 1QZ5A 4JKCA 3V1RA 3SV3A 1BCOA 2EHGA 3V6DA 3ISNC 5GADP 3LPTA 1WBDA 3D2EB 4OKKA 4FCYA 4BDYA 4BVPA 4H0PA 4PHTX 4BWJA 1FKPA 1HLUA 1XUPO 3E1YA 3AA3A 1WNSA 1U2VA 3HVTA 5FPEA 2V52B 3KZBA 4CHZA 1IKXA 3HBTA 5HRNA 1ATSA 4KPYA 2YV0X 4NCGA 4NYNA 4BGBA 2QKBA 4CCHA 4JI6K 5KRTA 5JMVA 4CJ4A 5AQYA 3S3OA 1LV5A 5ADXA 3O6WA 4CJTA 4CF8A 4DR1K 3E66A 3ZT4A 3MAQA 2DPNA 5GIOA 2NNWA 2RN2A 3SUNA 5HRSA 5DM7L 3T1AA 2AJQA 1A5VA 1DT9A 1LWFA 1RBUA 3QDKA 4DU4A 4DTRA 4IJAA 1U6ZA 1XWLA 1U48A 4DV4K 2P9UB 3OVNA 3E9PA 1XQSC 4W5QA 2P9UA 1IBLK 3QO9A 1NGEA 3MCPA 2ZGZA 4MDBA 3D7EO 4E0DA 4GY2B 3EL2A 4JI4K 4E1JA 1NG9A 4FLYA 4F8RA 4JYAK 3VEYA 4CZKA 1KSPA 5AQUA 3AGKA 2XY8A 2O8BA 3DRPA 1BI4B 4BRKA 4GMJB 3DXKA 3CD6N 5BN8A 3KKRA 4Y1CA 1KLMA 1QSSA 1QQMA 3I8BA 3OBYA 1RTHA 2IAJA 2XY6A 4ZHRA 3DLHA 4NB4A 2GWJA 1CZAN 3S9HA 2VGMA 2OANA 4CFCA 4M3ZA 1SZ2A 5C25A 4EFHA 3W0LA 4FZXC 3C7NA 1HKCA 4W5OA 1VSFA 2VYPA 2W6LA 4FJ8A 1WLJA 4DQQA 1UOCA 4QAGA 4GVMA 4CZEA 4FJHA 1VK0A 3OHRA 3U4LA 1G99A 4BWMA 4B9UA 4R5PA 4B08A 4DQIA 5FRMA 3ULDA 4O44A 4H0XB 3CC7N 4E89A 2FSNA 3RTVA 3P31A 4JHDA 1T7PA 3SMSA 3HYFA 1S3XA 3ZSOA 3J7AP 4K25A 1BIZA 3VEVA 4CJ7A 4DTJA 3LDOA 3OJUA 2O8DA 4LF7K 1CLQA 5KQ8A 4B1ZA 3ULEA 4H5NA 1RNHA 4B8AB 3O1BA 4FJNA 2GEMA 1KTQA 4F2SA 3H46O 2Z1GA 1KXPA 1FKOA 5BPMA 4G9ZA 1OH5A 1T3VA 3BUZB 3ENHA 2UXCK 5AFUA 3MEGA 3C6HA 3FGUA 2A42A 4CJ5A 1L5UA 1M1KO 4JKFA 3O08A 5KI6A 1VSMA 1O1WA 3RMAA 3KIOA 3VQEA 4WYBA 1TUYA 2YHYA 4U7BA 2YNIA 1C0UA 3O80A 4FWSA 3THXA 3OY9A 5D3GA 4FLUA 3TWHA 1ZBIA 3HVRA 4CZFA 1NGDA 3QINA 4IFVA 3MN5A 3O9TA 4DTXA 3L6QA 4WFBL 3THWA 5CYMA 2HMIA 4JLHA 4FW2A 4F3OA 1NGAA 4PUOA 4BGAA 1O13A 1HYSA 4CBWA 2F7TA 2ZJRL 1TK0A 1E3MA 4KHSA 3K0SA 4GW6A 4E7IA 2PAVA 2P9PB 4E7KA 5AQNA 3VQ5A 4FM2A 2E2PA 3HRGA 3KTQA 5BRDA 4FWKA 1B92A 1ZYQA 4FJ9A 4KBOA 5E84A 4CJWA 4FOEA 2VG7A 2PZSA 4AM7A 1KFSA 5FPDA 1RCHA 1NK8A 1RBRA 4FWLA 5C24A 3VGKA 3OYAA 4YOVA 1NOZA 1Z6RA 2FF6A 4O5BA 4GNIA 5AQTA 4DV1K 5DM6L 1S72N 4DF8A 1NK6A 3B6PA 4QS8A 3OTOK 3NGYA 1K9MO 2ZGYA 4CF1A 3RMCA 3L8BA 3NF7A 2O8BB 4MLHA 3QEVA 1RT6A 3QIOA 4JI2K 3VQ7A 5EXWA 3OJSA 2HBKA 3WT0A 1RGIA 1RBTA 4OPKA 2FBTA 1T44A 1VQ5N 1VQ4N 1Q86O 1T6DA 4OO1J 3FZHA 4H5TA 3RSEB 3D2FA 3SPZA 5HLFA 1KAXA 4C8KA 1QVFM 4CK2A 3CIPA 3RSEA 1S22A 1U2VB 1GLCG 4BRPA 2X74A 4CGIA 1LCUA 3BF1A 2IS3A 1BUPA 1RT5A 3UKUA 1RT1A 3SI6A 3K9JA 4H0TB 2NRVA 4FM1A 2Q0RA 4JHDB 1MWKA 1L3VA 1QTMA 1NMDA 4OKEA 4W5TA 1F21A 4DR5K 4TSXA 3HSCA 1S1XA 3EZ5A 2HVIA 1VQ6N 1GLBG 4LC9B 3NGIA 1NJXA 2HBJA 3LM9A 3ULEB 5KGXA 2YJEA 1VQ9N 3V9SA 3F73A 4AHUA 5BR8K 2KFZA 1RDBA 2WUSA 3FZFA 3ALYA 1MDUB 1ZC6A 3DXMA 4MQ3A 3TABA 3VEZA 1QQCA 4JRPA 3LM2A 4FK4A 3PIPL 4HHTA 3O9QA 5C15A 2G8FA 4B9MA 4BE1A 3BZCA 3NF6A 4C1NI 4IG3A 3GDQA 4DU1A 2G8WA 1NMNA 4QS7A 4B3OA 3K5NA 4YOWA 4Q0BA 4FLVA 3NDKA 3AVBA 2DY4A 3OBWA 4PKIA 1ILYA 1SL1A 3F9MA 3L4QA 3HPGA 4IFYA 3C95A 3ENOA 3RR8A 4FO0A 3ZSWA 1X9WA 3HP6A 1C1CA 3U3YA 1R59O 2CGLA 4BR5A 1NGJA 2JWKA 4CESA 3NGZA 4MLEA 4DFJA 3SQ1A 5EX5A 3OYEA 4KHPK 2GELA 4CZMA 1WB9A 3TR8A 3U6FA 4ISGA 2D0PA 4IDKA 3BDPA 4N56A 1YVUA 4CFAA 4IKFA 3RVCA 3GBTA 2FSJA 2ASPA 5I9EB 2FXUA 4DKWA 4IBNA 1KD1O 3D45A 4DSEA 3MDQA 4CIEA 1NKBA 1VSIA 1TUUA 4XH1A 2E6LA 5K14A 2I7NA 3CYMA 5J2MA 3K5MA 4HTUA 4DS5A 2D0CA 3V1QA 4CGHA 4C23A 1IKWA 2FBVA 1LW2A 4DSFA 1ATNA 3EY1A 2IC3A 2KHOA 1I3AA 4K8ZA 1X3MA 3IRXA 1HPZA 2A5XA 1C0TA 1CZBA 5AQWA 2OYQA 3PIOL 3D0PA 3O1WA 1DEJA 2YX6A 1KLNA 5IT9O 1Z25A 4B3SK 3LP0A 4JKDA 3KK7A 3JAMO 1BIUA 3QETA 3ZETB 4KV8A 3CXCM 1T03A 4IOAL 4NCBA 4JNEA 2HF3A 1VHXA 1QQNA 2HHWA 1ATRA 5J2PA 2HHXA 3SUQA 3CM6A 2OCEA 1HX1A 2YKMA 2FSKA 4LF5K 1B9DA 3AO3A 3M8QA 2WTUA 4FJ7A 4K43A 1P90A 3QEXA 1VRTA 3O3HA 1SUQA 3J7YP 1TAUA 3EKUA 3FZLA 1XHXA 3HPOA 2OZMA 4DTSA 4R79A 1C6VA 3IUCA 3HOSA 3WXIA 3EN9A 1S1VA 1VQ8N 1NGBA 4LF6K 3LAMA 3CI5A 1WUAA 3V9WA 1JKHA 1GOBA 3T69A 4FLZA 5HRRA 1NGHA 3LDLA 1MA9B 1VQKN 3SQ0A 4GKKK 1RDUA 3RRGA 2IGIA 4LFCK 3CC2N 5AQGA 3H45C 1K73O 1X9MA 5A2QO 4CHPA 1FW6A 1D8YA 3O9RA 1VAZA 3RRHA 5ELZA 4KREA 3LWLA 3M6GA 3KK1A 3QEWA 4NXNK 1NM1A 3VA0A 2WONA 4QOZB 3TI0A 3U9ZA 4AQYK 4N5SA 3WXLA 4CEEA 3L2RA 1QHAA 3VQBA 1NKCA 1B9FA 2FF3B 1ITGA 1G15A 1QSYA 5AQFA 4JK8A 1Q9YA 4JRQA 4OPAA 1YITN 1HNXK 3TTFA 1JCGA 4CJFA 3TSQA 3DLKA 5MLCQ 3FLCO 3NF8A 2QI2A 3AVNA 3AA2A 1VSDA 4AHTA 3AAQA 3HJFA 1HKBA 1C0GA 1KAYA 2YNFA 1KVCA 3CCSN 5AQZA 1SQKA 5GAGP 3TAEA 1P8ZA 2HMPA 2YNHA 2CGJA 4K41A 1GLJO 1V4TA 2WOMA 2HHSA 4CEZA 1JLBA 1TAQA 2KKZA 3VGLA 3GG4A 4I6MB 1FJGK 3R6MA 3ZYYX 4O0JA 1TKXA 3CCRN 3QERA 1KFDA 2Q2RA 3A5LC 1I94K 4JD2B 1TL3A 4A5BA 4IEIA 2ZD1A 2YJFA 1LAVA 4IOXA 3FE1A 3ZEUA 4KHQA 1L3TA 3TAQA 4H5VA 1GOAA 2ZJPL 4M3YA 4KHWA 1D9FA 4BREA 4FXDA 3CERA 3RMDA 2P9SB 3A5MC 2BDPA 2Q1NA 4BR2A 2ASMA 3THYA 5I42A 1M90O 3OYDA 1JCFA 2NUBA 3QMLA 1VQ7N 5AQXA 3MXJA 1YJ9N 4BQLA 1TKZA 3GOIA 2DTUA 4Z4CA 4H0OA 1YJWN 1VQLN 1HYZA 1RILA 3I8DA 3VPZA 1YT3A 5E26A 3S3NA 3J8AA 3QNOA 3V81A 4J2BA 2E6MA 2UUCK 5KGWA 2XY5A 3VTIA 4JKAA 4E1NA 1WSHA 4CJQA 1FXXA 4IO8A 3ZEUB 4DF4A 3OS0A 4GKJK 2G8IA 4WQ5A 5AQSA 1ASUA 5B8HA 3L2QA 5AQJA 1RT4A 4HVJA 5H1SQ 1S1WA 2VWKA 1KVBA 3OYMA 3MXMA 1ZBHA 5SWMA 1VSEA 3KJVA 1VQNN 4AHCA 2VGNA 2FBXA 2CH5A 3O5BA 4I2PA 3LDNA 3LPUA 3QFUA 1K6YA 1DGKN 4RW9A 4BRGA 3D6RA 2P9LA 4KB1A 4CIGA 4BRLA 2FBYA 1YTAA 2RHKA 4H5RA 2A40A 4X66K 4CGGA 5JVGL 2YHXA 1W0HA 3VN5A 2YHBA 4KKOA 1JXEA 3AVAA 3TARA 3ZSVA 1RDAA 4A57A 3OS1A 1WSFA 1BU6O 5DK5A 2QA4N 3DRSA 3MN7A 3VF4A 3V1OA 3LP1A 3VEWA 4DSJA 3R3LA 1RDCA 3QBXA 1YF5L 3FZKA 2GWKA 3HL8A 3D2EA 5TKWA 5AQHA 3KHYA 1JL1A 4OVLA 2KW4A 1NGCA 3A0IX 2P9IB 4BR9A 3EE9A 2QXLA 3CPEA 5JLFA 1K8AO 1N32K 1HMVA 4JI7K 4WF9L 1IKYA 4RW7A 3H6EA 4ISEA 1OH6A 5FLXO 4FWQA 3WNHA 3S3MA 3VF6A 4I9LA 2OPSA 3M5RA 2J4RA 1Y64A 4B8CA 3ZX0A 5FRNA 4A59A 4CJSA 4CF0A 3G25A 4MO4A 4DU3A 2NRRA 2VWJA 2X78A 5BRHA 5EVZA 3VEXA 3NE6A 4C1NK 3ZSRA 3TAMA 2Y1JA 3IMXA 3CFRA 5JICA 4OPJA 3B6OA 1OVQA 3AA4A 4JKHA 3I56N 2W41A 4H4OA 1XMOK 3K2PA 3OYBA 2O8EB 2FC0A 2PBDA 5HRPA 2JLEA 3NBPA 1HQUA 5EOYA 4F4KA 1XHZA 3C0BA 3QLHA 3CPWM 4GV6A 3KD5E 1IO2A 1S5JA 3SUPA 3BGRA 1T8EA 4ILJA 4DV2K 1VRUA 3V9ZA 4XEIA 2ZE2A 3CM5A 3VGMA 4QS9A 4CZLA 3OYFA 4CGJA 4DV3K 4FJ5A 4DR6K 1U45A 1NBWA 3UIQA 3WEEA 3SJHA 3OYJA 1VSJA 3WNFA 4DLGA 5M1OA 4LH4A 3MMVA 2BH1A 2E2QA 1RBVA 4AM6A 4B9NA 4KH6A 1GLDG 2QEXN 4CJRA 1GLAG 3DXMB 3AVLA 4CZJA 4V19S 4BC2A 4B1XB 3KLHA 3C7NB 2P5OA 3G10A 5CYQA 3KLGA 4CHOA 2V51B 3TAFA 2D0OA 3N4PA 3JSMA 3WXKA 2Z1HA 4AHVA 5DMRA 4WE1A 3SK3A 3AY9A 4CEBA 5FDLA 4ID5A 4DV5K 4DTMA 2ATQA 4DR4K 4HUEA 4NXMK 5AZIA 3K5LA 2YKNA 3U8XA 3AO1A 4AHSA 1HPMA 3DXKB 4X64K 3OA9A 3CCQN 3DAWA 3K57A 5AJ3K 3AO4A 4JKEA 1YAGA 4LFAK 3KK2A 4I6MA 5AZIB 4BDZA 1REVA 3AGRA 3CJ1A 2RE2A 3G71N 4YDUC 3LWMA 2GUIA 5BPNA 3VERA 4CGDA 2UUBK 3K5OA 2BUPA 1Y97A 2HSTA 2O8FA 2P9LB 3CFPA 2IIRA 4OGCA 5T7BA 4DHYA 2YHWA 4FW1A 1QVGM 1L3UA 4O8UA 4JK7A 4IFEA 4FZYA 3PX4A 4EP5A 4B9LA 4X62K 4DFPA 4NCAA 2OPPA 4GV3A 1HRHA 4DB3A 4BC4A 3G6EN 5C42A 3H1QA 3NH0A 4IEEA 1ESVA
chains in the Genus database with same CATH topology
1IKWA 1KVAA 2FBVA 4I7FA 1LW2A 3AO2A 4E7HA 4DSFA 4M3XA 4E7LA 3EY1A 2IC3A 1I3AA 3VQ8A 4K8ZA 3QEPA 3HT3A 3IRXA 1HPZA 2HHUA 4LH5A 4PA1A 3L2VA 1C0TA 3LZJA 3IAYA 2PYJA 4Q5VA 4CJUA 1CZBA 1VSHA 1X1PA 2BANA 2HNZA 3AVHA 4DG1A 3T19A 1TGOA 2OYQA 3C6UA 3D0PA 4AH9A 2OA8A 1QS4A 5CZ1A 3E01A 2HHTA 2DFEA 1KLNA 4C8MA 4M42A 1Z25A 1NJZA 2O4GA 1X9SA 3LP0A 3EYZA 1LWCA 4DTUA 3AVMA 1DLOA 1BIUA 2B6AA 5CY4A 1W9HA 3QETA 4DMNA 3PX0A 4KV8A 4JS4A 4Z0UA 3VQAA 1T03A 4NCBA 4DWIA 3MXIA 4FK2A 2HHWA 4FZZA 5CZ2A 4AILC 1WSIA 1JXBA 4CK1A 4F2RA 5J2PA 1N6QA 3P1GA 4KTWA 1BL3A 5E41A 3SUQA 2HHXA 3CM6A 2XHBA 1WN7A 4UQGA 2D0AA 3L3VA 2YKMA 3NAEA 3KD1E 3V1RA 3SV3A 1B9DA 3AO3A 1BCOA 3M8QA 4FJ7A 2EHGA 3V6DA 3QEXA 3ISNC 1VRTA 5KRSA 1ASWA 3NH0A 4L8RB 3O3HA 4KTQA 3LPTA 1SUQA 3NF9A 4CIFA 1TAUA 4OKKA 3LANA 1XHXA 3AVGA 1JLGA 1J53A 3HPOA 4FCYA 4BDYA 4DTSA 3DMJA 2OZMA 5HP1A 1C6VA 1UAXA 2O4IA 4CEFA 2F8TA 4BWJA 1FKPA 3ZSQA 2RF2A 1FK9A 1S1VA 2HNDA 2BE2A 3IG1A 3LAMA 3AA3A 1WNSA 4CECA 3I0SA 3QNNA 4FVMA 1JKHA 1DTQA 1GOBA 3V9WA 1ZBUA 4FLZA 1TKDA 3HVTA 5HRRA 4KHNA 3NHGA 1S1UA 3SQ0A 4CHZA 1IKXA 3KK3A 5HRNA 3WNGA 3ZCMA 1SKSA 2IGIA 3OYHA 3RRGA 3T3FA 4KPYA 3CFOA 2OPRA 1EXQA 2YV0X 1UA1A 4NCGA 4NYNA 2OZSA 4KAZA 3FFIA 1X9MA 2QKBA 4FLWA 4YNQA 4CCHA 2X6NA 1C0MA 5KRTA 1JL2A 4CJ4A 3S3OA 2HHQA 1LV5A 4CHPA 4CJTA 4CF8A 3ZT4A 3MAQA 2A1RA 1D8YA 3HO1A 3ZSYA 3ZT3A 3RRHA 4KREA 3LWLA 4DSLA 2D5RA 3KK1A 2RKIA 3OYKA 3QEWA 4J2EA 2RN2A 3SUNA 4DFMA 2XY7A 3TANA 5HRSA 3VA0A 4HCBA 4KTZA 3T1AA 2WONA 2AJQA 1A5VA 4M3WA 1QE1A 1LWFA 2F96A 3TI0A 1RBUA 4QOZB 4DU4A 4DTRA 1XWLA 3C94A 4B9SA 2QKKA 1U48A 4N5SA 1NKEA 1YTUA 3JYTA 3OVNA 4CEEA 4W5QA 1IG9A 3QEIA 4E19A 1LW0A 3L2RA 1NK7A 4BDPA 3IS9A 3VQBA 1NKCA 1B9FA 4ICLA 1BCMA 1S6PA 2OPQA 3QO9A 1WAFA 4E0DA 1VSLA 2IOCA 4AHRA 3OYGA 1ITGA 1G15A 2P5GA 1LAWA 3K59A 1QSYA 3DRRA 4FLYA 3RMBA 4F8RA 1Q9YA 4JRQA 1KSPA 1J5OA 1XC9A 2XY8A 4M41A 3DRPA 1BI4B 3AVIA 1A5WA 1NK4A 4GMJB 2LSNA 4CJFA 3DLKA 2YNGA 1EKEA 3NF8A 2HHVA 3PUFA 3AVNA 4AHTA 1WAJA 1VSDA 3AA2A 3DI6A 3KKRA 1KLMA 4Y1CA 1QSSA 4DQPA 4EZ9A 2YNFA 4CE9A 1KVCA 4CJLA 4CJPA 4DSIA 1RTHA 2IAJA 3VQ4A 3TAEA 2YNHA 2XY6A 4ZHRA 4CF2A 3DLHA 2WOMA 4OLBA 4KO0A 4CEZA 1Q9XA 2G8KA 2HHSA 1JLBA 1TAQA 1WSGA 2HVHA 2VG5A 4EP4A 3G0ZA 3S9HA 1BGXT 1EETA 4BACA 1EX4A 4N76A 4O0JA 1S6QA 1TKXA 4CFCA 3QERA 2ZQBA 4CFDA 1TK8A 3A2FA 4M3ZA 5C25A 1KFDA 2KZZA 3K58A 4FZXC 3THVA 2G8HA 1GOCA 1TKTA 3RR7A 4W5OA 3NCIA 1HYVA 1Q8IA 1TL3A 1VSFA 4E1MA 4E7JA 4FJ8A 2ZD1A 1WLJA 4DQQA 1LAVA 1UOCA 2Y1IA 1HJRA 4QAGA 4GVMA 3LAKA 1C1BA 5J2QA 1L3TA 4KHQA 2KFNA 3TAQA 4CJVA 3SNNA 1GOAA 4I9QA 5KTQA 4FJHA 1J54A 4KHWA 4M3YA 1VK0A 1JLQA 4CGFA 2KTQA 1D9FA 4CHQA 4FJXA 4FXDA 3RMDA 4BWMA 4B9UA 4R5PA 4B08A 4DQIA 1NJYA 5FRMA 2BDPA 2Q3SA 4O44A 3ULDA 4QCLA 4E89A 1L3SA 3PO4A 1DTTA 4CJ3A 3OYLA 3PV8A 3AV9A 1U04A 3RTVA 5I42A 3OYDA 1T7PA 2PYLA 2NUBA 3HYFA 4FK0A 3ZSOA 4FJMA 1JLEA 3MXJA 1BIZA 1Z26A 4JS5A 4MFBA 3SYZA 1UWBA 2YHAA 1TKZA 4DTJA 1SV5A 3M8PA 4FJGA 2IDOA 3OJUA 1C1AA 4PQUA 4CEAA 2DTUA 4CEQA 1CLQA 4Z4CA 4DTNA 4F3TA 1RNHA 1U49A 1HYZA 4B8AB 4ZTFA 1RILA 1S1TA 4FJNA 3I8DA 4F2SA 1KTQA 1YT3A 4KHYA 1RT2A 2Z1GA 3S3NA 1FKOA 3QNOA 3V81A 4J2BA 1KCFA 2E6MA 5KGWA 3VQDA 3H08A 4C8NA 4CFBA 2XY5A 1QSLA 3MEGA 4CJ5A 4E1NA 1WSHA 1L5UA 4I2QA 4CJQA 1FXXA 3HP9A 3VQPA 4DF4A 5KI6A 1VSMA 1J9AA 1O1WA 3OS0A 4FLTA 3RMAA 1NJWA 4FJJA 3KIOA 3VQEA 4RG8A 4J2DA 2G8IA 1ASUA 2Z1JA 1S9GA 4CJEA 3L2QA 4CHNA 1JLFA 1RT4A 4ID1A 2GV9A 4RW6A 3ZT2A 4HVJA 2YNIA 1C0UA 1S1WA 2VWKA 1KVBA 3OYMA 3MXMA 1UA0A 1ZBHA 5SWMA 4CK3A 1VSEA 4IG0A 3ZSXA 3OY9A 3KJVA 1NOYA 5D3GA 4FLUA 2RPIA 3OYIA 3TWHA 4RW4A 3OS2A 2A1SA 4AHCA 1ZBIA 1ZBFA 3HVRA 3ASMA 2FBXA 3QINA 2HW3A 4IFVA 4DTXA 4I2PA 4BE0A 2KQ2A 3LPUA 3L2WA 1JLCA 4M3TA 4PY5A 3C6TA 3O3GA 3V9UA 1WSEA 3SQ4A 1TV6A 5CYMA 1K6YA 2HMIA 4JLHA 3QIPA 4RW9A 1VSKA 1ASVA 4CF9A 4FW2A 3VQ9A 1U4BA 4CIGA 3DOLA 4F3OA 4KB1A 4PUOA 2FBYA 4Y1DA 3DLGA 1HYSA 1HNIA 1YTAA 3PX6A 4DSKA 1SL0A 2DFHA 1ZBLA 1TK0A 3VQCA 3M8SA 4CGGA 3LALA 1W0HA 4FLXA 3VN5A 4KHSA 2YHBA 4KKOA 2X6SA 4OJRA 1JXEA 4GW6A 3AVAA 4XIUA 4E7IA 3TARA 2G8UA 1CZ9A 2HB5A 1BHLA 1RDAA 3ZSVA 3OS1A 1WSFA 3NH2A 4E7KA 5DK5A 3VQ5A 4FM2A 3DRSA 2I5JA 3V1OA 3LP1A 3RWUA 4NYFA 4DSJA 3KTQA 4J2AA 4KHUA 1RDCA 1B92A 3LZIA 1ZYQA 4FJ9A 2VG6A 3LP3A 4CJWA 3TAPA 2VG7A 3HL8A 2PZSA 2PY5A 1KFSA 2QXFA 2D0BA 1RCHA 4LSLA 1NK8A 1JL1A 3TAGA 1CXQA 4FYDA 4OVLA 2KW4A 5EU7A 1TL1A 1RBRA 2DFFA 5C24A 3ITHA 3OYAA 2R7YA 1RBSA 1RTIA 1KRPA 1NOZA 4Z4FA 3DLRA 1HMVA 4O5BA 1IKYA 4RW7A 3LP2A 4K8XA 4DF8A 3VA3A 4Z4GA 1LWEA 1NK6A 5J2NA 4CEOA 3PY8A 5JS1A 3B6PA 3WNHA 3S3MA 1U47A 3DLEA 4I9LA 4B9TA 3NGYA 2OPSA 4CJKA 3RMCA 4CF1A 1BI4A 2W42A 3L8BA 3NF7A 4ELUA 3QEVA 1RT6A 3QIOA 3WNEA 3VQ7A 4KRFA 4B8CA 4DQSA 3PO5A 5FRNA 3MEEA 4CJSA 3OJSA 4E3SA 4CF0A 4H8KA 4ELVA 2KZMA 2P51A 1BQMA 1RBTA 3KLIA 1RT7A 4OPKA 2VWJA 4DU3A 2FBTA 4BE2A 5J1EA 2X78A 4O55A 4B9VA 3KLFA 3HJFA 3HSTB 4Z4HA 1SKRA 3U3GA 3NE6A 3ZSRA 2Z1IA 2XRIA 3MECA 1SL2A 1I39A 3TAMA 2HNYA 2Y1JA 1EP4A 3AA5X 3ZT1A 4O0IA 3SPZA 4HCCA 1TVRA 3CFRA 4O4GA 5HLFA 4CK2A 4OPJA 4C8KA 1WSJA 4EZ6A 3HK2A 3B6OA 3OYNA 3ZSZA 3SPYA 3VQQA 3AA4A 2X74A 4CGIA 4H4MA 3DLBA 4ZTJA 1BISA 2IS3A 4OGEA 4H4OA 3DYAA 1RT5A 3SV4A 4HUGA 3K2PA 3P83D 1RT1A 3OYBA 2FC0A 3SI6A 4C8LA 1HQEA 4N47A 5HRPA 4W5NA 2JLEA 3NBPA 4FM1A 1HQUA 4F4KA 1XHZA 1L3VA 1QTMA 3QLHA 4OKEA 1T05A 4W5TA 3KD5E 5JS2A 1F21A 1IO2A 1S5JA 4TSXA 3SUPA 3BGRA 1S1XA 1T8EA 3L2UA 3EZ5A 2HVIA 3P5JA 1IH7A 1NK9A 1VRUA 3V9ZA 2P1JA 2ZE2A 3CM5A 3CQ8A 2EX3A 3NFAA 3MEDA 3NGIA 4FJKA 1NJXA 1RTDA 3OYFA 4CHYA 4CGJA 3F9KA 3OYCA 4FJ5A 4ELTA 1U45A 5KGXA 4KI6A 1RT3A 3V9SA 3UIQA 3F73A 4AHUA 3OYJA 3AVKA 2KFZA 1RDBA 1VSJA 4Z4EA 3ALYA 4MQ3A 3TABA 3WNFA 4DLGA 4LH4A 1QQCA 1MU2A 2ETJA 4JRPA 1R0AA 4FJIA 1RBVA 4B9NA 4FK4A 2ITGA 1N5YA 2F8SA 4HHTA 4CJRA 1HNVA 3O4QA 1NK0A 3AVLA 2G8FA 4YFUA 3HPHA 4B9MA 4BE1A 3KLHA 3NF6A 3VQ6A 3SUOA 1XI1A 2G8VA 1IKVA 2P5OA 4N41A 3G10A 5CYQA 3KLGA 4CHOA 4LY7A 4IG3A 3TAFA 5HBMA 2G8WA 4DU1A 3QESA 4DTPA 3JSMA 3AO5A 5I3UA 4OLAA 2Z1HA 4B3OA 1D5AA 3K5NA 4AHVA 5DMRA 2JGUA 4KB0A 4Q0BA 4FLVA 4WE1A 2QK9A 4W5RA 4CEBA 5FDLA 4CEDA 3DM2A 2B4JA 2XO7A 4ID5A 4HUFA 3NDKA 4DTMA 1SKWA 4FJLA 4OKJA 2ATQA 3AVBA 2DY4A 4LD0A 4HUEA 3K5LA 3AVJA 3I0RA 2YKNA 3AO1A 1SL1A 4C8OA 1RDDA 4DTOA 3HPGA 4IFYA 4KI4A 1NK5A 3C95A 4G1QA 4AHSA 4RW8A 3RR8A 3LDSA 4M45A 3ZSWA 1X9WA 2E4LA 4FM0A 3CG7A 4LSNA 3HP6A 1C1CA 3ZT0A 5SZTA 2B5JA 3M8RA 3K57A 3U3YA 3AO4A 3KK2A 3HXMA 4BDZA 1REVA 3V9XA 4DQRA 4CESA 1S9EA 3NGZA 1CXUA 3O4NA 4DFJA 3SQ1A 3LWMA 2GUIA 5FROA 3OYEA 4CGDA 4M3UA 3K5OA 1Y97A 3SZ2A 3TR8A 3CFPA 3U6FA 4Z4IA 3SJJA 1QHTA 4KFBA 1RTJA 4OGCA 5T7BA 4IDKA 3BDPA 4N56A 1YVUA 3KLEA 2BGGA 4FW1A 4CFAA 1A5XA 3SCXA 1L3UA 4IKFA 1JLAA 4PWDA 3O3FA 4DLEA 4IBNA 4FZYA 3PX4A 4DS4A 3KKSA 3D45A 4EP5A 4DSEA 4DFKA 3AVCA 1TK5A 1BQNA 4CIEA 3NH1A 1NKBA 4B9LA 1VSIA 4M3RA 4DFPA 2GBZA 3V4IA 2E6LA 3SQ2A 5K14A 4NCAA 2OPPA 3CYMA 4CERA 5J2MA 1HRHA 3AVFA 3K5MA 5HROA 1D9DA 4HTUA 5C42A 4DS5A 2D0CA 3HM9A 3V1QA 4CGHA 3L3UA 3DOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IKW A;  1KVA A;  2FBV A;  4I7F A;  1LW2 A;  3AO2 A;  4E7H A;  4DSF A;  4M3X A;  4E7L A;  3EY1 A;  2IC3 A;  1I3A A;  3VQ8 A;  4K8Z A;  3QEP A;  3HT3 A;  3IRX A;  1HPZ A;  2HHU A;  4LH5 A;  4PA1 A;  3L2V A;  1C0T A;  3LZJ A;  3IAY A;  2PYJ A;  4Q5V A;  4CJU A;  1CZB A;  1VSH A;  1X1P A;  2BAN A;  2HNZ A;  3AVH A;  4DG1 A;  3T19 A;  1TGO A;  2OYQ A;  3C6U A;  3D0P A;  4AH9 A;  2OA8 A;  1QS4 A;  5CZ1 A;  3E01 A;  2HHT A;  2DFE A;  1KLN A;  4C8M A;  4M42 A;  1Z25 A;  1NJZ A;  2O4G A;  1X9S A;  3LP0 A;  3EYZ A;  1LWC A;  4DTU A;  3AVM A;  1DLO A;  1BIU A;  2B6A A;  5CY4 A;  1W9H A;  3QET A;  4DMN A;  3PX0 A;  4KV8 A;  4JS4 A;  4Z0U A;  3VQA A;  1T03 A;  4NCB A;  4DWI A;  3MXI A;  4FK2 A;  2HHW A;  4FZZ A;  5CZ2 A;  4AIL C;  1WSI A;  1JXB A;  4CK1 A;  4F2R A;  5J2P A;  1N6Q A;  3P1G A;  4KTW A;  1BL3 A;  5E41 A;  3SUQ A;  2HHX A;  3CM6 A;  2XHB A;  1WN7 A;  4UQG A;  2D0A A;  3L3V A;  2YKM A;  3NAE A;  3KD1 E;  3V1R A;  3SV3 A;  1B9D A;  3AO3 A;  1BCO A;  3M8Q A;  4FJ7 A;  2EHG A;  3V6D A;  3QEX A;  3ISN C;  1VRT A;  5KRS A;  1ASW A;  3NH0 A;  4L8R B;  3O3H A;  4KTQ A;  3LPT A;  1SUQ A;  3NF9 A;  4CIF A;  1TAU A;  4OKK A;  3LAN A;  1XHX A;  3AVG A;  1JLG A;  1J53 A;  3HPO A;  4FCY A;  4BDY A;  4DTS A;  3DMJ A;  2OZM A;  5HP1 A;  1C6V A;  1UAX A;  2O4I A;  4CEF A;  2F8T A;  4BWJ A;  1FKP A;  3ZSQ A;  2RF2 A;  1FK9 A;  1S1V A;  2HND A;  2BE2 A;  3IG1 A;  3LAM A;  3AA3 A;  1WNS A;  4CEC A;  3I0S A;  3QNN A;  4FVM A;  1JKH A;  1DTQ A;  1GOB A;  3V9W A;  1ZBU A;  4FLZ A;  1TKD A;  3HVT A;  5HRR A;  4KHN A;  3NHG A;  1S1U A;  3SQ0 A;  4CHZ A;  1IKX A;  3KK3 A;  5HRN A;  3WNG A;  3ZCM A;  1SKS A;  2IGI A;  3OYH A;  3RRG A;  3T3F A;  4KPY A;  3CFO A;  2OPR A;  1EXQ A;  2YV0 X;  1UA1 A;  4NCG A;  4NYN A;  2OZS A;  4KAZ A;  3FFI A;  1X9M A;  2QKB A;  4FLW A;  4YNQ A;  4CCH A;  2X6N A;  1C0M A;  5KRT A;  1JL2 A;  4CJ4 A;  3S3O A;  2HHQ A;  1LV5 A;  4CHP A;  4CJT A;  4CF8 A;  3ZT4 A;  3MAQ A;  2A1R A;  1D8Y A;  3HO1 A;  3ZSY A;  3ZT3 A;  3RRH A;  4KRE A;  3LWL A;  4DSL A;  2D5R A;  3KK1 A;  2RKI A;  3OYK A;  3QEW A;  4J2E A;  2RN2 A;  3SUN A;  4DFM A;  2XY7 A;  3TAN A;  5HRS A;  3VA0 A;  4HCB A;  4KTZ A;  3T1A A;  2WON A;  2AJQ A;  1A5V A;  4M3W A;  1QE1 A;  1LWF A;  2F96 A;  3TI0 A;  1RBU A;  4QOZ B;  4DU4 A;  4DTR A;  1XWL A;  3C94 A;  4B9S A;  2QKK A;  1U48 A;  4N5S A;  1NKE A;  1YTU A;  3JYT A;  3OVN A;  4CEE A;  4W5Q A;  1IG9 A;  3QEI A;  4E19 A;  1LW0 A;  3L2R A;  1NK7 A;  4BDP A;  3IS9 A;  3VQB A;  1NKC A;  1B9F A;  4ICL A;  1BCM A;  1S6P A;  2OPQ A;  3QO9 A;  1WAF A;  4E0D A;  1VSL A;  2IOC A;  4AHR A;  3OYG A;  1ITG A;  1G15 A;  2P5G A;  1LAW A;  3K59 A;  1QSY A;  3DRR A;  4FLY A;  3RMB A;  4F8R A;  1Q9Y A;  4JRQ A;  1KSP A;  1J5O A;  1XC9 A;  2XY8 A;  4M41 A;  3DRP A;  1BI4 B;  3AVI A;  1A5W A;  1NK4 A;  4GMJ B;  2LSN A;  4CJF A;  3DLK A;  2YNG A;  1EKE A;  3NF8 A;  2HHV A;  3PUF A;  3AVN A;  4AHT A;  1WAJ A;  1VSD A;  3AA2 A;  3DI6 A;  3KKR A;  1KLM A;  4Y1C A;  1QSS A;  4DQP A;  4EZ9 A;  2YNF A;  4CE9 A;  1KVC A;  4CJL A;  4CJP A;  4DSI A;  1RTH A;  2IAJ A;  3VQ4 A;  3TAE A;  2YNH A;  2XY6 A;  4ZHR A;  4CF2 A;  3DLH A;  2WOM A;  4OLB A;  4KO0 A;  4CEZ A;  1Q9X A;  2G8K A;  2HHS A;  1JLB A;  1TAQ A;  1WSG A;  2HVH A;  2VG5 A;  4EP4 A;  3G0Z A;  3S9H A;  1BGX T;  1EET A;  4BAC A;  1EX4 A;  4N76 A;  4O0J A;  1S6Q A;  1TKX A;  4CFC A;  3QER A;  2ZQB A;  4CFD A;  1TK8 A;  3A2F A;  4M3Z A;  5C25 A;  1KFD A;  2KZZ A;  3K58 A;  4FZX C;  3THV A;  2G8H A;  1GOC A;  1TKT A;  3RR7 A;  4W5O A;  3NCI A;  1HYV A;  1Q8I A;  1TL3 A;  1VSF A;  4E1M A;  4E7J A;  4FJ8 A;  2ZD1 A;  1WLJ A;  4DQQ A;  1LAV A;  1UOC A;  2Y1I A;  1HJR A;  4QAG A;  4GVM A;  3LAK A;  1C1B A;  5J2Q A;  1L3T A;  4KHQ A;  2KFN A;  3TAQ A;  4CJV A;  3SNN A;  1GOA A;  4I9Q A;  5KTQ A;  4FJH A;  1J54 A;  4KHW A;  4M3Y A;  1VK0 A;  1JLQ A;  4CGF A;  2KTQ A;  1D9F A;  4CHQ A;  4FJX A;  4FXD A;  3RMD A;  4BWM A;  4B9U A;  4R5P A;  4B08 A;  4DQI A;  1NJY A;  5FRM A;  2BDP A;  2Q3S A;  4O44 A;  3ULD A;  4QCL A;  4E89 A;  1L3S A;  3PO4 A;  1DTT A;  4CJ3 A;  3OYL A;  3PV8 A;  3AV9 A;  1U04 A;  3RTV A;  5I42 A;  3OYD A;  1T7P A;  2PYL A;  2NUB A;  3HYF A;  4FK0 A;  3ZSO A;  4FJM A;  1JLE A;  3MXJ A;  1BIZ A;  1Z26 A;  4JS5 A;  4MFB A;  3SYZ A;  1UWB A;  2YHA A;  1TKZ A;  4DTJ A;  1SV5 A;  3M8P A;  4FJG A;  2IDO A;  3OJU A;  1C1A A;  4PQU A;  4CEA A;  2DTU A;  4CEQ A;  1CLQ A;  4Z4C A;  4DTN A;  4F3T A;  1RNH A;  1U49 A;  1HYZ A;  4B8A B;  4ZTF A;  1RIL A;  1S1T A;  4FJN A;  3I8D A;  4F2S A;  1KTQ A;  1YT3 A;  4KHY A;  1RT2 A;  2Z1G A;  3S3N A;  1FKO A;  3QNO A;  3V81 A;  4J2B A;  1KCF A;  2E6M A;  5KGW A;  3VQD A;  3H08 A;  4C8N A;  4CFB A;  2XY5 A;  1QSL A;  3MEG A;  4CJ5 A;  4E1N A;  1WSH A;  1L5U A;  4I2Q A;  4CJQ A;  1FXX A;  3HP9 A;  3VQP A;  4DF4 A;  5KI6 A;  1VSM A;  1J9A A;  1O1W A;  3OS0 A;  4FLT A;  3RMA A;  1NJW A;  4FJJ A;  3KIO A;  3VQE A;  4RG8 A;  4J2D A;  2G8I A;  1ASU A;  2Z1J A;  1S9G A;  4CJE A;  3L2Q A;  4CHN A;  1JLF A;  1RT4 A;  4ID1 A;  2GV9 A;  4RW6 A;  3ZT2 A;  4HVJ A;  2YNI A;  1C0U A;  1S1W A;  2VWK A;  1KVB A;  3OYM A;  3MXM A;  1UA0 A;  1ZBH A;  5SWM A;  4CK3 A;  1VSE A;  4IG0 A;  3ZSX A;  3OY9 A;  3KJV A;  1NOY A;  5D3G A;  4FLU A;  2RPI A;  3OYI A;  3TWH A;  4RW4 A;  3OS2 A;  2A1S A;  4AHC A;  1ZBI A;  1ZBF A;  3HVR A;  3ASM A;  2FBX A;  3QIN A;  2HW3 A;  4IFV A;  4DTX A;  4I2P A;  4BE0 A;  2KQ2 A;  3LPU A;  3L2W A;  1JLC A;  4M3T A;  4PY5 A;  3C6T A;  3O3G A;  3V9U A;  1WSE A;  3SQ4 A;  1TV6 A;  5CYM A;  1K6Y A;  2HMI A;  4JLH A;  3QIP A;  4RW9 A;  1VSK A;  1ASV A;  4CF9 A;  4FW2 A;  3VQ9 A;  1U4B A;  4CIG A;  3DOL A;  4F3O A;  4KB1 A;  4PUO A;  2FBY A;  4Y1D A;  3DLG A;  1HYS A;  1HNI A;  1YTA A;  3PX6 A;  4DSK A;  1SL0 A;  2DFH A;  1ZBL A;  1TK0 A;  3VQC A;  3M8S A;  4CGG A;  3LAL A;  1W0H A;  4FLX A;  3VN5 A;  4KHS A;  2YHB A;  4KKO A;  2X6S A;  4OJR A;  1JXE A;  4GW6 A;  3AVA A;  4XIU A;  4E7I A;  3TAR A;  2G8U A;  1CZ9 A;  2HB5 A;  1BHL A;  1RDA A;  3ZSV A;  3OS1 A;  1WSF A;  3NH2 A;  4E7K A;  5DK5 A;  3VQ5 A;  4FM2 A;  3DRS A;  2I5J A;  3V1O A;  3LP1 A;  3RWU A;  4NYF A;  4DSJ A;  3KTQ A;  4J2A A;  4KHU A;  1RDC A;  1B92 A;  3LZI A;  1ZYQ A;  4FJ9 A;  2VG6 A;  3LP3 A;  4CJW A;  3TAP A;  2VG7 A;  3HL8 A;  2PZS A;  2PY5 A;  1KFS A;  2QXF A;  2D0B A;  1RCH A;  4LSL A;  1NK8 A;  1JL1 A;  3TAG A;  1CXQ A;  4FYD A;  4OVL A;  2KW4 A;  5EU7 A;  1TL1 A;  1RBR A;  2DFF A;  5C24 A;  3ITH A;  3OYA A;  2R7Y A;  1RBS A;  1RTI A;  1KRP A;  1NOZ A;  4Z4F A;  3DLR A;  1HMV A;  4O5B A;  1IKY A;  4RW7 A;  3LP2 A;  4K8X A;  4DF8 A;  3VA3 A;  4Z4G A;  1LWE A;  1NK6 A;  5J2N A;  4CEO A;  3PY8 A;  5JS1 A;  3B6P A;  3WNH A;  3S3M A;  1U47 A;  3DLE A;  4I9L A;  4B9T A;  3NGY A;  2OPS A;  4CJK A;  3RMC A;  4CF1 A;  1BI4 A;  2W42 A;  3L8B A;  3NF7 A;  4ELU A;  3QEV A;  1RT6 A;  3QIO A;  3WNE A;  3VQ7 A;  4KRF A;  4B8C A;  4DQS A;  3PO5 A;  5FRN A;  3MEE A;  4CJS A;  3OJS A;  4E3S A;  4CF0 A;  4H8K A;  4ELV A;  2KZM A;  2P51 A;  1BQM A;  1RBT A;  3KLI A;  1RT7 A;  4OPK A;  2VWJ A;  4DU3 A;  2FBT A;  4BE2 A;  5J1E A;  2X78 A;  4O55 A;  4B9V A;  3KLF A;  3HJF A;  3HST B;  4Z4H A;  1SKR A;  3U3G A;  3NE6 A;  3ZSR A;  2Z1I A;  2XRI A;  3MEC A;  1SL2 A;  1I39 A;  3TAM A;  2HNY A;  2Y1J A;  1EP4 A;  3AA5 X;  3ZT1 A;  4O0I A;  3SPZ A;  4HCC A;  1TVR A;  3CFR A;  4O4G A;  5HLF A;  4CK2 A;  4OPJ A;  4C8K A;  1WSJ A;  4EZ6 A;  3HK2 A;  3B6O A;  3OYN A;  3ZSZ A;  3SPY A;  3VQQ A;  3AA4 A;  2X74 A;  4CGI A;  4H4M A;  3DLB A;  4ZTJ A;  1BIS A;  2IS3 A;  4OGE A;  4H4O A;  3DYA A;  1RT5 A;  3SV4 A;  4HUG A;  3K2P A;  3P83 D;  1RT1 A;  3OYB A;  2FC0 A;  3SI6 A;  4C8L A;  1HQE A;  4N47 A;  5HRP A;  4W5N A;  2JLE A;  3NBP A;  4FM1 A;  1HQU A;  4F4K A;  1XHZ A;  1L3V A;  1QTM A;  3QLH A;  4OKE A;  1T05 A;  4W5T A;  3KD5 E;  5JS2 A;  1F21 A;  1IO2 A;  1S5J A;  4TSX A;  3SUP A;  3BGR A;  1S1X A;  1T8E A;  3L2U A;  3EZ5 A;  2HVI A;  3P5J A;  1IH7 A;  1NK9 A;  1VRU A;  3V9Z A;  2P1J A;  2ZE2 A;  3CM5 A;  3CQ8 A;  2EX3 A;  3NFA A;  3MED A;  3NGI A;  4FJK A;  1NJX A;  1RTD A;  3OYF A;  4CHY A;  4CGJ A;  3F9K A;  3OYC A;  4FJ5 A;  4ELT A;  1U45 A;  5KGX A;  4KI6 A;  1RT3 A;  3V9S A;  3UIQ A;  3F73 A;  4AHU A;  3OYJ A;  3AVK A;  2KFZ A;  1RDB A;  1VSJ A;  4Z4E A;  3ALY A;  4MQ3 A;  3TAB A;  3WNF A;  4DLG A;  4LH4 A;  1QQC A;  1MU2 A;  2ETJ A;  4JRP A;  1R0A A;  4FJI A;  1RBV A;  4B9N A;  4FK4 A;  2ITG A;  1N5Y A;  2F8S A;  4HHT A;  4CJR A;  1HNV A;  3O4Q A;  1NK0 A;  3AVL A;  2G8F A;  4YFU A;  3HPH A;  4B9M A;  4BE1 A;  3KLH A;  3NF6 A;  3VQ6 A;  3SUO A;  1XI1 A;  2G8V A;  1IKV A;  2P5O A;  4N41 A;  3G10 A;  5CYQ A;  3KLG A;  4CHO A;  4LY7 A;  4IG3 A;  3TAF A;  5HBM A;  2G8W A;  4DU1 A;  3QES A;  4DTP A;  3JSM A;  3AO5 A;  5I3U A;  4OLA A;  2Z1H A;  4B3O A;  1D5A A;  3K5N A;  4AHV A;  5DMR A;  2JGU A;  4KB0 A;  4Q0B A;  4FLV A;  4WE1 A;  2QK9 A;  4W5R A;  4CEB A;  5FDL A;  4CED A;  3DM2 A;  2B4J A;  2XO7 A;  4ID5 A;  4HUF A;  3NDK A;  4DTM A;  1SKW A;  4FJL A;  4OKJ A;  2ATQ A;  3AVB A;  2DY4 A;  4LD0 A;  4HUE A;  3K5L A;  3AVJ A;  3I0R A;  2YKN A;  3AO1 A;  1SL1 A;  4C8O A;  1RDD A;  4DTO A;  3HPG A;  4IFY A;  4KI4 A;  1NK5 A;  3C95 A;  4G1Q A;  4AHS A;  4RW8 A;  3RR8 A;  3LDS A;  4M45 A;  3ZSW A;  1X9W A;  2E4L A;  4FM0 A;  3CG7 A;  4LSN A;  3HP6 A;  1C1C A;  3ZT0 A;  5SZT A;  2B5J A;  3M8R A;  3K57 A;  3U3Y A;  3AO4 A;  3KK2 A;  3HXM A;  4BDZ A;  1REV A;  3V9X A;  4DQR A;  4CES A;  1S9E A;  3NGZ A;  1CXU A;  3O4N A;  4DFJ A;  3SQ1 A;  3LWM A;  2GUI A;  5FRO A;  3OYE A;  4CGD A;  4M3U A;  3K5O A;  1Y97 A;  3SZ2 A;  3TR8 A;  3CFP A;  3U6F A;  4Z4I A;  3SJJ A;  1QHT A;  4KFB A;  1RTJ A;  4OGC A;  5T7B A;  4IDK A;  3BDP A;  4N56 A;  1YVU A;  3KLE A;  2BGG A;  4FW1 A;  4CFA A;  1A5X A;  3SCX A;  1L3U A;  4IKF A;  1JLA A;  4PWD A;  3O3F A;  4DLE A;  4IBN A;  4FZY A;  3PX4 A;  4DS4 A;  3KKS A;  3D45 A;  4EP5 A;  4DSE A;  4DFK A;  3AVC A;  1TK5 A;  1BQN A;  4CIE A;  3NH1 A;  1NKB A;  4B9L A;  1VSI A;  4M3R A;  4DFP A;  2GBZ A;  3V4I A;  2E6L A;  3SQ2 A;  5K14 A;  4NCA A;  2OPP A;  3CYM A;  4CER A;  5J2M A;  1HRH A;  3AVF A;  3K5M A;  5HRO A;  1D9D A;  4HTU A;  5C42 A;  4DS5 A;  2D0C A;  3HM9 A;  3V1Q A;  4CGH A;  3L3U A;  3DOK A; 
#chains in the Genus database with same CATH topology
 1KVA A;  4JKG B;  4BQZ A;  3HM8 A;  4I7F A;  3MX5 A;  3AO2 A;  4PL8 A;  4YDU A;  3VQ8 A;  1Q7Y O;  3G4S N;  3QEP A;  3PSI A;  4PA1 A;  2YI1 A;  2QWP A;  4CJU A;  1X1P A;  2HNZ A;  2BAN A;  4DG1 A;  3T19 A;  4JI0 K;  3N4Q A;  1BDG A;  1QS4 A;  4C8M A;  1D4X A;  4EIA A;  4RWT A;  2F9T A;  1DLO A;  3A8Y A;  3VET A;  5CY4 A;  1W9H A;  3CJA A;  3VOV A;  3PX0 A;  4BRO A;  3PSF A;  1VQO N;  5C12 A;  3W3D A;  2W40 A;  1OH8 A;  4B3R K;  4FK2 A;  3DLL L;  2HBL A;  3JS6 A;  1WSI A;  4Z94 A;  4AIL C;  4CK1 A;  1KQS M;  4F2R A;  4YOT A;  1K8K A;  1N6Q A;  2QWM A;  3P1G A;  4KTW A;  2NLX A;  3L3V A;  3NAE A;  5AZJ A;  4CI6 A;  5KRS A;  1ASW A;  5KQD A;  4L8R B;  1W2B M;  1IBM K;  4IXC A;  1J53 A;  1JLG A;  1BA1 A;  3DMJ A;  5GIP A;  1OH7 A;  2O4I A;  4CEF A;  1Z05 A;  2F8T A;  3ZSQ A;  2RF2 A;  2BE2 A;  4EHU A;  4DUY K;  3I0S A;  2ITM A;  3QNN A;  3CCL N;  1DTQ A;  4BRC A;  1S1U A;  4DV6 K;  1SKS A;  3ZCM A;  4B3M K;  1XNQ K;  3OYH A;  3CCV N;  1VQM N;  3B8A X;  2OPR A;  3A5N C;  2OZS A;  4KAZ A;  4FOI A;  4FLW A;  2X6N A;  1C0M A;  1JL2 A;  3P4I A;  2HHQ A;  1ZXO A;  4DSL A;  2RKI A;  3EEQ A;  3TAN A;  2XY7 A;  4HCB A;  4M3W A;  2F96 A;  3T1H K;  3LL3 A;  3C94 A;  4B9S A;  2QKK A;  1NKE A;  1YTU A;  3BP8 A;  3JYT A;  1IG9 A;  3JXU A;  4BDP A;  3IS9 A;  2JWL A;  1BCM A;  4U67 L;  1VSL A;  3TTD A;  4AHR A;  4PKH A;  1LAW A;  2OTL N;  4JKB A;  4H03 B;  1NU0 A;  4FPA A;  4IO9 L;  5M1Q A;  3VF2 A;  2CGK A;  1J5O A;  1XC9 A;  4M41 A;  3CHW A;  3HZ6 A;  1A5W A;  5IWA K;  4HWI A;  5AQO A;  1WAJ A;  3CJ9 A;  3DI6 A;  4EZ9 A;  3NMU A;  4DSI A;  4CZG A;  3VQ4 A;  3LDQ A;  1XNR K;  4DCH A;  4OLB A;  2P9N B;  4KO0 A;  1Q9X A;  2G8K A;  5HL7 L;  2OTJ N;  3G0Z A;  2NRX A;  1BGX T;  4BRF A;  4K0K K;  3SBG A;  4A5A A;  4N76 A;  1S6Q A;  1RDW X;  4FL9 A;  1N36 K;  2IVO A;  2ZQB A;  3MCA B;  2AP1 A;  4IWV A;  3K58 A;  1HYV A;  4E1M A;  1VQP N;  2Y1I A;  4YOX A;  5KPR A;  3LAK A;  5J2Q A;  3SNN A;  1J54 A;  2KTQ A;  4CGF A;  4IDH A;  2NRW A;  4GVE A;  3E9O A;  2VWB A;  1NJY A;  4EAH D;  4DR7 K;  5KPZ A;  1XC3 A;  1L3S A;  3PV8 A;  3OYL A;  3AV9 A;  2E2N A;  2PYL A;  5AQV A;  3OW2 M;  3ATV A;  1JLE A;  1Z26 A;  4NLC A;  1IG8 A;  4MFB A;  3SYZ A;  4WFN L;  1SV5 A;  3M8P A;  4FJG A;  1C1A A;  4CEA A;  5BRF A;  4DTN A;  3O8M A;  1U49 A;  1S1T A;  4KHY A;  3HOT A;  3MK6 A;  4Y0W A;  3AAR A;  5GAH P;  3VQD A;  1QSL A;  4C8N A;  3SAH A;  2P9K A;  1EWR A;  4WCE L;  1OKJ A;  5LJV A;  3E9L A;  3VQP A;  2EWS A;  1J9A A;  4FLT A;  4FJJ A;  4RG8 A;  4NO7 A;  4CJE A;  4ID1 A;  1UA0 A;  5BN9 A;  5BR9 A;  4A62 A;  3ZSX A;  1NOY A;  4JD2 A;  3OYI A;  4RW4 A;  3OS2 A;  1ZBF A;  3O9S A;  2HW3 A;  1IV0 A;  2E8A A;  4BE0 A;  1JLC A;  4JAX A;  3O3G A;  3V9U A;  1WSE A;  1TV6 A;  5LL6 Z;  3HTV A;  3QIP A;  1VSK A;  1ASV A;  4CF9 A;  5BPL A;  4PL7 A;  4YY3 K;  3DOL A;  3DLG A;  2W6K A;  5ADX H;  2DFH A;  1ZBL A;  5LY3 A;  4FLX A;  2X6S A;  2G8U A;  1CZ9 A;  1BHL A;  3QBW A;  3ZX3 A;  2WFB A;  2I5J A;  1N34 K;  3RWU A;  2O8D B;  4CW7 B;  3VTH A;  3LZI A;  1YXQ A;  3LP3 A;  2PY5 A;  3UKR A;  4LSL A;  5EU7 A;  1X3N A;  3ITH A;  3T7Z A;  1RTI A;  4Z4F A;  3DLR A;  3Q7B A;  2UU9 K;  3LP2 A;  4K8X A;  4Z4G A;  5J2N A;  3DLE A;  4B9T A;  2P9P A;  4CJK A;  1BI4 A;  2W42 A;  4ELU A;  4B9Q A;  4KRF A;  3PO5 A;  4DQS A;  4H5W A;  4B1Y B;  3ID8 A;  4H8K A;  4ELV A;  2Q0U A;  4ILG B;  1BQM A;  4FWO A;  5CHI A;  3WEE B;  5J1E A;  4BE2 A;  3ENB A;  4B9V A;  3HST B;  4Z4H A;  1SKR A;  4FPB A;  4JK9 A;  3U3G A;  1YHQ N;  1Q82 O;  2Z1I A;  3MEC A;  1YUW A;  1SL2 A;  1I39 A;  1EP4 A;  3AA5 X;  5AQK A;  4HCC A;  4O0I A;  3NVK A;  4O4G A;  4EZ6 A;  1WSJ A;  1GLE G;  3SPY A;  3SAG A;  5AFU H;  3KWI A;  4JEP A;  4OGE A;  1BIS A;  4DR3 K;  1EO1 A;  3EKS A;  5JS2 A;  2AA4 A;  3Q7C A;  1W7A A;  4UY8 O;  4X65 K;  4AF1 A;  1HNZ K;  2P1J A;  3CQ8 A;  3O4W A;  2FLO A;  3D2F B;  3MED A;  3NFA A;  1NJI O;  1RTD A;  4FJK A;  1HUX A;  3F9K A;  3ID6 A;  3OYC A;  3CMA N;  1RT3 A;  2ZM6 K;  4Z4E A;  3T1Y K;  3TTC A;  3J7Z O;  1MU2 A;  1R0A A;  4FJI A;  2ITG A;  2F8S A;  4LF9 K;  3HPH A;  1XI1 A;  1IKV A;  4N41 A;  5F0X A;  3BY5 A;  4LY7 A;  5HBM A;  3K9K A;  5I3U A;  2PFU A;  1QQO A;  2QK9 A;  4W5R A;  3PLA A;  4KH5 A;  3DM2 A;  2P9I A;  2HF4 A;  2XO7 A;  4FJL A;  1TYQ B;  1GLF O;  4LD0 A;  3UKR B;  5M1K A;  2HHH K;  2ASO A;  5M1P A;  5JLH A;  4DTO A;  1NK5 A;  4EHT A;  2HOE A;  3TU5 A;  5C10 A;  2E4L A;  4FM0 A;  3CG7 A;  4LSN A;  3ZT0 A;  5SZT A;  3M8R A;  3HXM A;  4JI8 K;  2Q36 A;  3V9X A;  3O4N A;  4JKG A;  4BRD A;  5BRE A;  5FRO A;  4PKG A;  4M3U A;  4M7Y A;  5M1F A;  3THW B;  3SZ2 A;  1QHT A;  4KFB A;  4BVO A;  2WBN A;  3TPQ A;  4JI5 K;  2BGG A;  1JLA A;  3GL1 A;  3O3F A;  4LF4 K;  3VMF B;  4DFK A;  5C2F A;  3AVC A;  1TK5 A;  1BQN A;  3NH1 A;  4M3R A;  3MN9 A;  2GBZ A;  3V4I A;  2O8C A;  3P38 A;  3TSU A;  2VQF K;  3HM9 A;  3DOK A;  1ZBU A;  5GIN A;  4E7L A;  1IBK K;  4B1W B;  1NGI A;  2E2O A;  1RFQ A;  4ISF A;  3L2V A;  3LZJ A;  2PYJ A;  3U9D A;  3L4I A;  1VSH A;  3UB5 A;  1TGO A;  4AH9 A;  5CZ1 A;  2NRZ A;  4BG9 A;  2HHT A;  4M42 A;  2O4G A;  4K42 A;  1X9S A;  1LWC A;  5LMU K;  4DTU A;  3AVM A;  4M63 C;  1DKG D;  2QW9 A;  4DMN A;  2ZWH A;  4WQ4 A;  3O9U A;  4DWI A;  3M1F A;  3MXI A;  3I55 N;  4FZZ A;  3M3Z A;  2I7P A;  4CZH A;  4WQ5 C;  4JN4 A;  1WOQ A;  4BRQ A;  3KD1 E;  3MX2 A;  4DR2 K;  3KVG A;  4KTQ A;  4CIF A;  3NF9 A;  2KLA A;  4YOR A;  3LAN A;  3AVG A;  4L3Q A;  5HP1 A;  2QWN A;  4BRH A;  1UAX A;  1Q81 O;  1FK9 A;  2HND A;  3IG1 A;  4FSV A;  4CEC A;  4B3T K;  4FVM A;  1TKD A;  4KHN A;  3NHG A;  2F9W A;  3KK3 A;  1J5E K;  3WNG A;  3SMP A;  4WQ4 C;  4IOC L;  4A2A A;  1BO5 O;  3T3F A;  3CFO A;  1EXQ A;  1UA1 A;  5AQI A;  4ILH A;  3FFI A;  4YNQ A;  2GX9 A;  1LOT B;  2O8C B;  3WQT A;  1NGF A;  2A1R A;  3HO1 A;  3ZSY A;  3ZT3 A;  4J8F A;  4DQ8 A;  2D5R A;  4J2E A;  3OYK A;  1T6C A;  4DFM A;  5AZJ B;  4KTZ A;  5FPM A;  1QE1 A;  2QWO A;  4M7X A;  1YVN A;  3QEI A;  4E19 A;  1LW0 A;  1NK7 A;  4A61 A;  3IDH A;  4ICL A;  1S6P A;  2OPQ A;  4DV7 K;  1TYQ A;  1WAF A;  2IOC A;  3OYG A;  3F5T A;  3GE1 A;  2P5G A;  3K59 A;  2E1Z A;  3DRR A;  3RMB A;  3UE5 A;  3R8E A;  3VEO A;  5F1X A;  3AVI A;  2E5L K;  3IFR A;  1NK4 A;  2LSN A;  4CBU A;  1W97 L;  2YNG A;  1EKE A;  4IZ9 A;  4LFB K;  2HHV A;  3PUF A;  3TSP A;  4DQP A;  4CE9 A;  4CJL A;  4CJP A;  4JI1 K;  4CF2 A;  3CCM N;  1NLV A;  3S41 A;  1HR0 K;  3CCJ N;  1WSG A;  2HVH A;  2VG5 A;  4EP4 A;  3F2K A;  1EET A;  1ZBS A;  3FR0 A;  4BAC A;  4JV5 K;  1EX4 A;  4CFD A;  1TK8 A;  3A2F A;  2KZZ A;  3THX B;  4FWN A;  3THV A;  2G8H A;  1GOC A;  1TKT A;  3RR7 A;  3NCI A;  1Q8I A;  4E7J A;  4IJN A;  4BC5 A;  1BWF O;  3QFP A;  1HJR A;  4A2B A;  1C1B A;  3MWP A;  4BR4 A;  2KFN A;  2E88 A;  4CJV A;  2A41 A;  4I9Q A;  2QWQ A;  5KTQ A;  4YHH K;  1JLQ A;  4CHQ A;  3CET A;  4FJX A;  3CME N;  4BR0 A;  2QWR A;  2VCP A;  2Q3S A;  4QCL A;  1YIJ N;  5EY4 A;  3PO4 A;  4RCH A;  1DTT A;  4BY9 C;  4CJ3 A;  1J6Z A;  3SBT A;  1U04 A;  2IVN A;  2UXB K;  4CD3 A;  4FK0 A;  4FJM A;  3WQU A;  3H1V X;  3ZX2 A;  4JS5 A;  4O5F A;  1UWB A;  2YHA A;  4PQU A;  2IDO A;  3DWL A;  2E20 A;  4O8K A;  2QWL A;  3FFK B;  3R9P A;  4CEQ A;  3J80 O;  3I33 A;  4F3T A;  4ZTF A;  1Q18 A;  3WXJ A;  1RT2 A;  3WXM B;  5LJW A;  2V7Y A;  1KCF A;  3EE8 A;  3H08 A;  4CFB A;  3CCE N;  4I2Q A;  3HP9 A;  2VQE K;  1BA0 A;  3C65 A;  1NJW A;  3AAP A;  1N8R O;  4J2D A;  1QZ6 A;  3UKU B;  1NWK A;  2Z1J A;  1S9G A;  3NVM A;  5AQL A;  5LMN K;  4CHN A;  1JLF A;  4RW6 A;  2E1Y A;  2GV9 A;  3ZT2 A;  4BC3 A;  1YJN N;  4CK3 A;  4IG0 A;  1NNE A;  5TKY A;  2RPI A;  1IJJ A;  1C0F A;  2A1S A;  3DJC A;  1SS6 A;  3ASM A;  3MN6 A;  3QB0 A;  2A6A A;  2KQ2 A;  3L2W A;  4M3T A;  4PY5 A;  4BR7 A;  3FZM A;  3C6T A;  1MWM A;  3SQ4 A;  4BRN A;  3VEN A;  3VQ9 A;  1U4B A;  2ZJQ L;  4FVU A;  4Y1D A;  1HNI A;  4DSK A;  3PX6 A;  1SL0 A;  3MWT A;  4MDA A;  3VQC A;  3M8S A;  3LAL A;  5M1N A;  4OJR A;  4XIU A;  2H3G X;  4NLB A;  2HB5 A;  3CJC A;  4OPH A;  3NH2 A;  4NYF A;  5AQR A;  4J2A A;  4KHU A;  3P39 A;  1H1V A;  4FWR A;  4BRI A;  2VG6 A;  3TAP A;  2QXF A;  2D0B A;  3TAG A;  1CXQ A;  4FYD A;  3THY B;  1TL1 A;  2DFF A;  2R7Y A;  1RBS A;  1KRP A;  4B1U B;  3VA3 A;  1LWE A;  2NRT A;  4CEO A;  3PY8 A;  5JS1 A;  3CQX A;  1U47 A;  2YCH A;  3BF3 A;  4YOY A;  1E4G T;  3CQY A;  3WNE A;  3MEE A;  1JJ2 M;  4E3S A;  5FPN A;  5CE3 A;  2KZM A;  2P51 A;  3BZK A;  3KLI A;  1RT7 A;  3CJB A;  5AQP A;  4O55 A;  1KC8 O;  3KLF A;  1KAZ A;  3WUH A;  2XRI A;  2HNY A;  3ZT1 A;  1TVR A;  3HK2 A;  3OYN A;  3ZSZ A;  1EWQ A;  3VQQ A;  2F4V K;  2WC9 A;  3DLB A;  4H4M A;  4FWP A;  4ZTJ A;  3SV4 A;  3DYA A;  1X9J A;  4HUG A;  3P83 D;  3J81 O;  4C8L A;  1HQE A;  4N47 A;  5C0Y A;  4W5N A;  4CD1 A;  2UXD K;  1V4S A;  3CC4 N;  1T05 A;  2NRH A;  1E4F T;  2Q97 A;  4BRM A;  3L2U A;  1WBB A;  3ATU A;  3P5J A;  1IH7 A;  1NK9 A;  4OX9 K;  4CVN E;  2QM1 A;  2EX3 A;  3SAF A;  2UYT A;  2BTF A;  4CHY A;  4KI6 A;  4ELT A;  2O8F B;  3L0Q A;  3AVK A;  1HJO A;  2P9N A;  3HI0 A;  3ZET A;  1N33 K;  4B1V A;  3CJ7 A;  4DV0 K;  3SLC A;  2ETJ A;  3BEX A;  4LF8 K;  1N5Y A;  1HNV A;  3O4Q A;  1NK0 A;  4RTF D;  4YFU A;  4GV9 A;  3H3O B;  3VQ6 A;  3SUO A;  2G8V A;  5JVH L;  1SAZ A;  3QES A;  4DTP A;  1XMQ K;  3AO5 A;  2IVP A;  3LDP A;  2QTD A;  4OLA A;  3EO3 A;  1D5A A;  5AQQ A;  2JGU A;  4KB0 A;  4H0V B;  1HKG A;  4CED A;  3ZLJ A;  2B4J A;  1SKW A;  4HUF A;  4OKJ A;  3H3N O;  3QIC A;  3AVJ A;  3I0R A;  2V7Z A;  4C8O A;  1RDD A;  3KWG A;  5AQM A;  2O8E A;  4KI4 A;  2D4W A;  4G1Q A;  2Q31 A;  4RW8 A;  2GUP A;  3LDS A;  1HNW K;  4M45 A;  5HOO A;  4F9O A;  2B5J A;  4HTL A;  4YOU A;  4DQR A;  2UUA K;  1S9E A;  1CXU A;  5GAE P;  4JI3 K;  1JCE A;  3A5O C;  2GTD A;  5C2D A;  4Z4I A;  3SJJ A;  5F2R A;  3VES A;  1RTJ A;  3C6A A;  5KPT A;  3KLE A;  3SCX A;  1A5X A;  3R1X A;  4PWD A;  4DLE A;  1BOT O;  4DS4 A;  3KKS A;  3SQ2 A;  1EQY A;  4CER A;  5HRO A;  3EZW A;  3AVF A;  1D9D A;  2CH6 A;  1NJZ A;  3IKM A;  3L3U A;  4H0Y B;  4MO5 A;  4E7H A;  4M3X A;  2HBM A;  1K8K B;  3HT3 A;  1NGG A;  4BRA A;  2HHU A;  4LH5 A;  3IAY A;  1GLL O;  2A3Z A;  4Q5V A;  4DUZ K;  4XH5 A;  4BG8 A;  3AVH A;  3C6U A;  2OA8 A;  3E01 A;  3CCU N;  2DFE A;  1OVY A;  3EYZ A;  1YI2 N;  3CF5 L;  2B6A A;  4XH4 A;  4CBX A;  5CR4 A;  4WFA L;  4JS4 A;  5AR0 A;  4Z0U A;  3VQA A;  2D1K A;  4KH4 A;  2P9K B;  2ZF5 O;  5CZ2 A;  1JXB A;  2NZT A;  4CZI A;  1BG3 A;  1BL3 A;  5E41 A;  2P9S A;  4FWM A;  2XHB A;  1WN7 A;  4UQG A;  2D0A A;  1QZ5 A;  4JKC A;  3V1R A;  3SV3 A;  1BCO A;  2EHG A;  3V6D A;  3ISN C;  5GAD P;  3LPT A;  1WBD A;  3D2E B;  4OKK A;  4FCY A;  4BDY A;  4BVP A;  4H0P A;  4PHT X;  4BWJ A;  1FKP A;  1HLU A;  1XUP O;  3E1Y A;  3AA3 A;  1WNS A;  1U2V A;  3HVT A;  5FPE A;  2V52 B;  3KZB A;  4CHZ A;  1IKX A;  3HBT A;  5HRN A;  1ATS A;  4KPY A;  2YV0 X;  4NCG A;  4NYN A;  4BGB A;  2QKB A;  4CCH A;  4JI6 K;  5KRT A;  5JMV A;  4CJ4 A;  5AQY A;  3S3O A;  1LV5 A;  5ADX A;  3O6W A;  4CJT A;  4CF8 A;  4DR1 K;  3E66 A;  3ZT4 A;  3MAQ A;  2DPN A;  5GIO A;  2NNW A;  2RN2 A;  3SUN A;  5HRS A;  5DM7 L;  3T1A A;  2AJQ A;  1A5V A;  1DT9 A;  1LWF A;  1RBU A;  3QDK A;  4DU4 A;  4DTR A;  4IJA A;  1U6Z A;  1XWL A;  1U48 A;  4DV4 K;  2P9U B;  3OVN A;  3E9P A;  1XQS C;  4W5Q A;  2P9U A;  1IBL K;  3QO9 A;  1NGE A;  3MCP A;  2ZGZ A;  4MDB A;  3D7E O;  4E0D A;  4GY2 B;  3EL2 A;  4JI4 K;  4E1J A;  1NG9 A;  4FLY A;  4F8R A;  4JYA K;  3VEY A;  4CZK A;  1KSP A;  5AQU A;  3AGK A;  2XY8 A;  2O8B A;  3DRP A;  1BI4 B;  4BRK A;  4GMJ B;  3DXK A;  3CD6 N;  5BN8 A;  3KKR A;  4Y1C A;  1KLM A;  1QSS A;  1QQM A;  3I8B A;  3OBY A;  1RTH A;  2IAJ A;  2XY6 A;  4ZHR A;  3DLH A;  4NB4 A;  2GWJ A;  1CZA N;  3S9H A;  2VGM A;  2OAN A;  4CFC A;  4M3Z A;  1SZ2 A;  5C25 A;  4EFH A;  3W0L A;  4FZX C;  3C7N A;  1HKC A;  4W5O A;  1VSF A;  2VYP A;  2W6L A;  4FJ8 A;  1WLJ A;  4DQQ A;  1UOC A;  4QAG A;  4GVM A;  4CZE A;  4FJH A;  1VK0 A;  3OHR A;  3U4L A;  1G99 A;  4BWM A;  4B9U A;  4R5P A;  4B08 A;  4DQI A;  5FRM A;  3ULD A;  4O44 A;  4H0X B;  3CC7 N;  4E89 A;  2FSN A;  3RTV A;  3P31 A;  4JHD A;  1T7P A;  3SMS A;  3HYF A;  1S3X A;  3ZSO A;  3J7A P;  4K25 A;  1BIZ A;  3VEV A;  4CJ7 A;  4DTJ A;  3LDO A;  3OJU A;  2O8D A;  4LF7 K;  1CLQ A;  5KQ8 A;  4B1Z A;  3ULE A;  4H5N A;  1RNH A;  4B8A B;  3O1B A;  4FJN A;  2GEM A;  1KTQ A;  4F2S A;  3H46 O;  2Z1G A;  1KXP A;  1FKO A;  5BPM A;  4G9Z A;  1OH5 A;  1T3V A;  3BUZ B;  3ENH A;  2UXC K;  5AFU A;  3MEG A;  3C6H A;  3FGU A;  2A42 A;  4CJ5 A;  1L5U A;  1M1K O;  4JKF A;  3O08 A;  5KI6 A;  1VSM A;  1O1W A;  3RMA A;  3KIO A;  3VQE A;  4WYB A;  1TUY A;  2YHY A;  4U7B A;  2YNI A;  1C0U A;  3O80 A;  4FWS A;  3THX A;  3OY9 A;  5D3G A;  4FLU A;  3TWH A;  1ZBI A;  3HVR A;  4CZF A;  1NGD A;  3QIN A;  4IFV A;  3MN5 A;  3O9T A;  4DTX A;  3L6Q A;  4WFB L;  3THW A;  5CYM A;  2HMI A;  4JLH A;  4FW2 A;  4F3O A;  1NGA A;  4PUO A;  4BGA A;  1O13 A;  1HYS A;  4CBW A;  2F7T A;  2ZJR L;  1TK0 A;  1E3M A;  4KHS A;  3K0S A;  4GW6 A;  4E7I A;  2PAV A;  2P9P B;  4E7K A;  5AQN A;  3VQ5 A;  4FM2 A;  2E2P A;  3HRG A;  3KTQ A;  5BRD A;  4FWK A;  1B92 A;  1ZYQ A;  4FJ9 A;  4KBO A;  5E84 A;  4CJW A;  4FOE A;  2VG7 A;  2PZS A;  4AM7 A;  1KFS A;  5FPD A;  1RCH A;  1NK8 A;  1RBR A;  4FWL A;  5C24 A;  3VGK A;  3OYA A;  4YOV A;  1NOZ A;  1Z6R A;  2FF6 A;  4O5B A;  4GNI A;  5AQT A;  4DV1 K;  5DM6 L;  1S72 N;  4DF8 A;  1NK6 A;  3B6P A;  4QS8 A;  3OTO K;  3NGY A;  1K9M O;  2ZGY A;  4CF1 A;  3RMC A;  3L8B A;  3NF7 A;  2O8B B;  4MLH A;  3QEV A;  1RT6 A;  3QIO A;  4JI2 K;  3VQ7 A;  5EXW A;  3OJS A;  2HBK A;  3WT0 A;  1RGI A;  1RBT A;  4OPK A;  2FBT A;  1T44 A;  1VQ5 N;  1VQ4 N;  1Q86 O;  1T6D A;  4OO1 J;  3FZH A;  4H5T A;  3RSE B;  3D2F A;  3SPZ A;  5HLF A;  1KAX A;  4C8K A;  1QVF M;  4CK2 A;  3CIP A;  3RSE A;  1S22 A;  1U2V B;  1GLC G;  4BRP A;  2X74 A;  4CGI A;  1LCU A;  3BF1 A;  2IS3 A;  1BUP A;  1RT5 A;  3UKU A;  1RT1 A;  3SI6 A;  3K9J A;  4H0T B;  2NRV A;  4FM1 A;  2Q0R A;  4JHD B;  1MWK A;  1L3V A;  1QTM A;  1NMD A;  4OKE A;  4W5T A;  1F21 A;  4DR5 K;  4TSX A;  3HSC A;  1S1X A;  3EZ5 A;  2HVI A;  1VQ6 N;  1GLB G;  4LC9 B;  3NGI A;  1NJX A;  2HBJ A;  3LM9 A;  3ULE B;  5KGX A;  2YJE A;  1VQ9 N;  3V9S A;  3F73 A;  4AHU A;  5BR8 K;  2KFZ A;  1RDB A;  2WUS A;  3FZF A;  3ALY A;  1MDU B;  1ZC6 A;  3DXM A;  4MQ3 A;  3TAB A;  3VEZ A;  1QQC A;  4JRP A;  3LM2 A;  4FK4 A;  3PIP L;  4HHT A;  3O9Q A;  5C15 A;  2G8F A;  4B9M A;  4BE1 A;  3BZC A;  3NF6 A;  4C1N I;  4IG3 A;  3GDQ A;  4DU1 A;  2G8W A;  1NMN A;  4QS7 A;  4B3O A;  3K5N A;  4YOW A;  4Q0B A;  4FLV A;  3NDK A;  3AVB A;  2DY4 A;  3OBW A;  4PKI A;  1ILY A;  1SL1 A;  3F9M A;  3L4Q A;  3HPG A;  4IFY A;  3C95 A;  3ENO A;  3RR8 A;  4FO0 A;  3ZSW A;  1X9W A;  3HP6 A;  1C1C A;  3U3Y A;  1R59 O;  2CGL A;  4BR5 A;  1NGJ A;  2JWK A;  4CES A;  3NGZ A;  4MLE A;  4DFJ A;  3SQ1 A;  5EX5 A;  3OYE A;  4KHP K;  2GEL A;  4CZM A;  1WB9 A;  3TR8 A;  3U6F A;  4ISG A;  2D0P A;  4IDK A;  3BDP A;  4N56 A;  1YVU A;  4CFA A;  4IKF A;  3RVC A;  3GBT A;  2FSJ A;  2ASP A;  5I9E B;  2FXU A;  4DKW A;  4IBN A;  1KD1 O;  3D45 A;  4DSE A;  3MDQ A;  4CIE A;  1NKB A;  1VSI A;  1TUU A;  4XH1 A;  2E6L A;  5K14 A;  2I7N A;  3CYM A;  5J2M A;  3K5M A;  4HTU A;  4DS5 A;  2D0C A;  3V1Q A;  4CGH A;  4C23 A;  1IKW A;  2FBV A;  1LW2 A;  4DSF A;  1ATN A;  3EY1 A;  2IC3 A;  2KHO A;  1I3A A;  4K8Z A;  1X3M A;  3IRX A;  1HPZ A;  2A5X A;  1C0T A;  1CZB A;  5AQW A;  2OYQ A;  3PIO L;  3D0P A;  3O1W A;  1DEJ A;  2YX6 A;  1KLN A;  5IT9 O;  1Z25 A;  4B3S K;  3LP0 A;  4JKD A;  3KK7 A;  3JAM O;  1BIU A;  3QET A;  3ZET B;  4KV8 A;  3CXC M;  1T03 A;  4IOA L;  4NCB A;  4JNE A;  2HF3 A;  1VHX A;  1QQN A;  2HHW A;  1ATR A;  5J2P A;  2HHX A;  3SUQ A;  3CM6 A;  2OCE A;  1HX1 A;  2YKM A;  2FSK A;  4LF5 K;  1B9D A;  3AO3 A;  3M8Q A;  2WTU A;  4FJ7 A;  4K43 A;  1P90 A;  3QEX A;  1VRT A;  3O3H A;  1SUQ A;  3J7Y P;  1TAU A;  3EKU A;  3FZL A;  1XHX A;  3HPO A;  2OZM A;  4DTS A;  4R79 A;  1C6V A;  3IUC A;  3HOS A;  3WXI A;  3EN9 A;  1S1V A;  1VQ8 N;  1NGB A;  4LF6 K;  3LAM A;  3CI5 A;  1WUA A;  3V9W A;  1JKH A;  1GOB A;  3T69 A;  4FLZ A;  5HRR A;  1NGH A;  3LDL A;  1MA9 B;  1VQK N;  3SQ0 A;  4GKK K;  1RDU A;  3RRG A;  2IGI A;  4LFC K;  3CC2 N;  5AQG A;  3H45 C;  1K73 O;  1X9M A;  5A2Q O;  4CHP A;  1FW6 A;  1D8Y A;  3O9R A;  1VAZ A;  3RRH A;  5ELZ A;  4KRE A;  3LWL A;  3M6G A;  3KK1 A;  3QEW A;  4NXN K;  1NM1 A;  3VA0 A;  2WON A;  4QOZ B;  3TI0 A;  3U9Z A;  4AQY K;  4N5S A;  3WXL A;  4CEE A;  3L2R A;  1QHA A;  3VQB A;  1NKC A;  1B9F A;  2FF3 B;  1ITG A;  1G15 A;  1QSY A;  5AQF A;  4JK8 A;  1Q9Y A;  4JRQ A;  4OPA A;  1YIT N;  1HNX K;  3TTF A;  1JCG A;  4CJF A;  3TSQ A;  3DLK A;  5MLC Q;  3FLC O;  3NF8 A;  2QI2 A;  3AVN A;  3AA2 A;  1VSD A;  4AHT A;  3AAQ A;  3HJF A;  1HKB A;  1C0G A;  1KAY A;  2YNF A;  1KVC A;  3CCS N;  5AQZ A;  1SQK A;  5GAG P;  3TAE A;  1P8Z A;  2HMP A;  2YNH A;  2CGJ A;  4K41 A;  1GLJ O;  1V4T A;  2WOM A;  2HHS A;  4CEZ A;  1JLB A;  1TAQ A;  2KKZ A;  3VGL A;  3GG4 A;  4I6M B;  1FJG K;  3R6M A;  3ZYY X;  4O0J A;  1TKX A;  3CCR N;  3QER A;  1KFD A;  2Q2R A;  3A5L C;  1I94 K;  4JD2 B;  1TL3 A;  4A5B A;  4IEI A;  2ZD1 A;  2YJF A;  1LAV A;  4IOX A;  3FE1 A;  3ZEU A;  4KHQ A;  1L3T A;  3TAQ A;  4H5V A;  1GOA A;  2ZJP L;  4M3Y A;  4KHW A;  1D9F A;  4BRE A;  4FXD A;  3CER A;  3RMD A;  2P9S B;  3A5M C;  2BDP A;  2Q1N A;  4BR2 A;  2ASM A;  3THY A;  5I42 A;  1M90 O;  3OYD A;  1JCF A;  2NUB A;  3QML A;  1VQ7 N;  5AQX A;  3MXJ A;  1YJ9 N;  4BQL A;  1TKZ A;  3GOI A;  2DTU A;  4Z4C A;  4H0O A;  1YJW N;  1VQL N;  1HYZ A;  1RIL A;  3I8D A;  3VPZ A;  1YT3 A;  5E26 A;  3S3N A;  3J8A A;  3QNO A;  3V81 A;  4J2B A;  2E6M A;  2UUC K;  5KGW A;  2XY5 A;  3VTI A;  4JKA A;  4E1N A;  1WSH A;  4CJQ A;  1FXX A;  4IO8 A;  3ZEU B;  4DF4 A;  3OS0 A;  4GKJ K;  2G8I A;  4WQ5 A;  5AQS A;  1ASU A;  5B8H A;  3L2Q A;  5AQJ A;  1RT4 A;  4HVJ A;  5H1S Q;  1S1W A;  2VWK A;  1KVB A;  3OYM A;  3MXM A;  1ZBH A;  5SWM A;  1VSE A;  3KJV A;  1VQN N;  4AHC A;  2VGN A;  2FBX A;  2CH5 A;  3O5B A;  4I2P A;  3LDN A;  3LPU A;  3QFU A;  1K6Y A;  1DGK N;  4RW9 A;  4BRG A;  3D6R A;  2P9L A;  4KB1 A;  4CIG A;  4BRL A;  2FBY A;  1YTA A;  2RHK A;  4H5R A;  2A40 A;  4X66 K;  4CGG A;  5JVG L;  2YHX A;  1W0H A;  3VN5 A;  2YHB A;  4KKO A;  1JXE A;  3AVA A;  3TAR A;  3ZSV A;  1RDA A;  4A57 A;  3OS1 A;  1WSF A;  1BU6 O;  5DK5 A;  2QA4 N;  3DRS A;  3MN7 A;  3VF4 A;  3V1O A;  3LP1 A;  3VEW A;  4DSJ A;  3R3L A;  1RDC A;  3QBX A;  1YF5 L;  3FZK A;  2GWK A;  3HL8 A;  3D2E A;  5TKW A;  5AQH A;  3KHY A;  1JL1 A;  4OVL A;  2KW4 A;  1NGC A;  3A0I X;  2P9I B;  4BR9 A;  3EE9 A;  2QXL A;  3CPE A;  5JLF A;  1K8A O;  1N32 K;  1HMV A;  4JI7 K;  4WF9 L;  1IKY A;  4RW7 A;  3H6E A;  4ISE A;  1OH6 A;  5FLX O;  4FWQ A;  3WNH A;  3S3M A;  3VF6 A;  4I9L A;  2OPS A;  3M5R A;  2J4R A;  1Y64 A;  4B8C A;  3ZX0 A;  5FRN A;  4A59 A;  4CJS A;  4CF0 A;  3G25 A;  4MO4 A;  4DU3 A;  2NRR A;  2VWJ A;  2X78 A;  5BRH A;  5EVZ A;  3VEX A;  3NE6 A;  4C1N K;  3ZSR A;  3TAM A;  2Y1J A;  3IMX A;  3CFR A;  5JIC A;  4OPJ A;  3B6O A;  1OVQ A;  3AA4 A;  4JKH A;  3I56 N;  2W41 A;  4H4O A;  1XMO K;  3K2P A;  3OYB A;  2O8E B;  2FC0 A;  2PBD A;  5HRP A;  2JLE A;  3NBP A;  1HQU A;  5EOY A;  4F4K A;  1XHZ A;  3C0B A;  3QLH A;  3CPW M;  4GV6 A;  3KD5 E;  1IO2 A;  1S5J A;  3SUP A;  3BGR A;  1T8E A;  4ILJ A;  4DV2 K;  1VRU A;  3V9Z A;  4XEI A;  2ZE2 A;  3CM5 A;  3VGM A;  4QS9 A;  4CZL A;  3OYF A;  4CGJ A;  4DV3 K;  4FJ5 A;  4DR6 K;  1U45 A;  1NBW A;  3UIQ A;  3WEE A;  3SJH A;  3OYJ A;  1VSJ A;  3WNF A;  4DLG A;  5M1O A;  4LH4 A;  3MMV A;  2BH1 A;  2E2Q A;  1RBV A;  4AM6 A;  4B9N A;  4KH6 A;  1GLD G;  2QEX N;  4CJR A;  1GLA G;  3DXM B;  3AVL A;  4CZJ A;  4V19 S;  4BC2 A;  4B1X B;  3KLH A;  3C7N B;  2P5O A;  3G10 A;  5CYQ A;  3KLG A;  4CHO A;  2V51 B;  3TAF A;  2D0O A;  3N4P A;  3JSM A;  3WXK A;  2Z1H A;  4AHV A;  5DMR A;  4WE1 A;  3SK3 A;  3AY9 A;  4CEB A;  5FDL A;  4ID5 A;  4DV5 K;  4DTM A;  2ATQ A;  4DR4 K;  4HUE A;  4NXM K;  5AZI A;  3K5L A;  2YKN A;  3U8X A;  3AO1 A;  4AHS A;  1HPM A;  3DXK B;  4X64 K;  3OA9 A;  3CCQ N;  3DAW A;  3K57 A;  5AJ3 K;  3AO4 A;  4JKE A;  1YAG A;  4LFA K;  3KK2 A;  4I6M A;  5AZI B;  4BDZ A;  1REV A;  3AGR A;  3CJ1 A;  2RE2 A;  3G71 N;  4YDU C;  3LWM A;  2GUI A;  5BPN A;  3VER A;  4CGD A;  2UUB K;  3K5O A;  2BUP A;  1Y97 A;  2HST A;  2O8F A;  2P9L B;  3CFP A;  2IIR A;  4OGC A;  5T7B A;  4DHY A;  2YHW A;  4FW1 A;  1QVG M;  1L3U A;  4O8U A;  4JK7 A;  4IFE A;  4FZY A;  3PX4 A;  4EP5 A;  4B9L A;  4X62 K;  4DFP A;  4NCA A;  2OPP A;  4GV3 A;  1HRH A;  4DB3 A;  4BC4 A;  3G6E N;  5C42 A;  3H1Q A;  3NH0 A;  4IEE A;  1ESV A; 
#chains in the Genus database with same CATH homology
 1IKW A;  1KVA A;  2FBV A;  4I7F A;  1LW2 A;  3AO2 A;  4E7H A;  4DSF A;  4M3X A;  4E7L A;  3EY1 A;  2IC3 A;  1I3A A;  3VQ8 A;  4K8Z A;  3QEP A;  3HT3 A;  3IRX A;  1HPZ A;  2HHU A;  4LH5 A;  4PA1 A;  3L2V A;  1C0T A;  3LZJ A;  3IAY A;  2PYJ A;  4Q5V A;  4CJU A;  1CZB A;  1VSH A;  1X1P A;  2BAN A;  2HNZ A;  3AVH A;  4DG1 A;  3T19 A;  1TGO A;  2OYQ A;  3C6U A;  3D0P A;  4AH9 A;  2OA8 A;  1QS4 A;  5CZ1 A;  3E01 A;  2HHT A;  2DFE A;  1KLN A;  4C8M A;  4M42 A;  1Z25 A;  1NJZ A;  2O4G A;  1X9S A;  3LP0 A;  3EYZ A;  1LWC A;  4DTU A;  3AVM A;  1DLO A;  1BIU A;  2B6A A;  5CY4 A;  1W9H A;  3QET A;  4DMN A;  3PX0 A;  4KV8 A;  4JS4 A;  4Z0U A;  3VQA A;  1T03 A;  4NCB A;  4DWI A;  3MXI A;  4FK2 A;  2HHW A;  4FZZ A;  5CZ2 A;  4AIL C;  1WSI A;  1JXB A;  4CK1 A;  4F2R A;  5J2P A;  1N6Q A;  3P1G A;  4KTW A;  1BL3 A;  5E41 A;  3SUQ A;  2HHX A;  3CM6 A;  2XHB A;  1WN7 A;  4UQG A;  2D0A A;  3L3V A;  2YKM A;  3NAE A;  3KD1 E;  3V1R A;  3SV3 A;  1B9D A;  3AO3 A;  1BCO A;  3M8Q A;  4FJ7 A;  2EHG A;  3V6D A;  3QEX A;  3ISN C;  1VRT A;  5KRS A;  1ASW A;  3NH0 A;  4L8R B;  3O3H A;  4KTQ A;  3LPT A;  1SUQ A;  3NF9 A;  4CIF A;  1TAU A;  4OKK A;  3LAN A;  1XHX A;  3AVG A;  1JLG A;  1J53 A;  3HPO A;  4FCY A;  4BDY A;  4DTS A;  3DMJ A;  2OZM A;  5HP1 A;  1C6V A;  1UAX A;  2O4I A;  4CEF A;  2F8T A;  4BWJ A;  1FKP A;  3ZSQ A;  2RF2 A;  1FK9 A;  1S1V A;  2HND A;  2BE2 A;  3IG1 A;  3LAM A;  3AA3 A;  1WNS A;  4CEC A;  3I0S A;  3QNN A;  4FVM A;  1JKH A;  1DTQ A;  1GOB A;  3V9W A;  1ZBU A;  4FLZ A;  1TKD A;  3HVT A;  5HRR A;  4KHN A;  3NHG A;  1S1U A;  3SQ0 A;  4CHZ A;  1IKX A;  3KK3 A;  5HRN A;  3WNG A;  3ZCM A;  1SKS A;  2IGI A;  3OYH A;  3RRG A;  3T3F A;  4KPY A;  3CFO A;  2OPR A;  1EXQ A;  2YV0 X;  1UA1 A;  4NCG A;  4NYN A;  2OZS A;  4KAZ A;  3FFI A;  1X9M A;  2QKB A;  4FLW A;  4YNQ A;  4CCH A;  2X6N A;  1C0M A;  5KRT A;  1JL2 A;  4CJ4 A;  3S3O A;  2HHQ A;  1LV5 A;  4CHP A;  4CJT A;  4CF8 A;  3ZT4 A;  3MAQ A;  2A1R A;  1D8Y A;  3HO1 A;  3ZSY A;  3ZT3 A;  3RRH A;  4KRE A;  3LWL A;  4DSL A;  2D5R A;  3KK1 A;  2RKI A;  3OYK A;  3QEW A;  4J2E A;  2RN2 A;  3SUN A;  4DFM A;  2XY7 A;  3TAN A;  5HRS A;  3VA0 A;  4HCB A;  4KTZ A;  3T1A A;  2WON A;  2AJQ A;  1A5V A;  4M3W A;  1QE1 A;  1LWF A;  2F96 A;  3TI0 A;  1RBU A;  4QOZ B;  4DU4 A;  4DTR A;  1XWL A;  3C94 A;  4B9S A;  2QKK A;  1U48 A;  4N5S A;  1NKE A;  1YTU A;  3JYT A;  3OVN A;  4CEE A;  4W5Q A;  1IG9 A;  3QEI A;  4E19 A;  1LW0 A;  3L2R A;  1NK7 A;  4BDP A;  3IS9 A;  3VQB A;  1NKC A;  1B9F A;  4ICL A;  1BCM A;  1S6P A;  2OPQ A;  3QO9 A;  1WAF A;  4E0D A;  1VSL A;  2IOC A;  4AHR A;  3OYG A;  1ITG A;  1G15 A;  2P5G A;  1LAW A;  3K59 A;  1QSY A;  3DRR A;  4FLY A;  3RMB A;  4F8R A;  1Q9Y A;  4JRQ A;  1KSP A;  1J5O A;  1XC9 A;  2XY8 A;  4M41 A;  3DRP A;  1BI4 B;  3AVI A;  1A5W A;  1NK4 A;  4GMJ B;  2LSN A;  4CJF A;  3DLK A;  2YNG A;  1EKE A;  3NF8 A;  2HHV A;  3PUF A;  3AVN A;  4AHT A;  1WAJ A;  1VSD A;  3AA2 A;  3DI6 A;  3KKR A;  1KLM A;  4Y1C A;  1QSS A;  4DQP A;  4EZ9 A;  2YNF A;  4CE9 A;  1KVC A;  4CJL A;  4CJP A;  4DSI A;  1RTH A;  2IAJ A;  3VQ4 A;  3TAE A;  2YNH A;  2XY6 A;  4ZHR A;  4CF2 A;  3DLH A;  2WOM A;  4OLB A;  4KO0 A;  4CEZ A;  1Q9X A;  2G8K A;  2HHS A;  1JLB A;  1TAQ A;  1WSG A;  2HVH A;  2VG5 A;  4EP4 A;  3G0Z A;  3S9H A;  1BGX T;  1EET A;  4BAC A;  1EX4 A;  4N76 A;  4O0J A;  1S6Q A;  1TKX A;  4CFC A;  3QER A;  2ZQB A;  4CFD A;  1TK8 A;  3A2F A;  4M3Z A;  5C25 A;  1KFD A;  2KZZ A;  3K58 A;  4FZX C;  3THV A;  2G8H A;  1GOC A;  1TKT A;  3RR7 A;  4W5O A;  3NCI A;  1HYV A;  1Q8I A;  1TL3 A;  1VSF A;  4E1M A;  4E7J A;  4FJ8 A;  2ZD1 A;  1WLJ A;  4DQQ A;  1LAV A;  1UOC A;  2Y1I A;  1HJR A;  4QAG A;  4GVM A;  3LAK A;  1C1B A;  5J2Q A;  1L3T A;  4KHQ A;  2KFN A;  3TAQ A;  4CJV A;  3SNN A;  1GOA A;  4I9Q A;  5KTQ A;  4FJH A;  1J54 A;  4KHW A;  4M3Y A;  1VK0 A;  1JLQ A;  4CGF A;  2KTQ A;  1D9F A;  4CHQ A;  4FJX A;  4FXD A;  3RMD A;  4BWM A;  4B9U A;  4R5P A;  4B08 A;  4DQI A;  1NJY A;  5FRM A;  2BDP A;  2Q3S A;  4O44 A;  3ULD A;  4QCL A;  4E89 A;  1L3S A;  3PO4 A;  1DTT A;  4CJ3 A;  3OYL A;  3PV8 A;  3AV9 A;  1U04 A;  3RTV A;  5I42 A;  3OYD A;  1T7P A;  2PYL A;  2NUB A;  3HYF A;  4FK0 A;  3ZSO A;  4FJM A;  1JLE A;  3MXJ A;  1BIZ A;  1Z26 A;  4JS5 A;  4MFB A;  3SYZ A;  1UWB A;  2YHA A;  1TKZ A;  4DTJ A;  1SV5 A;  3M8P A;  4FJG A;  2IDO A;  3OJU A;  1C1A A;  4PQU A;  4CEA A;  2DTU A;  4CEQ A;  1CLQ A;  4Z4C A;  4DTN A;  4F3T A;  1RNH A;  1U49 A;  1HYZ A;  4B8A B;  4ZTF A;  1RIL A;  1S1T A;  4FJN A;  3I8D A;  4F2S A;  1KTQ A;  1YT3 A;  4KHY A;  1RT2 A;  2Z1G A;  3S3N A;  1FKO A;  3QNO A;  3V81 A;  4J2B A;  1KCF A;  2E6M A;  5KGW A;  3VQD A;  3H08 A;  4C8N A;  4CFB A;  2XY5 A;  1QSL A;  3MEG A;  4CJ5 A;  4E1N A;  1WSH A;  1L5U A;  4I2Q A;  4CJQ A;  1FXX A;  3HP9 A;  3VQP A;  4DF4 A;  5KI6 A;  1VSM A;  1J9A A;  1O1W A;  3OS0 A;  4FLT A;  3RMA A;  1NJW A;  4FJJ A;  3KIO A;  3VQE A;  4RG8 A;  4J2D A;  2G8I A;  1ASU A;  2Z1J A;  1S9G A;  4CJE A;  3L2Q A;  4CHN A;  1JLF A;  1RT4 A;  4ID1 A;  2GV9 A;  4RW6 A;  3ZT2 A;  4HVJ A;  2YNI A;  1C0U A;  1S1W A;  2VWK A;  1KVB A;  3OYM A;  3MXM A;  1UA0 A;  1ZBH A;  5SWM A;  4CK3 A;  1VSE A;  4IG0 A;  3ZSX A;  3OY9 A;  3KJV A;  1NOY A;  5D3G A;  4FLU A;  2RPI A;  3OYI A;  3TWH A;  4RW4 A;  3OS2 A;  2A1S A;  4AHC A;  1ZBI A;  1ZBF A;  3HVR A;  3ASM A;  2FBX A;  3QIN A;  2HW3 A;  4IFV A;  4DTX A;  4I2P A;  4BE0 A;  2KQ2 A;  3LPU A;  3L2W A;  1JLC A;  4M3T A;  4PY5 A;  3C6T A;  3O3G A;  3V9U A;  1WSE A;  3SQ4 A;  1TV6 A;  5CYM A;  1K6Y A;  2HMI A;  4JLH A;  3QIP A;  4RW9 A;  1VSK A;  1ASV A;  4CF9 A;  4FW2 A;  3VQ9 A;  1U4B A;  4CIG A;  3DOL A;  4F3O A;  4KB1 A;  4PUO A;  2FBY A;  4Y1D A;  3DLG A;  1HYS A;  1HNI A;  1YTA A;  3PX6 A;  4DSK A;  1SL0 A;  2DFH A;  1ZBL A;  1TK0 A;  3VQC A;  3M8S A;  4CGG A;  3LAL A;  1W0H A;  4FLX A;  3VN5 A;  4KHS A;  2YHB A;  4KKO A;  2X6S A;  4OJR A;  1JXE A;  4GW6 A;  3AVA A;  4XIU A;  4E7I A;  3TAR A;  2G8U A;  1CZ9 A;  2HB5 A;  1BHL A;  1RDA A;  3ZSV A;  3OS1 A;  1WSF A;  3NH2 A;  4E7K A;  5DK5 A;  3VQ5 A;  4FM2 A;  3DRS A;  2I5J A;  3V1O A;  3LP1 A;  3RWU A;  4NYF A;  4DSJ A;  3KTQ A;  4J2A A;  4KHU A;  1RDC A;  1B92 A;  3LZI A;  1ZYQ A;  4FJ9 A;  2VG6 A;  3LP3 A;  4CJW A;  3TAP A;  2VG7 A;  3HL8 A;  2PZS A;  2PY5 A;  1KFS A;  2QXF A;  2D0B A;  1RCH A;  4LSL A;  1NK8 A;  1JL1 A;  3TAG A;  1CXQ A;  4FYD A;  4OVL A;  2KW4 A;  5EU7 A;  1TL1 A;  1RBR A;  2DFF A;  5C24 A;  3ITH A;  3OYA A;  2R7Y A;  1RBS A;  1RTI A;  1KRP A;  1NOZ A;  4Z4F A;  3DLR A;  1HMV A;  4O5B A;  1IKY A;  4RW7 A;  3LP2 A;  4K8X A;  4DF8 A;  3VA3 A;  4Z4G A;  1LWE A;  1NK6 A;  5J2N A;  4CEO A;  3PY8 A;  5JS1 A;  3B6P A;  3WNH A;  3S3M A;  1U47 A;  3DLE A;  4I9L A;  4B9T A;  3NGY A;  2OPS A;  4CJK A;  3RMC A;  4CF1 A;  1BI4 A;  2W42 A;  3L8B A;  3NF7 A;  4ELU A;  3QEV A;  1RT6 A;  3QIO A;  3WNE A;  3VQ7 A;  4KRF A;  4B8C A;  4DQS A;  3PO5 A;  5FRN A;  3MEE A;  4CJS A;  3OJS A;  4E3S A;  4CF0 A;  4H8K A;  4ELV A;  2KZM A;  2P51 A;  1BQM A;  1RBT A;  3KLI A;  1RT7 A;  4OPK A;  2VWJ A;  4DU3 A;  2FBT A;  4BE2 A;  5J1E A;  2X78 A;  4O55 A;  4B9V A;  3KLF A;  3HJF A;  3HST B;  4Z4H A;  1SKR A;  3U3G A;  3NE6 A;  3ZSR A;  2Z1I A;  2XRI A;  3MEC A;  1SL2 A;  1I39 A;  3TAM A;  2HNY A;  2Y1J A;  1EP4 A;  3AA5 X;  3ZT1 A;  4O0I A;  3SPZ A;  4HCC A;  1TVR A;  3CFR A;  4O4G A;  5HLF A;  4CK2 A;  4OPJ A;  4C8K A;  1WSJ A;  4EZ6 A;  3HK2 A;  3B6O A;  3OYN A;  3ZSZ A;  3SPY A;  3VQQ A;  3AA4 A;  2X74 A;  4CGI A;  4H4M A;  3DLB A;  4ZTJ A;  1BIS A;  2IS3 A;  4OGE A;  4H4O A;  3DYA A;  1RT5 A;  3SV4 A;  4HUG A;  3K2P A;  3P83 D;  1RT1 A;  3OYB A;  2FC0 A;  3SI6 A;  4C8L A;  1HQE A;  4N47 A;  5HRP A;  4W5N A;  2JLE A;  3NBP A;  4FM1 A;  1HQU A;  4F4K A;  1XHZ A;  1L3V A;  1QTM A;  3QLH A;  4OKE A;  1T05 A;  4W5T A;  3KD5 E;  5JS2 A;  1F21 A;  1IO2 A;  1S5J A;  4TSX A;  3SUP A;  3BGR A;  1S1X A;  1T8E A;  3L2U A;  3EZ5 A;  2HVI A;  3P5J A;  1IH7 A;  1NK9 A;  1VRU A;  3V9Z A;  2P1J A;  2ZE2 A;  3CM5 A;  3CQ8 A;  2EX3 A;  3NFA A;  3MED A;  3NGI A;  4FJK A;  1NJX A;  1RTD A;  3OYF A;  4CHY A;  4CGJ A;  3F9K A;  3OYC A;  4FJ5 A;  4ELT A;  1U45 A;  5KGX A;  4KI6 A;  1RT3 A;  3V9S A;  3UIQ A;  3F73 A;  4AHU A;  3OYJ A;  3AVK A;  2KFZ A;  1RDB A;  1VSJ A;  4Z4E A;  3ALY A;  4MQ3 A;  3TAB A;  3WNF A;  4DLG A;  4LH4 A;  1QQC A;  1MU2 A;  2ETJ A;  4JRP A;  1R0A A;  4FJI A;  1RBV A;  4B9N A;  4FK4 A;  2ITG A;  1N5Y A;  2F8S A;  4HHT A;  4CJR A;  1HNV A;  3O4Q A;  1NK0 A;  3AVL A;  2G8F A;  4YFU A;  3HPH A;  4B9M A;  4BE1 A;  3KLH A;  3NF6 A;  3VQ6 A;  3SUO A;  1XI1 A;  2G8V A;  1IKV A;  2P5O A;  4N41 A;  3G10 A;  5CYQ A;  3KLG A;  4CHO A;  4LY7 A;  4IG3 A;  3TAF A;  5HBM A;  2G8W A;  4DU1 A;  3QES A;  4DTP A;  3JSM A;  3AO5 A;  5I3U A;  4OLA A;  2Z1H A;  4B3O A;  1D5A A;  3K5N A;  4AHV A;  5DMR A;  2JGU A;  4KB0 A;  4Q0B A;  4FLV A;  4WE1 A;  2QK9 A;  4W5R A;  4CEB A;  5FDL A;  4CED A;  3DM2 A;  2B4J A;  2XO7 A;  4ID5 A;  4HUF A;  3NDK A;  4DTM A;  1SKW A;  4FJL A;  4OKJ A;  2ATQ A;  3AVB A;  2DY4 A;  4LD0 A;  4HUE A;  3K5L A;  3AVJ A;  3I0R A;  2YKN A;  3AO1 A;  1SL1 A;  4C8O A;  1RDD A;  4DTO A;  3HPG A;  4IFY A;  4KI4 A;  1NK5 A;  3C95 A;  4G1Q A;  4AHS A;  4RW8 A;  3RR8 A;  3LDS A;  4M45 A;  3ZSW A;  1X9W A;  2E4L A;  4FM0 A;  3CG7 A;  4LSN A;  3HP6 A;  1C1C A;  3ZT0 A;  5SZT A;  2B5J A;  3M8R A;  3K57 A;  3U3Y A;  3AO4 A;  3KK2 A;  3HXM A;  4BDZ A;  1REV A;  3V9X A;  4DQR A;  4CES A;  1S9E A;  3NGZ A;  1CXU A;  3O4N A;  4DFJ A;  3SQ1 A;  3LWM A;  2GUI A;  5FRO A;  3OYE A;  4CGD A;  4M3U A;  3K5O A;  1Y97 A;  3SZ2 A;  3TR8 A;  3CFP A;  3U6F A;  4Z4I A;  3SJJ A;  1QHT A;  4KFB A;  1RTJ A;  4OGC A;  5T7B A;  4IDK A;  3BDP A;  4N56 A;  1YVU A;  3KLE A;  2BGG A;  4FW1 A;  4CFA A;  1A5X A;  3SCX A;  1L3U A;  4IKF A;  1JLA A;  4PWD A;  3O3F A;  4DLE A;  4IBN A;  4FZY A;  3PX4 A;  4DS4 A;  3KKS A;  3D45 A;  4EP5 A;  4DSE A;  4DFK A;  3AVC A;  1TK5 A;  1BQN A;  4CIE A;  3NH1 A;  1NKB A;  4B9L A;  1VSI A;  4M3R A;  4DFP A;  2GBZ A;  3V4I A;  2E6L A;  3SQ2 A;  5K14 A;  4NCA A;  2OPP A;  3CYM A;  4CER A;  5J2M A;  1HRH A;  3AVF A;  3K5M A;  5HRO A;  1D9D A;  4HTU A;  5C42 A;  4DS5 A;  2D0C A;  3HM9 A;  3V1Q A;  4CGH A;  3L3U A;  3DOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...