4CGLA

Leishmania major n-myristoyltransferase in complex with an aminoacylpyrrolidine inhibitor
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diverse Modes of Binding in Structures of Leishmania Major N-Myristoyltransferase with Selective Inhibitors
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 119
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cglA00
4A2ZA 5AG5A 4CGNA 4UFVA 4UCNA 5G21A 4A95A 4C2ZA 4CGPA 4CGLA 5AG4A 3IWEA 3JTKA 4CGMA 2WUUA 4CYQA 4BBHA 4CGOA 5AGEA 4B14A 2YNEA 4A30A 4CAEA 5G20A 5G1ZA 4B12A 4B13A 4CYPA 4B11A 4UFXA 4C2YA 4CYNA 5AG7A 2YNDA 5AG6A 4A32A 4CYOA 5A28A 4C2XA 4UCMA 4UCPA 4UFWA 2WSAA 5A27A 2YNCC 4CAFA 4A31A 4B10A 3H5ZA 4C7IA 2YNCA 5G22A 4C68A 3IU1A 4A33A 4C7HA 3IU2A
chains in the Genus database with same CATH superfamily
1ZG9A 2V8GA 4KSFA 4MMOA 5AG5A 1MJ9A 3P2FA 5K8OA 3GUXA 1VIXA 2PC1A 4CRYB 4OC2A 2GIVA 2WUUA 4CYQA 5IB9A 3N7ZA 3G3SA 2FSRA 4CAEA 2ANPA 4IHMA 2PDOA 1N71A 4GS4A 2AFWA 2PE3A 2GANA 3SI0A 4M3SA 3TO6A 1M1DA 1Z8TA 5HVGA 3SXNA 2EUIA 4F0XA 2GLFA 3H4QA 3SI2A 3V38A 1S7FA 2B3UA 3F8KA 5LYFA 2R8VA 4XPDB 3LMSA 4K30A 4P4JA 1M4IA 1Z4EA 2PJ0A 4NSQA 4Q36A 2VZYA 3GLJA 4UBRA 3NFZA 1F57A 1VHEA 2BUEA 3H8GA 4KOVA 5JQ4A 1Z9UA 4ZY0A 3FNCA 2FCKA 2CNTA 3EO4A 4OADA 1U6MA 2FS5A 4DYOA 3I3GA 4CGMA 2JEVA 3B3VA 1Y7EA 4PSWA 2CF4A 5F47A 4UWIA 2WZNA 2QIRA 4OC0A 4NXYA 1LAMA 3VATA 5G1ZA 2VZZA 2D4OA 4UF4A 1Y0RA 3BJ8A 2Z0ZA 4MFJA 3WC5A 1I21A 3LODA 4OC1A 3CXPA 4GXHA 3N5FA 4JJXA 4IK2A 4CPAA 1NE9A 1XRYA 1P0HA 4KUAA 4X8IA 4ZY2A 2PVVA 1CBXA 1RTQA 5KTDA 5K8PA 2J8NA 3F5BA 1LRZA 5G22A 3BI0A 4E0AA 1Y7RA 2C6GA 2ABZA 3IU1A 3K9UA 3OWCA 4NGTA 5K8MA 4KVME 3B35A 4CGNA 4TWEA 1LAPA 3MGDA 3CXSA 4H6UA 3NA6A 1KUXA 4HKFA 4A95A 2PJ2A 3TE4A 3NH4A 3PBBA 4BBHA 4FD5A 1FY7A 2X7BA 4Q7AA 5F48A 4CRZB 4B14A 5IV0A 2ZEMA 1Q2DA 4B13A 2FIAA 4U5YA 2R7HA 4R87A 4EWTA 3MN8A 3S6KA 1WWZA 2B5GA 2BO9A 5GCNA 1Z4RA 4A32A 4CYOA 2Z11A 3S6GA 2POKA 2V8VA 3PZJA 1BLLE 2BOAA 2Z3MA 2WPXA 2IL4A 2R1IA 2V77A 4KS9A 2EVNA 3FMCA 4M6HA 1Z8XA 4A2ZA 3EFAA 1YR0A 4Y49C 1PCAA 2J8MA 5C88A 2Z3OA 1R43A 5G21A 2Q4VA 1DE4C 2EK9A 4CGPA 5F09A 2EO8A 1DTDA 3QB8A 4FD4A 3MRUA 4OMEA 4X5KA 3ZZIA 1TKFA 2QVPA 4MFQA 3LWUA 1BPMA 2HUZA 3SJXA 1CX8A 3V8IA 3PB7X 1ZLHA 2PIYA 4NGRA 5LRGA 1S7LA 3TO7A 4HPSA 4B12A 1CG2A 2RC4A 2AFZA 4DJLA 2B4DA 1XE4A 4R57A 4PXCA 1ON0A 4JWPA 2ZEHA 3R96A 3K2KA 3JVNA 2A4NA 1PYTB 1KWMA 4MFLA 1QQ9A 4X3RA 5HMNA 5KTCA 3IEHA 4PSXA 1ZG8A 1NSLA 4BMHA 3NE7A 4M6IA 1IY7A 2PSWA 3KQXA 4KOXA 2C1CA 2ZENA 1TXRA 3IJ3A 3PB9X 2ZW7A 2FE7A 4Z65A 3B2YA 4KSAA 5LYDA 2R98A 3T90A 4QB9A 2GU2A 2PJ7A 4ZYQA 5CBMA 1XBUA 3DR6A 3PP9A 1Q7LA 2BCOA 2OZHA 1UWYA 3TT2A 3HLPA 4A30A 1CPXA 2ARHA 2OH1A 4KOUA 5FVJA 5J8CA 1V0CA 1HDUA 2PJ1A 3KI9A 4M85A 4B11A 3E0KA 4JXRA 4C2YA 2KCWA 3CPAA 2IJZA 3LD2A 2Q7SA 4J3GA 1P4NA 2IMOA 1FNOA 3FIXA 3G8WA 3FYNA 1YQEA 5A27A 4PK3A 1ELMP 1XF8A 2JBJA 3PBEA 3KQZA 1NSAA 1IGBA 2PJAA 2PJ6A 4OC3A 1QSTA 4HNYB 4QBJA 4AVBA 1A2ZA 4X2TA 4TNUA 2FL4A 3FB3A 4NF1A 4P4BA 4UCNA 3A9LA 1QSNA 4KORA 2DF5A 2Z10A 3CZXA 3DNSA 4F8ZA 3SHPA 4HNWB 4Q38A 4YFJA 3B3WA 5K8NA 4AG7A 4FWUA 2F7VA 5H86A 2WPWA 4RI1A 4U9YA 3D2PA 2H5MA 1VKCA 2V8HA 3FX6A 1YREA 4OIDA 4ZX8A 1PU9A 4AVCA 2Q44A 2CIJA 3FEEA 3NH8A 5LYLA 2V8DA 2B4BA 1IOIA 3LACA 5KTAA 4UWJA 2JBKA 4KOTA 1NMTA 4R3LA 1XEBA 3DLJA 4DNCA 4II9A 4C2ZA 4XNHC 1OZPA 1OBRA 2VL1A 2VXKA 1ELLP 2G3AA 4H6ZA 2F8HA 5G20A 2BL1A 3K9TA 3GKRA 4I49A 1K4JA 4KVOE 4R76A 1JWQA 1Z8WA 4JXQA 1CP6A 1M4DA 2OZUA 4C2XA 3BJ7A 4DUKA 4R8FA 4CAVA 1YMEA 4JLYA 2GLJA 1RXTA 3JUWA 1JQGA 3S9NA 4NGMA 4F0YA 2ZEDA 2Q43A 4UEFA 2B5GB 1B87A 2ZELA 4MHZA 4H2KA 4G1PA 3VWDA 1M4LA 1AUGA 1CM0A 3S6HA 4MCRA 1VGYA 1YW4A 1QSRA 4MJ8A 1QSOA 2DXQA 3IWEA 3L2NA 2Z3NA 3WC6A 2ATRA 4YU9A 2F5IA 4H89A 4ZY1A 4NCZA 2C6CA 2YNEA 2NMTA 2Z3LA 4PXDA 2NYQA 3S9LA 2ZEPA 1RO5A 5ELYA 4B5PA 4KUBA 4R9MA 5CPAA 3RAMA 1KUYA 4KSIA 2PR8A 3PEIA 4QC6A 2AFUA 2P6GA 4UA3A 1CJWA 2HC9A 3RNZA 4KOWA 4UEZA 2VI7A 2Q51A 2PJ3A 3IIBA 4L89A 4QUSA 2PCUA 1XIXA 2HQYA 1SQHA 4NGSA 3BHXA 1XMBA 2PRBA 2B4DB 2OU2A 2REFA 4RS2A 1PUAA 3GIUA 1ZLIA 4R6TA 3D7FA 4MCSA 7CPAA 3WABA 3PFEA 5ISVA 1KZFA 2J9AA 3GYAA 2Z3KA 4LUAA 4NGQA 5E96A 5H84A 8CPAA 3NE8A 4MFZA 5AGEA 5DWNA 5LRJA 3EY5A 4P4FA 2FIWA 4EFDA 4NGPA 5HXDA 2PJBA 3DR8A 3FVLA 4LQ6A 2AFXA 2PJ4A 3IWGA 4OAEA 3DDDA 3PB6X 5F49A 2EBJA 2PJ5A 4NJQA 4OKOA 4RN7A 3FBUA 3C26A 4Y49B 3WC7A 1B6BA 1L0CA 1KUVA 2CTCA 4RUHA 5HH1A 5C82A 2AFOA 5CNPA 1F2PA 3FECA 2GE3A 1Q2YA 3B3CA 3D7GA 2CY2A 4UFVA 2PR1A 3RO0A 3RZAA 1X10A 2AJ6A 4MHNA 3BI1A 1VHOA 3CXQA 3D2MA 4PK2A 4WWVA 1IIDA 3B8GA 1IOFA 2JEWA 2PVWA 3TO9A 4CAXA 4YRHA 5I0CA 3KHZA 5JH9A 5J1QA 4LX9A 4QVTA 1HDQA 1HEEA 4P10A 4PPZA 4CYNA 1BOBA 2YNDA 3VWEA 1XFOA 2CXAA 1S7NA 1ZO0A 4JZ0A 4E8OA 4O23A 3QNVA 4CS0B 2YNCC 2I00A 2ODFA 2VEZA 2XEJA 3KZWA 2OOTA 2BSWA 2K5TA 5DWMA 2RB7A 3TFYA 1CPSA 2VQYA 4PXBA 5IX3A 2ZEEA 1UFHA 4A39A 2O28A 4E2AA 3TOBA 2GFQA 2ZW4A 5I4MA 4FAIA 1AMPA 4UIAA 1MJAA 4OLLA 3GY9A 1TF8A 4ZGYB 4XNHB 4YWYA 4PV6A 4EMEA 3EC4A 3KKWA 5F46A 3W91A 1YGHA 1TKHA 3JRUA 4CAWA 3PGPA 4MHPA 1Q2CA 2PJ9A 1S5KA 2D4PA 4KOYA 2QMLA 3ZJ0A 4NGNA 4UCPA 3SJGA 4UFWA 2WYRA 3KL9A 4CAFA 2XEIA 4XPKA 2O4HA 2P6EA 5EBVA 3KASA 2QJ8A 3R9EA 4C7HA 2QECA 3V7ZA 1R3NA 3TCVA 1BPNA 4W9YA 4UIBA 4A37A 4GM5A 1YW6A 2CTBA 2JLMA 4BD9A 1Y9KA 1XOVA 1CP7A 4AVAA 3I9SA 3D7HA 2ZXVA 4LQGA 1YSJA 2DPSA 3TOAA 1AYEA 2OB0A 3WT4A 3QAHA 2P0WA 1Y9WA 3EXNA 3IWWA 3IC1A 4MRIA 3QAYA 4MI4A 1M44A 2AFSA 3BLNA 4ZX9A 2ZOFA 2I3CA 1I12A 3KR5A 2P6FA 5D29A 4A94A 3R9GA 4C7IA 3D66A 3TTHA 4B5PB 4K3NA 3FH4A 4MCPA 4UEEA 1F2OA 4KLVA 2RFHA 3NH5A 4P4EA 4F6AA 1GYTA 1MK4A 2FXFA 2ZEFA 2CNMA 3D7DA 3FJUA 2XEGA 3D4UA 4NJRA 3PB4X 1IB1E 1S7KA 1FT7A 3TX8A 2Q04A 3R9FA 1YX0A 1H8LA 2Z3PA 3CDXA 1IYLA 1XMTA 1M4GA 2C6PA 4IUSA 5HVHA 1ARMA 3D8PA 3F0AA 2HV2A 2I79A 3DGVA 4IAVA 4ZBGA 4OP4A 1BAVA 4L8AA 5A28A 4UCMA 1Z2LA 2Q4ZA 2EK8A 2G0BA 1TF9A 3SI1A 2DEAA 2JDCA 2Q7BA 2B58A 3I1UA 5JGFA 4A31A 3RBUA 2G9DA 3B3SA 2BEIA 3S6FA 1YVKA 3RYOA 4NEXA 2HB6A 1QMUA 1Y0YA 3UY5A 4PXEA 3IGRA 1Z8LA 1BO4A 2PRQA 1GHEA 4P45A 4CGOA 4OIWA 1IICA 3DSBA 5DS0A 4IF5A 3SXOA 2JDDA 3P2HA 1S3ZA 2AFMA 2G3TA 4MY3A 2ZW5A 3B3TA 1J4JA 1YLOA 4CYPA 4UFXA 3SJFA 3CT9A 4MHYA 5IB0A 4MFPA 2CNSA 3R1KA 5AG6A 2QYVA 4JYWA 2B3VA 3H8FA 4AG9A 3D68A 4KZTA 2DPTA 2XEFA 4XPDC 3R95A 4ZI6A 3B7IA 2ZEGA 3D67A 2YNCA 4XPLA 3PRTA 1ZG7A 5BWAB 1YLEA 1S60A 4F9VA 5J8FA 1X12A 2C27A 2IQ6A 3ISXA 4KLWA 3KHXA 2Q4YA 2YGWA 3GB0A 4FD7A 4CGLA 1I1DA 1LCPA 2VBQA 2OZGA 4P6YA 2EWBA 4MCQA 3W6SA 4MBUA 3H8EA 1TKJA 1QSMA 4OC5A 4JD6A 4WJBA 3CPXA 2PJCA 4P4DA 2OR4A 2GREA 4B6ZA 4MY0A 2NSMA 5LRKA 2PIZA 5AG7A 4FBEA 4FUUA 2AE6A 1VHSA 1LANA 2PQ8A 4MHDA 4A38A 4B5OA 4ORFA 4PQAA 1IYKA 2WSAA 1YK3A 5EC4A 5JM6A 2ZOGA 1Z5RA 2REEA 4FD6A 3FRMA 3VH9A 4BINA 4P44A 4B10A 4F9UA 3H5ZA 2ZPAA 6CPAA 3TC8A 4C68A 4EVYA 3T8WA 3IU2A 4R3KA 2ZW6A 1XJOA 4ONWA 2PJ8A 4ONUA 4OC4A 3PB8X 3FXTA 2FT0A 3KGQA 4P4IA 1IU8A 5AG4A 1EE3P 2ZEOA 1TIQA 5D8NA 3JTKA 4U9ZA 3FF3A 4KOSA 3KR4A 4MXUA 3IFEA 2O53A 1YVOA 2J8RA 3D3SA 4YGOA 5HVFA 1LFWA 5JPHA 5EMIA 1ARLA 4R7MA 4AB7A 2FVGA 5LYIA 1MJBA 3PFOA 4KVXA 1LOKA 3WR7A 3IO1A 2Q0YA 4HNXB 4M6GA 5THWA 4MFKA 3ISZA 1WK4A 2Y0MA 3FEDA 3T9YA 3S9MA 4NFRA 3VARA 3HUVA 4AXVA 1R57A 3SJEA 3BXMA 4A33A 3W6XA
chains in the Genus database with same CATH topology
4KSFA 5AG5A 1MJ9A 3P2FA 2PC1A 4CRYB 2GIVA 2WUUA 4CYQA 3N7ZA 3G3SA 2FSRA 4CAEA 2PDOA 1N71A 4GS4A 2GANA 4M3SA 3TO6A 1M1DA 3SXNA 2EUIA 4F0XA 3H4QA 1S7FA 2B3UA 3F8KA 2R8VA 4XPDB 4K30A 1M4IA 1Z4EA 4NSQA 4Q36A 2VZYA 4UBRA 4KOVA 2BUEA 5JQ4A 1Z9UA 3FNCA 2FCKA 2CNTA 3EO4A 4OADA 1U6MA 2FS5A 3I3GA 4CGMA 2JEVA 4PSWA 5F47A 4UWIA 2QIRA 4NXYA 5G1ZA 2VZZA 2D4OA 3BJ8A 2Z0ZA 4MFJA 1I21A 3LODA 3CXPA 4JJXA 1NE9A 1P0HA 4KUAA 5KTDA 2J8NA 3F5BA 1LRZA 5G22A 4E0AA 1Y7RA 3IU1A 3OWCA 3K9UA 4KVME 4CGNA 3MGDA 4H6UA 3CXSA 4HKFA 1KUXA 4A95A 3TE4A 4BBHA 4FD5A 1FY7A 2X7BA 4CRZB 5F48A 4B14A 5IV0A 1Q2DA 4B13A 2FIAA 4U5YA 2R7HA 4R87A 3S6KA 1WWZA 2B5GA 5GCNA 1Z4RA 4A32A 4CYOA 2Z11A 3S6GA 3PZJA 2Z3MA 2WPXA 2IL4A 2R1IA 4KS9A 2EVNA 4A2ZA 3EFAA 1YR0A 4Y49C 2J8MA 5C88A 2Z3OA 5G21A 2Q4VA 4CGPA 3QB8A 4FD4A 3ZZIA 4X5KA 4MFQA 3V8IA 2HUZA 1S7LA 3TO7A 4B12A 2RC4A 2B4DA 1XE4A 4R57A 1ON0A 4JWPA 3R96A 3JVNA 2A4NA 4MFLA 5HMNA 5KTCA 4PSXA 1NSLA 4BMHA 3NE7A 2PSWA 4KOXA 2ZW7A 2FE7A 4KSAA 2R98A 3T90A 4QB9A 3DR6A 3PP9A 2OZHA 3TT2A 4A30A 2ARHA 2OH1A 4KOUA 5FVJA 5J8CA 1V0CA 4B11A 4M85A 3E0KA 4JXRA 4C2YA 2KCWA 3LD2A 4J3GA 1P4NA 3FIXA 3G8WA 5A27A 3FYNA 4PK3A 1XF8A 1QSTA 4HNYB 4QBJA 4AVBA 2FL4A 3FB3A 4NF1A 4UCNA 3A9LA 1QSNA 4KORA 2Z10A 3DNSA 3SHPA 4HNWB 4Q38A 4YFJA 4AG7A 5H86A 2WPWA 4RI1A 4U9YA 3D2PA 2H5MA 1VKCA 1YREA 1PU9A 4AVCA 2Q44A 2B4BA 5KTAA 4UWJA 4KOTA 1NMTA 4R3LA 1XEBA 4DNCA 4II9A 4C2ZA 4XNHC 1OZPA 2VXKA 2G3AA 4H6ZA 5G20A 2BL1A 3GKRA 4I49A 4KVOE 1K4JA 4JXQA 2OZUA 1M4DA 4C2XA 3BJ7A 4CAVA 4JLYA 1RXTA 3JUWA 4F0YA 2B5GB 1B87A 3VWDA 3S6HA 1CM0A 1QSRA 4MJ8A 1QSOA 2DXQA 3IWEA 2Z3NA 2ATRA 2F5IA 4H89A 4NCZA 2YNEA 2NMTA 2Z3LA 1RO5A 4B5PA 4KUBA 4R9MA 1KUYA 2PR8A 4QC6A 2P6GA 4UA3A 1CJWA 4KOWA 2VI7A 4L89A 4QUSA 1XIXA 2HQYA 1SQHA 2PRBA 2B4DB 2OU2A 2REFA 4RS2A 1PUAA 5ISVA 1KZFA 4LUAA 3GYAA 2Z3KA 5E96A 5H84A 4MFZA 5AGEA 5DWNA 3EY5A 2FIWA 3DR8A 3IWGA 4OAEA 3DDDA 5F49A 3FBUA 3C26A 4Y49B 1B6BA 1L0CA 1KUVA 5HH1A 5C82A 5CNPA 2GE3A 1Q2YA 2CY2A 4UFVA 2PR1A 2AJ6A 3CXQA 3D2MA 4PK2A 3TO9A 1IIDA 3B8GA 4CAXA 4YRHA 5I0CA 4LX9A 4QVTA 4CYNA 1BOBA 2YNDA 3VWEA 2CXAA 1S7NA 1ZO0A 4E8OA 4CS0B 2YNCC 2I00A 2VEZA 2BSWA 2K5TA 5DWMA 3TFYA 2VQYA 5IX3A 1UFHA 2O28A 4E2AA 3TOBA 2ZW4A 1MJAA 4OLLA 3GY9A 4ZGYB 4XNHB 4PV6A 3EC4A 3KKWA 5F46A 3W91A 1YGHA 4CAWA 3PGPA 1Q2CA 1S5KA 2D4PA 4KOYA 2QMLA 3ZJ0A 4UCPA 4UFWA 4CAFA 4XPKA 2P6EA 5EBVA 3R9EA 4C7HA 2QECA 3TCVA 2JLMA 1Y9KA 4AVAA 3I9SA 2ZXVA 3TOAA 2DPSA 2OB0A 3QAHA 2P0WA 1Y9WA 3EXNA 4MI4A 1M44A 3BLNA 1I12A 2P6FA 3R9GA 4C7IA 3TTHA 4B5PB 4KLVA 4F6AA 1MK4A 2FXFA 2CNMA 1IB1E 1S7KA 2Q04A 3R9FA 1YX0A 2Z3PA 1IYLA 1XMTA 1M4GA 4IUSA 3D8PA 3F0AA 2HV2A 2I79A 4ZBGA 4L8AA 5A28A 4UCMA 2G0BA 2JDCA 2Q7BA 2B58A 4A31A 2BEIA 3S6FA 1YVKA 3RYOA 4NEXA 3UY5A 3IGRA 1BO4A 1GHEA 4CGOA 1IICA 3DSBA 4IF5A 3SXOA 2JDDA 3P2HA 1S3ZA 2G3TA 4MY3A 2ZW5A 1J4JA 4CYPA 4UFXA 5IB0A 4MFPA 2CNSA 3R1KA 5AG6A 2B3VA 4AG9A 4KZTA 2DPTA 3R95A 4XPDC 2YNCA 4XPLA 5BWAB 1YLEA 1S60A 5J8FA 2C27A 4KLWA 2Q4YA 2YGWA 4FD7A 4CGLA 1I1DA 2VBQA 2OZGA 3W6SA 4MBUA 1QSMA 4JD6A 4MY0A 5AG7A 2AE6A 1VHSA 2PQ8A 4MHDA 4B5OA 4ORFA 1IYKA 2WSAA 1YK3A 5EC4A 4FD6A 2REEA 3FRMA 4B10A 3H5ZA 2ZPAA 4C68A 4EVYA 3IU2A 4R3KA 2ZW6A 4ONUA 3FXTA 2FT0A 5AG4A 1TIQA 3JTKA 4U9ZA 4KOSA 1YVOA 2J8RA 3D3SA 4YGOA 5JPHA 4AB7A 1MJBA 4KVXA 3WR7A 2Q0YA 4HNXB 4MFKA 1WK4A 2Y0MA 3T9YA 1R57A 4A33A 3W6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A2Z A;  5AG5 A;  4CGN A;  4UFV A;  4UCN A;  5G21 A;  4A95 A;  4C2Z A;  4CGP A;  4CGL A;  5AG4 A;  3IWE A;  3JTK A;  4CGM A;  2WUU A;  4CYQ A;  4BBH A;  4CGO A;  5AGE A;  4B14 A;  2YNE A;  4A30 A;  4CAE A;  5G20 A;  5G1Z A;  4B12 A;  4B13 A;  4CYP A;  4B11 A;  4UFX A;  4C2Y A;  4CYN A;  5AG7 A;  2YND A;  5AG6 A;  4A32 A;  4CYO A;  5A28 A;  4C2X A;  4UCM A;  4UCP A;  4UFW A;  2WSA A;  5A27 A;  2YNC C;  4CAF A;  4A31 A;  4B10 A;  3H5Z A;  4C7I A;  2YNC A;  5G22 A;  4C68 A;  3IU1 A;  4A33 A;  4C7H A;  3IU2 A; 
#chains in the Genus database with same CATH topology
 1ZG9 A;  2V8G A;  4KSF A;  4MMO A;  5AG5 A;  1MJ9 A;  3P2F A;  5K8O A;  3GUX A;  1VIX A;  2PC1 A;  4CRY B;  4OC2 A;  2GIV A;  2WUU A;  4CYQ A;  5IB9 A;  3N7Z A;  3G3S A;  2FSR A;  4CAE A;  2ANP A;  4IHM A;  2PDO A;  1N71 A;  4GS4 A;  2AFW A;  2PE3 A;  2GAN A;  3SI0 A;  4M3S A;  3TO6 A;  1M1D A;  1Z8T A;  5HVG A;  3SXN A;  2EUI A;  4F0X A;  2GLF A;  3H4Q A;  3SI2 A;  3V38 A;  1S7F A;  2B3U A;  3F8K A;  5LYF A;  2R8V A;  4XPD B;  3LMS A;  4K30 A;  4P4J A;  1M4I A;  1Z4E A;  2PJ0 A;  4NSQ A;  4Q36 A;  2VZY A;  3GLJ A;  4UBR A;  3NFZ A;  1F57 A;  1VHE A;  2BUE A;  3H8G A;  4KOV A;  5JQ4 A;  1Z9U A;  4ZY0 A;  3FNC A;  2FCK A;  2CNT A;  3EO4 A;  4OAD A;  1U6M A;  2FS5 A;  4DYO A;  3I3G A;  4CGM A;  2JEV A;  3B3V A;  1Y7E A;  4PSW A;  2CF4 A;  5F47 A;  4UWI A;  2WZN A;  2QIR A;  4OC0 A;  4NXY A;  1LAM A;  3VAT A;  5G1Z A;  2VZZ A;  2D4O A;  4UF4 A;  1Y0R A;  3BJ8 A;  2Z0Z A;  4MFJ A;  3WC5 A;  1I21 A;  3LOD A;  4OC1 A;  3CXP A;  4GXH A;  3N5F A;  4JJX A;  4IK2 A;  4CPA A;  1NE9 A;  1XRY A;  1P0H A;  4KUA A;  4X8I A;  4ZY2 A;  2PVV A;  1CBX A;  1RTQ A;  5KTD A;  5K8P A;  2J8N A;  3F5B A;  1LRZ A;  5G22 A;  3BI0 A;  4E0A A;  1Y7R A;  2C6G A;  2ABZ A;  3IU1 A;  3K9U A;  3OWC A;  4NGT A;  5K8M A;  4KVM E;  3B35 A;  4CGN A;  4TWE A;  1LAP A;  3MGD A;  3CXS A;  4H6U A;  3NA6 A;  1KUX A;  4HKF A;  4A95 A;  2PJ2 A;  3TE4 A;  3NH4 A;  3PBB A;  4BBH A;  4FD5 A;  1FY7 A;  2X7B A;  4Q7A A;  5F48 A;  4CRZ B;  4B14 A;  5IV0 A;  2ZEM A;  1Q2D A;  4B13 A;  2FIA A;  4U5Y A;  2R7H A;  4R87 A;  4EWT A;  3MN8 A;  3S6K A;  1WWZ A;  2B5G A;  2BO9 A;  5GCN A;  1Z4R A;  4A32 A;  4CYO A;  2Z11 A;  3S6G A;  2POK A;  2V8V A;  3PZJ A;  1BLL E;  2BOA A;  2Z3M A;  2WPX A;  2IL4 A;  2R1I A;  2V77 A;  4KS9 A;  2EVN A;  3FMC A;  4M6H A;  1Z8X A;  4A2Z A;  3EFA A;  1YR0 A;  4Y49 C;  1PCA A;  2J8M A;  5C88 A;  2Z3O A;  1R43 A;  5G21 A;  2Q4V A;  1DE4 C;  2EK9 A;  4CGP A;  5F09 A;  2EO8 A;  1DTD A;  3QB8 A;  4FD4 A;  3MRU A;  4OME A;  4X5K A;  3ZZI A;  1TKF A;  2QVP A;  4MFQ A;  3LWU A;  1BPM A;  2HUZ A;  3SJX A;  1CX8 A;  3V8I A;  3PB7 X;  1ZLH A;  2PIY A;  4NGR A;  5LRG A;  1S7L A;  3TO7 A;  4HPS A;  4B12 A;  1CG2 A;  2RC4 A;  2AFZ A;  4DJL A;  2B4D A;  1XE4 A;  4R57 A;  4PXC A;  1ON0 A;  4JWP A;  2ZEH A;  3R96 A;  3K2K A;  3JVN A;  2A4N A;  1PYT B;  1KWM A;  4MFL A;  1QQ9 A;  4X3R A;  5HMN A;  5KTC A;  3IEH A;  4PSX A;  1ZG8 A;  1NSL A;  4BMH A;  3NE7 A;  4M6I A;  1IY7 A;  2PSW A;  3KQX A;  4KOX A;  2C1C A;  2ZEN A;  1TXR A;  3IJ3 A;  3PB9 X;  2ZW7 A;  2FE7 A;  4Z65 A;  3B2Y A;  4KSA A;  5LYD A;  2R98 A;  3T90 A;  4QB9 A;  2GU2 A;  2PJ7 A;  4ZYQ A;  5CBM A;  1XBU A;  3DR6 A;  3PP9 A;  1Q7L A;  2BCO A;  2OZH A;  1UWY A;  3TT2 A;  3HLP A;  4A30 A;  1CPX A;  2ARH A;  2OH1 A;  4KOU A;  5FVJ A;  5J8C A;  1V0C A;  1HDU A;  2PJ1 A;  3KI9 A;  4M85 A;  4B11 A;  3E0K A;  4JXR A;  4C2Y A;  2KCW A;  3CPA A;  2IJZ A;  3LD2 A;  2Q7S A;  4J3G A;  1P4N A;  2IMO A;  1FNO A;  3FIX A;  3G8W A;  3FYN A;  1YQE A;  5A27 A;  4PK3 A;  1ELM P;  1XF8 A;  2JBJ A;  3PBE A;  3KQZ A;  1NSA A;  1IGB A;  2PJA A;  2PJ6 A;  4OC3 A;  1QST A;  4HNY B;  4QBJ A;  4AVB A;  1A2Z A;  4X2T A;  4TNU A;  2FL4 A;  3FB3 A;  4NF1 A;  4P4B A;  4UCN A;  3A9L A;  1QSN A;  4KOR A;  2DF5 A;  2Z10 A;  3CZX A;  3DNS A;  4F8Z A;  3SHP A;  4HNW B;  4Q38 A;  4YFJ A;  3B3W A;  5K8N A;  4AG7 A;  4FWU A;  2F7V A;  5H86 A;  2WPW A;  4RI1 A;  4U9Y A;  3D2P A;  2H5M A;  1VKC A;  2V8H A;  3FX6 A;  1YRE A;  4OID A;  4ZX8 A;  1PU9 A;  4AVC A;  2Q44 A;  2CIJ A;  3FEE A;  3NH8 A;  5LYL A;  2V8D A;  2B4B A;  1IOI A;  3LAC A;  5KTA A;  4UWJ A;  2JBK A;  4KOT A;  1NMT A;  4R3L A;  1XEB A;  3DLJ A;  4DNC A;  4II9 A;  4C2Z A;  4XNH C;  1OZP A;  1OBR A;  2VL1 A;  2VXK A;  1ELL P;  2G3A A;  4H6Z A;  2F8H A;  5G20 A;  2BL1 A;  3K9T A;  3GKR A;  4I49 A;  1K4J A;  4KVO E;  4R76 A;  1JWQ A;  1Z8W A;  4JXQ A;  1CP6 A;  1M4D A;  2OZU A;  4C2X A;  3BJ7 A;  4DUK A;  4R8F A;  4CAV A;  1YME A;  4JLY A;  2GLJ A;  1RXT A;  3JUW A;  1JQG A;  3S9N A;  4NGM A;  4F0Y A;  2ZED A;  2Q43 A;  4UEF A;  2B5G B;  1B87 A;  2ZEL A;  4MHZ A;  4H2K A;  4G1P A;  3VWD A;  1M4L A;  1AUG A;  1CM0 A;  3S6H A;  4MCR A;  1VGY A;  1YW4 A;  1QSR A;  4MJ8 A;  1QSO A;  2DXQ A;  3IWE A;  3L2N A;  2Z3N A;  3WC6 A;  2ATR A;  4YU9 A;  2F5I A;  4H89 A;  4ZY1 A;  4NCZ A;  2C6C A;  2YNE A;  2NMT A;  2Z3L A;  4PXD A;  2NYQ A;  3S9L A;  2ZEP A;  1RO5 A;  5ELY A;  4B5P A;  4KUB A;  4R9M A;  5CPA A;  3RAM A;  1KUY A;  4KSI A;  2PR8 A;  3PEI A;  4QC6 A;  2AFU A;  2P6G A;  4UA3 A;  1CJW A;  2HC9 A;  3RNZ A;  4KOW A;  4UEZ A;  2VI7 A;  2Q51 A;  2PJ3 A;  3IIB A;  4L89 A;  4QUS A;  2PCU A;  1XIX A;  2HQY A;  1SQH A;  4NGS A;  3BHX A;  1XMB A;  2PRB A;  2B4D B;  2OU2 A;  2REF A;  4RS2 A;  1PUA A;  3GIU A;  1ZLI A;  4R6T A;  3D7F A;  4MCS A;  7CPA A;  3WAB A;  3PFE A;  5ISV A;  1KZF A;  2J9A A;  3GYA A;  2Z3K A;  4LUA A;  4NGQ A;  5E96 A;  5H84 A;  8CPA A;  3NE8 A;  4MFZ A;  5AGE A;  5DWN A;  5LRJ A;  3EY5 A;  4P4F A;  2FIW A;  4EFD A;  4NGP A;  5HXD A;  2PJB A;  3DR8 A;  3FVL A;  4LQ6 A;  2AFX A;  2PJ4 A;  3IWG A;  4OAE A;  3DDD A;  3PB6 X;  5F49 A;  2EBJ A;  2PJ5 A;  4NJQ A;  4OKO A;  4RN7 A;  3FBU A;  3C26 A;  4Y49 B;  3WC7 A;  1B6B A;  1L0C A;  1KUV A;  2CTC A;  4RUH A;  5HH1 A;  5C82 A;  2AFO A;  5CNP A;  1F2P A;  3FEC A;  2GE3 A;  1Q2Y A;  3B3C A;  3D7G A;  2CY2 A;  4UFV A;  2PR1 A;  3RO0 A;  3RZA A;  1X10 A;  2AJ6 A;  4MHN A;  3BI1 A;  1VHO A;  3CXQ A;  3D2M A;  4PK2 A;  4WWV A;  1IID A;  3B8G A;  1IOF A;  2JEW A;  2PVW A;  3TO9 A;  4CAX A;  4YRH A;  5I0C A;  3KHZ A;  5JH9 A;  5J1Q A;  4LX9 A;  4QVT A;  1HDQ A;  1HEE A;  4P10 A;  4PPZ A;  4CYN A;  1BOB A;  2YND A;  3VWE A;  1XFO A;  2CXA A;  1S7N A;  1ZO0 A;  4JZ0 A;  4E8O A;  4O23 A;  3QNV A;  4CS0 B;  2YNC C;  2I00 A;  2ODF A;  2VEZ A;  2XEJ A;  3KZW A;  2OOT A;  2BSW A;  2K5T A;  5DWM A;  2RB7 A;  3TFY A;  1CPS A;  2VQY A;  4PXB A;  5IX3 A;  2ZEE A;  1UFH A;  4A39 A;  2O28 A;  4E2A A;  3TOB A;  2GFQ A;  2ZW4 A;  5I4M A;  4FAI A;  1AMP A;  4UIA A;  1MJA A;  4OLL A;  3GY9 A;  1TF8 A;  4ZGY B;  4XNH B;  4YWY A;  4PV6 A;  4EME A;  3EC4 A;  3KKW A;  5F46 A;  3W91 A;  1YGH A;  1TKH A;  3JRU A;  4CAW A;  3PGP A;  4MHP A;  1Q2C A;  2PJ9 A;  1S5K A;  2D4P A;  4KOY A;  2QML A;  3ZJ0 A;  4NGN A;  4UCP A;  3SJG A;  4UFW A;  2WYR A;  3KL9 A;  4CAF A;  2XEI A;  4XPK A;  2O4H A;  2P6E A;  5EBV A;  3KAS A;  2QJ8 A;  3R9E A;  4C7H A;  2QEC A;  3V7Z A;  1R3N A;  3TCV A;  1BPN A;  4W9Y A;  4UIB A;  4A37 A;  4GM5 A;  1YW6 A;  2CTB A;  2JLM A;  4BD9 A;  1Y9K A;  1XOV A;  1CP7 A;  4AVA A;  3I9S A;  3D7H A;  2ZXV A;  4LQG A;  1YSJ A;  2DPS A;  3TOA A;  1AYE A;  2OB0 A;  3WT4 A;  3QAH A;  2P0W A;  1Y9W A;  3EXN A;  3IWW A;  3IC1 A;  4MRI A;  3QAY A;  4MI4 A;  1M44 A;  2AFS A;  3BLN A;  4ZX9 A;  2ZOF A;  2I3C A;  1I12 A;  3KR5 A;  2P6F A;  5D29 A;  4A94 A;  3R9G A;  4C7I A;  3D66 A;  3TTH A;  4B5P B;  4K3N A;  3FH4 A;  4MCP A;  4UEE A;  1F2O A;  4KLV A;  2RFH A;  3NH5 A;  4P4E A;  4F6A A;  1GYT A;  1MK4 A;  2FXF A;  2ZEF A;  2CNM A;  3D7D A;  3FJU A;  2XEG A;  3D4U A;  4NJR A;  3PB4 X;  1IB1 E;  1S7K A;  1FT7 A;  3TX8 A;  2Q04 A;  3R9F A;  1YX0 A;  1H8L A;  2Z3P A;  3CDX A;  1IYL A;  1XMT A;  1M4G A;  2C6P A;  4IUS A;  5HVH A;  1ARM A;  3D8P A;  3F0A A;  2HV2 A;  2I79 A;  3DGV A;  4IAV A;  4ZBG A;  4OP4 A;  1BAV A;  4L8A A;  5A28 A;  4UCM A;  1Z2L A;  2Q4Z A;  2EK8 A;  2G0B A;  1TF9 A;  3SI1 A;  2DEA A;  2JDC A;  2Q7B A;  2B58 A;  3I1U A;  5JGF A;  4A31 A;  3RBU A;  2G9D A;  3B3S A;  2BEI A;  3S6F A;  1YVK A;  3RYO A;  4NEX A;  2HB6 A;  1QMU A;  1Y0Y A;  3UY5 A;  4PXE A;  3IGR A;  1Z8L A;  1BO4 A;  2PRQ A;  1GHE A;  4P45 A;  4CGO A;  4OIW A;  1IIC A;  3DSB A;  5DS0 A;  4IF5 A;  3SXO A;  2JDD A;  3P2H A;  1S3Z A;  2AFM A;  2G3T A;  4MY3 A;  2ZW5 A;  3B3T A;  1J4J A;  1YLO A;  4CYP A;  4UFX A;  3SJF A;  3CT9 A;  4MHY A;  5IB0 A;  4MFP A;  2CNS A;  3R1K A;  5AG6 A;  2QYV A;  4JYW A;  2B3V A;  3H8F A;  4AG9 A;  3D68 A;  4KZT A;  2DPT A;  2XEF A;  4XPD C;  3R95 A;  4ZI6 A;  3B7I A;  2ZEG A;  3D67 A;  2YNC A;  4XPL A;  3PRT A;  1ZG7 A;  5BWA B;  1YLE A;  1S60 A;  4F9V A;  5J8F A;  1X12 A;  2C27 A;  2IQ6 A;  3ISX A;  4KLW A;  3KHX A;  2Q4Y A;  2YGW A;  3GB0 A;  4FD7 A;  4CGL A;  1I1D A;  1LCP A;  2VBQ A;  2OZG A;  4P6Y A;  2EWB A;  4MCQ A;  3W6S A;  4MBU A;  3H8E A;  1TKJ A;  1QSM A;  4OC5 A;  4JD6 A;  4WJB A;  3CPX A;  2PJC A;  4P4D A;  2OR4 A;  2GRE A;  4B6Z A;  4MY0 A;  2NSM A;  5LRK A;  2PIZ A;  5AG7 A;  4FBE A;  4FUU A;  2AE6 A;  1VHS A;  1LAN A;  2PQ8 A;  4MHD A;  4A38 A;  4B5O A;  4ORF A;  4PQA A;  1IYK A;  2WSA A;  1YK3 A;  5EC4 A;  5JM6 A;  2ZOG A;  1Z5R A;  2REE A;  4FD6 A;  3FRM A;  3VH9 A;  4BIN A;  4P44 A;  4B10 A;  4F9U A;  3H5Z A;  2ZPA A;  6CPA A;  3TC8 A;  4C68 A;  4EVY A;  3T8W A;  3IU2 A;  4R3K A;  2ZW6 A;  1XJO A;  4ONW A;  2PJ8 A;  4ONU A;  4OC4 A;  3PB8 X;  3FXT A;  2FT0 A;  3KGQ A;  4P4I A;  1IU8 A;  5AG4 A;  1EE3 P;  2ZEO A;  1TIQ A;  5D8N A;  3JTK A;  4U9Z A;  3FF3 A;  4KOS A;  3KR4 A;  4MXU A;  3IFE A;  2O53 A;  1YVO A;  2J8R A;  3D3S A;  4YGO A;  5HVF A;  1LFW A;  5JPH A;  5EMI A;  1ARL A;  4R7M A;  4AB7 A;  2FVG A;  5LYI A;  1MJB A;  3PFO A;  4KVX A;  1LOK A;  3WR7 A;  3IO1 A;  2Q0Y A;  4HNX B;  4M6G A;  5THW A;  4MFK A;  3ISZ A;  1WK4 A;  2Y0M A;  3FED A;  3T9Y A;  3S9M A;  4NFR A;  3VAR A;  3HUV A;  4AXV A;  1R57 A;  3SJE A;  3BXM A;  4A33 A;  3W6X A; 
#chains in the Genus database with same CATH homology
 4KSF A;  5AG5 A;  1MJ9 A;  3P2F A;  2PC1 A;  4CRY B;  2GIV A;  2WUU A;  4CYQ A;  3N7Z A;  3G3S A;  2FSR A;  4CAE A;  2PDO A;  1N71 A;  4GS4 A;  2GAN A;  4M3S A;  3TO6 A;  1M1D A;  3SXN A;  2EUI A;  4F0X A;  3H4Q A;  1S7F A;  2B3U A;  3F8K A;  2R8V A;  4XPD B;  4K30 A;  1M4I A;  1Z4E A;  4NSQ A;  4Q36 A;  2VZY A;  4UBR A;  4KOV A;  2BUE A;  5JQ4 A;  1Z9U A;  3FNC A;  2FCK A;  2CNT A;  3EO4 A;  4OAD A;  1U6M A;  2FS5 A;  3I3G A;  4CGM A;  2JEV A;  4PSW A;  5F47 A;  4UWI A;  2QIR A;  4NXY A;  5G1Z A;  2VZZ A;  2D4O A;  3BJ8 A;  2Z0Z A;  4MFJ A;  1I21 A;  3LOD A;  3CXP A;  4JJX A;  1NE9 A;  1P0H A;  4KUA A;  5KTD A;  2J8N A;  3F5B A;  1LRZ A;  5G22 A;  4E0A A;  1Y7R A;  3IU1 A;  3OWC A;  3K9U A;  4KVM E;  4CGN A;  3MGD A;  4H6U A;  3CXS A;  4HKF A;  1KUX A;  4A95 A;  3TE4 A;  4BBH A;  4FD5 A;  1FY7 A;  2X7B A;  4CRZ B;  5F48 A;  4B14 A;  5IV0 A;  1Q2D A;  4B13 A;  2FIA A;  4U5Y A;  2R7H A;  4R87 A;  3S6K A;  1WWZ A;  2B5G A;  5GCN A;  1Z4R A;  4A32 A;  4CYO A;  2Z11 A;  3S6G A;  3PZJ A;  2Z3M A;  2WPX A;  2IL4 A;  2R1I A;  4KS9 A;  2EVN A;  4A2Z A;  3EFA A;  1YR0 A;  4Y49 C;  2J8M A;  5C88 A;  2Z3O A;  5G21 A;  2Q4V A;  4CGP A;  3QB8 A;  4FD4 A;  3ZZI A;  4X5K A;  4MFQ A;  3V8I A;  2HUZ A;  1S7L A;  3TO7 A;  4B12 A;  2RC4 A;  2B4D A;  1XE4 A;  4R57 A;  1ON0 A;  4JWP A;  3R96 A;  3JVN A;  2A4N A;  4MFL A;  5HMN A;  5KTC A;  4PSX A;  1NSL A;  4BMH A;  3NE7 A;  2PSW A;  4KOX A;  2ZW7 A;  2FE7 A;  4KSA A;  2R98 A;  3T90 A;  4QB9 A;  3DR6 A;  3PP9 A;  2OZH A;  3TT2 A;  4A30 A;  2ARH A;  2OH1 A;  4KOU A;  5FVJ A;  5J8C A;  1V0C A;  4B11 A;  4M85 A;  3E0K A;  4JXR A;  4C2Y A;  2KCW A;  3LD2 A;  4J3G A;  1P4N A;  3FIX A;  3G8W A;  5A27 A;  3FYN A;  4PK3 A;  1XF8 A;  1QST A;  4HNY B;  4QBJ A;  4AVB A;  2FL4 A;  3FB3 A;  4NF1 A;  4UCN A;  3A9L A;  1QSN A;  4KOR A;  2Z10 A;  3DNS A;  3SHP A;  4HNW B;  4Q38 A;  4YFJ A;  4AG7 A;  5H86 A;  2WPW A;  4RI1 A;  4U9Y A;  3D2P A;  2H5M A;  1VKC A;  1YRE A;  1PU9 A;  4AVC A;  2Q44 A;  2B4B A;  5KTA A;  4UWJ A;  4KOT A;  1NMT A;  4R3L A;  1XEB A;  4DNC A;  4II9 A;  4C2Z A;  4XNH C;  1OZP A;  2VXK A;  2G3A A;  4H6Z A;  5G20 A;  2BL1 A;  3GKR A;  4I49 A;  4KVO E;  1K4J A;  4JXQ A;  2OZU A;  1M4D A;  4C2X A;  3BJ7 A;  4CAV A;  4JLY A;  1RXT A;  3JUW A;  4F0Y A;  2B5G B;  1B87 A;  3VWD A;  3S6H A;  1CM0 A;  1QSR A;  4MJ8 A;  1QSO A;  2DXQ A;  3IWE A;  2Z3N A;  2ATR A;  2F5I A;  4H89 A;  4NCZ A;  2YNE A;  2NMT A;  2Z3L A;  1RO5 A;  4B5P A;  4KUB A;  4R9M A;  1KUY A;  2PR8 A;  4QC6 A;  2P6G A;  4UA3 A;  1CJW A;  4KOW A;  2VI7 A;  4L89 A;  4QUS A;  1XIX A;  2HQY A;  1SQH A;  2PRB A;  2B4D B;  2OU2 A;  2REF A;  4RS2 A;  1PUA A;  5ISV A;  1KZF A;  4LUA A;  3GYA A;  2Z3K A;  5E96 A;  5H84 A;  4MFZ A;  5AGE A;  5DWN A;  3EY5 A;  2FIW A;  3DR8 A;  3IWG A;  4OAE A;  3DDD A;  5F49 A;  3FBU A;  3C26 A;  4Y49 B;  1B6B A;  1L0C A;  1KUV A;  5HH1 A;  5C82 A;  5CNP A;  2GE3 A;  1Q2Y A;  2CY2 A;  4UFV A;  2PR1 A;  2AJ6 A;  3CXQ A;  3D2M A;  4PK2 A;  3TO9 A;  1IID A;  3B8G A;  4CAX A;  4YRH A;  5I0C A;  4LX9 A;  4QVT A;  4CYN A;  1BOB A;  2YND A;  3VWE A;  2CXA A;  1S7N A;  1ZO0 A;  4E8O A;  4CS0 B;  2YNC C;  2I00 A;  2VEZ A;  2BSW A;  2K5T A;  5DWM A;  3TFY A;  2VQY A;  5IX3 A;  1UFH A;  2O28 A;  4E2A A;  3TOB A;  2ZW4 A;  1MJA A;  4OLL A;  3GY9 A;  4ZGY B;  4XNH B;  4PV6 A;  3EC4 A;  3KKW A;  5F46 A;  3W91 A;  1YGH A;  4CAW A;  3PGP A;  1Q2C A;  1S5K A;  2D4P A;  4KOY A;  2QML A;  3ZJ0 A;  4UCP A;  4UFW A;  4CAF A;  4XPK A;  2P6E A;  5EBV A;  3R9E A;  4C7H A;  2QEC A;  3TCV A;  2JLM A;  1Y9K A;  4AVA A;  3I9S A;  2ZXV A;  3TOA A;  2DPS A;  2OB0 A;  3QAH A;  2P0W A;  1Y9W A;  3EXN A;  4MI4 A;  1M44 A;  3BLN A;  1I12 A;  2P6F A;  3R9G A;  4C7I A;  3TTH A;  4B5P B;  4KLV A;  4F6A A;  1MK4 A;  2FXF A;  2CNM A;  1IB1 E;  1S7K A;  2Q04 A;  3R9F A;  1YX0 A;  2Z3P A;  1IYL A;  1XMT A;  1M4G A;  4IUS A;  3D8P A;  3F0A A;  2HV2 A;  2I79 A;  4ZBG A;  4L8A A;  5A28 A;  4UCM A;  2G0B A;  2JDC A;  2Q7B A;  2B58 A;  4A31 A;  2BEI A;  3S6F A;  1YVK A;  3RYO A;  4NEX A;  3UY5 A;  3IGR A;  1BO4 A;  1GHE A;  4CGO A;  1IIC A;  3DSB A;  4IF5 A;  3SXO A;  2JDD A;  3P2H A;  1S3Z A;  2G3T A;  4MY3 A;  2ZW5 A;  1J4J A;  4CYP A;  4UFX A;  5IB0 A;  4MFP A;  2CNS A;  3R1K A;  5AG6 A;  2B3V A;  4AG9 A;  4KZT A;  2DPT A;  3R95 A;  4XPD C;  2YNC A;  4XPL A;  5BWA B;  1YLE A;  1S60 A;  5J8F A;  2C27 A;  4KLW A;  2Q4Y A;  2YGW A;  4FD7 A;  4CGL A;  1I1D A;  2VBQ A;  2OZG A;  3W6S A;  4MBU A;  1QSM A;  4JD6 A;  4MY0 A;  5AG7 A;  2AE6 A;  1VHS A;  2PQ8 A;  4MHD A;  4B5O A;  4ORF A;  1IYK A;  2WSA A;  1YK3 A;  5EC4 A;  4FD6 A;  2REE A;  3FRM A;  4B10 A;  3H5Z A;  2ZPA A;  4C68 A;  4EVY A;  3IU2 A;  4R3K A;  2ZW6 A;  4ONU A;  3FXT A;  2FT0 A;  5AG4 A;  1TIQ A;  3JTK A;  4U9Z A;  4KOS A;  1YVO A;  2J8R A;  3D3S A;  4YGO A;  5JPH A;  4AB7 A;  1MJB A;  4KVX A;  3WR7 A;  2Q0Y A;  4HNX B;  4MFK A;  1WK4 A;  2Y0M A;  3T9Y A;  1R57 A;  4A33 A;  3W6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...