4CGLA

Leishmania major n-myristoyltransferase in complex with an aminoacylpyrrolidine inhibitor
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
411
structure length
411
Chain Sequence
b'AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Diverse Modes of Binding in Structures of Leishmania Major N-Myristoyltransferase with Selective Inhibitors
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 119
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cglA00
5G21A 4UFWA 5G20A 5AG6A 4A32A 4C7IA 5AGEA 5A28A 4B14A 4UCNA 4BBHA 4CYPA 5AG4A 3IU2A 4A30A 4CAFA 4A33A 4C2XA 4C2ZA 2YNCC 4B12A 4CYQA 2WSAA 5G1ZA 4A95A 4CAEA 4CYNA 4B10A 5AG5A 2YNEA 4A2ZA 5G22A 3IWEA 4A31A 4B13A 3IU1A 4CYOA 4B11A 4CGOA 4UFXA 4CGLA 2WUUA 4CGNA 4UCMA 4C68A 4C7HA 4CGPA 2YNDA 3JTKA 5AG7A 4C2YA 4UCPA 4UFVA 2YNCA 5A27A 4CGMA 3H5ZA
chains in the Genus database with same CATH superfamily
2WYRA 3NH8A 3IFEA 3VATA 2ZPAA 2V77A 4CRYB 3S6FA 5AGEA 4Y49C 1Q2CA 1QQ9A 2ZEEA 3FNCA 4BBHA 3CPAA 1R57A 2ATRA 1IYLA 3IEHA 3NH4A 4KSAA 4FD4A 1QSTA 4A33A 4B6ZA 4C2XA 4E0AA 2WSAA 4KS9A 4MI4A 4CAEA 5LYDA 2D4PA 4OC1A 3BXMA 2PRQA 4MY0A 3D7DA 3R95A 4R87A 5K8MA 1IIDA 4Q7AA 3JUWA 3PB4X 2XEIA 3QNVA 2Q43A 4B5OA 3GB0A 1F2OA 1SQHA 2WUUA 4G1PA 3FXTA 1BPMA 2REFA 3FRMA 2PJ6A 5BWAB 1V0CA 3WC6A 4GM5A 2J8MA 2I3CA 4PXCA 2C27A 3B3CA 3D8PA 2R7HA 1B6BA 4QB9A 2F7VA 3TO9A 3D4UA 1XIXA 2RC4A 2BSWA 2GLFA 3GKRA 2J8NA 2Z11A 3FYNA 3KHZA 3IU2A 2H5MA 4NEXA 4W9YA 3IIBA 4O23A 3R1KA 2VZYA 3FIXA 4KOWA 2OB0A 1Y0RA 2YNEA 3CXSA 3FEEA 3B3WA 4QC6A 3D67A 4OP4A 4DNCA 3D66A 4NGSA 1AYEA 2Z3LA 3IJ3A 2OU2A 4XPDC 3T8WA 3IU1A 2Q44A 3NH5A 1LANA 3FJUA 3KZWA 5IV0A 2B4BA 4MHZA 1A2ZA 1CJWA 2PJ8A 3OWCA 2Z3PA 1NSLA 4PK2A 4MFZA 5GCNA 4UCPA 4KSFA 4HNWB 5I0CA 4FWUA 4ORFA 2Z3KA 2O28A 3H5ZA 4ZX8A 1XBUA 2J8RA 5G20A 4MFKA 1M4GA 2B5GB 4PQAA 4JZ0A 4OC2A 4PV6A 4CAXA 1RTQA 4NJRA 2PIZA 5FVJA 3F8KA 3IWGA 1Z9UA 1XOVA 4P4DA 4OIDA 3W91A 3WC7A 4LUAA 3DDDA 2FL4A 5G1ZA 4NGQA 1TXRA 4RUHA 5AG5A 2AFMA 4A2ZA 4R9MA 1MJ9A 5JGFA 2JBJA 3CZXA 2ZEPA 3NFZA 3TTHA 2EWBA 4JXQA 4R3KA 2QYVA 4KZTA 1NE9A 2C6CA 2ZEHA 5C88A 4CGOA 4ZY1A 1XEBA 3DSBA 4CGPA 3CDXA 2ZW4A 3I3GA 3IGRA 2BL1A 2HV2A 2VZZA 4F8ZA 1VGYA 1KUVA 2ZELA 4IAVA 4H89A 1QSMA 3VARA 2PJBA 3PB6X 1Z8XA 2IJZA 2B3UA 3D7HA 3V38A 2GLJA 4PXBA 4AVBA 1ZG7A 4EFDA 4XNHB 4UEEA 2DPTA 5F47A 4CYPA 2PSWA 2VI7A 2Z3MA 1WK4A 3EO4A 2EUIA 2PR8A 4A95A 4A37A 4HNXB 1MJAA 3KR5A 3T9YA 3MRUA 3PB9X 3TC8A 3TOBA 3FB3A 1UWYA 1YVKA 3RBUA 1LAMA 2Z0ZA 2PVWA 3KQZA 3WR7A 3DR8A 3EY5A 4GXHA 2EBJA 3H8FA 4EMEA 1I1DA 3E0KA 4HPSA 1ELLP 2V8GA 2ZW6A 5EC4A 1HDQA 2AJ6A 4KLVA 1IYKA 2BUEA 2I79A 1VHEA 2GE3A 2G3TA 2HB6A 1ARMA 2IL4A 4FD7A 3TO6A 4ZGYB 1F57A 4F6AA 8CPAA 4KLWA 3B3VA 1ELMP 2RB7A 4A94A 4CYNA 5KTDA 2CF4A 4UIBA 3SJFA 2AE6A 4CAVA 5CBMA 4X3RA 1TF9A 5G22A 4CRZB 4E2AA 4MMOA 3DNSA 2AFZA 2R98A 1KWMA 3TT2A 4CGLA 3RO0A 2OZGA 4ZBGA 3S6KA 1P0HA 3KGQA 5LRGA 3D7GA 2HC9A 5LRKA 3IWWA 4CAWA 2JDDA 4P6YA 4X5KA 4BMHA 3QAYA 4UA3A 4ZY0A 1M44A 1KUXA 2P6FA 3EC4A 1DTDA 1YQEA 4KVXA 4CAFA 4QBJA 2VBQA 4UWJA 4F9VA 4Q36A 4B12A 4RS2A 3ISZA 3B35A 3KI9A 1MK4A 2CXAA 1CP7A 2G0BA 1LRZA 1R43A 2HQYA 3G8WA 3TCVA 4UBRA 4OAEA 4L89A 2DPSA 1LAPA 1M4DA 3P2HA 2BEIA 3LODA 1Y9KA 1Z5RA 1ZLHA 4UWIA 3S9LA 3KASA 1RXTA 4I49A 3W6XA 5KTCA 3CT9A 1QMUA 1VHOA 1ZO0A 1IU8A 4MHNA 5AG7A 5THWA 3ZJ0A 1Z4EA 3GLJA 1I12A 5K8NA 3PEIA 4R7MA 5G21A 1U6MA 2OH1A 2YGWA 1M1DA 2PJAA 1JQGA 3TO7A 4P10A 4WWVA 1TF8A 1BO4A 3EXNA 4UCNA 2PVVA 1Z2LA 3R96A 1HEEA 3BI0A 4XPDB 4CYQA 3VWEA 3HLPA 2PIYA 2PJCA 4MY3A 1NMTA 1B87A 4UIAA 1IGBA 3FECA 2Z3NA 1NSAA 3SI2A 3CPXA 4UEZA 1XF8A 1S7FA 1XMTA 2DF5A 2GIVA 4KOYA 4NGMA 5CNPA 4FD5A 4AXVA 2BO9A 2PRBA 3V8IA 4GS4A 2ZEMA 5HXDA 4R8FA 4YFJA 2CIJA 3FX6A 3D68A 1PU9A 4MCQA 1IY7A 2FT0A 1GHEA 2WPWA 3BHXA 3MGDA 1CX8A 5F48A 4UFWA 2ZW5A 3HUVA 1RO5A 1EE3P 2WPXA 5A28A 1KZFA 4B14A 2ABZA 4X2TA 4F0YA 2F8HA 2PJ7A 3PRTA 4OMEA 2IMOA 3H8EA 1CPXA 4WJBA 2YNCC 2CNTA 5K8OA 5JPHA 3C26A 3KL9A 3KQXA 4YRHA 2PJ3A 4E8OA 4FBEA 5F09A 2PJ0A 3W6SA 1TKJA 3GYAA 4NGNA 4OADA 3SJXA 1HDUA 4A31A 1BOBA 1FY7A 3NE8A 4KVOE 1LCPA 4U9YA 4CYOA 2PR1A 4JXRA 5DWNA 3S9MA 5J1QA 2CTCA 5LRJA 3S9NA 3UY5A 4CPAA 4MRIA 1DE4C 4UEFA 3PBBA 4AVCA 2Q4YA 5K8PA 4PPZA 1IB1E 1YLOA 1OBRA 4FD6A 4R76A 3R9EA 3D2PA 4RN7A 3SJGA 5F46A 3ISXA 2IQ6A 1Q2DA 2PQ8A 4P4BA 2P0WA 4LX9A 3BJ8A 1S7KA 3F0AA 1CG2A 5HVGA 3EFAA 3H4QA 1X10A 1R3NA 3A9LA 4IK2A 3TE4A 4R57A 1I21A 1Y7EA 4HNYB 1PUAA 3GUXA 1VKCA 5DWMA 4L8AA 5H86A 5LYIA 2RFHA 3IWEA 5ISVA 4OLLA 1Q7LA 1S7LA 3PFOA 1YSJA 4JJXA 5JQ4A 3CXQA 4TWEA 4DJLA 1VHSA 2EK9A 2GFQA 3G3SA 3QAHA 4Q38A 3TX8A 4AB7A 2GANA 3GY9A 4UCMA 3K9TA 2CNSA 2G3AA 2XEGA 1YX0A 2JBKA 4P4FA 4FUUA 4DUKA 4Z65A 1FNOA 3FVLA 2NSMA 1Y0YA 1UFHA 4K3NA 4MFLA 4MHPA 5CPAA 3WT4A 4OIWA 4A32A 2O4HA 4BD9A 3CXPA 2JDCA 3VWDA 5D29A 2AFOA 2P6EA 5KTAA 1S5KA 1FT7A 2Y0MA 4LQ6A 4XNHC 5HVFA 1YK3A 4KORA 3NE7A 1QSRA 3F5BA 1IOFA 1Z8TA 2O53A 2G9DA 2GREA 3KR4A 1L0CA 1K4JA 3B8GA 1BPNA 5F49A 4K30A 2EO8A 4NGPA 4ONUA 4R3LA 4Y49B 4UFVA 2X7BA 2FSRA 2QJ8A 3JRUA 4MHDA 1X12A 4MBUA 3R9GA 4MFPA 3D7FA 4KVME 3WC5A 3BJ7A 2PJ2A 4U5YA 2FVGA 2ZOGA 1S3ZA 5J8CA 4A30A 3LMSA 3RNZA 5IX3A 2V8HA 4MXUA 4NF1A 4FAIA 1Z8LA 3I9SA 2JLMA 1AUGA 1ZLIA 1YW4A 4P45A 3N5FA 2AFXA 3DGVA 4HKFA 2QVPA 1Q2YA 2PJ5A 4KUAA 4NGRA 2REEA 4OC0A 2ZEDA 4UF4A 4P4JA 4M6GA 4JD6A 4R6TA 2FXFA 2ODFA 4P4EA 3B3SA 3DLJA 3PGPA 5J8FA 2NYQA 4NFRA 3D3SA 3B2YA 4AG9A 3FBUA 5HH1A 2AFWA 4NCZA 2R8VA 3DR6A 3SI0A 3PB8X 3LACA 1YR0A 2VEZA 1YVOA 4PK3A 4DYOA 4EVYA 3L2NA 4KOUA 2V8VA 3D2MA 1YW6A 2FCKA 2B3VA 4M3SA 4B10A 1Z4RA 4MFQA 2C6GA 3PZJA 3I1UA 1ON0A 1IOIA 4AG7A 4C68A 4B5PA 4C7HA 1XFOA 2CNMA 2OR4A 3R9FA 4NXYA 4QUSA 2Q04A 2GU2A 1CM0A 1Z8WA 5EMIA 3RAMA 4H2KA 2R1IA 4P4IA 1AMPA 3QB8A 4J3GA 3N7ZA 2QECA 2POKA 3K9UA 1N71A 5JH9A 2CTBA 1QSNA 2FIWA 3MN8A 5AG4A 4YGOA 3GIUA 1IICA 3NA6A 4H6ZA 4C2ZA 4PSWA 4EWTA 3B7IA 2ZXVA 2ARHA 1XRYA 3ZZIA 2F5IA 4KSIA 2DEAA 4OC4A 5E96A 5I4MA 4CS0B 4MCSA 3FF3A 1H8LA 2ANPA 3FEDA 1M4IA 4MJ8A 2Z3OA 1BAVA 2HUZA 1XE4A 2C1CA 3BLNA 1MJBA 2Q4ZA 3IC1A 2FS5A 2YNDA 2AFUA 3JTKA 2B4DB 2FIAA 4KOVA 4A39A 5LYFA 2YNCA 5ELYA 1QSOA 4CGMA 1TKFA 1YLEA 7CPAA 2JEWA 2QMLA 4KUBA 4X8IA 5AG6A 1WWZA 4ZX9A 4JWPA 4C7IA 4JYWA 2AFSA 2Q7SA 1Y9WA 4H6UA 4F0XA 2XEFA 4KOTA 2V8DA 4MCRA 3RZAA 2EK8A 3PP9A 4MFJA 1JWQA 3WABA 3S6HA 4BINA 4IHMA 4KOSA 2ZOFA 2K5TA 3PB7X 2DXQA 3RYOA 6CPAA 5HVHA 3SJEA 2PJ4A 1S7NA 4ONWA 2WZNA 5HMNA 5IB0A 4YU9A 2PDOA 3P2FA 3VH9A 1S60A 5LYLA 4CGNA 2B4DA 4OC3A 1KUYA 4ZI6A 2Q4VA 4U9ZA 4RI1A 2OOTA 3B3TA 5A27A 2B5GA 4MCPA 4NGTA 3SHPA 4M6IA 3SXNA 2P6GA 1YMEA 2EVNA 3T90A 1CBXA 1ZG8A 3LWUA 2Q7BA 5IB9A 2C6PA 4IF5A 4KOXA 1LOKA 4QVTA 5DS0A 3H8GA 2A4NA 3PBEA 4II9A 1CP6A 2B58A 3TOAA 2PE3A 2PJ1A 3FMCA 1TKHA 4ZY2A 1YREA 2OZHA 2ZEGA 1LFWA 1P4NA 1ZG9A 4B13A 2I00A 2VXKA 4LQGA 2JEVA 3V7ZA 1PCAA 5JM6A 4UFXA 1J4JA 1F2PA 1XJOA 1YGHA 2Z10A 2ZEOA 2VL1A 1Y7RA 2BOAA 4XPLA 2ZENA 4C2YA 4P44A 3BI1A 1BLLE 4IUSA 2D4OA 4M85A 1M4LA 1XMBA 2NMTA 4OKOA 1GYTA 4PXDA 3FH4A 1TIQA 2ZEFA 2BCOA 1VIXA 3IO1A 2ZW7A 2KCWA 4M6HA 4A38A 1CPSA 2PC1A 2PJ9A 2CY2A 3TFYA 3LD2A 4MHYA 5D8NA 5H84A 5EBVA 3PFEA 4TNUA 5C82A 3KKWA 2QIRA 2OZUA 2J9AA 2Q51A 4YWYA 4XPKA 4F9UA 3S6GA 4NJQA 4OC5A 4AVAA 4B11A 4ZYQA 1PYTB 2FE7A 1ARLA 2PCUA 3K2KA 4JLYA 4NSQA 2XEJA 1OZPA 4PSXA 3SXOA 3KHXA 3JVNA 4B5PB 3SI1A 2Q0YA 2VQYA 4PXEA
chains in the Genus database with same CATH topology
4CRYB 2ZPAA 3S6FA 5AGEA 4Y49C 1Q2CA 3FNCA 4BBHA 1R57A 2ATRA 1IYLA 4KSAA 4A33A 4FD4A 1QSTA 4C2XA 4E0AA 2WSAA 4KS9A 4MI4A 4CAEA 2D4PA 4MY0A 3R95A 4R87A 1IIDA 3JUWA 4B5OA 1SQHA 2WUUA 3FXTA 2REFA 3FRMA 5BWAB 1V0CA 2J8MA 2C27A 3D8PA 2R7HA 1B6BA 4QB9A 3TO9A 1XIXA 2RC4A 2BSWA 3GKRA 2J8NA 2Z11A 3FYNA 3IU2A 2H5MA 4NEXA 3R1KA 2VZYA 3FIXA 4KOWA 2OB0A 2YNEA 3CXSA 4QC6A 4DNCA 2Z3LA 2OU2A 4XPDC 3IU1A 2Q44A 5IV0A 2B4BA 1CJWA 3OWCA 2Z3PA 1NSLA 4PK2A 4MFZA 5GCNA 4UCPA 4KSFA 4HNWB 5I0CA 4ORFA 2Z3KA 2O28A 3H5ZA 2J8RA 5G20A 4MFKA 1M4GA 2B5GB 4CAXA 4PV6A 5FVJA 3F8KA 3IWGA 1Z9UA 3W91A 4LUAA 3DDDA 2FL4A 5G1ZA 5AG5A 4A2ZA 4R9MA 1MJ9A 3TTHA 4JXQA 4R3KA 4KZTA 1NE9A 5C88A 4CGOA 1XEBA 3DSBA 4CGPA 2ZW4A 3I3GA 3IGRA 2BL1A 2HV2A 2VZZA 1KUVA 4H89A 1QSMA 2B3UA 4AVBA 4XNHB 2DPTA 5F47A 4CYPA 2PSWA 2VI7A 2Z3MA 1WK4A 3EO4A 2EUIA 2PR8A 4A95A 4HNXB 1MJAA 3T9YA 3TOBA 3FB3A 1YVKA 2Z0ZA 3WR7A 3DR8A 3EY5A 1I1DA 3E0KA 2ZW6A 5EC4A 2AJ6A 4KLVA 1IYKA 2BUEA 2I79A 2GE3A 2G3TA 2IL4A 4FD7A 4ZGYB 3TO6A 4F6AA 4KLWA 4CYNA 5KTDA 2AE6A 4CAVA 5G22A 4CRZB 4E2AA 3DNSA 2R98A 3TT2A 4CGLA 2OZGA 4ZBGA 3S6KA 1P0HA 4CAWA 2JDDA 4X5KA 4BMHA 4UA3A 1M44A 1KUXA 2P6FA 3EC4A 4KVXA 4CAFA 4QBJA 2VBQA 4UWJA 4Q36A 4B12A 4RS2A 1MK4A 2CXAA 2G0BA 3G8WA 1LRZA 2HQYA 3TCVA 4UBRA 4OAEA 4L89A 2DPSA 1M4DA 3P2HA 2BEIA 3LODA 1Y9KA 4UWIA 1RXTA 4I49A 3W6XA 5KTCA 5AG7A 1ZO0A 3ZJ0A 1Z4EA 1I12A 5G21A 1U6MA 2OH1A 2YGWA 1M1DA 3TO7A 1BO4A 3EXNA 4UCNA 4XPDB 4CYQA 3VWEA 4MY3A 1NMTA 1B87A 2Z3NA 1XF8A 1S7FA 1XMTA 2GIVA 4KOYA 5CNPA 4FD5A 2PRBA 3V8IA 4GS4A 4YFJA 1PU9A 3MGDA 2FT0A 1GHEA 2WPWA 5F48A 4UFWA 2ZW5A 1RO5A 2WPXA 5A28A 1KZFA 4B14A 4F0YA 2YNCC 2CNTA 5JPHA 3C26A 4YRHA 4E8OA 3W6SA 3GYAA 4OADA 4A31A 1BOBA 1FY7A 4KVOE 4U9YA 4CYOA 2PR1A 4JXRA 5DWNA 3UY5A 4AVCA 2Q4YA 1IB1E 4FD6A 3R9EA 3D2PA 5F46A 2PQ8A 1Q2DA 2P0WA 4LX9A 3BJ8A 1S7KA 3F0AA 3EFAA 3H4QA 3A9LA 3TE4A 4R57A 1I21A 4HNYB 1PUAA 1VKCA 5DWMA 4L8AA 5H86A 3IWEA 5ISVA 4OLLA 1S7LA 4JJXA 5JQ4A 3CXQA 1VHSA 3G3SA 4Q38A 3QAHA 4AB7A 2GANA 3GY9A 4UCMA 2CNSA 2G3AA 1YX0A 1UFHA 4MFLA 4A32A 3CXPA 2JDCA 3VWDA 2P6EA 5KTAA 1S5KA 2Y0MA 4XNHC 1YK3A 4KORA 3NE7A 1QSRA 3F5BA 1L0CA 1K4JA 3B8GA 5F49A 4K30A 4ONUA 4R3LA 4Y49B 4UFVA 2X7BA 2FSRA 4MHDA 3R9GA 4MBUA 4MFPA 4KVME 3BJ7A 4U5YA 5J8CA 1S3ZA 4A30A 5IX3A 4NF1A 3I9SA 2JLMA 4HKFA 1Q2YA 4KUAA 2REEA 4JD6A 2FXFA 3PGPA 5J8FA 4AG9A 3D3SA 3FBUA 5HH1A 4NCZA 2R8VA 3DR6A 1YR0A 2VEZA 1YVOA 4PK3A 4EVYA 4KOUA 3D2MA 2FCKA 2B3VA 4M3SA 4B10A 1Z4RA 4MFQA 3PZJA 1ON0A 4AG7A 4C68A 4B5PA 4C7HA 2CNMA 3R9FA 4NXYA 4QUSA 2Q04A 1CM0A 2R1IA 3QB8A 4J3GA 3N7ZA 2QECA 3K9UA 1N71A 2FIWA 1QSNA 5AG4A 4YGOA 4C2ZA 1IICA 4H6ZA 4PSWA 2ZXVA 2ARHA 3ZZIA 2F5IA 5E96A 4CS0B 1M4IA 4MJ8A 2Z3OA 2HUZA 1XE4A 3BLNA 1MJBA 2FS5A 2YNDA 3JTKA 2B4DB 2FIAA 4KOVA 2YNCA 1QSOA 4CGMA 1YLEA 2QMLA 4KUBA 5AG6A 1WWZA 4JWPA 4C7IA 4H6UA 1Y9WA 4F0XA 4KOTA 3PP9A 4MFJA 3S6HA 4KOSA 2K5TA 3RYOA 2DXQA 1S7NA 5HMNA 5IB0A 2PDOA 3P2FA 1S60A 4CGNA 2B4DA 1KUYA 2Q4VA 4U9ZA 4RI1A 5A27A 2B5GA 3SHPA 3SXNA 2P6GA 2EVNA 3T90A 2Q7BA 4KOXA 4IF5A 4QVTA 2A4NA 4II9A 2B58A 3TOAA 1YREA 2OZHA 1P4NA 4B13A 2I00A 2VXKA 2JEVA 4UFXA 1J4JA 3R96A 1YGHA 2Z10A 4XPLA 1Y7RA 4C2YA 4IUSA 2D4OA 4M85A 2NMTA 1TIQA 2ZW7A 2KCWA 2PC1A 2CY2A 3TFYA 3LD2A 5H84A 5EBVA 5C82A 3KKWA 2QIRA 2OZUA 4XPKA 3S6GA 4B11A 4AVAA 2FE7A 4JLYA 4NSQA 4PSXA 1OZPA 3SXOA 3JVNA 4B5PB 2Q0YA 2VQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G21 A;  4UFW A;  5G20 A;  5AG6 A;  4A32 A;  4C7I A;  5AGE A;  5A28 A;  4B14 A;  4UCN A;  4BBH A;  4CYP A;  5AG4 A;  3IU2 A;  4A30 A;  4CAF A;  4A33 A;  4C2X A;  4C2Z A;  2YNC C;  4B12 A;  4CYQ A;  2WSA A;  5G1Z A;  4A95 A;  4CAE A;  4CYN A;  4B10 A;  5AG5 A;  2YNE A;  4A2Z A;  5G22 A;  3IWE A;  4A31 A;  4B13 A;  3IU1 A;  4CYO A;  4B11 A;  4CGO A;  4UFX A;  4CGL A;  2WUU A;  4CGN A;  4UCM A;  4C68 A;  4C7H A;  4CGP A;  2YND A;  3JTK A;  5AG7 A;  4C2Y A;  4UCP A;  4UFV A;  2YNC A;  5A27 A;  4CGM A;  3H5Z A; 
#chains in the Genus database with same CATH topology
 2WYR A;  3NH8 A;  3IFE A;  3VAT A;  2ZPA A;  2V77 A;  4CRY B;  3S6F A;  5AGE A;  4Y49 C;  1Q2C A;  1QQ9 A;  2ZEE A;  3FNC A;  4BBH A;  3CPA A;  1R57 A;  2ATR A;  1IYL A;  3IEH A;  3NH4 A;  4KSA A;  4FD4 A;  1QST A;  4A33 A;  4B6Z A;  4C2X A;  4E0A A;  2WSA A;  4KS9 A;  4MI4 A;  4CAE A;  5LYD A;  2D4P A;  4OC1 A;  3BXM A;  2PRQ A;  4MY0 A;  3D7D A;  3R95 A;  4R87 A;  5K8M A;  1IID A;  4Q7A A;  3JUW A;  3PB4 X;  2XEI A;  3QNV A;  2Q43 A;  4B5O A;  3GB0 A;  1F2O A;  1SQH A;  2WUU A;  4G1P A;  3FXT A;  1BPM A;  2REF A;  3FRM A;  2PJ6 A;  5BWA B;  1V0C A;  3WC6 A;  4GM5 A;  2J8M A;  2I3C A;  4PXC A;  2C27 A;  3B3C A;  3D8P A;  2R7H A;  1B6B A;  4QB9 A;  2F7V A;  3TO9 A;  3D4U A;  1XIX A;  2RC4 A;  2BSW A;  2GLF A;  3GKR A;  2J8N A;  2Z11 A;  3FYN A;  3KHZ A;  3IU2 A;  2H5M A;  4NEX A;  4W9Y A;  3IIB A;  4O23 A;  3R1K A;  2VZY A;  3FIX A;  4KOW A;  2OB0 A;  1Y0R A;  2YNE A;  3CXS A;  3FEE A;  3B3W A;  4QC6 A;  3D67 A;  4OP4 A;  4DNC A;  3D66 A;  4NGS A;  1AYE A;  2Z3L A;  3IJ3 A;  2OU2 A;  4XPD C;  3T8W A;  3IU1 A;  2Q44 A;  3NH5 A;  1LAN A;  3FJU A;  3KZW A;  5IV0 A;  2B4B A;  4MHZ A;  1A2Z A;  1CJW A;  2PJ8 A;  3OWC A;  2Z3P A;  1NSL A;  4PK2 A;  4MFZ A;  5GCN A;  4UCP A;  4KSF A;  4HNW B;  5I0C A;  4FWU A;  4ORF A;  2Z3K A;  2O28 A;  3H5Z A;  4ZX8 A;  1XBU A;  2J8R A;  5G20 A;  4MFK A;  1M4G A;  2B5G B;  4PQA A;  4JZ0 A;  4OC2 A;  4PV6 A;  4CAX A;  1RTQ A;  4NJR A;  2PIZ A;  5FVJ A;  3F8K A;  3IWG A;  1Z9U A;  1XOV A;  4P4D A;  4OID A;  3W91 A;  3WC7 A;  4LUA A;  3DDD A;  2FL4 A;  5G1Z A;  4NGQ A;  1TXR A;  4RUH A;  5AG5 A;  2AFM A;  4A2Z A;  4R9M A;  1MJ9 A;  5JGF A;  2JBJ A;  3CZX A;  2ZEP A;  3NFZ A;  3TTH A;  2EWB A;  4JXQ A;  4R3K A;  2QYV A;  4KZT A;  1NE9 A;  2C6C A;  2ZEH A;  5C88 A;  4CGO A;  4ZY1 A;  1XEB A;  3DSB A;  4CGP A;  3CDX A;  2ZW4 A;  3I3G A;  3IGR A;  2BL1 A;  2HV2 A;  2VZZ A;  4F8Z A;  1VGY A;  1KUV A;  2ZEL A;  4IAV A;  4H89 A;  1QSM A;  3VAR A;  2PJB A;  3PB6 X;  1Z8X A;  2IJZ A;  2B3U A;  3D7H A;  3V38 A;  2GLJ A;  4PXB A;  4AVB A;  1ZG7 A;  4EFD A;  4XNH B;  4UEE A;  2DPT A;  5F47 A;  4CYP A;  2PSW A;  2VI7 A;  2Z3M A;  1WK4 A;  3EO4 A;  2EUI A;  2PR8 A;  4A95 A;  4A37 A;  4HNX B;  1MJA A;  3KR5 A;  3T9Y A;  3MRU A;  3PB9 X;  3TC8 A;  3TOB A;  3FB3 A;  1UWY A;  1YVK A;  3RBU A;  1LAM A;  2Z0Z A;  2PVW A;  3KQZ A;  3WR7 A;  3DR8 A;  3EY5 A;  4GXH A;  2EBJ A;  3H8F A;  4EME A;  1I1D A;  3E0K A;  4HPS A;  1ELL P;  2V8G A;  2ZW6 A;  5EC4 A;  1HDQ A;  2AJ6 A;  4KLV A;  1IYK A;  2BUE A;  2I79 A;  1VHE A;  2GE3 A;  2G3T A;  2HB6 A;  1ARM A;  2IL4 A;  4FD7 A;  3TO6 A;  4ZGY B;  1F57 A;  4F6A A;  8CPA A;  4KLW A;  3B3V A;  1ELM P;  2RB7 A;  4A94 A;  4CYN A;  5KTD A;  2CF4 A;  4UIB A;  3SJF A;  2AE6 A;  4CAV A;  5CBM A;  4X3R A;  1TF9 A;  5G22 A;  4CRZ B;  4E2A A;  4MMO A;  3DNS A;  2AFZ A;  2R98 A;  1KWM A;  3TT2 A;  4CGL A;  3RO0 A;  2OZG A;  4ZBG A;  3S6K A;  1P0H A;  3KGQ A;  5LRG A;  3D7G A;  2HC9 A;  5LRK A;  3IWW A;  4CAW A;  2JDD A;  4P6Y A;  4X5K A;  4BMH A;  3QAY A;  4UA3 A;  4ZY0 A;  1M44 A;  1KUX A;  2P6F A;  3EC4 A;  1DTD A;  1YQE A;  4KVX A;  4CAF A;  4QBJ A;  2VBQ A;  4UWJ A;  4F9V A;  4Q36 A;  4B12 A;  4RS2 A;  3ISZ A;  3B35 A;  3KI9 A;  1MK4 A;  2CXA A;  1CP7 A;  2G0B A;  1LRZ A;  1R43 A;  2HQY A;  3G8W A;  3TCV A;  4UBR A;  4OAE A;  4L89 A;  2DPS A;  1LAP A;  1M4D A;  3P2H A;  2BEI A;  3LOD A;  1Y9K A;  1Z5R A;  1ZLH A;  4UWI A;  3S9L A;  3KAS A;  1RXT A;  4I49 A;  3W6X A;  5KTC A;  3CT9 A;  1QMU A;  1VHO A;  1ZO0 A;  1IU8 A;  4MHN A;  5AG7 A;  5THW A;  3ZJ0 A;  1Z4E A;  3GLJ A;  1I12 A;  5K8N A;  3PEI A;  4R7M A;  5G21 A;  1U6M A;  2OH1 A;  2YGW A;  1M1D A;  2PJA A;  1JQG A;  3TO7 A;  4P10 A;  4WWV A;  1TF8 A;  1BO4 A;  3EXN A;  4UCN A;  2PVV A;  1Z2L A;  3R96 A;  1HEE A;  3BI0 A;  4XPD B;  4CYQ A;  3VWE A;  3HLP A;  2PIY A;  2PJC A;  4MY3 A;  1NMT A;  1B87 A;  4UIA A;  1IGB A;  3FEC A;  2Z3N A;  1NSA A;  3SI2 A;  3CPX A;  4UEZ A;  1XF8 A;  1S7F A;  1XMT A;  2DF5 A;  2GIV A;  4KOY A;  4NGM A;  5CNP A;  4FD5 A;  4AXV A;  2BO9 A;  2PRB A;  3V8I A;  4GS4 A;  2ZEM A;  5HXD A;  4R8F A;  4YFJ A;  2CIJ A;  3FX6 A;  3D68 A;  1PU9 A;  4MCQ A;  1IY7 A;  2FT0 A;  1GHE A;  2WPW A;  3BHX A;  3MGD A;  1CX8 A;  5F48 A;  4UFW A;  2ZW5 A;  3HUV A;  1RO5 A;  1EE3 P;  2WPX A;  5A28 A;  1KZF A;  4B14 A;  2ABZ A;  4X2T A;  4F0Y A;  2F8H A;  2PJ7 A;  3PRT A;  4OME A;  2IMO A;  3H8E A;  1CPX A;  4WJB A;  2YNC C;  2CNT A;  5K8O A;  5JPH A;  3C26 A;  3KL9 A;  3KQX A;  4YRH A;  2PJ3 A;  4E8O A;  4FBE A;  5F09 A;  2PJ0 A;  3W6S A;  1TKJ A;  3GYA A;  4NGN A;  4OAD A;  3SJX A;  1HDU A;  4A31 A;  1BOB A;  1FY7 A;  3NE8 A;  4KVO E;  1LCP A;  4U9Y A;  4CYO A;  2PR1 A;  4JXR A;  5DWN A;  3S9M A;  5J1Q A;  2CTC A;  5LRJ A;  3S9N A;  3UY5 A;  4CPA A;  4MRI A;  1DE4 C;  4UEF A;  3PBB A;  4AVC A;  2Q4Y A;  5K8P A;  4PPZ A;  1IB1 E;  1YLO A;  1OBR A;  4FD6 A;  4R76 A;  3R9E A;  3D2P A;  4RN7 A;  3SJG A;  5F46 A;  3ISX A;  2IQ6 A;  1Q2D A;  2PQ8 A;  4P4B A;  2P0W A;  4LX9 A;  3BJ8 A;  1S7K A;  3F0A A;  1CG2 A;  5HVG A;  3EFA A;  3H4Q A;  1X10 A;  1R3N A;  3A9L A;  4IK2 A;  3TE4 A;  4R57 A;  1I21 A;  1Y7E A;  4HNY B;  1PUA A;  3GUX A;  1VKC A;  5DWM A;  4L8A A;  5H86 A;  5LYI A;  2RFH A;  3IWE A;  5ISV A;  4OLL A;  1Q7L A;  1S7L A;  3PFO A;  1YSJ A;  4JJX A;  5JQ4 A;  3CXQ A;  4TWE A;  4DJL A;  1VHS A;  2EK9 A;  2GFQ A;  3G3S A;  3QAH A;  4Q38 A;  3TX8 A;  4AB7 A;  2GAN A;  3GY9 A;  4UCM A;  3K9T A;  2CNS A;  2G3A A;  2XEG A;  1YX0 A;  2JBK A;  4P4F A;  4FUU A;  4DUK A;  4Z65 A;  1FNO A;  3FVL A;  2NSM A;  1Y0Y A;  1UFH A;  4K3N A;  4MFL A;  4MHP A;  5CPA A;  3WT4 A;  4OIW A;  4A32 A;  2O4H A;  4BD9 A;  3CXP A;  2JDC A;  3VWD A;  5D29 A;  2AFO A;  2P6E A;  5KTA A;  1S5K A;  1FT7 A;  2Y0M A;  4LQ6 A;  4XNH C;  5HVF A;  1YK3 A;  4KOR A;  3NE7 A;  1QSR A;  3F5B A;  1IOF A;  1Z8T A;  2O53 A;  2G9D A;  2GRE A;  3KR4 A;  1L0C A;  1K4J A;  3B8G A;  1BPN A;  5F49 A;  4K30 A;  2EO8 A;  4NGP A;  4ONU A;  4R3L A;  4Y49 B;  4UFV A;  2X7B A;  2FSR A;  2QJ8 A;  3JRU A;  4MHD A;  1X12 A;  4MBU A;  3R9G A;  4MFP A;  3D7F A;  4KVM E;  3WC5 A;  3BJ7 A;  2PJ2 A;  4U5Y A;  2FVG A;  2ZOG A;  1S3Z A;  5J8C A;  4A30 A;  3LMS A;  3RNZ A;  5IX3 A;  2V8H A;  4MXU A;  4NF1 A;  4FAI A;  1Z8L A;  3I9S A;  2JLM A;  1AUG A;  1ZLI A;  1YW4 A;  4P45 A;  3N5F A;  2AFX A;  3DGV A;  4HKF A;  2QVP A;  1Q2Y A;  2PJ5 A;  4KUA A;  4NGR A;  2REE A;  4OC0 A;  2ZED A;  4UF4 A;  4P4J A;  4M6G A;  4JD6 A;  4R6T A;  2FXF A;  2ODF A;  4P4E A;  3B3S A;  3DLJ A;  3PGP A;  5J8F A;  2NYQ A;  4NFR A;  3D3S A;  3B2Y A;  4AG9 A;  3FBU A;  5HH1 A;  2AFW A;  4NCZ A;  2R8V A;  3DR6 A;  3SI0 A;  3PB8 X;  3LAC A;  1YR0 A;  2VEZ A;  1YVO A;  4PK3 A;  4DYO A;  4EVY A;  3L2N A;  4KOU A;  2V8V A;  3D2M A;  1YW6 A;  2FCK A;  2B3V A;  4M3S A;  4B10 A;  1Z4R A;  4MFQ A;  2C6G A;  3PZJ A;  3I1U A;  1ON0 A;  1IOI A;  4AG7 A;  4C68 A;  4B5P A;  4C7H A;  1XFO A;  2CNM A;  2OR4 A;  3R9F A;  4NXY A;  4QUS A;  2Q04 A;  2GU2 A;  1CM0 A;  1Z8W A;  5EMI A;  3RAM A;  4H2K A;  2R1I A;  4P4I A;  1AMP A;  3QB8 A;  4J3G A;  3N7Z A;  2QEC A;  2POK A;  3K9U A;  1N71 A;  5JH9 A;  2CTB A;  1QSN A;  2FIW A;  3MN8 A;  5AG4 A;  4YGO A;  3GIU A;  1IIC A;  3NA6 A;  4H6Z A;  4C2Z A;  4PSW A;  4EWT A;  3B7I A;  2ZXV A;  2ARH A;  1XRY A;  3ZZI A;  2F5I A;  4KSI A;  2DEA A;  4OC4 A;  5E96 A;  5I4M A;  4CS0 B;  4MCS A;  3FF3 A;  1H8L A;  2ANP A;  3FED A;  1M4I A;  4MJ8 A;  2Z3O A;  1BAV A;  2HUZ A;  1XE4 A;  2C1C A;  3BLN A;  1MJB A;  2Q4Z A;  3IC1 A;  2FS5 A;  2YND A;  2AFU A;  3JTK A;  2B4D B;  2FIA A;  4KOV A;  4A39 A;  5LYF A;  2YNC A;  5ELY A;  1QSO A;  4CGM A;  1TKF A;  1YLE A;  7CPA A;  2JEW A;  2QML A;  4KUB A;  4X8I A;  5AG6 A;  1WWZ A;  4ZX9 A;  4JWP A;  4C7I A;  4JYW A;  2AFS A;  2Q7S A;  1Y9W A;  4H6U A;  4F0X A;  2XEF A;  4KOT A;  2V8D A;  4MCR A;  3RZA A;  2EK8 A;  3PP9 A;  4MFJ A;  1JWQ A;  3WAB A;  3S6H A;  4BIN A;  4IHM A;  4KOS A;  2ZOF A;  2K5T A;  3PB7 X;  2DXQ A;  3RYO A;  6CPA A;  5HVH A;  3SJE A;  2PJ4 A;  1S7N A;  4ONW A;  2WZN A;  5HMN A;  5IB0 A;  4YU9 A;  2PDO A;  3P2F A;  3VH9 A;  1S60 A;  5LYL A;  4CGN A;  2B4D A;  4OC3 A;  1KUY A;  4ZI6 A;  2Q4V A;  4U9Z A;  4RI1 A;  2OOT A;  3B3T A;  5A27 A;  2B5G A;  4MCP A;  4NGT A;  3SHP A;  4M6I A;  3SXN A;  2P6G A;  1YME A;  2EVN A;  3T90 A;  1CBX A;  1ZG8 A;  3LWU A;  2Q7B A;  5IB9 A;  2C6P A;  4IF5 A;  4KOX A;  1LOK A;  4QVT A;  5DS0 A;  3H8G A;  2A4N A;  3PBE A;  4II9 A;  1CP6 A;  2B58 A;  3TOA A;  2PE3 A;  2PJ1 A;  3FMC A;  1TKH A;  4ZY2 A;  1YRE A;  2OZH A;  2ZEG A;  1LFW A;  1P4N A;  1ZG9 A;  4B13 A;  2I00 A;  2VXK A;  4LQG A;  2JEV A;  3V7Z A;  1PCA A;  5JM6 A;  4UFX A;  1J4J A;  1F2P A;  1XJO A;  1YGH A;  2Z10 A;  2ZEO A;  2VL1 A;  1Y7R A;  2BOA A;  4XPL A;  2ZEN A;  4C2Y A;  4P44 A;  3BI1 A;  1BLL E;  4IUS A;  2D4O A;  4M85 A;  1M4L A;  1XMB A;  2NMT A;  4OKO A;  1GYT A;  4PXD A;  3FH4 A;  1TIQ A;  2ZEF A;  2BCO A;  1VIX A;  3IO1 A;  2ZW7 A;  2KCW A;  4M6H A;  4A38 A;  1CPS A;  2PC1 A;  2PJ9 A;  2CY2 A;  3TFY A;  3LD2 A;  4MHY A;  5D8N A;  5H84 A;  5EBV A;  3PFE A;  4TNU A;  5C82 A;  3KKW A;  2QIR A;  2OZU A;  2J9A A;  2Q51 A;  4YWY A;  4XPK A;  4F9U A;  3S6G A;  4NJQ A;  4OC5 A;  4AVA A;  4B11 A;  4ZYQ A;  1PYT B;  2FE7 A;  1ARL A;  2PCU A;  3K2K A;  4JLY A;  4NSQ A;  2XEJ A;  1OZP A;  4PSX A;  3SXO A;  3KHX A;  3JVN A;  4B5P B;  3SI1 A;  2Q0Y A;  2VQY A;  4PXE A; 
#chains in the Genus database with same CATH homology
 4CRY B;  2ZPA A;  3S6F A;  5AGE A;  4Y49 C;  1Q2C A;  3FNC A;  4BBH A;  1R57 A;  2ATR A;  1IYL A;  4KSA A;  4A33 A;  4FD4 A;  1QST A;  4C2X A;  4E0A A;  2WSA A;  4KS9 A;  4MI4 A;  4CAE A;  2D4P A;  4MY0 A;  3R95 A;  4R87 A;  1IID A;  3JUW A;  4B5O A;  1SQH A;  2WUU A;  3FXT A;  2REF A;  3FRM A;  5BWA B;  1V0C A;  2J8M A;  2C27 A;  3D8P A;  2R7H A;  1B6B A;  4QB9 A;  3TO9 A;  1XIX A;  2RC4 A;  2BSW A;  3GKR A;  2J8N A;  2Z11 A;  3FYN A;  3IU2 A;  2H5M A;  4NEX A;  3R1K A;  2VZY A;  3FIX A;  4KOW A;  2OB0 A;  2YNE A;  3CXS A;  4QC6 A;  4DNC A;  2Z3L A;  2OU2 A;  4XPD C;  3IU1 A;  2Q44 A;  5IV0 A;  2B4B A;  1CJW A;  3OWC A;  2Z3P A;  1NSL A;  4PK2 A;  4MFZ A;  5GCN A;  4UCP A;  4KSF A;  4HNW B;  5I0C A;  4ORF A;  2Z3K A;  2O28 A;  3H5Z A;  2J8R A;  5G20 A;  4MFK A;  1M4G A;  2B5G B;  4CAX A;  4PV6 A;  5FVJ A;  3F8K A;  3IWG A;  1Z9U A;  3W91 A;  4LUA A;  3DDD A;  2FL4 A;  5G1Z A;  5AG5 A;  4A2Z A;  4R9M A;  1MJ9 A;  3TTH A;  4JXQ A;  4R3K A;  4KZT A;  1NE9 A;  5C88 A;  4CGO A;  1XEB A;  3DSB A;  4CGP A;  2ZW4 A;  3I3G A;  3IGR A;  2BL1 A;  2HV2 A;  2VZZ A;  1KUV A;  4H89 A;  1QSM A;  2B3U A;  4AVB A;  4XNH B;  2DPT A;  5F47 A;  4CYP A;  2PSW A;  2VI7 A;  2Z3M A;  1WK4 A;  3EO4 A;  2EUI A;  2PR8 A;  4A95 A;  4HNX B;  1MJA A;  3T9Y A;  3TOB A;  3FB3 A;  1YVK A;  2Z0Z A;  3WR7 A;  3DR8 A;  3EY5 A;  1I1D A;  3E0K A;  2ZW6 A;  5EC4 A;  2AJ6 A;  4KLV A;  1IYK A;  2BUE A;  2I79 A;  2GE3 A;  2G3T A;  2IL4 A;  4FD7 A;  4ZGY B;  3TO6 A;  4F6A A;  4KLW A;  4CYN A;  5KTD A;  2AE6 A;  4CAV A;  5G22 A;  4CRZ B;  4E2A A;  3DNS A;  2R98 A;  3TT2 A;  4CGL A;  2OZG A;  4ZBG A;  3S6K A;  1P0H A;  4CAW A;  2JDD A;  4X5K A;  4BMH A;  4UA3 A;  1M44 A;  1KUX A;  2P6F A;  3EC4 A;  4KVX A;  4CAF A;  4QBJ A;  2VBQ A;  4UWJ A;  4Q36 A;  4B12 A;  4RS2 A;  1MK4 A;  2CXA A;  2G0B A;  3G8W A;  1LRZ A;  2HQY A;  3TCV A;  4UBR A;  4OAE A;  4L89 A;  2DPS A;  1M4D A;  3P2H A;  2BEI A;  3LOD A;  1Y9K A;  4UWI A;  1RXT A;  4I49 A;  3W6X A;  5KTC A;  5AG7 A;  1ZO0 A;  3ZJ0 A;  1Z4E A;  1I12 A;  5G21 A;  1U6M A;  2OH1 A;  2YGW A;  1M1D A;  3TO7 A;  1BO4 A;  3EXN A;  4UCN A;  4XPD B;  4CYQ A;  3VWE A;  4MY3 A;  1NMT A;  1B87 A;  2Z3N A;  1XF8 A;  1S7F A;  1XMT A;  2GIV A;  4KOY A;  5CNP A;  4FD5 A;  2PRB A;  3V8I A;  4GS4 A;  4YFJ A;  1PU9 A;  3MGD A;  2FT0 A;  1GHE A;  2WPW A;  5F48 A;  4UFW A;  2ZW5 A;  1RO5 A;  2WPX A;  5A28 A;  1KZF A;  4B14 A;  4F0Y A;  2YNC C;  2CNT A;  5JPH A;  3C26 A;  4YRH A;  4E8O A;  3W6S A;  3GYA A;  4OAD A;  4A31 A;  1BOB A;  1FY7 A;  4KVO E;  4U9Y A;  4CYO A;  2PR1 A;  4JXR A;  5DWN A;  3UY5 A;  4AVC A;  2Q4Y A;  1IB1 E;  4FD6 A;  3R9E A;  3D2P A;  5F46 A;  2PQ8 A;  1Q2D A;  2P0W A;  4LX9 A;  3BJ8 A;  1S7K A;  3F0A A;  3EFA A;  3H4Q A;  3A9L A;  3TE4 A;  4R57 A;  1I21 A;  4HNY B;  1PUA A;  1VKC A;  5DWM A;  4L8A A;  5H86 A;  3IWE A;  5ISV A;  4OLL A;  1S7L A;  4JJX A;  5JQ4 A;  3CXQ A;  1VHS A;  3G3S A;  4Q38 A;  3QAH A;  4AB7 A;  2GAN A;  3GY9 A;  4UCM A;  2CNS A;  2G3A A;  1YX0 A;  1UFH A;  4MFL A;  4A32 A;  3CXP A;  2JDC A;  3VWD A;  2P6E A;  5KTA A;  1S5K A;  2Y0M A;  4XNH C;  1YK3 A;  4KOR A;  3NE7 A;  1QSR A;  3F5B A;  1L0C A;  1K4J A;  3B8G A;  5F49 A;  4K30 A;  4ONU A;  4R3L A;  4Y49 B;  4UFV A;  2X7B A;  2FSR A;  4MHD A;  3R9G A;  4MBU A;  4MFP A;  4KVM E;  3BJ7 A;  4U5Y A;  5J8C A;  1S3Z A;  4A30 A;  5IX3 A;  4NF1 A;  3I9S A;  2JLM A;  4HKF A;  1Q2Y A;  4KUA A;  2REE A;  4JD6 A;  2FXF A;  3PGP A;  5J8F A;  4AG9 A;  3D3S A;  3FBU A;  5HH1 A;  4NCZ A;  2R8V A;  3DR6 A;  1YR0 A;  2VEZ A;  1YVO A;  4PK3 A;  4EVY A;  4KOU A;  3D2M A;  2FCK A;  2B3V A;  4M3S A;  4B10 A;  1Z4R A;  4MFQ A;  3PZJ A;  1ON0 A;  4AG7 A;  4C68 A;  4B5P A;  4C7H A;  2CNM A;  3R9F A;  4NXY A;  4QUS A;  2Q04 A;  1CM0 A;  2R1I A;  3QB8 A;  4J3G A;  3N7Z A;  2QEC A;  3K9U A;  1N71 A;  2FIW A;  1QSN A;  5AG4 A;  4YGO A;  4C2Z A;  1IIC A;  4H6Z A;  4PSW A;  2ZXV A;  2ARH A;  3ZZI A;  2F5I A;  5E96 A;  4CS0 B;  1M4I A;  4MJ8 A;  2Z3O A;  2HUZ A;  1XE4 A;  3BLN A;  1MJB A;  2FS5 A;  2YND A;  3JTK A;  2B4D B;  2FIA A;  4KOV A;  2YNC A;  1QSO A;  4CGM A;  1YLE A;  2QML A;  4KUB A;  5AG6 A;  1WWZ A;  4JWP A;  4C7I A;  4H6U A;  1Y9W A;  4F0X A;  4KOT A;  3PP9 A;  4MFJ A;  3S6H A;  4KOS A;  2K5T A;  3RYO A;  2DXQ A;  1S7N A;  5HMN A;  5IB0 A;  2PDO A;  3P2F A;  1S60 A;  4CGN A;  2B4D A;  1KUY A;  2Q4V A;  4U9Z A;  4RI1 A;  5A27 A;  2B5G A;  3SHP A;  3SXN A;  2P6G A;  2EVN A;  3T90 A;  2Q7B A;  4KOX A;  4IF5 A;  4QVT A;  2A4N A;  4II9 A;  2B58 A;  3TOA A;  1YRE A;  2OZH A;  1P4N A;  4B13 A;  2I00 A;  2VXK A;  2JEV A;  4UFX A;  1J4J A;  3R96 A;  1YGH A;  2Z10 A;  4XPL A;  1Y7R A;  4C2Y A;  4IUS A;  2D4O A;  4M85 A;  2NMT A;  1TIQ A;  2ZW7 A;  2KCW A;  2PC1 A;  2CY2 A;  3TFY A;  3LD2 A;  5H84 A;  5EBV A;  5C82 A;  3KKW A;  2QIR A;  2OZU A;  4XPK A;  3S6G A;  4B11 A;  4AVA A;  2FE7 A;  4JLY A;  4NSQ A;  4PSX A;  1OZP A;  3SXO A;  3JVN A;  4B5P B;  2Q0Y A;  2VQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...