4CGMA

Leishmania major n-myristoyltransferase in complex with a biphenyl- derivative inhibitor
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Diverse Modes of Binding in Structures of Leishmania Major N-Myristoyltransferase with Selective Inhibitors
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 125
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cgmA00
4CGOA 4CGNA 4B10A 4A33A 4B14A 4CYPA 5G21A 4C7IA 5G1ZA 4CAEA 4CAFA 4CGPA 4UFWA 3IU1A 4UCNA 4UFVA 4A2ZA 2YNEA 5AG5A 3IWEA 5AGEA 5A27A 5AG7A 2YNDA 3JTKA 3IU2A 4A31A 4CGMA 5A28A 4CYQA 5AG4A 4A95A 4UFXA 4UCMA 4BBHA 4CGLA 4C2XA 4CYNA 5G20A 5AG6A 4A30A 4CYOA 4C2ZA 3H5ZA 2WSAA 4UCPA 4B12A 2WUUA 4C68A 4B13A 4A32A 4C2YA 4C7HA 2YNCA 2YNCC 4B11A 5G22A
chains in the Genus database with same CATH superfamily
2B4DA 4H6UA 1FNOA 2OZUA 4GM5A 3TC8A 3TTHA 1R57A 2X7BA 1RTQA 2DF5A 1CG2A 2JBKA 2Z11A 3NH8A 3FJUA 2EWBA 3IO1A 1M4DA 4NXYA 4PK2A 2BO9A 4Y49C 1R43A 3BJ7A 3S9LA 2G3AA 4KSIA 2I00A 5A28A 2PR8A 3CT9A 4MHDA 3RZAA 5AG4A 4RUHA 5ELYA 4UFXA 1IOIA 3VATA 4KOSA 3CXPA 3B3TA 4Q36A 4A94A 1XFOA 3MN8A 4MHNA 2PJ9A 4ZYQA 1Z8TA 2IMOA 2JDDA 3SJEA 1F57A 3EO4A 3S9NA 2CTBA 2YNCA 3W6SA 2OZHA 4A31A 4UBRA 4CGNA 2FIWA 2P6GA 1TXRA 4C7IA 1GHEA 2VZZA 2ZELA 3SJXA 1BOBA 2AFMA 3F8KA 2BL1A 4F6AA 1PU9A 4NF1A 1M4GA 4FWUA 3IU1A 2AJ6A 2R8VA 3GYAA 4Y49B 2ZENA 1B87A 2ZEMA 4KSAA 4MXUA 2JLMA 3QNVA 1XE4A 2V8DA 1YREA 2FE7A 2PJCA 2ZW5A 2Z3OA 4PXCA 4X8IA 4B6ZA 4YFJA 4QUSA 2QJ8A 4OLLA 4RN7A 1Y0RA 2GREA 3LD2A 4CYQA 4W9YA 5ISVA 1BPNA 1Q2CA 1LRZA 4CYOA 1OBRA 4R7MA 4QVTA 5CBMA 4P45A 4NJQA 1S3ZA 4EVYA 1QSMA 5HVGA 2J8RA 2ZOFA 2B5GB 3KQZA 4A32A 5JH9A 4CS0B 4B12A 2F8HA 5K8NA 1CBXA 2Q4VA 4OADA 1B6BA 4P4EA 3B8GA 3KR5A 3PZJA 5C88A 4F0YA 1AUGA 4BINA 2PJBA 1CP6A 3BXMA 3FYNA 4ZY2A 1Q2YA 3BJ8A 4JJXA 2BOAA 3HLPA 1I21A 2ODFA 2Q44A 3FRMA 2FS5A 1BO4A 1UWYA 1K4JA 4MFKA 1XF8A 5HVFA 4EMEA 4G1PA 2QMLA 4K30A 2YGWA 2PJ6A 3D7HA 4Q7AA 5HMNA 1Z8WA 4OMEA 1I12A 3EFAA 3RYOA 3B3CA 1L0CA 4LUAA 1CPXA 3D7GA 1YLOA 4KUBA 1ZG8A 2Q0YA 2WYRA 1XMTA 2C6GA 2Q4YA 4UIAA 1Y0YA 1I1DA 5G21A 4A33A 4AVCA 4MBUA 1DTDA 2IJZA 5EMIA 4KORA 3PB7X 3LWUA 3VARA 2XEGA 4MHPA 4L89A 1Z9UA 5CNPA 1CJWA 2JEWA 2VQYA 2Z3PA 2V77A 1HDQA 4FD4A 4R76A 4AG9A 4M85A 4XNHC 4TNUA 1M1DA 1YW6A 3R9EA 4BBHA 4CYNA 2HV2A 1ZLHA 4PXBA 1Z4EA 3KKWA 4QB9A 3TOAA 1KZFA 2H5MA 2BUEA 3H5ZA 1QSNA 1LANA 2ZEFA 4KOYA 3JVNA 4MJ8A 5LYLA 4JLYA 4PK3A 4DYOA 3VH9A 1KWMA 1XMBA 3SHPA 1IOFA 5IB0A 1YMEA 4UEEA 1TF9A 4OIDA 3EXNA 3FMCA 3IJ3A 4NGQA 4TWEA 4KS9A 4KLVA 4A2ZA 2I79A 2PJ3A 3PBBA 1Y9WA 3OWCA 2J8MA 2YNEA 1P0HA 3KHZA 5AGEA 1XIXA 2ZOGA 5JM6A 4NCZA 4OC2A 5H86A 1ZG9A 4OIWA 4XNHB 3GKRA 2REEA 3KR4A 3QAYA 6CPAA 3IC1A 2FVGA 4H6ZA 1IB1E 2ZEDA 4F9UA 3VWDA 3W91A 4KZTA 1S7FA 2XEJA 1YX0A 4GS4A 3N7ZA 3SJGA 4CRZB 1LAPA 3IWGA 2PJ2A 5E96A 3D7FA 2WZNA 1NMTA 1NSAA 3V8IA 1H8LA 2CF4A 1N71A 3BI0A 4PSXA 3R95A 3S9MA 4NGTA 4R9MA 3TT2A 4HNWB 4GXHA 5KTCA 3H8EA 3DLJA 3FH4A 2B3UA 1NSLA 3CPAA 4IAVA 2Z3KA 2O53A 4U9ZA 2RFHA 7CPAA 5A27A 2DPTA 4B5PB 4CPAA 2JEVA 5F48A 2WPXA 3R9FA 4ZGYB 4O23A 4B5PA 4KOTA 3PEIA 5JQ4A 3I3GA 4MCQA 3CZXA 5H84A 3RO0A 2QECA 5LYDA 2PRQA 4A95A 1VGYA 4YWYA 2XEFA 2CY2A 4OC1A 2PSWA 4A30A 1QSTA 3NH4A 1PUAA 4PPZA 3KI9A 3R9GA 5CPAA 3H4QA 2HQYA 3DNSA 2G0BA 2QVPA 2OH1A 3FNCA 1P4NA 2ZXVA 3IFEA 4XPLA 1Z5RA 3TOBA 4CAVA 2EUIA 4CRYB 2DXQA 3ZJ0A 4M6IA 1VIXA 2GLFA 1IYKA 2D4OA 4FAIA 1F2OA 4UFWA 1LAMA 4MCRA 1RO5A 4R8FA 2VZYA 4FD7A 4YRHA 2F7VA 3TO6A 5K8OA 2GU2A 2PIYA 4KVXA 4NEXA 5D29A 5BWAB 2C1CA 2CIJA 1NE9A 4NJRA 3TCVA 1XBUA 2GFQA 2ZEEA 1J4JA 3A9LA 1BAVA 2IL4A 4OC0A 1Y7EA 2FXFA 2R98A 1TIQA 4AXVA 4DNCA 3DSBA 4B13A 4MCPA 4ZI6A 3SI1A 2ZEPA 1R3NA 3KASA 1XEBA 2B5GA 5F46A 1BLLE 1KUYA 4UWIA 5IV0A 1XJOA 2ZEOA 2FL4A 4KVOE 3IGRA 2PJ7A 3D3SA 1AMPA 4PXDA 5AG5A 3PB8X 3FF3A 3RNZA 3GB0A 3JRUA 4LQGA 4MY3A 4ZY0A 4M6GA 3DDDA 4RI1A 4OC3A 4OAEA 4DJLA 4KOXA 2AFZA 5I4MA 4NGMA 2FCKA 4P4IA 3V7ZA 4OC4A 4U5YA 4WWVA 1U6MA 3MGDA 5LRGA 1S5KA 5K8MA 4R87A 1Y7RA 2P6FA 2WUUA 2Z3NA 2ZW6A 3FEDA 3G3SA 2HB6A 4NGNA 1Q2DA 1CP7A 4C68A 2QIRA 4II9A 3HUVA 4P4JA 4JXQA 2PJ5A 5HH1A 4IF5A 3EY5A 2R7HA 2RB7A 4B10A 4MFZA 3ISZA 4CAXA 2B4BA 5C82A 4IHMA 5THWA 4KUAA 3GIUA 2IQ6A 3E0KA 3WC5A 2REFA 3KGQA 2EK8A 4R57A 5LRKA 2J8NA 3PP9A 4JZ0A 1XRYA 1AYEA 4L8AA 5FVJA 5F49A 5GCNA 3KL9A 5AG7A 1QMUA 4KLWA 3TO9A 3IU2A 3L2NA 2OB0A 4HNYB 4P6YA 4PV6A 2WPWA 5DWMA 4DUKA 3KZWA 3S6GA 4LX9A 5HXDA 1IYLA 4MFPA 1YVKA 3PFOA 1M4IA 3C26A 2ZPAA 4R6TA 5LYIA 2EBJA 4X5KA 3QB8A 4ZX8A 4K3NA 2ANPA 4H2KA 1MJ9A 1ZO0A 2QYVA 3PB6X 4H89A 3LMSA 1JWQA 1Z8XA 3I1UA 1LFWA 2PR1A 3B7IA 5IB9A 1YW4A 1IIDA 1MJAA 2EO8A 4MFQA 2PE3A 5JGFA 3LODA 4OP4A 1IGBA 2C27A 2CTCA 3CXQA 1SQHA 4ZY1A 2Q04A 3B2YA 3IWEA 4NGPA 3G8WA 1VHOA 1VHSA 2OU2A 1S7KA 2VL1A 3DR8A 2V8HA 4IK2A 4M3SA 3D68A 4Z65A 3FBUA 4P4DA 2Q4ZA 2PCUA 1YLEA 1MK4A 4C2XA 1ELMP 3T90A 1DE4C 3F0AA 3GY9A 3ISXA 4NGSA 4YU9A 4ONWA 4BMHA 4MHYA 2AFXA 5KTDA 3D7DA 5DWNA 4LQ6A 5IX3A 4ONUA 4WJBA 3PB4X 4R3KA 3NH5A 2Z3MA 3PRTA 1HEEA 3UY5A 5G22A 2BCOA 2ZEGA 3WC7A 3FECA 4HKFA 1V0CA 3CDXA 4B14A 5F09A 4RS2A 1X12A 3VWEA 4CGPA 1YK3A 4XPKA 3SXNA 3GLJA 1IICA 2PJ0A 4ORFA 4A39A 3QAHA 3H8FA 2AFUA 5HVHA 1S60A 2JDCA 4U9YA 3PB9X 1YR0A 1M44A 2D4PA 3NE8A 4PXEA 1WK4A 4X3RA 5EC4A 3RBUA 5J8CA 2ABZA 3P2HA 4MRIA 3T9YA 5F47A 3BLNA 3D2PA 1MJBA 2BEIA 2I3CA 1CPSA 2CXAA 4UIBA 2WSAA 4UCPA 2ATRA 5J8FA 2B4DB 2ZEHA 1X10A 3I9SA 1ON0A 5EBVA 4OC5A 3TE4A 3SI0A 4FUUA 4KSFA 1A2ZA 1F2PA 3FVLA 2CNSA 3CPXA 1OZPA 1TKHA 3R1KA 3PBEA 4KVME 3R96A 4AB7A 2B58A 2OOTA 4MHZA 1Q7LA 2YNDA 2GE3A 2PRBA 3N5FA 2O4HA 2CNTA 4MCSA 3B3VA 2P0WA 4R3LA 3WC6A 2HC9A 3TFYA 2V8VA 4HPSA 4MFJA 3FX6A 1Y9KA 2ZW7A 3IIBA 3IEHA 1FY7A 3WR7A 4B11A 4CGOA 2Z0ZA 4HNXB 1ARLA 2C6PA 3TO7A 4E8OA 2R1IA 4ZX9A 4CAWA 2PVWA 2Q7SA 2BSWA 1HDUA 2C6CA 4UFVA 1PYTB 2K5TA 3DGVA 4A37A 1M4LA 2Q51A 4EWTA 2NMTA 4JWPA 3H8GA 4BD9A 2PQ8A 5K8PA 4F8ZA 2J9AA 1YSJA 3B3WA 4UCMA 3D2MA 3NE7A 2O28A 2G9DA 5G20A 3W6XA 3EC4A 3SJFA 4C2ZA 5I0CA 2PVVA 2CNMA 3BI1A 4X2TA 5D8NA 4OKOA 2F5IA 2PC1A 4UA3A 4ZBGA 5LRJA 3MRUA 4PSWA 1ZLIA 4F0XA 2DEAA 3V38A 2V8GA 2Z10A 4J3GA 5JPHA 3SI2A 1EE3P 1S7NA 2Q7BA 3T8WA 4UEZA 3JUWA 1S7LA 4M6HA 1CM0A 4QC6A 1KUVA 3PGPA 3SXOA 3CXSA 4AVBA 2EK9A 4JD6A 4MFLA 2KCWA 1XOVA 2VEZA 2PJ4A 1IU8A 2HUZA 4B5OA 1ZG7A 2FIAA 3GUXA 4KOVA 4IUSA 5KTAA 2AFSA 4FD6A 3S6KA 5LYFA 3KQXA 4UWJA 4Q38A 2ZW4A 3WABA 2PDOA 2EVNA 3B3SA 4I49A 2AFOA 4MMOA 2B3VA 4E0AA 4JYWA 4NFRA 5J1QA 2POKA 4JXRA 2PJAA 4XPDC 4CAFA 4E2AA 3F5BA 3ZZIA 4A38A 8CPAA 2AE6A 4UCNA 2GANA 2P6EA 4YGOA 4AG7A 1Z8LA 4FBEA 1IY7A 1Z2LA 1UFHA 4NSQA 3FXTA 4UF4A 1RXTA 2OR4A 1TF8A 2VBQA 1ARMA 4NGRA 3WT4A 3K9TA 4MY0A 1ELLP 4P44A 1VKCA 1CX8A 4CGLA 1TKJA 2PIZA 1YQEA 2XEIA 1PCAA 3B35A 3BHXA 4QBJA 3D66A 1Z4RA 2PJ1A 3LACA 4AVAA 1GYTA 4KOWA 4P10A 2FT0A 3FEEA 1VHEA 4C7HA 3FB3A 1YGHA 3PFEA 2NYQA 4XPDB 3KHXA 1YVOA 3S6FA 2GLJA 4CYPA 3NA6A 2VI7A 5G1ZA 2A4NA 4CAEA 2JBJA 2Q43A 1LCPA 3K9UA 3S6HA 4PQAA 3D67A 2DPSA 5DS0A 3D8PA 1JQGA 3K2KA 1QSOA 4KOUA 2ARHA 1TKFA 2GIVA 4P4FA 1LOKA 1FT7A 2OZGA 3FIXA 3JTKA 3TX8A 2RC4A 4CGMA 1KUXA 1BPMA 1QQ9A 4FD5A 4UEFA 2AFWA 2NSMA 3DR6A 2VXKA 4MI4A 1QSRA 1WWZA 5AG6A 2FSRA 4P4BA 4F9VA 2G3TA 2PJ8A 2Y0MA 3D4UA 2Z3LA 4EFDA 3IWWA 3NFZA 4C2YA 3P2FA 2YNCC 3RAMA
chains in the Genus database with same CATH topology
2B4DA 4H6UA 3TTHA 2OZUA 1R57A 2X7BA 2Z11A 1M4DA 4NXYA 4PK2A 4Y49C 3BJ7A 2G3AA 2I00A 5A28A 2PR8A 4MHDA 4UFXA 4KOSA 3CXPA 4Q36A 2JDDA 3EO4A 2YNCA 3W6SA 2OZHA 4A31A 4UBRA 4CGNA 2FIWA 2P6GA 4C7IA 1GHEA 2VZZA 1BOBA 3F8KA 4F6AA 2BL1A 1PU9A 4NF1A 1M4GA 3IU1A 2AJ6A 2R8VA 3GYAA 4Y49B 1B87A 4KSAA 2JLMA 1XE4A 1YREA 2FE7A 2ZW5A 2Z3OA 4YFJA 4QUSA 4OLLA 4CYQA 3LD2A 5ISVA 1Q2CA 1LRZA 4CYOA 4QVTA 1S3ZA 4EVYA 1QSMA 2J8RA 2B5GB 4A32A 4CS0B 4B12A 2Q4VA 4OADA 1B6BA 3B8GA 5C88A 3PZJA 4F0YA 3FYNA 1Q2YA 3BJ8A 4JJXA 1I21A 2Q44A 3FRMA 2FS5A 1BO4A 4MFKA 1K4JA 1XF8A 2QMLA 4K30A 2YGWA 5HMNA 1I12A 3EFAA 3RYOA 1L0CA 4LUAA 4KUBA 2Q0YA 1XMTA 2Q4YA 4A33A 4AVCA 1I1DA 5G21A 4MBUA 4KORA 4L89A 1Z9UA 5CNPA 1CJWA 2VQYA 2Z3PA 4FD4A 4AG9A 4M85A 4XNHC 1M1DA 4BBHA 3R9EA 4CYNA 2HV2A 1Z4EA 3KKWA 4QB9A 3TOAA 1KZFA 2H5MA 2BUEA 3H5ZA 1QSNA 4KOYA 3JVNA 4MJ8A 4JLYA 4PK3A 3SHPA 5IB0A 3EXNA 4KS9A 4KLVA 4A2ZA 2I79A 1Y9WA 3OWCA 2J8MA 2YNEA 1P0HA 5AGEA 1XIXA 4NCZA 5H86A 4XNHB 3GKRA 2REEA 4H6ZA 1IB1E 3VWDA 3W91A 4KZTA 1S7FA 1YX0A 4GS4A 3N7ZA 4CRZB 3IWGA 5E96A 1NMTA 3V8IA 1N71A 4PSXA 3TT2A 3R95A 4R9MA 4HNWB 5KTCA 2B3UA 1NSLA 2Z3KA 4U9ZA 5A27A 2DPTA 4B5PB 2JEVA 5F48A 2WPXA 3R9FA 4ZGYB 4B5PA 4KOTA 5JQ4A 3I3GA 5H84A 5AG4A 2QECA 4A95A 2CY2A 2PSWA 4A30A 1QSTA 1PUAA 3R9GA 3H4QA 2HQYA 3DNSA 2G0BA 2OH1A 3FNCA 1P4NA 2ZXVA 4XPLA 3TOBA 4CRYB 4CAVA 2EUIA 2DXQA 3ZJ0A 1IYKA 2D4OA 4UFWA 1RO5A 2VZYA 4FD7A 4YRHA 3TO6A 4KVXA 4NEXA 5BWAB 1NE9A 3TCVA 1J4JA 3A9LA 2IL4A 2FXFA 2R98A 1TIQA 4DNCA 3DSBA 4B13A 1XEBA 2B5GA 5F46A 1KUYA 4UWIA 5IV0A 2FL4A 4KVOE 3IGRA 3D3SA 5AG5A 4MY3A 3DDDA 4RI1A 4OAEA 4KOXA 2FCKA 4U5YA 3MGDA 1U6MA 1S5KA 4R87A 1Y7RA 2P6FA 2WUUA 2Z3NA 2ZW6A 3G3SA 4C68A 4II9A 1Q2DA 2QIRA 4JXQA 5HH1A 4IF5A 3EY5A 2R7HA 4B10A 4CAXA 4MFZA 2B4BA 5C82A 4KUAA 3E0KA 2REFA 4R57A 2J8NA 3PP9A 4L8AA 5FVJA 5F49A 5GCNA 3TO9A 5AG7A 4KLWA 3IU2A 2OB0A 4HNYB 4PV6A 2WPWA 5DWMA 3S6GA 4LX9A 1IYLA 4MFPA 1YVKA 1M4IA 3C26A 2ZPAA 4X5KA 3QB8A 1MJ9A 1ZO0A 4H89A 2PR1A 1IIDA 1MJAA 4MFQA 3LODA 2C27A 3CXQA 1SQHA 2Q04A 3IWEA 3G8WA 2OU2A 1VHSA 3DR8A 1S7KA 4M3SA 3FBUA 1YLEA 1MK4A 4C2XA 3T90A 3F0AA 3GY9A 4BMHA 5KTDA 5DWNA 5IX3A 4ONUA 4R3KA 2Z3MA 3UY5A 5G22A 4HKFA 4B14A 1V0CA 4RS2A 3VWEA 4CGPA 1YK3A 4XPKA 3SXNA 1IICA 4ORFA 3QAHA 1S60A 2JDCA 4U9YA 1YR0A 1M44A 2D4PA 1WK4A 5EC4A 5J8CA 3P2HA 3T9YA 5F47A 3BLNA 3D2PA 1MJBA 2BEIA 2CXAA 2WSAA 4UCPA 2ATRA 5J8FA 2B4DB 3I9SA 1ON0A 5EBVA 3TE4A 4KSFA 2CNSA 1OZPA 3R1KA 4KVME 3R96A 4AB7A 2B58A 2YNDA 2GE3A 2PRBA 2CNTA 2P0WA 4R3LA 3TFYA 4MFJA 1Y9KA 2ZW7A 1FY7A 3WR7A 4B11A 4CGOA 2Z0ZA 4HNXB 3TO7A 4E8OA 2R1IA 4CAWA 2BSWA 4UFVA 2K5TA 2NMTA 4JWPA 2PQ8A 4UCMA 3D2MA 3NE7A 2O28A 5G20A 3W6XA 3EC4A 4C2ZA 5I0CA 2CNMA 2F5IA 2PC1A 4UA3A 4ZBGA 4PSWA 4F0XA 5JPHA 2Z10A 4J3GA 1S7NA 2Q7BA 3JUWA 1S7LA 1CM0A 4QC6A 1KUVA 3PGPA 3SXOA 3CXSA 4AVBA 4JD6A 4MFLA 2KCWA 2VEZA 4B5OA 2HUZA 2FIAA 4KOVA 5KTAA 4IUSA 3S6KA 4FD6A 4UWJA 4Q38A 2ZW4A 2PDOA 2EVNA 4I49A 2B3VA 4E0AA 4JXRA 4XPDC 4CAFA 4E2AA 3F5BA 3ZZIA 2AE6A 4UCNA 2GANA 2P6EA 4YGOA 4AG7A 1UFHA 4NSQA 3FXTA 1RXTA 2VBQA 4MY0A 1VKCA 4CGLA 4QBJA 1Z4RA 4AVAA 4KOWA 2FT0A 4C7HA 3FB3A 1YGHA 4XPDB 1YVOA 3S6FA 4CYPA 2VI7A 5G1ZA 2A4NA 4CAEA 3K9UA 3S6HA 2DPSA 3D8PA 1QSOA 4KOUA 2ARHA 2GIVA 2OZGA 3FIXA 3JTKA 2RC4A 4CGMA 1KUXA 4FD5A 4MI4A 3DR6A 2VXKA 1QSRA 1WWZA 5AG6A 2FSRA 2G3TA 2Y0MA 2Z3LA 4C2YA 3P2FA 2YNCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGO A;  4CGN A;  4B10 A;  4A33 A;  4B14 A;  4CYP A;  5G21 A;  4C7I A;  5G1Z A;  4CAE A;  4CAF A;  4CGP A;  4UFW A;  3IU1 A;  4UCN A;  4UFV A;  4A2Z A;  2YNE A;  5AG5 A;  3IWE A;  5AGE A;  5A27 A;  5AG7 A;  2YND A;  3JTK A;  3IU2 A;  4A31 A;  4CGM A;  5A28 A;  4CYQ A;  5AG4 A;  4A95 A;  4UFX A;  4UCM A;  4BBH A;  4CGL A;  4C2X A;  4CYN A;  5G20 A;  5AG6 A;  4A30 A;  4CYO A;  4C2Z A;  3H5Z A;  2WSA A;  4UCP A;  4B12 A;  2WUU A;  4C68 A;  4B13 A;  4A32 A;  4C2Y A;  4C7H A;  2YNC A;  2YNC C;  4B11 A;  5G22 A; 
#chains in the Genus database with same CATH topology
 2B4D A;  4H6U A;  1FNO A;  2OZU A;  4GM5 A;  3TC8 A;  3TTH A;  1R57 A;  2X7B A;  1RTQ A;  2DF5 A;  1CG2 A;  2JBK A;  2Z11 A;  3NH8 A;  3FJU A;  2EWB A;  3IO1 A;  1M4D A;  4NXY A;  4PK2 A;  2BO9 A;  4Y49 C;  1R43 A;  3BJ7 A;  3S9L A;  2G3A A;  4KSI A;  2I00 A;  5A28 A;  2PR8 A;  3CT9 A;  4MHD A;  3RZA A;  5AG4 A;  4RUH A;  5ELY A;  4UFX A;  1IOI A;  3VAT A;  4KOS A;  3CXP A;  3B3T A;  4Q36 A;  4A94 A;  1XFO A;  3MN8 A;  4MHN A;  2PJ9 A;  4ZYQ A;  1Z8T A;  2IMO A;  2JDD A;  3SJE A;  1F57 A;  3EO4 A;  3S9N A;  2CTB A;  2YNC A;  3W6S A;  2OZH A;  4A31 A;  4UBR A;  4CGN A;  2FIW A;  2P6G A;  1TXR A;  4C7I A;  1GHE A;  2VZZ A;  2ZEL A;  3SJX A;  1BOB A;  2AFM A;  3F8K A;  2BL1 A;  4F6A A;  1PU9 A;  4NF1 A;  1M4G A;  4FWU A;  3IU1 A;  2AJ6 A;  2R8V A;  3GYA A;  4Y49 B;  2ZEN A;  1B87 A;  2ZEM A;  4KSA A;  4MXU A;  2JLM A;  3QNV A;  1XE4 A;  2V8D A;  1YRE A;  2FE7 A;  2PJC A;  2ZW5 A;  2Z3O A;  4PXC A;  4X8I A;  4B6Z A;  4YFJ A;  4QUS A;  2QJ8 A;  4OLL A;  4RN7 A;  1Y0R A;  2GRE A;  3LD2 A;  4CYQ A;  4W9Y A;  5ISV A;  1BPN A;  1Q2C A;  1LRZ A;  4CYO A;  1OBR A;  4R7M A;  4QVT A;  5CBM A;  4P45 A;  4NJQ A;  1S3Z A;  4EVY A;  1QSM A;  5HVG A;  2J8R A;  2ZOF A;  2B5G B;  3KQZ A;  4A32 A;  5JH9 A;  4CS0 B;  4B12 A;  2F8H A;  5K8N A;  1CBX A;  2Q4V A;  4OAD A;  1B6B A;  4P4E A;  3B8G A;  3KR5 A;  3PZJ A;  5C88 A;  4F0Y A;  1AUG A;  4BIN A;  2PJB A;  1CP6 A;  3BXM A;  3FYN A;  4ZY2 A;  1Q2Y A;  3BJ8 A;  4JJX A;  2BOA A;  3HLP A;  1I21 A;  2ODF A;  2Q44 A;  3FRM A;  2FS5 A;  1BO4 A;  1UWY A;  1K4J A;  4MFK A;  1XF8 A;  5HVF A;  4EME A;  4G1P A;  2QML A;  4K30 A;  2YGW A;  2PJ6 A;  3D7H A;  4Q7A A;  5HMN A;  1Z8W A;  4OME A;  1I12 A;  3EFA A;  3RYO A;  3B3C A;  1L0C A;  4LUA A;  1CPX A;  3D7G A;  1YLO A;  4KUB A;  1ZG8 A;  2Q0Y A;  2WYR A;  1XMT A;  2C6G A;  2Q4Y A;  4UIA A;  1Y0Y A;  1I1D A;  5G21 A;  4A33 A;  4AVC A;  4MBU A;  1DTD A;  2IJZ A;  5EMI A;  4KOR A;  3PB7 X;  3LWU A;  3VAR A;  2XEG A;  4MHP A;  4L89 A;  1Z9U A;  5CNP A;  1CJW A;  2JEW A;  2VQY A;  2Z3P A;  2V77 A;  1HDQ A;  4FD4 A;  4R76 A;  4AG9 A;  4M85 A;  4XNH C;  4TNU A;  1M1D A;  1YW6 A;  3R9E A;  4BBH A;  4CYN A;  2HV2 A;  1ZLH A;  4PXB A;  1Z4E A;  3KKW A;  4QB9 A;  3TOA A;  1KZF A;  2H5M A;  2BUE A;  3H5Z A;  1QSN A;  1LAN A;  2ZEF A;  4KOY A;  3JVN A;  4MJ8 A;  5LYL A;  4JLY A;  4PK3 A;  4DYO A;  3VH9 A;  1KWM A;  1XMB A;  3SHP A;  1IOF A;  5IB0 A;  1YME A;  4UEE A;  1TF9 A;  4OID A;  3EXN A;  3FMC A;  3IJ3 A;  4NGQ A;  4TWE A;  4KS9 A;  4KLV A;  4A2Z A;  2I79 A;  2PJ3 A;  3PBB A;  1Y9W A;  3OWC A;  2J8M A;  2YNE A;  1P0H A;  3KHZ A;  5AGE A;  1XIX A;  2ZOG A;  5JM6 A;  4NCZ A;  4OC2 A;  5H86 A;  1ZG9 A;  4OIW A;  4XNH B;  3GKR A;  2REE A;  3KR4 A;  3QAY A;  6CPA A;  3IC1 A;  2FVG A;  4H6Z A;  1IB1 E;  2ZED A;  4F9U A;  3VWD A;  3W91 A;  4KZT A;  1S7F A;  2XEJ A;  1YX0 A;  4GS4 A;  3N7Z A;  3SJG A;  4CRZ B;  1LAP A;  3IWG A;  2PJ2 A;  5E96 A;  3D7F A;  2WZN A;  1NMT A;  1NSA A;  3V8I A;  1H8L A;  2CF4 A;  1N71 A;  3BI0 A;  4PSX A;  3R95 A;  3S9M A;  4NGT A;  4R9M A;  3TT2 A;  4HNW B;  4GXH A;  5KTC A;  3H8E A;  3DLJ A;  3FH4 A;  2B3U A;  1NSL A;  3CPA A;  4IAV A;  2Z3K A;  2O53 A;  4U9Z A;  2RFH A;  7CPA A;  5A27 A;  2DPT A;  4B5P B;  4CPA A;  2JEV A;  5F48 A;  2WPX A;  3R9F A;  4ZGY B;  4O23 A;  4B5P A;  4KOT A;  3PEI A;  5JQ4 A;  3I3G A;  4MCQ A;  3CZX A;  5H84 A;  3RO0 A;  2QEC A;  5LYD A;  2PRQ A;  4A95 A;  1VGY A;  4YWY A;  2XEF A;  2CY2 A;  4OC1 A;  2PSW A;  4A30 A;  1QST A;  3NH4 A;  1PUA A;  4PPZ A;  3KI9 A;  3R9G A;  5CPA A;  3H4Q A;  2HQY A;  3DNS A;  2G0B A;  2QVP A;  2OH1 A;  3FNC A;  1P4N A;  2ZXV A;  3IFE A;  4XPL A;  1Z5R A;  3TOB A;  4CAV A;  2EUI A;  4CRY B;  2DXQ A;  3ZJ0 A;  4M6I A;  1VIX A;  2GLF A;  1IYK A;  2D4O A;  4FAI A;  1F2O A;  4UFW A;  1LAM A;  4MCR A;  1RO5 A;  4R8F A;  2VZY A;  4FD7 A;  4YRH A;  2F7V A;  3TO6 A;  5K8O A;  2GU2 A;  2PIY A;  4KVX A;  4NEX A;  5D29 A;  5BWA B;  2C1C A;  2CIJ A;  1NE9 A;  4NJR A;  3TCV A;  1XBU A;  2GFQ A;  2ZEE A;  1J4J A;  3A9L A;  1BAV A;  2IL4 A;  4OC0 A;  1Y7E A;  2FXF A;  2R98 A;  1TIQ A;  4AXV A;  4DNC A;  3DSB A;  4B13 A;  4MCP A;  4ZI6 A;  3SI1 A;  2ZEP A;  1R3N A;  3KAS A;  1XEB A;  2B5G A;  5F46 A;  1BLL E;  1KUY A;  4UWI A;  5IV0 A;  1XJO A;  2ZEO A;  2FL4 A;  4KVO E;  3IGR A;  2PJ7 A;  3D3S A;  1AMP A;  4PXD A;  5AG5 A;  3PB8 X;  3FF3 A;  3RNZ A;  3GB0 A;  3JRU A;  4LQG A;  4MY3 A;  4ZY0 A;  4M6G A;  3DDD A;  4RI1 A;  4OC3 A;  4OAE A;  4DJL A;  4KOX A;  2AFZ A;  5I4M A;  4NGM A;  2FCK A;  4P4I A;  3V7Z A;  4OC4 A;  4U5Y A;  4WWV A;  1U6M A;  3MGD A;  5LRG A;  1S5K A;  5K8M A;  4R87 A;  1Y7R A;  2P6F A;  2WUU A;  2Z3N A;  2ZW6 A;  3FED A;  3G3S A;  2HB6 A;  4NGN A;  1Q2D A;  1CP7 A;  4C68 A;  2QIR A;  4II9 A;  3HUV A;  4P4J A;  4JXQ A;  2PJ5 A;  5HH1 A;  4IF5 A;  3EY5 A;  2R7H A;  2RB7 A;  4B10 A;  4MFZ A;  3ISZ A;  4CAX A;  2B4B A;  5C82 A;  4IHM A;  5THW A;  4KUA A;  3GIU A;  2IQ6 A;  3E0K A;  3WC5 A;  2REF A;  3KGQ A;  2EK8 A;  4R57 A;  5LRK A;  2J8N A;  3PP9 A;  4JZ0 A;  1XRY A;  1AYE A;  4L8A A;  5FVJ A;  5F49 A;  5GCN A;  3KL9 A;  5AG7 A;  1QMU A;  4KLW A;  3TO9 A;  3IU2 A;  3L2N A;  2OB0 A;  4HNY B;  4P6Y A;  4PV6 A;  2WPW A;  5DWM A;  4DUK A;  3KZW A;  3S6G A;  4LX9 A;  5HXD A;  1IYL A;  4MFP A;  1YVK A;  3PFO A;  1M4I A;  3C26 A;  2ZPA A;  4R6T A;  5LYI A;  2EBJ A;  4X5K A;  3QB8 A;  4ZX8 A;  4K3N A;  2ANP A;  4H2K A;  1MJ9 A;  1ZO0 A;  2QYV A;  3PB6 X;  4H89 A;  3LMS A;  1JWQ A;  1Z8X A;  3I1U A;  1LFW A;  2PR1 A;  3B7I A;  5IB9 A;  1YW4 A;  1IID A;  1MJA A;  2EO8 A;  4MFQ A;  2PE3 A;  5JGF A;  3LOD A;  4OP4 A;  1IGB A;  2C27 A;  2CTC A;  3CXQ A;  1SQH A;  4ZY1 A;  2Q04 A;  3B2Y A;  3IWE A;  4NGP A;  3G8W A;  1VHO A;  1VHS A;  2OU2 A;  1S7K A;  2VL1 A;  3DR8 A;  2V8H A;  4IK2 A;  4M3S A;  3D68 A;  4Z65 A;  3FBU A;  4P4D A;  2Q4Z A;  2PCU A;  1YLE A;  1MK4 A;  4C2X A;  1ELM P;  3T90 A;  1DE4 C;  3F0A A;  3GY9 A;  3ISX A;  4NGS A;  4YU9 A;  4ONW A;  4BMH A;  4MHY A;  2AFX A;  5KTD A;  3D7D A;  5DWN A;  4LQ6 A;  5IX3 A;  4ONU A;  4WJB A;  3PB4 X;  4R3K A;  3NH5 A;  2Z3M A;  3PRT A;  1HEE A;  3UY5 A;  5G22 A;  2BCO A;  2ZEG A;  3WC7 A;  3FEC A;  4HKF A;  1V0C A;  3CDX A;  4B14 A;  5F09 A;  4RS2 A;  1X12 A;  3VWE A;  4CGP A;  1YK3 A;  4XPK A;  3SXN A;  3GLJ A;  1IIC A;  2PJ0 A;  4ORF A;  4A39 A;  3QAH A;  3H8F A;  2AFU A;  5HVH A;  1S60 A;  2JDC A;  4U9Y A;  3PB9 X;  1YR0 A;  1M44 A;  2D4P A;  3NE8 A;  4PXE A;  1WK4 A;  4X3R A;  5EC4 A;  3RBU A;  5J8C A;  2ABZ A;  3P2H A;  4MRI A;  3T9Y A;  5F47 A;  3BLN A;  3D2P A;  1MJB A;  2BEI A;  2I3C A;  1CPS A;  2CXA A;  4UIB A;  2WSA A;  4UCP A;  2ATR A;  5J8F A;  2B4D B;  2ZEH A;  1X10 A;  3I9S A;  1ON0 A;  5EBV A;  4OC5 A;  3TE4 A;  3SI0 A;  4FUU A;  4KSF A;  1A2Z A;  1F2P A;  3FVL A;  2CNS A;  3CPX A;  1OZP A;  1TKH A;  3R1K A;  3PBE A;  4KVM E;  3R96 A;  4AB7 A;  2B58 A;  2OOT A;  4MHZ A;  1Q7L A;  2YND A;  2GE3 A;  2PRB A;  3N5F A;  2O4H A;  2CNT A;  4MCS A;  3B3V A;  2P0W A;  4R3L A;  3WC6 A;  2HC9 A;  3TFY A;  2V8V A;  4HPS A;  4MFJ A;  3FX6 A;  1Y9K A;  2ZW7 A;  3IIB A;  3IEH A;  1FY7 A;  3WR7 A;  4B11 A;  4CGO A;  2Z0Z A;  4HNX B;  1ARL A;  2C6P A;  3TO7 A;  4E8O A;  2R1I A;  4ZX9 A;  4CAW A;  2PVW A;  2Q7S A;  2BSW A;  1HDU A;  2C6C A;  4UFV A;  1PYT B;  2K5T A;  3DGV A;  4A37 A;  1M4L A;  2Q51 A;  4EWT A;  2NMT A;  4JWP A;  3H8G A;  4BD9 A;  2PQ8 A;  5K8P A;  4F8Z A;  2J9A A;  1YSJ A;  3B3W A;  4UCM A;  3D2M A;  3NE7 A;  2O28 A;  2G9D A;  5G20 A;  3W6X A;  3EC4 A;  3SJF A;  4C2Z A;  5I0C A;  2PVV A;  2CNM A;  3BI1 A;  4X2T A;  5D8N A;  4OKO A;  2F5I A;  2PC1 A;  4UA3 A;  4ZBG A;  5LRJ A;  3MRU A;  4PSW A;  1ZLI A;  4F0X A;  2DEA A;  3V38 A;  2V8G A;  2Z10 A;  4J3G A;  5JPH A;  3SI2 A;  1EE3 P;  1S7N A;  2Q7B A;  3T8W A;  4UEZ A;  3JUW A;  1S7L A;  4M6H A;  1CM0 A;  4QC6 A;  1KUV A;  3PGP A;  3SXO A;  3CXS A;  4AVB A;  2EK9 A;  4JD6 A;  4MFL A;  2KCW A;  1XOV A;  2VEZ A;  2PJ4 A;  1IU8 A;  2HUZ A;  4B5O A;  1ZG7 A;  2FIA A;  3GUX A;  4KOV A;  4IUS A;  5KTA A;  2AFS A;  4FD6 A;  3S6K A;  5LYF A;  3KQX A;  4UWJ A;  4Q38 A;  2ZW4 A;  3WAB A;  2PDO A;  2EVN A;  3B3S A;  4I49 A;  2AFO A;  4MMO A;  2B3V A;  4E0A A;  4JYW A;  4NFR A;  5J1Q A;  2POK A;  4JXR A;  2PJA A;  4XPD C;  4CAF A;  4E2A A;  3F5B A;  3ZZI A;  4A38 A;  8CPA A;  2AE6 A;  4UCN A;  2GAN A;  2P6E A;  4YGO A;  4AG7 A;  1Z8L A;  4FBE A;  1IY7 A;  1Z2L A;  1UFH A;  4NSQ A;  3FXT A;  4UF4 A;  1RXT A;  2OR4 A;  1TF8 A;  2VBQ A;  1ARM A;  4NGR A;  3WT4 A;  3K9T A;  4MY0 A;  1ELL P;  4P44 A;  1VKC A;  1CX8 A;  4CGL A;  1TKJ A;  2PIZ A;  1YQE A;  2XEI A;  1PCA A;  3B35 A;  3BHX A;  4QBJ A;  3D66 A;  1Z4R A;  2PJ1 A;  3LAC A;  4AVA A;  1GYT A;  4KOW A;  4P10 A;  2FT0 A;  3FEE A;  1VHE A;  4C7H A;  3FB3 A;  1YGH A;  3PFE A;  2NYQ A;  4XPD B;  3KHX A;  1YVO A;  3S6F A;  2GLJ A;  4CYP A;  3NA6 A;  2VI7 A;  5G1Z A;  2A4N A;  4CAE A;  2JBJ A;  2Q43 A;  1LCP A;  3K9U A;  3S6H A;  4PQA A;  3D67 A;  2DPS A;  5DS0 A;  3D8P A;  1JQG A;  3K2K A;  1QSO A;  4KOU A;  2ARH A;  1TKF A;  2GIV A;  4P4F A;  1LOK A;  1FT7 A;  2OZG A;  3FIX A;  3JTK A;  3TX8 A;  2RC4 A;  4CGM A;  1KUX A;  1BPM A;  1QQ9 A;  4FD5 A;  4UEF A;  2AFW A;  2NSM A;  3DR6 A;  2VXK A;  4MI4 A;  1QSR A;  1WWZ A;  5AG6 A;  2FSR A;  4P4B A;  4F9V A;  2G3T A;  2PJ8 A;  2Y0M A;  3D4U A;  2Z3L A;  4EFD A;  3IWW A;  3NFZ A;  4C2Y A;  3P2F A;  2YNC C;  3RAM A; 
#chains in the Genus database with same CATH homology
 2B4D A;  4H6U A;  3TTH A;  2OZU A;  1R57 A;  2X7B A;  2Z11 A;  1M4D A;  4NXY A;  4PK2 A;  4Y49 C;  3BJ7 A;  2G3A A;  2I00 A;  5A28 A;  2PR8 A;  4MHD A;  4UFX A;  4KOS A;  3CXP A;  4Q36 A;  2JDD A;  3EO4 A;  2YNC A;  3W6S A;  2OZH A;  4A31 A;  4UBR A;  4CGN A;  2FIW A;  2P6G A;  4C7I A;  1GHE A;  2VZZ A;  1BOB A;  3F8K A;  4F6A A;  2BL1 A;  1PU9 A;  4NF1 A;  1M4G A;  3IU1 A;  2AJ6 A;  2R8V A;  3GYA A;  4Y49 B;  1B87 A;  4KSA A;  2JLM A;  1XE4 A;  1YRE A;  2FE7 A;  2ZW5 A;  2Z3O A;  4YFJ A;  4QUS A;  4OLL A;  4CYQ A;  3LD2 A;  5ISV A;  1Q2C A;  1LRZ A;  4CYO A;  4QVT A;  1S3Z A;  4EVY A;  1QSM A;  2J8R A;  2B5G B;  4A32 A;  4CS0 B;  4B12 A;  2Q4V A;  4OAD A;  1B6B A;  3B8G A;  5C88 A;  3PZJ A;  4F0Y A;  3FYN A;  1Q2Y A;  3BJ8 A;  4JJX A;  1I21 A;  2Q44 A;  3FRM A;  2FS5 A;  1BO4 A;  4MFK A;  1K4J A;  1XF8 A;  2QML A;  4K30 A;  2YGW A;  5HMN A;  1I12 A;  3EFA A;  3RYO A;  1L0C A;  4LUA A;  4KUB A;  2Q0Y A;  1XMT A;  2Q4Y A;  4A33 A;  4AVC A;  1I1D A;  5G21 A;  4MBU A;  4KOR A;  4L89 A;  1Z9U A;  5CNP A;  1CJW A;  2VQY A;  2Z3P A;  4FD4 A;  4AG9 A;  4M85 A;  4XNH C;  1M1D A;  4BBH A;  3R9E A;  4CYN A;  2HV2 A;  1Z4E A;  3KKW A;  4QB9 A;  3TOA A;  1KZF A;  2H5M A;  2BUE A;  3H5Z A;  1QSN A;  4KOY A;  3JVN A;  4MJ8 A;  4JLY A;  4PK3 A;  3SHP A;  5IB0 A;  3EXN A;  4KS9 A;  4KLV A;  4A2Z A;  2I79 A;  1Y9W A;  3OWC A;  2J8M A;  2YNE A;  1P0H A;  5AGE A;  1XIX A;  4NCZ A;  5H86 A;  4XNH B;  3GKR A;  2REE A;  4H6Z A;  1IB1 E;  3VWD A;  3W91 A;  4KZT A;  1S7F A;  1YX0 A;  4GS4 A;  3N7Z A;  4CRZ B;  3IWG A;  5E96 A;  1NMT A;  3V8I A;  1N71 A;  4PSX A;  3TT2 A;  3R95 A;  4R9M A;  4HNW B;  5KTC A;  2B3U A;  1NSL A;  2Z3K A;  4U9Z A;  5A27 A;  2DPT A;  4B5P B;  2JEV A;  5F48 A;  2WPX A;  3R9F A;  4ZGY B;  4B5P A;  4KOT A;  5JQ4 A;  3I3G A;  5H84 A;  5AG4 A;  2QEC A;  4A95 A;  2CY2 A;  2PSW A;  4A30 A;  1QST A;  1PUA A;  3R9G A;  3H4Q A;  2HQY A;  3DNS A;  2G0B A;  2OH1 A;  3FNC A;  1P4N A;  2ZXV A;  4XPL A;  3TOB A;  4CRY B;  4CAV A;  2EUI A;  2DXQ A;  3ZJ0 A;  1IYK A;  2D4O A;  4UFW A;  1RO5 A;  2VZY A;  4FD7 A;  4YRH A;  3TO6 A;  4KVX A;  4NEX A;  5BWA B;  1NE9 A;  3TCV A;  1J4J A;  3A9L A;  2IL4 A;  2FXF A;  2R98 A;  1TIQ A;  4DNC A;  3DSB A;  4B13 A;  1XEB A;  2B5G A;  5F46 A;  1KUY A;  4UWI A;  5IV0 A;  2FL4 A;  4KVO E;  3IGR A;  3D3S A;  5AG5 A;  4MY3 A;  3DDD A;  4RI1 A;  4OAE A;  4KOX A;  2FCK A;  4U5Y A;  3MGD A;  1U6M A;  1S5K A;  4R87 A;  1Y7R A;  2P6F A;  2WUU A;  2Z3N A;  2ZW6 A;  3G3S A;  4C68 A;  4II9 A;  1Q2D A;  2QIR A;  4JXQ A;  5HH1 A;  4IF5 A;  3EY5 A;  2R7H A;  4B10 A;  4CAX A;  4MFZ A;  2B4B A;  5C82 A;  4KUA A;  3E0K A;  2REF A;  4R57 A;  2J8N A;  3PP9 A;  4L8A A;  5FVJ A;  5F49 A;  5GCN A;  3TO9 A;  5AG7 A;  4KLW A;  3IU2 A;  2OB0 A;  4HNY B;  4PV6 A;  2WPW A;  5DWM A;  3S6G A;  4LX9 A;  1IYL A;  4MFP A;  1YVK A;  1M4I A;  3C26 A;  2ZPA A;  4X5K A;  3QB8 A;  1MJ9 A;  1ZO0 A;  4H89 A;  2PR1 A;  1IID A;  1MJA A;  4MFQ A;  3LOD A;  2C27 A;  3CXQ A;  1SQH A;  2Q04 A;  3IWE A;  3G8W A;  2OU2 A;  1VHS A;  3DR8 A;  1S7K A;  4M3S A;  3FBU A;  1YLE A;  1MK4 A;  4C2X A;  3T90 A;  3F0A A;  3GY9 A;  4BMH A;  5KTD A;  5DWN A;  5IX3 A;  4ONU A;  4R3K A;  2Z3M A;  3UY5 A;  5G22 A;  4HKF A;  4B14 A;  1V0C A;  4RS2 A;  3VWE A;  4CGP A;  1YK3 A;  4XPK A;  3SXN A;  1IIC A;  4ORF A;  3QAH A;  1S60 A;  2JDC A;  4U9Y A;  1YR0 A;  1M44 A;  2D4P A;  1WK4 A;  5EC4 A;  5J8C A;  3P2H A;  3T9Y A;  5F47 A;  3BLN A;  3D2P A;  1MJB A;  2BEI A;  2CXA A;  2WSA A;  4UCP A;  2ATR A;  5J8F A;  2B4D B;  3I9S A;  1ON0 A;  5EBV A;  3TE4 A;  4KSF A;  2CNS A;  1OZP A;  3R1K A;  4KVM E;  3R96 A;  4AB7 A;  2B58 A;  2YND A;  2GE3 A;  2PRB A;  2CNT A;  2P0W A;  4R3L A;  3TFY A;  4MFJ A;  1Y9K A;  2ZW7 A;  1FY7 A;  3WR7 A;  4B11 A;  4CGO A;  2Z0Z A;  4HNX B;  3TO7 A;  4E8O A;  2R1I A;  4CAW A;  2BSW A;  4UFV A;  2K5T A;  2NMT A;  4JWP A;  2PQ8 A;  4UCM A;  3D2M A;  3NE7 A;  2O28 A;  5G20 A;  3W6X A;  3EC4 A;  4C2Z A;  5I0C A;  2CNM A;  2F5I A;  2PC1 A;  4UA3 A;  4ZBG A;  4PSW A;  4F0X A;  5JPH A;  2Z10 A;  4J3G A;  1S7N A;  2Q7B A;  3JUW A;  1S7L A;  1CM0 A;  4QC6 A;  1KUV A;  3PGP A;  3SXO A;  3CXS A;  4AVB A;  4JD6 A;  4MFL A;  2KCW A;  2VEZ A;  4B5O A;  2HUZ A;  2FIA A;  4KOV A;  5KTA A;  4IUS A;  3S6K A;  4FD6 A;  4UWJ A;  4Q38 A;  2ZW4 A;  2PDO A;  2EVN A;  4I49 A;  2B3V A;  4E0A A;  4JXR A;  4XPD C;  4CAF A;  4E2A A;  3F5B A;  3ZZI A;  2AE6 A;  4UCN A;  2GAN A;  2P6E A;  4YGO A;  4AG7 A;  1UFH A;  4NSQ A;  3FXT A;  1RXT A;  2VBQ A;  4MY0 A;  1VKC A;  4CGL A;  4QBJ A;  1Z4R A;  4AVA A;  4KOW A;  2FT0 A;  4C7H A;  3FB3 A;  1YGH A;  4XPD B;  1YVO A;  3S6F A;  4CYP A;  2VI7 A;  5G1Z A;  2A4N A;  4CAE A;  3K9U A;  3S6H A;  2DPS A;  3D8P A;  1QSO A;  4KOU A;  2ARH A;  2GIV A;  2OZG A;  3FIX A;  3JTK A;  2RC4 A;  4CGM A;  1KUX A;  4FD5 A;  4MI4 A;  3DR6 A;  2VXK A;  1QSR A;  1WWZ A;  5AG6 A;  2FSR A;  2G3T A;  2Y0M A;  2Z3L A;  4C2Y A;  3P2F A;  2YNC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...