4CGMA

Leishmania major n-myristoyltransferase in complex with a biphenyl- derivative inhibitor
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
411
structure length
411
Chain Sequence
b'AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Diverse Modes of Binding in Structures of Leishmania Major N-Myristoyltransferase with Selective Inhibitors
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 125
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cgmA00
5AG6A 4C7IA 5G21A 5A28A 4UFVA 4UFWA 4A30A 4C2XA 4A2ZA 4CGPA 4UFXA 5G22A 4CGOA 2YNCA 4CGLA 4A33A 4C2YA 4CGNA 5AG5A 4UCMA 4CYPA 4B12A 4CYOA 4CAFA 3IU1A 4B10A 5AGEA 5AG4A 4C2ZA 3JTKA 4B14A 2YNDA 4A32A 4B11A 4C68A 4UCNA 4C7HA 4CYQA 5G1ZA 5AG7A 5G20A 4A95A 4A31A 2YNEA 2WUUA 3H5ZA 3IWEA 4CGMA 4CAEA 5A27A 4BBHA 2WSAA 4UCPA 3IU2A 4B13A 4CYNA 2YNCC
chains in the Genus database with same CATH superfamily
4C7IA 3C26A 3PB9X 1TF9A 2FIWA 4UFVA 3KI9A 2DPSA 5JGFA 2JEWA 1R57A 1NMTA 2VBQA 2Q4VA 4XNHC 2ANPA 4ONUA 3LWUA 4F0XA 4DJLA 1V0CA 5IV0A 1I1DA 4P6YA 2G3AA 4B5PB 2ARHA 3GY9A 4C2ZA 2FT0A 2D4PA 2CTBA 2O53A 5CNPA 3KR5A 3TO6A 4OC2A 4A32A 1QMUA 3D2MA 2CIJA 3FX6A 2VZYA 2PJ9A 4TWEA 3RO0A 3SHPA 4K3NA 1Z5RA 2R1IA 4KUAA 3VATA 1PU9A 2BCOA 3S9NA 4WWVA 3PBEA 5FVJA 3IJ3A 1KUYA 4IAVA 4ZY2A 2O4HA 3PB8X 4U9YA 3TO9A 3B8GA 2JDCA 4CRYB 2ZELA 3B3CA 4NGMA 2XEIA 3B3SA 3A9LA 5H86A 2B4BA 4PQAA 1ON0A 1LAMA 1R3NA 1TXRA 3D66A 2ABZA 2JLMA 3EC4A 4MHNA 3P2HA 2NYQA 4Y49B 5CPAA 3GKRA 2WZNA 3BJ8A 5HVGA 2V77A 2XEJA 4OP4A 5I4MA 2IJZA 4L89A 2ODFA 3RZAA 4ONWA 4MXUA 4UEEA 3K9UA 4B5PA 2AFXA 1YX0A 4X5KA 1YW6A 4RN7A 2V8HA 1BO4A 3TT2A 3FEEA 2P0WA 1OBRA 3IWEA 3CPXA 5LYIA 3RNZA 3SJEA 4P10A 3G3SA 1Z8LA 2RB7A 3WABA 4A38A 3NH5A 4DYOA 3FEDA 4GS4A 4H89A 4BINA 1U6MA 3KZWA 4PV6A 1M4DA 2PIYA 2PR8A 4QC6A 4X8IA 2GLJA 3HLPA 3KKWA 3R9FA 4KOWA 3TX8A 1HEEA 4YFJA 5DS0A 5J1QA 2QECA 4KORA 2ZEEA 1YK3A 3TC8A 2CXAA 3CPAA 2ZEHA 4NGQA 4E0AA 5I0CA 2FIAA 1MJAA 5J8CA 1M44A 4JXQA 2FS5A 4NGPA 3HUVA 3BLNA 4A37A 4KSFA 1I12A 2GLFA 2OH1A 2RC4A 3SI1A 3D67A 5LRGA 2ZOFA 3F8KA 1CP7A 4Z65A 8CPAA 2Z3KA 1XJOA 4A2ZA 2G0BA 4MCPA 3V8IA 1IOIA 4KS9A 4R8FA 1S7FA 4P4DA 3QNVA 4P4IA 4YGOA 4QBJA 1Y7RA 2HC9A 5K8OA 5ELYA 2Z3NA 2ZEOA 3PBBA 4MHDA 2VI7A 4NXYA 2YNDA 1YREA 1FNOA 4KLWA 3D4UA 1VHOA 2VZZA 3EXNA 3H8EA 4MBUA 4ZY0A 1Y7EA 4MHPA 5EMIA 2EK8A 4KZTA 4P4EA 5JQ4A 2PDOA 2AFMA 3IWWA 2I00A 2IL4A 2AFZA 4IK2A 4CGOA 1QSMA 2J8RA 1IYLA 1XBUA 4UWIA 4MY0A 2PJ5A 1TIQA 3V38A 4IUSA 4MI4A 1ZG7A 2PJ3A 1MJBA 2A4NA 4R3LA 3S6KA 3SJGA 1QSTA 5EC4A 3E0KA 3LODA 2FCKA 4MFZA 4BD9A 4CAVA 4PXEA 1VHEA 1K4JA 5F09A 1PUAA 4MMOA 3B2YA 3W6XA 2Q4ZA 3D7FA 1Y9WA 2HUZA 3PFOA 4CYQA 1YMEA 5G20A 4ORFA 3BHXA 4NGRA 2C6GA 4CS0B 4CGMA 3I9SA 4KVME 1B87A 3SJXA 3FH4A 4UBRA 1Q7LA 2GANA 2PVWA 6CPAA 4H6ZA 1CP6A 4CPAA 4ZYQA 3LD2A 1GYTA 2AFOA 2C27A 1Z8XA 2V8VA 3N5FA 3SXNA 3DNSA 4JZ0A 2JDDA 3B35A 4F0YA 4F9UA 1Q2YA 3D8PA 3CXPA 2FE7A 4R6TA 4NJRA 4XNHB 3KL9A 1XF8A 4YWYA 4CGNA 4GXHA 4R3KA 2BUEA 1ZG9A 2REFA 2WYRA 3B7IA 3JVNA 3KQXA 4G1PA 2ZOGA 3SJFA 5LYLA 3KASA 4XPDC 1UFHA 2Q44A 3PZJA 3SI2A 1FY7A 3B3WA 2ZW5A 5IX3A 4CAXA 2B5GB 4B11A 2CNTA 5G1ZA 3TCVA 3CXSA 2BSWA 4LUAA 4UWJA 2PE3A 3VARA 1VIXA 1XRYA 2QIRA 3R1KA 4B10A 4YU9A 4KOXA 3PB4X 3TOAA 4UEZA 5HVHA 4MFQA 3FB3A 1S7LA 1YVKA 2NMTA 1IY7A 1NSAA 2RFHA 1S7KA 2DPTA 3FNCA 2Z3OA 1NE9A 1R43A 5E96A 4CRZB 4ZY1A 3JUWA 1N71A 1M1DA 3H8FA 1F2PA 3VWDA 4UCMA 1QSNA 4U5YA 1ZO0A 3IEHA 4K30A 2OZGA 3QB8A 4E2AA 2O28A 1B6BA 4UF4A 5AG4A 2R8VA 4P45A 3R9EA 2HB6A 4B14A 4X3RA 3D2PA 3N7ZA 4HPSA 4KOYA 1PYTB 3WC6A 3TFYA 1DTDA 4L8AA 2B5GA 2Z0ZA 4PSXA 1BLLE 3PFEA 2F8HA 1NSLA 1IB1E 4KVXA 3FF3A 3NH8A 2OB0A 1IYKA 1M4GA 2CNSA 4MJ8A 1IU8A 4R57A 3BJ7A 3CZXA 4RS2A 1YW4A 4M6GA 1HDUA 4P4BA 3GIUA 4UFWA 3WC7A 2Z11A 1QSOA 3NFZA 1WK4A 2CNMA 3CDXA 3PB7X 4MFPA 3RBUA 3S6FA 4AXVA 2ZW7A 5LYFA 1EE3P 5JH9A 4KSIA 5D8NA 5AG5A 3UY5A 3DDDA 3H8GA 4PK2A 2VQYA 2ATRA 4HNYB 3V7ZA 4CAWA 4AVBA 4MFLA 4MRIA 5KTDA 4Q36A 1BPMA 2PC1A 2XEGA 3NE8A 4M6HA 4C68A 2VEZA 4UCNA 5LRJA 4KOSA 4J3GA 4PXDA 3KGQA 4F6AA 3ZJ0A 2PJ7A 2EWBA 3W6SA 3S6GA 5KTAA 5K8MA 2OZHA 3OWCA 2YNCC 3KQZA 4JD6A 5AG6A 2FSRA 2PVVA 5G21A 4EWTA 4F9VA 4II9A 3R95A 4NCZA 2PJ4A 1YQEA 1CJWA 1XMTA 4KVOE 4A33A 1OZPA 1TKJA 4JJXA 1M4IA 2PRQA 1RTQA 3WT4A 3KHZA 4CYPA 4CAFA 3MRUA 3T8WA 4B5OA 2REEA 4E8OA 1AUGA 4FD4A 4XPKA 2ZEDA 4NGTA 3FRMA 2PJAA 3IGRA 4OIWA 2OOTA 4C7HA 1KUXA 4P44A 2C6PA 2YGWA 4M85A 1Y0RA 2FL4A 3TO7A 4QVTA 1S5KA 3F5BA 2P6FA 1IOFA 3B3TA 1S7NA 2WSAA 3MN8A 1CPXA 2JBKA 1MK4A 5JPHA 4TNUA 4F8ZA 2KCWA 5A28A 1VKCA 2ZW6A 4A30A 4C2XA 3FMCA 1ZLIA 4UIAA 1AYEA 3B3VA 4ZBGA 1YGHA 2C6CA 1Y0YA 4KOUA 4DUKA 2B4DB 2BO9A 2PRBA 3FYNA 1JQGA 2F5IA 3G8WA 4B12A 2H5MA 4JYWA 1MJ9A 2B3UA 2GFQA 5DWMA 2K5TA 4H6UA 4I49A 4UEFA 4UIBA 4EMEA 3GUXA 2IMOA 1BAVA 2Z3LA 3QAYA 1I21A 2J8MA 3H5ZA 1JWQA 1ELMP 4NGSA 1CM0A 4LX9A 4XPLA 3PP9A 4PSWA 3VH9A 5HMNA 1LANA 3IU2A 4OMEA 1LCPA 1Z2LA 1XE4A 1YLOA 3QAHA 2NSMA 1X10A 5F46A 2ZENA 1Q2CA 3GYAA 3MGDA 3KHXA 3D3SA 2QMLA 2P6GA 2Q7SA 2WPWA 4EVYA 4H2KA 4ZGYB 4OLLA 1YR0A 1XIXA 4LQGA 3ZZIA 4OC0A 2B4DA 3IU1A 2ZEPA 4QUSA 5F48A 4ZX9A 1X12A 2FVGA 2ZPAA 4GM5A 5LRKA 1Z8WA 1H8LA 2J9AA 4WJBA 1ZG8A 4XPDB 5HH1A 3LACA 3WR7A 3JRUA 2HQYA 2Q7BA 3W91A 5G22A 1Z9UA 2V8DA 1FT7A 4NSQA 2I3CA 2Q43A 1RXTA 3I1UA 1J4JA 4HNXB 3TE4A 1ARMA 3FBUA 3P2FA 2Q04A 4FAIA 2FXFA 4O23A 1XFOA 2PSWA 5J8FA 4OC4A 4RI1A 3RAMA 5CBMA 2Z3MA 2WPXA 4JLYA 4MHZA 4ZX8A 3CT9A 1CBXA 1VGYA 3NH4A 2D4OA 3IC1A 3TTHA 1P4NA 2AJ6A 2BEIA 4CYOA 3S9LA 4RUHA 1IIDA 5K8NA 1SQHA 2BL1A 3WC5A 2DXQA 4JXRA 2BOAA 3D7GA 3FVLA 4HNWB 2CY2A 2VXKA 2XEFA 2ZEFA 3DGVA 3PEIA 5AG7A 4AG9A 3NA6A 4M3SA 1KZFA 2CTCA 4U9ZA 4A31A 2WUUA 4EFDA 2PJ8A 4OAEA 1IGBA 2Q51A 1YSJA 2JEVA 2EUIA 5BWAB 4BBHA 4MCSA 3FXTA 4B13A 3EO4A 3ISXA 1KWMA 2ZXVA 2ZEMA 2C1CA 1Z4RA 4B6ZA 4PPZA 4CGLA 2P6EA 2AFSA 1ZLHA 2ZEGA 4KSAA 1ARLA 1Z4EA 3T90A 4R7MA 4Y49C 3BXMA 2B3VA 3GB0A 1BPNA 4W9YA 3IIBA 2GU2A 4FD5A 2I79A 4R76A 1CG2A 1QQ9A 3R9GA 4LQ6A 1QSRA 3IFEA 2AFUA 4A94A 1DE4C 4IF5A 1HDQA 5C82A 3L2NA 2QVPA 2Q0YA 4P4JA 1KUVA 2HV2A 3D68A 4M6IA 3D7DA 2JBJA 4R9MA 3DLJA 4YRHA 1LOKA 2PQ8A 4PK3A 2G3TA 4MCRA 5A27A 2PCUA 4UCPA 3K9TA 4MHYA 5DWNA 3BI1A 3DSBA 4FD7A 3F0AA 4CGPA 4OC1A 3EY5A 5IB0A 4PXCA 4MY3A 2OZUA 4P4FA 2IQ6A 2PJBA 2Q4YA 1XOVA 1GHEA 2EBJA 1AMPA 3BI0A 1YVOA 5H84A 4MCQA 1P0HA 3JTKA 4FD6A 4AB7A 4KOTA 3DR8A 4NF1A 4A95A 3IO1A 3S9MA 3FJUA 4MFJA 3VWEA 4OC5A 4OKOA 4DNCA 1Z8TA 4QB9A 5C88A 1F2OA 4AVCA 1S60A 4X2TA 4PXBA 4OC3A 3FECA 2POKA 3CXQA 4UFXA 1Y9KA 1TKHA 2PJCA 2R98A 2YNCA 3KR4A 3NE7A 2R7HA 3PRTA 4KUBA 3PB6X 3D7HA 2J8NA 3GLJA 4NGNA 1UWYA 3DR6A 3FIXA 4BMHA 5GCNA 2X7BA 3IWGA 3RYOA 2GIVA 2PR1A 5AGEA 2GREA 3SI0A 4AG7A 4AVAA 4KOVA 2EVNA 4UA3A 1TKFA 4IHMA 4NFRA 1RO5A 2AFWA 2GE3A 2DEAA 2PIZA 3K2KA 5F47A 1BOBA 4FBEA 1L0CA 3TOBA 4CAEA 1A2ZA 4MFKA 5LYDA 4OIDA 1XEBA 3EFAA 3T9YA 1LAPA 4OADA 1S3ZA 2AE6A 4HKFA 2DF5A 3R96A 5HXDA 1CX8A 2Z3PA 5JM6A 4Q7AA 2G9DA 5THWA 3ISZA 3I3GA 1F57A 2PJ0A 3LMSA 1PCAA 4NJQA 4FWUA 3SXOA 4C2YA 1LFWA 2CF4A 2Z10A 5HVFA 2QJ8A 1TF8A 2OU2A 1CPSA 4R87A 2OR4A 1YLEA 2PJ2A 2V8GA 5EBVA 1ELLP 7CPAA 2PJ1A 2PJ6A 4FUUA 3H4QA 5IB9A 2F7VA 2QYVA 4A39A 2EK9A 4KLVA 2EO8A 1Q2DA 2ZW4A 1IICA 4ZI6A 5ISVA 2Y0MA 5KTCA 3PGPA 2YNEA 2B58A 1XMBA 2VL1A 5D29A 1M4LA 4JWPA 3S6HA 4NEXA 5K8PA 1LRZA 1WWZA 4Q38A 4CYNA 1VHSA 5F49A
chains in the Genus database with same CATH topology
4C7IA 3C26A 2FIWA 4UFVA 2DPSA 1R57A 1NMTA 2VBQA 2Q4VA 4XNHC 4ONUA 4F0XA 5IV0A 1V0CA 1I1DA 2G3AA 4B5PB 2ARHA 3GY9A 4C2ZA 2FT0A 2D4PA 5CNPA 3TO6A 4A32A 3D2MA 2VZYA 3SHPA 2R1IA 4KUAA 1PU9A 5FVJA 1KUYA 4U9YA 3TO9A 3B8GA 2JDCA 4CRYB 3A9LA 5H86A 2B4BA 1ON0A 3EC4A 2JLMA 4Y49B 3P2HA 3GKRA 3BJ8A 4L89A 3K9UA 4B5PA 1YX0A 4X5KA 1BO4A 3TT2A 2P0WA 3IWEA 3G3SA 4GS4A 4H89A 1U6MA 4PV6A 1M4DA 2PR8A 4QC6A 3KKWA 3R9FA 4YFJA 4KOWA 2QECA 4KORA 1YK3A 2CXAA 4E0AA 5I0CA 2FIAA 1MJAA 5J8CA 1M44A 4JXQA 2FS5A 3BLNA 4KSFA 1I12A 2OH1A 2RC4A 3F8KA 2Z3KA 4A2ZA 2G0BA 3V8IA 4KS9A 1S7FA 4YGOA 4QBJA 1Y7RA 2Z3NA 4MHDA 2VI7A 4NXYA 2YNDA 1YREA 4KLWA 2VZZA 3EXNA 4MBUA 4KZTA 5JQ4A 2PDOA 2I00A 2IL4A 4CGOA 1QSMA 2J8RA 1IYLA 4UWIA 4MY0A 1TIQA 4IUSA 4MI4A 1MJBA 2A4NA 4R3LA 3S6KA 1QSTA 5EC4A 3E0KA 3LODA 2FCKA 4MFZA 4CAVA 1K4JA 1PUAA 3W6XA 1Y9WA 2HUZA 4CYQA 5G20A 4ORFA 4CS0B 4CGMA 3I9SA 4KVME 1B87A 4UBRA 2GANA 4H6ZA 3LD2A 2C27A 3SXNA 3DNSA 2JDDA 4F0YA 1Q2YA 3D8PA 3CXPA 2FE7A 4XNHB 4CGNA 1XF8A 4R3KA 2BUEA 2REFA 3JVNA 4XPDC 1UFHA 2Q44A 3PZJA 1FY7A 5IX3A 2ZW5A 4CAXA 2B5GB 4B11A 2CNTA 5G1ZA 3TCVA 3CXSA 2BSWA 4LUAA 4UWJA 2QIRA 3R1KA 4B10A 4KOXA 3TOAA 4MFQA 3FB3A 1S7LA 1YVKA 2NMTA 1S7KA 2DPTA 3FNCA 2Z3OA 1NE9A 5E96A 4CRZB 3JUWA 1N71A 1M1DA 3VWDA 4UCMA 1QSNA 4U5YA 1ZO0A 4K30A 2OZGA 3QB8A 4E2AA 2O28A 1B6BA 5AG4A 2R8VA 3R9EA 4B14A 3D2PA 3N7ZA 4KOYA 3TFYA 4L8AA 2B5GA 2Z0ZA 4PSXA 1NSLA 1IB1E 4KVXA 2OB0A 1IYKA 1M4GA 2CNSA 4MJ8A 4R57A 4RS2A 3BJ7A 4UFWA 2Z11A 1QSOA 1WK4A 2CNMA 4MFPA 3S6FA 2ZW7A 5AG5A 3UY5A 3DDDA 4PK2A 2VQYA 2ATRA 4HNYB 4CAWA 4AVBA 4MFLA 5KTDA 4Q36A 2PC1A 4C68A 2VEZA 4UCNA 4KOSA 4J3GA 4F6AA 3ZJ0A 3W6SA 3S6GA 5KTAA 2OZHA 3OWCA 2YNCC 4JD6A 5AG6A 2FSRA 5G21A 4II9A 3R95A 4NCZA 1CJWA 1XMTA 4KVOE 4A33A 1OZPA 4JJXA 1M4IA 4CYPA 4CAFA 4B5OA 2REEA 4E8OA 4FD4A 4XPKA 3FRMA 3IGRA 4C7HA 1KUXA 2YGWA 4M85A 2FL4A 3TO7A 4QVTA 1S5KA 3F5BA 2P6FA 1S7NA 2WSAA 1MK4A 5JPHA 2KCWA 5A28A 1VKCA 2ZW6A 4A30A 4C2XA 4ZBGA 1YGHA 4KOUA 2B4DB 2PRBA 3FYNA 2F5IA 3G8WA 4B12A 2H5MA 1MJ9A 2B3UA 5DWMA 2K5TA 4H6UA 4I49A 2Z3LA 1I21A 2J8MA 3H5ZA 4XPLA 5HMNA 1CM0A 4LX9A 3PP9A 4PSWA 3IU2A 1XE4A 3QAHA 5F46A 1Q2CA 3GYAA 3MGDA 3D3SA 2QMLA 2P6GA 2WPWA 4EVYA 4ZGYB 4OLLA 1YR0A 1XIXA 3ZZIA 2B4DA 3IU1A 4QUSA 5F48A 2ZPAA 4XPDB 5HH1A 3WR7A 3W91A 2HQYA 2Q7BA 1Z9UA 4NSQA 1RXTA 1J4JA 4HNXB 3TE4A 3FBUA 3P2FA 2Q04A 5J8FA 2FXFA 2PSWA 4RI1A 2Z3MA 2WPXA 4JLYA 2D4OA 3TTHA 1P4NA 2AJ6A 2BEIA 4CYOA 1IIDA 1SQHA 2BL1A 2DXQA 4JXRA 4HNWB 2CY2A 2VXKA 5AG7A 4AG9A 4M3SA 4A31A 1KZFA 4U9ZA 2WUUA 4OAEA 2JEVA 5BWAB 2EUIA 4BBHA 3FXTA 4B13A 3EO4A 2ZXVA 1Z4RA 4CGLA 2P6EA 4KSAA 1Z4EA 3T90A 4Y49C 2B3VA 4FD5A 2I79A 3R9GA 1QSRA 4IF5A 5C82A 2Q0YA 1KUVA 2HV2A 4R9MA 4YRHA 4PK3A 2PQ8A 2G3TA 5A27A 4UCPA 5DWNA 3DSBA 4FD7A 3F0AA 4CGPA 3EY5A 5IB0A 4MY3A 2OZUA 2Q4YA 1GHEA 1YVOA 5H84A 1P0HA 3JTKA 4FD6A 4KOTA 3DR8A 4NF1A 4A95A 4MFJA 3VWEA 4DNCA 4QB9A 5C88A 4AVCA 1S60A 3CXQA 4UFXA 1Y9KA 5G22A 2YNCA 2R98A 3NE7A 4KUBA 4AB7A 2R7HA 2J8NA 3DR6A 3FIXA 4BMHA 5GCNA 2X7BA 3IWGA 3RYOA 2GIVA 2PR1A 5AGEA 4AG7A 4AVAA 4KOVA 2EVNA 4UA3A 1RO5A 2GE3A 5F47A 1BOBA 1L0CA 3TOBA 4CAEA 4MFKA 1XEBA 3EFAA 3T9YA 4OADA 1S3ZA 2AE6A 4HKFA 3R96A 2Z3PA 3I3GA 3SXOA 4C2YA 2Z10A 2OU2A 4R87A 1YLEA 5EBVA 3H4QA 4KLVA 1Q2DA 2ZW4A 1IICA 5ISVA 2Y0MA 5KTCA 3PGPA 2YNEA 2B58A 4JWPA 3S6HA 4NEXA 1LRZA 1WWZA 4Q38A 4CYNA 1VHSA 5F49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AG6 A;  4C7I A;  5G21 A;  5A28 A;  4UFV A;  4UFW A;  4A30 A;  4C2X A;  4A2Z A;  4CGP A;  4UFX A;  5G22 A;  4CGO A;  2YNC A;  4CGL A;  4A33 A;  4C2Y A;  4CGN A;  5AG5 A;  4UCM A;  4CYP A;  4B12 A;  4CYO A;  4CAF A;  3IU1 A;  4B10 A;  5AGE A;  5AG4 A;  4C2Z A;  3JTK A;  4B14 A;  2YND A;  4A32 A;  4B11 A;  4C68 A;  4UCN A;  4C7H A;  4CYQ A;  5G1Z A;  5AG7 A;  5G20 A;  4A95 A;  4A31 A;  2YNE A;  2WUU A;  3H5Z A;  3IWE A;  4CGM A;  4CAE A;  5A27 A;  4BBH A;  2WSA A;  4UCP A;  3IU2 A;  4B13 A;  4CYN A;  2YNC C; 
#chains in the Genus database with same CATH topology
 4C7I A;  3C26 A;  3PB9 X;  1TF9 A;  2FIW A;  4UFV A;  3KI9 A;  2DPS A;  5JGF A;  2JEW A;  1R57 A;  1NMT A;  2VBQ A;  2Q4V A;  4XNH C;  2ANP A;  4ONU A;  3LWU A;  4F0X A;  4DJL A;  1V0C A;  5IV0 A;  1I1D A;  4P6Y A;  2G3A A;  4B5P B;  2ARH A;  3GY9 A;  4C2Z A;  2FT0 A;  2D4P A;  2CTB A;  2O53 A;  5CNP A;  3KR5 A;  3TO6 A;  4OC2 A;  4A32 A;  1QMU A;  3D2M A;  2CIJ A;  3FX6 A;  2VZY A;  2PJ9 A;  4TWE A;  3RO0 A;  3SHP A;  4K3N A;  1Z5R A;  2R1I A;  4KUA A;  3VAT A;  1PU9 A;  2BCO A;  3S9N A;  4WWV A;  3PBE A;  5FVJ A;  3IJ3 A;  1KUY A;  4IAV A;  4ZY2 A;  2O4H A;  3PB8 X;  4U9Y A;  3TO9 A;  3B8G A;  2JDC A;  4CRY B;  2ZEL A;  3B3C A;  4NGM A;  2XEI A;  3B3S A;  3A9L A;  5H86 A;  2B4B A;  4PQA A;  1ON0 A;  1LAM A;  1R3N A;  1TXR A;  3D66 A;  2ABZ A;  2JLM A;  3EC4 A;  4MHN A;  3P2H A;  2NYQ A;  4Y49 B;  5CPA A;  3GKR A;  2WZN A;  3BJ8 A;  5HVG A;  2V77 A;  2XEJ A;  4OP4 A;  5I4M A;  2IJZ A;  4L89 A;  2ODF A;  3RZA A;  4ONW A;  4MXU A;  4UEE A;  3K9U A;  4B5P A;  2AFX A;  1YX0 A;  4X5K A;  1YW6 A;  4RN7 A;  2V8H A;  1BO4 A;  3TT2 A;  3FEE A;  2P0W A;  1OBR A;  3IWE A;  3CPX A;  5LYI A;  3RNZ A;  3SJE A;  4P10 A;  3G3S A;  1Z8L A;  2RB7 A;  3WAB A;  4A38 A;  3NH5 A;  4DYO A;  3FED A;  4GS4 A;  4H89 A;  4BIN A;  1U6M A;  3KZW A;  4PV6 A;  1M4D A;  2PIY A;  2PR8 A;  4QC6 A;  4X8I A;  2GLJ A;  3HLP A;  3KKW A;  3R9F A;  4KOW A;  3TX8 A;  1HEE A;  4YFJ A;  5DS0 A;  5J1Q A;  2QEC A;  4KOR A;  2ZEE A;  1YK3 A;  3TC8 A;  2CXA A;  3CPA A;  2ZEH A;  4NGQ A;  4E0A A;  5I0C A;  2FIA A;  1MJA A;  5J8C A;  1M44 A;  4JXQ A;  2FS5 A;  4NGP A;  3HUV A;  3BLN A;  4A37 A;  4KSF A;  1I12 A;  2GLF A;  2OH1 A;  2RC4 A;  3SI1 A;  3D67 A;  5LRG A;  2ZOF A;  3F8K A;  1CP7 A;  4Z65 A;  8CPA A;  2Z3K A;  1XJO A;  4A2Z A;  2G0B A;  4MCP A;  3V8I A;  1IOI A;  4KS9 A;  4R8F A;  1S7F A;  4P4D A;  3QNV A;  4P4I A;  4YGO A;  4QBJ A;  1Y7R A;  2HC9 A;  5K8O A;  5ELY A;  2Z3N A;  2ZEO A;  3PBB A;  4MHD A;  2VI7 A;  4NXY A;  2YND A;  1YRE A;  1FNO A;  4KLW A;  3D4U A;  1VHO A;  2VZZ A;  3EXN A;  3H8E A;  4MBU A;  4ZY0 A;  1Y7E A;  4MHP A;  5EMI A;  2EK8 A;  4KZT A;  4P4E A;  5JQ4 A;  2PDO A;  2AFM A;  3IWW A;  2I00 A;  2IL4 A;  2AFZ A;  4IK2 A;  4CGO A;  1QSM A;  2J8R A;  1IYL A;  1XBU A;  4UWI A;  4MY0 A;  2PJ5 A;  1TIQ A;  3V38 A;  4IUS A;  4MI4 A;  1ZG7 A;  2PJ3 A;  1MJB A;  2A4N A;  4R3L A;  3S6K A;  3SJG A;  1QST A;  5EC4 A;  3E0K A;  3LOD A;  2FCK A;  4MFZ A;  4BD9 A;  4CAV A;  4PXE A;  1VHE A;  1K4J A;  5F09 A;  1PUA A;  4MMO A;  3B2Y A;  3W6X A;  2Q4Z A;  3D7F A;  1Y9W A;  2HUZ A;  3PFO A;  4CYQ A;  1YME A;  5G20 A;  4ORF A;  3BHX A;  4NGR A;  2C6G A;  4CS0 B;  4CGM A;  3I9S A;  4KVM E;  1B87 A;  3SJX A;  3FH4 A;  4UBR A;  1Q7L A;  2GAN A;  2PVW A;  6CPA A;  4H6Z A;  1CP6 A;  4CPA A;  4ZYQ A;  3LD2 A;  1GYT A;  2AFO A;  2C27 A;  1Z8X A;  2V8V A;  3N5F A;  3SXN A;  3DNS A;  4JZ0 A;  2JDD A;  3B35 A;  4F0Y A;  4F9U A;  1Q2Y A;  3D8P A;  3CXP A;  2FE7 A;  4R6T A;  4NJR A;  4XNH B;  3KL9 A;  1XF8 A;  4YWY A;  4CGN A;  4GXH A;  4R3K A;  2BUE A;  1ZG9 A;  2REF A;  2WYR A;  3B7I A;  3JVN A;  3KQX A;  4G1P A;  2ZOG A;  3SJF A;  5LYL A;  3KAS A;  4XPD C;  1UFH A;  2Q44 A;  3PZJ A;  3SI2 A;  1FY7 A;  3B3W A;  2ZW5 A;  5IX3 A;  4CAX A;  2B5G B;  4B11 A;  2CNT A;  5G1Z A;  3TCV A;  3CXS A;  2BSW A;  4LUA A;  4UWJ A;  2PE3 A;  3VAR A;  1VIX A;  1XRY A;  2QIR A;  3R1K A;  4B10 A;  4YU9 A;  4KOX A;  3PB4 X;  3TOA A;  4UEZ A;  5HVH A;  4MFQ A;  3FB3 A;  1S7L A;  1YVK A;  2NMT A;  1IY7 A;  1NSA A;  2RFH A;  1S7K A;  2DPT A;  3FNC A;  2Z3O A;  1NE9 A;  1R43 A;  5E96 A;  4CRZ B;  4ZY1 A;  3JUW A;  1N71 A;  1M1D A;  3H8F A;  1F2P A;  3VWD A;  4UCM A;  1QSN A;  4U5Y A;  1ZO0 A;  3IEH A;  4K30 A;  2OZG A;  3QB8 A;  4E2A A;  2O28 A;  1B6B A;  4UF4 A;  5AG4 A;  2R8V A;  4P45 A;  3R9E A;  2HB6 A;  4B14 A;  4X3R A;  3D2P A;  3N7Z A;  4HPS A;  4KOY A;  1PYT B;  3WC6 A;  3TFY A;  1DTD A;  4L8A A;  2B5G A;  2Z0Z A;  4PSX A;  1BLL E;  3PFE A;  2F8H A;  1NSL A;  1IB1 E;  4KVX A;  3FF3 A;  3NH8 A;  2OB0 A;  1IYK A;  1M4G A;  2CNS A;  4MJ8 A;  1IU8 A;  4R57 A;  3BJ7 A;  3CZX A;  4RS2 A;  1YW4 A;  4M6G A;  1HDU A;  4P4B A;  3GIU A;  4UFW A;  3WC7 A;  2Z11 A;  1QSO A;  3NFZ A;  1WK4 A;  2CNM A;  3CDX A;  3PB7 X;  4MFP A;  3RBU A;  3S6F A;  4AXV A;  2ZW7 A;  5LYF A;  1EE3 P;  5JH9 A;  4KSI A;  5D8N A;  5AG5 A;  3UY5 A;  3DDD A;  3H8G A;  4PK2 A;  2VQY A;  2ATR A;  4HNY B;  3V7Z A;  4CAW A;  4AVB A;  4MFL A;  4MRI A;  5KTD A;  4Q36 A;  1BPM A;  2PC1 A;  2XEG A;  3NE8 A;  4M6H A;  4C68 A;  2VEZ A;  4UCN A;  5LRJ A;  4KOS A;  4J3G A;  4PXD A;  3KGQ A;  4F6A A;  3ZJ0 A;  2PJ7 A;  2EWB A;  3W6S A;  3S6G A;  5KTA A;  5K8M A;  2OZH A;  3OWC A;  2YNC C;  3KQZ A;  4JD6 A;  5AG6 A;  2FSR A;  2PVV A;  5G21 A;  4EWT A;  4F9V A;  4II9 A;  3R95 A;  4NCZ A;  2PJ4 A;  1YQE A;  1CJW A;  1XMT A;  4KVO E;  4A33 A;  1OZP A;  1TKJ A;  4JJX A;  1M4I A;  2PRQ A;  1RTQ A;  3WT4 A;  3KHZ A;  4CYP A;  4CAF A;  3MRU A;  3T8W A;  4B5O A;  2REE A;  4E8O A;  1AUG A;  4FD4 A;  4XPK A;  2ZED A;  4NGT A;  3FRM A;  2PJA A;  3IGR A;  4OIW A;  2OOT A;  4C7H A;  1KUX A;  4P44 A;  2C6P A;  2YGW A;  4M85 A;  1Y0R A;  2FL4 A;  3TO7 A;  4QVT A;  1S5K A;  3F5B A;  2P6F A;  1IOF A;  3B3T A;  1S7N A;  2WSA A;  3MN8 A;  1CPX A;  2JBK A;  1MK4 A;  5JPH A;  4TNU A;  4F8Z A;  2KCW A;  5A28 A;  1VKC A;  2ZW6 A;  4A30 A;  4C2X A;  3FMC A;  1ZLI A;  4UIA A;  1AYE A;  3B3V A;  4ZBG A;  1YGH A;  2C6C A;  1Y0Y A;  4KOU A;  4DUK A;  2B4D B;  2BO9 A;  2PRB A;  3FYN A;  1JQG A;  2F5I A;  3G8W A;  4B12 A;  2H5M A;  4JYW A;  1MJ9 A;  2B3U A;  2GFQ A;  5DWM A;  2K5T A;  4H6U A;  4I49 A;  4UEF A;  4UIB A;  4EME A;  3GUX A;  2IMO A;  1BAV A;  2Z3L A;  3QAY A;  1I21 A;  2J8M A;  3H5Z A;  1JWQ A;  1ELM P;  4NGS A;  1CM0 A;  4LX9 A;  4XPL A;  3PP9 A;  4PSW A;  3VH9 A;  5HMN A;  1LAN A;  3IU2 A;  4OME A;  1LCP A;  1Z2L A;  1XE4 A;  1YLO A;  3QAH A;  2NSM A;  1X10 A;  5F46 A;  2ZEN A;  1Q2C A;  3GYA A;  3MGD A;  3KHX A;  3D3S A;  2QML A;  2P6G A;  2Q7S A;  2WPW A;  4EVY A;  4H2K A;  4ZGY B;  4OLL A;  1YR0 A;  1XIX A;  4LQG A;  3ZZI A;  4OC0 A;  2B4D A;  3IU1 A;  2ZEP A;  4QUS A;  5F48 A;  4ZX9 A;  1X12 A;  2FVG A;  2ZPA A;  4GM5 A;  5LRK A;  1Z8W A;  1H8L A;  2J9A A;  4WJB A;  1ZG8 A;  4XPD B;  5HH1 A;  3LAC A;  3WR7 A;  3JRU A;  2HQY A;  2Q7B A;  3W91 A;  5G22 A;  1Z9U A;  2V8D A;  1FT7 A;  4NSQ A;  2I3C A;  2Q43 A;  1RXT A;  3I1U A;  1J4J A;  4HNX B;  3TE4 A;  1ARM A;  3FBU A;  3P2F A;  2Q04 A;  4FAI A;  2FXF A;  4O23 A;  1XFO A;  2PSW A;  5J8F A;  4OC4 A;  4RI1 A;  3RAM A;  5CBM A;  2Z3M A;  2WPX A;  4JLY A;  4MHZ A;  4ZX8 A;  3CT9 A;  1CBX A;  1VGY A;  3NH4 A;  2D4O A;  3IC1 A;  3TTH A;  1P4N A;  2AJ6 A;  2BEI A;  4CYO A;  3S9L A;  4RUH A;  1IID A;  5K8N A;  1SQH A;  2BL1 A;  3WC5 A;  2DXQ A;  4JXR A;  2BOA A;  3D7G A;  3FVL A;  4HNW B;  2CY2 A;  2VXK A;  2XEF A;  2ZEF A;  3DGV A;  3PEI A;  5AG7 A;  4AG9 A;  3NA6 A;  4M3S A;  1KZF A;  2CTC A;  4U9Z A;  4A31 A;  2WUU A;  4EFD A;  2PJ8 A;  4OAE A;  1IGB A;  2Q51 A;  1YSJ A;  2JEV A;  2EUI A;  5BWA B;  4BBH A;  4MCS A;  3FXT A;  4B13 A;  3EO4 A;  3ISX A;  1KWM A;  2ZXV A;  2ZEM A;  2C1C A;  1Z4R A;  4B6Z A;  4PPZ A;  4CGL A;  2P6E A;  2AFS A;  1ZLH A;  2ZEG A;  4KSA A;  1ARL A;  1Z4E A;  3T90 A;  4R7M A;  4Y49 C;  3BXM A;  2B3V A;  3GB0 A;  1BPN A;  4W9Y A;  3IIB A;  2GU2 A;  4FD5 A;  2I79 A;  4R76 A;  1CG2 A;  1QQ9 A;  3R9G A;  4LQ6 A;  1QSR A;  3IFE A;  2AFU A;  4A94 A;  1DE4 C;  4IF5 A;  1HDQ A;  5C82 A;  3L2N A;  2QVP A;  2Q0Y A;  4P4J A;  1KUV A;  2HV2 A;  3D68 A;  4M6I A;  3D7D A;  2JBJ A;  4R9M A;  3DLJ A;  4YRH A;  1LOK A;  2PQ8 A;  4PK3 A;  2G3T A;  4MCR A;  5A27 A;  2PCU A;  4UCP A;  3K9T A;  4MHY A;  5DWN A;  3BI1 A;  3DSB A;  4FD7 A;  3F0A A;  4CGP A;  4OC1 A;  3EY5 A;  5IB0 A;  4PXC A;  4MY3 A;  2OZU A;  4P4F A;  2IQ6 A;  2PJB A;  2Q4Y A;  1XOV A;  1GHE A;  2EBJ A;  1AMP A;  3BI0 A;  1YVO A;  5H84 A;  4MCQ A;  1P0H A;  3JTK A;  4FD6 A;  4AB7 A;  4KOT A;  3DR8 A;  4NF1 A;  4A95 A;  3IO1 A;  3S9M A;  3FJU A;  4MFJ A;  3VWE A;  4OC5 A;  4OKO A;  4DNC A;  1Z8T A;  4QB9 A;  5C88 A;  1F2O A;  4AVC A;  1S60 A;  4X2T A;  4PXB A;  4OC3 A;  3FEC A;  2POK A;  3CXQ A;  4UFX A;  1Y9K A;  1TKH A;  2PJC A;  2R98 A;  2YNC A;  3KR4 A;  3NE7 A;  2R7H A;  3PRT A;  4KUB A;  3PB6 X;  3D7H A;  2J8N A;  3GLJ A;  4NGN A;  1UWY A;  3DR6 A;  3FIX A;  4BMH A;  5GCN A;  2X7B A;  3IWG A;  3RYO A;  2GIV A;  2PR1 A;  5AGE A;  2GRE A;  3SI0 A;  4AG7 A;  4AVA A;  4KOV A;  2EVN A;  4UA3 A;  1TKF A;  4IHM A;  4NFR A;  1RO5 A;  2AFW A;  2GE3 A;  2DEA A;  2PIZ A;  3K2K A;  5F47 A;  1BOB A;  4FBE A;  1L0C A;  3TOB A;  4CAE A;  1A2Z A;  4MFK A;  5LYD A;  4OID A;  1XEB A;  3EFA A;  3T9Y A;  1LAP A;  4OAD A;  1S3Z A;  2AE6 A;  4HKF A;  2DF5 A;  3R96 A;  5HXD A;  1CX8 A;  2Z3P A;  5JM6 A;  4Q7A A;  2G9D A;  5THW A;  3ISZ A;  3I3G A;  1F57 A;  2PJ0 A;  3LMS A;  1PCA A;  4NJQ A;  4FWU A;  3SXO A;  4C2Y A;  1LFW A;  2CF4 A;  2Z10 A;  5HVF A;  2QJ8 A;  1TF8 A;  2OU2 A;  1CPS A;  4R87 A;  2OR4 A;  1YLE A;  2PJ2 A;  2V8G A;  5EBV A;  1ELL P;  7CPA A;  2PJ1 A;  2PJ6 A;  4FUU A;  3H4Q A;  5IB9 A;  2F7V A;  2QYV A;  4A39 A;  2EK9 A;  4KLV A;  2EO8 A;  1Q2D A;  2ZW4 A;  1IIC A;  4ZI6 A;  5ISV A;  2Y0M A;  5KTC A;  3PGP A;  2YNE A;  2B58 A;  1XMB A;  2VL1 A;  5D29 A;  1M4L A;  4JWP A;  3S6H A;  4NEX A;  5K8P A;  1LRZ A;  1WWZ A;  4Q38 A;  4CYN A;  1VHS A;  5F49 A; 
#chains in the Genus database with same CATH homology
 4C7I A;  3C26 A;  2FIW A;  4UFV A;  2DPS A;  1R57 A;  1NMT A;  2VBQ A;  2Q4V A;  4XNH C;  4ONU A;  4F0X A;  5IV0 A;  1V0C A;  1I1D A;  2G3A A;  4B5P B;  2ARH A;  3GY9 A;  4C2Z A;  2FT0 A;  2D4P A;  5CNP A;  3TO6 A;  4A32 A;  3D2M A;  2VZY A;  3SHP A;  2R1I A;  4KUA A;  1PU9 A;  5FVJ A;  1KUY A;  4U9Y A;  3TO9 A;  3B8G A;  2JDC A;  4CRY B;  3A9L A;  5H86 A;  2B4B A;  1ON0 A;  3EC4 A;  2JLM A;  4Y49 B;  3P2H A;  3GKR A;  3BJ8 A;  4L89 A;  3K9U A;  4B5P A;  1YX0 A;  4X5K A;  1BO4 A;  3TT2 A;  2P0W A;  3IWE A;  3G3S A;  4GS4 A;  4H89 A;  1U6M A;  4PV6 A;  1M4D A;  2PR8 A;  4QC6 A;  3KKW A;  3R9F A;  4YFJ A;  4KOW A;  2QEC A;  4KOR A;  1YK3 A;  2CXA A;  4E0A A;  5I0C A;  2FIA A;  1MJA A;  5J8C A;  1M44 A;  4JXQ A;  2FS5 A;  3BLN A;  4KSF A;  1I12 A;  2OH1 A;  2RC4 A;  3F8K A;  2Z3K A;  4A2Z A;  2G0B A;  3V8I A;  4KS9 A;  1S7F A;  4YGO A;  4QBJ A;  1Y7R A;  2Z3N A;  4MHD A;  2VI7 A;  4NXY A;  2YND A;  1YRE A;  4KLW A;  2VZZ A;  3EXN A;  4MBU A;  4KZT A;  5JQ4 A;  2PDO A;  2I00 A;  2IL4 A;  4CGO A;  1QSM A;  2J8R A;  1IYL A;  4UWI A;  4MY0 A;  1TIQ A;  4IUS A;  4MI4 A;  1MJB A;  2A4N A;  4R3L A;  3S6K A;  1QST A;  5EC4 A;  3E0K A;  3LOD A;  2FCK A;  4MFZ A;  4CAV A;  1K4J A;  1PUA A;  3W6X A;  1Y9W A;  2HUZ A;  4CYQ A;  5G20 A;  4ORF A;  4CS0 B;  4CGM A;  3I9S A;  4KVM E;  1B87 A;  4UBR A;  2GAN A;  4H6Z A;  3LD2 A;  2C27 A;  3SXN A;  3DNS A;  2JDD A;  4F0Y A;  1Q2Y A;  3D8P A;  3CXP A;  2FE7 A;  4XNH B;  4CGN A;  1XF8 A;  4R3K A;  2BUE A;  2REF A;  3JVN A;  4XPD C;  1UFH A;  2Q44 A;  3PZJ A;  1FY7 A;  5IX3 A;  2ZW5 A;  4CAX A;  2B5G B;  4B11 A;  2CNT A;  5G1Z A;  3TCV A;  3CXS A;  2BSW A;  4LUA A;  4UWJ A;  2QIR A;  3R1K A;  4B10 A;  4KOX A;  3TOA A;  4MFQ A;  3FB3 A;  1S7L A;  1YVK A;  2NMT A;  1S7K A;  2DPT A;  3FNC A;  2Z3O A;  1NE9 A;  5E96 A;  4CRZ B;  3JUW A;  1N71 A;  1M1D A;  3VWD A;  4UCM A;  1QSN A;  4U5Y A;  1ZO0 A;  4K30 A;  2OZG A;  3QB8 A;  4E2A A;  2O28 A;  1B6B A;  5AG4 A;  2R8V A;  3R9E A;  4B14 A;  3D2P A;  3N7Z A;  4KOY A;  3TFY A;  4L8A A;  2B5G A;  2Z0Z A;  4PSX A;  1NSL A;  1IB1 E;  4KVX A;  2OB0 A;  1IYK A;  1M4G A;  2CNS A;  4MJ8 A;  4R57 A;  4RS2 A;  3BJ7 A;  4UFW A;  2Z11 A;  1QSO A;  1WK4 A;  2CNM A;  4MFP A;  3S6F A;  2ZW7 A;  5AG5 A;  3UY5 A;  3DDD A;  4PK2 A;  2VQY A;  2ATR A;  4HNY B;  4CAW A;  4AVB A;  4MFL A;  5KTD A;  4Q36 A;  2PC1 A;  4C68 A;  2VEZ A;  4UCN A;  4KOS A;  4J3G A;  4F6A A;  3ZJ0 A;  3W6S A;  3S6G A;  5KTA A;  2OZH A;  3OWC A;  2YNC C;  4JD6 A;  5AG6 A;  2FSR A;  5G21 A;  4II9 A;  3R95 A;  4NCZ A;  1CJW A;  1XMT A;  4KVO E;  4A33 A;  1OZP A;  4JJX A;  1M4I A;  4CYP A;  4CAF A;  4B5O A;  2REE A;  4E8O A;  4FD4 A;  4XPK A;  3FRM A;  3IGR A;  4C7H A;  1KUX A;  2YGW A;  4M85 A;  2FL4 A;  3TO7 A;  4QVT A;  1S5K A;  3F5B A;  2P6F A;  1S7N A;  2WSA A;  1MK4 A;  5JPH A;  2KCW A;  5A28 A;  1VKC A;  2ZW6 A;  4A30 A;  4C2X A;  4ZBG A;  1YGH A;  4KOU A;  2B4D B;  2PRB A;  3FYN A;  2F5I A;  3G8W A;  4B12 A;  2H5M A;  1MJ9 A;  2B3U A;  5DWM A;  2K5T A;  4H6U A;  4I49 A;  2Z3L A;  1I21 A;  2J8M A;  3H5Z A;  4XPL A;  5HMN A;  1CM0 A;  4LX9 A;  3PP9 A;  4PSW A;  3IU2 A;  1XE4 A;  3QAH A;  5F46 A;  1Q2C A;  3GYA A;  3MGD A;  3D3S A;  2QML A;  2P6G A;  2WPW A;  4EVY A;  4ZGY B;  4OLL A;  1YR0 A;  1XIX A;  3ZZI A;  2B4D A;  3IU1 A;  4QUS A;  5F48 A;  2ZPA A;  4XPD B;  5HH1 A;  3WR7 A;  3W91 A;  2HQY A;  2Q7B A;  1Z9U A;  4NSQ A;  1RXT A;  1J4J A;  4HNX B;  3TE4 A;  3FBU A;  3P2F A;  2Q04 A;  5J8F A;  2FXF A;  2PSW A;  4RI1 A;  2Z3M A;  2WPX A;  4JLY A;  2D4O A;  3TTH A;  1P4N A;  2AJ6 A;  2BEI A;  4CYO A;  1IID A;  1SQH A;  2BL1 A;  2DXQ A;  4JXR A;  4HNW B;  2CY2 A;  2VXK A;  5AG7 A;  4AG9 A;  4M3S A;  4A31 A;  1KZF A;  4U9Z A;  2WUU A;  4OAE A;  2JEV A;  5BWA B;  2EUI A;  4BBH A;  3FXT A;  4B13 A;  3EO4 A;  2ZXV A;  1Z4R A;  4CGL A;  2P6E A;  4KSA A;  1Z4E A;  3T90 A;  4Y49 C;  2B3V A;  4FD5 A;  2I79 A;  3R9G A;  1QSR A;  4IF5 A;  5C82 A;  2Q0Y A;  1KUV A;  2HV2 A;  4R9M A;  4YRH A;  4PK3 A;  2PQ8 A;  2G3T A;  5A27 A;  4UCP A;  5DWN A;  3DSB A;  4FD7 A;  3F0A A;  4CGP A;  3EY5 A;  5IB0 A;  4MY3 A;  2OZU A;  2Q4Y A;  1GHE A;  1YVO A;  5H84 A;  1P0H A;  3JTK A;  4FD6 A;  4KOT A;  3DR8 A;  4NF1 A;  4A95 A;  4MFJ A;  3VWE A;  4DNC A;  4QB9 A;  5C88 A;  4AVC A;  1S60 A;  3CXQ A;  4UFX A;  1Y9K A;  5G22 A;  2YNC A;  2R98 A;  3NE7 A;  4KUB A;  4AB7 A;  2R7H A;  2J8N A;  3DR6 A;  3FIX A;  4BMH A;  5GCN A;  2X7B A;  3IWG A;  3RYO A;  2GIV A;  2PR1 A;  5AGE A;  4AG7 A;  4AVA A;  4KOV A;  2EVN A;  4UA3 A;  1RO5 A;  2GE3 A;  5F47 A;  1BOB A;  1L0C A;  3TOB A;  4CAE A;  4MFK A;  1XEB A;  3EFA A;  3T9Y A;  4OAD A;  1S3Z A;  2AE6 A;  4HKF A;  3R96 A;  2Z3P A;  3I3G A;  3SXO A;  4C2Y A;  2Z10 A;  2OU2 A;  4R87 A;  1YLE A;  5EBV A;  3H4Q A;  4KLV A;  1Q2D A;  2ZW4 A;  1IIC A;  5ISV A;  2Y0M A;  5KTC A;  3PGP A;  2YNE A;  2B58 A;  4JWP A;  3S6H A;  4NEX A;  1LRZ A;  1WWZ A;  4Q38 A;  4CYN A;  1VHS A;  5F49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...