4CGMA

Leishmania major n-myristoyltransferase in complex with a biphenyl- derivative inhibitor
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diverse Modes of Binding in Structures of Leishmania Major N-Myristoyltransferase with Selective Inhibitors
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 125
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cgmA00
4B13A 5A27A 3IU1A 5G1ZA 5AGEA 3H5ZA 4B11A 4CGLA 3IWEA 4BBHA 4CYNA 4CYPA 5G22A 4A30A 5A28A 4UCNA 5AG4A 4UCPA 5AG7A 4A33A 4C2YA 4CGNA 4CGOA 4CGMA 2YNCC 4B12A 4C2XA 4UFWA 4A31A 4B10A 4C2ZA 4A2ZA 4C7IA 4CYOA 4A95A 4CAEA 3JTKA 5AG6A 5G20A 5G21A 2WSAA 3IU2A 4B14A 4C7HA 4C68A 4CAFA 2YNDA 2YNCA 4UFVA 5AG5A 4A32A 2WUUA 2YNEA 4CGPA 4CYQA 4UCMA 4UFXA
chains in the Genus database with same CATH superfamily
4PXEA 3IU1A 3SI1A 4KOSA 3H5ZA 3S6KA 1XEBA 4P4FA 3KHXA 3BJ8A 1F57A 1YVOA 1M4IA 1FT7A 4OKOA 4P45A 3PB7X 1LRZA 2B5GA 3PB8X 1IICA 4UWIA 3VWEA 2ABZA 5KTDA 2EVNA 2PJ7A 2VZZA 4CAVA 1VHOA 2P0WA 1Y7EA 4UEEA 4PK2A 2Z0ZA 4PSXA 3G3SA 2CIJA 4B5OA 2IL4A 4KORA 2I3CA 4B14A 1LAMA 3V38A 2Z3MA 3H8GA 5IV0A 4UEFA 4TNUA 4ZYQA 1Z2LA 2Q44A 2PIZA 1QSRA 1IB1E 1ZLHA 4ONUA 4JYWA 2FVGA 4X2TA 4B13A 4UF4A 1M4GA 1VHEA 1ZO0A 2VL1A 3KGQA 2D4PA 1NSAA 4HNYB 3VWDA 3W6XA 4AXVA 4PXDA 1B6BA 4Z65A 1MJBA 4ONWA 2Q51A 2QYVA 3I9SA 1TKHA 5F48A 3WC5A 3FYNA 3TT2A 3JVNA 4OMEA 3QB8A 1MK4A 3S9MA 4P4IA 2POKA 2X7BA 3FNCA 3TX8A 4A39A 3SJEA 3B8GA 1HEEA 1TKJA 2OZHA 3K9TA 4L89A 2PR1A 4ZI6A 3SI2A 2OZUA 1ZLIA 3PFOA 2Q4ZA 4F9UA 3IJ3A 1JQGA 4P4BA 1Y9WA 4U9YA 2B4BA 2PVWA 1CP7A 4DYOA 5BWAB 2QECA 2AFMA 4A38A 2BL1A 2VZYA 4QC6A 4CRZB 1FNOA 2G0BA 2REEA 2ZEDA 2V8VA 2ZEPA 4F9VA 1Q2YA 2PJBA 4MJ8A 3R96A 5IB9A 1CM0A 3BLNA 4FWUA 3L2NA 1KUYA 4K30A 2VEZA 3CPXA 4UIAA 4P10A 1YSJA 4G1PA 1S3ZA 1YREA 1TKFA 2HUZA 2I79A 2REFA 2GU2A 5H84A 5HVHA 2YNCC 4M85A 4OLLA 1DE4C 2O28A 1QSNA 1QSMA 5JM6A 3T90A 4AG7A 4PV6A 3SXOA 1Y7RA 3B3SA 2Y0MA 2H5MA 1PU9A 2P6GA 2ZOFA 3DNSA 2FT0A 4GM5A 1AUGA 3FB3A 4R76A 4DUKA 1BLLE 3C26A 3FX6A 3NH4A 3IFEA 2PJ4A 4GXHA 2HB6A 4MCSA 4L8AA 1IOIA 2Q43A 3WC7A 2Z11A 3CZXA 1KUVA 2FIWA 2P6FA 1XIXA 2V8DA 4R57A 2XEFA 4XPDC 4F0YA 2FCKA 5CPAA 2C6CA 2Z3KA 3K2KA 3ISXA 1V0CA 4WJBA 3D7FA 2Z3LA 2PC1A 4A33A 2DEAA 3S9NA 3B3CA 2Z3OA 4R3LA 4ZX8A 2FXFA 3LMSA 4NXYA 3ZZIA 5K8NA 5D8NA 2NYQA 1I1DA 1QMUA 3FEEA 4OC0A 2CNMA 3DR8A 2JLMA 2IQ6A 4OC3A 4ZY0A 2D4OA 2R1IA 3WABA 4RS2A 3WC6A 1YVKA 1Q2CA 4EVYA 2EBJA 1YW4A 3FF3A 4B6ZA 2YNCA 4EFDA 3D7HA 3N5FA 3F8KA 2ZEEA 1OBRA 2KCWA 4M6HA 3NH8A 3H8EA 3IC1A 4P44A 3HUVA 4KS9A 3PB9X 5DS0A 2JDCA 2PJAA 1TIQA 1K4JA 1YQEA 4NGRA 4YWYA 5CBMA 2BOAA 2NSMA 2OR4A 1Z4EA 3S6GA 2PJ0A 4II9A 4ZGYB 3KL9A 4UCPA 3R9EA 4CPAA 1ON0A 3PFEA 5LYFA 1OZPA 5J8CA 2B4DA 1VHSA 4MHPA 1A2ZA 7CPAA 5I0CA 2OB0A 4B5PB 2ZXVA 2GREA 3EO4A 1Y9KA 1S7LA 3VATA 4UBRA 4Y49B 4MCPA 4C68A 4GS4A 2EK9A 4KSIA 4A32A 3B35A 4J3GA 3EY5A 4KOYA 1PCAA 2C1CA 4HKFA 3P2HA 2VQYA 2Q7BA 4YRHA 4CYQA 4KLVA 5F49A 3DDDA 3GB0A 4KVOE 2CNSA 2GIVA 1CBXA 1CX8A 1P0HA 3D8PA 1IYLA 2DXQA 4KLWA 3SJXA 2VXKA 1U6MA 1PUAA 4H89A 4IUSA 4KUBA 4C2YA 2AE6A 4MFJA 4OC1A 2O53A 2F5IA 2BCOA 2G3TA 2Q04A 3CXQA 3IGRA 3PBEA 4OP4A 2PJ5A 2ZELA 3NFZA 4KOUA 1NSLA 1BAVA 3RNZA 4CAEA 3D2MA 4MFKA 1R57A 1Z8LA 4AVAA 4AVBA 2V77A 4RN7A 5G21A 2ZW5A 2FIAA 2WSAA 3IU2A 1NMTA 2V8HA 5GCNA 3TO9A 5HMNA 4MCQA 4C7HA 2JEWA 5AG5A 1ARLA 3MRUA 2ZW6A 2C27A 2EWBA 3BHXA 4KOXA 4NFRA 1I21A 2PRBA 4P4EA 4ZX9A 3SXNA 4UFXA 1IY7A 5AGEA 1BO4A 2PSWA 1RO5A 2R98A 2XEJA 3H8FA 1S7KA 4MHDA 4LUAA 4PQAA 5G22A 4ZY2A 1ZG9A 4B5PA 4FUUA 5JQ4A 5A28A 3GUXA 1YMEA 5AG4A 1IIDA 2RFHA 3VARA 1YK3A 5ISVA 3QNVA 4CGMA 2F8HA 2JEVA 4E2AA 1BPMA 3KR4A 2EUIA 2Z10A 1XMBA 4KSAA 4MCRA 4XPDB 3LACA 3PB6X 2I00A 4U9ZA 1KZFA 3BI0A 5EMIA 4H2KA 1CJWA 4IAVA 1TF8A 2K5TA 5DWNA 1M1DA 2Z3PA 1L0CA 3KR5A 3FJUA 2CTCA 3DGVA 3RAMA 4QUSA 5A27A 4WWVA 3E0KA 3D3SA 4CS0B 4DNCA 4ZBGA 3S6FA 4OAEA 4UWJA 4MRIA 4FAIA 1S7FA 3KKWA 3G8WA 1S7NA 3ISZA 4UCNA 4KOTA 4XNHC 4M6GA 3CDXA 3BJ7A 4PXCA 1NE9A 4R87A 4R7MA 4OC4A 2WZNA 2J9AA 3P2FA 1R43A 2AJ6A 1MJAA 5I4MA 4AG9A 5THWA 4UEZA 4IF5A 3WR7A 2DF5A 4B10A 1AYEA 1KWMA 2HV2A 2PJCA 3RO0A 1LFWA 2A4NA 3I1UA 2VI7A 4OADA 2R8VA 4H6ZA 3K9UA 4JXRA 1S5KA 3TTHA 3D66A 3RZAA 1KUXA 2B5GB 2PIYA 1XOVA 3IIBA 4FD7A 4NCZA 4MHNA 4CRYB 4R8FA 5LRKA 1GYTA 4YFJA 3FVLA 3QAYA 3F5BA 3LWUA 1XE4A 1X10A 2J8NA 3T9YA 5K8PA 4Y49C 3TCVA 2ZW4A 4JD6A 5F09A 4FD5A 2GANA 4TWEA 4YU9A 3SI0A 3TOAA 4PK3A 3SJGA 4C2XA 5LYIA 1YGHA 4NGQA 2BUEA 1ELLP 3W91A 3FECA 5G20A 2CNTA 3EXNA 3JRUA 3PB4X 3V8IA 3F0AA 5JH9A 3FRMA 3W6SA 2JBJA 3GIUA 4MY3A 4KUAA 1X12A 3DSBA 4YGOA 5C88A 5HH1A 1XBUA 4MMOA 5DWMA 1YW6A 1J4JA 2JDDA 4NSQA 4RI1A 3MN8A 5HVGA 2OH1A 3TFYA 1CP6A 3JUWA 2QMLA 2B3UA 4MBUA 5EBVA 5F47A 1M4DA 4RUHA 1N71A 3FMCA 3B2YA 4NJRA 1FY7A 4LX9A 4B12A 1ELMP 2QVPA 4NJQA 5J8FA 4A31A 4OIDA 1XJOA 4C2ZA 2BO9A 3UY5A 2G9DA 4C7IA 4QBJA 4BD9A 4QVTA 2FE7A 4FBEA 2PCUA 2PJ3A 2ZPAA 3B3WA 3A9LA 3R9FA 4CAFA 2ATRA 1TXRA 2J8MA 3PBBA 3WT4A 3NE7A 2PJ2A 1Z5RA 4AB7A 1LCPA 3FEDA 4EWTA 1XF8A 4IHMA 4JLYA 4HPSA 3RYOA 1YLEA 2AFXA 3GYAA 1WWZA 5G1ZA 3KZWA 4EMEA 2VBQA 1LANA 3TE4A 1MJ9A 2AFSA 4MFPA 1AMPA 2PJ1A 3FIXA 5F46A 2P6EA 1CPSA 4R9MA 4CAXA 4KOVA 3B3VA 1ZG8A 1UWYA 3EC4A 4F8ZA 5K8OA 3N7ZA 5LYDA 1HDQA 1R3NA 4LQ6A 1VGYA 2O4HA 4MHZA 4NGPA 4P4DA 1QSOA 2AFZA 1Y0YA 4XNHB 3ZJ0A 1Y0RA 4AVCA 2YNEA 3KHZA 4U5YA 3D7GA 3NA6A 3BXMA 5LRJA 1P4NA 2EK8A 2IMOA 3IWEA 4K3NA 8CPAA 2RB7A 3PZJA 1LAPA 2WYRA 3KQZA 2PVVA 2PQ8A 3S9LA 4NF1A 2AFOA 4MFQA 4UA3A 2Q7SA 2CXAA 2GE3A 4X8IA 5LRGA 3IO1A 2B3VA 1H8LA 2ZEOA 5EC4A 5ELYA 4NGTA 2C6PA 4HNXB 3D68A 3GY9A 1XFOA 4BMHA 3JTKA 1YLOA 3IEHA 5AG6A 4ORFA 3LODA 4XPLA 1SQHA 4KOWA 4NGMA 4XPKA 2Q4YA 2PR8A 1HDUA 4KZTA 5C82A 1Z9UA 1VIXA 1RTQA 1XRYA 2J8RA 4O23A 3R1KA 4B11A 4BBHA 4CGLA 3TOBA 4A30A 2AFWA 2HC9A 3CPAA 3D4UA 3NE8A 4CAWA 2EO8A 1UFHA 3B7IA 1CG2A 5AG7A 3RBUA 2GFQA 3OWCA 4PSWA 5JPHA 1B87A 4Q38A 4P4JA 4MFLA 2F7VA 4A95A 4W9YA 3KQXA 3V7ZA 2Z3NA 1ZG7A 4JXQA 3R9GA 2V8GA 1M4LA 1TF9A 3CT9A 2ODFA 4I49A 4UFVA 4FD4A 2XEIA 4CGPA 4F0XA 1BPNA 3EFAA 4M3SA 4F6AA 2ZEHA 2FSRA 4CYPA 2YGWA 1DTDA 2R7HA 5FVJA 5KTAA 5IB0A 5HVFA 1Q2DA 4H6UA 2RC4A 1Q7LA 4CGNA 3TO6A 1VKCA 4BINA 2ZENA 4CGOA 4KSFA 1LOKA 6CPAA 1Z8WA 4KVME 2BSWA 3S6HA 1Z8XA 4UFWA 4CYOA 2CTBA 2ZEFA 4IK2A 3I3GA 3B3TA 1IYKA 2PJ9A 4MXUA 4E8OA 1IU8A 2XEGA 4MI4A 3TC8A 1M44A 3LD2A 4JWPA 2PRQA 1QSTA 3SHPA 5J1QA 2CY2A 3KI9A 3R95A 4ZY1A 1F2OA 4NEXA 1I12A 3PP9A 5LYLA 4X5KA 1GHEA 2NMTA 2PE3A 1Z8TA 2BEIA 3GLJA 4OIWA 4X3RA 2ZW7A 2Q0YA 2WPXA 4MY0A 2QJ8A 1IGBA 2DPTA 4A94A 2ZOGA 3BI1A 1S60A 2C6GA 2HQYA 2Q4VA 2ZEGA 3TO7A 2ZEMA 2GLFA 4MHYA 2DPSA 5K8MA 3IWGA 1BOBA 2PJ6A 1YX0A 5JGFA 3VH9A 4HNWB 4QB9A 2OOTA 5HXDA 3FBUA 2PDOA 1JWQA 4Q7AA 3FXTA 2OZGA 2B58A 1IOFA 3PRTA 2FL4A 2YNDA 3D67A 4KVXA 4MFZA 3D7DA 3T8WA 4NGSA 3D2PA 4E0AA 2IJZA 3DR6A 4UIBA 4UCMA 2GLJA 5KTCA 4OC2A 3CXPA 4R6TA 2ANPA 3DLJA 3IWWA 4CYNA 2AFUA 1PYTB 4JZ0A 5H86A 2PJ8A 3GKRA 3SJFA 3KASA 5CNPA 1EE3P 2FS5A 4OC5A 4FD6A 2QIRA 3NH5A 4Q36A 1Z4RA 3QAHA 4A37A 3H4QA 1ARMA 3PEIA 4R3KA 4A2ZA 1RXTA 1YR0A 4DJLA 1F2PA 3CXSA 2WPWA 2JBKA 4PXBA 4PPZA 3FH4A 3HLPA 3PGPA 4M6IA 2G3AA 4P6YA 5E96A 1XMTA 4JJXA 2B4DB 2OU2A 1QQ9A 5D29A 4LQGA 1WK4A 2WUUA 2ARHA 2CF4A 1CPXA 5IX3A 3MGDA 4NGNA
chains in the Genus database with same CATH topology
3IU1A 4KOSA 3H5ZA 3S6KA 1XEBA 3BJ8A 1YVOA 1M4IA 1LRZA 2B5GA 1IICA 4UWIA 3VWEA 5KTDA 2EVNA 2VZZA 4CAVA 2P0WA 4PK2A 2Z0ZA 4PSXA 3G3SA 4B5OA 2IL4A 4KORA 4B14A 2Z3MA 5IV0A 2Q44A 1QSRA 1IB1E 4ONUA 4B13A 4CYNA 1M4GA 1ZO0A 4HNYB 2D4PA 3VWDA 3W6XA 1B6BA 1MJBA 3I9SA 5F48A 3FYNA 3TT2A 3JVNA 3QB8A 1MK4A 2X7BA 3FNCA 3B8GA 2OZHA 4L89A 2PR1A 2OZUA 4U9YA 1Y9WA 5BWAB 2B4BA 2QECA 2BL1A 2VZYA 4QC6A 4CRZB 2G0BA 2REEA 1Q2YA 4MJ8A 3R96A 1CM0A 3BLNA 1KUYA 4K30A 2VEZA 1S3ZA 1YREA 2HUZA 2I79A 2REFA 5H84A 2YNCC 4M85A 4OLLA 2O28A 1QSNA 1QSMA 3T90A 4AG7A 4PV6A 3SXOA 1Y7RA 2Y0MA 2H5MA 1PU9A 2P6GA 3DNSA 2FT0A 3FB3A 3C26A 4L8AA 2Z11A 1KUVA 2FIWA 2P6FA 1XIXA 4R57A 4XPDC 4F0YA 2FCKA 2Z3KA 1V0CA 2Z3LA 2PC1A 4A33A 2Z3OA 4R3LA 3ZZIA 2FXFA 4NXYA 1I1DA 2CNMA 3DR8A 2JLMA 2D4OA 2R1IA 4RS2A 1YVKA 1Q2CA 4EVYA 2YNCA 3F8KA 2KCWA 4KS9A 2JDCA 1TIQA 1K4JA 3S6GA 1Z4EA 4II9A 4ZGYB 4UCPA 3R9EA 1ON0A 1OZPA 5J8CA 2B4DA 1VHSA 5I0CA 2OB0A 4B5PB 2ZXVA 3EO4A 1Y9KA 1S7LA 4UBRA 4Y49B 4C68A 4GS4A 4A32A 4J3GA 3EY5A 4KOYA 4HKFA 3P2HA 2VQYA 2Q7BA 4YRHA 4CYQA 4KLVA 5F49A 3DDDA 4KVOE 2CNSA 2GIVA 1P0HA 3D8PA 1IYLA 2DXQA 4KLWA 2VXKA 1U6MA 1PUAA 4H89A 4IUSA 4KUBA 4C2YA 2AE6A 4MFJA 2F5IA 2G3TA 2Q04A 3CXQA 3IGRA 1NSLA 4KOUA 4CAEA 3D2MA 4MFKA 1R57A 4AVAA 4AVBA 5GCNA 5G21A 2ZW5A 2FIAA 2WSAA 3IU2A 1NMTA 3TO9A 5HMNA 4C7HA 5AG5A 2ZW6A 2C27A 4KOXA 1I21A 2PRBA 3SXNA 4UFXA 5AGEA 1BO4A 2PSWA 1RO5A 2R98A 4MHDA 1S7KA 4B5PA 4LUAA 5G22A 5JQ4A 5A28A 5AG4A 1IIDA 1YK3A 5ISVA 4CGMA 2JEVA 4E2AA 2EUIA 2Z10A 4KSAA 4XPDB 2I00A 4U9ZA 1KZFA 1CJWA 2K5TA 5DWNA 1M1DA 2Z3PA 1L0CA 5A27A 4QUSA 3E0KA 3D3SA 4CS0B 4DNCA 4ZBGA 3S6FA 4OAEA 4UWJA 1S7FA 3KKWA 3G8WA 1S7NA 4UCNA 4KOTA 4XNHC 3BJ7A 4R87A 1NE9A 3P2FA 2AJ6A 1MJAA 4AG9A 4IF5A 3WR7A 4B10A 2HV2A 2A4NA 2VI7A 4OADA 2R8VA 4H6ZA 3K9UA 4JXRA 1S5KA 3TTHA 1KUXA 2B5GB 4FD7A 4NCZA 4CRYB 4YFJA 3F5BA 1XE4A 2J8NA 3T9YA 4Y49C 3TCVA 2ZW4A 4JD6A 4FD5A 2GANA 3TOAA 4PK3A 4C2XA 1YGHA 2BUEA 3W91A 5G20A 2CNTA 3EXNA 3V8IA 3F0AA 3FRMA 3W6SA 4MY3A 4KUAA 3DSBA 4YGOA 5C88A 5HH1A 5DWMA 1J4JA 2JDDA 4NSQA 4RI1A 2OH1A 3TFYA 3JUWA 2QMLA 2B3UA 4MBUA 5EBVA 5F47A 1M4DA 1N71A 1FY7A 4LX9A 4B12A 5J8FA 4A31A 4C2ZA 4C7IA 3UY5A 4QBJA 4QVTA 2FE7A 2ZPAA 3A9LA 3R9FA 4CAFA 2ATRA 2J8MA 3NE7A 4AB7A 1XF8A 4JLYA 3RYOA 1YLEA 3GYAA 1WWZA 5G1ZA 2VBQA 3TE4A 1MJ9A 4MFPA 5F46A 3FIXA 2P6EA 4R9MA 4CAXA 4KOVA 3EC4A 3N7ZA 1QSOA 3ZJ0A 4XNHB 4AVCA 2YNEA 4U5YA 1P4NA 3IWEA 3PZJA 2PQ8A 4NF1A 4MFQA 4UA3A 2CXAA 2GE3A 2B3VA 5EC4A 4HNXB 3GY9A 4BMHA 3JTKA 5AG6A 4ORFA 3LODA 4XPLA 1SQHA 4KOWA 4XPKA 2Q4YA 2PR8A 4KZTA 5C82A 1Z9UA 2J8RA 4CGLA 4B11A 3R1KA 4BBHA 3TOBA 4A30A 4CAWA 1UFHA 5AG7A 3OWCA 4PSWA 5JPHA 1B87A 4Q38A 4MFLA 4A95A 2Z3NA 4JXQA 3R9GA 4UFVA 4I49A 4FD4A 4CGPA 4F0XA 3EFAA 4M3SA 4F6AA 2FSRA 4CYPA 2YGWA 5FVJA 2R7HA 5KTAA 5IB0A 1Q2DA 4H6UA 2RC4A 4CGNA 3TO6A 1VKCA 4CGOA 4KSFA 4KVME 2BSWA 3S6HA 4UFWA 4CYOA 3I3GA 1IYKA 4E8OA 4MI4A 1M44A 3LD2A 4JWPA 1QSTA 3SHPA 2CY2A 3R95A 4NEXA 1I12A 3PP9A 4X5KA 1GHEA 2NMTA 2BEIA 2ZW7A 2Q0YA 2WPXA 4MY0A 2DPTA 1S60A 2HQYA 2Q4VA 3TO7A 2DPSA 3IWGA 1BOBA 1YX0A 4HNWB 4QB9A 3FBUA 2PDOA 3FXTA 2B58A 2OZGA 2FL4A 2YNDA 4KVXA 4MFZA 3D2PA 4E0AA 3DR6A 4UCMA 5KTCA 3CXPA 5H86A 3GKRA 5CNPA 2FS5A 4FD6A 2QIRA 4Q36A 1Z4RA 3QAHA 3H4QA 4R3KA 4A2ZA 1RXTA 1YR0A 3CXSA 2WPWA 5E96A 3PGPA 2G3AA 1XMTA 4JJXA 2B4DB 2OU2A 1WK4A 2WUUA 2ARHA 5IX3A 3MGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B13 A;  5A27 A;  3IU1 A;  5G1Z A;  5AGE A;  3H5Z A;  4B11 A;  4CGL A;  3IWE A;  4BBH A;  4CYN A;  4CYP A;  5G22 A;  4A30 A;  5A28 A;  4UCN A;  5AG4 A;  4UCP A;  5AG7 A;  4A33 A;  4C2Y A;  4CGN A;  4CGO A;  4CGM A;  2YNC C;  4B12 A;  4C2X A;  4UFW A;  4A31 A;  4B10 A;  4C2Z A;  4A2Z A;  4C7I A;  4CYO A;  4A95 A;  4CAE A;  3JTK A;  5AG6 A;  5G20 A;  5G21 A;  2WSA A;  3IU2 A;  4B14 A;  4C7H A;  4C68 A;  4CAF A;  2YND A;  2YNC A;  4UFV A;  5AG5 A;  4A32 A;  2WUU A;  2YNE A;  4CGP A;  4CYQ A;  4UCM A;  4UFX A; 
#chains in the Genus database with same CATH topology
 4PXE A;  3IU1 A;  3SI1 A;  4KOS A;  3H5Z A;  3S6K A;  1XEB A;  4P4F A;  3KHX A;  3BJ8 A;  1F57 A;  1YVO A;  1M4I A;  1FT7 A;  4OKO A;  4P45 A;  3PB7 X;  1LRZ A;  2B5G A;  3PB8 X;  1IIC A;  4UWI A;  3VWE A;  2ABZ A;  5KTD A;  2EVN A;  2PJ7 A;  2VZZ A;  4CAV A;  1VHO A;  2P0W A;  1Y7E A;  4UEE A;  4PK2 A;  2Z0Z A;  4PSX A;  3G3S A;  2CIJ A;  4B5O A;  2IL4 A;  4KOR A;  2I3C A;  4B14 A;  1LAM A;  3V38 A;  2Z3M A;  3H8G A;  5IV0 A;  4UEF A;  4TNU A;  4ZYQ A;  1Z2L A;  2Q44 A;  2PIZ A;  1QSR A;  1IB1 E;  1ZLH A;  4ONU A;  4JYW A;  2FVG A;  4X2T A;  4B13 A;  4UF4 A;  1M4G A;  1VHE A;  1ZO0 A;  2VL1 A;  3KGQ A;  2D4P A;  1NSA A;  4HNY B;  3VWD A;  3W6X A;  4AXV A;  4PXD A;  1B6B A;  4Z65 A;  1MJB A;  4ONW A;  2Q51 A;  2QYV A;  3I9S A;  1TKH A;  5F48 A;  3WC5 A;  3FYN A;  3TT2 A;  3JVN A;  4OME A;  3QB8 A;  1MK4 A;  3S9M A;  4P4I A;  2POK A;  2X7B A;  3FNC A;  3TX8 A;  4A39 A;  3SJE A;  3B8G A;  1HEE A;  1TKJ A;  2OZH A;  3K9T A;  4L89 A;  2PR1 A;  4ZI6 A;  3SI2 A;  2OZU A;  1ZLI A;  3PFO A;  2Q4Z A;  4F9U A;  3IJ3 A;  1JQG A;  4P4B A;  1Y9W A;  4U9Y A;  2B4B A;  2PVW A;  1CP7 A;  4DYO A;  5BWA B;  2QEC A;  2AFM A;  4A38 A;  2BL1 A;  2VZY A;  4QC6 A;  4CRZ B;  1FNO A;  2G0B A;  2REE A;  2ZED A;  2V8V A;  2ZEP A;  4F9V A;  1Q2Y A;  2PJB A;  4MJ8 A;  3R96 A;  5IB9 A;  1CM0 A;  3BLN A;  4FWU A;  3L2N A;  1KUY A;  4K30 A;  2VEZ A;  3CPX A;  4UIA A;  4P10 A;  1YSJ A;  4G1P A;  1S3Z A;  1YRE A;  1TKF A;  2HUZ A;  2I79 A;  2REF A;  2GU2 A;  5H84 A;  5HVH A;  2YNC C;  4M85 A;  4OLL A;  1DE4 C;  2O28 A;  1QSN A;  1QSM A;  5JM6 A;  3T90 A;  4AG7 A;  4PV6 A;  3SXO A;  1Y7R A;  3B3S A;  2Y0M A;  2H5M A;  1PU9 A;  2P6G A;  2ZOF A;  3DNS A;  2FT0 A;  4GM5 A;  1AUG A;  3FB3 A;  4R76 A;  4DUK A;  1BLL E;  3C26 A;  3FX6 A;  3NH4 A;  3IFE A;  2PJ4 A;  4GXH A;  2HB6 A;  4MCS A;  4L8A A;  1IOI A;  2Q43 A;  3WC7 A;  2Z11 A;  3CZX A;  1KUV A;  2FIW A;  2P6F A;  1XIX A;  2V8D A;  4R57 A;  2XEF A;  4XPD C;  4F0Y A;  2FCK A;  5CPA A;  2C6C A;  2Z3K A;  3K2K A;  3ISX A;  1V0C A;  4WJB A;  3D7F A;  2Z3L A;  2PC1 A;  4A33 A;  2DEA A;  3S9N A;  3B3C A;  2Z3O A;  4R3L A;  4ZX8 A;  2FXF A;  3LMS A;  4NXY A;  3ZZI A;  5K8N A;  5D8N A;  2NYQ A;  1I1D A;  1QMU A;  3FEE A;  4OC0 A;  2CNM A;  3DR8 A;  2JLM A;  2IQ6 A;  4OC3 A;  4ZY0 A;  2D4O A;  2R1I A;  3WAB A;  4RS2 A;  3WC6 A;  1YVK A;  1Q2C A;  4EVY A;  2EBJ A;  1YW4 A;  3FF3 A;  4B6Z A;  2YNC A;  4EFD A;  3D7H A;  3N5F A;  3F8K A;  2ZEE A;  1OBR A;  2KCW A;  4M6H A;  3NH8 A;  3H8E A;  3IC1 A;  4P44 A;  3HUV A;  4KS9 A;  3PB9 X;  5DS0 A;  2JDC A;  2PJA A;  1TIQ A;  1K4J A;  1YQE A;  4NGR A;  4YWY A;  5CBM A;  2BOA A;  2NSM A;  2OR4 A;  1Z4E A;  3S6G A;  2PJ0 A;  4II9 A;  4ZGY B;  3KL9 A;  4UCP A;  3R9E A;  4CPA A;  1ON0 A;  3PFE A;  5LYF A;  1OZP A;  5J8C A;  2B4D A;  1VHS A;  4MHP A;  1A2Z A;  7CPA A;  5I0C A;  2OB0 A;  4B5P B;  2ZXV A;  2GRE A;  3EO4 A;  1Y9K A;  1S7L A;  3VAT A;  4UBR A;  4Y49 B;  4MCP A;  4C68 A;  4GS4 A;  2EK9 A;  4KSI A;  4A32 A;  3B35 A;  4J3G A;  3EY5 A;  4KOY A;  1PCA A;  2C1C A;  4HKF A;  3P2H A;  2VQY A;  2Q7B A;  4YRH A;  4CYQ A;  4KLV A;  5F49 A;  3DDD A;  3GB0 A;  4KVO E;  2CNS A;  2GIV A;  1CBX A;  1CX8 A;  1P0H A;  3D8P A;  1IYL A;  2DXQ A;  4KLW A;  3SJX A;  2VXK A;  1U6M A;  1PUA A;  4H89 A;  4IUS A;  4KUB A;  4C2Y A;  2AE6 A;  4MFJ A;  4OC1 A;  2O53 A;  2F5I A;  2BCO A;  2G3T A;  2Q04 A;  3CXQ A;  3IGR A;  3PBE A;  4OP4 A;  2PJ5 A;  2ZEL A;  3NFZ A;  4KOU A;  1NSL A;  1BAV A;  3RNZ A;  4CAE A;  3D2M A;  4MFK A;  1R57 A;  1Z8L A;  4AVA A;  4AVB A;  2V77 A;  4RN7 A;  5G21 A;  2ZW5 A;  2FIA A;  2WSA A;  3IU2 A;  1NMT A;  2V8H A;  5GCN A;  3TO9 A;  5HMN A;  4MCQ A;  4C7H A;  2JEW A;  5AG5 A;  1ARL A;  3MRU A;  2ZW6 A;  2C27 A;  2EWB A;  3BHX A;  4KOX A;  4NFR A;  1I21 A;  2PRB A;  4P4E A;  4ZX9 A;  3SXN A;  4UFX A;  1IY7 A;  5AGE A;  1BO4 A;  2PSW A;  1RO5 A;  2R98 A;  2XEJ A;  3H8F A;  1S7K A;  4MHD A;  4LUA A;  4PQA A;  5G22 A;  4ZY2 A;  1ZG9 A;  4B5P A;  4FUU A;  5JQ4 A;  5A28 A;  3GUX A;  1YME A;  5AG4 A;  1IID A;  2RFH A;  3VAR A;  1YK3 A;  5ISV A;  3QNV A;  4CGM A;  2F8H A;  2JEV A;  4E2A A;  1BPM A;  3KR4 A;  2EUI A;  2Z10 A;  1XMB A;  4KSA A;  4MCR A;  4XPD B;  3LAC A;  3PB6 X;  2I00 A;  4U9Z A;  1KZF A;  3BI0 A;  5EMI A;  4H2K A;  1CJW A;  4IAV A;  1TF8 A;  2K5T A;  5DWN A;  1M1D A;  2Z3P A;  1L0C A;  3KR5 A;  3FJU A;  2CTC A;  3DGV A;  3RAM A;  4QUS A;  5A27 A;  4WWV A;  3E0K A;  3D3S A;  4CS0 B;  4DNC A;  4ZBG A;  3S6F A;  4OAE A;  4UWJ A;  4MRI A;  4FAI A;  1S7F A;  3KKW A;  3G8W A;  1S7N A;  3ISZ A;  4UCN A;  4KOT A;  4XNH C;  4M6G A;  3CDX A;  3BJ7 A;  4PXC A;  1NE9 A;  4R87 A;  4R7M A;  4OC4 A;  2WZN A;  2J9A A;  3P2F A;  1R43 A;  2AJ6 A;  1MJA A;  5I4M A;  4AG9 A;  5THW A;  4UEZ A;  4IF5 A;  3WR7 A;  2DF5 A;  4B10 A;  1AYE A;  1KWM A;  2HV2 A;  2PJC A;  3RO0 A;  1LFW A;  2A4N A;  3I1U A;  2VI7 A;  4OAD A;  2R8V A;  4H6Z A;  3K9U A;  4JXR A;  1S5K A;  3TTH A;  3D66 A;  3RZA A;  1KUX A;  2B5G B;  2PIY A;  1XOV A;  3IIB A;  4FD7 A;  4NCZ A;  4MHN A;  4CRY B;  4R8F A;  5LRK A;  1GYT A;  4YFJ A;  3FVL A;  3QAY A;  3F5B A;  3LWU A;  1XE4 A;  1X10 A;  2J8N A;  3T9Y A;  5K8P A;  4Y49 C;  3TCV A;  2ZW4 A;  4JD6 A;  5F09 A;  4FD5 A;  2GAN A;  4TWE A;  4YU9 A;  3SI0 A;  3TOA A;  4PK3 A;  3SJG A;  4C2X A;  5LYI A;  1YGH A;  4NGQ A;  2BUE A;  1ELL P;  3W91 A;  3FEC A;  5G20 A;  2CNT A;  3EXN A;  3JRU A;  3PB4 X;  3V8I A;  3F0A A;  5JH9 A;  3FRM A;  3W6S A;  2JBJ A;  3GIU A;  4MY3 A;  4KUA A;  1X12 A;  3DSB A;  4YGO A;  5C88 A;  5HH1 A;  1XBU A;  4MMO A;  5DWM A;  1YW6 A;  1J4J A;  2JDD A;  4NSQ A;  4RI1 A;  3MN8 A;  5HVG A;  2OH1 A;  3TFY A;  1CP6 A;  3JUW A;  2QML A;  2B3U A;  4MBU A;  5EBV A;  5F47 A;  1M4D A;  4RUH A;  1N71 A;  3FMC A;  3B2Y A;  4NJR A;  1FY7 A;  4LX9 A;  4B12 A;  1ELM P;  2QVP A;  4NJQ A;  5J8F A;  4A31 A;  4OID A;  1XJO A;  4C2Z A;  2BO9 A;  3UY5 A;  2G9D A;  4C7I A;  4QBJ A;  4BD9 A;  4QVT A;  2FE7 A;  4FBE A;  2PCU A;  2PJ3 A;  2ZPA A;  3B3W A;  3A9L A;  3R9F A;  4CAF A;  2ATR A;  1TXR A;  2J8M A;  3PBB A;  3WT4 A;  3NE7 A;  2PJ2 A;  1Z5R A;  4AB7 A;  1LCP A;  3FED A;  4EWT A;  1XF8 A;  4IHM A;  4JLY A;  4HPS A;  3RYO A;  1YLE A;  2AFX A;  3GYA A;  1WWZ A;  5G1Z A;  3KZW A;  4EME A;  2VBQ A;  1LAN A;  3TE4 A;  1MJ9 A;  2AFS A;  4MFP A;  1AMP A;  2PJ1 A;  3FIX A;  5F46 A;  2P6E A;  1CPS A;  4R9M A;  4CAX A;  4KOV A;  3B3V A;  1ZG8 A;  1UWY A;  3EC4 A;  4F8Z A;  5K8O A;  3N7Z A;  5LYD A;  1HDQ A;  1R3N A;  4LQ6 A;  1VGY A;  2O4H A;  4MHZ A;  4NGP A;  4P4D A;  1QSO A;  2AFZ A;  1Y0Y A;  4XNH B;  3ZJ0 A;  1Y0R A;  4AVC A;  2YNE A;  3KHZ A;  4U5Y A;  3D7G A;  3NA6 A;  3BXM A;  5LRJ A;  1P4N A;  2EK8 A;  2IMO A;  3IWE A;  4K3N A;  8CPA A;  2RB7 A;  3PZJ A;  1LAP A;  2WYR A;  3KQZ A;  2PVV A;  2PQ8 A;  3S9L A;  4NF1 A;  2AFO A;  4MFQ A;  4UA3 A;  2Q7S A;  2CXA A;  2GE3 A;  4X8I A;  5LRG A;  3IO1 A;  2B3V A;  1H8L A;  2ZEO A;  5EC4 A;  5ELY A;  4NGT A;  2C6P A;  4HNX B;  3D68 A;  3GY9 A;  1XFO A;  4BMH A;  3JTK A;  1YLO A;  3IEH A;  5AG6 A;  4ORF A;  3LOD A;  4XPL A;  1SQH A;  4KOW A;  4NGM A;  4XPK A;  2Q4Y A;  2PR8 A;  1HDU A;  4KZT A;  5C82 A;  1Z9U A;  1VIX A;  1RTQ A;  1XRY A;  2J8R A;  4O23 A;  3R1K A;  4B11 A;  4BBH A;  4CGL A;  3TOB A;  4A30 A;  2AFW A;  2HC9 A;  3CPA A;  3D4U A;  3NE8 A;  4CAW A;  2EO8 A;  1UFH A;  3B7I A;  1CG2 A;  5AG7 A;  3RBU A;  2GFQ A;  3OWC A;  4PSW A;  5JPH A;  1B87 A;  4Q38 A;  4P4J A;  4MFL A;  2F7V A;  4A95 A;  4W9Y A;  3KQX A;  3V7Z A;  2Z3N A;  1ZG7 A;  4JXQ A;  3R9G A;  2V8G A;  1M4L A;  1TF9 A;  3CT9 A;  2ODF A;  4I49 A;  4UFV A;  4FD4 A;  2XEI A;  4CGP A;  4F0X A;  1BPN A;  3EFA A;  4M3S A;  4F6A A;  2ZEH A;  2FSR A;  4CYP A;  2YGW A;  1DTD A;  2R7H A;  5FVJ A;  5KTA A;  5IB0 A;  5HVF A;  1Q2D A;  4H6U A;  2RC4 A;  1Q7L A;  4CGN A;  3TO6 A;  1VKC A;  4BIN A;  2ZEN A;  4CGO A;  4KSF A;  1LOK A;  6CPA A;  1Z8W A;  4KVM E;  2BSW A;  3S6H A;  1Z8X A;  4UFW A;  4CYO A;  2CTB A;  2ZEF A;  4IK2 A;  3I3G A;  3B3T A;  1IYK A;  2PJ9 A;  4MXU A;  4E8O A;  1IU8 A;  2XEG A;  4MI4 A;  3TC8 A;  1M44 A;  3LD2 A;  4JWP A;  2PRQ A;  1QST A;  3SHP A;  5J1Q A;  2CY2 A;  3KI9 A;  3R95 A;  4ZY1 A;  1F2O A;  4NEX A;  1I12 A;  3PP9 A;  5LYL A;  4X5K A;  1GHE A;  2NMT A;  2PE3 A;  1Z8T A;  2BEI A;  3GLJ A;  4OIW A;  4X3R A;  2ZW7 A;  2Q0Y A;  2WPX A;  4MY0 A;  2QJ8 A;  1IGB A;  2DPT A;  4A94 A;  2ZOG A;  3BI1 A;  1S60 A;  2C6G A;  2HQY A;  2Q4V A;  2ZEG A;  3TO7 A;  2ZEM A;  2GLF A;  4MHY A;  2DPS A;  5K8M A;  3IWG A;  1BOB A;  2PJ6 A;  1YX0 A;  5JGF A;  3VH9 A;  4HNW B;  4QB9 A;  2OOT A;  5HXD A;  3FBU A;  2PDO A;  1JWQ A;  4Q7A A;  3FXT A;  2OZG A;  2B58 A;  1IOF A;  3PRT A;  2FL4 A;  2YND A;  3D67 A;  4KVX A;  4MFZ A;  3D7D A;  3T8W A;  4NGS A;  3D2P A;  4E0A A;  2IJZ A;  3DR6 A;  4UIB A;  4UCM A;  2GLJ A;  5KTC A;  4OC2 A;  3CXP A;  4R6T A;  2ANP A;  3DLJ A;  3IWW A;  4CYN A;  2AFU A;  1PYT B;  4JZ0 A;  5H86 A;  2PJ8 A;  3GKR A;  3SJF A;  3KAS A;  5CNP A;  1EE3 P;  2FS5 A;  4OC5 A;  4FD6 A;  2QIR A;  3NH5 A;  4Q36 A;  1Z4R A;  3QAH A;  4A37 A;  3H4Q A;  1ARM A;  3PEI A;  4R3K A;  4A2Z A;  1RXT A;  1YR0 A;  4DJL A;  1F2P A;  3CXS A;  2WPW A;  2JBK A;  4PXB A;  4PPZ A;  3FH4 A;  3HLP A;  3PGP A;  4M6I A;  2G3A A;  4P6Y A;  5E96 A;  1XMT A;  4JJX A;  2B4D B;  2OU2 A;  1QQ9 A;  5D29 A;  4LQG A;  1WK4 A;  2WUU A;  2ARH A;  2CF4 A;  1CPX A;  5IX3 A;  3MGD A;  4NGN A; 
#chains in the Genus database with same CATH homology
 3IU1 A;  4KOS A;  3H5Z A;  3S6K A;  1XEB A;  3BJ8 A;  1YVO A;  1M4I A;  1LRZ A;  2B5G A;  1IIC A;  4UWI A;  3VWE A;  5KTD A;  2EVN A;  2VZZ A;  4CAV A;  2P0W A;  4PK2 A;  2Z0Z A;  4PSX A;  3G3S A;  4B5O A;  2IL4 A;  4KOR A;  4B14 A;  2Z3M A;  5IV0 A;  2Q44 A;  1QSR A;  1IB1 E;  4ONU A;  4B13 A;  4CYN A;  1M4G A;  1ZO0 A;  4HNY B;  2D4P A;  3VWD A;  3W6X A;  1B6B A;  1MJB A;  3I9S A;  5F48 A;  3FYN A;  3TT2 A;  3JVN A;  3QB8 A;  1MK4 A;  2X7B A;  3FNC A;  3B8G A;  2OZH A;  4L89 A;  2PR1 A;  2OZU A;  4U9Y A;  1Y9W A;  5BWA B;  2B4B A;  2QEC A;  2BL1 A;  2VZY A;  4QC6 A;  4CRZ B;  2G0B A;  2REE A;  1Q2Y A;  4MJ8 A;  3R96 A;  1CM0 A;  3BLN A;  1KUY A;  4K30 A;  2VEZ A;  1S3Z A;  1YRE A;  2HUZ A;  2I79 A;  2REF A;  5H84 A;  2YNC C;  4M85 A;  4OLL A;  2O28 A;  1QSN A;  1QSM A;  3T90 A;  4AG7 A;  4PV6 A;  3SXO A;  1Y7R A;  2Y0M A;  2H5M A;  1PU9 A;  2P6G A;  3DNS A;  2FT0 A;  3FB3 A;  3C26 A;  4L8A A;  2Z11 A;  1KUV A;  2FIW A;  2P6F A;  1XIX A;  4R57 A;  4XPD C;  4F0Y A;  2FCK A;  2Z3K A;  1V0C A;  2Z3L A;  2PC1 A;  4A33 A;  2Z3O A;  4R3L A;  3ZZI A;  2FXF A;  4NXY A;  1I1D A;  2CNM A;  3DR8 A;  2JLM A;  2D4O A;  2R1I A;  4RS2 A;  1YVK A;  1Q2C A;  4EVY A;  2YNC A;  3F8K A;  2KCW A;  4KS9 A;  2JDC A;  1TIQ A;  1K4J A;  3S6G A;  1Z4E A;  4II9 A;  4ZGY B;  4UCP A;  3R9E A;  1ON0 A;  1OZP A;  5J8C A;  2B4D A;  1VHS A;  5I0C A;  2OB0 A;  4B5P B;  2ZXV A;  3EO4 A;  1Y9K A;  1S7L A;  4UBR A;  4Y49 B;  4C68 A;  4GS4 A;  4A32 A;  4J3G A;  3EY5 A;  4KOY A;  4HKF A;  3P2H A;  2VQY A;  2Q7B A;  4YRH A;  4CYQ A;  4KLV A;  5F49 A;  3DDD A;  4KVO E;  2CNS A;  2GIV A;  1P0H A;  3D8P A;  1IYL A;  2DXQ A;  4KLW A;  2VXK A;  1U6M A;  1PUA A;  4H89 A;  4IUS A;  4KUB A;  4C2Y A;  2AE6 A;  4MFJ A;  2F5I A;  2G3T A;  2Q04 A;  3CXQ A;  3IGR A;  1NSL A;  4KOU A;  4CAE A;  3D2M A;  4MFK A;  1R57 A;  4AVA A;  4AVB A;  5GCN A;  5G21 A;  2ZW5 A;  2FIA A;  2WSA A;  3IU2 A;  1NMT A;  3TO9 A;  5HMN A;  4C7H A;  5AG5 A;  2ZW6 A;  2C27 A;  4KOX A;  1I21 A;  2PRB A;  3SXN A;  4UFX A;  5AGE A;  1BO4 A;  2PSW A;  1RO5 A;  2R98 A;  4MHD A;  1S7K A;  4B5P A;  4LUA A;  5G22 A;  5JQ4 A;  5A28 A;  5AG4 A;  1IID A;  1YK3 A;  5ISV A;  4CGM A;  2JEV A;  4E2A A;  2EUI A;  2Z10 A;  4KSA A;  4XPD B;  2I00 A;  4U9Z A;  1KZF A;  1CJW A;  2K5T A;  5DWN A;  1M1D A;  2Z3P A;  1L0C A;  5A27 A;  4QUS A;  3E0K A;  3D3S A;  4CS0 B;  4DNC A;  4ZBG A;  3S6F A;  4OAE A;  4UWJ A;  1S7F A;  3KKW A;  3G8W A;  1S7N A;  4UCN A;  4KOT A;  4XNH C;  3BJ7 A;  4R87 A;  1NE9 A;  3P2F A;  2AJ6 A;  1MJA A;  4AG9 A;  4IF5 A;  3WR7 A;  4B10 A;  2HV2 A;  2A4N A;  2VI7 A;  4OAD A;  2R8V A;  4H6Z A;  3K9U A;  4JXR A;  1S5K A;  3TTH A;  1KUX A;  2B5G B;  4FD7 A;  4NCZ A;  4CRY B;  4YFJ A;  3F5B A;  1XE4 A;  2J8N A;  3T9Y A;  4Y49 C;  3TCV A;  2ZW4 A;  4JD6 A;  4FD5 A;  2GAN A;  3TOA A;  4PK3 A;  4C2X A;  1YGH A;  2BUE A;  3W91 A;  5G20 A;  2CNT A;  3EXN A;  3V8I A;  3F0A A;  3FRM A;  3W6S A;  4MY3 A;  4KUA A;  3DSB A;  4YGO A;  5C88 A;  5HH1 A;  5DWM A;  1J4J A;  2JDD A;  4NSQ A;  4RI1 A;  2OH1 A;  3TFY A;  3JUW A;  2QML A;  2B3U A;  4MBU A;  5EBV A;  5F47 A;  1M4D A;  1N71 A;  1FY7 A;  4LX9 A;  4B12 A;  5J8F A;  4A31 A;  4C2Z A;  4C7I A;  3UY5 A;  4QBJ A;  4QVT A;  2FE7 A;  2ZPA A;  3A9L A;  3R9F A;  4CAF A;  2ATR A;  2J8M A;  3NE7 A;  4AB7 A;  1XF8 A;  4JLY A;  3RYO A;  1YLE A;  3GYA A;  1WWZ A;  5G1Z A;  2VBQ A;  3TE4 A;  1MJ9 A;  4MFP A;  5F46 A;  3FIX A;  2P6E A;  4R9M A;  4CAX A;  4KOV A;  3EC4 A;  3N7Z A;  1QSO A;  3ZJ0 A;  4XNH B;  4AVC A;  2YNE A;  4U5Y A;  1P4N A;  3IWE A;  3PZJ A;  2PQ8 A;  4NF1 A;  4MFQ A;  4UA3 A;  2CXA A;  2GE3 A;  2B3V A;  5EC4 A;  4HNX B;  3GY9 A;  4BMH A;  3JTK A;  5AG6 A;  4ORF A;  3LOD A;  4XPL A;  1SQH A;  4KOW A;  4XPK A;  2Q4Y A;  2PR8 A;  4KZT A;  5C82 A;  1Z9U A;  2J8R A;  4CGL A;  4B11 A;  3R1K A;  4BBH A;  3TOB A;  4A30 A;  4CAW A;  1UFH A;  5AG7 A;  3OWC A;  4PSW A;  5JPH A;  1B87 A;  4Q38 A;  4MFL A;  4A95 A;  2Z3N A;  4JXQ A;  3R9G A;  4UFV A;  4I49 A;  4FD4 A;  4CGP A;  4F0X A;  3EFA A;  4M3S A;  4F6A A;  2FSR A;  4CYP A;  2YGW A;  5FVJ A;  2R7H A;  5KTA A;  5IB0 A;  1Q2D A;  4H6U A;  2RC4 A;  4CGN A;  3TO6 A;  1VKC A;  4CGO A;  4KSF A;  4KVM E;  2BSW A;  3S6H A;  4UFW A;  4CYO A;  3I3G A;  1IYK A;  4E8O A;  4MI4 A;  1M44 A;  3LD2 A;  4JWP A;  1QST A;  3SHP A;  2CY2 A;  3R95 A;  4NEX A;  1I12 A;  3PP9 A;  4X5K A;  1GHE A;  2NMT A;  2BEI A;  2ZW7 A;  2Q0Y A;  2WPX A;  4MY0 A;  2DPT A;  1S60 A;  2HQY A;  2Q4V A;  3TO7 A;  2DPS A;  3IWG A;  1BOB A;  1YX0 A;  4HNW B;  4QB9 A;  3FBU A;  2PDO A;  3FXT A;  2B58 A;  2OZG A;  2FL4 A;  2YND A;  4KVX A;  4MFZ A;  3D2P A;  4E0A A;  3DR6 A;  4UCM A;  5KTC A;  3CXP A;  5H86 A;  3GKR A;  5CNP A;  2FS5 A;  4FD6 A;  2QIR A;  4Q36 A;  1Z4R A;  3QAH A;  3H4Q A;  4R3K A;  4A2Z A;  1RXT A;  1YR0 A;  3CXS A;  2WPW A;  5E96 A;  3PGP A;  2G3A A;  1XMT A;  4JJX A;  2B4D B;  2OU2 A;  1WK4 A;  2WUU A;  2ARH A;  5IX3 A;  3MGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...