4CGMA

Leishmania major n-myristoyltransferase in complex with a biphenyl- derivative inhibitor
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diverse Modes of Binding in Structures of Leishmania Major N-Myristoyltransferase with Selective Inhibitors
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 125
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cgmA00
4UCMA 4A95A 3JTKA 4C7HA 4CAFA 4A33A 4CYPA 4CGLA 4A2ZA 4B12A 5AG6A 4CGOA 4UFVA 2YNEA 4CGMA 5G21A 2WSAA 2YNDA 4UFWA 2YNCA 4UFXA 3IU2A 4CGPA 4B10A 4CGNA 5G1ZA 4C2ZA 4CYNA 2WUUA 4C68A 4C2XA 4CYOA 3IU1A 4UCNA 4B14A 4C7IA 2YNCC 4B13A 4CYQA 5AG4A 5AGEA 4C2YA 4UCPA 5A28A 3IWEA 4CAEA 4A32A 5G20A 4BBHA 5G22A 3H5ZA 5A27A 4A30A 4B11A 5AG5A 4A31A 5AG7A
chains in the Genus database with same CATH superfamily
2QJ8A 1Z4EA 1P0HA 4KVME 3IIBA 4MHYA 4F0YA 4CRZB 2RB7A 1YR0A 3IJ3A 1CP6A 3N7ZA 3GY9A 2QVPA 1M44A 2HB6A 3TE4A 5HH1A 5G21A 4DJLA 2YNDA 3WT4A 7CPAA 5JH9A 2Z3KA 2PCUA 1ELLP 1Z8WA 1U6MA 4MCRA 4OAEA 3GYAA 2V8GA 3MN8A 3FX6A 1IYLA 1XF8A 1ZLIA 2WUUA 2VZZA 1CBXA 1NSLA 3FEEA 4UEEA 3T8WA 4OC2A 3SJEA 4F6AA 5A28A 1XBUA 2PR1A 4M6IA 4RN7A 2PIZA 1P4NA 2IMOA 3B3CA 1Y7EA 2Q0YA 3LODA 1QQ9A 1I1DA 2REEA 4UWIA 3DSBA 3EO4A 2GIVA 3TCVA 2OH1A 1LAMA 1XEBA 3FEDA 1TF8A 3KASA 3CT9A 3FRMA 4Z65A 4R6TA 5DWNA 4E0AA 1CG2A 1TXRA 2GLJA 3PGPA 4NGPA 4YRHA 3S9NA 2ZXVA 3D4UA 1KUYA 3VARA 2GFQA 3LWUA 3PFOA 4NJQA 4PQAA 4KUAA 3IC1A 5D8NA 1LAPA 3I9SA 1YLEA 1F2PA 3RBUA 2EBJA 1ARLA 4NCZA 4KSAA 4PSXA 3F0AA 3V8IA 4OKOA 2ZOGA 4JJXA 1ELMP 2V8HA 5ISVA 2FL4A 1QSNA 2Z3LA 3H4QA 3CXQA 2B3VA 2REFA 5IX3A 4KOSA 5BWAB 3GUXA 2AFMA 3SJXA 3B8GA 2EK9A 4LQ6A 3TO9A 4MFKA 3D7GA 4EVYA 2GLFA 4P4IA 4MHPA 2FIWA 3CXSA 2PRQA 1CM0A 4MFLA 4RUHA 1X10A 2JDDA 3KGQA 3IWWA 2GANA 4RI1A 3R1KA 3BJ8A 4JXRA 1AYEA 2JEVA 2QECA 5JGFA 1ZG8A 3R96A 3PP9A 3W6XA 3FJUA 3LACA 4YFJA 2Z10A 3IU1A 3K9TA 2B4DB 4LQGA 4ZGYB 1XE4A 4KOXA 2BL1A 2IQ6A 4NGNA 2OZGA 3WC5A 3CDXA 1Q7LA 2J9AA 1IGBA 1Y0YA 1ZG9A 3B3TA 4IAVA 3EFAA 1Z2LA 3PB9X 4MFZA 4EMEA 3H8GA 2PJBA 3DLJA 1NSAA 3V7ZA 4A31A 2O4HA 4P4DA 1MJ9A 2P0WA 4XPKA 1LRZA 5JQ4A 2VZYA 2I00A 2WPXA 4F9UA 1VGYA 5KTCA 1AUGA 2C1CA 1IOFA 2VL1A 1CJWA 1CX8A 2XEGA 2J8RA 3DDDA 4MRIA 3IEHA 5JPHA 1KZFA 1KWMA 2PDOA 1A2ZA 1MJBA 2Q51A 3CXPA 2YNCA 2ZEHA 4PXEA 1Q2CA 4UF4A 1IIDA 4C2ZA 2J8NA 4JXQA 2ZENA 3BLNA 4C2XA 2XEFA 3PB6X 1BAVA 1N71A 2FVGA 3F5BA 2ZEFA 2R7HA 2DPTA 3ISZA 4O23A 4P4BA 4QVTA 1B87A 1Z8TA 1RTQA 3KQXA 1Z4RA 2CNTA 1F2OA 2Q7BA 3D7HA 1S7NA 2PR8A 3RAMA 3VWDA 1YK3A 3QAHA 2G9DA 3PEIA 4KOYA 2ZEOA 2R98A 5LRJA 2FS5A 4LUAA 2OB0A 2FXFA 1IY7A 3GIUA 3JUWA 4A39A 3D66A 1YVOA 2IJZA 4MFPA 2NMTA 1HEEA 3H8FA 3BI0A 1S7KA 2B4DA 3TX8A 4YU9A 1BO4A 4FD4A 3D68A 4MHZA 2P6GA 4OC4A 4NJRA 2Z0ZA 4ONUA 4HPSA 6CPAA 1Y7RA 2F8HA 3RZAA 3JVNA 2PJAA 4J3GA 3NH5A 4MI4A 1I21A 4UWJA 4UEZA 3RYOA 4WJBA 4I49A 5IB0A 4IUSA 4F8ZA 3D7FA 3FNCA 1KUVA 2VQYA 2EO8A 3RO0A 1XMTA 4UIAA 4PV6A 3GB0A 3SHPA 4AVBA 1ZO0A 4H2KA 4WWVA 1B6BA 4ZY1A 1F57A 2QMLA 4JLYA 4A95A 4MHDA 3CPAA 2V77A 2G0BA 4MFJA 5H84A 4OC5A 3WC7A 2WZNA 3T9YA 4NF1A 2EVNA 3S6KA 2R1IA 4JYWA 1SQHA 3FIXA 1XJOA 2BCOA 2ODFA 4KUBA 3D8PA 3K2KA 4BINA 4IK2A 3S6FA 2GU2A 4HNXB 4KS9A 4TNUA 2ABZA 3BXMA 1YVKA 1OZPA 2FE7A 2GREA 3CPXA 1VKCA 3N5FA 3ZJ0A 3ZZIA 4P6YA 4UCPA 4B5OA 3L2NA 3S6HA 1Z5RA 4NEXA 4A30A 3R9GA 2NYQA 1XMBA 4P45A 2B58A 2WPWA 5LYIA 2CNMA 1M4LA 3JTKA 5I4MA 1BOBA 1FY7A 2Q44A 4PXCA 3TC8A 4CGLA 1Z8XA 3BHXA 2D4OA 1J4JA 4P4FA 5LRGA 4H89A 4B5PA 1UWYA 3SJGA 4KOWA 2PJ9A 4A94A 1JQGA 3C26A 4CGPA 4MCQA 1V0CA 5D29A 4U9ZA 5F46A 4ZI6A 1EE3P 4UCNA 4B14A 1XRYA 3DGVA 4ZYQA 5LYFA 2IL4A 4ZX9A 3SI0A 3FMCA 5CBMA 3E0KA 4HNYB 4DNCA 4KVXA 2JLMA 3TO7A 2PJ8A 2ZW4A 1CP7A 2EK8A 2G3TA 2C27A 1TKFA 1M1DA 4OC3A 2XEIA 4NFRA 4ZBGA 4C7HA 4AB7A 4U5YA 3MGDA 4A33A 1WK4A 3IFEA 3KHXA 1S60A 3I3GA 4LX9A 4MFQA 1XFOA 5CNPA 4A2ZA 4CAWA 3NA6A 4L89A 4Y49C 4XPDC 1GYTA 5F09A 3B3VA 4UA3A 4UFXA 4YWYA 3TOAA 5K8PA 2PJ7A 5GCNA 3G3SA 4XNHB 3SI1A 3V38A 4OP4A 4PK2A 4CAXA 1BLLE 4CYNA 1ZG7A 3WR7A 1CPSA 4C7IA 5K8OA 1X12A 2PVVA 3IGRA 4M3SA 1GHEA 2Q4VA 4KVOE 1PUAA 4X2TA 5A27A 1XIXA 3QAYA 5K8MA 3D7DA 1MJAA 5HVGA 2JBKA 4JZ0A 3LD2A 5FVJA 2AFWA 4A37A 3KHZA 4JWPA 2EUIA 4B5PB 4CYPA 3KZWA 2CY2A 4B12A 1IU8A 5HMNA 1Q2DA 5LYDA 2OR4A 2PRBA 3H8EA 3P2HA 5E96A 5KTAA 2Z3MA 4UIBA 4MHNA 5F49A 4KOVA 2DF5A 2AJ6A 4FWUA 1QSMA 1PU9A 4NGTA 4C68A 5DWMA 5KTDA 2C6GA 3LMSA 4FAIA 4FD7A 2I3CA 4NXYA 1LANA 5CPAA 4FBEA 1ZLHA 4A32A 3PB4X 3QB8A 4A38A 3DNSA 4PPZA 2Q4YA 2PJ3A 2WYRA 2HQYA 3D2MA 2Q4ZA 2CTBA 1TIQA 3DR8A 1JWQA 4DYOA 5I0CA 1QMUA 1H8LA 2BEIA 2C6CA 4UCMA 2PJ0A 4CAFA 1VIXA 4Q38A 8CPAA 2OU2A 1VHOA 1NE9A 2VI7A 4R87A 2VEZA 1M4GA 2OZUA 5DS0A 4PXBA 2KCWA 4II9A 1YREA 2VBQA 4UFWA 4NGMA 2B5GB 2ZEMA 3FBUA 4FD6A 4KORA 3PRTA 4OIDA 4Q36A 3TTHA 3RNZA 3S9LA 2P6EA 1VHEA 2DPSA 1IB1E 2O28A 4MBUA 4RS2A 2Z3OA 4CRYB 1YW6A 4K3NA 3CZXA 3FVLA 2O53A 4ZY2A 4MY3A 1Z9UA 5G22A 1YGHA 4CPAA 3PB7X 4IHMA 1LFWA 2JEWA 4GS4A 2AFSA 4B11A 5JM6A 2YGWA 2ANPA 2R8VA 2PE3A 4XNHC 3R95A 2EWBA 2B4BA 3PB8X 2G3AA 2PC1A 1BPNA 4BMHA 1YQEA 2CNSA 2P6FA 2PJCA 4B6ZA 4KZTA 1QSTA 4Y49B 4F0XA 3VH9A 4HKFA 3KR4A 2ZEEA 5EC4A 3B3WA 2VXKA 2BOAA 5G1ZA 3WABA 5F48A 2POKA 2Z3PA 2K5TA 4AXVA 2F5IA 4OMEA 2PIYA 4C2YA 2CTCA 4MMOA 4OLLA 1FT7A 1ON0A 2V8VA 5HVHA 4TWEA 1M4IA 3D67A 4R3LA 4BBHA 1LCPA 1AMPA 4G1PA 5J8FA 2GE3A 4KSIA 2ATRA 3G8WA 4H6ZA 5J1QA 5ELYA 2ZW5A 3W6SA 2J8MA 1IICA 3VATA 3EY5A 1WWZA 3K9UA 5H86A 3EC4A 2Z3NA 5LRKA 4MXUA 4BD9A 4QC6A 4MCPA 2RFHA 3R9EA 3HLPA 2YNEA 4EFDA 1ARMA 1LOKA 4KOUA 2WSAA 1RXTA 4HNWB 4KLVA 2Q7SA 1S7LA 3B3SA 4Q7AA 4XPDB 4AVAA 2FIAA 1YMEA 2A4NA 1KUXA 4KSFA 1XOVA 4CGNA 2ZEGA 3B7IA 1L0CA 1HDQA 3FB3A 4H6UA 5IV0A 3KQZA 3B2YA 4ZY0A 4CYQA 3R9FA 5AG4A 1BPMA 5AGEA 5THWA 4F9VA 1FNOA 3A9LA 3IWEA 3PBEA 4X3RA 4OADA 3VWEA 2FSRA 3S6GA 1M4DA 4X5KA 3FF3A 4KLWA 1Y9WA 4R76A 2ZELA 1YSJA 1RO5A 2JDCA 4EWTA 3NH8A 2DXQA 4GM5A 3BJ7A 1OBRA 3JRUA 3NH4A 1IOIA 1S3ZA 1IYKA 1TKHA 4CGOA 2ZW6A 2Z11A 4R57A 2JBJA 2PVWA 4PSWA 3SI2A 1CPXA 2B3UA 3IU2A 2Y0MA 3BI1A 4PK3A 1MK4A 2HUZA 1YLOA 3OWCA 4R8FA 2BUEA 2PJ2A 2PSWA 3S9MA 3NE8A 4CYOA 2F7VA 3T90A 5K8NA 3TFYA 5F47A 3B35A 1NMTA 1QSRA 1DTDA 1VHSA 2ZOFA 3GKRA 4YGOA 5G20A 1QSOA 3PFEA 4UEFA 4M6HA 1Z8LA 3FYNA 4P4EA 2AFUA 2I79A 3F8KA 4R3KA 3D2PA 1I12A 4R9MA 1TF9A 2ZEDA 4PXDA 4UFVA 2BSWA 4M85A 1K4JA 4R7MA 4ORFA 2ARHA 2PJ5A 4OC1A 4ZX8A 1R57A 4E2AA 4IF5A 4B10A 4NGQA 4QB9A 1DE4C 3SJFA 2Q04A 1Q2YA 1R43A 2YNCC 4M6GA 3P2FA 3TT2A 4AG7A 2HV2A 3KKWA 1HDUA 3KR5A 3FXTA 2HC9A 3WC6A 3UY5A 4K30A 4ONWA 2D4PA 5AG5A 3QNVA 4UBRA 2X7BA 5AG7A 4MCSA 2PJ1A 1YX0A 1S7FA 2AE6A 3TO6A 4P44A 3I1UA 4XPLA 3NE7A 5AG6A 5LYLA 4NGRA 4CS0B 4GXHA 4QBJA 5C88A 3MRUA 1PYTB 1Y0RA 5HXDA 5EBVA 4E8OA 3IO1A 3KI9A 4CAVA 4U9YA 4L8AA 4OC0A 2OOTA 5J8CA 2XEJA 2CXAA 4MJ8A 5HVFA 4MY0A 2BO9A 4CAEA 1PCAA 4NGSA 3FECA 4FD5A 2V8DA 2RC4A 3H5ZA 5C82A 2DEAA 2FT0A 4W9YA 1YW4A 1R3NA 2AFOA 4P4JA 1TKJA 3KL9A 2B5GA 3D3SA 3EXNA 3GLJA 3SXNA 2C6PA 4AG9A 3W91A 4AVCA 1Y9KA 2CIJA 3FH4A 4CGMA 3SXOA 2QYVA 2PJ4A 2FCKA 2ZEPA 5IB9A 3NFZA 2PJ6A 1UFHA 3IWGA 2Q43A 4KOTA 4P10A 2H5MA 4QUSA 3ISXA 4DUKA 4OIWA 1S5KA 2AFZA 2PQ8A 3PZJA 4B13A 3DR6A 2ZW7A 2OZHA 2AFXA 3TOBA 3PBBA 2ZPAA 4JD6A 4FUUA 2CF4A 5EMIA 4X8IA 3HUVA 2QIRA 2NSMA 4NSQA
chains in the Genus database with same CATH topology
1Z4EA 1P0HA 4KVME 4F0YA 4CRZB 1YR0A 3N7ZA 3GY9A 1M44A 3TE4A 5HH1A 5G21A 2YNDA 2Z3KA 4OAEA 1U6MA 3GYAA 1IYLA 1XF8A 2WUUA 2VZZA 1NSLA 4F6AA 5A28A 2PR1A 1P4NA 2Q0YA 3LODA 1I1DA 2REEA 4UWIA 3DSBA 3EO4A 2GIVA 3TCVA 2OH1A 1XEBA 3FRMA 5DWNA 4E0AA 3PGPA 4YRHA 2ZXVA 1KUYA 4KUAA 3I9SA 1YLEA 4NCZA 4KSAA 4PSXA 3F0AA 3V8IA 4JJXA 5ISVA 2FL4A 1QSNA 2Z3LA 3H4QA 3CXQA 2B3VA 2REFA 5IX3A 4KOSA 5BWAB 3B8GA 3TO9A 4MFKA 4EVYA 2FIWA 3CXSA 4MFLA 1CM0A 2JDDA 4RI1A 3R1KA 3BJ8A 4JXRA 2JEVA 2QECA 4YFJA 3R96A 3PP9A 3W6XA 2Z10A 3IU1A 2B4DB 4ZGYB 1XE4A 4KOXA 2BL1A 2OZGA 3EFAA 4MFZA 4A31A 1MJ9A 2P0WA 4XPKA 1LRZA 5JQ4A 2VZYA 2I00A 2WPXA 5KTCA 1CJWA 3DDDA 2J8RA 5JPHA 1KZFA 2PDOA 1MJBA 3CXPA 2YNCA 1Q2CA 1IIDA 4C2ZA 2J8NA 4JXQA 3BLNA 4C2XA 1N71A 3F5BA 2R7HA 2DPTA 4QVTA 1B87A 1Z4RA 2CNTA 2Q7BA 1S7NA 2PR8A 3VWDA 3QAHA 1YK3A 4KOYA 2R98A 2FS5A 4LUAA 2OB0A 2FXFA 3JUWA 4MFPA 1YVOA 2NMTA 1S7KA 2B4DA 1BO4A 4FD4A 2P6GA 2Z0ZA 4ONUA 1Y7RA 3JVNA 4J3GA 4MI4A 3RYOA 1I21A 4UWJA 4I49A 5IB0A 4IUSA 3FNCA 1KUVA 2VQYA 1XMTA 4PV6A 3SHPA 4AVBA 1ZO0A 1B6BA 2QMLA 4JLYA 4A95A 4MHDA 5H84A 2G0BA 4MFJA 3T9YA 4NF1A 2EVNA 3S6KA 2R1IA 1SQHA 3FIXA 4KUBA 3D8PA 3S6FA 4HNXB 4KS9A 1YVKA 1OZPA 2FE7A 1VKCA 3ZJ0A 3ZZIA 4UCPA 4B5OA 3S6HA 4NEXA 4A30A 3R9GA 2B58A 2WPWA 2CNMA 3JTKA 1BOBA 1FY7A 2Q44A 4CGLA 2D4OA 1J4JA 4H89A 4B5PA 4KOWA 3C26A 4CGPA 1V0CA 4U9ZA 5F46A 4UCNA 4B14A 2IL4A 3E0KA 4HNYB 4DNCA 4KVXA 2JLMA 3TO7A 2ZW4A 2G3TA 2C27A 1M1DA 4ZBGA 4C7HA 4AB7A 4U5YA 3MGDA 4A33A 1WK4A 5CNPA 4MFQA 1S60A 3I3GA 4LX9A 4A2ZA 4CAWA 4L89A 4Y49C 4XPDC 4UFXA 4UA3A 3TOAA 5GCNA 3G3SA 4XNHB 4CAXA 4PK2A 4CYNA 3WR7A 4C7IA 3IGRA 4M3SA 1GHEA 2Q4VA 4KVOE 1PUAA 5A27A 1XIXA 1MJAA 3LD2A 5FVJA 4JWPA 2EUIA 4B5PB 4CYPA 2CY2A 4B12A 5HMNA 1Q2DA 5E96A 2PRBA 3P2HA 5KTAA 2Z3MA 5F49A 4KOVA 2AJ6A 1QSMA 1PU9A 4C68A 5DWMA 5KTDA 4FD7A 4NXYA 4A32A 3QB8A 3DNSA 2Q4YA 2HQYA 3D2MA 1TIQA 3DR8A 5I0CA 2BEIA 4UCMA 4CAFA 4Q38A 2OU2A 1NE9A 2VI7A 4R87A 2VEZA 1M4GA 2OZUA 2KCWA 4II9A 1YREA 2VBQA 4UFWA 2B5GB 3FBUA 4FD6A 4KORA 4Q36A 3TTHA 2P6EA 2DPSA 1IB1E 2O28A 4MBUA 4RS2A 2Z3OA 4CRYB 4MY3A 1Z9UA 5G22A 1YGHA 4GS4A 4B11A 2YGWA 2R8VA 4XNHC 3R95A 2B4BA 2G3AA 2PC1A 4BMHA 2CNSA 2P6FA 4KZTA 1QSTA 4Y49B 4F0XA 4HKFA 5EC4A 5G1ZA 2VXKA 5F48A 2Z3PA 2K5TA 2F5IA 4C2YA 4OLLA 1ON0A 1M4IA 4R3LA 4BBHA 5J8FA 2GE3A 2ATRA 3G8WA 4H6ZA 2ZW5A 3W6SA 2J8MA 1IICA 3EY5A 1WWZA 3K9UA 5H86A 3EC4A 2Z3NA 4QC6A 3R9EA 2YNEA 4KOUA 2WSAA 1RXTA 4HNWB 4KLVA 4XPDB 1S7LA 4AVAA 2FIAA 2A4NA 1KUXA 4KSFA 4CGNA 5IV0A 1L0CA 3FB3A 4H6UA 4CYQA 3R9FA 5AG4A 5AGEA 3A9LA 3IWEA 4OADA 3VWEA 2FSRA 3S6GA 1M4DA 4X5KA 4KLWA 1Y9WA 1RO5A 2JDCA 2DXQA 3BJ7A 1S3ZA 4CGOA 1IYKA 2ZW6A 2Z11A 4R57A 4PSWA 2B3UA 3IU2A 2Y0MA 4PK3A 1MK4A 2HUZA 3OWCA 2BUEA 2PSWA 4CYOA 3T90A 3TFYA 5F47A 1NMTA 1QSRA 1VHSA 3GKRA 4YGOA 5G20A 1QSOA 3FYNA 2I79A 3F8KA 4R3KA 3D2PA 1I12A 4R9MA 4UFVA 2BSWA 4M85A 1K4JA 4ORFA 2ARHA 4E2AA 1R57A 4IF5A 4B10A 4QB9A 1Q2YA 2Q04A 2YNCC 3P2FA 3TT2A 4AG7A 2HV2A 3KKWA 3FXTA 3UY5A 4K30A 2D4PA 5AG5A 4UBRA 2X7BA 5AG7A 1YX0A 1S7FA 2AE6A 3TO6A 4XPLA 3NE7A 5AG6A 4CS0B 4QBJA 5C88A 5EBVA 4E8OA 4CAVA 4U9YA 4L8AA 5J8CA 4MJ8A 2CXAA 4MY0A 4CAEA 4FD5A 2RC4A 3H5ZA 5C82A 2FT0A 2B5GA 3D3SA 3EXNA 3SXNA 4AG9A 3W91A 4AVCA 1Y9KA 4CGMA 3SXOA 2FCKA 1UFHA 3IWGA 4KOTA 2H5MA 4QUSA 1S5KA 2PQ8A 3PZJA 4B13A 3DR6A 2ZW7A 2OZHA 3TOBA 2ZPAA 4JD6A 2QIRA 2GANA 4NSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UCM A;  4A95 A;  3JTK A;  4C7H A;  4CAF A;  4A33 A;  4CYP A;  4CGL A;  4A2Z A;  4B12 A;  5AG6 A;  4CGO A;  4UFV A;  2YNE A;  4CGM A;  5G21 A;  2WSA A;  2YND A;  4UFW A;  2YNC A;  4UFX A;  3IU2 A;  4CGP A;  4B10 A;  4CGN A;  5G1Z A;  4C2Z A;  4CYN A;  2WUU A;  4C68 A;  4C2X A;  4CYO A;  3IU1 A;  4UCN A;  4B14 A;  4C7I A;  2YNC C;  4B13 A;  4CYQ A;  5AG4 A;  5AGE A;  4C2Y A;  4UCP A;  5A28 A;  3IWE A;  4CAE A;  4A32 A;  5G20 A;  4BBH A;  5G22 A;  3H5Z A;  5A27 A;  4A30 A;  4B11 A;  5AG5 A;  4A31 A;  5AG7 A; 
#chains in the Genus database with same CATH topology
 2QJ8 A;  1Z4E A;  1P0H A;  4KVM E;  3IIB A;  4MHY A;  4F0Y A;  4CRZ B;  2RB7 A;  1YR0 A;  3IJ3 A;  1CP6 A;  3N7Z A;  3GY9 A;  2QVP A;  1M44 A;  2HB6 A;  3TE4 A;  5HH1 A;  5G21 A;  4DJL A;  2YND A;  3WT4 A;  7CPA A;  5JH9 A;  2Z3K A;  2PCU A;  1ELL P;  1Z8W A;  1U6M A;  4MCR A;  4OAE A;  3GYA A;  2V8G A;  3MN8 A;  3FX6 A;  1IYL A;  1XF8 A;  1ZLI A;  2WUU A;  2VZZ A;  1CBX A;  1NSL A;  3FEE A;  4UEE A;  3T8W A;  4OC2 A;  3SJE A;  4F6A A;  5A28 A;  1XBU A;  2PR1 A;  4M6I A;  4RN7 A;  2PIZ A;  1P4N A;  2IMO A;  3B3C A;  1Y7E A;  2Q0Y A;  3LOD A;  1QQ9 A;  1I1D A;  2REE A;  4UWI A;  3DSB A;  3EO4 A;  2GIV A;  3TCV A;  2OH1 A;  1LAM A;  1XEB A;  3FED A;  1TF8 A;  3KAS A;  3CT9 A;  3FRM A;  4Z65 A;  4R6T A;  5DWN A;  4E0A A;  1CG2 A;  1TXR A;  2GLJ A;  3PGP A;  4NGP A;  4YRH A;  3S9N A;  2ZXV A;  3D4U A;  1KUY A;  3VAR A;  2GFQ A;  3LWU A;  3PFO A;  4NJQ A;  4PQA A;  4KUA A;  3IC1 A;  5D8N A;  1LAP A;  3I9S A;  1YLE A;  1F2P A;  3RBU A;  2EBJ A;  1ARL A;  4NCZ A;  4KSA A;  4PSX A;  3F0A A;  3V8I A;  4OKO A;  2ZOG A;  4JJX A;  1ELM P;  2V8H A;  5ISV A;  2FL4 A;  1QSN A;  2Z3L A;  3H4Q A;  3CXQ A;  2B3V A;  2REF A;  5IX3 A;  4KOS A;  5BWA B;  3GUX A;  2AFM A;  3SJX A;  3B8G A;  2EK9 A;  4LQ6 A;  3TO9 A;  4MFK A;  3D7G A;  4EVY A;  2GLF A;  4P4I A;  4MHP A;  2FIW A;  3CXS A;  2PRQ A;  1CM0 A;  4MFL A;  4RUH A;  1X10 A;  2JDD A;  3KGQ A;  3IWW A;  2GAN A;  4RI1 A;  3R1K A;  3BJ8 A;  4JXR A;  1AYE A;  2JEV A;  2QEC A;  5JGF A;  1ZG8 A;  3R96 A;  3PP9 A;  3W6X A;  3FJU A;  3LAC A;  4YFJ A;  2Z10 A;  3IU1 A;  3K9T A;  2B4D B;  4LQG A;  4ZGY B;  1XE4 A;  4KOX A;  2BL1 A;  2IQ6 A;  4NGN A;  2OZG A;  3WC5 A;  3CDX A;  1Q7L A;  2J9A A;  1IGB A;  1Y0Y A;  1ZG9 A;  3B3T A;  4IAV A;  3EFA A;  1Z2L A;  3PB9 X;  4MFZ A;  4EME A;  3H8G A;  2PJB A;  3DLJ A;  1NSA A;  3V7Z A;  4A31 A;  2O4H A;  4P4D A;  1MJ9 A;  2P0W A;  4XPK A;  1LRZ A;  5JQ4 A;  2VZY A;  2I00 A;  2WPX A;  4F9U A;  1VGY A;  5KTC A;  1AUG A;  2C1C A;  1IOF A;  2VL1 A;  1CJW A;  1CX8 A;  2XEG A;  2J8R A;  3DDD A;  4MRI A;  3IEH A;  5JPH A;  1KZF A;  1KWM A;  2PDO A;  1A2Z A;  1MJB A;  2Q51 A;  3CXP A;  2YNC A;  2ZEH A;  4PXE A;  1Q2C A;  4UF4 A;  1IID A;  4C2Z A;  2J8N A;  4JXQ A;  2ZEN A;  3BLN A;  4C2X A;  2XEF A;  3PB6 X;  1BAV A;  1N71 A;  2FVG A;  3F5B A;  2ZEF A;  2R7H A;  2DPT A;  3ISZ A;  4O23 A;  4P4B A;  4QVT A;  1B87 A;  1Z8T A;  1RTQ A;  3KQX A;  1Z4R A;  2CNT A;  1F2O A;  2Q7B A;  3D7H A;  1S7N A;  2PR8 A;  3RAM A;  3VWD A;  1YK3 A;  3QAH A;  2G9D A;  3PEI A;  4KOY A;  2ZEO A;  2R98 A;  5LRJ A;  2FS5 A;  4LUA A;  2OB0 A;  2FXF A;  1IY7 A;  3GIU A;  3JUW A;  4A39 A;  3D66 A;  1YVO A;  2IJZ A;  4MFP A;  2NMT A;  1HEE A;  3H8F A;  3BI0 A;  1S7K A;  2B4D A;  3TX8 A;  4YU9 A;  1BO4 A;  4FD4 A;  3D68 A;  4MHZ A;  2P6G A;  4OC4 A;  4NJR A;  2Z0Z A;  4ONU A;  4HPS A;  6CPA A;  1Y7R A;  2F8H A;  3RZA A;  3JVN A;  2PJA A;  4J3G A;  3NH5 A;  4MI4 A;  1I21 A;  4UWJ A;  4UEZ A;  3RYO A;  4WJB A;  4I49 A;  5IB0 A;  4IUS A;  4F8Z A;  3D7F A;  3FNC A;  1KUV A;  2VQY A;  2EO8 A;  3RO0 A;  1XMT A;  4UIA A;  4PV6 A;  3GB0 A;  3SHP A;  4AVB A;  1ZO0 A;  4H2K A;  4WWV A;  1B6B A;  4ZY1 A;  1F57 A;  2QML A;  4JLY A;  4A95 A;  4MHD A;  3CPA A;  2V77 A;  2G0B A;  4MFJ A;  5H84 A;  4OC5 A;  3WC7 A;  2WZN A;  3T9Y A;  4NF1 A;  2EVN A;  3S6K A;  2R1I A;  4JYW A;  1SQH A;  3FIX A;  1XJO A;  2BCO A;  2ODF A;  4KUB A;  3D8P A;  3K2K A;  4BIN A;  4IK2 A;  3S6F A;  2GU2 A;  4HNX B;  4KS9 A;  4TNU A;  2ABZ A;  3BXM A;  1YVK A;  1OZP A;  2FE7 A;  2GRE A;  3CPX A;  1VKC A;  3N5F A;  3ZJ0 A;  3ZZI A;  4P6Y A;  4UCP A;  4B5O A;  3L2N A;  3S6H A;  1Z5R A;  4NEX A;  4A30 A;  3R9G A;  2NYQ A;  1XMB A;  4P45 A;  2B58 A;  2WPW A;  5LYI A;  2CNM A;  1M4L A;  3JTK A;  5I4M A;  1BOB A;  1FY7 A;  2Q44 A;  4PXC A;  3TC8 A;  4CGL A;  1Z8X A;  3BHX A;  2D4O A;  1J4J A;  4P4F A;  5LRG A;  4H89 A;  4B5P A;  1UWY A;  3SJG A;  4KOW A;  2PJ9 A;  4A94 A;  1JQG A;  3C26 A;  4CGP A;  4MCQ A;  1V0C A;  5D29 A;  4U9Z A;  5F46 A;  4ZI6 A;  1EE3 P;  4UCN A;  4B14 A;  1XRY A;  3DGV A;  4ZYQ A;  5LYF A;  2IL4 A;  4ZX9 A;  3SI0 A;  3FMC A;  5CBM A;  3E0K A;  4HNY B;  4DNC A;  4KVX A;  2JLM A;  3TO7 A;  2PJ8 A;  2ZW4 A;  1CP7 A;  2EK8 A;  2G3T A;  2C27 A;  1TKF A;  1M1D A;  4OC3 A;  2XEI A;  4NFR A;  4ZBG A;  4C7H A;  4AB7 A;  4U5Y A;  3MGD A;  4A33 A;  1WK4 A;  3IFE A;  3KHX A;  1S60 A;  3I3G A;  4LX9 A;  4MFQ A;  1XFO A;  5CNP A;  4A2Z A;  4CAW A;  3NA6 A;  4L89 A;  4Y49 C;  4XPD C;  1GYT A;  5F09 A;  3B3V A;  4UA3 A;  4UFX A;  4YWY A;  3TOA A;  5K8P A;  2PJ7 A;  5GCN A;  3G3S A;  4XNH B;  3SI1 A;  3V38 A;  4OP4 A;  4PK2 A;  4CAX A;  1BLL E;  4CYN A;  1ZG7 A;  3WR7 A;  1CPS A;  4C7I A;  5K8O A;  1X12 A;  2PVV A;  3IGR A;  4M3S A;  1GHE A;  2Q4V A;  4KVO E;  1PUA A;  4X2T A;  5A27 A;  1XIX A;  3QAY A;  5K8M A;  3D7D A;  1MJA A;  5HVG A;  2JBK A;  4JZ0 A;  3LD2 A;  5FVJ A;  2AFW A;  4A37 A;  3KHZ A;  4JWP A;  2EUI A;  4B5P B;  4CYP A;  3KZW A;  2CY2 A;  4B12 A;  1IU8 A;  5HMN A;  1Q2D A;  5LYD A;  2OR4 A;  2PRB A;  3H8E A;  3P2H A;  5E96 A;  5KTA A;  2Z3M A;  4UIB A;  4MHN A;  5F49 A;  4KOV A;  2DF5 A;  2AJ6 A;  4FWU A;  1QSM A;  1PU9 A;  4NGT A;  4C68 A;  5DWM A;  5KTD A;  2C6G A;  3LMS A;  4FAI A;  4FD7 A;  2I3C A;  4NXY A;  1LAN A;  5CPA A;  4FBE A;  1ZLH A;  4A32 A;  3PB4 X;  3QB8 A;  4A38 A;  3DNS A;  4PPZ A;  2Q4Y A;  2PJ3 A;  2WYR A;  2HQY A;  3D2M A;  2Q4Z A;  2CTB A;  1TIQ A;  3DR8 A;  1JWQ A;  4DYO A;  5I0C A;  1QMU A;  1H8L A;  2BEI A;  2C6C A;  4UCM A;  2PJ0 A;  4CAF A;  1VIX A;  4Q38 A;  8CPA A;  2OU2 A;  1VHO A;  1NE9 A;  2VI7 A;  4R87 A;  2VEZ A;  1M4G A;  2OZU A;  5DS0 A;  4PXB A;  2KCW A;  4II9 A;  1YRE A;  2VBQ A;  4UFW A;  4NGM A;  2B5G B;  2ZEM A;  3FBU A;  4FD6 A;  4KOR A;  3PRT A;  4OID A;  4Q36 A;  3TTH A;  3RNZ A;  3S9L A;  2P6E A;  1VHE A;  2DPS A;  1IB1 E;  2O28 A;  4MBU A;  4RS2 A;  2Z3O A;  4CRY B;  1YW6 A;  4K3N A;  3CZX A;  3FVL A;  2O53 A;  4ZY2 A;  4MY3 A;  1Z9U A;  5G22 A;  1YGH A;  4CPA A;  3PB7 X;  4IHM A;  1LFW A;  2JEW A;  4GS4 A;  2AFS A;  4B11 A;  5JM6 A;  2YGW A;  2ANP A;  2R8V A;  2PE3 A;  4XNH C;  3R95 A;  2EWB A;  2B4B A;  3PB8 X;  2G3A A;  2PC1 A;  1BPN A;  4BMH A;  1YQE A;  2CNS A;  2P6F A;  2PJC A;  4B6Z A;  4KZT A;  1QST A;  4Y49 B;  4F0X A;  3VH9 A;  4HKF A;  3KR4 A;  2ZEE A;  5EC4 A;  3B3W A;  2VXK A;  2BOA A;  5G1Z A;  3WAB A;  5F48 A;  2POK A;  2Z3P A;  2K5T A;  4AXV A;  2F5I A;  4OME A;  2PIY A;  4C2Y A;  2CTC A;  4MMO A;  4OLL A;  1FT7 A;  1ON0 A;  2V8V A;  5HVH A;  4TWE A;  1M4I A;  3D67 A;  4R3L A;  4BBH A;  1LCP A;  1AMP A;  4G1P A;  5J8F A;  2GE3 A;  4KSI A;  2ATR A;  3G8W A;  4H6Z A;  5J1Q A;  5ELY A;  2ZW5 A;  3W6S A;  2J8M A;  1IIC A;  3VAT A;  3EY5 A;  1WWZ A;  3K9U A;  5H86 A;  3EC4 A;  2Z3N A;  5LRK A;  4MXU A;  4BD9 A;  4QC6 A;  4MCP A;  2RFH A;  3R9E A;  3HLP A;  2YNE A;  4EFD A;  1ARM A;  1LOK A;  4KOU A;  2WSA A;  1RXT A;  4HNW B;  4KLV A;  2Q7S A;  1S7L A;  3B3S A;  4Q7A A;  4XPD B;  4AVA A;  2FIA A;  1YME A;  2A4N A;  1KUX A;  4KSF A;  1XOV A;  4CGN A;  2ZEG A;  3B7I A;  1L0C A;  1HDQ A;  3FB3 A;  4H6U A;  5IV0 A;  3KQZ A;  3B2Y A;  4ZY0 A;  4CYQ A;  3R9F A;  5AG4 A;  1BPM A;  5AGE A;  5THW A;  4F9V A;  1FNO A;  3A9L A;  3IWE A;  3PBE A;  4X3R A;  4OAD A;  3VWE A;  2FSR A;  3S6G A;  1M4D A;  4X5K A;  3FF3 A;  4KLW A;  1Y9W A;  4R76 A;  2ZEL A;  1YSJ A;  1RO5 A;  2JDC A;  4EWT A;  3NH8 A;  2DXQ A;  4GM5 A;  3BJ7 A;  1OBR A;  3JRU A;  3NH4 A;  1IOI A;  1S3Z A;  1IYK A;  1TKH A;  4CGO A;  2ZW6 A;  2Z11 A;  4R57 A;  2JBJ A;  2PVW A;  4PSW A;  3SI2 A;  1CPX A;  2B3U A;  3IU2 A;  2Y0M A;  3BI1 A;  4PK3 A;  1MK4 A;  2HUZ A;  1YLO A;  3OWC A;  4R8F A;  2BUE A;  2PJ2 A;  2PSW A;  3S9M A;  3NE8 A;  4CYO A;  2F7V A;  3T90 A;  5K8N A;  3TFY A;  5F47 A;  3B35 A;  1NMT A;  1QSR A;  1DTD A;  1VHS A;  2ZOF A;  3GKR A;  4YGO A;  5G20 A;  1QSO A;  3PFE A;  4UEF A;  4M6H A;  1Z8L A;  3FYN A;  4P4E A;  2AFU A;  2I79 A;  3F8K A;  4R3K A;  3D2P A;  1I12 A;  4R9M A;  1TF9 A;  2ZED A;  4PXD A;  4UFV A;  2BSW A;  4M85 A;  1K4J A;  4R7M A;  4ORF A;  2ARH A;  2PJ5 A;  4OC1 A;  4ZX8 A;  1R57 A;  4E2A A;  4IF5 A;  4B10 A;  4NGQ A;  4QB9 A;  1DE4 C;  3SJF A;  2Q04 A;  1Q2Y A;  1R43 A;  2YNC C;  4M6G A;  3P2F A;  3TT2 A;  4AG7 A;  2HV2 A;  3KKW A;  1HDU A;  3KR5 A;  3FXT A;  2HC9 A;  3WC6 A;  3UY5 A;  4K30 A;  4ONW A;  2D4P A;  5AG5 A;  3QNV A;  4UBR A;  2X7B A;  5AG7 A;  4MCS A;  2PJ1 A;  1YX0 A;  1S7F A;  2AE6 A;  3TO6 A;  4P44 A;  3I1U A;  4XPL A;  3NE7 A;  5AG6 A;  5LYL A;  4NGR A;  4CS0 B;  4GXH A;  4QBJ A;  5C88 A;  3MRU A;  1PYT B;  1Y0R A;  5HXD A;  5EBV A;  4E8O A;  3IO1 A;  3KI9 A;  4CAV A;  4U9Y A;  4L8A A;  4OC0 A;  2OOT A;  5J8C A;  2XEJ A;  2CXA A;  4MJ8 A;  5HVF A;  4MY0 A;  2BO9 A;  4CAE A;  1PCA A;  4NGS A;  3FEC A;  4FD5 A;  2V8D A;  2RC4 A;  3H5Z A;  5C82 A;  2DEA A;  2FT0 A;  4W9Y A;  1YW4 A;  1R3N A;  2AFO A;  4P4J A;  1TKJ A;  3KL9 A;  2B5G A;  3D3S A;  3EXN A;  3GLJ A;  3SXN A;  2C6P A;  4AG9 A;  3W91 A;  4AVC A;  1Y9K A;  2CIJ A;  3FH4 A;  4CGM A;  3SXO A;  2QYV A;  2PJ4 A;  2FCK A;  2ZEP A;  5IB9 A;  3NFZ A;  2PJ6 A;  1UFH A;  3IWG A;  2Q43 A;  4KOT A;  4P10 A;  2H5M A;  4QUS A;  3ISX A;  4DUK A;  4OIW A;  1S5K A;  2AFZ A;  2PQ8 A;  3PZJ A;  4B13 A;  3DR6 A;  2ZW7 A;  2OZH A;  2AFX A;  3TOB A;  3PBB A;  2ZPA A;  4JD6 A;  4FUU A;  2CF4 A;  5EMI A;  4X8I A;  3HUV A;  2QIR A;  2NSM A;  4NSQ A; 
#chains in the Genus database with same CATH homology
 1Z4E A;  1P0H A;  4KVM E;  4F0Y A;  4CRZ B;  1YR0 A;  3N7Z A;  3GY9 A;  1M44 A;  3TE4 A;  5HH1 A;  5G21 A;  2YND A;  2Z3K A;  4OAE A;  1U6M A;  3GYA A;  1IYL A;  1XF8 A;  2WUU A;  2VZZ A;  1NSL A;  4F6A A;  5A28 A;  2PR1 A;  1P4N A;  2Q0Y A;  3LOD A;  1I1D A;  2REE A;  4UWI A;  3DSB A;  3EO4 A;  2GIV A;  3TCV A;  2OH1 A;  1XEB A;  3FRM A;  5DWN A;  4E0A A;  3PGP A;  4YRH A;  2ZXV A;  1KUY A;  4KUA A;  3I9S A;  1YLE A;  4NCZ A;  4KSA A;  4PSX A;  3F0A A;  3V8I A;  4JJX A;  5ISV A;  2FL4 A;  1QSN A;  2Z3L A;  3H4Q A;  3CXQ A;  2B3V A;  2REF A;  5IX3 A;  4KOS A;  5BWA B;  3B8G A;  3TO9 A;  4MFK A;  4EVY A;  2FIW A;  3CXS A;  4MFL A;  1CM0 A;  2JDD A;  4RI1 A;  3R1K A;  3BJ8 A;  4JXR A;  2JEV A;  2QEC A;  4YFJ A;  3R96 A;  3PP9 A;  3W6X A;  2Z10 A;  3IU1 A;  2B4D B;  4ZGY B;  1XE4 A;  4KOX A;  2BL1 A;  2OZG A;  3EFA A;  4MFZ A;  4A31 A;  1MJ9 A;  2P0W A;  4XPK A;  1LRZ A;  5JQ4 A;  2VZY A;  2I00 A;  2WPX A;  5KTC A;  1CJW A;  3DDD A;  2J8R A;  5JPH A;  1KZF A;  2PDO A;  1MJB A;  3CXP A;  2YNC A;  1Q2C A;  1IID A;  4C2Z A;  2J8N A;  4JXQ A;  3BLN A;  4C2X A;  1N71 A;  3F5B A;  2R7H A;  2DPT A;  4QVT A;  1B87 A;  1Z4R A;  2CNT A;  2Q7B A;  1S7N A;  2PR8 A;  3VWD A;  3QAH A;  1YK3 A;  4KOY A;  2R98 A;  2FS5 A;  4LUA A;  2OB0 A;  2FXF A;  3JUW A;  4MFP A;  1YVO A;  2NMT A;  1S7K A;  2B4D A;  1BO4 A;  4FD4 A;  2P6G A;  2Z0Z A;  4ONU A;  1Y7R A;  3JVN A;  4J3G A;  4MI4 A;  3RYO A;  1I21 A;  4UWJ A;  4I49 A;  5IB0 A;  4IUS A;  3FNC A;  1KUV A;  2VQY A;  1XMT A;  4PV6 A;  3SHP A;  4AVB A;  1ZO0 A;  1B6B A;  2QML A;  4JLY A;  4A95 A;  4MHD A;  5H84 A;  2G0B A;  4MFJ A;  3T9Y A;  4NF1 A;  2EVN A;  3S6K A;  2R1I A;  1SQH A;  3FIX A;  4KUB A;  3D8P A;  3S6F A;  4HNX B;  4KS9 A;  1YVK A;  1OZP A;  2FE7 A;  1VKC A;  3ZJ0 A;  3ZZI A;  4UCP A;  4B5O A;  3S6H A;  4NEX A;  4A30 A;  3R9G A;  2B58 A;  2WPW A;  2CNM A;  3JTK A;  1BOB A;  1FY7 A;  2Q44 A;  4CGL A;  2D4O A;  1J4J A;  4H89 A;  4B5P A;  4KOW A;  3C26 A;  4CGP A;  1V0C A;  4U9Z A;  5F46 A;  4UCN A;  4B14 A;  2IL4 A;  3E0K A;  4HNY B;  4DNC A;  4KVX A;  2JLM A;  3TO7 A;  2ZW4 A;  2G3T A;  2C27 A;  1M1D A;  4ZBG A;  4C7H A;  4AB7 A;  4U5Y A;  3MGD A;  4A33 A;  1WK4 A;  5CNP A;  4MFQ A;  1S60 A;  3I3G A;  4LX9 A;  4A2Z A;  4CAW A;  4L89 A;  4Y49 C;  4XPD C;  4UFX A;  4UA3 A;  3TOA A;  5GCN A;  3G3S A;  4XNH B;  4CAX A;  4PK2 A;  4CYN A;  3WR7 A;  4C7I A;  3IGR A;  4M3S A;  1GHE A;  2Q4V A;  4KVO E;  1PUA A;  5A27 A;  1XIX A;  1MJA A;  3LD2 A;  5FVJ A;  4JWP A;  2EUI A;  4B5P B;  4CYP A;  2CY2 A;  4B12 A;  5HMN A;  1Q2D A;  5E96 A;  2PRB A;  3P2H A;  5KTA A;  2Z3M A;  5F49 A;  4KOV A;  2AJ6 A;  1QSM A;  1PU9 A;  4C68 A;  5DWM A;  5KTD A;  4FD7 A;  4NXY A;  4A32 A;  3QB8 A;  3DNS A;  2Q4Y A;  2HQY A;  3D2M A;  1TIQ A;  3DR8 A;  5I0C A;  2BEI A;  4UCM A;  4CAF A;  4Q38 A;  2OU2 A;  1NE9 A;  2VI7 A;  4R87 A;  2VEZ A;  1M4G A;  2OZU A;  2KCW A;  4II9 A;  1YRE A;  2VBQ A;  4UFW A;  2B5G B;  3FBU A;  4FD6 A;  4KOR A;  4Q36 A;  3TTH A;  2P6E A;  2DPS A;  1IB1 E;  2O28 A;  4MBU A;  4RS2 A;  2Z3O A;  4CRY B;  4MY3 A;  1Z9U A;  5G22 A;  1YGH A;  4GS4 A;  4B11 A;  2YGW A;  2R8V A;  4XNH C;  3R95 A;  2B4B A;  2G3A A;  2PC1 A;  4BMH A;  2CNS A;  2P6F A;  4KZT A;  1QST A;  4Y49 B;  4F0X A;  4HKF A;  5EC4 A;  5G1Z A;  2VXK A;  5F48 A;  2Z3P A;  2K5T A;  2F5I A;  4C2Y A;  4OLL A;  1ON0 A;  1M4I A;  4R3L A;  4BBH A;  5J8F A;  2GE3 A;  2ATR A;  3G8W A;  4H6Z A;  2ZW5 A;  3W6S A;  2J8M A;  1IIC A;  3EY5 A;  1WWZ A;  3K9U A;  5H86 A;  3EC4 A;  2Z3N A;  4QC6 A;  3R9E A;  2YNE A;  4KOU A;  2WSA A;  1RXT A;  4HNW B;  4KLV A;  4XPD B;  1S7L A;  4AVA A;  2FIA A;  2A4N A;  1KUX A;  4KSF A;  4CGN A;  5IV0 A;  1L0C A;  3FB3 A;  4H6U A;  4CYQ A;  3R9F A;  5AG4 A;  5AGE A;  3A9L A;  3IWE A;  4OAD A;  3VWE A;  2FSR A;  3S6G A;  1M4D A;  4X5K A;  4KLW A;  1Y9W A;  1RO5 A;  2JDC A;  2DXQ A;  3BJ7 A;  1S3Z A;  4CGO A;  1IYK A;  2ZW6 A;  2Z11 A;  4R57 A;  4PSW A;  2B3U A;  3IU2 A;  2Y0M A;  4PK3 A;  1MK4 A;  2HUZ A;  3OWC A;  2BUE A;  2PSW A;  4CYO A;  3T90 A;  3TFY A;  5F47 A;  1NMT A;  1QSR A;  1VHS A;  3GKR A;  4YGO A;  5G20 A;  1QSO A;  3FYN A;  2I79 A;  3F8K A;  4R3K A;  3D2P A;  1I12 A;  4R9M A;  4UFV A;  2BSW A;  4M85 A;  1K4J A;  4ORF A;  2ARH A;  4E2A A;  1R57 A;  4IF5 A;  4B10 A;  4QB9 A;  1Q2Y A;  2Q04 A;  2YNC C;  3P2F A;  3TT2 A;  4AG7 A;  2HV2 A;  3KKW A;  3FXT A;  3UY5 A;  4K30 A;  2D4P A;  5AG5 A;  4UBR A;  2X7B A;  5AG7 A;  1YX0 A;  1S7F A;  2AE6 A;  3TO6 A;  4XPL A;  3NE7 A;  5AG6 A;  4CS0 B;  4QBJ A;  5C88 A;  5EBV A;  4E8O A;  4CAV A;  4U9Y A;  4L8A A;  5J8C A;  4MJ8 A;  2CXA A;  4MY0 A;  4CAE A;  4FD5 A;  2RC4 A;  3H5Z A;  5C82 A;  2FT0 A;  2B5G A;  3D3S A;  3EXN A;  3SXN A;  4AG9 A;  3W91 A;  4AVC A;  1Y9K A;  4CGM A;  3SXO A;  2FCK A;  1UFH A;  3IWG A;  4KOT A;  2H5M A;  4QUS A;  1S5K A;  2PQ8 A;  3PZJ A;  4B13 A;  3DR6 A;  2ZW7 A;  2OZH A;  3TOB A;  2ZPA A;  4JD6 A;  2QIR A;  2GAN A;  4NSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...