The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
46
|
sequence length |
135
|
structure length |
135
|
Chain Sequence |
DPFSRAKSLLKSTILHAERCKEFVGNMLEEYQDPAETTVQSLVPINTWGKSAKRKLQEEITSDPDWHQCPRKRAKMSYLAIIAGSIQDRDKKQTNVPRAFMLRGSQIEYDMKATRGLVVDTTNRIIVGGETVLRE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Comparative Structural and Functional Analysis of Orthomyxovirus Polymerase CAP-Snatching Domains.
pubmed doi rcsb |
| molecule tags |
Viral protein
|
| source organism |
Thogoto virus
|
| molecule keywords |
POLYMERASE ACIDIC PROTEIN
|
| total genus |
46
|
| structure length |
135
|
| sequence length |
135
|
| ec nomenclature | |
| pdb deposition date | 2013-12-01 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Zinc Finger, Delta Prime; domain 3 | Zinc Finger, Delta Prime; domain 3 |
#chains in the Genus database with same CATH superfamily 4CHD A; #chains in the Genus database with same CATH topology 3GLG A; 3BGE A; 3RC3 A; 1JQJ C; 1JR3 A; 3CTD A; 1SXJ C; 1XXH A; 3ZH9 B; 3GLG E; 1JR3 E; 1A5T A; 1SXJ D; 1XXH E; 3ES5 A; 1MW5 A; 1IQP A; 1SXJ B; 2R9G A; 2GNO A; 3GLH B; 3GLI B; 2CHQ A; 3GLF B; 1SXJ A; 1SXJ E; 4CHD A; 3GLI A; 3GLF A; 3U5Z B; 3GLH A; 3GLI E; 3GLF E; 3GLH E; 3U61 B; 2CHV A; 3U60 B; 1JR3 D; 3U5Z A; 3GLG B; 3PVS A; 2QW6 A; 1XXH B; 3U60 A; 3U61 A; 3RC8 A; #chains in the Genus database with same CATH homology 3GLG A; 3BGE A; 3RC3 A; 1JQJ C; 1JR3 A; 3CTD A; 1SXJ C; 1XXH A; 3ZH9 B; 3GLG E; 1JR3 E; 1A5T A; 1SXJ D; 1XXH E; 3ES5 A; 1MW5 A; 1IQP A; 1SXJ B; 2R9G A; 2GNO A; 3GLH B; 3GLI B; 2CHQ A; 3GLF B; 1SXJ A; 1SXJ E; 4CHD A; 3GLI A; 3GLF A; 3U5Z B; 3GLH A; 3GLI E; 3GLF E; 3GLH E; 3U61 B; 2CHV A; 3U60 B; 1JR3 D; 3U5Z A; 3GLG B; 3PVS A; 2QW6 A; 1XXH B; 3U60 A; 3U61 A; 3RC8 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
