4CHMA

Structure of inner membrane complex (imc) sub-compartment protein 1 (isp1) from toxoplasma gondii
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
SMASPQVTAADIEDLHRRLLAGMAVLVLLQDGTRLQCILHYNEADSSLSISCEDKVRVIPLSDIKALLHTRDQLQRVETKANLVDDESCVALHLLESGNCIPLRFDGVKDKTCFVDLLKKLKAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMC SUB-COMPARTMENT PROTEIN ISP1
publication title The Inner Membrane Complex Sub-Compartment Proteins Critical for Replication of the Apicomplexan Parasite Toxoplasma Gondii Adopt a Pleckstrin Homology Fold
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Cell cycle
total genus 35
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18161 ISP1_C ISP1 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4chmA00
4F7GA 2NMBA 3U7DA 1V5PA 3WA0A 1V61A 2CODA 3PP2A 3OANA 2I1JA 2LYDA 4NSWA 1H10A 3GYPA 1KZGA 3KRWA 2R0DA 2Z0OA 4HB3B 4HB2B 4GMVA 2DKPA 2RSGA 2VRWB 4EKUA 5C6RA 3PZDA 1V5UA 2CRFA 2I5FA 2W2WA 2H7EA 2DTCA 2NZ8B 2OQBA 4Z2NA 2DKQA 3LJUX 3ULCA 3TW1A 4PQ0A 1U5EA 1AQCA 2RNRB 3SV1A 1MK9B 2YVCA 3ODXA 1TXDA 1LB1A 2K00A 1MPHA 2H7DA 2COFA 4KVGB 2YSZA 2P0HA 2VKIA 1E5WA 3SYXA 4MT7A 2IFSA 4B6HA 3MDBC 2D11A 3D8DA 5J3TA 4A6HA 2N0YA 2YF0A 1QC6A 1SGHA 2ZPYA 2DHIA 2YS3A 2K2JA 1Y5OA 1X1FA 3DXEA 2EMSA 3CXBB 2KCJA 1XD4A 1UPRA 1UNPA 1M7RA 4IFSA 1P3RA 2GJYA 1NU2A 1M7EA 3KY9A 2J0JA 4IOYX 1U29A 2MDXA 3CIKA 2D4QA 1NTYA 2AL6A 5J3QA 2D9VA 2QKMA 4HHVA 2YS5A 1NI2A 4P7IA 2IYBA 2V76A 3V5WA 2K2UA 4NY0A 5HE3A 3SUZA 4Y94A 3PSCA 2GCJA 3G9WA 3UZTA 5GOWB 1WGUA 2D9WA 4HAYB 5CLQB 3ZDTA 1XCGA 5D3WA 3PVWA 2DYQA 1UEFA 1MIZB 1X11A 4KHOA 1J0WA 2DA0A 3D8FA 3ODWA 4C0AA 2DX1A 4A6KA 1I7AA 2EC1A 1WJMA 2DN6A 3AU4A 3HK0A 3P7ZA 3TFMA 5D3XA 2HTHB 1K5DB 5D3VA 5FI1A 2Y8GA 1BWNA 3M1IB 5C16A 4MK0A 4CYEA 5DHAB 2X18A 3BJIA 2HE7A 4HAVB 2MWNB 2OTXA 2D2QA 2L2IA 2Z0QA 2YS1A 1ZVRA 4A5KA 4IAPA 1FGYA 5KCVA 2P8VA 3QIJA 1ZC4B 4K2PA 1NTVA 4EMOA 5KQ1A 3F0WA 1DDVA 3T06A 3WYFB 3A98B 1KZ7A 3HW2B 2G35A 2E2XA 5JP4A 2Q13A 4HAUB 3KSYA 4HB4B 1Q67A 2W2XC 2DYNA 3N7CA 4WVFB 1KI1B 3FEHA 4ZRJA 2MFQA 3TO1A 3A8PA 1QQGA 3DXCA 1XX0A 1ZC3B 1Y19B 4TKNA 2R09A 1EGXA 4L6EA 1BTNA 1W1GA 2EJ8A 4KHAA 1X05A 4TYZA 4WSFA 2L1CA 2W2XD 5HE2A 5JHHA 1UNRA 5DHFB 1DROA 1DYNA 2RGNB 1X86A 5LOPB 1GC7A 2J59M 2D10A 1DBHA 2Y7BA 4MY6A 2LG1A 3O96A 3QBVB 3MPXA 4KHBB 2DHKA 2EMTA 2YRYA 2ROZB 2ELAA 5JLJB 2DX5A 1XODA 1X1GA 4GXBA 4A6FA 4XWXA 4WJ7A 1SHCA 1FB8A 4HDQA 2ELBA 2DLWA 4ZRIA 1OMWA 1XR0B 3AU5A 2RLOA 3TVVA 2YT1A 1MAIA 2N23A 5HE0A 4PNKA 4DX8A 4HAXB 1WG7A 1FAOA 2ADZA 1FGZA 3ODOA 4HDOA 1WJ1A 4K17A 5HE1A 3IVFA 4D0NB 4A6FB 1PLSA 1IRSA 2P0FA 1K5GB 1RRPB 1FHXA 3QWMA 2LULA 3BINA 1V5MA 4CHJA 4K81A 4F7HA 2GS0A 3RCPA 3ZVRA 2RUKB 3GYOA 1FOEA 3D8EA 4HAWB 2P0DA 4GZUA 5EFXA 4GMXB 1UPQA 5JHGA 2AEHA 3F5RA 1EVHA 1MIXA 2DHJA 3NSUA 1Z87A 2FJLA 2ROVA 4DBBA 1GC6A 4K2OA 2J0MA 5D27A 1I2HA 1WI1A 3ULBA 2UZRA 3VIAA 1U5DA 3A8QA 5LONB 1GG3A 1PMSA 2M14A 4F7UP 1WGQA 5CLLB 4YL8A 2I1KA 5DI9B 1U5FA 1V88A 5J3YA 4EJNA 4HB0B 2LOZA 4DX90 3SNHA 1FHWA 4YONA 3KRXA 3PEGA 2DFKA 5KQ4A 1PFJA 2D9ZA 1B55A 3TCAA 1TQZA 2BCJA 3PVLA 2QKLA 1EF1A 4H8SA 1ZM0A 1P5TA 4CHMA 2LKOA 4KAXB 1MK7B 2D9YA 3FM8C 2COCA 4BBKA 4GN1A 1OQNA 1EAZA 1U27A 2XQNM 5C5BA 1MKEA 2KUPA 4GPTB 4HATB 1J19A 3AJ4A 2GCLA 5D3YA 1BAKA 1WVHA 1ZSQA 2YT0A 5FI0A 1BTKA 3PVUA 1XKEA 1V89A 2VSZA 2COAA 3HQCA 1N3HA 2KGXB 1UNQA 2RVBB 1AWEA 1W1DA 3X23A 1W1HA 2D9XA 1RJ2A 3PG7A 1P6SA 5DIFB 2PZ1A 1U2BA 2J0KA 2JP2A 4Z2MB 2UZSA 5DH9B 4HAZB 2UVMA 1DDMA 2LOXA 5C5BB 5C79A 2M38A 3U8ZA 1TJ6A 2MKRA 2Y8FA 2Z0PA 3FSSA 3SO6A 3KZ1A 1H4RA 1ISNA 2CAYA 2CY4A 3VOQA 3DXDA 2CY5A 2I5CA 4DXAB 1OY2A 3ML4A 5L81A 1FHOA 1DDWA 1LW3A 3P6AA 4ZRKA 1U5GA
chains in the Genus database with same CATH superfamily
4F7GA 2NMBA 3U7DA 1V5PA 2Z14A 3WA0A 1V61A 2CODA 3PP2A 3OANA 2I1JA 2LYDA 4NSWA 1H10A 4QJ4B 3GYPA 1KZGA 3KRWA 2R0DA 2Z0OA 4HB3B 4HB2B 4GMVA 2DKPA 2RSGA 2VRWB 4EKUA 5C6RA 4GOUA 3PZDA 1V5UA 2ZKMX 2CRFA 2I5FA 2W2WA 2H7EA 2DTCA 2NZ8B 2OQBA 4Z2NA 2DKQA 3LJUX 3ULCA 3TW1A 4PQ0A 1U5EA 1AQCA 2RNRB 3SV1A 1MK9B 2YVCA 3ODXA 2Z59A 1TXDA 1LB1A 2K00A 4OSNA 1MPHA 2H7DA 2COFA 4KVGB 2YSZA 4OT1A 2P0HA 2VKIA 1E5WA 3SYXA 4MT7A 2IFSA 4B6HA 3MDBC 2D11A 3D8DA 3A58A 5J3TA 4A6HA 2N0YA 2YF0A 1QC6A 1SGHA 2ZPYA 2DHIA 2YS3A 4CSQA 2K2JA 1Y5OA 1X1FA 3DXEA 2EMSA 2KIGA 3CXBB 2KCJA 1XD4A 1UPRA 1UNPA 4D6WA 2FJUB 1M7RA 4IFSA 2YT2A 1P3RA 2GJYA 1NU2A 1M7EA 3KY9A 2J0JA 4IOYX 4HSIA 1U29A 2MDXA 3CIKA 4QXAB 2D4QA 2KIEA 1NTYA 2AL6A 5J3QA 2NBVA 2D9VA 2QKMA 4HHVA 2YS5A 1NI2A 4P7IA 2IYBA 2V76A 3V5WA 2K2UA 4NY0A 5HE3A 3DCXA 3SUZA 4Y94A 3PSCA 2GCJA 3G9WA 3UZTA 5GOWB 1WGUA 2D9WA 4HAYB 5CLQB 3ZDTA 1XCGA 5D3WA 3PVWA 2DYQA 1UEFA 1MIZB 1X11A 4KHOA 1J0WA 2DA0A 3D8FA 3ODWA 4C0AA 2DX1A 4A6KA 1I7AA 2EC1A 1WJMA 2DN6A 3AU4A 5I2MA 3HK0A 3P7ZA 3TFMA 4DIXA 5D3XA 2HTHB 1K5DB 5D3VA 5FI1A 2Y8GA 1BWNA 3M1IB 5C16A 4MK0A 4CYEA 3NW8A 5DHAB 2X18A 3BJIA 2HE7A 4HAVB 2MWNB 2OTXA 1MI1A 2D2QA 2L2IA 2Z0QA 2YS1A 1ZVRA 4A5KA 4IAPA 1FGYA 5KCVA 5M4YB 2P8VA 3QIJA 1ZC4B 4K2PA 1NTVA 4EMOA 5KQ1A 3F0WA 1DDVA 3T06A 3WYFB 3A98B 1KZ7A 3HW2B 2G35A 2E2XA 5JP4A 2Q13A 4HAUB 3KSYA 4HB4B 1Q67A 2W2XC 2DYNA 3N7CA 4WVFB 1KI1B 3FEHA 4ZRJA 2MFQA 3TO1A 3A8PA 1QQGA 1ZYIA 3DXCA 1XX0A 3B77A 1ZC3B 1Y19B 4TKNA 2R09A 1EGXA 4KHBA 4L6EA 1BTNA 1W1GA 2EJ8A 4KHAA 3NWAA 1X05A 4TYZA 4WSFA 2L1CA 2W2XD 5HE2A 2K49A 3HIEA 5JHHA 1UNRA 5DHFB 1DROA 1DYNA 2RGNB 1X86A 5LOPB 1GC7A 2J59M 2D10A 1DBHA 2R2YA 2Y7BA 4MY6A 2LG1A 3O96A 3QBVB 3MPXA 4KHBB 2DHKA 2EMTA 2YRYA 2ROZB 2ELAA 5JLJB 2DX5A 1XODA 1X1GA 4GXBA 4A6FA 4XWXA 4WJ7A 1SHCA 1FB8A 4HDQA 2ELBA 2DLWA 4ZRIA 1OMWA 1XR0B 3AU5A 2RLOA 3TVVA 2YT1A 1MAIA 2N23A 5HE0A 4PNKA 4DX8A 4HAXB 1WG7A 1FAOA 2ADZA 1FGZA 3ODOA 4HDOA 1WJ1A 4K17A 5HE1A 3IVFA 4D0NB 4A6FB 1T77A 1PLSA 1IRSA 2P0FA 1K5GB 1RRPB 1FHXA 3QWMA 2LULA 3BINA 1V5MA 4CHJA 4K81A 3NWDA 2GS0A 4F7HA 3RCPA 3ZVRA 2RUKB 3GYOA 1FOEA 3D8EA 4HAWB 2P0DA 4GZUA 5EFXA 2RRFA 4GMXB 4QJ3B 1UPQA 2K8EA 5JHGA 2AEHA 3F5RA 1EVHA 1MIXA 2DHJA 3NSUA 1Z87A 2FJLA 2GUMA 2ROVA 4DBBA 1GC6A 3FVCA 4K2OA 2J0MA 5D27A 1I2HA 4QJ5B 1WI1A 3ULBA 2UZRA 3VIAA 1U5DA 3A8QA 5LONB 1GG3A 1PMSA 2M14A 4F7UP 1WGQA 5CLLB 3HSAA 4GNKB 4YL8A 2I1KA 5DI9B 1U5FA 1V88A 5J3YA 4EJNA 4HB0B 2LOZA 4DX90 3SNHA 1FHWA 4YONA 3KRXA 3PEGA 2DFKA 5KQ4A 1PFJA 2D9ZA 1B55A 3TCAA 1TQZA 2BCJA 3PVLA 2Z13A 2QKLA 1EF1A 4H8SA 1ZM0A 1P5TA 4CHMA 2LKOA 4KAXB 1MK7B 2D9YA 3FM8C 2COCA 4BBKA 4GN1A 1OQNA 1EAZA 1U27A 2XQNM 5C5BA 1MKEA 2KUPA 4GPTB 4HATB 1J19A 3AJ4A 2GCLA 5D3YA 5IRSA 1BAKA 1WVHA 1ZSQA 2YT0A 5FI0A 1BTKA 3PVUA 1XKEA 1V89A 2VSZA 2COAA 3HQCA 1N3HA 2KGXB 1UNQA 2RVBB 1AWEA 1W1DA 3X23A 1W1HA 3OHMB 2D9XA 1RJ2A 3PG7A 1P6SA 5DIFB 2PZ1A 4L1RA 1U2BA 2J0KA 2JP2A 4Z2MB 2UZSA 5DH9B 4HAZB 2UVMA 1DDMA 2LOXA 5C5BB 5C79A 2M38A 3U8ZA 1TJ6A 5LG4B 2MKRA 2Y8FA 2Z0PA 3FSSA 3SO6A 3KZ1A 1H4RA 1ISNA 2CAYA 2Z4DA 2CY4A 3U12A 3VOQA 2KR0A 3DXDA 2CY5A 2I5CA 4DXAB 1OY2A 3ML4A 5I2SA 2KUQA 5L81A 1FHOA 3NWFA 1DDWA 1LW3A 3P6AA 4ZRKA 1U5GA
chains in the Genus database with same CATH topology
4F7GA 2NMBA 3U7DA 1V5PA 3WA0A 1V61A 2CODA 3PP2A 3OANA 2I1JA 2LYDA 4NSWA 1H10A 3GYPA 1KZGA 3KRWA 2R0DA 2Z0OA 4HB3B 4HB2B 4GMVA 2DKPA 2RSGA 2VRWB 4EKUA 5C6RA 3PZDA 1V5UA 2CRFA 2I5FA 2W2WA 2H7EA 2DTCA 2NZ8B 2OQBA 4Z2NA 2DKQA 3LJUX 3ULCA 3TW1A 4PQ0A 1U5EA 1AQCA 2RNRB 3SV1A 1MK9B 2YVCA 3ODXA 1TXDA 1LB1A 2K00A 1MPHA 2H7DA 2COFA 4KVGB 2YSZA 2P0HA 2VKIA 1E5WA 3SYXA 4MT7A 2IFSA 4B6HA 3MDBC 2D11A 3D8DA 5J3TA 4A6HA 2N0YA 2YF0A 1QC6A 1SGHA 2ZPYA 2DHIA 2YS3A 2K2JA 1Y5OA 1X1FA 3DXEA 2EMSA 3CXBB 2KCJA 1XD4A 1UPRA 1UNPA 1M7RA 4IFSA 1P3RA 2GJYA 1NU2A 1M7EA 3KY9A 2J0JA 4IOYX 1U29A 2MDXA 3CIKA 2D4QA 1NTYA 2AL6A 5J3QA 2D9VA 2QKMA 4HHVA 2YS5A 1NI2A 4P7IA 2IYBA 2V76A 3V5WA 2K2UA 4NY0A 5HE3A 3SUZA 4Y94A 3PSCA 2GCJA 3G9WA 3UZTA 5GOWB 1WGUA 2D9WA 4HAYB 5CLQB 3ZDTA 1XCGA 5D3WA 3PVWA 2DYQA 1UEFA 1MIZB 1X11A 4KHOA 1J0WA 2DA0A 3D8FA 3ODWA 4C0AA 2DX1A 4A6KA 1I7AA 2EC1A 1WJMA 2DN6A 3AU4A 3HK0A 3P7ZA 3TFMA 5D3XA 2HTHB 1K5DB 5D3VA 5FI1A 2Y8GA 1BWNA 3M1IB 5C16A 4MK0A 4CYEA 5DHAB 2X18A 3BJIA 2HE7A 4HAVB 2MWNB 2OTXA 2D2QA 2L2IA 2Z0QA 2YS1A 1ZVRA 4A5KA 4IAPA 1FGYA 5KCVA 2P8VA 3QIJA 1ZC4B 4K2PA 1NTVA 4EMOA 5KQ1A 3F0WA 1DDVA 3T06A 3WYFB 3A98B 1KZ7A 3HW2B 2G35A 2E2XA 5JP4A 2Q13A 4HAUB 3KSYA 4HB4B 1Q67A 2W2XC 2DYNA 3N7CA 4WVFB 1KI1B 3FEHA 4ZRJA 2MFQA 3TO1A 3A8PA 1QQGA 3DXCA 1XX0A 1ZC3B 1Y19B 4TKNA 2R09A 1EGXA 4L6EA 1BTNA 1W1GA 2EJ8A 4KHAA 1X05A 4TYZA 4WSFA 2L1CA 2W2XD 5HE2A 5JHHA 1UNRA 5DHFB 1DROA 1DYNA 2RGNB 1X86A 5LOPB 1GC7A 2J59M 2D10A 1DBHA 2Y7BA 4MY6A 2LG1A 3O96A 3QBVB 3MPXA 4KHBB 2DHKA 2EMTA 2YRYA 2ROZB 2ELAA 5JLJB 2DX5A 1XODA 1X1GA 4GXBA 4A6FA 4XWXA 4WJ7A 1SHCA 1FB8A 4HDQA 2ELBA 2DLWA 4ZRIA 1OMWA 1XR0B 3AU5A 2RLOA 3TVVA 2YT1A 1MAIA 2N23A 5HE0A 4PNKA 4DX8A 4HAXB 1WG7A 1FAOA 2ADZA 1FGZA 3ODOA 4HDOA 1WJ1A 4K17A 5HE1A 3IVFA 4D0NB 4A6FB 1PLSA 1IRSA 2P0FA 1K5GB 1RRPB 1FHXA 3QWMA 2LULA 3BINA 1V5MA 4CHJA 4K81A 4F7HA 2GS0A 3RCPA 3ZVRA 2RUKB 3GYOA 1FOEA 3D8EA 4HAWB 2P0DA 4GZUA 5EFXA 4GMXB 1UPQA 5JHGA 2AEHA 3F5RA 1EVHA 1MIXA 2DHJA 3NSUA 1Z87A 2FJLA 2ROVA 4DBBA 1GC6A 4K2OA 2J0MA 5D27A 1I2HA 1WI1A 3ULBA 2UZRA 3VIAA 1U5DA 3A8QA 5LONB 1GG3A 1PMSA 2M14A 4F7UP 1WGQA 5CLLB 4YL8A 2I1KA 5DI9B 1U5FA 1V88A 5J3YA 4EJNA 4HB0B 2LOZA 4DX90 3SNHA 1FHWA 4YONA 3KRXA 3PEGA 2DFKA 5KQ4A 1PFJA 2D9ZA 1B55A 3TCAA 1TQZA 2BCJA 3PVLA 2QKLA 1EF1A 4H8SA 1ZM0A 1P5TA 4CHMA 2LKOA 4KAXB 1MK7B 2D9YA 3FM8C 2COCA 4BBKA 4GN1A 1OQNA 1EAZA 1U27A 2XQNM 5C5BA 1MKEA 2KUPA 4GPTB 4HATB 1J19A 3AJ4A 2GCLA 5D3YA 1BAKA 1WVHA 1ZSQA 2YT0A 5FI0A 1BTKA 3PVUA 1XKEA 1V89A 2VSZA 2COAA 3HQCA 1N3HA 2KGXB 1UNQA 2RVBB 1AWEA 1W1DA 3X23A 1W1HA 2D9XA 1RJ2A 3PG7A 1P6SA 5DIFB 2PZ1A 1U2BA 2J0KA 2JP2A 4Z2MB 2UZSA 5DH9B 4HAZB 2UVMA 1DDMA 2LOXA 5C5BB 5C79A 2M38A 3U8ZA 1TJ6A 2MKRA 2Y8FA 2Z0PA 3FSSA 3SO6A 3KZ1A 1H4RA 1ISNA 2CAYA 2CY4A 3VOQA 3DXDA 2CY5A 2I5CA 4DXAB 1OY2A 3ML4A 5L81A 1FHOA 1DDWA 1LW3A 3P6AA 4ZRKA 1U5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7G A;  2NMB A;  3U7D A;  1V5P A;  3WA0 A;  1V61 A;  2COD A;  3PP2 A;  3OAN A;  2I1J A;  2LYD A;  4NSW A;  1H10 A;  3GYP A;  1KZG A;  3KRW A;  2R0D A;  2Z0O A;  4HB3 B;  4HB2 B;  4GMV A;  2DKP A;  2RSG A;  2VRW B;  4EKU A;  5C6R A;  3PZD A;  1V5U A;  2CRF A;  2I5F A;  2W2W A;  2H7E A;  2DTC A;  2NZ8 B;  2OQB A;  4Z2N A;  2DKQ A;  3LJU X;  3ULC A;  3TW1 A;  4PQ0 A;  1U5E A;  1AQC A;  2RNR B;  3SV1 A;  1MK9 B;  2YVC A;  3ODX A;  1TXD A;  1LB1 A;  2K00 A;  1MPH A;  2H7D A;  2COF A;  4KVG B;  2YSZ A;  2P0H A;  2VKI A;  1E5W A;  3SYX A;  4MT7 A;  2IFS A;  4B6H A;  3MDB C;  2D11 A;  3D8D A;  5J3T A;  4A6H A;  2N0Y A;  2YF0 A;  1QC6 A;  1SGH A;  2ZPY A;  2DHI A;  2YS3 A;  2K2J A;  1Y5O A;  1X1F A;  3DXE A;  2EMS A;  3CXB B;  2KCJ A;  1XD4 A;  1UPR A;  1UNP A;  1M7R A;  4IFS A;  1P3R A;  2GJY A;  1NU2 A;  1M7E A;  3KY9 A;  2J0J A;  4IOY X;  1U29 A;  2MDX A;  3CIK A;  2D4Q A;  1NTY A;  2AL6 A;  5J3Q A;  2D9V A;  2QKM A;  4HHV A;  2YS5 A;  1NI2 A;  4P7I A;  2IYB A;  2V76 A;  3V5W A;  2K2U A;  4NY0 A;  5HE3 A;  3SUZ A;  4Y94 A;  3PSC A;  2GCJ A;  3G9W A;  3UZT A;  5GOW B;  1WGU A;  2D9W A;  4HAY B;  5CLQ B;  3ZDT A;  1XCG A;  5D3W A;  3PVW A;  2DYQ A;  1UEF A;  1MIZ B;  1X11 A;  4KHO A;  1J0W A;  2DA0 A;  3D8F A;  3ODW A;  4C0A A;  2DX1 A;  4A6K A;  1I7A A;  2EC1 A;  1WJM A;  2DN6 A;  3AU4 A;  3HK0 A;  3P7Z A;  3TFM A;  5D3X A;  2HTH B;  1K5D B;  5D3V A;  5FI1 A;  2Y8G A;  1BWN A;  3M1I B;  5C16 A;  4MK0 A;  4CYE A;  5DHA B;  2X18 A;  3BJI A;  2HE7 A;  4HAV B;  2MWN B;  2OTX A;  2D2Q A;  2L2I A;  2Z0Q A;  2YS1 A;  1ZVR A;  4A5K A;  4IAP A;  1FGY A;  5KCV A;  2P8V A;  3QIJ A;  1ZC4 B;  4K2P A;  1NTV A;  4EMO A;  5KQ1 A;  3F0W A;  1DDV A;  3T06 A;  3WYF B;  3A98 B;  1KZ7 A;  3HW2 B;  2G35 A;  2E2X A;  5JP4 A;  2Q13 A;  4HAU B;  3KSY A;  4HB4 B;  1Q67 A;  2W2X C;  2DYN A;  3N7C A;  4WVF B;  1KI1 B;  3FEH A;  4ZRJ A;  2MFQ A;  3TO1 A;  3A8P A;  1QQG A;  3DXC A;  1XX0 A;  1ZC3 B;  1Y19 B;  4TKN A;  2R09 A;  1EGX A;  4L6E A;  1BTN A;  1W1G A;  2EJ8 A;  4KHA A;  1X05 A;  4TYZ A;  4WSF A;  2L1C A;  2W2X D;  5HE2 A;  5JHH A;  1UNR A;  5DHF B;  1DRO A;  1DYN A;  2RGN B;  1X86 A;  5LOP B;  1GC7 A;  2J59 M;  2D10 A;  1DBH A;  2Y7B A;  4MY6 A;  2LG1 A;  3O96 A;  3QBV B;  3MPX A;  4KHB B;  2DHK A;  2EMT A;  2YRY A;  2ROZ B;  2ELA A;  5JLJ B;  2DX5 A;  1XOD A;  1X1G A;  4GXB A;  4A6F A;  4XWX A;  4WJ7 A;  1SHC A;  1FB8 A;  4HDQ A;  2ELB A;  2DLW A;  4ZRI A;  1OMW A;  1XR0 B;  3AU5 A;  2RLO A;  3TVV A;  2YT1 A;  1MAI A;  2N23 A;  5HE0 A;  4PNK A;  4DX8 A;  4HAX B;  1WG7 A;  1FAO A;  2ADZ A;  1FGZ A;  3ODO A;  4HDO A;  1WJ1 A;  4K17 A;  5HE1 A;  3IVF A;  4D0N B;  4A6F B;  1PLS A;  1IRS A;  2P0F A;  1K5G B;  1RRP B;  1FHX A;  3QWM A;  2LUL A;  3BIN A;  1V5M A;  4CHJ A;  4K81 A;  4F7H A;  2GS0 A;  3RCP A;  3ZVR A;  2RUK B;  3GYO A;  1FOE A;  3D8E A;  4HAW B;  2P0D A;  4GZU A;  5EFX A;  4GMX B;  1UPQ A;  5JHG A;  2AEH A;  3F5R A;  1EVH A;  1MIX A;  2DHJ A;  3NSU A;  1Z87 A;  2FJL A;  2ROV A;  4DBB A;  1GC6 A;  4K2O A;  2J0M A;  5D27 A;  1I2H A;  1WI1 A;  3ULB A;  2UZR A;  3VIA A;  1U5D A;  3A8Q A;  5LON B;  1GG3 A;  1PMS A;  2M14 A;  4F7U P;  1WGQ A;  5CLL B;  4YL8 A;  2I1K A;  5DI9 B;  1U5F A;  1V88 A;  5J3Y A;  4EJN A;  4HB0 B;  2LOZ A;  4DX9 0;  3SNH A;  1FHW A;  4YON A;  3KRX A;  3PEG A;  2DFK A;  5KQ4 A;  1PFJ A;  2D9Z A;  1B55 A;  3TCA A;  1TQZ A;  2BCJ A;  3PVL A;  2QKL A;  1EF1 A;  4H8S A;  1ZM0 A;  1P5T A;  4CHM A;  2LKO A;  4KAX B;  1MK7 B;  2D9Y A;  3FM8 C;  2COC A;  4BBK A;  4GN1 A;  1OQN A;  1EAZ A;  1U27 A;  2XQN M;  5C5B A;  1MKE A;  2KUP A;  4GPT B;  4HAT B;  1J19 A;  3AJ4 A;  2GCL A;  5D3Y A;  1BAK A;  1WVH A;  1ZSQ A;  2YT0 A;  5FI0 A;  1BTK A;  3PVU A;  1XKE A;  1V89 A;  2VSZ A;  2COA A;  3HQC A;  1N3H A;  2KGX B;  1UNQ A;  2RVB B;  1AWE A;  1W1D A;  3X23 A;  1W1H A;  2D9X A;  1RJ2 A;  3PG7 A;  1P6S A;  5DIF B;  2PZ1 A;  1U2B A;  2J0K A;  2JP2 A;  4Z2M B;  2UZS A;  5DH9 B;  4HAZ B;  2UVM A;  1DDM A;  2LOX A;  5C5B B;  5C79 A;  2M38 A;  3U8Z A;  1TJ6 A;  2MKR A;  2Y8F A;  2Z0P A;  3FSS A;  3SO6 A;  3KZ1 A;  1H4R A;  1ISN A;  2CAY A;  2CY4 A;  3VOQ A;  3DXD A;  2CY5 A;  2I5C A;  4DXA B;  1OY2 A;  3ML4 A;  5L81 A;  1FHO A;  1DDW A;  1LW3 A;  3P6A A;  4ZRK A;  1U5G A; 
#chains in the Genus database with same CATH topology
 4F7G A;  2NMB A;  3U7D A;  1V5P A;  2Z14 A;  3WA0 A;  1V61 A;  2COD A;  3PP2 A;  3OAN A;  2I1J A;  2LYD A;  4NSW A;  1H10 A;  4QJ4 B;  3GYP A;  1KZG A;  3KRW A;  2R0D A;  2Z0O A;  4HB3 B;  4HB2 B;  4GMV A;  2DKP A;  2RSG A;  2VRW B;  4EKU A;  5C6R A;  4GOU A;  3PZD A;  1V5U A;  2ZKM X;  2CRF A;  2I5F A;  2W2W A;  2H7E A;  2DTC A;  2NZ8 B;  2OQB A;  4Z2N A;  2DKQ A;  3LJU X;  3ULC A;  3TW1 A;  4PQ0 A;  1U5E A;  1AQC A;  2RNR B;  3SV1 A;  1MK9 B;  2YVC A;  3ODX A;  2Z59 A;  1TXD A;  1LB1 A;  2K00 A;  4OSN A;  1MPH A;  2H7D A;  2COF A;  4KVG B;  2YSZ A;  4OT1 A;  2P0H A;  2VKI A;  1E5W A;  3SYX A;  4MT7 A;  2IFS A;  4B6H A;  3MDB C;  2D11 A;  3D8D A;  3A58 A;  5J3T A;  4A6H A;  2N0Y A;  2YF0 A;  1QC6 A;  1SGH A;  2ZPY A;  2DHI A;  2YS3 A;  4CSQ A;  2K2J A;  1Y5O A;  1X1F A;  3DXE A;  2EMS A;  2KIG A;  3CXB B;  2KCJ A;  1XD4 A;  1UPR A;  1UNP A;  4D6W A;  2FJU B;  1M7R A;  4IFS A;  2YT2 A;  1P3R A;  2GJY A;  1NU2 A;  1M7E A;  3KY9 A;  2J0J A;  4IOY X;  4HSI A;  1U29 A;  2MDX A;  3CIK A;  4QXA B;  2D4Q A;  2KIE A;  1NTY A;  2AL6 A;  5J3Q A;  2NBV A;  2D9V A;  2QKM A;  4HHV A;  2YS5 A;  1NI2 A;  4P7I A;  2IYB A;  2V76 A;  3V5W A;  2K2U A;  4NY0 A;  5HE3 A;  3DCX A;  3SUZ A;  4Y94 A;  3PSC A;  2GCJ A;  3G9W A;  3UZT A;  5GOW B;  1WGU A;  2D9W A;  4HAY B;  5CLQ B;  3ZDT A;  1XCG A;  5D3W A;  3PVW A;  2DYQ A;  1UEF A;  1MIZ B;  1X11 A;  4KHO A;  1J0W A;  2DA0 A;  3D8F A;  3ODW A;  4C0A A;  2DX1 A;  4A6K A;  1I7A A;  2EC1 A;  1WJM A;  2DN6 A;  3AU4 A;  5I2M A;  3HK0 A;  3P7Z A;  3TFM A;  4DIX A;  5D3X A;  2HTH B;  1K5D B;  5D3V A;  5FI1 A;  2Y8G A;  1BWN A;  3M1I B;  5C16 A;  4MK0 A;  4CYE A;  3NW8 A;  5DHA B;  2X18 A;  3BJI A;  2HE7 A;  4HAV B;  2MWN B;  2OTX A;  1MI1 A;  2D2Q A;  2L2I A;  2Z0Q A;  2YS1 A;  1ZVR A;  4A5K A;  4IAP A;  1FGY A;  5KCV A;  5M4Y B;  2P8V A;  3QIJ A;  1ZC4 B;  4K2P A;  1NTV A;  4EMO A;  5KQ1 A;  3F0W A;  1DDV A;  3T06 A;  3WYF B;  3A98 B;  1KZ7 A;  3HW2 B;  2G35 A;  2E2X A;  5JP4 A;  2Q13 A;  4HAU B;  3KSY A;  4HB4 B;  1Q67 A;  2W2X C;  2DYN A;  3N7C A;  4WVF B;  1KI1 B;  3FEH A;  4ZRJ A;  2MFQ A;  3TO1 A;  3A8P A;  1QQG A;  1ZYI A;  3DXC A;  1XX0 A;  3B77 A;  1ZC3 B;  1Y19 B;  4TKN A;  2R09 A;  1EGX A;  4KHB A;  4L6E A;  1BTN A;  1W1G A;  2EJ8 A;  4KHA A;  3NWA A;  1X05 A;  4TYZ A;  4WSF A;  2L1C A;  2W2X D;  5HE2 A;  2K49 A;  3HIE A;  5JHH A;  1UNR A;  5DHF B;  1DRO A;  1DYN A;  2RGN B;  1X86 A;  5LOP B;  1GC7 A;  2J59 M;  2D10 A;  1DBH A;  2R2Y A;  2Y7B A;  4MY6 A;  2LG1 A;  3O96 A;  3QBV B;  3MPX A;  4KHB B;  2DHK A;  2EMT A;  2YRY A;  2ROZ B;  2ELA A;  5JLJ B;  2DX5 A;  1XOD A;  1X1G A;  4GXB A;  4A6F A;  4XWX A;  4WJ7 A;  1SHC A;  1FB8 A;  4HDQ A;  2ELB A;  2DLW A;  4ZRI A;  1OMW A;  1XR0 B;  3AU5 A;  2RLO A;  3TVV A;  2YT1 A;  1MAI A;  2N23 A;  5HE0 A;  4PNK A;  4DX8 A;  4HAX B;  1WG7 A;  1FAO A;  2ADZ A;  1FGZ A;  3ODO A;  4HDO A;  1WJ1 A;  4K17 A;  5HE1 A;  3IVF A;  4D0N B;  4A6F B;  1T77 A;  1PLS A;  1IRS A;  2P0F A;  1K5G B;  1RRP B;  1FHX A;  3QWM A;  2LUL A;  3BIN A;  1V5M A;  4CHJ A;  4K81 A;  3NWD A;  2GS0 A;  4F7H A;  3RCP A;  3ZVR A;  2RUK B;  3GYO A;  1FOE A;  3D8E A;  4HAW B;  2P0D A;  4GZU A;  5EFX A;  2RRF A;  4GMX B;  4QJ3 B;  1UPQ A;  2K8E A;  5JHG A;  2AEH A;  3F5R A;  1EVH A;  1MIX A;  2DHJ A;  3NSU A;  1Z87 A;  2FJL A;  2GUM A;  2ROV A;  4DBB A;  1GC6 A;  3FVC A;  4K2O A;  2J0M A;  5D27 A;  1I2H A;  4QJ5 B;  1WI1 A;  3ULB A;  2UZR A;  3VIA A;  1U5D A;  3A8Q A;  5LON B;  1GG3 A;  1PMS A;  2M14 A;  4F7U P;  1WGQ A;  5CLL B;  3HSA A;  4GNK B;  4YL8 A;  2I1K A;  5DI9 B;  1U5F A;  1V88 A;  5J3Y A;  4EJN A;  4HB0 B;  2LOZ A;  4DX9 0;  3SNH A;  1FHW A;  4YON A;  3KRX A;  3PEG A;  2DFK A;  5KQ4 A;  1PFJ A;  2D9Z A;  1B55 A;  3TCA A;  1TQZ A;  2BCJ A;  3PVL A;  2Z13 A;  2QKL A;  1EF1 A;  4H8S A;  1ZM0 A;  1P5T A;  4CHM A;  2LKO A;  4KAX B;  1MK7 B;  2D9Y A;  3FM8 C;  2COC A;  4BBK A;  4GN1 A;  1OQN A;  1EAZ A;  1U27 A;  2XQN M;  5C5B A;  1MKE A;  2KUP A;  4GPT B;  4HAT B;  1J19 A;  3AJ4 A;  2GCL A;  5D3Y A;  5IRS A;  1BAK A;  1WVH A;  1ZSQ A;  2YT0 A;  5FI0 A;  1BTK A;  3PVU A;  1XKE A;  1V89 A;  2VSZ A;  2COA A;  3HQC A;  1N3H A;  2KGX B;  1UNQ A;  2RVB B;  1AWE A;  1W1D A;  3X23 A;  1W1H A;  3OHM B;  2D9X A;  1RJ2 A;  3PG7 A;  1P6S A;  5DIF B;  2PZ1 A;  4L1R A;  1U2B A;  2J0K A;  2JP2 A;  4Z2M B;  2UZS A;  5DH9 B;  4HAZ B;  2UVM A;  1DDM A;  2LOX A;  5C5B B;  5C79 A;  2M38 A;  3U8Z A;  1TJ6 A;  5LG4 B;  2MKR A;  2Y8F A;  2Z0P A;  3FSS A;  3SO6 A;  3KZ1 A;  1H4R A;  1ISN A;  2CAY A;  2Z4D A;  2CY4 A;  3U12 A;  3VOQ A;  2KR0 A;  3DXD A;  2CY5 A;  2I5C A;  4DXA B;  1OY2 A;  3ML4 A;  5I2S A;  2KUQ A;  5L81 A;  1FHO A;  3NWF A;  1DDW A;  1LW3 A;  3P6A A;  4ZRK A;  1U5G A; 
#chains in the Genus database with same CATH homology
 4F7G A;  2NMB A;  3U7D A;  1V5P A;  3WA0 A;  1V61 A;  2COD A;  3PP2 A;  3OAN A;  2I1J A;  2LYD A;  4NSW A;  1H10 A;  3GYP A;  1KZG A;  3KRW A;  2R0D A;  2Z0O A;  4HB3 B;  4HB2 B;  4GMV A;  2DKP A;  2RSG A;  2VRW B;  4EKU A;  5C6R A;  3PZD A;  1V5U A;  2CRF A;  2I5F A;  2W2W A;  2H7E A;  2DTC A;  2NZ8 B;  2OQB A;  4Z2N A;  2DKQ A;  3LJU X;  3ULC A;  3TW1 A;  4PQ0 A;  1U5E A;  1AQC A;  2RNR B;  3SV1 A;  1MK9 B;  2YVC A;  3ODX A;  1TXD A;  1LB1 A;  2K00 A;  1MPH A;  2H7D A;  2COF A;  4KVG B;  2YSZ A;  2P0H A;  2VKI A;  1E5W A;  3SYX A;  4MT7 A;  2IFS A;  4B6H A;  3MDB C;  2D11 A;  3D8D A;  5J3T A;  4A6H A;  2N0Y A;  2YF0 A;  1QC6 A;  1SGH A;  2ZPY A;  2DHI A;  2YS3 A;  2K2J A;  1Y5O A;  1X1F A;  3DXE A;  2EMS A;  3CXB B;  2KCJ A;  1XD4 A;  1UPR A;  1UNP A;  1M7R A;  4IFS A;  1P3R A;  2GJY A;  1NU2 A;  1M7E A;  3KY9 A;  2J0J A;  4IOY X;  1U29 A;  2MDX A;  3CIK A;  2D4Q A;  1NTY A;  2AL6 A;  5J3Q A;  2D9V A;  2QKM A;  4HHV A;  2YS5 A;  1NI2 A;  4P7I A;  2IYB A;  2V76 A;  3V5W A;  2K2U A;  4NY0 A;  5HE3 A;  3SUZ A;  4Y94 A;  3PSC A;  2GCJ A;  3G9W A;  3UZT A;  5GOW B;  1WGU A;  2D9W A;  4HAY B;  5CLQ B;  3ZDT A;  1XCG A;  5D3W A;  3PVW A;  2DYQ A;  1UEF A;  1MIZ B;  1X11 A;  4KHO A;  1J0W A;  2DA0 A;  3D8F A;  3ODW A;  4C0A A;  2DX1 A;  4A6K A;  1I7A A;  2EC1 A;  1WJM A;  2DN6 A;  3AU4 A;  3HK0 A;  3P7Z A;  3TFM A;  5D3X A;  2HTH B;  1K5D B;  5D3V A;  5FI1 A;  2Y8G A;  1BWN A;  3M1I B;  5C16 A;  4MK0 A;  4CYE A;  5DHA B;  2X18 A;  3BJI A;  2HE7 A;  4HAV B;  2MWN B;  2OTX A;  2D2Q A;  2L2I A;  2Z0Q A;  2YS1 A;  1ZVR A;  4A5K A;  4IAP A;  1FGY A;  5KCV A;  2P8V A;  3QIJ A;  1ZC4 B;  4K2P A;  1NTV A;  4EMO A;  5KQ1 A;  3F0W A;  1DDV A;  3T06 A;  3WYF B;  3A98 B;  1KZ7 A;  3HW2 B;  2G35 A;  2E2X A;  5JP4 A;  2Q13 A;  4HAU B;  3KSY A;  4HB4 B;  1Q67 A;  2W2X C;  2DYN A;  3N7C A;  4WVF B;  1KI1 B;  3FEH A;  4ZRJ A;  2MFQ A;  3TO1 A;  3A8P A;  1QQG A;  3DXC A;  1XX0 A;  1ZC3 B;  1Y19 B;  4TKN A;  2R09 A;  1EGX A;  4L6E A;  1BTN A;  1W1G A;  2EJ8 A;  4KHA A;  1X05 A;  4TYZ A;  4WSF A;  2L1C A;  2W2X D;  5HE2 A;  5JHH A;  1UNR A;  5DHF B;  1DRO A;  1DYN A;  2RGN B;  1X86 A;  5LOP B;  1GC7 A;  2J59 M;  2D10 A;  1DBH A;  2Y7B A;  4MY6 A;  2LG1 A;  3O96 A;  3QBV B;  3MPX A;  4KHB B;  2DHK A;  2EMT A;  2YRY A;  2ROZ B;  2ELA A;  5JLJ B;  2DX5 A;  1XOD A;  1X1G A;  4GXB A;  4A6F A;  4XWX A;  4WJ7 A;  1SHC A;  1FB8 A;  4HDQ A;  2ELB A;  2DLW A;  4ZRI A;  1OMW A;  1XR0 B;  3AU5 A;  2RLO A;  3TVV A;  2YT1 A;  1MAI A;  2N23 A;  5HE0 A;  4PNK A;  4DX8 A;  4HAX B;  1WG7 A;  1FAO A;  2ADZ A;  1FGZ A;  3ODO A;  4HDO A;  1WJ1 A;  4K17 A;  5HE1 A;  3IVF A;  4D0N B;  4A6F B;  1PLS A;  1IRS A;  2P0F A;  1K5G B;  1RRP B;  1FHX A;  3QWM A;  2LUL A;  3BIN A;  1V5M A;  4CHJ A;  4K81 A;  4F7H A;  2GS0 A;  3RCP A;  3ZVR A;  2RUK B;  3GYO A;  1FOE A;  3D8E A;  4HAW B;  2P0D A;  4GZU A;  5EFX A;  4GMX B;  1UPQ A;  5JHG A;  2AEH A;  3F5R A;  1EVH A;  1MIX A;  2DHJ A;  3NSU A;  1Z87 A;  2FJL A;  2ROV A;  4DBB A;  1GC6 A;  4K2O A;  2J0M A;  5D27 A;  1I2H A;  1WI1 A;  3ULB A;  2UZR A;  3VIA A;  1U5D A;  3A8Q A;  5LON B;  1GG3 A;  1PMS A;  2M14 A;  4F7U P;  1WGQ A;  5CLL B;  4YL8 A;  2I1K A;  5DI9 B;  1U5F A;  1V88 A;  5J3Y A;  4EJN A;  4HB0 B;  2LOZ A;  4DX9 0;  3SNH A;  1FHW A;  4YON A;  3KRX A;  3PEG A;  2DFK A;  5KQ4 A;  1PFJ A;  2D9Z A;  1B55 A;  3TCA A;  1TQZ A;  2BCJ A;  3PVL A;  2QKL A;  1EF1 A;  4H8S A;  1ZM0 A;  1P5T A;  4CHM A;  2LKO A;  4KAX B;  1MK7 B;  2D9Y A;  3FM8 C;  2COC A;  4BBK A;  4GN1 A;  1OQN A;  1EAZ A;  1U27 A;  2XQN M;  5C5B A;  1MKE A;  2KUP A;  4GPT B;  4HAT B;  1J19 A;  3AJ4 A;  2GCL A;  5D3Y A;  1BAK A;  1WVH A;  1ZSQ A;  2YT0 A;  5FI0 A;  1BTK A;  3PVU A;  1XKE A;  1V89 A;  2VSZ A;  2COA A;  3HQC A;  1N3H A;  2KGX B;  1UNQ A;  2RVB B;  1AWE A;  1W1D A;  3X23 A;  1W1H A;  2D9X A;  1RJ2 A;  3PG7 A;  1P6S A;  5DIF B;  2PZ1 A;  1U2B A;  2J0K A;  2JP2 A;  4Z2M B;  2UZS A;  5DH9 B;  4HAZ B;  2UVM A;  1DDM A;  2LOX A;  5C5B B;  5C79 A;  2M38 A;  3U8Z A;  1TJ6 A;  2MKR A;  2Y8F A;  2Z0P A;  3FSS A;  3SO6 A;  3KZ1 A;  1H4R A;  1ISN A;  2CAY A;  2CY4 A;  3VOQ A;  3DXD A;  2CY5 A;  2I5C A;  4DXA B;  1OY2 A;  3ML4 A;  5L81 A;  1FHO A;  1DDW A;  1LW3 A;  3P6A A;  4ZRK A;  1U5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...