4CHMA

Structure of inner membrane complex (imc) sub-compartment protein 1 (isp1) from toxoplasma gondii
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
SMASPQVTAADIEDLHRRLLAGMAVLVLLQDGTRLQCILHYNEADSSLSISCEDKVRVIPLSDIKALLHTRDQLQRVETKANLVDDESCVALHLLESGNCIPLRFDGVKDKTCFVDLLKKLKAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMC SUB-COMPARTMENT PROTEIN ISP1
publication title The Inner Membrane Complex Sub-Compartment Proteins Critical for Replication of the Apicomplexan Parasite Toxoplasma Gondii Adopt a Pleckstrin Homology Fold
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Cell cycle
total genus 35
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18161 ISP1_C ISP1 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4chmA00
2AL6A 3VIAA 5JHHA 2LOXA 4YL8A 1WJMA 1MKEA 2AEHA 5D3WA 1UPQA 3U8ZA 3QBVB 2X18A 3D8FA 4KHBB 4C0AA 1AWEA 1ZC3B 1V61A 2DN6A 4GPTB 3LJUX 1WGUA 1FGYA 3FSSA 2ELAA 3GYOA 3TFMA 2YSZA 3V5WA 3ODWA 2ELBA 5HE1A 5HE2A 1FOEA 5JLJB 1NU2A 1FGZA 1N3HA 5JHGA 3KSYA 4Z2NA 3UZTA 2D10A 1MAIA 4HB4B 4A6HA 2K00A 1X86A 3PVLA 4PNKA 1FHOA 3X23A 2RSGA 2YF0A 4MK0A 3TVVA 1MIZB 1XR0B 1BTNA 2GJYA 2P0HA 3AJ4A 5KCVA 2ROVA 4MT7A 2W2XD 4NSWA 2YRYA 1U2BA 2VKIA 3FEHA 2Y7BA 3PVWA 1H4RA 3ULBA 2I5CA 3WYFB 1UNQA 2YT1A 3AU4A 1P5TA 2CY5A 1TQZA 2M38A 3A8QA 2J59M 4HAVB 3CXBB 4IAPA 4ZRJA 2UZSA 2H7EA 1V5UA 2DHJA 3D8EA 3TW1A 1DROA 4L6EA 3PG7A 2R09A 5FI1A 1FB8A 5D3VA 1NTYA 1XCGA 1GC6A 2JP2A 4IFSA 1OMWA 1W1HA 4WVFB 2LYDA 2V76A 1EAZA 1K5DB 1MK7B 2N23A 5DHAB 4BBKA 2L1CA 1SGHA 5C79A 1J19A 5DH9B 2RUKB 2XQNM 3U7DA 5JP4A 2GS0A 3BINA 2N0YA 1KI1B 4F7HA 4A6FA 1PLSA 1AQCA 1OQNA 1WJ1A 3ULCA 2DYQA 3KRXA 1U29A 4GMXB 1UEFA 2YVCA 2W2WA 5LONB 1V88A 4CHJA 2K2UA 1ISNA 5J3YA 2IFSA 3TCAA 1FHWA 1X11A 2HTHB 2D11A 1DBHA 2I5FA 2QKLA 2RLOA 4IOYX 2ROZB 4P7IA 4HAUB 4MY6A 2YT0A 1K5GB 1X05A 3SUZA 1LW3A 4A5KA 2G35A 4HB3B 2PZ1A 2UVMA 4HATB 4K2OA 4KAXB 2P8VA 4WSFA 2GCJA 4XWXA 4A6FB 2KGXB 2UZRA 3SYXA 2Z0PA 2EC1A 2Q13A 1M7EA 5EFXA 4HAWB 3SNHA 2DKQA 1SHCA 3DXEA 2DKPA 3ZDTA 4H8SA 3NSUA 1DDWA 4NY0A 1KZ7A 1EVHA 1Z87A 4TYZA 1UNPA 1Q67A 2D4QA 4CHMA 3ODXA 2COFA 1ZSQA 1KZGA 1WGQA 3PZDA 1GC7A 3VOQA 2P0DA 2EMTA 2MDXA 2GCLA 4F7GA 2KUPA 2H7DA 4HB0B 3WA0A 1FAOA 1P6SA 2CRFA 2RNRB 2I1JA 2CODA 1MK9B 4B6HA 1I7AA 5KQ1A 1GG3A 3ML4A 2DTCA 3A98B 1UNRA 2D2QA 4K17A 4EJNA 3DXDA 5L81A 3QWMA 2LKOA 3N7CA 2DYNA 5J3TA 1V89A 3PVUA 1W1DA 1EGXA 1BTKA 1WG7A 1W1GA 2QKMA 5LOPB 2D9ZA 1DDVA 5CLQB 3SV1A 1OY2A 1ZC4B 1RRPB 4HAXB 4CYEA 2EMSA 4GZUA 3HW2B 3AU5A 3IVFA 5CLLB 1M7RA 2DX1A 2EJ8A 3F0WA 2E2XA 4Y94A 2D9YA 4GMVA 4HB2B 2YS1A 5C5BA 1P3RA 1U27A 1U5DA 2L2IA 3GYPA 5HE0A 4F7UP 3PP2A 2DLWA 4HAYB 2Y8FA 2CY4A 1V5PA 2KCJA 1TXDA 2VRWB 4DBBA 3CIKA 5C16A 2D9VA 2D9WA 4DXAB 3RCPA 1V5MA 3O96A 1NI2A 1I2HA 5DHFB 1DDMA 5J3QA 1MPHA 1U5EA 2DHKA 4HDQA 1ZVRA 2BCJA 4ZRIA 2J0MA 4GN1A 1IRSA 3KZ1A 1U5GA 3OANA 5C5BB 3KRWA 1MIXA 3QIJA 2J0KA 5C6RA 2I1KA 1X1FA 3PSCA 2IYBA 2FJLA 3ODOA 3FM8C 2DX5A 3HK0A 4EKUA 3DXCA 2RGNB 1WVHA 2LOZA 2YS3A 2NZ8B 4HAZB 1E5WA 3G9WA 3KY9A 2R0DA 5GOWB 2HE7A 4EMOA 3D8DA 3P7ZA 4HHVA 3TO1A 1TJ6A 2Z0QA 3MDBC 5D3YA 1NTVA 2D9XA 4D0NB 2MFQA 3A8PA 3SO6A 2ADZA 2Z0OA 2COCA 2COAA 4A6KA 3T06A 5HE3A 4K2PA 1H10A 3HQCA 1XKEA 3ZVRA 4KVGB 4TKNA 1RJ2A 1WI1A 1XX0A 1DYNA 1FHXA 3MPXA 2DHIA 1BAKA 4Z2MB 4DX8A 1U5FA 1LB1A 4KHOA 2LG1A 3F5RA 2OQBA 4HDOA 4K81A 2RVBB 3BJIA 4YONA 5D27A 2DFKA 3P6AA 4PQ0A 4GXBA 1X1GA 2ZPYA 1QQGA 1EF1A 2Y8GA 3M1IB 5D3XA 4WJ7A 5DI9B 3PEGA 1UPRA 5DIFB 2LULA 2YS5A 1QC6A 4DX90 4ZRKA 2W2XC 1Y5OA 2CAYA 4KHAA 1J0WA 1B55A 1PMSA 5KQ4A 2OTXA 2VSZA 1Y19B 2NMBA 2M14A 1BWNA 2DA0A 1PFJA 1XODA 5FI0A 2MWNB 2J0JA 1ZM0A 2P0FA 2K2JA 1XD4A 2MKRA
chains in the Genus database with same CATH superfamily
2AL6A 3VIAA 5JHHA 2LOXA 4YL8A 1WJMA 1MKEA 2AEHA 5D3WA 1UPQA 3U8ZA 3QBVB 2X18A 3D8FA 4KHBB 4C0AA 1AWEA 1ZC3B 1V61A 2DN6A 4GPTB 3LJUX 1WGUA 1FGYA 3FSSA 2ELAA 3GYOA 3TFMA 2KIEA 2YSZA 3V5WA 3ODWA 2ELBA 5HE1A 5HE2A 1FOEA 5JLJB 1NU2A 1FGZA 1N3HA 5JHGA 3KSYA 4Z2NA 3UZTA 2D10A 1MAIA 4HB4B 4A6HA 2K00A 1X86A 3PVLA 4PNKA 1FHOA 3X23A 2RSGA 2YF0A 4MK0A 3TVVA 1MIZB 1XR0B 4QJ3B 1BTNA 2GJYA 2P0HA 3AJ4A 5KCVA 2ROVA 4MT7A 2W2XD 1MI1A 4NSWA 3NW8A 2YRYA 1U2BA 2VKIA 3FEHA 2Y7BA 3PVWA 1H4RA 3ULBA 2I5CA 3WYFB 1UNQA 2YT1A 3AU4A 1P5TA 2CY5A 1TQZA 2M38A 3A8QA 2J59M 4HAVB 3CXBB 4IAPA 4ZRJA 2UZSA 4QJ4B 4GNKB 2H7EA 1V5UA 2DHJA 2KIGA 2Z59A 3D8EA 3TW1A 1DROA 4L6EA 2YT2A 3NWDA 3PG7A 2R09A 5FI1A 1FB8A 5D3VA 1NTYA 1XCGA 1GC6A 2JP2A 4IFSA 1OMWA 5I2SA 1W1HA 4WVFB 2LYDA 1ZYIA 2V76A 1EAZA 1K5DB 1MK7B 2N23A 5DHAB 4BBKA 2L1CA 1SGHA 4KHBA 5C79A 1J19A 5DH9B 2RUKB 2XQNM 3U7DA 5JP4A 2GS0A 3BINA 2N0YA 1KI1B 4F7HA 4A6FA 1PLSA 1AQCA 1OQNA 1WJ1A 3ULCA 2DYQA 3KRXA 1U29A 4GMXB 1UEFA 2YVCA 2W2WA 5LONB 1V88A 4CHJA 2K2UA 1ISNA 5J3YA 2Z13A 3A58A 2IFSA 3TCAA 1FHWA 1X11A 2HTHB 2D11A 1DBHA 2I5FA 2QKLA 2RLOA 4QXAB 4IOYX 2ROZB 4P7IA 4HAUB 4MY6A 2YT0A 1K5GB 1X05A 4CSQA 3SUZA 1LW3A 4A5KA 2G35A 4HB3B 2PZ1A 2UVMA 4HATB 4K2OA 4KAXB 2P8VA 4WSFA 2GCJA 4XWXA 4A6FB 2KGXB 2UZRA 3SYXA 2Z0PA 2EC1A 2Q13A 1M7EA 5EFXA 4HAWB 3SNHA 2DKQA 1SHCA 3DXEA 2DKPA 3U12A 3ZDTA 4H8SA 3NSUA 1DDWA 4NY0A 1KZ7A 1EVHA 1Z87A 3DCXA 4TYZA 1UNPA 1Q67A 2D4QA 3NWFA 4CHMA 2R2YA 3ODXA 2COFA 1ZSQA 1KZGA 1WGQA 3PZDA 1GC7A 3VOQA 2P0DA 2EMTA 2MDXA 2K49A 2GCLA 4F7GA 2KUPA 2H7DA 4HB0B 3WA0A 1FAOA 1P6SA 2CRFA 2RNRB 2I1JA 2CODA 1MK9B 4B6HA 1I7AA 3NWAA 5KQ1A 5LG4B 1GG3A 3ML4A 2DTCA 3A98B 1UNRA 2D2QA 4QJ5B 4K17A 4EJNA 3DXDA 5L81A 3QWMA 2LKOA 3N7CA 2DYNA 4D6WA 5J3TA 1V89A 3PVUA 1W1DA 1EGXA 1BTKA 1WG7A 1W1GA 2QKMA 2KUQA 5LOPB 2D9ZA 1DDVA 5CLQB 3SV1A 1OY2A 1ZC4B 1RRPB 4HAXB 4CYEA 2EMSA 4GZUA 3HW2B 3AU5A 3IVFA 5CLLB 1M7RA 3HIEA 2DX1A 2EJ8A 3F0WA 2E2XA 4Y94A 2D9YA 4GMVA 4HB2B 2YS1A 5C5BA 1P3RA 1U27A 1U5DA 2L2IA 2K8EA 3GYPA 2KR0A 5HE0A 4F7UP 3PP2A 2DLWA 4OT1A 4HAYB 2Y8FA 2CY4A 1V5PA 2KCJA 4GOUA 1TXDA 2VRWB 4DBBA 3CIKA 5C16A 2D9VA 2D9WA 4DXAB 3RCPA 1V5MA 3O96A 1NI2A 1I2HA 5DHFB 4DIXA 1DDMA 5J3QA 1MPHA 1U5EA 2DHKA 4HDQA 1ZVRA 2BCJA 4ZRIA 2J0MA 4GN1A 1IRSA 3KZ1A 1U5GA 3OHMB 3OANA 5C5BB 3KRWA 2RRFA 5M4YB 1MIXA 3QIJA 2J0KA 5C6RA 2I1KA 1X1FA 3PSCA 2IYBA 3B77A 2FJLA 3ODOA 3FM8C 2DX5A 3HK0A 4EKUA 3DXCA 2RGNB 1WVHA 2LOZA 2YS3A 2NZ8B 4HAZB 1E5WA 3G9WA 3KY9A 2R0DA 5GOWB 2HE7A 4EMOA 3D8DA 3P7ZA 2GUMA 4HHVA 3TO1A 5IRSA 1TJ6A 2Z0QA 3MDBC 3FVCA 5D3YA 1NTVA 2D9XA 5I2MA 4D0NB 2MFQA 3A8PA 3SO6A 2ADZA 2NBVA 2Z0OA 2Z4DA 2COCA 2COAA 4A6KA 3T06A 2ZKMX 4K2PA 5HE3A 1H10A 3HQCA 1XKEA 3ZVRA 4KVGB 4TKNA 1RJ2A 1WI1A 4OSNA 4L1RA 1XX0A 1DYNA 1FHXA 1T77A 2DHIA 3MPXA 1BAKA 4Z2MB 4DX8A 1U5FA 1LB1A 4KHOA 3HSAA 2LG1A 3F5RA 2OQBA 4HDOA 4K81A 2RVBB 3BJIA 4YONA 5D27A 2DFKA 3P6AA 4PQ0A 4GXBA 1X1GA 2ZPYA 1QQGA 1EF1A 2Y8GA 3M1IB 5D3XA 4WJ7A 5DI9B 3PEGA 1UPRA 5DIFB 2LULA 2YS5A 1QC6A 2FJUB 4DX90 4ZRKA 2W2XC 1Y5OA 2CAYA 4KHAA 1J0WA 1B55A 4HSIA 1PMSA 5KQ4A 2OTXA 2VSZA 1Y19B 2NMBA 2M14A 1BWNA 2DA0A 1PFJA 1XODA 5FI0A 2MWNB 2J0JA 1ZM0A 2P0FA 2K2JA 1XD4A 2Z14A 2MKRA
chains in the Genus database with same CATH topology
2AL6A 3VIAA 5JHHA 2LOXA 4YL8A 1WJMA 1MKEA 2AEHA 5D3WA 1UPQA 3U8ZA 3QBVB 2X18A 3D8FA 4KHBB 4C0AA 1AWEA 1ZC3B 1V61A 2DN6A 4GPTB 3LJUX 1WGUA 1FGYA 3FSSA 2ELAA 3GYOA 3TFMA 2YSZA 3V5WA 3ODWA 2ELBA 5HE1A 5HE2A 1FOEA 5JLJB 1NU2A 1FGZA 1N3HA 5JHGA 3KSYA 4Z2NA 3UZTA 2D10A 1MAIA 4HB4B 4A6HA 2K00A 1X86A 3PVLA 4PNKA 1FHOA 3X23A 2RSGA 2YF0A 4MK0A 3TVVA 1MIZB 1XR0B 1BTNA 2GJYA 2P0HA 3AJ4A 5KCVA 2ROVA 4MT7A 2W2XD 4NSWA 2YRYA 1U2BA 2VKIA 3FEHA 2Y7BA 3PVWA 1H4RA 3ULBA 2I5CA 3WYFB 1UNQA 2YT1A 3AU4A 1P5TA 2CY5A 1TQZA 2M38A 3A8QA 2J59M 4HAVB 3CXBB 4IAPA 4ZRJA 2UZSA 2H7EA 1V5UA 2DHJA 3D8EA 3TW1A 1DROA 4L6EA 3PG7A 2R09A 5FI1A 1FB8A 5D3VA 1NTYA 1XCGA 1GC6A 2JP2A 4IFSA 1OMWA 1W1HA 4WVFB 2LYDA 2V76A 1EAZA 1K5DB 1MK7B 2N23A 5DHAB 4BBKA 2L1CA 1SGHA 5C79A 1J19A 5DH9B 2RUKB 2XQNM 3U7DA 5JP4A 2GS0A 3BINA 2N0YA 1KI1B 4F7HA 4A6FA 1PLSA 1AQCA 1OQNA 1WJ1A 3ULCA 2DYQA 3KRXA 1U29A 4GMXB 1UEFA 2YVCA 2W2WA 5LONB 1V88A 4CHJA 2K2UA 1ISNA 5J3YA 2IFSA 3TCAA 1FHWA 1X11A 2HTHB 2D11A 1DBHA 2I5FA 2QKLA 2RLOA 4IOYX 2ROZB 4P7IA 4HAUB 4MY6A 2YT0A 1K5GB 1X05A 3SUZA 1LW3A 4A5KA 2G35A 4HB3B 2PZ1A 2UVMA 4HATB 4K2OA 4KAXB 2P8VA 4WSFA 2GCJA 4XWXA 4A6FB 2KGXB 2UZRA 3SYXA 2Z0PA 2EC1A 2Q13A 1M7EA 5EFXA 4HAWB 3SNHA 2DKQA 1SHCA 3DXEA 2DKPA 3ZDTA 4H8SA 3NSUA 1DDWA 4NY0A 1KZ7A 1EVHA 1Z87A 4TYZA 1UNPA 1Q67A 2D4QA 4CHMA 3ODXA 2COFA 1ZSQA 1KZGA 1WGQA 3PZDA 1GC7A 3VOQA 2P0DA 2EMTA 2MDXA 2GCLA 4F7GA 2KUPA 2H7DA 4HB0B 3WA0A 1FAOA 1P6SA 2CRFA 2RNRB 2I1JA 2CODA 1MK9B 4B6HA 1I7AA 5KQ1A 1GG3A 3ML4A 2DTCA 3A98B 1UNRA 2D2QA 4K17A 4EJNA 3DXDA 5L81A 3QWMA 2LKOA 3N7CA 2DYNA 5J3TA 1V89A 3PVUA 1W1DA 1EGXA 1BTKA 1WG7A 1W1GA 2QKMA 5LOPB 2D9ZA 1DDVA 5CLQB 3SV1A 1OY2A 1ZC4B 1RRPB 4HAXB 4CYEA 2EMSA 4GZUA 3HW2B 3AU5A 3IVFA 5CLLB 1M7RA 2DX1A 2EJ8A 3F0WA 2E2XA 4Y94A 2D9YA 4GMVA 4HB2B 2YS1A 5C5BA 1P3RA 1U27A 1U5DA 2L2IA 3GYPA 5HE0A 4F7UP 3PP2A 2DLWA 4HAYB 2Y8FA 2CY4A 1V5PA 2KCJA 1TXDA 2VRWB 4DBBA 3CIKA 5C16A 2D9VA 2D9WA 4DXAB 3RCPA 1V5MA 3O96A 1NI2A 1I2HA 5DHFB 1DDMA 5J3QA 1MPHA 1U5EA 2DHKA 4HDQA 1ZVRA 2BCJA 4ZRIA 2J0MA 4GN1A 1IRSA 3KZ1A 1U5GA 3OANA 5C5BB 3KRWA 1MIXA 3QIJA 2J0KA 5C6RA 2I1KA 1X1FA 3PSCA 2IYBA 2FJLA 3ODOA 3FM8C 2DX5A 3HK0A 4EKUA 3DXCA 2RGNB 1WVHA 2LOZA 2YS3A 2NZ8B 4HAZB 1E5WA 3G9WA 3KY9A 2R0DA 5GOWB 2HE7A 4EMOA 3D8DA 3P7ZA 4HHVA 3TO1A 1TJ6A 2Z0QA 3MDBC 5D3YA 1NTVA 2D9XA 4D0NB 2MFQA 3A8PA 3SO6A 2ADZA 2Z0OA 2COCA 2COAA 4A6KA 3T06A 5HE3A 4K2PA 1H10A 3HQCA 1XKEA 3ZVRA 4KVGB 4TKNA 1RJ2A 1WI1A 1XX0A 1DYNA 1FHXA 3MPXA 2DHIA 1BAKA 4Z2MB 4DX8A 1U5FA 1LB1A 4KHOA 2LG1A 3F5RA 2OQBA 4HDOA 4K81A 2RVBB 3BJIA 4YONA 5D27A 2DFKA 3P6AA 4PQ0A 4GXBA 1X1GA 2ZPYA 1QQGA 1EF1A 2Y8GA 3M1IB 5D3XA 4WJ7A 5DI9B 3PEGA 1UPRA 5DIFB 2LULA 2YS5A 1QC6A 4DX90 4ZRKA 2W2XC 1Y5OA 2CAYA 4KHAA 1J0WA 1B55A 1PMSA 5KQ4A 2OTXA 2VSZA 1Y19B 2NMBA 2M14A 1BWNA 2DA0A 1PFJA 1XODA 5FI0A 2MWNB 2J0JA 1ZM0A 2P0FA 2K2JA 1XD4A 2MKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AL6 A;  3VIA A;  5JHH A;  2LOX A;  4YL8 A;  1WJM A;  1MKE A;  2AEH A;  5D3W A;  1UPQ A;  3U8Z A;  3QBV B;  2X18 A;  3D8F A;  4KHB B;  4C0A A;  1AWE A;  1ZC3 B;  1V61 A;  2DN6 A;  4GPT B;  3LJU X;  1WGU A;  1FGY A;  3FSS A;  2ELA A;  3GYO A;  3TFM A;  2YSZ A;  3V5W A;  3ODW A;  2ELB A;  5HE1 A;  5HE2 A;  1FOE A;  5JLJ B;  1NU2 A;  1FGZ A;  1N3H A;  5JHG A;  3KSY A;  4Z2N A;  3UZT A;  2D10 A;  1MAI A;  4HB4 B;  4A6H A;  2K00 A;  1X86 A;  3PVL A;  4PNK A;  1FHO A;  3X23 A;  2RSG A;  2YF0 A;  4MK0 A;  3TVV A;  1MIZ B;  1XR0 B;  1BTN A;  2GJY A;  2P0H A;  3AJ4 A;  5KCV A;  2ROV A;  4MT7 A;  2W2X D;  4NSW A;  2YRY A;  1U2B A;  2VKI A;  3FEH A;  2Y7B A;  3PVW A;  1H4R A;  3ULB A;  2I5C A;  3WYF B;  1UNQ A;  2YT1 A;  3AU4 A;  1P5T A;  2CY5 A;  1TQZ A;  2M38 A;  3A8Q A;  2J59 M;  4HAV B;  3CXB B;  4IAP A;  4ZRJ A;  2UZS A;  2H7E A;  1V5U A;  2DHJ A;  3D8E A;  3TW1 A;  1DRO A;  4L6E A;  3PG7 A;  2R09 A;  5FI1 A;  1FB8 A;  5D3V A;  1NTY A;  1XCG A;  1GC6 A;  2JP2 A;  4IFS A;  1OMW A;  1W1H A;  4WVF B;  2LYD A;  2V76 A;  1EAZ A;  1K5D B;  1MK7 B;  2N23 A;  5DHA B;  4BBK A;  2L1C A;  1SGH A;  5C79 A;  1J19 A;  5DH9 B;  2RUK B;  2XQN M;  3U7D A;  5JP4 A;  2GS0 A;  3BIN A;  2N0Y A;  1KI1 B;  4F7H A;  4A6F A;  1PLS A;  1AQC A;  1OQN A;  1WJ1 A;  3ULC A;  2DYQ A;  3KRX A;  1U29 A;  4GMX B;  1UEF A;  2YVC A;  2W2W A;  5LON B;  1V88 A;  4CHJ A;  2K2U A;  1ISN A;  5J3Y A;  2IFS A;  3TCA A;  1FHW A;  1X11 A;  2HTH B;  2D11 A;  1DBH A;  2I5F A;  2QKL A;  2RLO A;  4IOY X;  2ROZ B;  4P7I A;  4HAU B;  4MY6 A;  2YT0 A;  1K5G B;  1X05 A;  3SUZ A;  1LW3 A;  4A5K A;  2G35 A;  4HB3 B;  2PZ1 A;  2UVM A;  4HAT B;  4K2O A;  4KAX B;  2P8V A;  4WSF A;  2GCJ A;  4XWX A;  4A6F B;  2KGX B;  2UZR A;  3SYX A;  2Z0P A;  2EC1 A;  2Q13 A;  1M7E A;  5EFX A;  4HAW B;  3SNH A;  2DKQ A;  1SHC A;  3DXE A;  2DKP A;  3ZDT A;  4H8S A;  3NSU A;  1DDW A;  4NY0 A;  1KZ7 A;  1EVH A;  1Z87 A;  4TYZ A;  1UNP A;  1Q67 A;  2D4Q A;  4CHM A;  3ODX A;  2COF A;  1ZSQ A;  1KZG A;  1WGQ A;  3PZD A;  1GC7 A;  3VOQ A;  2P0D A;  2EMT A;  2MDX A;  2GCL A;  4F7G A;  2KUP A;  2H7D A;  4HB0 B;  3WA0 A;  1FAO A;  1P6S A;  2CRF A;  2RNR B;  2I1J A;  2COD A;  1MK9 B;  4B6H A;  1I7A A;  5KQ1 A;  1GG3 A;  3ML4 A;  2DTC A;  3A98 B;  1UNR A;  2D2Q A;  4K17 A;  4EJN A;  3DXD A;  5L81 A;  3QWM A;  2LKO A;  3N7C A;  2DYN A;  5J3T A;  1V89 A;  3PVU A;  1W1D A;  1EGX A;  1BTK A;  1WG7 A;  1W1G A;  2QKM A;  5LOP B;  2D9Z A;  1DDV A;  5CLQ B;  3SV1 A;  1OY2 A;  1ZC4 B;  1RRP B;  4HAX B;  4CYE A;  2EMS A;  4GZU A;  3HW2 B;  3AU5 A;  3IVF A;  5CLL B;  1M7R A;  2DX1 A;  2EJ8 A;  3F0W A;  2E2X A;  4Y94 A;  2D9Y A;  4GMV A;  4HB2 B;  2YS1 A;  5C5B A;  1P3R A;  1U27 A;  1U5D A;  2L2I A;  3GYP A;  5HE0 A;  4F7U P;  3PP2 A;  2DLW A;  4HAY B;  2Y8F A;  2CY4 A;  1V5P A;  2KCJ A;  1TXD A;  2VRW B;  4DBB A;  3CIK A;  5C16 A;  2D9V A;  2D9W A;  4DXA B;  3RCP A;  1V5M A;  3O96 A;  1NI2 A;  1I2H A;  5DHF B;  1DDM A;  5J3Q A;  1MPH A;  1U5E A;  2DHK A;  4HDQ A;  1ZVR A;  2BCJ A;  4ZRI A;  2J0M A;  4GN1 A;  1IRS A;  3KZ1 A;  1U5G A;  3OAN A;  5C5B B;  3KRW A;  1MIX A;  3QIJ A;  2J0K A;  5C6R A;  2I1K A;  1X1F A;  3PSC A;  2IYB A;  2FJL A;  3ODO A;  3FM8 C;  2DX5 A;  3HK0 A;  4EKU A;  3DXC A;  2RGN B;  1WVH A;  2LOZ A;  2YS3 A;  2NZ8 B;  4HAZ B;  1E5W A;  3G9W A;  3KY9 A;  2R0D A;  5GOW B;  2HE7 A;  4EMO A;  3D8D A;  3P7Z A;  4HHV A;  3TO1 A;  1TJ6 A;  2Z0Q A;  3MDB C;  5D3Y A;  1NTV A;  2D9X A;  4D0N B;  2MFQ A;  3A8P A;  3SO6 A;  2ADZ A;  2Z0O A;  2COC A;  2COA A;  4A6K A;  3T06 A;  5HE3 A;  4K2P A;  1H10 A;  3HQC A;  1XKE A;  3ZVR A;  4KVG B;  4TKN A;  1RJ2 A;  1WI1 A;  1XX0 A;  1DYN A;  1FHX A;  3MPX A;  2DHI A;  1BAK A;  4Z2M B;  4DX8 A;  1U5F A;  1LB1 A;  4KHO A;  2LG1 A;  3F5R A;  2OQB A;  4HDO A;  4K81 A;  2RVB B;  3BJI A;  4YON A;  5D27 A;  2DFK A;  3P6A A;  4PQ0 A;  4GXB A;  1X1G A;  2ZPY A;  1QQG A;  1EF1 A;  2Y8G A;  3M1I B;  5D3X A;  4WJ7 A;  5DI9 B;  3PEG A;  1UPR A;  5DIF B;  2LUL A;  2YS5 A;  1QC6 A;  4DX9 0;  4ZRK A;  2W2X C;  1Y5O A;  2CAY A;  4KHA A;  1J0W A;  1B55 A;  1PMS A;  5KQ4 A;  2OTX A;  2VSZ A;  1Y19 B;  2NMB A;  2M14 A;  1BWN A;  2DA0 A;  1PFJ A;  1XOD A;  5FI0 A;  2MWN B;  2J0J A;  1ZM0 A;  2P0F A;  2K2J A;  1XD4 A;  2MKR A; 
#chains in the Genus database with same CATH topology
 2AL6 A;  3VIA A;  5JHH A;  2LOX A;  4YL8 A;  1WJM A;  1MKE A;  2AEH A;  5D3W A;  1UPQ A;  3U8Z A;  3QBV B;  2X18 A;  3D8F A;  4KHB B;  4C0A A;  1AWE A;  1ZC3 B;  1V61 A;  2DN6 A;  4GPT B;  3LJU X;  1WGU A;  1FGY A;  3FSS A;  2ELA A;  3GYO A;  3TFM A;  2KIE A;  2YSZ A;  3V5W A;  3ODW A;  2ELB A;  5HE1 A;  5HE2 A;  1FOE A;  5JLJ B;  1NU2 A;  1FGZ A;  1N3H A;  5JHG A;  3KSY A;  4Z2N A;  3UZT A;  2D10 A;  1MAI A;  4HB4 B;  4A6H A;  2K00 A;  1X86 A;  3PVL A;  4PNK A;  1FHO A;  3X23 A;  2RSG A;  2YF0 A;  4MK0 A;  3TVV A;  1MIZ B;  1XR0 B;  4QJ3 B;  1BTN A;  2GJY A;  2P0H A;  3AJ4 A;  5KCV A;  2ROV A;  4MT7 A;  2W2X D;  1MI1 A;  4NSW A;  3NW8 A;  2YRY A;  1U2B A;  2VKI A;  3FEH A;  2Y7B A;  3PVW A;  1H4R A;  3ULB A;  2I5C A;  3WYF B;  1UNQ A;  2YT1 A;  3AU4 A;  1P5T A;  2CY5 A;  1TQZ A;  2M38 A;  3A8Q A;  2J59 M;  4HAV B;  3CXB B;  4IAP A;  4ZRJ A;  2UZS A;  4QJ4 B;  4GNK B;  2H7E A;  1V5U A;  2DHJ A;  2KIG A;  2Z59 A;  3D8E A;  3TW1 A;  1DRO A;  4L6E A;  2YT2 A;  3NWD A;  3PG7 A;  2R09 A;  5FI1 A;  1FB8 A;  5D3V A;  1NTY A;  1XCG A;  1GC6 A;  2JP2 A;  4IFS A;  1OMW A;  5I2S A;  1W1H A;  4WVF B;  2LYD A;  1ZYI A;  2V76 A;  1EAZ A;  1K5D B;  1MK7 B;  2N23 A;  5DHA B;  4BBK A;  2L1C A;  1SGH A;  4KHB A;  5C79 A;  1J19 A;  5DH9 B;  2RUK B;  2XQN M;  3U7D A;  5JP4 A;  2GS0 A;  3BIN A;  2N0Y A;  1KI1 B;  4F7H A;  4A6F A;  1PLS A;  1AQC A;  1OQN A;  1WJ1 A;  3ULC A;  2DYQ A;  3KRX A;  1U29 A;  4GMX B;  1UEF A;  2YVC A;  2W2W A;  5LON B;  1V88 A;  4CHJ A;  2K2U A;  1ISN A;  5J3Y A;  2Z13 A;  3A58 A;  2IFS A;  3TCA A;  1FHW A;  1X11 A;  2HTH B;  2D11 A;  1DBH A;  2I5F A;  2QKL A;  2RLO A;  4QXA B;  4IOY X;  2ROZ B;  4P7I A;  4HAU B;  4MY6 A;  2YT0 A;  1K5G B;  1X05 A;  4CSQ A;  3SUZ A;  1LW3 A;  4A5K A;  2G35 A;  4HB3 B;  2PZ1 A;  2UVM A;  4HAT B;  4K2O A;  4KAX B;  2P8V A;  4WSF A;  2GCJ A;  4XWX A;  4A6F B;  2KGX B;  2UZR A;  3SYX A;  2Z0P A;  2EC1 A;  2Q13 A;  1M7E A;  5EFX A;  4HAW B;  3SNH A;  2DKQ A;  1SHC A;  3DXE A;  2DKP A;  3U12 A;  3ZDT A;  4H8S A;  3NSU A;  1DDW A;  4NY0 A;  1KZ7 A;  1EVH A;  1Z87 A;  3DCX A;  4TYZ A;  1UNP A;  1Q67 A;  2D4Q A;  3NWF A;  4CHM A;  2R2Y A;  3ODX A;  2COF A;  1ZSQ A;  1KZG A;  1WGQ A;  3PZD A;  1GC7 A;  3VOQ A;  2P0D A;  2EMT A;  2MDX A;  2K49 A;  2GCL A;  4F7G A;  2KUP A;  2H7D A;  4HB0 B;  3WA0 A;  1FAO A;  1P6S A;  2CRF A;  2RNR B;  2I1J A;  2COD A;  1MK9 B;  4B6H A;  1I7A A;  3NWA A;  5KQ1 A;  5LG4 B;  1GG3 A;  3ML4 A;  2DTC A;  3A98 B;  1UNR A;  2D2Q A;  4QJ5 B;  4K17 A;  4EJN A;  3DXD A;  5L81 A;  3QWM A;  2LKO A;  3N7C A;  2DYN A;  4D6W A;  5J3T A;  1V89 A;  3PVU A;  1W1D A;  1EGX A;  1BTK A;  1WG7 A;  1W1G A;  2QKM A;  2KUQ A;  5LOP B;  2D9Z A;  1DDV A;  5CLQ B;  3SV1 A;  1OY2 A;  1ZC4 B;  1RRP B;  4HAX B;  4CYE A;  2EMS A;  4GZU A;  3HW2 B;  3AU5 A;  3IVF A;  5CLL B;  1M7R A;  3HIE A;  2DX1 A;  2EJ8 A;  3F0W A;  2E2X A;  4Y94 A;  2D9Y A;  4GMV A;  4HB2 B;  2YS1 A;  5C5B A;  1P3R A;  1U27 A;  1U5D A;  2L2I A;  2K8E A;  3GYP A;  2KR0 A;  5HE0 A;  4F7U P;  3PP2 A;  2DLW A;  4OT1 A;  4HAY B;  2Y8F A;  2CY4 A;  1V5P A;  2KCJ A;  4GOU A;  1TXD A;  2VRW B;  4DBB A;  3CIK A;  5C16 A;  2D9V A;  2D9W A;  4DXA B;  3RCP A;  1V5M A;  3O96 A;  1NI2 A;  1I2H A;  5DHF B;  4DIX A;  1DDM A;  5J3Q A;  1MPH A;  1U5E A;  2DHK A;  4HDQ A;  1ZVR A;  2BCJ A;  4ZRI A;  2J0M A;  4GN1 A;  1IRS A;  3KZ1 A;  1U5G A;  3OHM B;  3OAN A;  5C5B B;  3KRW A;  2RRF A;  5M4Y B;  1MIX A;  3QIJ A;  2J0K A;  5C6R A;  2I1K A;  1X1F A;  3PSC A;  2IYB A;  3B77 A;  2FJL A;  3ODO A;  3FM8 C;  2DX5 A;  3HK0 A;  4EKU A;  3DXC A;  2RGN B;  1WVH A;  2LOZ A;  2YS3 A;  2NZ8 B;  4HAZ B;  1E5W A;  3G9W A;  3KY9 A;  2R0D A;  5GOW B;  2HE7 A;  4EMO A;  3D8D A;  3P7Z A;  2GUM A;  4HHV A;  3TO1 A;  5IRS A;  1TJ6 A;  2Z0Q A;  3MDB C;  3FVC A;  5D3Y A;  1NTV A;  2D9X A;  5I2M A;  4D0N B;  2MFQ A;  3A8P A;  3SO6 A;  2ADZ A;  2NBV A;  2Z0O A;  2Z4D A;  2COC A;  2COA A;  4A6K A;  3T06 A;  2ZKM X;  4K2P A;  5HE3 A;  1H10 A;  3HQC A;  1XKE A;  3ZVR A;  4KVG B;  4TKN A;  1RJ2 A;  1WI1 A;  4OSN A;  4L1R A;  1XX0 A;  1DYN A;  1FHX A;  1T77 A;  2DHI A;  3MPX A;  1BAK A;  4Z2M B;  4DX8 A;  1U5F A;  1LB1 A;  4KHO A;  3HSA A;  2LG1 A;  3F5R A;  2OQB A;  4HDO A;  4K81 A;  2RVB B;  3BJI A;  4YON A;  5D27 A;  2DFK A;  3P6A A;  4PQ0 A;  4GXB A;  1X1G A;  2ZPY A;  1QQG A;  1EF1 A;  2Y8G A;  3M1I B;  5D3X A;  4WJ7 A;  5DI9 B;  3PEG A;  1UPR A;  5DIF B;  2LUL A;  2YS5 A;  1QC6 A;  2FJU B;  4DX9 0;  4ZRK A;  2W2X C;  1Y5O A;  2CAY A;  4KHA A;  1J0W A;  1B55 A;  4HSI A;  1PMS A;  5KQ4 A;  2OTX A;  2VSZ A;  1Y19 B;  2NMB A;  2M14 A;  1BWN A;  2DA0 A;  1PFJ A;  1XOD A;  5FI0 A;  2MWN B;  2J0J A;  1ZM0 A;  2P0F A;  2K2J A;  1XD4 A;  2Z14 A;  2MKR A; 
#chains in the Genus database with same CATH homology
 2AL6 A;  3VIA A;  5JHH A;  2LOX A;  4YL8 A;  1WJM A;  1MKE A;  2AEH A;  5D3W A;  1UPQ A;  3U8Z A;  3QBV B;  2X18 A;  3D8F A;  4KHB B;  4C0A A;  1AWE A;  1ZC3 B;  1V61 A;  2DN6 A;  4GPT B;  3LJU X;  1WGU A;  1FGY A;  3FSS A;  2ELA A;  3GYO A;  3TFM A;  2YSZ A;  3V5W A;  3ODW A;  2ELB A;  5HE1 A;  5HE2 A;  1FOE A;  5JLJ B;  1NU2 A;  1FGZ A;  1N3H A;  5JHG A;  3KSY A;  4Z2N A;  3UZT A;  2D10 A;  1MAI A;  4HB4 B;  4A6H A;  2K00 A;  1X86 A;  3PVL A;  4PNK A;  1FHO A;  3X23 A;  2RSG A;  2YF0 A;  4MK0 A;  3TVV A;  1MIZ B;  1XR0 B;  1BTN A;  2GJY A;  2P0H A;  3AJ4 A;  5KCV A;  2ROV A;  4MT7 A;  2W2X D;  4NSW A;  2YRY A;  1U2B A;  2VKI A;  3FEH A;  2Y7B A;  3PVW A;  1H4R A;  3ULB A;  2I5C A;  3WYF B;  1UNQ A;  2YT1 A;  3AU4 A;  1P5T A;  2CY5 A;  1TQZ A;  2M38 A;  3A8Q A;  2J59 M;  4HAV B;  3CXB B;  4IAP A;  4ZRJ A;  2UZS A;  2H7E A;  1V5U A;  2DHJ A;  3D8E A;  3TW1 A;  1DRO A;  4L6E A;  3PG7 A;  2R09 A;  5FI1 A;  1FB8 A;  5D3V A;  1NTY A;  1XCG A;  1GC6 A;  2JP2 A;  4IFS A;  1OMW A;  1W1H A;  4WVF B;  2LYD A;  2V76 A;  1EAZ A;  1K5D B;  1MK7 B;  2N23 A;  5DHA B;  4BBK A;  2L1C A;  1SGH A;  5C79 A;  1J19 A;  5DH9 B;  2RUK B;  2XQN M;  3U7D A;  5JP4 A;  2GS0 A;  3BIN A;  2N0Y A;  1KI1 B;  4F7H A;  4A6F A;  1PLS A;  1AQC A;  1OQN A;  1WJ1 A;  3ULC A;  2DYQ A;  3KRX A;  1U29 A;  4GMX B;  1UEF A;  2YVC A;  2W2W A;  5LON B;  1V88 A;  4CHJ A;  2K2U A;  1ISN A;  5J3Y A;  2IFS A;  3TCA A;  1FHW A;  1X11 A;  2HTH B;  2D11 A;  1DBH A;  2I5F A;  2QKL A;  2RLO A;  4IOY X;  2ROZ B;  4P7I A;  4HAU B;  4MY6 A;  2YT0 A;  1K5G B;  1X05 A;  3SUZ A;  1LW3 A;  4A5K A;  2G35 A;  4HB3 B;  2PZ1 A;  2UVM A;  4HAT B;  4K2O A;  4KAX B;  2P8V A;  4WSF A;  2GCJ A;  4XWX A;  4A6F B;  2KGX B;  2UZR A;  3SYX A;  2Z0P A;  2EC1 A;  2Q13 A;  1M7E A;  5EFX A;  4HAW B;  3SNH A;  2DKQ A;  1SHC A;  3DXE A;  2DKP A;  3ZDT A;  4H8S A;  3NSU A;  1DDW A;  4NY0 A;  1KZ7 A;  1EVH A;  1Z87 A;  4TYZ A;  1UNP A;  1Q67 A;  2D4Q A;  4CHM A;  3ODX A;  2COF A;  1ZSQ A;  1KZG A;  1WGQ A;  3PZD A;  1GC7 A;  3VOQ A;  2P0D A;  2EMT A;  2MDX A;  2GCL A;  4F7G A;  2KUP A;  2H7D A;  4HB0 B;  3WA0 A;  1FAO A;  1P6S A;  2CRF A;  2RNR B;  2I1J A;  2COD A;  1MK9 B;  4B6H A;  1I7A A;  5KQ1 A;  1GG3 A;  3ML4 A;  2DTC A;  3A98 B;  1UNR A;  2D2Q A;  4K17 A;  4EJN A;  3DXD A;  5L81 A;  3QWM A;  2LKO A;  3N7C A;  2DYN A;  5J3T A;  1V89 A;  3PVU A;  1W1D A;  1EGX A;  1BTK A;  1WG7 A;  1W1G A;  2QKM A;  5LOP B;  2D9Z A;  1DDV A;  5CLQ B;  3SV1 A;  1OY2 A;  1ZC4 B;  1RRP B;  4HAX B;  4CYE A;  2EMS A;  4GZU A;  3HW2 B;  3AU5 A;  3IVF A;  5CLL B;  1M7R A;  2DX1 A;  2EJ8 A;  3F0W A;  2E2X A;  4Y94 A;  2D9Y A;  4GMV A;  4HB2 B;  2YS1 A;  5C5B A;  1P3R A;  1U27 A;  1U5D A;  2L2I A;  3GYP A;  5HE0 A;  4F7U P;  3PP2 A;  2DLW A;  4HAY B;  2Y8F A;  2CY4 A;  1V5P A;  2KCJ A;  1TXD A;  2VRW B;  4DBB A;  3CIK A;  5C16 A;  2D9V A;  2D9W A;  4DXA B;  3RCP A;  1V5M A;  3O96 A;  1NI2 A;  1I2H A;  5DHF B;  1DDM A;  5J3Q A;  1MPH A;  1U5E A;  2DHK A;  4HDQ A;  1ZVR A;  2BCJ A;  4ZRI A;  2J0M A;  4GN1 A;  1IRS A;  3KZ1 A;  1U5G A;  3OAN A;  5C5B B;  3KRW A;  1MIX A;  3QIJ A;  2J0K A;  5C6R A;  2I1K A;  1X1F A;  3PSC A;  2IYB A;  2FJL A;  3ODO A;  3FM8 C;  2DX5 A;  3HK0 A;  4EKU A;  3DXC A;  2RGN B;  1WVH A;  2LOZ A;  2YS3 A;  2NZ8 B;  4HAZ B;  1E5W A;  3G9W A;  3KY9 A;  2R0D A;  5GOW B;  2HE7 A;  4EMO A;  3D8D A;  3P7Z A;  4HHV A;  3TO1 A;  1TJ6 A;  2Z0Q A;  3MDB C;  5D3Y A;  1NTV A;  2D9X A;  4D0N B;  2MFQ A;  3A8P A;  3SO6 A;  2ADZ A;  2Z0O A;  2COC A;  2COA A;  4A6K A;  3T06 A;  5HE3 A;  4K2P A;  1H10 A;  3HQC A;  1XKE A;  3ZVR A;  4KVG B;  4TKN A;  1RJ2 A;  1WI1 A;  1XX0 A;  1DYN A;  1FHX A;  3MPX A;  2DHI A;  1BAK A;  4Z2M B;  4DX8 A;  1U5F A;  1LB1 A;  4KHO A;  2LG1 A;  3F5R A;  2OQB A;  4HDO A;  4K81 A;  2RVB B;  3BJI A;  4YON A;  5D27 A;  2DFK A;  3P6A A;  4PQ0 A;  4GXB A;  1X1G A;  2ZPY A;  1QQG A;  1EF1 A;  2Y8G A;  3M1I B;  5D3X A;  4WJ7 A;  5DI9 B;  3PEG A;  1UPR A;  5DIF B;  2LUL A;  2YS5 A;  1QC6 A;  4DX9 0;  4ZRK A;  2W2X C;  1Y5O A;  2CAY A;  4KHA A;  1J0W A;  1B55 A;  1PMS A;  5KQ4 A;  2OTX A;  2VSZ A;  1Y19 B;  2NMB A;  2M14 A;  1BWN A;  2DA0 A;  1PFJ A;  1XOD A;  5FI0 A;  2MWN B;  2J0J A;  1ZM0 A;  2P0F A;  2K2J A;  1XD4 A;  2MKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...