4CHMA

Structure of inner membrane complex (imc) sub-compartment protein 1 (isp1) from toxoplasma gondii
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
SMASPQVTAADIEDLHRRLLAGMAVLVLLQDGTRLQCILHYNEADSSLSISCEDKVRVIPLSDIKALLHTRDQLQRVETKANLVDDESCVALHLLESGNCIPLRFDGVKDKTCFVDLLKKLKAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Inner Membrane Complex Sub-Compartment Proteins Critical for Replication of the Apicomplexan Parasite Toxoplasma Gondii Adopt a Pleckstrin Homology Fold
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Cell cycle
molecule keywords IMC SUB-COMPARTMENT PROTEIN ISP1
total genus 35
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18161 ISP1_C ISP1 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4chmA00
3DXEA 4KHOA 1DROA 4ZRJA 4HB2B 1FGZA 1TJ6A 4PQ0A 4A6HA 1XKEA 4GPTB 2NZ8B 5JP4A 1UPRA 1UNPA 2BCJA 1MIZB 2VRWB 4PNKA 3CIKA 3P7ZA 2LYDA 3MPXA 3A8PA 1U5DA 3TW1A 2RVBB 5D3WA 1V88A 3U7DA 2CODA 1X1GA 2DKPA 3PVLA 4IAPA 2VKIA 4Z2MB 2GCLA 1P3RA 2COFA 2DYQA 2Z0QA 2RGNB 2EMSA 2LG1A 2D9YA 2E2XA 5L81A 4GXBA 4KAXB 1V5PA 3ZVRA 2MWNB 5KCVA 1QC6A 2ROZB 4HAXB 2N23A 2P8VA 3OANA 3X23A 3NSUA 2GCJA 1V61A 4ZRKA 1KZGA 1P5TA 1SGHA 1M7EA 1E5WA 1OMWA 1NU2A 2UZRA 1RRPB 2L2IA 1WG7A 2DHKA 3KSYA 2M38A 4Y94A 2G35A 4C0AA 4GMXB 4K2PA 3KRXA 4CHMA 3LJUX 1UNRA 4MK0A 1BTKA 1V5UA 4XWXA 3ULBA 2YVCA 3T06A 3A8QA 5D3YA 4DX8A 5HE0A 4WSFA 1GC6A 1UNQA 4HAYB 2UVMA 2YT0A 5CLLB 1BAKA 2MKRA 4K81A 1MPHA 1FHXA 1ZC4B 4HAVB 1N3HA 5JHHA 4DX90 3SO6A 4WJ7A 2H7DA 3QWMA 5HE1A 5C79A 2CY4A 2IYBA 1Y19B 1DBHA 4H8SA 1GC7A 1FOEA 2K00A 4DXAB 2P0FA 2LOZA 1ZC3B 2Z0PA 3IVFA 4ZRIA 2D4QA 2I1JA 4KHBB 3D8DA 2X18A 2K2JA 2D9VA 2K2UA 2VSZA 3D8FA 3MDBC 5D3VA 5EFXA 4YL8A 2I5CA 2W2XD 5C16A 2V76A 4EMOA 2EJ8A 4P7IA 2YS5A 2D9ZA 1AQCA 3PEGA 1MAIA 4A6FA 1UEFA 2ELBA 1MK9B 1WI1A 2MFQA 1QQGA 2NMBA 3PVUA 4A6KA 2W2WA 2MDXA 1WVHA 4HAUB 4TYZA 2RLOA 4HAWB 2DA0A 1EGXA 5DHAB 2YT1A 4HATB 1LB1A 2DFKA 4KHAA 1U5FA 4MT7A 2IFSA 3FM8C 1H4RA 3PZDA 5D27A 1DDVA 1XCGA 4CHJA 1DYNA 4IOYX 2LOXA 1TXDA 1ZVRA 5JHGA 4NSWA 5JLJB 1ZM0A 5J3YA 1X1FA 5DI9B 2DX1A 1NTYA 3QIJA 4F7UP 3F0WA 1GG3A 1V5MA 3F5RA 2M14A 4NY0A 2RUKB 2AL6A 2D9WA 2I5FA 1XX0A 1TQZA 1W1HA 2COCA 2UZSA 2EC1A 1V89A 1XR0B 2W2XC 5LOPB 1M7RA 1MK7B 4F7HA 4HB3B 1FAOA 3PG7A 2JP2A 2Y8GA 1PFJA 3AU4A 3SV1A 3TFMA 3V5WA 2YS1A 3SYXA 1U29A 1NTVA 3TCAA 2J59M 2YRYA 4IFSA 4B6HA 2R0DA 2D11A 1KZ7A 1X86A 2CAYA 2COAA 3ODXA 4WVFB 3AU5A 3GYOA 5CLQB 3KRWA 2EMTA 3QBVB 4EJNA 2QKLA 2P0DA 4HHVA 1RJ2A 5HE2A 4K17A 3ZDTA 2N0YA 4GN1A 4HDQA 1XODA 5DIFB 3U8ZA 2J0JA 2RSGA 4TKNA 3WYFB 2Z0OA 4GZUA 3CXBB 1MKEA 3AJ4A 2Y7BA 3VOQA 3KZ1A 2P0HA 1U2BA 2DX5A 3M1IB 2KCJA 2LULA 3G9WA 4GMVA 1WGUA 3A98B 5J3TA 1DDMA 3KY9A 2YF0A 5C6RA 2DLWA 1PMSA 3HQCA 2DN6A 2XQNM 1Z87A 5HE3A 2PZ1A 3ODOA 1SHCA 1EVHA 5LONB 4Z2NA 3ML4A 1NI2A 1WJMA 1Y5OA 4HAZB 4A5KA 3WA0A 2I1KA 4HB4B 2J0MA 3TO1A 2D2QA 1OY2A 2ROVA 1K5GB 5KQ1A 1FGYA 1EAZA 2R09A 2OQBA 2GJYA 3HK0A 1OQNA 3PP2A 3SNHA 2ELAA 5DHFB 1KI1B 3RCPA 5C5BB 1DDWA 2Q13A 2YS3A 5FI0A 3TVVA 1J19A 3BINA 3D8EA 2L1CA 1X11A 3ODWA 4MY6A 5GOWB 1WJ1A 1U5GA 1AWEA 2KGXB 2D10A 1I2HA 1IRSA 4HDOA 1ISNA 3PSCA 2HE7A 1MIXA 2FJLA 2GS0A 3HW2B 2AEHA 1W1DA 2YSZA 2KUPA 3DXDA 1UPQA 1FHWA 1K5DB 2J0KA 5D3XA 1LW3A 2Y8FA 1I7AA 2DYNA 3UZTA 1FHOA 2DTCA 4L6EA 1ZSQA 4DBBA 5C5BA 5DH9B 4KVGB 2D9XA 1BWNA 3DXCA 4EKUA 2RNRB 4D0NB 2ADZA 1Q67A 1WGQA 2ZPYA 1BTNA 1FB8A 4F7GA 2DHIA 1P6SA 4A6FB 5FI1A 2OTXA 4CYEA 1J0WA 3GYPA 3ULCA 2DKQA 2LKOA 1EF1A 4HB0B 2CY5A 1U27A 3N7CA 4BBKA 3PVWA 5KQ4A 3BJIA 2QKMA 3O96A 1W1GA 4YONA 3SUZA 1PLSA 3FEHA 2H7EA 1U5EA 2DHJA 5J3QA 4K2OA 1B55A 1XD4A 1X05A 3P6AA 3VIAA 2CRFA 2HTHB 1H10A 3FSSA
chains in the Genus database with same CATH superfamily
2KUQA 3DXEA 4KHOA 1DROA 4ZRJA 3NWDA 2GUMA 4HB2B 1FGZA 1TJ6A 3B77A 4PQ0A 4A6HA 1XKEA 4GPTB 2NZ8B 5JP4A 1UPRA 1UNPA 2BCJA 1MIZB 2VRWB 3DCXA 4PNKA 3CIKA 3P7ZA 2LYDA 3MPXA 3A8PA 1U5DA 2FJUB 3TW1A 2RVBB 5D3WA 1V88A 3U7DA 2CODA 4L1RA 1X1GA 2DKPA 3PVLA 4IAPA 2VKIA 4QJ5B 4Z2MB 2GCLA 1P3RA 2COFA 2DYQA 2KIEA 2Z0QA 2RGNB 2EMSA 2LG1A 2D9YA 4OT1A 2E2XA 5L81A 2KR0A 4GXBA 4KAXB 2NBVA 1V5PA 3ZVRA 2MWNB 5KCVA 1QC6A 2ROZB 4HAXB 2N23A 2P8VA 3OANA 3X23A 3NSUA 2GCJA 4GNKB 1V61A 4ZRKA 1KZGA 1P5TA 1SGHA 3HSAA 1M7EA 1E5WA 1OMWA 1NU2A 2UZRA 4D6WA 1RRPB 3NWFA 3NWAA 2Z4DA 2L2IA 4CSQA 5IRSA 1WG7A 2DHKA 3KSYA 2M38A 4Y94A 2G35A 4C0AA 4GMXB 4K2PA 3FVCA 2Z59A 3KRXA 4CHMA 3LJUX 1UNRA 4MK0A 2K8EA 1BTKA 1V5UA 4XWXA 3ULBA 2YVCA 3T06A 3A8QA 5D3YA 4DX8A 5HE0A 4WSFA 1GC6A 1UNQA 4HAYB 2UVMA 2YT0A 5CLLB 1BAKA 2MKRA 4K81A 1MPHA 1FHXA 1ZC4B 2R2YA 4HAVB 1N3HA 5JHHA 4DX90 3SO6A 4WJ7A 2H7DA 3QWMA 5HE1A 5C79A 2CY4A 2IYBA 1Y19B 1DBHA 4H8SA 1GC7A 1FOEA 2K00A 4DXAB 2P0FA 2LOZA 1ZC3B 2Z0PA 3IVFA 4ZRIA 2D4QA 2I1JA 3A58A 4KHBB 3D8DA 2X18A 4DIXA 2K2JA 2D9VA 2K2UA 4GOUA 2VSZA 3D8FA 3MDBC 5D3VA 5EFXA 4YL8A 2I5CA 2W2XD 4HSIA 5C16A 3NW8A 2V76A 3HIEA 4EMOA 2EJ8A 4P7IA 5M4YB 2YS5A 2D9ZA 1AQCA 3PEGA 1MAIA 4A6FA 1UEFA 2ELBA 1MK9B 1WI1A 4OSNA 2MFQA 1QQGA 2NMBA 3PVUA 4A6KA 2W2WA 2MDXA 1WVHA 4HAUB 4TYZA 2RLOA 4HAWB 2DA0A 1EGXA 5DHAB 2YT1A 4HATB 1LB1A 2DFKA 4KHAA 1U5FA 4QJ4B 4MT7A 2KIGA 2IFSA 3FM8C 1H4RA 3PZDA 5D27A 2Z13A 1DDVA 1XCGA 4CHJA 1DYNA 4IOYX 2LOXA 1TXDA 1ZVRA 5JHGA 4NSWA 5JLJB 1ZM0A 5J3YA 1X1FA 5DI9B 2DX1A 1NTYA 3QIJA 4F7UP 3F0WA 1GG3A 1V5MA 3F5RA 2M14A 4NY0A 2RUKB 2AL6A 2D9WA 2I5FA 1XX0A 1TQZA 1W1HA 2COCA 2UZSA 2EC1A 1V89A 1XR0B 2W2XC 5LOPB 1M7RA 1MK7B 4F7HA 4HB3B 1FAOA 3PG7A 2JP2A 2Y8GA 1PFJA 3AU4A 3SV1A 3TFMA 3V5WA 2YS1A 3SYXA 1U29A 1NTVA 3TCAA 2J59M 2YRYA 4IFSA 4B6HA 2R0DA 2D11A 1KZ7A 1X86A 2CAYA 2COAA 2YT2A 3ODXA 1MI1A 4WVFB 3AU5A 3GYOA 5CLQB 3KRWA 2EMTA 3QBVB 4EJNA 2QKLA 2P0DA 4HHVA 1RJ2A 5HE2A 4K17A 3ZDTA 2N0YA 4GN1A 4HDQA 5I2MA 1XODA 5DIFB 3U8ZA 2J0JA 2RSGA 4TKNA 3WYFB 2Z0OA 4GZUA 3CXBB 1MKEA 3AJ4A 2Y7BA 3VOQA 3KZ1A 2P0HA 1U2BA 2DX5A 2Z14A 3M1IB 2KCJA 2LULA 3G9WA 4GMVA 1WGUA 3A98B 5J3TA 1ZYIA 1DDMA 3KY9A 2YF0A 5C6RA 2DLWA 1PMSA 3HQCA 2DN6A 2XQNM 1Z87A 5HE3A 2PZ1A 3ODOA 1SHCA 1EVHA 5LONB 4Z2NA 3ML4A 1NI2A 1WJMA 1Y5OA 4HAZB 4A5KA 3WA0A 3OHMB 2I1KA 4HB4B 2J0MA 3TO1A 2D2QA 1OY2A 2ROVA 1K5GB 5KQ1A 1FGYA 1EAZA 3U12A 2R09A 2OQBA 2GJYA 3HK0A 1OQNA 3PP2A 3SNHA 2ELAA 5DHFB 1KI1B 3RCPA 5C5BB 1DDWA 5LG4B 2Q13A 2YS3A 5FI0A 3TVVA 1J19A 3BINA 3D8EA 2L1CA 1X11A 3ODWA 4MY6A 5GOWB 1WJ1A 1U5GA 1AWEA 2KGXB 2D10A 1I2HA 1IRSA 4HDOA 1ISNA 3PSCA 2HE7A 1MIXA 2FJLA 2GS0A 3HW2B 2AEHA 1W1DA 2YSZA 2KUPA 3DXDA 4KHBA 1UPQA 1FHWA 1K5DB 2J0KA 5D3XA 1LW3A 2Y8FA 1I7AA 2DYNA 3UZTA 1FHOA 2DTCA 4L6EA 1ZSQA 4DBBA 5C5BA 5DH9B 4KVGB 2D9XA 1BWNA 1T77A 3DXCA 4EKUA 2RNRB 2K49A 4D0NB 2ADZA 1Q67A 1WGQA 2ZPYA 1BTNA 1FB8A 4F7GA 5I2SA 2DHIA 4QJ3B 1P6SA 4A6FB 5FI1A 2OTXA 4CYEA 1J0WA 3GYPA 3ULCA 2DKQA 4QXAB 2LKOA 1EF1A 4HB0B 2CY5A 1U27A 2RRFA 3N7CA 4BBKA 3PVWA 5KQ4A 3BJIA 2QKMA 3O96A 1W1GA 4YONA 3SUZA 1PLSA 3FEHA 2H7EA 1U5EA 2ZKMX 2DHJA 5J3QA 4K2OA 1B55A 1XD4A 1X05A 3P6AA 3VIAA 2CRFA 2HTHB 1H10A 3FSSA
chains in the Genus database with same CATH topology
3DXEA 4KHOA 1DROA 4ZRJA 4HB2B 1FGZA 1TJ6A 4PQ0A 4A6HA 1XKEA 4GPTB 2NZ8B 5JP4A 1UPRA 1UNPA 2BCJA 1MIZB 2VRWB 4PNKA 3CIKA 3P7ZA 2LYDA 3MPXA 3A8PA 1U5DA 3TW1A 2RVBB 5D3WA 1V88A 3U7DA 2CODA 1X1GA 2DKPA 3PVLA 4IAPA 2VKIA 4Z2MB 2GCLA 1P3RA 2COFA 2DYQA 2Z0QA 2RGNB 2EMSA 2LG1A 2D9YA 2E2XA 5L81A 4GXBA 4KAXB 1V5PA 3ZVRA 2MWNB 5KCVA 1QC6A 2ROZB 4HAXB 2N23A 2P8VA 3OANA 3X23A 3NSUA 2GCJA 1V61A 4ZRKA 1KZGA 1P5TA 1SGHA 1M7EA 1E5WA 1OMWA 1NU2A 2UZRA 1RRPB 2L2IA 1WG7A 2DHKA 3KSYA 2M38A 4Y94A 2G35A 4C0AA 4GMXB 4K2PA 3KRXA 4CHMA 3LJUX 1UNRA 4MK0A 1BTKA 1V5UA 4XWXA 3ULBA 2YVCA 3T06A 3A8QA 5D3YA 4DX8A 5HE0A 4WSFA 1GC6A 1UNQA 4HAYB 2UVMA 2YT0A 5CLLB 1BAKA 2MKRA 4K81A 1MPHA 1FHXA 1ZC4B 4HAVB 1N3HA 5JHHA 4DX90 3SO6A 4WJ7A 2H7DA 3QWMA 5HE1A 5C79A 2CY4A 2IYBA 1Y19B 1DBHA 4H8SA 1GC7A 1FOEA 2K00A 4DXAB 2P0FA 2LOZA 1ZC3B 2Z0PA 3IVFA 4ZRIA 2D4QA 2I1JA 4KHBB 3D8DA 2X18A 2K2JA 2D9VA 2K2UA 2VSZA 3D8FA 3MDBC 5D3VA 5EFXA 4YL8A 2I5CA 2W2XD 5C16A 2V76A 4EMOA 2EJ8A 4P7IA 2YS5A 2D9ZA 1AQCA 3PEGA 1MAIA 4A6FA 1UEFA 2ELBA 1MK9B 1WI1A 2MFQA 1QQGA 2NMBA 3PVUA 4A6KA 2W2WA 2MDXA 1WVHA 4HAUB 4TYZA 2RLOA 4HAWB 2DA0A 1EGXA 5DHAB 2YT1A 4HATB 1LB1A 2DFKA 4KHAA 1U5FA 4MT7A 2IFSA 3FM8C 1H4RA 3PZDA 5D27A 1DDVA 1XCGA 4CHJA 1DYNA 4IOYX 2LOXA 1TXDA 1ZVRA 5JHGA 4NSWA 5JLJB 1ZM0A 5J3YA 1X1FA 5DI9B 2DX1A 1NTYA 3QIJA 4F7UP 3F0WA 1GG3A 1V5MA 3F5RA 2M14A 4NY0A 2RUKB 2AL6A 2D9WA 2I5FA 1XX0A 1TQZA 1W1HA 2COCA 2UZSA 2EC1A 1V89A 1XR0B 2W2XC 5LOPB 1M7RA 1MK7B 4F7HA 4HB3B 1FAOA 3PG7A 2JP2A 2Y8GA 1PFJA 3AU4A 3SV1A 3TFMA 3V5WA 2YS1A 3SYXA 1U29A 1NTVA 3TCAA 2J59M 2YRYA 4IFSA 4B6HA 2R0DA 2D11A 1KZ7A 1X86A 2CAYA 2COAA 3ODXA 4WVFB 3AU5A 3GYOA 5CLQB 3KRWA 2EMTA 3QBVB 4EJNA 2QKLA 2P0DA 4HHVA 1RJ2A 5HE2A 4K17A 3ZDTA 2N0YA 4GN1A 4HDQA 1XODA 5DIFB 3U8ZA 2J0JA 2RSGA 4TKNA 3WYFB 2Z0OA 4GZUA 3CXBB 1MKEA 3AJ4A 2Y7BA 3VOQA 3KZ1A 2P0HA 1U2BA 2DX5A 3M1IB 2KCJA 2LULA 3G9WA 4GMVA 1WGUA 3A98B 5J3TA 1DDMA 3KY9A 2YF0A 5C6RA 2DLWA 1PMSA 3HQCA 2DN6A 2XQNM 1Z87A 5HE3A 2PZ1A 3ODOA 1SHCA 1EVHA 5LONB 4Z2NA 3ML4A 1NI2A 1WJMA 1Y5OA 4HAZB 4A5KA 3WA0A 2I1KA 4HB4B 2J0MA 3TO1A 2D2QA 1OY2A 2ROVA 1K5GB 5KQ1A 1FGYA 1EAZA 2R09A 2OQBA 2GJYA 3HK0A 1OQNA 3PP2A 3SNHA 2ELAA 5DHFB 1KI1B 3RCPA 5C5BB 1DDWA 2Q13A 2YS3A 5FI0A 3TVVA 1J19A 3BINA 3D8EA 2L1CA 1X11A 3ODWA 4MY6A 5GOWB 1WJ1A 1U5GA 1AWEA 2KGXB 2D10A 1I2HA 1IRSA 4HDOA 1ISNA 3PSCA 2HE7A 1MIXA 2FJLA 2GS0A 3HW2B 2AEHA 1W1DA 2YSZA 2KUPA 3DXDA 1UPQA 1FHWA 1K5DB 2J0KA 5D3XA 1LW3A 2Y8FA 1I7AA 2DYNA 3UZTA 1FHOA 2DTCA 4L6EA 1ZSQA 4DBBA 5C5BA 5DH9B 4KVGB 2D9XA 1BWNA 3DXCA 4EKUA 2RNRB 4D0NB 2ADZA 1Q67A 1WGQA 2ZPYA 1BTNA 1FB8A 4F7GA 2DHIA 1P6SA 4A6FB 5FI1A 2OTXA 4CYEA 1J0WA 3GYPA 3ULCA 2DKQA 2LKOA 1EF1A 4HB0B 2CY5A 1U27A 3N7CA 4BBKA 3PVWA 5KQ4A 3BJIA 2QKMA 3O96A 1W1GA 4YONA 3SUZA 1PLSA 3FEHA 2H7EA 1U5EA 2DHJA 5J3QA 4K2OA 1B55A 1XD4A 1X05A 3P6AA 3VIAA 2CRFA 2HTHB 1H10A 3FSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXE A;  4KHO A;  1DRO A;  4ZRJ A;  4HB2 B;  1FGZ A;  1TJ6 A;  4PQ0 A;  4A6H A;  1XKE A;  4GPT B;  2NZ8 B;  5JP4 A;  1UPR A;  1UNP A;  2BCJ A;  1MIZ B;  2VRW B;  4PNK A;  3CIK A;  3P7Z A;  2LYD A;  3MPX A;  3A8P A;  1U5D A;  3TW1 A;  2RVB B;  5D3W A;  1V88 A;  3U7D A;  2COD A;  1X1G A;  2DKP A;  3PVL A;  4IAP A;  2VKI A;  4Z2M B;  2GCL A;  1P3R A;  2COF A;  2DYQ A;  2Z0Q A;  2RGN B;  2EMS A;  2LG1 A;  2D9Y A;  2E2X A;  5L81 A;  4GXB A;  4KAX B;  1V5P A;  3ZVR A;  2MWN B;  5KCV A;  1QC6 A;  2ROZ B;  4HAX B;  2N23 A;  2P8V A;  3OAN A;  3X23 A;  3NSU A;  2GCJ A;  1V61 A;  4ZRK A;  1KZG A;  1P5T A;  1SGH A;  1M7E A;  1E5W A;  1OMW A;  1NU2 A;  2UZR A;  1RRP B;  2L2I A;  1WG7 A;  2DHK A;  3KSY A;  2M38 A;  4Y94 A;  2G35 A;  4C0A A;  4GMX B;  4K2P A;  3KRX A;  4CHM A;  3LJU X;  1UNR A;  4MK0 A;  1BTK A;  1V5U A;  4XWX A;  3ULB A;  2YVC A;  3T06 A;  3A8Q A;  5D3Y A;  4DX8 A;  5HE0 A;  4WSF A;  1GC6 A;  1UNQ A;  4HAY B;  2UVM A;  2YT0 A;  5CLL B;  1BAK A;  2MKR A;  4K81 A;  1MPH A;  1FHX A;  1ZC4 B;  4HAV B;  1N3H A;  5JHH A;  4DX9 0;  3SO6 A;  4WJ7 A;  2H7D A;  3QWM A;  5HE1 A;  5C79 A;  2CY4 A;  2IYB A;  1Y19 B;  1DBH A;  4H8S A;  1GC7 A;  1FOE A;  2K00 A;  4DXA B;  2P0F A;  2LOZ A;  1ZC3 B;  2Z0P A;  3IVF A;  4ZRI A;  2D4Q A;  2I1J A;  4KHB B;  3D8D A;  2X18 A;  2K2J A;  2D9V A;  2K2U A;  2VSZ A;  3D8F A;  3MDB C;  5D3V A;  5EFX A;  4YL8 A;  2I5C A;  2W2X D;  5C16 A;  2V76 A;  4EMO A;  2EJ8 A;  4P7I A;  2YS5 A;  2D9Z A;  1AQC A;  3PEG A;  1MAI A;  4A6F A;  1UEF A;  2ELB A;  1MK9 B;  1WI1 A;  2MFQ A;  1QQG A;  2NMB A;  3PVU A;  4A6K A;  2W2W A;  2MDX A;  1WVH A;  4HAU B;  4TYZ A;  2RLO A;  4HAW B;  2DA0 A;  1EGX A;  5DHA B;  2YT1 A;  4HAT B;  1LB1 A;  2DFK A;  4KHA A;  1U5F A;  4MT7 A;  2IFS A;  3FM8 C;  1H4R A;  3PZD A;  5D27 A;  1DDV A;  1XCG A;  4CHJ A;  1DYN A;  4IOY X;  2LOX A;  1TXD A;  1ZVR A;  5JHG A;  4NSW A;  5JLJ B;  1ZM0 A;  5J3Y A;  1X1F A;  5DI9 B;  2DX1 A;  1NTY A;  3QIJ A;  4F7U P;  3F0W A;  1GG3 A;  1V5M A;  3F5R A;  2M14 A;  4NY0 A;  2RUK B;  2AL6 A;  2D9W A;  2I5F A;  1XX0 A;  1TQZ A;  1W1H A;  2COC A;  2UZS A;  2EC1 A;  1V89 A;  1XR0 B;  2W2X C;  5LOP B;  1M7R A;  1MK7 B;  4F7H A;  4HB3 B;  1FAO A;  3PG7 A;  2JP2 A;  2Y8G A;  1PFJ A;  3AU4 A;  3SV1 A;  3TFM A;  3V5W A;  2YS1 A;  3SYX A;  1U29 A;  1NTV A;  3TCA A;  2J59 M;  2YRY A;  4IFS A;  4B6H A;  2R0D A;  2D11 A;  1KZ7 A;  1X86 A;  2CAY A;  2COA A;  3ODX A;  4WVF B;  3AU5 A;  3GYO A;  5CLQ B;  3KRW A;  2EMT A;  3QBV B;  4EJN A;  2QKL A;  2P0D A;  4HHV A;  1RJ2 A;  5HE2 A;  4K17 A;  3ZDT A;  2N0Y A;  4GN1 A;  4HDQ A;  1XOD A;  5DIF B;  3U8Z A;  2J0J A;  2RSG A;  4TKN A;  3WYF B;  2Z0O A;  4GZU A;  3CXB B;  1MKE A;  3AJ4 A;  2Y7B A;  3VOQ A;  3KZ1 A;  2P0H A;  1U2B A;  2DX5 A;  3M1I B;  2KCJ A;  2LUL A;  3G9W A;  4GMV A;  1WGU A;  3A98 B;  5J3T A;  1DDM A;  3KY9 A;  2YF0 A;  5C6R A;  2DLW A;  1PMS A;  3HQC A;  2DN6 A;  2XQN M;  1Z87 A;  5HE3 A;  2PZ1 A;  3ODO A;  1SHC A;  1EVH A;  5LON B;  4Z2N A;  3ML4 A;  1NI2 A;  1WJM A;  1Y5O A;  4HAZ B;  4A5K A;  3WA0 A;  2I1K A;  4HB4 B;  2J0M A;  3TO1 A;  2D2Q A;  1OY2 A;  2ROV A;  1K5G B;  5KQ1 A;  1FGY A;  1EAZ A;  2R09 A;  2OQB A;  2GJY A;  3HK0 A;  1OQN A;  3PP2 A;  3SNH A;  2ELA A;  5DHF B;  1KI1 B;  3RCP A;  5C5B B;  1DDW A;  2Q13 A;  2YS3 A;  5FI0 A;  3TVV A;  1J19 A;  3BIN A;  3D8E A;  2L1C A;  1X11 A;  3ODW A;  4MY6 A;  5GOW B;  1WJ1 A;  1U5G A;  1AWE A;  2KGX B;  2D10 A;  1I2H A;  1IRS A;  4HDO A;  1ISN A;  3PSC A;  2HE7 A;  1MIX A;  2FJL A;  2GS0 A;  3HW2 B;  2AEH A;  1W1D A;  2YSZ A;  2KUP A;  3DXD A;  1UPQ A;  1FHW A;  1K5D B;  2J0K A;  5D3X A;  1LW3 A;  2Y8F A;  1I7A A;  2DYN A;  3UZT A;  1FHO A;  2DTC A;  4L6E A;  1ZSQ A;  4DBB A;  5C5B A;  5DH9 B;  4KVG B;  2D9X A;  1BWN A;  3DXC A;  4EKU A;  2RNR B;  4D0N B;  2ADZ A;  1Q67 A;  1WGQ A;  2ZPY A;  1BTN A;  1FB8 A;  4F7G A;  2DHI A;  1P6S A;  4A6F B;  5FI1 A;  2OTX A;  4CYE A;  1J0W A;  3GYP A;  3ULC A;  2DKQ A;  2LKO A;  1EF1 A;  4HB0 B;  2CY5 A;  1U27 A;  3N7C A;  4BBK A;  3PVW A;  5KQ4 A;  3BJI A;  2QKM A;  3O96 A;  1W1G A;  4YON A;  3SUZ A;  1PLS A;  3FEH A;  2H7E A;  1U5E A;  2DHJ A;  5J3Q A;  4K2O A;  1B55 A;  1XD4 A;  1X05 A;  3P6A A;  3VIA A;  2CRF A;  2HTH B;  1H10 A;  3FSS A; 
#chains in the Genus database with same CATH topology
 2KUQ A;  3DXE A;  4KHO A;  1DRO A;  4ZRJ A;  3NWD A;  2GUM A;  4HB2 B;  1FGZ A;  1TJ6 A;  3B77 A;  4PQ0 A;  4A6H A;  1XKE A;  4GPT B;  2NZ8 B;  5JP4 A;  1UPR A;  1UNP A;  2BCJ A;  1MIZ B;  2VRW B;  3DCX A;  4PNK A;  3CIK A;  3P7Z A;  2LYD A;  3MPX A;  3A8P A;  1U5D A;  2FJU B;  3TW1 A;  2RVB B;  5D3W A;  1V88 A;  3U7D A;  2COD A;  4L1R A;  1X1G A;  2DKP A;  3PVL A;  4IAP A;  2VKI A;  4QJ5 B;  4Z2M B;  2GCL A;  1P3R A;  2COF A;  2DYQ A;  2KIE A;  2Z0Q A;  2RGN B;  2EMS A;  2LG1 A;  2D9Y A;  4OT1 A;  2E2X A;  5L81 A;  2KR0 A;  4GXB A;  4KAX B;  2NBV A;  1V5P A;  3ZVR A;  2MWN B;  5KCV A;  1QC6 A;  2ROZ B;  4HAX B;  2N23 A;  2P8V A;  3OAN A;  3X23 A;  3NSU A;  2GCJ A;  4GNK B;  1V61 A;  4ZRK A;  1KZG A;  1P5T A;  1SGH A;  3HSA A;  1M7E A;  1E5W A;  1OMW A;  1NU2 A;  2UZR A;  4D6W A;  1RRP B;  3NWF A;  3NWA A;  2Z4D A;  2L2I A;  4CSQ A;  5IRS A;  1WG7 A;  2DHK A;  3KSY A;  2M38 A;  4Y94 A;  2G35 A;  4C0A A;  4GMX B;  4K2P A;  3FVC A;  2Z59 A;  3KRX A;  4CHM A;  3LJU X;  1UNR A;  4MK0 A;  2K8E A;  1BTK A;  1V5U A;  4XWX A;  3ULB A;  2YVC A;  3T06 A;  3A8Q A;  5D3Y A;  4DX8 A;  5HE0 A;  4WSF A;  1GC6 A;  1UNQ A;  4HAY B;  2UVM A;  2YT0 A;  5CLL B;  1BAK A;  2MKR A;  4K81 A;  1MPH A;  1FHX A;  1ZC4 B;  2R2Y A;  4HAV B;  1N3H A;  5JHH A;  4DX9 0;  3SO6 A;  4WJ7 A;  2H7D A;  3QWM A;  5HE1 A;  5C79 A;  2CY4 A;  2IYB A;  1Y19 B;  1DBH A;  4H8S A;  1GC7 A;  1FOE A;  2K00 A;  4DXA B;  2P0F A;  2LOZ A;  1ZC3 B;  2Z0P A;  3IVF A;  4ZRI A;  2D4Q A;  2I1J A;  3A58 A;  4KHB B;  3D8D A;  2X18 A;  4DIX A;  2K2J A;  2D9V A;  2K2U A;  4GOU A;  2VSZ A;  3D8F A;  3MDB C;  5D3V A;  5EFX A;  4YL8 A;  2I5C A;  2W2X D;  4HSI A;  5C16 A;  3NW8 A;  2V76 A;  3HIE A;  4EMO A;  2EJ8 A;  4P7I A;  5M4Y B;  2YS5 A;  2D9Z A;  1AQC A;  3PEG A;  1MAI A;  4A6F A;  1UEF A;  2ELB A;  1MK9 B;  1WI1 A;  4OSN A;  2MFQ A;  1QQG A;  2NMB A;  3PVU A;  4A6K A;  2W2W A;  2MDX A;  1WVH A;  4HAU B;  4TYZ A;  2RLO A;  4HAW B;  2DA0 A;  1EGX A;  5DHA B;  2YT1 A;  4HAT B;  1LB1 A;  2DFK A;  4KHA A;  1U5F A;  4QJ4 B;  4MT7 A;  2KIG A;  2IFS A;  3FM8 C;  1H4R A;  3PZD A;  5D27 A;  2Z13 A;  1DDV A;  1XCG A;  4CHJ A;  1DYN A;  4IOY X;  2LOX A;  1TXD A;  1ZVR A;  5JHG A;  4NSW A;  5JLJ B;  1ZM0 A;  5J3Y A;  1X1F A;  5DI9 B;  2DX1 A;  1NTY A;  3QIJ A;  4F7U P;  3F0W A;  1GG3 A;  1V5M A;  3F5R A;  2M14 A;  4NY0 A;  2RUK B;  2AL6 A;  2D9W A;  2I5F A;  1XX0 A;  1TQZ A;  1W1H A;  2COC A;  2UZS A;  2EC1 A;  1V89 A;  1XR0 B;  2W2X C;  5LOP B;  1M7R A;  1MK7 B;  4F7H A;  4HB3 B;  1FAO A;  3PG7 A;  2JP2 A;  2Y8G A;  1PFJ A;  3AU4 A;  3SV1 A;  3TFM A;  3V5W A;  2YS1 A;  3SYX A;  1U29 A;  1NTV A;  3TCA A;  2J59 M;  2YRY A;  4IFS A;  4B6H A;  2R0D A;  2D11 A;  1KZ7 A;  1X86 A;  2CAY A;  2COA A;  2YT2 A;  3ODX A;  1MI1 A;  4WVF B;  3AU5 A;  3GYO A;  5CLQ B;  3KRW A;  2EMT A;  3QBV B;  4EJN A;  2QKL A;  2P0D A;  4HHV A;  1RJ2 A;  5HE2 A;  4K17 A;  3ZDT A;  2N0Y A;  4GN1 A;  4HDQ A;  5I2M A;  1XOD A;  5DIF B;  3U8Z A;  2J0J A;  2RSG A;  4TKN A;  3WYF B;  2Z0O A;  4GZU A;  3CXB B;  1MKE A;  3AJ4 A;  2Y7B A;  3VOQ A;  3KZ1 A;  2P0H A;  1U2B A;  2DX5 A;  2Z14 A;  3M1I B;  2KCJ A;  2LUL A;  3G9W A;  4GMV A;  1WGU A;  3A98 B;  5J3T A;  1ZYI A;  1DDM A;  3KY9 A;  2YF0 A;  5C6R A;  2DLW A;  1PMS A;  3HQC A;  2DN6 A;  2XQN M;  1Z87 A;  5HE3 A;  2PZ1 A;  3ODO A;  1SHC A;  1EVH A;  5LON B;  4Z2N A;  3ML4 A;  1NI2 A;  1WJM A;  1Y5O A;  4HAZ B;  4A5K A;  3WA0 A;  3OHM B;  2I1K A;  4HB4 B;  2J0M A;  3TO1 A;  2D2Q A;  1OY2 A;  2ROV A;  1K5G B;  5KQ1 A;  1FGY A;  1EAZ A;  3U12 A;  2R09 A;  2OQB A;  2GJY A;  3HK0 A;  1OQN A;  3PP2 A;  3SNH A;  2ELA A;  5DHF B;  1KI1 B;  3RCP A;  5C5B B;  1DDW A;  5LG4 B;  2Q13 A;  2YS3 A;  5FI0 A;  3TVV A;  1J19 A;  3BIN A;  3D8E A;  2L1C A;  1X11 A;  3ODW A;  4MY6 A;  5GOW B;  1WJ1 A;  1U5G A;  1AWE A;  2KGX B;  2D10 A;  1I2H A;  1IRS A;  4HDO A;  1ISN A;  3PSC A;  2HE7 A;  1MIX A;  2FJL A;  2GS0 A;  3HW2 B;  2AEH A;  1W1D A;  2YSZ A;  2KUP A;  3DXD A;  4KHB A;  1UPQ A;  1FHW A;  1K5D B;  2J0K A;  5D3X A;  1LW3 A;  2Y8F A;  1I7A A;  2DYN A;  3UZT A;  1FHO A;  2DTC A;  4L6E A;  1ZSQ A;  4DBB A;  5C5B A;  5DH9 B;  4KVG B;  2D9X A;  1BWN A;  1T77 A;  3DXC A;  4EKU A;  2RNR B;  2K49 A;  4D0N B;  2ADZ A;  1Q67 A;  1WGQ A;  2ZPY A;  1BTN A;  1FB8 A;  4F7G A;  5I2S A;  2DHI A;  4QJ3 B;  1P6S A;  4A6F B;  5FI1 A;  2OTX A;  4CYE A;  1J0W A;  3GYP A;  3ULC A;  2DKQ A;  4QXA B;  2LKO A;  1EF1 A;  4HB0 B;  2CY5 A;  1U27 A;  2RRF A;  3N7C A;  4BBK A;  3PVW A;  5KQ4 A;  3BJI A;  2QKM A;  3O96 A;  1W1G A;  4YON A;  3SUZ A;  1PLS A;  3FEH A;  2H7E A;  1U5E A;  2ZKM X;  2DHJ A;  5J3Q A;  4K2O A;  1B55 A;  1XD4 A;  1X05 A;  3P6A A;  3VIA A;  2CRF A;  2HTH B;  1H10 A;  3FSS A; 
#chains in the Genus database with same CATH homology
 3DXE A;  4KHO A;  1DRO A;  4ZRJ A;  4HB2 B;  1FGZ A;  1TJ6 A;  4PQ0 A;  4A6H A;  1XKE A;  4GPT B;  2NZ8 B;  5JP4 A;  1UPR A;  1UNP A;  2BCJ A;  1MIZ B;  2VRW B;  4PNK A;  3CIK A;  3P7Z A;  2LYD A;  3MPX A;  3A8P A;  1U5D A;  3TW1 A;  2RVB B;  5D3W A;  1V88 A;  3U7D A;  2COD A;  1X1G A;  2DKP A;  3PVL A;  4IAP A;  2VKI A;  4Z2M B;  2GCL A;  1P3R A;  2COF A;  2DYQ A;  2Z0Q A;  2RGN B;  2EMS A;  2LG1 A;  2D9Y A;  2E2X A;  5L81 A;  4GXB A;  4KAX B;  1V5P A;  3ZVR A;  2MWN B;  5KCV A;  1QC6 A;  2ROZ B;  4HAX B;  2N23 A;  2P8V A;  3OAN A;  3X23 A;  3NSU A;  2GCJ A;  1V61 A;  4ZRK A;  1KZG A;  1P5T A;  1SGH A;  1M7E A;  1E5W A;  1OMW A;  1NU2 A;  2UZR A;  1RRP B;  2L2I A;  1WG7 A;  2DHK A;  3KSY A;  2M38 A;  4Y94 A;  2G35 A;  4C0A A;  4GMX B;  4K2P A;  3KRX A;  4CHM A;  3LJU X;  1UNR A;  4MK0 A;  1BTK A;  1V5U A;  4XWX A;  3ULB A;  2YVC A;  3T06 A;  3A8Q A;  5D3Y A;  4DX8 A;  5HE0 A;  4WSF A;  1GC6 A;  1UNQ A;  4HAY B;  2UVM A;  2YT0 A;  5CLL B;  1BAK A;  2MKR A;  4K81 A;  1MPH A;  1FHX A;  1ZC4 B;  4HAV B;  1N3H A;  5JHH A;  4DX9 0;  3SO6 A;  4WJ7 A;  2H7D A;  3QWM A;  5HE1 A;  5C79 A;  2CY4 A;  2IYB A;  1Y19 B;  1DBH A;  4H8S A;  1GC7 A;  1FOE A;  2K00 A;  4DXA B;  2P0F A;  2LOZ A;  1ZC3 B;  2Z0P A;  3IVF A;  4ZRI A;  2D4Q A;  2I1J A;  4KHB B;  3D8D A;  2X18 A;  2K2J A;  2D9V A;  2K2U A;  2VSZ A;  3D8F A;  3MDB C;  5D3V A;  5EFX A;  4YL8 A;  2I5C A;  2W2X D;  5C16 A;  2V76 A;  4EMO A;  2EJ8 A;  4P7I A;  2YS5 A;  2D9Z A;  1AQC A;  3PEG A;  1MAI A;  4A6F A;  1UEF A;  2ELB A;  1MK9 B;  1WI1 A;  2MFQ A;  1QQG A;  2NMB A;  3PVU A;  4A6K A;  2W2W A;  2MDX A;  1WVH A;  4HAU B;  4TYZ A;  2RLO A;  4HAW B;  2DA0 A;  1EGX A;  5DHA B;  2YT1 A;  4HAT B;  1LB1 A;  2DFK A;  4KHA A;  1U5F A;  4MT7 A;  2IFS A;  3FM8 C;  1H4R A;  3PZD A;  5D27 A;  1DDV A;  1XCG A;  4CHJ A;  1DYN A;  4IOY X;  2LOX A;  1TXD A;  1ZVR A;  5JHG A;  4NSW A;  5JLJ B;  1ZM0 A;  5J3Y A;  1X1F A;  5DI9 B;  2DX1 A;  1NTY A;  3QIJ A;  4F7U P;  3F0W A;  1GG3 A;  1V5M A;  3F5R A;  2M14 A;  4NY0 A;  2RUK B;  2AL6 A;  2D9W A;  2I5F A;  1XX0 A;  1TQZ A;  1W1H A;  2COC A;  2UZS A;  2EC1 A;  1V89 A;  1XR0 B;  2W2X C;  5LOP B;  1M7R A;  1MK7 B;  4F7H A;  4HB3 B;  1FAO A;  3PG7 A;  2JP2 A;  2Y8G A;  1PFJ A;  3AU4 A;  3SV1 A;  3TFM A;  3V5W A;  2YS1 A;  3SYX A;  1U29 A;  1NTV A;  3TCA A;  2J59 M;  2YRY A;  4IFS A;  4B6H A;  2R0D A;  2D11 A;  1KZ7 A;  1X86 A;  2CAY A;  2COA A;  3ODX A;  4WVF B;  3AU5 A;  3GYO A;  5CLQ B;  3KRW A;  2EMT A;  3QBV B;  4EJN A;  2QKL A;  2P0D A;  4HHV A;  1RJ2 A;  5HE2 A;  4K17 A;  3ZDT A;  2N0Y A;  4GN1 A;  4HDQ A;  1XOD A;  5DIF B;  3U8Z A;  2J0J A;  2RSG A;  4TKN A;  3WYF B;  2Z0O A;  4GZU A;  3CXB B;  1MKE A;  3AJ4 A;  2Y7B A;  3VOQ A;  3KZ1 A;  2P0H A;  1U2B A;  2DX5 A;  3M1I B;  2KCJ A;  2LUL A;  3G9W A;  4GMV A;  1WGU A;  3A98 B;  5J3T A;  1DDM A;  3KY9 A;  2YF0 A;  5C6R A;  2DLW A;  1PMS A;  3HQC A;  2DN6 A;  2XQN M;  1Z87 A;  5HE3 A;  2PZ1 A;  3ODO A;  1SHC A;  1EVH A;  5LON B;  4Z2N A;  3ML4 A;  1NI2 A;  1WJM A;  1Y5O A;  4HAZ B;  4A5K A;  3WA0 A;  2I1K A;  4HB4 B;  2J0M A;  3TO1 A;  2D2Q A;  1OY2 A;  2ROV A;  1K5G B;  5KQ1 A;  1FGY A;  1EAZ A;  2R09 A;  2OQB A;  2GJY A;  3HK0 A;  1OQN A;  3PP2 A;  3SNH A;  2ELA A;  5DHF B;  1KI1 B;  3RCP A;  5C5B B;  1DDW A;  2Q13 A;  2YS3 A;  5FI0 A;  3TVV A;  1J19 A;  3BIN A;  3D8E A;  2L1C A;  1X11 A;  3ODW A;  4MY6 A;  5GOW B;  1WJ1 A;  1U5G A;  1AWE A;  2KGX B;  2D10 A;  1I2H A;  1IRS A;  4HDO A;  1ISN A;  3PSC A;  2HE7 A;  1MIX A;  2FJL A;  2GS0 A;  3HW2 B;  2AEH A;  1W1D A;  2YSZ A;  2KUP A;  3DXD A;  1UPQ A;  1FHW A;  1K5D B;  2J0K A;  5D3X A;  1LW3 A;  2Y8F A;  1I7A A;  2DYN A;  3UZT A;  1FHO A;  2DTC A;  4L6E A;  1ZSQ A;  4DBB A;  5C5B A;  5DH9 B;  4KVG B;  2D9X A;  1BWN A;  3DXC A;  4EKU A;  2RNR B;  4D0N B;  2ADZ A;  1Q67 A;  1WGQ A;  2ZPY A;  1BTN A;  1FB8 A;  4F7G A;  2DHI A;  1P6S A;  4A6F B;  5FI1 A;  2OTX A;  4CYE A;  1J0W A;  3GYP A;  3ULC A;  2DKQ A;  2LKO A;  1EF1 A;  4HB0 B;  2CY5 A;  1U27 A;  3N7C A;  4BBK A;  3PVW A;  5KQ4 A;  3BJI A;  2QKM A;  3O96 A;  1W1G A;  4YON A;  3SUZ A;  1PLS A;  3FEH A;  2H7E A;  1U5E A;  2DHJ A;  5J3Q A;  4K2O A;  1B55 A;  1XD4 A;  1X05 A;  3P6A A;  3VIA A;  2CRF A;  2HTH B;  1H10 A;  3FSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...