4CHMA

Structure of inner membrane complex (imc) sub-compartment protein 1 (isp1) from toxoplasma gondii
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
SMASPQVTAADIEDLHRRLLAGMAVLVLLQDGTRLQCILHYNEADSSLSISCEDKVRVIPLSDIKALLHTRDQLQRVETKANLVDDESCVALHLLESGNCIPLRFDGVKDKTCFVDLLKKLKAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Inner Membrane Complex Sub-Compartment Proteins Critical for Replication of the Apicomplexan Parasite Toxoplasma Gondii Adopt a Pleckstrin Homology Fold
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Cell cycle
molecule keywords IMC SUB-COMPARTMENT PROTEIN ISP1
total genus 35
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18161 ISP1_C ISP1 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4chmA00
5C16A 1Y19B 2OQBA 1MK7B 2LKOA 1WG7A 2D10A 3HK0A 2D9ZA 3D8FA 4GMXB 2M38A 1DYNA 4WSFA 2J59M 1V5MA 2D9WA 3RCPA 4DBBA 1DROA 1DDMA 2H7EA 3ULCA 3AU5A 4NY0A 3TCAA 1U5DA 1UPQA 2CY4A 2V76A 3KSYA 5KCVA 3X23A 3WYFB 1I2HA 5J3QA 1UPRA 3MPXA 2ELAA 2UZRA 4HB0B 3A8PA 1NTYA 3OANA 2MFQA 4K2OA 1FAOA 2RVBB 5EFXA 2RUKB 2LOZA 1MKEA 2Y7BA 1I7AA 5J3YA 1BWNA 4KHAA 2GCLA 2COFA 3WA0A 1Y5OA 5HE0A 3TW1A 1FOEA 1QC6A 2DA0A 1M7RA 1GC7A 1FHXA 1AWEA 1NI2A 3VOQA 5C6RA 1FGZA 2DTCA 2EMTA 2N0YA 2RGNB 2MDXA 1SGHA 1X86A 2I5CA 2DKPA 2ROZB 2JP2A 2L1CA 4L6EA 1V5PA 1OMWA 4K2PA 3SO6A 1QQGA 2YS3A 5HE2A 2KGXB 4A6HA 4HDOA 4Z2NA 2VKIA 2ELBA 2D9YA 4ZRIA 1PLSA 1EF1A 3D8EA 3CIKA 2Y8GA 2J0JA 1H10A 1FGYA 3PEGA 4TYZA 4EMOA 2IYBA 3T06A 5HE3A 2YVCA 2EJ8A 1MK9B 4CYEA 1U5FA 2RNRB 4IOYX 4ZRJA 4MK0A 1U27A 3ODOA 5HE1A 5C79A 5FI0A 3VIAA 2VRWB 4CHJA 1X05A 1U2BA 3TFMA 4DXAB 1X1GA 5J3TA 2NZ8B 4GZUA 3MDBC 3GYOA 4Y94A 3ZDTA 4WJ7A 2LOXA 1U29A 2Z0OA 3U8ZA 5CLLB 1TQZA 4HDQA 3AJ4A 3ML4A 3UZTA 3O96A 3TVVA 2AEHA 5D27A 3AU4A 3A98B 1XX0A 5LONB 1BTKA 1V5UA 1J0WA 3G9WA 2GS0A 2YF0A 2YT1A 2DX5A 2QKLA 2YS1A 2R09A 4HAXB 4KHOA 1U5GA 1UEFA 4P7IA 2IFSA 3KZ1A 2AL6A 2D2QA 3A8QA 5GOWB 1FB8A 1NU2A 4NSWA 2COAA 3P7ZA 1ZM0A 1E5WA 4A6FA 1V61A 2DN6A 1K5DB 4F7GA 1OY2A 1K5GB 1WI1A 2HE7A 1UNQA 1XCGA 4F7HA 4C0AA 1EAZA 1X1FA 3F0WA 1ZVRA 2P8VA 5CLQB 4KVGB 5FI1A 1H4RA 2I1KA 2K2JA 5DHFB 3ODWA 4KAXB 1MIXA 4HAUB 4IFSA 1RJ2A 1DDWA 2RSGA 2YSZA 1KI1B 4BBKA 4A5KA 2D4QA 2W2XD 4D0NB 1N3HA 2P0HA 2J0KA 3PG7A 1M7EA 5JP4A 2VSZA 2ZPYA 3PP2A 4MT7A 1P5TA 2G35A 4HB4B 1OQNA 2DHKA 2KUPA 1WGQA 1GG3A 3ULBA 2LULA 1PFJA 1W1DA 1X11A 1AQCA 5D3VA 1EVHA 4Z2MB 3FEHA 3U7DA 2P0DA 1Z87A 3PVUA 3ZVRA 2D9VA 2YT0A 2DHJA 1XR0B 4F7UP 4XWXA 1P6SA 3F5RA 2N23A 1WJ1A 3PSCA 4A6FB 4HAVB 3D8DA 1IRSA 3GYPA 2CY5A 2K2UA 4DX90 2H7DA 2FJLA 1J19A 2EC1A 1UNPA 3TO1A 3ODXA 4KHBB 2ADZA 1MPHA 4IAPA 3DXCA 1W1HA 4GPTB 1PMSA 2QKMA 2HTHB 2Z0PA 1LB1A 4DX8A 5JLJB 1UNRA 4TKNA 1FHOA 2Y8FA 2MKRA 4K81A 2CAYA 3BJIA 3BINA 2CRFA 1GC6A 4PQ0A 5D3WA 2CODA 3SV1A 2GJYA 4CHMA 3NSUA 1ZC4B 1EGXA 1WJMA 5DI9B 3KY9A 3PVWA 1BTNA 1V88A 2K00A 1WGUA 5LOPB 4HB3B 1TXDA 4H8SA 4A6KA 5JHHA 2Z0QA 4MY6A 1ZC3B 3V5WA 1XD4A 5DHAB 5D3YA 2KCJA 3KRXA 2J0MA 3CXBB 2COCA 4HAWB 1WVHA 3N7CA 3QIJA 4HAYB 4GN1A 2MWNB 1ISNA 2ROVA 4GXBA 4K17A 5JHGA 5DH9B 1SHCA 4HAZB 3IVFA 2XQNM 4YONA 1FHWA 4EJNA 1NTVA 2W2XC 2YRYA 1TJ6A 4WVFB 5L81A 1Q67A 2L2IA 1KZ7A 2I1JA 5KQ1A 2X18A 2GCJA 2NMBA 2Q13A 1RRPB 1U5EA 2E2XA 2M14A 1BAKA 2DHIA 1KZGA 2EMSA 1MIZB 2DX1A 3DXEA 2DLWA 2D9XA 3M1IB 3QWMA 2P0FA 2UZSA 5C5BA 2DYQA 4EKUA 1P3RA 3KRWA 2PZ1A 4YL8A 3P6AA 4HHVA 2UVMA 3PVLA 2DKQA 5DIFB 1XKEA 1DBHA 2D11A 5C5BB 2YS5A 3HW2B 1XODA 3FM8C 1MAIA 2I5FA 3SNHA 3HQCA 4GMVA 2R0DA 1DDVA 3PZDA 2DYNA 2LG1A 3SUZA 2W2WA 5KQ4A 2DFKA 2OTXA 4PNKA 3DXDA 1W1GA 1B55A 1ZSQA 1V89A 3QBVB 4ZRKA 3LJUX 2BCJA 2RLOA 4B6HA 4HATB 5D3XA 3FSSA 1LW3A 3SYXA 2LYDA 4HB2B
chains in the Genus database with same CATH superfamily
5C16A 1Y19B 2OQBA 4DIXA 1MK7B 2LKOA 1WG7A 5IRSA 2D10A 3HK0A 2D9ZA 3D8FA 4GMXB 2M38A 1DYNA 4WSFA 2K49A 2J59M 1V5MA 2D9WA 3RCPA 4DBBA 1DROA 1DDMA 2H7EA 3ULCA 3AU5A 4NY0A 1MI1A 3TCAA 1U5DA 1UPQA 2CY4A 2V76A 3KSYA 5KCVA 3X23A 3WYFB 1I2HA 5J3QA 1UPRA 4HB2B 3MPXA 2ELAA 2UZRA 4HB0B 3A8PA 1NTYA 3OANA 2MFQA 4K2OA 1FAOA 2RVBB 5EFXA 2RUKB 2LOZA 1MKEA 2Y7BA 1I7AA 5J3YA 1BWNA 4KHAA 2GCLA 2COFA 3WA0A 1Y5OA 5HE0A 3TW1A 1FOEA 1QC6A 2DA0A 1M7RA 1GC7A 1FHXA 1AWEA 1NI2A 3VOQA 5C6RA 1FGZA 2DTCA 2EMTA 2N0YA 2RGNB 2Z4DA 2MDXA 1SGHA 1X86A 2I5CA 2DKPA 2ROZB 2JP2A 2L1CA 4L6EA 1V5PA 1OMWA 5M4YB 4K2PA 3SO6A 1QQGA 2YS3A 5HE2A 2KGXB 4A6HA 4HDOA 4Z2NA 2VKIA 2ELBA 2D9YA 2KIEA 4ZRIA 1PLSA 1EF1A 3D8EA 3CIKA 2Y8GA 2J0JA 1H10A 1FGYA 3PEGA 4TYZA 4EMOA 2IYBA 3T06A 5HE3A 2YVCA 2EJ8A 1MK9B 4CYEA 2RRFA 1U5FA 1ZYIA 2RNRB 3NW8A 4IOYX 4ZRJA 4MK0A 1U27A 3ODOA 5HE1A 5C79A 5FI0A 3VIAA 2VRWB 4CHJA 1X05A 1U2BA 3NWDA 3TFMA 4DXAB 1X1GA 2FJUB 5J3TA 2NZ8B 4GZUA 3MDBC 3GYOA 3HIEA 4Y94A 4CSQA 3ZDTA 4WJ7A 3NWAA 2LOXA 1U29A 2Z0OA 3U8ZA 5CLLB 1TQZA 3OHMB 4HDQA 3AJ4A 3ML4A 3UZTA 3O96A 3TVVA 2AEHA 4QJ3B 5D27A 3AU4A 2K8EA 3A98B 1XX0A 2KUQA 5LONB 1BTKA 1V5UA 1J0WA 2YT2A 3G9WA 2GS0A 2YF0A 2Z59A 2YT1A 2DX5A 2QKLA 2YS1A 2R09A 4HAXB 4KHOA 1U5GA 1UEFA 4P7IA 2GUMA 4D6WA 2IFSA 3KZ1A 2AL6A 2D2QA 3A8QA 5GOWB 3U12A 1FB8A 1NU2A 4NSWA 2COAA 1ZM0A 1E5WA 4A6FA 1V61A 2DN6A 1K5DB 4F7GA 1OY2A 1K5GB 1WI1A 2HE7A 1UNQA 1XCGA 4F7HA 4C0AA 1EAZA 1X1FA 3F0WA 1ZVRA 2P8VA 5I2MA 5CLQB 4KVGB 5FI1A 1H4RA 2I1KA 2K2JA 5DHFB 3ODWA 4KAXB 1MIXA 4HAUB 4IFSA 1RJ2A 1DDWA 2YSZA 2RSGA 2R2YA 1KI1B 4BBKA 4A5KA 2D4QA 2W2XD 4D0NB 1N3HA 2P0HA 2J0KA 3A58A 3PG7A 2Z13A 1M7EA 5JP4A 2VSZA 2ZPYA 3PP2A 4MT7A 1P5TA 2G35A 4HB4B 1OQNA 2DHKA 2KUPA 1WGQA 1GG3A 3ULBA 3DCXA 2LULA 1PFJA 4GOUA 1W1DA 1X11A 1AQCA 5D3VA 1EVHA 3FVCA 4QJ4B 2ZKMX 4Z2MB 3FEHA 3U7DA 2P0DA 1Z87A 3PVUA 3ZVRA 2D9VA 2NBVA 3HSAA 2YT0A 2DHJA 1XR0B 4F7UP 4XWXA 1P6SA 3F5RA 2N23A 1WJ1A 3PSCA 4A6FB 4HAVB 3D8DA 1IRSA 3GYPA 2CY5A 2K2UA 4DX90 2H7DA 2FJLA 1J19A 2EC1A 4QXAB 1UNPA 3TO1A 3ODXA 1T77A 4KHBB 3NWFA 2ADZA 1MPHA 4IAPA 3DXCA 1W1HA 4GPTB 1PMSA 2QKMA 2HTHB 2Z0PA 1LB1A 4DX8A 5JLJB 1UNRA 4TKNA 1FHOA 2Y8FA 2MKRA 2CAYA 4K81A 3BJIA 3BINA 2CRFA 5LG4B 1GC6A 4PQ0A 5D3WA 2CODA 3SV1A 3B77A 2GJYA 4CHMA 3NSUA 1ZC4B 1EGXA 1WJMA 5DI9B 3KY9A 3PVWA 1BTNA 1V88A 2K00A 1WGUA 5LOPB 4HB3B 1TXDA 4H8SA 4A6KA 5JHHA 2Z0QA 4MY6A 1ZC3B 3V5WA 1XD4A 5DHAB 5D3YA 2KCJA 4QJ5B 3KRXA 2J0MA 3CXBB 4OT1A 2COCA 4HAWB 1WVHA 3N7CA 3QIJA 4HAYB 4GN1A 2MWNB 1ISNA 2ROVA 4GXBA 4K17A 5JHGA 5DH9B 1SHCA 4HAZB 3IVFA 2XQNM 4YONA 1FHWA 4EJNA 1NTVA 2W2XC 2YRYA 1TJ6A 4WVFB 5L81A 1Q67A 2L2IA 1KZ7A 2I1JA 5KQ1A 2X18A 4L1RA 2GCJA 2NMBA 2Q13A 1RRPB 1U5EA 2E2XA 2M14A 1BAKA 2DHIA 1KZGA 2EMSA 4HSIA 1MIZB 2DX1A 3DXEA 2DLWA 2D9XA 3M1IB 3QWMA 2P0FA 2UZSA 5C5BA 2DYQA 4EKUA 1P3RA 3KRWA 2PZ1A 4YL8A 3P6AA 4HHVA 4GNKB 2UVMA 3PVLA 2DKQA 5DIFB 1XKEA 1DBHA 2D11A 5C5BB 2YS5A 3HW2B 1XODA 2Z14A 3FM8C 5I2SA 1MAIA 2I5FA 2KIGA 3SNHA 3HQCA 4GMVA 2R0DA 1DDVA 3PZDA 2DYNA 2KR0A 4OSNA 2LG1A 3SUZA 2W2WA 5KQ4A 2DFKA 4KHBA 2OTXA 4PNKA 3DXDA 1W1GA 1B55A 1ZSQA 1V89A 3QBVB 4ZRKA 3LJUX 2BCJA 2RLOA 4B6HA 4HATB 5D3XA 3FSSA 1LW3A 3SYXA 2LYDA 3P7ZA
chains in the Genus database with same CATH topology
5C16A 1Y19B 2OQBA 1MK7B 2LKOA 1WG7A 2D10A 3HK0A 2D9ZA 3D8FA 4GMXB 2M38A 1DYNA 4WSFA 2J59M 1V5MA 2D9WA 3RCPA 4DBBA 1DROA 1DDMA 2H7EA 3ULCA 3AU5A 4NY0A 3TCAA 1U5DA 1UPQA 2CY4A 2V76A 3KSYA 5KCVA 3X23A 3WYFB 1I2HA 5J3QA 1UPRA 3MPXA 2ELAA 2UZRA 4HB0B 3A8PA 1NTYA 3OANA 2MFQA 4K2OA 1FAOA 2RVBB 5EFXA 2RUKB 2LOZA 1MKEA 2Y7BA 1I7AA 5J3YA 1BWNA 4KHAA 2GCLA 2COFA 3WA0A 1Y5OA 5HE0A 3TW1A 1FOEA 1QC6A 2DA0A 1M7RA 1GC7A 1FHXA 1AWEA 1NI2A 3VOQA 5C6RA 1FGZA 2DTCA 2EMTA 2N0YA 2RGNB 2MDXA 1SGHA 1X86A 2I5CA 2DKPA 2ROZB 2JP2A 2L1CA 4L6EA 1V5PA 1OMWA 4K2PA 3SO6A 1QQGA 2YS3A 5HE2A 2KGXB 4A6HA 4HDOA 4Z2NA 2VKIA 2ELBA 2D9YA 4ZRIA 1PLSA 1EF1A 3D8EA 3CIKA 2Y8GA 2J0JA 1H10A 1FGYA 3PEGA 4TYZA 4EMOA 2IYBA 3T06A 5HE3A 2YVCA 2EJ8A 1MK9B 4CYEA 1U5FA 2RNRB 4IOYX 4ZRJA 4MK0A 1U27A 3ODOA 5HE1A 5C79A 5FI0A 3VIAA 2VRWB 4CHJA 1X05A 1U2BA 3TFMA 4DXAB 1X1GA 5J3TA 2NZ8B 4GZUA 3MDBC 3GYOA 4Y94A 3ZDTA 4WJ7A 2LOXA 1U29A 2Z0OA 3U8ZA 5CLLB 1TQZA 4HDQA 3AJ4A 3ML4A 3UZTA 3O96A 3TVVA 2AEHA 5D27A 3AU4A 3A98B 1XX0A 5LONB 1BTKA 1V5UA 1J0WA 3G9WA 2GS0A 2YF0A 2YT1A 2DX5A 2QKLA 2YS1A 2R09A 4HAXB 4KHOA 1U5GA 1UEFA 4P7IA 2IFSA 3KZ1A 2AL6A 2D2QA 3A8QA 5GOWB 1FB8A 1NU2A 4NSWA 2COAA 3P7ZA 1ZM0A 1E5WA 4A6FA 1V61A 2DN6A 1K5DB 4F7GA 1OY2A 1K5GB 1WI1A 2HE7A 1UNQA 1XCGA 4F7HA 4C0AA 1EAZA 1X1FA 3F0WA 1ZVRA 2P8VA 5CLQB 4KVGB 5FI1A 1H4RA 2I1KA 2K2JA 5DHFB 3ODWA 4KAXB 1MIXA 4HAUB 4IFSA 1RJ2A 1DDWA 2RSGA 2YSZA 1KI1B 4BBKA 4A5KA 2D4QA 2W2XD 4D0NB 1N3HA 2P0HA 2J0KA 3PG7A 1M7EA 5JP4A 2VSZA 2ZPYA 3PP2A 4MT7A 1P5TA 2G35A 4HB4B 1OQNA 2DHKA 2KUPA 1WGQA 1GG3A 3ULBA 2LULA 1PFJA 1W1DA 1X11A 1AQCA 5D3VA 1EVHA 4Z2MB 3FEHA 3U7DA 2P0DA 1Z87A 3PVUA 3ZVRA 2D9VA 2YT0A 2DHJA 1XR0B 4F7UP 4XWXA 1P6SA 3F5RA 2N23A 1WJ1A 3PSCA 4A6FB 4HAVB 3D8DA 1IRSA 3GYPA 2CY5A 2K2UA 4DX90 2H7DA 2FJLA 1J19A 2EC1A 1UNPA 3TO1A 3ODXA 4KHBB 2ADZA 1MPHA 4IAPA 3DXCA 1W1HA 4GPTB 1PMSA 2QKMA 2HTHB 2Z0PA 1LB1A 4DX8A 5JLJB 1UNRA 4TKNA 1FHOA 2Y8FA 2MKRA 4K81A 2CAYA 3BJIA 3BINA 2CRFA 1GC6A 4PQ0A 5D3WA 2CODA 3SV1A 2GJYA 4CHMA 3NSUA 1ZC4B 1EGXA 1WJMA 5DI9B 3KY9A 3PVWA 1BTNA 1V88A 2K00A 1WGUA 5LOPB 4HB3B 1TXDA 4H8SA 4A6KA 5JHHA 2Z0QA 4MY6A 1ZC3B 3V5WA 1XD4A 5DHAB 5D3YA 2KCJA 3KRXA 2J0MA 3CXBB 2COCA 4HAWB 1WVHA 3N7CA 3QIJA 4HAYB 4GN1A 2MWNB 1ISNA 2ROVA 4GXBA 4K17A 5JHGA 5DH9B 1SHCA 4HAZB 3IVFA 2XQNM 4YONA 1FHWA 4EJNA 1NTVA 2W2XC 2YRYA 1TJ6A 4WVFB 5L81A 1Q67A 2L2IA 1KZ7A 2I1JA 5KQ1A 2X18A 2GCJA 2NMBA 2Q13A 1RRPB 1U5EA 2E2XA 2M14A 1BAKA 2DHIA 1KZGA 2EMSA 1MIZB 2DX1A 3DXEA 2DLWA 2D9XA 3M1IB 3QWMA 2P0FA 2UZSA 5C5BA 2DYQA 4EKUA 1P3RA 3KRWA 2PZ1A 4YL8A 3P6AA 4HHVA 2UVMA 3PVLA 2DKQA 5DIFB 1XKEA 1DBHA 2D11A 5C5BB 2YS5A 3HW2B 1XODA 3FM8C 1MAIA 2I5FA 3SNHA 3HQCA 4GMVA 2R0DA 1DDVA 3PZDA 2DYNA 2LG1A 3SUZA 2W2WA 5KQ4A 2DFKA 2OTXA 4PNKA 3DXDA 1W1GA 1B55A 1ZSQA 1V89A 3QBVB 4ZRKA 3LJUX 2BCJA 2RLOA 4B6HA 4HATB 5D3XA 3FSSA 1LW3A 3SYXA 2LYDA 4HB2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C16 A;  1Y19 B;  2OQB A;  1MK7 B;  2LKO A;  1WG7 A;  2D10 A;  3HK0 A;  2D9Z A;  3D8F A;  4GMX B;  2M38 A;  1DYN A;  4WSF A;  2J59 M;  1V5M A;  2D9W A;  3RCP A;  4DBB A;  1DRO A;  1DDM A;  2H7E A;  3ULC A;  3AU5 A;  4NY0 A;  3TCA A;  1U5D A;  1UPQ A;  2CY4 A;  2V76 A;  3KSY A;  5KCV A;  3X23 A;  3WYF B;  1I2H A;  5J3Q A;  1UPR A;  3MPX A;  2ELA A;  2UZR A;  4HB0 B;  3A8P A;  1NTY A;  3OAN A;  2MFQ A;  4K2O A;  1FAO A;  2RVB B;  5EFX A;  2RUK B;  2LOZ A;  1MKE A;  2Y7B A;  1I7A A;  5J3Y A;  1BWN A;  4KHA A;  2GCL A;  2COF A;  3WA0 A;  1Y5O A;  5HE0 A;  3TW1 A;  1FOE A;  1QC6 A;  2DA0 A;  1M7R A;  1GC7 A;  1FHX A;  1AWE A;  1NI2 A;  3VOQ A;  5C6R A;  1FGZ A;  2DTC A;  2EMT A;  2N0Y A;  2RGN B;  2MDX A;  1SGH A;  1X86 A;  2I5C A;  2DKP A;  2ROZ B;  2JP2 A;  2L1C A;  4L6E A;  1V5P A;  1OMW A;  4K2P A;  3SO6 A;  1QQG A;  2YS3 A;  5HE2 A;  2KGX B;  4A6H A;  4HDO A;  4Z2N A;  2VKI A;  2ELB A;  2D9Y A;  4ZRI A;  1PLS A;  1EF1 A;  3D8E A;  3CIK A;  2Y8G A;  2J0J A;  1H10 A;  1FGY A;  3PEG A;  4TYZ A;  4EMO A;  2IYB A;  3T06 A;  5HE3 A;  2YVC A;  2EJ8 A;  1MK9 B;  4CYE A;  1U5F A;  2RNR B;  4IOY X;  4ZRJ A;  4MK0 A;  1U27 A;  3ODO A;  5HE1 A;  5C79 A;  5FI0 A;  3VIA A;  2VRW B;  4CHJ A;  1X05 A;  1U2B A;  3TFM A;  4DXA B;  1X1G A;  5J3T A;  2NZ8 B;  4GZU A;  3MDB C;  3GYO A;  4Y94 A;  3ZDT A;  4WJ7 A;  2LOX A;  1U29 A;  2Z0O A;  3U8Z A;  5CLL B;  1TQZ A;  4HDQ A;  3AJ4 A;  3ML4 A;  3UZT A;  3O96 A;  3TVV A;  2AEH A;  5D27 A;  3AU4 A;  3A98 B;  1XX0 A;  5LON B;  1BTK A;  1V5U A;  1J0W A;  3G9W A;  2GS0 A;  2YF0 A;  2YT1 A;  2DX5 A;  2QKL A;  2YS1 A;  2R09 A;  4HAX B;  4KHO A;  1U5G A;  1UEF A;  4P7I A;  2IFS A;  3KZ1 A;  2AL6 A;  2D2Q A;  3A8Q A;  5GOW B;  1FB8 A;  1NU2 A;  4NSW A;  2COA A;  3P7Z A;  1ZM0 A;  1E5W A;  4A6F A;  1V61 A;  2DN6 A;  1K5D B;  4F7G A;  1OY2 A;  1K5G B;  1WI1 A;  2HE7 A;  1UNQ A;  1XCG A;  4F7H A;  4C0A A;  1EAZ A;  1X1F A;  3F0W A;  1ZVR A;  2P8V A;  5CLQ B;  4KVG B;  5FI1 A;  1H4R A;  2I1K A;  2K2J A;  5DHF B;  3ODW A;  4KAX B;  1MIX A;  4HAU B;  4IFS A;  1RJ2 A;  1DDW A;  2RSG A;  2YSZ A;  1KI1 B;  4BBK A;  4A5K A;  2D4Q A;  2W2X D;  4D0N B;  1N3H A;  2P0H A;  2J0K A;  3PG7 A;  1M7E A;  5JP4 A;  2VSZ A;  2ZPY A;  3PP2 A;  4MT7 A;  1P5T A;  2G35 A;  4HB4 B;  1OQN A;  2DHK A;  2KUP A;  1WGQ A;  1GG3 A;  3ULB A;  2LUL A;  1PFJ A;  1W1D A;  1X11 A;  1AQC A;  5D3V A;  1EVH A;  4Z2M B;  3FEH A;  3U7D A;  2P0D A;  1Z87 A;  3PVU A;  3ZVR A;  2D9V A;  2YT0 A;  2DHJ A;  1XR0 B;  4F7U P;  4XWX A;  1P6S A;  3F5R A;  2N23 A;  1WJ1 A;  3PSC A;  4A6F B;  4HAV B;  3D8D A;  1IRS A;  3GYP A;  2CY5 A;  2K2U A;  4DX9 0;  2H7D A;  2FJL A;  1J19 A;  2EC1 A;  1UNP A;  3TO1 A;  3ODX A;  4KHB B;  2ADZ A;  1MPH A;  4IAP A;  3DXC A;  1W1H A;  4GPT B;  1PMS A;  2QKM A;  2HTH B;  2Z0P A;  1LB1 A;  4DX8 A;  5JLJ B;  1UNR A;  4TKN A;  1FHO A;  2Y8F A;  2MKR A;  4K81 A;  2CAY A;  3BJI A;  3BIN A;  2CRF A;  1GC6 A;  4PQ0 A;  5D3W A;  2COD A;  3SV1 A;  2GJY A;  4CHM A;  3NSU A;  1ZC4 B;  1EGX A;  1WJM A;  5DI9 B;  3KY9 A;  3PVW A;  1BTN A;  1V88 A;  2K00 A;  1WGU A;  5LOP B;  4HB3 B;  1TXD A;  4H8S A;  4A6K A;  5JHH A;  2Z0Q A;  4MY6 A;  1ZC3 B;  3V5W A;  1XD4 A;  5DHA B;  5D3Y A;  2KCJ A;  3KRX A;  2J0M A;  3CXB B;  2COC A;  4HAW B;  1WVH A;  3N7C A;  3QIJ A;  4HAY B;  4GN1 A;  2MWN B;  1ISN A;  2ROV A;  4GXB A;  4K17 A;  5JHG A;  5DH9 B;  1SHC A;  4HAZ B;  3IVF A;  2XQN M;  4YON A;  1FHW A;  4EJN A;  1NTV A;  2W2X C;  2YRY A;  1TJ6 A;  4WVF B;  5L81 A;  1Q67 A;  2L2I A;  1KZ7 A;  2I1J A;  5KQ1 A;  2X18 A;  2GCJ A;  2NMB A;  2Q13 A;  1RRP B;  1U5E A;  2E2X A;  2M14 A;  1BAK A;  2DHI A;  1KZG A;  2EMS A;  1MIZ B;  2DX1 A;  3DXE A;  2DLW A;  2D9X A;  3M1I B;  3QWM A;  2P0F A;  2UZS A;  5C5B A;  2DYQ A;  4EKU A;  1P3R A;  3KRW A;  2PZ1 A;  4YL8 A;  3P6A A;  4HHV A;  2UVM A;  3PVL A;  2DKQ A;  5DIF B;  1XKE A;  1DBH A;  2D11 A;  5C5B B;  2YS5 A;  3HW2 B;  1XOD A;  3FM8 C;  1MAI A;  2I5F A;  3SNH A;  3HQC A;  4GMV A;  2R0D A;  1DDV A;  3PZD A;  2DYN A;  2LG1 A;  3SUZ A;  2W2W A;  5KQ4 A;  2DFK A;  2OTX A;  4PNK A;  3DXD A;  1W1G A;  1B55 A;  1ZSQ A;  1V89 A;  3QBV B;  4ZRK A;  3LJU X;  2BCJ A;  2RLO A;  4B6H A;  4HAT B;  5D3X A;  3FSS A;  1LW3 A;  3SYX A;  2LYD A;  4HB2 B; 
#chains in the Genus database with same CATH topology
 5C16 A;  1Y19 B;  2OQB A;  4DIX A;  1MK7 B;  2LKO A;  1WG7 A;  5IRS A;  2D10 A;  3HK0 A;  2D9Z A;  3D8F A;  4GMX B;  2M38 A;  1DYN A;  4WSF A;  2K49 A;  2J59 M;  1V5M A;  2D9W A;  3RCP A;  4DBB A;  1DRO A;  1DDM A;  2H7E A;  3ULC A;  3AU5 A;  4NY0 A;  1MI1 A;  3TCA A;  1U5D A;  1UPQ A;  2CY4 A;  2V76 A;  3KSY A;  5KCV A;  3X23 A;  3WYF B;  1I2H A;  5J3Q A;  1UPR A;  4HB2 B;  3MPX A;  2ELA A;  2UZR A;  4HB0 B;  3A8P A;  1NTY A;  3OAN A;  2MFQ A;  4K2O A;  1FAO A;  2RVB B;  5EFX A;  2RUK B;  2LOZ A;  1MKE A;  2Y7B A;  1I7A A;  5J3Y A;  1BWN A;  4KHA A;  2GCL A;  2COF A;  3WA0 A;  1Y5O A;  5HE0 A;  3TW1 A;  1FOE A;  1QC6 A;  2DA0 A;  1M7R A;  1GC7 A;  1FHX A;  1AWE A;  1NI2 A;  3VOQ A;  5C6R A;  1FGZ A;  2DTC A;  2EMT A;  2N0Y A;  2RGN B;  2Z4D A;  2MDX A;  1SGH A;  1X86 A;  2I5C A;  2DKP A;  2ROZ B;  2JP2 A;  2L1C A;  4L6E A;  1V5P A;  1OMW A;  5M4Y B;  4K2P A;  3SO6 A;  1QQG A;  2YS3 A;  5HE2 A;  2KGX B;  4A6H A;  4HDO A;  4Z2N A;  2VKI A;  2ELB A;  2D9Y A;  2KIE A;  4ZRI A;  1PLS A;  1EF1 A;  3D8E A;  3CIK A;  2Y8G A;  2J0J A;  1H10 A;  1FGY A;  3PEG A;  4TYZ A;  4EMO A;  2IYB A;  3T06 A;  5HE3 A;  2YVC A;  2EJ8 A;  1MK9 B;  4CYE A;  2RRF A;  1U5F A;  1ZYI A;  2RNR B;  3NW8 A;  4IOY X;  4ZRJ A;  4MK0 A;  1U27 A;  3ODO A;  5HE1 A;  5C79 A;  5FI0 A;  3VIA A;  2VRW B;  4CHJ A;  1X05 A;  1U2B A;  3NWD A;  3TFM A;  4DXA B;  1X1G A;  2FJU B;  5J3T A;  2NZ8 B;  4GZU A;  3MDB C;  3GYO A;  3HIE A;  4Y94 A;  4CSQ A;  3ZDT A;  4WJ7 A;  3NWA A;  2LOX A;  1U29 A;  2Z0O A;  3U8Z A;  5CLL B;  1TQZ A;  3OHM B;  4HDQ A;  3AJ4 A;  3ML4 A;  3UZT A;  3O96 A;  3TVV A;  2AEH A;  4QJ3 B;  5D27 A;  3AU4 A;  2K8E A;  3A98 B;  1XX0 A;  2KUQ A;  5LON B;  1BTK A;  1V5U A;  1J0W A;  2YT2 A;  3G9W A;  2GS0 A;  2YF0 A;  2Z59 A;  2YT1 A;  2DX5 A;  2QKL A;  2YS1 A;  2R09 A;  4HAX B;  4KHO A;  1U5G A;  1UEF A;  4P7I A;  2GUM A;  4D6W A;  2IFS A;  3KZ1 A;  2AL6 A;  2D2Q A;  3A8Q A;  5GOW B;  3U12 A;  1FB8 A;  1NU2 A;  4NSW A;  2COA A;  1ZM0 A;  1E5W A;  4A6F A;  1V61 A;  2DN6 A;  1K5D B;  4F7G A;  1OY2 A;  1K5G B;  1WI1 A;  2HE7 A;  1UNQ A;  1XCG A;  4F7H A;  4C0A A;  1EAZ A;  1X1F A;  3F0W A;  1ZVR A;  2P8V A;  5I2M A;  5CLQ B;  4KVG B;  5FI1 A;  1H4R A;  2I1K A;  2K2J A;  5DHF B;  3ODW A;  4KAX B;  1MIX A;  4HAU B;  4IFS A;  1RJ2 A;  1DDW A;  2YSZ A;  2RSG A;  2R2Y A;  1KI1 B;  4BBK A;  4A5K A;  2D4Q A;  2W2X D;  4D0N B;  1N3H A;  2P0H A;  2J0K A;  3A58 A;  3PG7 A;  2Z13 A;  1M7E A;  5JP4 A;  2VSZ A;  2ZPY A;  3PP2 A;  4MT7 A;  1P5T A;  2G35 A;  4HB4 B;  1OQN A;  2DHK A;  2KUP A;  1WGQ A;  1GG3 A;  3ULB A;  3DCX A;  2LUL A;  1PFJ A;  4GOU A;  1W1D A;  1X11 A;  1AQC A;  5D3V A;  1EVH A;  3FVC A;  4QJ4 B;  2ZKM X;  4Z2M B;  3FEH A;  3U7D A;  2P0D A;  1Z87 A;  3PVU A;  3ZVR A;  2D9V A;  2NBV A;  3HSA A;  2YT0 A;  2DHJ A;  1XR0 B;  4F7U P;  4XWX A;  1P6S A;  3F5R A;  2N23 A;  1WJ1 A;  3PSC A;  4A6F B;  4HAV B;  3D8D A;  1IRS A;  3GYP A;  2CY5 A;  2K2U A;  4DX9 0;  2H7D A;  2FJL A;  1J19 A;  2EC1 A;  4QXA B;  1UNP A;  3TO1 A;  3ODX A;  1T77 A;  4KHB B;  3NWF A;  2ADZ A;  1MPH A;  4IAP A;  3DXC A;  1W1H A;  4GPT B;  1PMS A;  2QKM A;  2HTH B;  2Z0P A;  1LB1 A;  4DX8 A;  5JLJ B;  1UNR A;  4TKN A;  1FHO A;  2Y8F A;  2MKR A;  2CAY A;  4K81 A;  3BJI A;  3BIN A;  2CRF A;  5LG4 B;  1GC6 A;  4PQ0 A;  5D3W A;  2COD A;  3SV1 A;  3B77 A;  2GJY A;  4CHM A;  3NSU A;  1ZC4 B;  1EGX A;  1WJM A;  5DI9 B;  3KY9 A;  3PVW A;  1BTN A;  1V88 A;  2K00 A;  1WGU A;  5LOP B;  4HB3 B;  1TXD A;  4H8S A;  4A6K A;  5JHH A;  2Z0Q A;  4MY6 A;  1ZC3 B;  3V5W A;  1XD4 A;  5DHA B;  5D3Y A;  2KCJ A;  4QJ5 B;  3KRX A;  2J0M A;  3CXB B;  4OT1 A;  2COC A;  4HAW B;  1WVH A;  3N7C A;  3QIJ A;  4HAY B;  4GN1 A;  2MWN B;  1ISN A;  2ROV A;  4GXB A;  4K17 A;  5JHG A;  5DH9 B;  1SHC A;  4HAZ B;  3IVF A;  2XQN M;  4YON A;  1FHW A;  4EJN A;  1NTV A;  2W2X C;  2YRY A;  1TJ6 A;  4WVF B;  5L81 A;  1Q67 A;  2L2I A;  1KZ7 A;  2I1J A;  5KQ1 A;  2X18 A;  4L1R A;  2GCJ A;  2NMB A;  2Q13 A;  1RRP B;  1U5E A;  2E2X A;  2M14 A;  1BAK A;  2DHI A;  1KZG A;  2EMS A;  4HSI A;  1MIZ B;  2DX1 A;  3DXE A;  2DLW A;  2D9X A;  3M1I B;  3QWM A;  2P0F A;  2UZS A;  5C5B A;  2DYQ A;  4EKU A;  1P3R A;  3KRW A;  2PZ1 A;  4YL8 A;  3P6A A;  4HHV A;  4GNK B;  2UVM A;  3PVL A;  2DKQ A;  5DIF B;  1XKE A;  1DBH A;  2D11 A;  5C5B B;  2YS5 A;  3HW2 B;  1XOD A;  2Z14 A;  3FM8 C;  5I2S A;  1MAI A;  2I5F A;  2KIG A;  3SNH A;  3HQC A;  4GMV A;  2R0D A;  1DDV A;  3PZD A;  2DYN A;  2KR0 A;  4OSN A;  2LG1 A;  3SUZ A;  2W2W A;  5KQ4 A;  2DFK A;  4KHB A;  2OTX A;  4PNK A;  3DXD A;  1W1G A;  1B55 A;  1ZSQ A;  1V89 A;  3QBV B;  4ZRK A;  3LJU X;  2BCJ A;  2RLO A;  4B6H A;  4HAT B;  5D3X A;  3FSS A;  1LW3 A;  3SYX A;  2LYD A;  3P7Z A; 
#chains in the Genus database with same CATH homology
 5C16 A;  1Y19 B;  2OQB A;  1MK7 B;  2LKO A;  1WG7 A;  2D10 A;  3HK0 A;  2D9Z A;  3D8F A;  4GMX B;  2M38 A;  1DYN A;  4WSF A;  2J59 M;  1V5M A;  2D9W A;  3RCP A;  4DBB A;  1DRO A;  1DDM A;  2H7E A;  3ULC A;  3AU5 A;  4NY0 A;  3TCA A;  1U5D A;  1UPQ A;  2CY4 A;  2V76 A;  3KSY A;  5KCV A;  3X23 A;  3WYF B;  1I2H A;  5J3Q A;  1UPR A;  3MPX A;  2ELA A;  2UZR A;  4HB0 B;  3A8P A;  1NTY A;  3OAN A;  2MFQ A;  4K2O A;  1FAO A;  2RVB B;  5EFX A;  2RUK B;  2LOZ A;  1MKE A;  2Y7B A;  1I7A A;  5J3Y A;  1BWN A;  4KHA A;  2GCL A;  2COF A;  3WA0 A;  1Y5O A;  5HE0 A;  3TW1 A;  1FOE A;  1QC6 A;  2DA0 A;  1M7R A;  1GC7 A;  1FHX A;  1AWE A;  1NI2 A;  3VOQ A;  5C6R A;  1FGZ A;  2DTC A;  2EMT A;  2N0Y A;  2RGN B;  2MDX A;  1SGH A;  1X86 A;  2I5C A;  2DKP A;  2ROZ B;  2JP2 A;  2L1C A;  4L6E A;  1V5P A;  1OMW A;  4K2P A;  3SO6 A;  1QQG A;  2YS3 A;  5HE2 A;  2KGX B;  4A6H A;  4HDO A;  4Z2N A;  2VKI A;  2ELB A;  2D9Y A;  4ZRI A;  1PLS A;  1EF1 A;  3D8E A;  3CIK A;  2Y8G A;  2J0J A;  1H10 A;  1FGY A;  3PEG A;  4TYZ A;  4EMO A;  2IYB A;  3T06 A;  5HE3 A;  2YVC A;  2EJ8 A;  1MK9 B;  4CYE A;  1U5F A;  2RNR B;  4IOY X;  4ZRJ A;  4MK0 A;  1U27 A;  3ODO A;  5HE1 A;  5C79 A;  5FI0 A;  3VIA A;  2VRW B;  4CHJ A;  1X05 A;  1U2B A;  3TFM A;  4DXA B;  1X1G A;  5J3T A;  2NZ8 B;  4GZU A;  3MDB C;  3GYO A;  4Y94 A;  3ZDT A;  4WJ7 A;  2LOX A;  1U29 A;  2Z0O A;  3U8Z A;  5CLL B;  1TQZ A;  4HDQ A;  3AJ4 A;  3ML4 A;  3UZT A;  3O96 A;  3TVV A;  2AEH A;  5D27 A;  3AU4 A;  3A98 B;  1XX0 A;  5LON B;  1BTK A;  1V5U A;  1J0W A;  3G9W A;  2GS0 A;  2YF0 A;  2YT1 A;  2DX5 A;  2QKL A;  2YS1 A;  2R09 A;  4HAX B;  4KHO A;  1U5G A;  1UEF A;  4P7I A;  2IFS A;  3KZ1 A;  2AL6 A;  2D2Q A;  3A8Q A;  5GOW B;  1FB8 A;  1NU2 A;  4NSW A;  2COA A;  3P7Z A;  1ZM0 A;  1E5W A;  4A6F A;  1V61 A;  2DN6 A;  1K5D B;  4F7G A;  1OY2 A;  1K5G B;  1WI1 A;  2HE7 A;  1UNQ A;  1XCG A;  4F7H A;  4C0A A;  1EAZ A;  1X1F A;  3F0W A;  1ZVR A;  2P8V A;  5CLQ B;  4KVG B;  5FI1 A;  1H4R A;  2I1K A;  2K2J A;  5DHF B;  3ODW A;  4KAX B;  1MIX A;  4HAU B;  4IFS A;  1RJ2 A;  1DDW A;  2RSG A;  2YSZ A;  1KI1 B;  4BBK A;  4A5K A;  2D4Q A;  2W2X D;  4D0N B;  1N3H A;  2P0H A;  2J0K A;  3PG7 A;  1M7E A;  5JP4 A;  2VSZ A;  2ZPY A;  3PP2 A;  4MT7 A;  1P5T A;  2G35 A;  4HB4 B;  1OQN A;  2DHK A;  2KUP A;  1WGQ A;  1GG3 A;  3ULB A;  2LUL A;  1PFJ A;  1W1D A;  1X11 A;  1AQC A;  5D3V A;  1EVH A;  4Z2M B;  3FEH A;  3U7D A;  2P0D A;  1Z87 A;  3PVU A;  3ZVR A;  2D9V A;  2YT0 A;  2DHJ A;  1XR0 B;  4F7U P;  4XWX A;  1P6S A;  3F5R A;  2N23 A;  1WJ1 A;  3PSC A;  4A6F B;  4HAV B;  3D8D A;  1IRS A;  3GYP A;  2CY5 A;  2K2U A;  4DX9 0;  2H7D A;  2FJL A;  1J19 A;  2EC1 A;  1UNP A;  3TO1 A;  3ODX A;  4KHB B;  2ADZ A;  1MPH A;  4IAP A;  3DXC A;  1W1H A;  4GPT B;  1PMS A;  2QKM A;  2HTH B;  2Z0P A;  1LB1 A;  4DX8 A;  5JLJ B;  1UNR A;  4TKN A;  1FHO A;  2Y8F A;  2MKR A;  4K81 A;  2CAY A;  3BJI A;  3BIN A;  2CRF A;  1GC6 A;  4PQ0 A;  5D3W A;  2COD A;  3SV1 A;  2GJY A;  4CHM A;  3NSU A;  1ZC4 B;  1EGX A;  1WJM A;  5DI9 B;  3KY9 A;  3PVW A;  1BTN A;  1V88 A;  2K00 A;  1WGU A;  5LOP B;  4HB3 B;  1TXD A;  4H8S A;  4A6K A;  5JHH A;  2Z0Q A;  4MY6 A;  1ZC3 B;  3V5W A;  1XD4 A;  5DHA B;  5D3Y A;  2KCJ A;  3KRX A;  2J0M A;  3CXB B;  2COC A;  4HAW B;  1WVH A;  3N7C A;  3QIJ A;  4HAY B;  4GN1 A;  2MWN B;  1ISN A;  2ROV A;  4GXB A;  4K17 A;  5JHG A;  5DH9 B;  1SHC A;  4HAZ B;  3IVF A;  2XQN M;  4YON A;  1FHW A;  4EJN A;  1NTV A;  2W2X C;  2YRY A;  1TJ6 A;  4WVF B;  5L81 A;  1Q67 A;  2L2I A;  1KZ7 A;  2I1J A;  5KQ1 A;  2X18 A;  2GCJ A;  2NMB A;  2Q13 A;  1RRP B;  1U5E A;  2E2X A;  2M14 A;  1BAK A;  2DHI A;  1KZG A;  2EMS A;  1MIZ B;  2DX1 A;  3DXE A;  2DLW A;  2D9X A;  3M1I B;  3QWM A;  2P0F A;  2UZS A;  5C5B A;  2DYQ A;  4EKU A;  1P3R A;  3KRW A;  2PZ1 A;  4YL8 A;  3P6A A;  4HHV A;  2UVM A;  3PVL A;  2DKQ A;  5DIF B;  1XKE A;  1DBH A;  2D11 A;  5C5B B;  2YS5 A;  3HW2 B;  1XOD A;  3FM8 C;  1MAI A;  2I5F A;  3SNH A;  3HQC A;  4GMV A;  2R0D A;  1DDV A;  3PZD A;  2DYN A;  2LG1 A;  3SUZ A;  2W2W A;  5KQ4 A;  2DFK A;  2OTX A;  4PNK A;  3DXD A;  1W1G A;  1B55 A;  1ZSQ A;  1V89 A;  3QBV B;  4ZRK A;  3LJU X;  2BCJ A;  2RLO A;  4B6H A;  4HAT B;  5D3X A;  3FSS A;  1LW3 A;  3SYX A;  2LYD A;  4HB2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...