4CHZA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
155
structure length
151
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 57
structure length 151
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4chzA00
3DLGA 3MXMA 4DQIA 4Q0BA 2P1JA 4L8RB 3NGZA 3NH0A 1ASVA 3ZSYA 4C8LA 4FJ9A 1TAUA 2HNZA 3OYNA 1JKHA 1C1BA 2JLEA 3LP3A 3LZJA 2OPSA 3VQQA 4CHQA 2QKKA 3LPTA 4CJEA 2LSNA 3LAKA 2G8HA 4J2DA 1T8EA 3SQ4A 2HNDA 1WSGA 1S1TA 2PZSA 1SL0A 3PY8A 3OS2A 4B8CA 4XIUA 4CJ3A 2VWJA 1TVRA 4CIFA 4BE1A 1U45A 3ZSXA 4KAZA 1WN7A 3VN5A 4FZYA 5DK5A 4M3TA 4DFMA 3OVNA 1S1XA 3OYAA 4DS5A 1VRUA 4W5NA 3K5NA 4Z0UA 4DLGA 4PY5A 1KVAA 1TGOA 1LAWA 4FJMA 3O3HA 2HHWA 1ZBFA 1NK6A 1RBRA 4FM1A 4FJLA 4I7FA 3OYHA 3HP9A 1WAFA 4BWJA 1NJWA 1JL2A 2E6MA 3KLIA 3C6UA 1WSFA 1EKEA 3IRXA 3VQ6A 3LP0A 4EP5A 3KD5E 3DM2A 1Q9XA 3KK2A 1VSLA 3K5OA 4OKJA 4CF1A 3V9UA 1NK4A 2HW3A 2KFNA 2X6NA 4ID1A 4I9LA 3MXJA 1BI4B 1Z25A 4CFCA 3SUQA 4FLZA 1VSIA 4ZTFA 4CJVA 2YNFA 2A1SA 1JLAA 1X1PA 4CEZA 3TABA 1ZBUA 1QHTA 1YVUA 1QQCA 1C0TA 4CFBA 3KKRA 3PX0A 4BDPA 4M42A 1RNHA 4OPJA 2HMIA 4I2QA 1KTQA 1C0MA 3CG7A 4CF0A 5KI6A 3NFAA 2G8FA 1C0UA 1F21A 4KB0A 1WSIA 4ELUA 4LH4A 2BDPA 2OA8A 4GVMA 4FJ8A 3ITHA 5JS1A 3TR8A 5HRPA 4LY7A 3L2VA 4OKEA 3AO2A 5HROA 1BIZA 1SUQA 3DRPA 3OJSA 3SQ1A 1NJYA 1TK0A 3ZT2A 3JSMA 2P5GA 1VSMA 4NYFA 4M41A 3CFOA 1EX4A 3O4QA 3VQPA 3LAMA 4YFUA 4FLTA 4C8KA 4NCBA 4E7JA 1L3UA 4DFPA 4KPYA 2F96A 1A5XA 1BCMA 4CF2A 5J2MA 3B6OA 1RBVA 3CQ8A 1JLEA 2D0BA 3ZT3A 4CJPA 3ULDA 4DSKA 3QIOA 3KLFA 4BACA 3A2FA 4B9TA 4IBNA 4I9QA 4RW7A 1BQNA 3VQ9A 4FK4A 1U04A 1QTMA 1KVCA 4CJWA 1X9WA 3L2UA 3RMDA 4TSXA 1W9HA 4CGDA 4HUGA 4CGHA 1BISA 3NGYA 3IAYA 3V1RA 3DI6A 1HPZA 3EYZA 1KLMA 4NCGA 1XHZA 3L3VA 1Z26A 4C8MA 5FRNA 5HRRA 5SZTA 3CFPA 2BANA 3RTVA 4CESA 4CJRA 2HHVA 1VSFA 1U49A 4DSJA 3ZSRA 1TKZA 3HM9A 4B08A 4B8AB 5T7BA 4FM0A 3AVIA 4DLEA 1NK0A 4OGCA 3IS9A 5HP1A 1KCFA 3QETA 1IO2A 2E4LA 4G1QA 4QAGA 4B9UA 3OS1A 2Y1IA 5CZ1A 3QEWA 4RW6A 3QO9A 2QKBA 4F4KA 1YT3A 4CJTA 4OJRA 4F3OA 3T19A 3LZIA 4DU1A 4AH9A 3VA0A 3ZT0A 5J2NA 3C6TA 1L3VA 3RR8A 2HB5A 4IFYA 4CF9A 4OPKA 4DTMA 1S1VA 3RRHA 1Q8IA 3V81A 2YKMA 4DTXA 4FLXA 2G8WA 4PQUA 1TKTA 2WONA 4DS4A 5HLFA 3RMBA 1B92A 1NOZA 1RDBA 1HRHA 1JLQA 2YNIA 3D0PA 4FLUA 1RBSA 2XY7A 3SPZA 4CHPA 2PY5A 3V4IA 3S3MA 1BHLA 3OS0A 4HCCA 1RDAA 4MFBA 3LP1A 1TK5A 3AVJA 5CYMA 4KHQA 1C1AA 2RN2A 3PV8A 3ZSOA 3SUOA 3HO1A 4E7HA 3AVAA 4H8KA 2EHGA 4JRQA 1VSEA 3U3YA 1D5AA 3NHGA 1IG9A 4CHNA 3M8QA 3ZT4A 3VQBA 1LW0A 1S9EA 1RTJA 1DTTA 4R5PA 1G15A 4IDKA 1ZBLA 4E7KA 4Z4IA 3M8RA 3K59A 4DTRA 2KQ2A 1RT1A 1GOAA 2QXFA 1C6VA 3E01A 1RBTA 4RG8A 5KGXA 4CGGA 1LAVA 2GBZA 3NGIA 1FKOA 1J53A 2IDOA 3AVCA 4JS4A 3AV9A 3KTQA 3VQ5A 3V1QA 4IG0A 3ISNC 1N6QA 1ZBIA 2HNYA 3K57A 5HRNA 4EZ6A 4KHNA 4CJLA 3DOLA 4KHWA 5FROA 4QOZB 1QSLA 1ITGA 2YHAA 4RW4A 4LD0A 3SCXA 3LWLA 1C1CA 4CJ4A 2KZZA 3MAQA 2HHTA 1GOCA 3NAEA 4F3TA 3SPYA 1VRTA 1HYZA 1WSHA 1NK5A 4CFDA 2DFFA 3NF7A 4E3SA 2HVIA 3HT3A 2VWKA 4UQGA 4E7IA 4FJIA 3DOKA 4N76A 1VSHA 4FLVA 2F8TA 4FW1A 3SNNA 1HYSA 4CGIA 5I3UA 4FJ5A 3AO3A 2FC0A 1N5YA 1RT6A 4O0JA 1RDCA 1TL1A 4PA1A 1DTQA 2X74A 1SKWA 2GV9A 4M3YA 2OZMA 3AVBA 3V6DA 2Z1IA 1S6QA 3VQ7A 4DMNA 4ZHRA 4YNQA 3NCIA 1JLCA 3OYCA 3SV4A 3T1AA 4OGEA 3OYMA 4DU4A 4DTPA 1SKSA 4B3OA 1WSEA 2DY4A 1UAXA 4C8NA 1KFDA 2VG7A 4M3UA 5CZ2A 1FXXA 3AO4A 4CFAA 1TK8A 4ELTA 1LV5A 3P5JA 4FW2A 2OYQA 1X9MA 2KZMA 4W5QA 1GOBA 3MEGA 4CJUA 3MEDA 1TL3A 3TI0A 1D8YA 4DF8A 2YV0X 4DTJA 4FJ7A 4BE0A 3ZCMA 4DTNA 3SQ2A 4Z4CA 3OYGA 1KFSA 1HNIA 3D45A 3SV3A 3V9SA 3OYBA 1RILA 2FBXA 4W5TA 3RMCA 1BCOA 2OPQA 4DSEA 4DTSA 5J2PA 3THVA 3AA2A 5EU7A 4HVJA 1I39A 1S1WA 1K6YA 1VK0A 3WNFA 1KRPA 3H08A 4KREA 4DTUA 1J9AA 3RR7A 2XY8A 4FXDA 2HHSA 1CZBA 2O4GA 3QNNA 3OYIA 3HVRA 2ZQBA 4O5BA 2G8KA 5C25A 2KFZA 4DFKA 2OPRA 4DG1A 4OVLA 1D9DA 3S9HA 3KIOA 2AJQA 1FKPA 2Z1GA 3O4NA 4GW6A 4FYDA 1BQMA 2RF2A 3AA3A 4FLYA 4DU3A 1RT4A 1J54A 2OPPA 3HK2A 3VQ4A 4IFVA 1NK8A 1RTDA 1I3AA 4N41A 4Z4GA 3KLHA 4J2AA 4IKFA 2XO7A 3L2WA 5FDLA 4BE2A 4CGFA 5JS2A 2DFHA 3G10A 3VQDA 1L5UA 1EP4A 1EXQA 4OLAA 2O4IA 2Z1HA 2A1RA 4CCHA 1A5WA 3DYAA 2KW4A 1J5OA 3AA5X 4DQRA 1NJXA 3AO1A 3KKSA 1UWBA 4Q5VA 1S6PA 3LDSA 5CY4A 4AHSA 4DQQA 3AVNA 1L3TA 2G8UA 2PYLA 4CK2A 4AHVA 2R7YA 1VSDA 2RPIA 3U6FA 4B9MA 1UA1A 3DRSA 4NCAA 4CEAA 2B6AA 2QK9A 4N5SA 1KVBA 3S3NA 3C94A 1W0HA 3QEPA 3ZT1A 2IC3A 5K14A 4E89A 3TAMA 4K8XA 3LALA 3RMAA 4PWDA 2E6LA 3IG1A 4DQPA 1TV6A 4AHCA 3DLHA 3ZSZA 4CK3A 3MECA 1IH7A 3QEVA 3HPGA 4M45A 1RTHA 3AVMA 1DLOA 4H4MA 3ZSVA 3QIPA 1JL1A 3VQCA 1JLGA 4DFJA 3TARA 1LWFA 1NKCA 1QSYA 4C8OA 1BIUA 1HQEA 4W5RA 1T7PA 4KI6A 3V9WA 2B5JA 1IKXA 3DLEA 1SL2A 3QINA 3NH1A 1WLJA 4EP4A 4JRPA 4J2EA 4CHZA 4ID5A 3KD1E 1CXQA 1MU2A 3CFRA 3SZ2A 4AHRA 3TAPA 4M3XA 3AO5A 4CERA 3VA3A 4KB1A 3AVHA 1BL3A 1JXBA 3DRRA 2PYJA 3UIQA 1XC9A 4E0DA 1QS4A 1HNVA 1ASUA 3L8BA 2ATQA 2D0AA 4FZZA 4FJNA 1R0AA 1LWEA 3CM5A 3M8PA 3TAFA 3TAQA 3CM6A 3I0SA 1WNSA 3F73A 1NJZA 2KTQA 4K8ZA 4FJXA 3RRGA 1EETA 3NDKA 4PUOA 4CEFA 3BDPA 3HVTA 3HYFA 5D3GA 4DF4A 2B4JA 2HVHA 1UOCA 4JS5A 4LH5A 2F8SA 1HJRA 5J2QA 4B9NA 4E1MA 4FCYA 5KTQA 4FLWA 2D5RA 1XI1A 3HP6A 2WOMA 4O44A 3V1OA 3NE6A 1HYVA 3HPHA 3TAGA 4FJKA 2YKNA 3TAEA 4FZXC 1REVA 3PX4A 3K58A 3P83D 3V9XA 2Y1JA 4Z4HA 2FBVA 4CHOA 4CK1A 4KHUA 2I5JA 4CECA 1ASWA 1HQUA 4N56A 1RT3A 3PUFA 3P1GA 3SJJA 4OLBA 3QEXA 4CGJA 3ZSQA 1LW2A 4AILC 4RW8A 3NF9A 2XY5A 1SV5A 1B9DA 3M8SA 3I0RA 1XWLA 2JGUA 1CXUA 2Z1JA 4HHTA 1SKRA 3WNHA 1IKWA 1BI4A 4KTQA 4Y1DA 3OYJA 4FJGA 4B9VA 3PO5A 5C42A 2FBYA 4NYNA 4KHYA 1QE1A 2ZD1A 3KK1A 4HUEA 2X78A 3TANA 1YTUA 2IS3A 3ZSWA 3I8DA 3MEEA 1O1WA 2ITGA 3T3FA 2XY6A 4FJHA 1YTAA 2G8IA 3TWHA 3PX6A 2P51A 2VG5A 2YHBA 2YNHA 3MXIA 4KTZA 1TKXA 1Y97A 5FRMA 1JXEA 2EX3A 3DMJA 1L3SA 4DSFA 3DLBA 1RT5A 3PO4A 1A5VA 4B9SA 3WNGA 4AHUA 1CLQA 2VG6A 4FJJA 1SL1A 4WE1A 3KK3A 4CIGA 3NH2A 3KLGA 1VSJA 1B9FA 4EZ9A 3SQ0A 3AA4A 3QNOA 3OYFA 5J1EA 1TKDA 1HMVA 3VQEA 2ETJA 1BGXT 4CE9A 4BWMA 3HXMA 3NF6A 4M3RA 1RTIA 3LP2A 3HJFA 3ALYA 2BE2A 3VQAA 3SUNA 4N47A 4ICLA 4FK2A 2Q3SA 4DQSA 3SUPA 5I42A 4E7LA 4M3WA 1IKVA 3NF8A 4H4OA 1U48A 3BGRA 3K2PA 3O3GA 1CZ9A 2HHQA 3AVGA 4I2PA 4LSLA 1U47A 2GUIA 4O0IA 4HUFA 1T03A 4F2SA 2RKIA 5HBMA 1TAQA 4CEQA 4Z4EA 2FBTA 4CJKA 4CEOA 4E1NA 3KLEA 4KHSA 5KRTA 4KFBA 4O4GA 3OYKA 3B6PA 3RWUA 2X6SA 5C24A 5DMRA 3AVFA 4CJQA 3SYZA 4F2RA 1ZBHA 1XHXA 3U3GA 2OZSA 1FK9A 1S5JA 3F9KA 3LANA 3L2RA 1Q9YA 4DSIA 4CF8A 1ZYQA 3DLKA 3EZ5A 2IAJA 2W42A 1S9GA 3FFIA 4IG3A 3QEIA 1UA0A 4Y1CA 1D9FA 3VQ8A 4CEDA 4QCLA 2HHXA 3QLHA 3HSTB 4FVMA 4KV8A 3HPOA 4FK0A 4KRFA 1JLFA 1IKYA 3AVKA 4KO0A 3K5MA 4E19A 1RDDA 4LSNA 2HHUA 1X9SA 2DFEA 2NUBA 4JLHA 4CIEA 1T05A 4DSLA 4CJ5A 4CHYA 4DWIA 3HL8A 5KRSA 4CJSA 4ELVA 4AHTA 2XHBA 2D0CA 2ZE2A 4BDYA 3L2QA 2IGIA 4M3ZA 1RCHA 3LPUA 1U4BA 4ZTJA 2P5OA 3V9ZA 1NK7A 3OYDA 3CYMA 1NOYA 4DTOA 3ASMA 3QERA 3OYLA 4J2BA 3JYTA 3G0ZA 1KLNA 3LWMA 4KI4A 3NBPA 4BDZA 4B9LA 1NKEA 3KJVA 5HRSA 3OY9A 4CJFA 3SI6A 5E41A 1NKBA 2IOCA 4KKOA 4KTWA 5CYQA 1RT2A 3AVLA 2XRIA 4HTUA 2G8VA 4RW9A 3K5LA 1NK9A 3DLRA 3S3OA 1VSKA 5SWMA 4GMJB 3OYEA 3EY1A 2BGGA 1JLBA 4HCBA 1LWCA 1WAJA 4CEEA 1KSPA 4F8RA 1S1UA 4Z4FA 1WSJA 3C95A 4FM2A 2YNGA 4OKKA 4W5OA 4MQ3A 3L3UA 1RBUA 4O55A 3QESA 3OJUA 1QSSA 2DTUA 1RT7A 4CEBA 3WNEA 3O3FA 5KGWA
chains in the Genus database with same CATH superfamily
4BRCA 3ZSYA 4FJ9A 2HNZA 4A61A 3LP3A 4IEEA 3LZJA 2QKKA 4IZ9A 3P31A 3O9RA 4CZEA 4B1YB 1SL0A 3NVMA 3CCEN 1HX1A 2P9UB 3VN5A 4A62A 4CZJA 4PHTX 4X64K 1WB9A 4W5NA 3K5NA 2ZJPL 1TGOA 1ZBFA 2Q97A 4FJLA 4FM1A 1DGKN 1NJWA 3E9LA 2E6MA 1J6ZA 4CZLA 4BR2A 3PIOL 2KFNA 2X6NA 3T69A 1BI4B 3O4WA 4DR3K 4FLZA 4LC9B 4FWKA 1RDUA 2YNFA 4H5VA 2E1YA 4CFBA 1C0TA 4BDPA 3KKRA 4JI0K 1S72N 1WBDA 1C0MA 3NFAA 2G8FA 4BR5A 1C0UA 4KB0A 4JK9A 3R6MA 4LH4A 2BDPA 2WUSA 3TR8A 1WBBA 1BIZA 2NNWA 4IO9L 3SQ1A 1SS6A 1XQSC 4M41A 3VQPA 3LAMA 3SJHA 4EAHD 3Q7CA 2F96A 1OH8A 1VQ5N 2QWNA 1QQOA 5AZJB 1JLEA 5DM7L 3ULDA 3OBYA 4BACA 3KLFA 2F7TA 3VGKA 3CERA 1BQNA 1QTMA 1DKGD 3VOVA 3H46O 4CGHA 3HI0A 4JI7K 3DI6A 1HPZA 3EYZA 1Z26A 5FRNA 3VEXA 4X65K 3LDLA 2BANA 2WBNA 3WT0A 1S3XA 5AQSA 2HHVA 3A5NC 4B08A 4K25A 4B8AB 5ADXA 2AP1A 4WFBL 4U67L 3IS9A 4WQ4C 2E4LA 4KH4A 4B9UA 3OS1A 4H5TA 4F4KA 1RDWX 4OJRA 3UB5A 3LZIA 3N4PA 1L3VA 3RR8A 4IFYA 1SAZA 2ZGYA 5M1OA 1S1VA 3RRHA 2YKMA 4PQUA 1TKTA 3CCVN 2WONA 1NOZA 3BEXA 4OPAA 2AA4A 1JLQA 3D0PA 4FWNA 4JK7A 5A2QO 4CHPA 3S3MA 3OS0A 1D4XA 4JHDA 1TK5A 3VEVA 3BP8A 5CYMA 4JI6K 3M8QA 3ZT4A 3VQBA 1DTTA 2FXUA 3JXUA 1ZBLA 3OHRA 1VHXA 4DTRA 1CZAN 5BRHA 2QXFA 1DT9A 5BN9A 1LAVA 1J53A 5FPEA 4JS4A 3VQ5A 3CPEA 4IG0A 4BROA 1N6QA 3K57A 1OH7A 4EZ6A 4QOZB 4KHWA 3QBXA 1ATSA 4LD0A 1JCFA 4JKDA 3H3OB 3LWLA 1VQ4N 2HHTA 1GOCA 3O80A 2PFUA 3NAEA 4O8UA 4AF1A 4F3TA 3EN9A 1VRTA 1HYZA 1NK5A 2HVIA 1HNWK 4CJ7A 4FJIA 5JLFA 1VSHA 2F9TA 3SNNA 1NWKA 4CGIA 4PA1A 2YJFA 3AGKA 4JKCA 2Z1IA 3VEYA 5KPZA 1SKSA 1JLCA 3OYCA 3JAMO 1KFDA 4M3UA 3P5JA 4FW2A 2HHHK 4W5QA 3ZYYX 4CJUA 1TL3A 3T1YK 1YAGA 4Z4CA 3OYGA 1HNIA 3D45A 3SV3A 3V9SA 2OTLN 2OCEA 1I39A 1K6YA 3WNFA 3H08A 4DTUA 3C6AA 3DLLL 2HBKA 3QNNA 3HVRA 1QZ5A 2ZQBA 4J8FA 1OVQA 5C25A 1JJ2M 2WC9A 3A5LC 1FKPA 3O4NA 5GAHP 2VQFK 5AQLA 3HK2A 4IFVA 5TKWA 4N41A 1HUXA 2E2NA 5FDLA 2DFHA 1L5UA 1EXQA 2O4IA 4DQRA 1K8AO 3MN9A 1NJXA 3KKSA 4MDBA 1C0GA 4QS7A 5CY4A 4AHSA 1VQPN 4CK2A 4AHVA 1VSDA 3MN6A 4A2AA 3DRSA 2D1KA 1VQKN 4NCAA 4CEAA 2B6AA 1KVBA 3C94A 4WQ5C 3W0LA 4K8XA 3RMAA 3WXMB 3IG1A 4YOUA 4BGAA 5AQVA 3MECA 1IH7A 1RTHA 1DLOA 3VQCA 1QSYA 4C8OA 4PWDA 1LWFA 1MA9B 2B5JA 2NRTA 4UY8O 4JRPA 1WLJA 4J2EA 4CHZA 4ID5A 1CXQA 4B1XB 4JAXA 4DV5K 4M3XA 2HBLA 4PKGA 4KB1A 3J7ZO 1XC9A 4FZZA 2H3GX 1LWEA 3CM5A 4KBOA 4A2BA 3TAFA 3TAQA 3I0SA 4DR7K 1NJZA 3NVKA 1YF5L 4KHPK 3MX5A 2E8AA 4IXCA 3RRGA 4PUOA 2YHYA 1SZ2A 3L6QA 3L4QA 3GL1A 4JS5A 2I7PA 3VGLA 3CC7N 3CCMN 4H03B 1FW6A 3THWA 3HPHA 4FZXC 3H1QA 4YOTA 4JHDB 4CHOA 1ASWA 4N56A 5KPRA 4CGJA 4XH1A 4RW8A 1T3VA 4ISGA 4YOYA 1HNXK 1SV5A 3HZ6A 2QWQA 3ZX2A 3ZX3A 4HHTA 3ATUA 2NRXA 4R79A 4KTQA 4Y1DA 3ENHA 2YHWA 3KK1A 4BR4A 2IS3A 3I8DA 2XY6A 1N34K 1NBWA 3QBWA 3T3FA 3VMFB 3MXIA 2P51A 5H1SQ 4GVEA 1GLLO 4DSFA 5LMUK 1A5VA 4OO1J 4FJJA 3KK3A 2VGMA 3M6GA 3K9KA 4IDHA 1NGGA 3OYFA 5BPNA 1NGIA 2VWBA 1YXQA 3LP2A 4HWIA 1T6DA 3ALYA 2BE2A 3WXLA 2QI2A 4MO5A 4FK2A 4X62K 3PSFA 3AARA 4BRHA 2FSKA 4M3WA 1U48A 4V19S 3BGRA 3K2PA 4I2PA 4DCHA 1U47A 1NG9A 2GUIA 4JI3K 1T03A 4F2SA 4H0OA 3ZETA 1I94K 2D4WA 3BF1A 5HBMA 1TAQA 4Z4EA 3KLEA 3ENBA 5AQMA 4CJQA 5DMRA 1XHXA 1NM1A 3L2RA 1ZYQA 3ZEUA 2W42A 4YOWA 3FFIA 3VQ8A 4MLHA 5M1PA 3HSTB 3ZLJA 3IDHA 2E1ZA 4KV8A 3HPOA 4IJAA 4KRFA 4I6MA 1IKYA 3K5MA 3SAHA 2Q2RA 4LSNA 2HHUA 4DSLA 3HL8A 3CCQN 1U2VA 1ZC6A 2XHBA 3OA9A 2D0CA 3WXIA 2VQEK 1U4BA 4ZTJA 3LDPA 1NK7A 3ID8A 1NOYA 3ASMA 3QERA 2A40A 3JYTA 1KLNA 4J2BA 1KAYA 2UUCK 3OY9A 4CZKA 2IOCA 4KKOA 4BQZA 4LFBK 2XRIA 4RW9A 4JKAA 4GMJB 2IVNA 3CD6N 4RTFD 4FM2A 5AQOA 1TUYA 4OKKA 4O55A 1RBUA 3QESA 1N32K 2DTUA 3IUCA 3WNEA 3DLGA 3MXMA 4DQIA 4C1NK 5C10A 3NH0A 4C8LA 3OYNA 5IT9O 2OPSA 3VQQA 4CHQA 3BUZB 5MLCQ 1QZ6A 4G9ZA 3LAKA 1M90O 2HNDA 1S1TA 3PY8A 4B1ZA 3VETA 1TVRA 3MDQA 3D2EA 1V4SA 4BE1A 3P39A 4DUYK 1N36K 1WN7A 3OVNA 1S1XA 3OYAA 4DS5A 1XNRK 3F2KA 4FJMA 3THWB 4JKFA 2NRRA 1RBRA 3RSEA 3KZBA 1EKEA 3SAGA 3M5RA 3KD5E 4KH5A 3CJCA 3DM2A 3WXKA 2GWKA 4OKJA 1O13A 2HW3A 1ATRA 4I9LA 1Z25A 4CFCA 2HSTA 2A1SA 1X1PA 1QHTA 2ZWHA 3EE9A 3O08A 3PX0A 2HMIA 4OPJA 4I2QA 3CG7A 1F21A 4GVMA 3W3DA 5HRPA 3L2VA 4OKEA 2WTUA 5HROA 4FPBA 2P5GA 2KKZA 3CFOA 1EX4A 1IJJA 4C8KA 5HOOA 1QVGM 1L3UA 4RWTA 4H5WA 1A5XA 2ASOA 3S41A 4CF2A 1QQMA 3CQ8A 2D0BA 3ZT3A 3QIOA 2QXLA 4IBNA 4B9TA 3UKRA 2O8CA 4XEIA 3ZX0A 4FK4A 2D0PA 4TSXA 1W9HA 4F9OA 1HLUA 2NZTA 3NGYA 3ZETB 3V1RA 1XHZA 3QB0A 4CESA 1NGEA 4DSJA 1N8RO 3ZSRA 5AQGA 3SAFA 3CI5A 1EWQA 4JKHA 5T7BA 3ID6A 3EL2A 1NK0A 1KCFA 4QAGA 1NGJA 3FZKA 2Y1IA 4RW6A 4GV6A 4I6MB 2E5LK 1Y64A 1VQ7N 5J2NA 3ZT0A 1HKBA 4CF9A 5BR8K 1GLDG 2FF6A 4A5AA 1U2VB 4DS4A 3SLCA 1B92A 4QS8A 4CD3A 5AQFA 1HRHA 4FLUA 1OVYA 2GWJA 2PY5A 4DV7K 4HCCA 4KHQA 1C1AA 4QS9A 1DEJA 4H8KA 2EHGA 4JRQA 3U3YA 3NHGA 4CHNA 1BA1A 3T7ZA 4Z4IA 4PL8A 1G15A 3WQUA 2J4RA 2KQ2A 1BO5O 1GOAA 3E01A 1C6VA 2P9PA 4RG8A 1JCEA 2GBZA 3O6WA 2NRVA 3AVCA 1LCUA 3V1QA 5JVHL 3VPZA 2HNYA 1Q18A 3CHWA 3DOLA 3EO3A 1ITGA 4RW4A 4IJNA 3CJ7A 4FWMA 5ADXH 2KZZA 2QWRA 3WQTA 2YI1A 3MK6A 1WSHA 3H1VX 4CFDA 5IWAK 1X3NA 5AR0A 2E2PA 4E3SA 5KPTA 4UQGA 3U8XA 4FLVA 3CF5L 5C12A 3FE1A 5I3UA 2FC0A 5EOYA 1N5YA 1TL1A 1SKWA 4M3YA 5B8HA 3THYA 3D2EB 3VQ7A 4ZHRA 2YCHA 3SV4A 4B3OA 3T1AA 4AQYK 3KVGA 4C8NA 2VG7A 1BOTO 1FXXA 2E2QA 5LJWA 3TTCA 2KZMA 2YV0X 4DTJA 3RSEB 4EFHA 3SQ2A 1K8KA 1VQMN 3OYBA 2FBXA 3M3ZA 4IEIA 1NGHA 1BCOA 4DSEA 5J2PA 3AA2A 5EU7A 4KREA 4BC5A 1KRPA 3TSQA 3EKUA 5F0XA 5AQQA 2P9LA 4FOEA 4O5BA 2PAVA 1D9DA 4YOXA 3KIOA 2AJQA 3WUHA 2A5XA 1BQMA 4FLYA 3A0IX 2OPPA 1NNEA 3VQ4A 3E1YA 1NK8A 1RTDA 3ULEB 4J2AA 3CJAA 5BRDA 3MMVA 3O1BA 4IKFA 2XO7A 3L2WA 5LMNK 2GUPA 3KWGA 4CCHA 2O8EB 3J8AA 3AA5X 5CR4A 1UWBA 2P9KA 4C1NI 1S6PA 2OTJN 2PYLA 2R7YA 1EQYA 4N5SA 2ITMA 3S3NA 2O8FA 5AQUA 3QEPA 3UKRB 2IC3A 5K14A 4JYAK 3WXJA 2O8CB 3Q7BA 3LALA 2UXCK 3UE5A 1TV6A 1EWRA 4AHCA 4Z94A 3ZSZA 3E66A 4XH5A 3QEVA 3JS6A 4M45A 3AVMA 2FLOA 3ZSVA 3QIPA 4DFJA 5EXWA 3VENA 4BRPA 2BUPA 2YHXA 4YY3K 1HQEA 3VTIA 2OANA 2ZJRL 1SL2A 3QINA 2QA4N 2F9WA 3O9UA 2V52B 1MU2A 3CFRA 3SZ2A 2QWMA 5AQIA 4CERA 3OBWA 2PYJA 1QS4A 1HNVA 3HTVA 5C2FA 3L8BA 2D0AA 3CM6A 2KTQA 3U9ZA 4WFAL 1EETA 1MDUB 5GINA 1NMNA 4NXMK 5D3GA 4YDUC 2B4JA 2HVHA 3BF3A 5J2QA 4B9NA 4E1MA 4FLWA 5BPLA 3I56N 4O44A 3TAGA 1HYVA 2YKNA 4KHUA 4BG8A 3PUFA 3SJJA 3QEXA 3H3NO 3I0RA 1XWLA 2JGUA 1SKRA 5AQXA 4AM7A 4LF4K 2P9PB 3GBTA 5C42A 2E88A 4PKIA 1ESVA 2ZD1A 4HUEA 2X78A 1YTUA 3ZSWA 3MEEA 3PX6A 2VG5A 2A3ZA 4KTZA 2EWSA 3DMJA 3CCJN 1L3SA 2Q0UA 3DLBA 1Q86O 4B9SA 3WNGA 1CLQA 2V7ZA 3NH2A 1B9FA 4EZ9A 4PKHA 1VAZA 1BG3A 4A59A 5J1EA 2HBMA 5JICA 1BGXT 4CE9A 3HXMA 4M3RA 1ZBSA 4BVPA 4BR0A 2CGKA 4ICLA 3THYB 2Q3SA 4DQSA 1HR0K 3SUPA 4CBUA 1IKVA 2QEXN 3THXA 3O3GA 3AVGA 4H0TB 4LSLA 3R9PA 4HUFA 2KLAA 1TYQA 4JK8A 3SBTA 1OH5A 3AAQA 4CJKA 4KFBA 4O4GA 3OYKA 1K8KB 4BC4A 2X6SA 3U3GA 2OZSA 1P90A 3KK7A 3LANA 1Q9YA 4CF8A 2IAJA 2BGGA 1S9GA 4DV1K 3QEIA 1W2BM 1KQSM 4CEDA 3QLHA 2P9LB 3QMLA 1NGCA 1JLFA 3AVKA 4FWSA 1RDDA 4E19A 2Q36A 5TKYA 5BR9A 1X9SA 2DFEA 4CIEA 3TSUA 1T05A 4CHYA 3I55N 1VQ8N 4DWIA 4CJSA 5AQNA 3C6HA 2IVOA 5FPDA 5BRFA 3L2QA 3LPUA 3C65A 2P5OA 3OYDA 3CYMA 4DKWA 4JKEA 4DTOA 5GADP 2ASPA 3G0ZA 4M63C 3NBPA 4BDZA 3BZKA 3KJVA 2CGJA 2GTDA 2P9KB 4WCEL 3SI6A 4M7XA 4KTWA 5CYQA 1GLCG 4HTUA 4NLBA 1J5EK 3D2FA 3DLRA 3S3OA 1NK9A 2O8FB 1JLBA 1KSPA 4Z4FA 2ZGZA 3EEQA 3C95A 2YNGA 1KD1O 3L3UA 4O5FA 3OJUA 1RT7A 2VCPA 4BG9A 4FO0A 3O3FA 3C0BA 1IBLK 4Q0BA 2P1JA 3NGZA 5AQWA 1WUAA 3FLCO 1TAUA 3O1WA 4O8KA 3P4IA 3OTOK 5M1QA 4K0KK 4CJEA 2LSNA 1T8EA 5AQHA 3OS2A 4XIUA 4CJ3A 2VWJA 4DV0K 1YJWN 4IOAL 3ZSXA 1EO1A 1R59O 5DK5A 4M3TA 1X9JA 3U4LA 4GNIA 1VRUA 4Z0UA 1E4GT 4BRIA 4PY5A 3CJ9A 5C2DA 1KVAA 4EHTA 3O3HA 4I7FA 3OYHA 2RHKA 3HP9A 5BN8A 5AQYA 3C6UA 1WSFA 3IRXA 4FSVA 3LP0A 4CZGA 2HF3A 1IG8A 1QVFM 3KK2A 3QFPA 3K5OA 4NO7A 4CF1A 1NK4A 4LF7K 3MXJA 3SUQA 2DPNA 2UUAK 1ZBUA 4FOIA 2YJEA 1YVUA 1RNHA 2CH6A 4CF0A 5KI6A 4FPAA 1WSIA 4ELUA 1XNQK 2OA8A 4FJ8A 3ITHA 5JS1A 2GX9A 1E4FT 3AO2A 2PZSA 1NJYA 3OJSA 3VGMA 3ZT2A 3JSMA 3FGUA 1VSMA 3TTDA 4DR1K 4FLTA 4YFUA 4OPHA 3B8AX 3QICA 1LOTB 2ZF5O 2QW9A 3CCLN 3B6OA 4CJPA 2I7NA 3A2FA 1IBMK 1BU6O 5CE3A 5EVZA 3THXB 1T44A 1U04A 1KVCA 4CJWA 3L2UA 3CJ1A 4JNEA 1TYQB 1YIJN 1KLMA 4NCGA 3AAPA 3L3VA 2QWPA 5HRRA 4LFAK 2FF3B 2FSJA 3F9MA 5E84A 2UU9K 4LF9K 5KQDA 4CJRA 3HM9A 4MLEA 4FM0A 3QETA 1IO2A 4G1QA 4BR9A 4K43A 1GLAG 3BY5A 3QEWA 1SQKA 4DR4K 3QO9A 2QKBA 1YT3A 4CJTA 4F3OA 4FWOA 4CZHA 5LL6Z 4AH9A 5AQJA 3C6TA 4GY2B 3CQXA 4JI2K 4OPKA 3LM9A 1Q8IA 4DTMA 3V81A 4DTXA 4FLXA 5HLFA 3RMBA 1YI2N 2XY7A 4ISFA 1RDAA 4MFBA 3LP1A 4H0XB 1Z05A 2RN2A 3PV8A 3ZSOA 3HO1A 4E7HA 5FPNA 1VSEA 3DXKA 1D5AA 1IG9A 4R5PA 1LW0A 1S9EA 1RTJA 1Q7YO 4E7KA 3K59A 5KGXA 2IIRA 3D2FB 1FJGK 2P9UA 4HTLA 5E26A 3MN7A 2IDOA 1X3MA 4IWVA 1OKJA 3ISNC 1ZBIA 3I33A 3UKUA 2YX6A 4CJLA 3IKMA 1ATNA 5FROA 1QSLA 5AZIA 2YHAA 1ILYA 1C1CA 4CJ4A 4IOCL 4B9QA 2QM1A 2V51B 2DFFA 5EX5A 4E7IA 4N76A 1RFQA 4BRFA 4CZIA 3E9PA 3TSPA 4FJ5A 1XUPO 1C0FA 3AO3A 4O0JA 2UXBK 2GV9A 3AVBA 4JI4K 4DMNA 1S6QA 3NCIA 4DU4A 1G99A 4OGEA 1WSEA 4WQ4A 4CW7B 2DY4A 1UAXA 3A5MC 5CZ2A 1TK8A 3AO4A 3CCRN 4ELTA 1LV5A 2OYQA 3HRGA 3H6EA 3HOSA 1GOBA 3MEGA 3TI0A 1D8YA 4DF8A 3K0SA 4CD1A 1RILA 5HL7L 3DWLA 4NXNK 5M1NA 2OPQA 3THVA 4HVJA 3EE8A 1VK0A 3CPWM 3RR7A 4FXDA 2XY8A 2HHSA 1CZBA 2O4GA 2G8KA 1M1KO 5AQZA 3M1FA 3OW2M 4DR6K 2KFZA 2P9IA 4DFKA 2OPRA 4DG1A 3VF4A 3ENOA 4OVLA 2W41A 2Z1GA 3G6EN 4GW6A 4FYDA 2RF2A 4EHUA 4K41A 4DU3A 1RT4A 4M7YA 4Z4GA 2BTFA 3IFRA 4BE2A 5JS2A 3IMXA 3TPQA 4OLAA 2Z1HA 3CC4N 3DJCA 3FZMA 1GLFO 3CC2N 3AO1A 3LDSA 2IVPA 1L3TA 3AVNA 1HKGA 3U6FA 1K73O 1UA1A 5EY4A 3ZEUB 2QK9A 1VQLN 1W0HA 3ZT1A 4E89A 4OX9K 4CBXA 3TAMA 2Q1NA 3TU5A 4DQPA 2VYPA 2VGNA 3HPGA 4H4MA 1NKCA 1JLGA 3TARA 4KI6A 1T7PA 3V9WA 1GLJO 3DLEA 4JKGA 4EP4A 5BREA 1U6ZA 4AHRA 3TAPA 1BL3A 3DRRA 3G71N 4E0DA 1P8ZA 1ASUA 4FJNA 5AQTA 1RGIA 1Q81O 3ATVA 3F73A 3LM2A 3H45C 1YITN 4FJXA 3NDKA 3BDPA 3HVTA 3HYFA 4DF4A 4E1JA 4BRKA 1HJRA 5F2RA 4FCYA 1VQNN 2D5RA 4PL7A 3R8EA 3V1OA 4BGBA 4C23A 3T1HK 3TAEA 1REVA 3PX4A 2WFBA 2FBVA 3EZWA 1NGFA 4CECA 3CXCM 1RT3A 4RCHA 3ZSQA 1LW2A 3DXKB 4AILC 2KHOA 2XY5A 5C15A 5JLHA 2UYTA 3OYJA 4FJGA 3PO5A 4NYNA 5AFUA 4KHYA 4ILHA 1QE1A 4KH6A 2G8IA 2ITGA 3TWHA 2YNHA 3UKUB 2V7YA 1OH6A 3SMSA 5FRMA 5AJ3K 1WOQA 5AZIB 1RT5A 4WQ5A 1SL1A 4WE1A 4CIGA 3AA4A 3QNOA 1TKDA 4FWLA 1HMVA 4ISEA 3VQEA 2HBJA 1KXPA 3NF6A 1RTIA 3HJFA 4N47A 4DV3K 4DR2K 5I42A 3MCPA 3PLAA 4H4OA 4IOXA 3MCAB 3J7AP 4O0IA 5GAGP 4NLCA 2RE2A 2RKIA 4CEQA 2FBTA 4CEOA 4E1NA 4JI5K 5KRTA 3GE1A 5C24A 3SYZA 1S22A 3G4SN 3U9DA 4DSIA 3DLKA 3EZ5A 4LFCK 4IG3A 4QCLA 1UA0A 4Y1CA 5AQRA 2O8DA 2HHXA 4FVMA 4FWQA 4FK0A 2P9IB 3CIPA 1W7AA 3MX2A 4CJ5A 1VQ9N 1W97L 2HOEA 5LY3A 3E9OA 4H0VB 4CBWA 4AHTA 5AQKA 4DV6K 4BDYA 4M3ZA 1RCHA 3SK3A 1MWKA 3AGRA 3V9ZA 3OYLA 4FWPA 3LWMA 4KI4A 4B9LA 1QHAA 1QQNA 1NKBA 4DR5K 2G8VA 5SWMA 3EY1A 4HCBA 5I9EB 1WAJA 1LWCA 4CEEA 4F8RA 1WSJA 4FL9A 4W5OA 5BPMA 1HPMA 5FPMA 2QTDA 4CEBA 1IV0A 3AY9A 5KGWA 4L8RB 1ASVA 4JKGB 1JKHA 1C1BA 2JLEA 3A8YA 3LPTA 3VF2A 4YOVA 2G8HA 4J2DA 3O9TA 3SQ4A 3D6RA 1WSGA 1NU0A 3FR0A 4B8CA 3NMUA 4CIFA 1U45A 4EIAA 3LL3A 4JN4A 4KAZA 4FZYA 4DFMA 4JKBA 4DLGA 4NB4A 1LAWA 3CQYA 4L3QA 2HHWA 3FZFA 3K9JA 4ILGB 1NK6A 5GIPA 1K9MO 1WAFA 4BWJA 2Q0RA 1XC3A 1JL2A 2E2OA 3KLIA 4Y0WA 4BRMA 3O5BA 3VQ6A 4EP5A 1Q9XA 1VSLA 3V9UA 5GAEP 4B3RK 4ID1A 1VSIA 4ZTFA 4CJVA 4BREA 1JLAA 2CH5A 2D0OA 4CEZA 4CVNE 3TABA 1VQ6N 1QQCA 4JD2A 2A42A 4M42A 3MWPA 4BRAA 1KTQA 2FSNA 3VERA 1KAZA 3N4QA 4LY7A 1SUQA 3DRPA 1TK0A 5M1KA 4NYFA 3EKSA 2BH1A 3O4QA 4NCBA 4JV5K 3SBGA 4E7JA 3KWIA 3J7YP 4DFPA 4KPYA 3P38A 1BCMA 3L4IA 5J2MA 1RBVA 1Q82O 4DSKA 3G25A 4I9QA 4RW7A 3VQ9A 3PSIA 1X9WA 3RMDA 1T6CA 4CGDA 3VTHA 4HUGA 1BISA 4JEPA 3IAYA 2A41A 2UXDK 4C8MA 5SZTA 3CFPA 2F4VK 3RTVA 3FFKB 2UUBK 1IBKK 1VSFA 2ZM6K 1U49A 4GKJK 1TKZA 3AVIA 4DLEA 1KC8O 4OGCA 4X66K 5HP1A 2PBDA 2O8DB 3WEEA 5CZ1A 3VEZA 3T19A 4DU1A 3VA0A 2HB5A 2G8WA 4B3TK 5F1XA 3DAWA 4LF8K 1RDBA 4YHHK 2QWOA 2YNIA 3SPZA 2CGLA 1RBSA 3V4IA 1BHLA 2ASMA 1YVNA 3O9QA 3AVJA 3SUOA 3AVAA 4AM6A 4BRNA 3CCUN 4U7BA 4IDKA 4BC3A 4BY9C 3M8RA 3L0QA 3SMPA 1RT1A 1RBTA 4CGGA 2GEMA 3NGIA 1FKOA 3AV9A 3KTQA 3LDOA 2NRWA 5HRNA 4BRGA 3CJBA 4B1VA 4KHNA 3SCXA 4CZFA 4JI8K 2HF4A 3MAQA 1YJ9N 3F5TA 4CZMA 3R1XA 3SPYA 4BR7A 4GV3A 3NF7A 3HT3A 2VWKA 4LF5K 2F8TA 3DOKA 1HYSA 3FZHA 4FW1A 2P9NA 5FLXO 1TUUA 1RT6A 1RDCA 3CMEN 1DTQA 2X74A 2OZMA 2W6LA 3V6DA 4YNQA 1GLBG 4DTPA 1NLVA 3OYMA 4YORA 4BRDA 1V4TA 4BQLA 4CFAA 4B3MK 1X9MA 1BDGA 3QFUA 4H0YB 4ILJA 3MEDA 3DXMA 4FJ7A 4BE0A 3ZCMA 4DTNA 1KFSA 2JWLA 4W5TA 3RMCA 4DTSA 1S1WA 4BRLA 1J9AA 2QWLA 3OYIA 3GDQA 4LF6K 4H5RA 4JD2B 3S9HA 4MDAA 3AA3A 3CMAN 1J54A 3TTFA 1HNZK 3D7EO 1I3AA 3R3LA 3KLHA 3GG4A 4CGFA 5M1FA 4WF9L 1KAXA 4B1UB 3HBTA 3G10A 3VQDA 1EP4A 2A1RA 1XMOK 1A5WA 3DYAA 2KW4A 1J5OA 4Q5VA 4DQQA 2G8UA 1XMQK 2RPIA 2P9SA 4H5NA 4B9MA 3J81O 2O8BA 2E6LA 5DM6L 3VEWA 3C7NA 4WFNL 3DLHA 4CK3A 1NMDA 1JL1A 3O8MA 5JMVA 1BIUA 4W5RA 4DV2K 1IKXA 1GLEG 3NH1A 4BC2A 3KD1E 1NGAA 5ELZA 3AO5A 4A5BA 3VA3A 3AVHA 1JXBA 4IO8A 3UIQA 2ATQA 5GIOA 3HSCA 1R0AA 3M8PA 3WEEB 1WNSA 4B3SK 3CETA 4K8ZA 4H0PA 3HOTA 4CEFA 2NLXA 1UOCA 2F8SA 4LH5A 4WYBA 3FZLA 1NJIO 5KTQA 2NRZA 1XI1A 3HP6A 3GOIA 2WOMA 4DUZK 1N33K 3NE6A 4FJKA 2HMPA 4IFEA 3K58A 3P83D 3V9XA 2Y1JA 4Z4HA 1H1VA 4CK1A 2I5JA 1HQUA 5C0YA 3P1GA 4OLBA 1HJOA 4B1WB 3NF9A 1B9DA 3M8SA 2Z1JA 1CXUA 3WNHA 1IKWA 1BI4A 4B9VA 3LDNA 2FBYA 4CI6A 5JVGL 3TANA 3KHYA 1O1WA 4XH4A 4FJHA 1E3MA 1YTAA 3BZCA 2YHBA 3CCSN 1TKXA 4BVOA 1Y97A 1JXEA 2EX3A 4A57A 3PO4A 4GKKK 3HM8A 4AHUA 2VG6A 4BRQA 3KLGA 1VSJA 3SQ0A 1Z6RA 4DB3A 2P9NB 2ETJA 4BWMA 4GV9A 5AZJA 3J80O 1HKCA 3VQAA 3SUNA 4K42A 4E7LA 3NF8A 3VESA 2ZJQL 1CZ9A 2HHQA 1ZXOA 3QDKA 3ULEA 3I8BA 2A6AA 1BA0A 1BUPA 2W40A 3DXMB 2O8EA 4KHSA 4YDUA 1NGBA 1NGDA 3B6PA 3RWUA 3AVFA 1ZBHA 4F2RA 1VQON 4DQ8A 1FK9A 1S5JA 4DHYA 5AFUH 3F9KA 3A5OC 4MO4A 1D9FA 3LDQA 3O9SA 3VF6A 3VEOA 2NRHA 4KO0A 4FVUA 4FWRA 2NUBA 1BWFO 4JLHA 2GELA 2E20A 2W6KA 5KRSA 4ELVA 1YHQN 2ZE2A 3PIPL 2IGIA 5CHIA 3MN5A 4DV4K 5KQ8A 1NKEA 5HRSA 4CJFA 5E41A 1YUWA 5AQPA 1RT2A 2P9SB 1JCGA 3AVLA 4JI1K 1YJNN 3K5LA 1VSKA 3OYEA 3MWTA 1MWMA 5LJVA 1S1UA 2O8BB 2JWKA 4MQ3A 3C7NB 1QSSA 2Q31A 3RVCA
chains in the Genus database with same CATH topology
3DLGA 3MXMA 4DQIA 4Q0BA 2P1JA 4L8RB 3NGZA 3NH0A 1ASVA 3ZSYA 4C8LA 4FJ9A 1TAUA 2HNZA 3OYNA 1JKHA 1C1BA 2JLEA 3LP3A 3LZJA 2OPSA 3VQQA 4CHQA 2QKKA 3LPTA 4CJEA 2LSNA 3LAKA 2G8HA 4J2DA 1T8EA 3SQ4A 2HNDA 1WSGA 1S1TA 2PZSA 1SL0A 3PY8A 3OS2A 4B8CA 4XIUA 4CJ3A 2VWJA 1TVRA 4CIFA 4BE1A 1U45A 3ZSXA 4KAZA 1WN7A 3VN5A 4FZYA 5DK5A 4M3TA 4DFMA 3OVNA 1S1XA 3OYAA 4DS5A 1VRUA 4W5NA 3K5NA 4Z0UA 4DLGA 4PY5A 1KVAA 1TGOA 1LAWA 4FJMA 3O3HA 2HHWA 1ZBFA 1NK6A 1RBRA 4FM1A 4FJLA 4I7FA 3OYHA 3HP9A 1WAFA 4BWJA 1NJWA 1JL2A 2E6MA 3KLIA 3C6UA 1WSFA 1EKEA 3IRXA 3VQ6A 3LP0A 4EP5A 3KD5E 3DM2A 1Q9XA 3KK2A 1VSLA 3K5OA 4OKJA 4CF1A 3V9UA 1NK4A 2HW3A 2KFNA 2X6NA 4ID1A 4I9LA 3MXJA 1BI4B 1Z25A 4CFCA 3SUQA 4FLZA 1VSIA 4ZTFA 4CJVA 2YNFA 2A1SA 1JLAA 1X1PA 4CEZA 3TABA 1ZBUA 1QHTA 1YVUA 1QQCA 1C0TA 4CFBA 3KKRA 3PX0A 4BDPA 4M42A 1RNHA 4OPJA 2HMIA 4I2QA 1KTQA 1C0MA 3CG7A 4CF0A 5KI6A 3NFAA 2G8FA 1C0UA 1F21A 4KB0A 1WSIA 4ELUA 4LH4A 2BDPA 2OA8A 4GVMA 4FJ8A 3ITHA 5JS1A 3TR8A 5HRPA 4LY7A 3L2VA 4OKEA 3AO2A 5HROA 1BIZA 1SUQA 3DRPA 3OJSA 3SQ1A 1NJYA 1TK0A 3ZT2A 3JSMA 2P5GA 1VSMA 4NYFA 4M41A 3CFOA 1EX4A 3O4QA 3VQPA 3LAMA 4YFUA 4FLTA 4C8KA 4NCBA 4E7JA 1L3UA 4DFPA 4KPYA 2F96A 1A5XA 1BCMA 4CF2A 5J2MA 3B6OA 1RBVA 3CQ8A 1JLEA 2D0BA 3ZT3A 4CJPA 3ULDA 4DSKA 3QIOA 3KLFA 4BACA 3A2FA 4B9TA 4IBNA 4I9QA 4RW7A 1BQNA 3VQ9A 4FK4A 1U04A 1QTMA 1KVCA 4CJWA 1X9WA 3L2UA 3RMDA 4TSXA 1W9HA 4CGDA 4HUGA 4CGHA 1BISA 3NGYA 3IAYA 3V1RA 3DI6A 1HPZA 3EYZA 1KLMA 4NCGA 1XHZA 3L3VA 1Z26A 4C8MA 5FRNA 5HRRA 5SZTA 3CFPA 2BANA 3RTVA 4CESA 4CJRA 2HHVA 1VSFA 1U49A 4DSJA 3ZSRA 1TKZA 3HM9A 4B08A 4B8AB 5T7BA 4FM0A 3AVIA 4DLEA 1NK0A 4OGCA 3IS9A 5HP1A 1KCFA 3QETA 1IO2A 2E4LA 4G1QA 4QAGA 4B9UA 3OS1A 2Y1IA 5CZ1A 3QEWA 4RW6A 3QO9A 2QKBA 4F4KA 1YT3A 4CJTA 4OJRA 4F3OA 3T19A 3LZIA 4DU1A 4AH9A 3VA0A 3ZT0A 5J2NA 3C6TA 1L3VA 3RR8A 2HB5A 4IFYA 4CF9A 4OPKA 4DTMA 1S1VA 3RRHA 1Q8IA 3V81A 2YKMA 4DTXA 4FLXA 2G8WA 4PQUA 1TKTA 2WONA 4DS4A 5HLFA 3RMBA 1B92A 1NOZA 1RDBA 1HRHA 1JLQA 2YNIA 3D0PA 4FLUA 1RBSA 2XY7A 3SPZA 4CHPA 2PY5A 3V4IA 3S3MA 1BHLA 3OS0A 4HCCA 1RDAA 4MFBA 3LP1A 1TK5A 3AVJA 5CYMA 4KHQA 1C1AA 2RN2A 3PV8A 3ZSOA 3SUOA 3HO1A 4E7HA 3AVAA 4H8KA 2EHGA 4JRQA 1VSEA 3U3YA 1D5AA 3NHGA 1IG9A 4CHNA 3M8QA 3ZT4A 3VQBA 1LW0A 1S9EA 1RTJA 1DTTA 4R5PA 1G15A 4IDKA 1ZBLA 4E7KA 4Z4IA 3M8RA 3K59A 4DTRA 2KQ2A 1RT1A 1GOAA 2QXFA 1C6VA 3E01A 1RBTA 4RG8A 5KGXA 4CGGA 1LAVA 2GBZA 3NGIA 1FKOA 1J53A 2IDOA 3AVCA 4JS4A 3AV9A 3KTQA 3VQ5A 3V1QA 4IG0A 3ISNC 1N6QA 1ZBIA 2HNYA 3K57A 5HRNA 4EZ6A 4KHNA 4CJLA 3DOLA 4KHWA 5FROA 4QOZB 1QSLA 1ITGA 2YHAA 4RW4A 4LD0A 3SCXA 3LWLA 1C1CA 4CJ4A 2KZZA 3MAQA 2HHTA 1GOCA 3NAEA 4F3TA 3SPYA 1VRTA 1HYZA 1WSHA 1NK5A 4CFDA 2DFFA 3NF7A 4E3SA 2HVIA 3HT3A 2VWKA 4UQGA 4E7IA 4FJIA 3DOKA 4N76A 1VSHA 4FLVA 2F8TA 4FW1A 3SNNA 1HYSA 4CGIA 5I3UA 4FJ5A 3AO3A 2FC0A 1N5YA 1RT6A 4O0JA 1RDCA 1TL1A 4PA1A 1DTQA 2X74A 1SKWA 2GV9A 4M3YA 2OZMA 3AVBA 3V6DA 2Z1IA 1S6QA 3VQ7A 4DMNA 4ZHRA 4YNQA 3NCIA 1JLCA 3OYCA 3SV4A 3T1AA 4OGEA 3OYMA 4DU4A 4DTPA 1SKSA 4B3OA 1WSEA 2DY4A 1UAXA 4C8NA 1KFDA 2VG7A 4M3UA 5CZ2A 1FXXA 3AO4A 4CFAA 1TK8A 4ELTA 1LV5A 3P5JA 4FW2A 2OYQA 1X9MA 2KZMA 4W5QA 1GOBA 3MEGA 4CJUA 3MEDA 1TL3A 3TI0A 1D8YA 4DF8A 2YV0X 4DTJA 4FJ7A 4BE0A 3ZCMA 4DTNA 3SQ2A 4Z4CA 3OYGA 1KFSA 1HNIA 3D45A 3SV3A 3V9SA 3OYBA 1RILA 2FBXA 4W5TA 3RMCA 1BCOA 2OPQA 4DSEA 4DTSA 5J2PA 3THVA 3AA2A 5EU7A 4HVJA 1I39A 1S1WA 1K6YA 1VK0A 3WNFA 1KRPA 3H08A 4KREA 4DTUA 1J9AA 3RR7A 2XY8A 4FXDA 2HHSA 1CZBA 2O4GA 3QNNA 3OYIA 3HVRA 2ZQBA 4O5BA 2G8KA 5C25A 2KFZA 4DFKA 2OPRA 4DG1A 4OVLA 1D9DA 3S9HA 3KIOA 2AJQA 1FKPA 2Z1GA 3O4NA 4GW6A 4FYDA 1BQMA 2RF2A 3AA3A 4FLYA 4DU3A 1RT4A 1J54A 2OPPA 3HK2A 3VQ4A 4IFVA 1NK8A 1RTDA 1I3AA 4N41A 4Z4GA 3KLHA 4J2AA 4IKFA 2XO7A 3L2WA 5FDLA 4BE2A 4CGFA 5JS2A 2DFHA 3G10A 3VQDA 1L5UA 1EP4A 1EXQA 4OLAA 2O4IA 2Z1HA 2A1RA 4CCHA 1A5WA 3DYAA 2KW4A 1J5OA 3AA5X 4DQRA 1NJXA 3AO1A 3KKSA 1UWBA 4Q5VA 1S6PA 3LDSA 5CY4A 4AHSA 4DQQA 3AVNA 1L3TA 2G8UA 2PYLA 4CK2A 4AHVA 2R7YA 1VSDA 2RPIA 3U6FA 4B9MA 1UA1A 3DRSA 4NCAA 4CEAA 2B6AA 2QK9A 4N5SA 1KVBA 3S3NA 3C94A 1W0HA 3QEPA 3ZT1A 2IC3A 5K14A 4E89A 3TAMA 4K8XA 3LALA 3RMAA 4PWDA 2E6LA 3IG1A 4DQPA 1TV6A 4AHCA 3DLHA 3ZSZA 4CK3A 3MECA 1IH7A 3QEVA 3HPGA 4M45A 1RTHA 3AVMA 1DLOA 4H4MA 3ZSVA 3QIPA 1JL1A 3VQCA 1JLGA 4DFJA 3TARA 1LWFA 1NKCA 1QSYA 4C8OA 1BIUA 1HQEA 4W5RA 1T7PA 4KI6A 3V9WA 2B5JA 1IKXA 3DLEA 1SL2A 3QINA 3NH1A 1WLJA 4EP4A 4JRPA 4J2EA 4CHZA 4ID5A 3KD1E 1CXQA 1MU2A 3CFRA 3SZ2A 4AHRA 3TAPA 4M3XA 3AO5A 4CERA 3VA3A 4KB1A 3AVHA 1BL3A 1JXBA 3DRRA 2PYJA 3UIQA 1XC9A 4E0DA 1QS4A 1HNVA 1ASUA 3L8BA 2ATQA 2D0AA 4FZZA 4FJNA 1R0AA 1LWEA 3CM5A 3M8PA 3TAFA 3TAQA 3CM6A 3I0SA 1WNSA 3F73A 1NJZA 2KTQA 4K8ZA 4FJXA 3RRGA 1EETA 3NDKA 4PUOA 4CEFA 3BDPA 3HVTA 3HYFA 5D3GA 4DF4A 2B4JA 2HVHA 1UOCA 4JS5A 4LH5A 2F8SA 1HJRA 5J2QA 4B9NA 4E1MA 4FCYA 5KTQA 4FLWA 2D5RA 1XI1A 3HP6A 2WOMA 4O44A 3V1OA 3NE6A 1HYVA 3HPHA 3TAGA 4FJKA 2YKNA 3TAEA 4FZXC 1REVA 3PX4A 3K58A 3P83D 3V9XA 2Y1JA 4Z4HA 2FBVA 4CHOA 4CK1A 4KHUA 2I5JA 4CECA 1ASWA 1HQUA 4N56A 1RT3A 3PUFA 3P1GA 3SJJA 4OLBA 3QEXA 4CGJA 3ZSQA 1LW2A 4AILC 4RW8A 3NF9A 2XY5A 1SV5A 1B9DA 3M8SA 3I0RA 1XWLA 2JGUA 1CXUA 2Z1JA 4HHTA 1SKRA 3WNHA 1IKWA 1BI4A 4KTQA 4Y1DA 3OYJA 4FJGA 4B9VA 3PO5A 5C42A 2FBYA 4NYNA 4KHYA 1QE1A 2ZD1A 3KK1A 4HUEA 2X78A 3TANA 1YTUA 2IS3A 3ZSWA 3I8DA 3MEEA 1O1WA 2ITGA 3T3FA 2XY6A 4FJHA 1YTAA 2G8IA 3TWHA 3PX6A 2P51A 2VG5A 2YHBA 2YNHA 3MXIA 4KTZA 1TKXA 1Y97A 5FRMA 1JXEA 2EX3A 3DMJA 1L3SA 4DSFA 3DLBA 1RT5A 3PO4A 1A5VA 4B9SA 3WNGA 4AHUA 1CLQA 2VG6A 4FJJA 1SL1A 4WE1A 3KK3A 4CIGA 3NH2A 3KLGA 1VSJA 1B9FA 4EZ9A 3SQ0A 3AA4A 3QNOA 3OYFA 5J1EA 1TKDA 1HMVA 3VQEA 2ETJA 1BGXT 4CE9A 4BWMA 3HXMA 3NF6A 4M3RA 1RTIA 3LP2A 3HJFA 3ALYA 2BE2A 3VQAA 3SUNA 4N47A 4ICLA 4FK2A 2Q3SA 4DQSA 3SUPA 5I42A 4E7LA 4M3WA 1IKVA 3NF8A 4H4OA 1U48A 3BGRA 3K2PA 3O3GA 1CZ9A 2HHQA 3AVGA 4I2PA 4LSLA 1U47A 2GUIA 4O0IA 4HUFA 1T03A 4F2SA 2RKIA 5HBMA 1TAQA 4CEQA 4Z4EA 2FBTA 4CJKA 4CEOA 4E1NA 3KLEA 4KHSA 5KRTA 4KFBA 4O4GA 3OYKA 3B6PA 3RWUA 2X6SA 5C24A 5DMRA 3AVFA 4CJQA 3SYZA 4F2RA 1ZBHA 1XHXA 3U3GA 2OZSA 1FK9A 1S5JA 3F9KA 3LANA 3L2RA 1Q9YA 4DSIA 4CF8A 1ZYQA 3DLKA 3EZ5A 2IAJA 2W42A 1S9GA 3FFIA 4IG3A 3QEIA 1UA0A 4Y1CA 1D9FA 3VQ8A 4CEDA 4QCLA 2HHXA 3QLHA 3HSTB 4FVMA 4KV8A 3HPOA 4FK0A 4KRFA 1JLFA 1IKYA 3AVKA 4KO0A 3K5MA 4E19A 1RDDA 4LSNA 2HHUA 1X9SA 2DFEA 2NUBA 4JLHA 4CIEA 1T05A 4DSLA 4CJ5A 4CHYA 4DWIA 3HL8A 5KRSA 4CJSA 4ELVA 4AHTA 2XHBA 2D0CA 2ZE2A 4BDYA 3L2QA 2IGIA 4M3ZA 1RCHA 3LPUA 1U4BA 4ZTJA 2P5OA 3V9ZA 1NK7A 3OYDA 3CYMA 1NOYA 4DTOA 3ASMA 3QERA 3OYLA 4J2BA 3JYTA 3G0ZA 1KLNA 3LWMA 4KI4A 3NBPA 4BDZA 4B9LA 1NKEA 3KJVA 5HRSA 3OY9A 4CJFA 3SI6A 5E41A 1NKBA 2IOCA 4KKOA 4KTWA 5CYQA 1RT2A 3AVLA 2XRIA 4HTUA 2G8VA 4RW9A 3K5LA 1NK9A 3DLRA 3S3OA 1VSKA 5SWMA 4GMJB 3OYEA 3EY1A 2BGGA 1JLBA 4HCBA 1LWCA 1WAJA 4CEEA 1KSPA 4F8RA 1S1UA 4Z4FA 1WSJA 3C95A 4FM2A 2YNGA 4OKKA 4W5OA 4MQ3A 3L3UA 1RBUA 4O55A 3QESA 3OJUA 1QSSA 2DTUA 1RT7A 4CEBA 3WNEA 3O3FA 5KGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLG A;  3MXM A;  4DQI A;  4Q0B A;  2P1J A;  4L8R B;  3NGZ A;  3NH0 A;  1ASV A;  3ZSY A;  4C8L A;  4FJ9 A;  1TAU A;  2HNZ A;  3OYN A;  1JKH A;  1C1B A;  2JLE A;  3LP3 A;  3LZJ A;  2OPS A;  3VQQ A;  4CHQ A;  2QKK A;  3LPT A;  4CJE A;  2LSN A;  3LAK A;  2G8H A;  4J2D A;  1T8E A;  3SQ4 A;  2HND A;  1WSG A;  1S1T A;  2PZS A;  1SL0 A;  3PY8 A;  3OS2 A;  4B8C A;  4XIU A;  4CJ3 A;  2VWJ A;  1TVR A;  4CIF A;  4BE1 A;  1U45 A;  3ZSX A;  4KAZ A;  1WN7 A;  3VN5 A;  4FZY A;  5DK5 A;  4M3T A;  4DFM A;  3OVN A;  1S1X A;  3OYA A;  4DS5 A;  1VRU A;  4W5N A;  3K5N A;  4Z0U A;  4DLG A;  4PY5 A;  1KVA A;  1TGO A;  1LAW A;  4FJM A;  3O3H A;  2HHW A;  1ZBF A;  1NK6 A;  1RBR A;  4FM1 A;  4FJL A;  4I7F A;  3OYH A;  3HP9 A;  1WAF A;  4BWJ A;  1NJW A;  1JL2 A;  2E6M A;  3KLI A;  3C6U A;  1WSF A;  1EKE A;  3IRX A;  3VQ6 A;  3LP0 A;  4EP5 A;  3KD5 E;  3DM2 A;  1Q9X A;  3KK2 A;  1VSL A;  3K5O A;  4OKJ A;  4CF1 A;  3V9U A;  1NK4 A;  2HW3 A;  2KFN A;  2X6N A;  4ID1 A;  4I9L A;  3MXJ A;  1BI4 B;  1Z25 A;  4CFC A;  3SUQ A;  4FLZ A;  1VSI A;  4ZTF A;  4CJV A;  2YNF A;  2A1S A;  1JLA A;  1X1P A;  4CEZ A;  3TAB A;  1ZBU A;  1QHT A;  1YVU A;  1QQC A;  1C0T A;  4CFB A;  3KKR A;  3PX0 A;  4BDP A;  4M42 A;  1RNH A;  4OPJ A;  2HMI A;  4I2Q A;  1KTQ A;  1C0M A;  3CG7 A;  4CF0 A;  5KI6 A;  3NFA A;  2G8F A;  1C0U A;  1F21 A;  4KB0 A;  1WSI A;  4ELU A;  4LH4 A;  2BDP A;  2OA8 A;  4GVM A;  4FJ8 A;  3ITH A;  5JS1 A;  3TR8 A;  5HRP A;  4LY7 A;  3L2V A;  4OKE A;  3AO2 A;  5HRO A;  1BIZ A;  1SUQ A;  3DRP A;  3OJS A;  3SQ1 A;  1NJY A;  1TK0 A;  3ZT2 A;  3JSM A;  2P5G A;  1VSM A;  4NYF A;  4M41 A;  3CFO A;  1EX4 A;  3O4Q A;  3VQP A;  3LAM A;  4YFU A;  4FLT A;  4C8K A;  4NCB A;  4E7J A;  1L3U A;  4DFP A;  4KPY A;  2F96 A;  1A5X A;  1BCM A;  4CF2 A;  5J2M A;  3B6O A;  1RBV A;  3CQ8 A;  1JLE A;  2D0B A;  3ZT3 A;  4CJP A;  3ULD A;  4DSK A;  3QIO A;  3KLF A;  4BAC A;  3A2F A;  4B9T A;  4IBN A;  4I9Q A;  4RW7 A;  1BQN A;  3VQ9 A;  4FK4 A;  1U04 A;  1QTM A;  1KVC A;  4CJW A;  1X9W A;  3L2U A;  3RMD A;  4TSX A;  1W9H A;  4CGD A;  4HUG A;  4CGH A;  1BIS A;  3NGY A;  3IAY A;  3V1R A;  3DI6 A;  1HPZ A;  3EYZ A;  1KLM A;  4NCG A;  1XHZ A;  3L3V A;  1Z26 A;  4C8M A;  5FRN A;  5HRR A;  5SZT A;  3CFP A;  2BAN A;  3RTV A;  4CES A;  4CJR A;  2HHV A;  1VSF A;  1U49 A;  4DSJ A;  3ZSR A;  1TKZ A;  3HM9 A;  4B08 A;  4B8A B;  5T7B A;  4FM0 A;  3AVI A;  4DLE A;  1NK0 A;  4OGC A;  3IS9 A;  5HP1 A;  1KCF A;  3QET A;  1IO2 A;  2E4L A;  4G1Q A;  4QAG A;  4B9U A;  3OS1 A;  2Y1I A;  5CZ1 A;  3QEW A;  4RW6 A;  3QO9 A;  2QKB A;  4F4K A;  1YT3 A;  4CJT A;  4OJR A;  4F3O A;  3T19 A;  3LZI A;  4DU1 A;  4AH9 A;  3VA0 A;  3ZT0 A;  5J2N A;  3C6T A;  1L3V A;  3RR8 A;  2HB5 A;  4IFY A;  4CF9 A;  4OPK A;  4DTM A;  1S1V A;  3RRH A;  1Q8I A;  3V81 A;  2YKM A;  4DTX A;  4FLX A;  2G8W A;  4PQU A;  1TKT A;  2WON A;  4DS4 A;  5HLF A;  3RMB A;  1B92 A;  1NOZ A;  1RDB A;  1HRH A;  1JLQ A;  2YNI A;  3D0P A;  4FLU A;  1RBS A;  2XY7 A;  3SPZ A;  4CHP A;  2PY5 A;  3V4I A;  3S3M A;  1BHL A;  3OS0 A;  4HCC A;  1RDA A;  4MFB A;  3LP1 A;  1TK5 A;  3AVJ A;  5CYM A;  4KHQ A;  1C1A A;  2RN2 A;  3PV8 A;  3ZSO A;  3SUO A;  3HO1 A;  4E7H A;  3AVA A;  4H8K A;  2EHG A;  4JRQ A;  1VSE A;  3U3Y A;  1D5A A;  3NHG A;  1IG9 A;  4CHN A;  3M8Q A;  3ZT4 A;  3VQB A;  1LW0 A;  1S9E A;  1RTJ A;  1DTT A;  4R5P A;  1G15 A;  4IDK A;  1ZBL A;  4E7K A;  4Z4I A;  3M8R A;  3K59 A;  4DTR A;  2KQ2 A;  1RT1 A;  1GOA A;  2QXF A;  1C6V A;  3E01 A;  1RBT A;  4RG8 A;  5KGX A;  4CGG A;  1LAV A;  2GBZ A;  3NGI A;  1FKO A;  1J53 A;  2IDO A;  3AVC A;  4JS4 A;  3AV9 A;  3KTQ A;  3VQ5 A;  3V1Q A;  4IG0 A;  3ISN C;  1N6Q A;  1ZBI A;  2HNY A;  3K57 A;  5HRN A;  4EZ6 A;  4KHN A;  4CJL A;  3DOL A;  4KHW A;  5FRO A;  4QOZ B;  1QSL A;  1ITG A;  2YHA A;  4RW4 A;  4LD0 A;  3SCX A;  3LWL A;  1C1C A;  4CJ4 A;  2KZZ A;  3MAQ A;  2HHT A;  1GOC A;  3NAE A;  4F3T A;  3SPY A;  1VRT A;  1HYZ A;  1WSH A;  1NK5 A;  4CFD A;  2DFF A;  3NF7 A;  4E3S A;  2HVI A;  3HT3 A;  2VWK A;  4UQG A;  4E7I A;  4FJI A;  3DOK A;  4N76 A;  1VSH A;  4FLV A;  2F8T A;  4FW1 A;  3SNN A;  1HYS A;  4CGI A;  5I3U A;  4FJ5 A;  3AO3 A;  2FC0 A;  1N5Y A;  1RT6 A;  4O0J A;  1RDC A;  1TL1 A;  4PA1 A;  1DTQ A;  2X74 A;  1SKW A;  2GV9 A;  4M3Y A;  2OZM A;  3AVB A;  3V6D A;  2Z1I A;  1S6Q A;  3VQ7 A;  4DMN A;  4ZHR A;  4YNQ A;  3NCI A;  1JLC A;  3OYC A;  3SV4 A;  3T1A A;  4OGE A;  3OYM A;  4DU4 A;  4DTP A;  1SKS A;  4B3O A;  1WSE A;  2DY4 A;  1UAX A;  4C8N A;  1KFD A;  2VG7 A;  4M3U A;  5CZ2 A;  1FXX A;  3AO4 A;  4CFA A;  1TK8 A;  4ELT A;  1LV5 A;  3P5J A;  4FW2 A;  2OYQ A;  1X9M A;  2KZM A;  4W5Q A;  1GOB A;  3MEG A;  4CJU A;  3MED A;  1TL3 A;  3TI0 A;  1D8Y A;  4DF8 A;  2YV0 X;  4DTJ A;  4FJ7 A;  4BE0 A;  3ZCM A;  4DTN A;  3SQ2 A;  4Z4C A;  3OYG A;  1KFS A;  1HNI A;  3D45 A;  3SV3 A;  3V9S A;  3OYB A;  1RIL A;  2FBX A;  4W5T A;  3RMC A;  1BCO A;  2OPQ A;  4DSE A;  4DTS A;  5J2P A;  3THV A;  3AA2 A;  5EU7 A;  4HVJ A;  1I39 A;  1S1W A;  1K6Y A;  1VK0 A;  3WNF A;  1KRP A;  3H08 A;  4KRE A;  4DTU A;  1J9A A;  3RR7 A;  2XY8 A;  4FXD A;  2HHS A;  1CZB A;  2O4G A;  3QNN A;  3OYI A;  3HVR A;  2ZQB A;  4O5B A;  2G8K A;  5C25 A;  2KFZ A;  4DFK A;  2OPR A;  4DG1 A;  4OVL A;  1D9D A;  3S9H A;  3KIO A;  2AJQ A;  1FKP A;  2Z1G A;  3O4N A;  4GW6 A;  4FYD A;  1BQM A;  2RF2 A;  3AA3 A;  4FLY A;  4DU3 A;  1RT4 A;  1J54 A;  2OPP A;  3HK2 A;  3VQ4 A;  4IFV A;  1NK8 A;  1RTD A;  1I3A A;  4N41 A;  4Z4G A;  3KLH A;  4J2A A;  4IKF A;  2XO7 A;  3L2W A;  5FDL A;  4BE2 A;  4CGF A;  5JS2 A;  2DFH A;  3G10 A;  3VQD A;  1L5U A;  1EP4 A;  1EXQ A;  4OLA A;  2O4I A;  2Z1H A;  2A1R A;  4CCH A;  1A5W A;  3DYA A;  2KW4 A;  1J5O A;  3AA5 X;  4DQR A;  1NJX A;  3AO1 A;  3KKS A;  1UWB A;  4Q5V A;  1S6P A;  3LDS A;  5CY4 A;  4AHS A;  4DQQ A;  3AVN A;  1L3T A;  2G8U A;  2PYL A;  4CK2 A;  4AHV A;  2R7Y A;  1VSD A;  2RPI A;  3U6F A;  4B9M A;  1UA1 A;  3DRS A;  4NCA A;  4CEA A;  2B6A A;  2QK9 A;  4N5S A;  1KVB A;  3S3N A;  3C94 A;  1W0H A;  3QEP A;  3ZT1 A;  2IC3 A;  5K14 A;  4E89 A;  3TAM A;  4K8X A;  3LAL A;  3RMA A;  4PWD A;  2E6L A;  3IG1 A;  4DQP A;  1TV6 A;  4AHC A;  3DLH A;  3ZSZ A;  4CK3 A;  3MEC A;  1IH7 A;  3QEV A;  3HPG A;  4M45 A;  1RTH A;  3AVM A;  1DLO A;  4H4M A;  3ZSV A;  3QIP A;  1JL1 A;  3VQC A;  1JLG A;  4DFJ A;  3TAR A;  1LWF A;  1NKC A;  1QSY A;  4C8O A;  1BIU A;  1HQE A;  4W5R A;  1T7P A;  4KI6 A;  3V9W A;  2B5J A;  1IKX A;  3DLE A;  1SL2 A;  3QIN A;  3NH1 A;  1WLJ A;  4EP4 A;  4JRP A;  4J2E A;  4CHZ A;  4ID5 A;  3KD1 E;  1CXQ A;  1MU2 A;  3CFR A;  3SZ2 A;  4AHR A;  3TAP A;  4M3X A;  3AO5 A;  4CER A;  3VA3 A;  4KB1 A;  3AVH A;  1BL3 A;  1JXB A;  3DRR A;  2PYJ A;  3UIQ A;  1XC9 A;  4E0D A;  1QS4 A;  1HNV A;  1ASU A;  3L8B A;  2ATQ A;  2D0A A;  4FZZ A;  4FJN A;  1R0A A;  1LWE A;  3CM5 A;  3M8P A;  3TAF A;  3TAQ A;  3CM6 A;  3I0S A;  1WNS A;  3F73 A;  1NJZ A;  2KTQ A;  4K8Z A;  4FJX A;  3RRG A;  1EET A;  3NDK A;  4PUO A;  4CEF A;  3BDP A;  3HVT A;  3HYF A;  5D3G A;  4DF4 A;  2B4J A;  2HVH A;  1UOC A;  4JS5 A;  4LH5 A;  2F8S A;  1HJR A;  5J2Q A;  4B9N A;  4E1M A;  4FCY A;  5KTQ A;  4FLW A;  2D5R A;  1XI1 A;  3HP6 A;  2WOM A;  4O44 A;  3V1O A;  3NE6 A;  1HYV A;  3HPH A;  3TAG A;  4FJK A;  2YKN A;  3TAE A;  4FZX C;  1REV A;  3PX4 A;  3K58 A;  3P83 D;  3V9X A;  2Y1J A;  4Z4H A;  2FBV A;  4CHO A;  4CK1 A;  4KHU A;  2I5J A;  4CEC A;  1ASW A;  1HQU A;  4N56 A;  1RT3 A;  3PUF A;  3P1G A;  3SJJ A;  4OLB A;  3QEX A;  4CGJ A;  3ZSQ A;  1LW2 A;  4AIL C;  4RW8 A;  3NF9 A;  2XY5 A;  1SV5 A;  1B9D A;  3M8S A;  3I0R A;  1XWL A;  2JGU A;  1CXU A;  2Z1J A;  4HHT A;  1SKR A;  3WNH A;  1IKW A;  1BI4 A;  4KTQ A;  4Y1D A;  3OYJ A;  4FJG A;  4B9V A;  3PO5 A;  5C42 A;  2FBY A;  4NYN A;  4KHY A;  1QE1 A;  2ZD1 A;  3KK1 A;  4HUE A;  2X78 A;  3TAN A;  1YTU A;  2IS3 A;  3ZSW A;  3I8D A;  3MEE A;  1O1W A;  2ITG A;  3T3F A;  2XY6 A;  4FJH A;  1YTA A;  2G8I A;  3TWH A;  3PX6 A;  2P51 A;  2VG5 A;  2YHB A;  2YNH A;  3MXI A;  4KTZ A;  1TKX A;  1Y97 A;  5FRM A;  1JXE A;  2EX3 A;  3DMJ A;  1L3S A;  4DSF A;  3DLB A;  1RT5 A;  3PO4 A;  1A5V A;  4B9S A;  3WNG A;  4AHU A;  1CLQ A;  2VG6 A;  4FJJ A;  1SL1 A;  4WE1 A;  3KK3 A;  4CIG A;  3NH2 A;  3KLG A;  1VSJ A;  1B9F A;  4EZ9 A;  3SQ0 A;  3AA4 A;  3QNO A;  3OYF A;  5J1E A;  1TKD A;  1HMV A;  3VQE A;  2ETJ A;  1BGX T;  4CE9 A;  4BWM A;  3HXM A;  3NF6 A;  4M3R A;  1RTI A;  3LP2 A;  3HJF A;  3ALY A;  2BE2 A;  3VQA A;  3SUN A;  4N47 A;  4ICL A;  4FK2 A;  2Q3S A;  4DQS A;  3SUP A;  5I42 A;  4E7L A;  4M3W A;  1IKV A;  3NF8 A;  4H4O A;  1U48 A;  3BGR A;  3K2P A;  3O3G A;  1CZ9 A;  2HHQ A;  3AVG A;  4I2P A;  4LSL A;  1U47 A;  2GUI A;  4O0I A;  4HUF A;  1T03 A;  4F2S A;  2RKI A;  5HBM A;  1TAQ A;  4CEQ A;  4Z4E A;  2FBT A;  4CJK A;  4CEO A;  4E1N A;  3KLE A;  4KHS A;  5KRT A;  4KFB A;  4O4G A;  3OYK A;  3B6P A;  3RWU A;  2X6S A;  5C24 A;  5DMR A;  3AVF A;  4CJQ A;  3SYZ A;  4F2R A;  1ZBH A;  1XHX A;  3U3G A;  2OZS A;  1FK9 A;  1S5J A;  3F9K A;  3LAN A;  3L2R A;  1Q9Y A;  4DSI A;  4CF8 A;  1ZYQ A;  3DLK A;  3EZ5 A;  2IAJ A;  2W42 A;  1S9G A;  3FFI A;  4IG3 A;  3QEI A;  1UA0 A;  4Y1C A;  1D9F A;  3VQ8 A;  4CED A;  4QCL A;  2HHX A;  3QLH A;  3HST B;  4FVM A;  4KV8 A;  3HPO A;  4FK0 A;  4KRF A;  1JLF A;  1IKY A;  3AVK A;  4KO0 A;  3K5M A;  4E19 A;  1RDD A;  4LSN A;  2HHU A;  1X9S A;  2DFE A;  2NUB A;  4JLH A;  4CIE A;  1T05 A;  4DSL A;  4CJ5 A;  4CHY A;  4DWI A;  3HL8 A;  5KRS A;  4CJS A;  4ELV A;  4AHT A;  2XHB A;  2D0C A;  2ZE2 A;  4BDY A;  3L2Q A;  2IGI A;  4M3Z A;  1RCH A;  3LPU A;  1U4B A;  4ZTJ A;  2P5O A;  3V9Z A;  1NK7 A;  3OYD A;  3CYM A;  1NOY A;  4DTO A;  3ASM A;  3QER A;  3OYL A;  4J2B A;  3JYT A;  3G0Z A;  1KLN A;  3LWM A;  4KI4 A;  3NBP A;  4BDZ A;  4B9L A;  1NKE A;  3KJV A;  5HRS A;  3OY9 A;  4CJF A;  3SI6 A;  5E41 A;  1NKB A;  2IOC A;  4KKO A;  4KTW A;  5CYQ A;  1RT2 A;  3AVL A;  2XRI A;  4HTU A;  2G8V A;  4RW9 A;  3K5L A;  1NK9 A;  3DLR A;  3S3O A;  1VSK A;  5SWM A;  4GMJ B;  3OYE A;  3EY1 A;  2BGG A;  1JLB A;  4HCB A;  1LWC A;  1WAJ A;  4CEE A;  1KSP A;  4F8R A;  1S1U A;  4Z4F A;  1WSJ A;  3C95 A;  4FM2 A;  2YNG A;  4OKK A;  4W5O A;  4MQ3 A;  3L3U A;  1RBU A;  4O55 A;  3QES A;  3OJU A;  1QSS A;  2DTU A;  1RT7 A;  4CEB A;  3WNE A;  3O3F A;  5KGW A; 
#chains in the Genus database with same CATH topology
 4BRC A;  3ZSY A;  4FJ9 A;  2HNZ A;  4A61 A;  3LP3 A;  4IEE A;  3LZJ A;  2QKK A;  4IZ9 A;  3P31 A;  3O9R A;  4CZE A;  4B1Y B;  1SL0 A;  3NVM A;  3CCE N;  1HX1 A;  2P9U B;  3VN5 A;  4A62 A;  4CZJ A;  4PHT X;  4X64 K;  1WB9 A;  4W5N A;  3K5N A;  2ZJP L;  1TGO A;  1ZBF A;  2Q97 A;  4FJL A;  4FM1 A;  1DGK N;  1NJW A;  3E9L A;  2E6M A;  1J6Z A;  4CZL A;  4BR2 A;  3PIO L;  2KFN A;  2X6N A;  3T69 A;  1BI4 B;  3O4W A;  4DR3 K;  4FLZ A;  4LC9 B;  4FWK A;  1RDU A;  2YNF A;  4H5V A;  2E1Y A;  4CFB A;  1C0T A;  4BDP A;  3KKR A;  4JI0 K;  1S72 N;  1WBD A;  1C0M A;  3NFA A;  2G8F A;  4BR5 A;  1C0U A;  4KB0 A;  4JK9 A;  3R6M A;  4LH4 A;  2BDP A;  2WUS A;  3TR8 A;  1WBB A;  1BIZ A;  2NNW A;  4IO9 L;  3SQ1 A;  1SS6 A;  1XQS C;  4M41 A;  3VQP A;  3LAM A;  3SJH A;  4EAH D;  3Q7C A;  2F96 A;  1OH8 A;  1VQ5 N;  2QWN A;  1QQO A;  5AZJ B;  1JLE A;  5DM7 L;  3ULD A;  3OBY A;  4BAC A;  3KLF A;  2F7T A;  3VGK A;  3CER A;  1BQN A;  1QTM A;  1DKG D;  3VOV A;  3H46 O;  4CGH A;  3HI0 A;  4JI7 K;  3DI6 A;  1HPZ A;  3EYZ A;  1Z26 A;  5FRN A;  3VEX A;  4X65 K;  3LDL A;  2BAN A;  2WBN A;  3WT0 A;  1S3X A;  5AQS A;  2HHV A;  3A5N C;  4B08 A;  4K25 A;  4B8A B;  5ADX A;  2AP1 A;  4WFB L;  4U67 L;  3IS9 A;  4WQ4 C;  2E4L A;  4KH4 A;  4B9U A;  3OS1 A;  4H5T A;  4F4K A;  1RDW X;  4OJR A;  3UB5 A;  3LZI A;  3N4P A;  1L3V A;  3RR8 A;  4IFY A;  1SAZ A;  2ZGY A;  5M1O A;  1S1V A;  3RRH A;  2YKM A;  4PQU A;  1TKT A;  3CCV N;  2WON A;  1NOZ A;  3BEX A;  4OPA A;  2AA4 A;  1JLQ A;  3D0P A;  4FWN A;  4JK7 A;  5A2Q O;  4CHP A;  3S3M A;  3OS0 A;  1D4X A;  4JHD A;  1TK5 A;  3VEV A;  3BP8 A;  5CYM A;  4JI6 K;  3M8Q A;  3ZT4 A;  3VQB A;  1DTT A;  2FXU A;  3JXU A;  1ZBL A;  3OHR A;  1VHX A;  4DTR A;  1CZA N;  5BRH A;  2QXF A;  1DT9 A;  5BN9 A;  1LAV A;  1J53 A;  5FPE A;  4JS4 A;  3VQ5 A;  3CPE A;  4IG0 A;  4BRO A;  1N6Q A;  3K57 A;  1OH7 A;  4EZ6 A;  4QOZ B;  4KHW A;  3QBX A;  1ATS A;  4LD0 A;  1JCF A;  4JKD A;  3H3O B;  3LWL A;  1VQ4 N;  2HHT A;  1GOC A;  3O80 A;  2PFU A;  3NAE A;  4O8U A;  4AF1 A;  4F3T A;  3EN9 A;  1VRT A;  1HYZ A;  1NK5 A;  2HVI A;  1HNW K;  4CJ7 A;  4FJI A;  5JLF A;  1VSH A;  2F9T A;  3SNN A;  1NWK A;  4CGI A;  4PA1 A;  2YJF A;  3AGK A;  4JKC A;  2Z1I A;  3VEY A;  5KPZ A;  1SKS A;  1JLC A;  3OYC A;  3JAM O;  1KFD A;  4M3U A;  3P5J A;  4FW2 A;  2HHH K;  4W5Q A;  3ZYY X;  4CJU A;  1TL3 A;  3T1Y K;  1YAG A;  4Z4C A;  3OYG A;  1HNI A;  3D45 A;  3SV3 A;  3V9S A;  2OTL N;  2OCE A;  1I39 A;  1K6Y A;  3WNF A;  3H08 A;  4DTU A;  3C6A A;  3DLL L;  2HBK A;  3QNN A;  3HVR A;  1QZ5 A;  2ZQB A;  4J8F A;  1OVQ A;  5C25 A;  1JJ2 M;  2WC9 A;  3A5L C;  1FKP A;  3O4N A;  5GAH P;  2VQF K;  5AQL A;  3HK2 A;  4IFV A;  5TKW A;  4N41 A;  1HUX A;  2E2N A;  5FDL A;  2DFH A;  1L5U A;  1EXQ A;  2O4I A;  4DQR A;  1K8A O;  3MN9 A;  1NJX A;  3KKS A;  4MDB A;  1C0G A;  4QS7 A;  5CY4 A;  4AHS A;  1VQP N;  4CK2 A;  4AHV A;  1VSD A;  3MN6 A;  4A2A A;  3DRS A;  2D1K A;  1VQK N;  4NCA A;  4CEA A;  2B6A A;  1KVB A;  3C94 A;  4WQ5 C;  3W0L A;  4K8X A;  3RMA A;  3WXM B;  3IG1 A;  4YOU A;  4BGA A;  5AQV A;  3MEC A;  1IH7 A;  1RTH A;  1DLO A;  3VQC A;  1QSY A;  4C8O A;  4PWD A;  1LWF A;  1MA9 B;  2B5J A;  2NRT A;  4UY8 O;  4JRP A;  1WLJ A;  4J2E A;  4CHZ A;  4ID5 A;  1CXQ A;  4B1X B;  4JAX A;  4DV5 K;  4M3X A;  2HBL A;  4PKG A;  4KB1 A;  3J7Z O;  1XC9 A;  4FZZ A;  2H3G X;  1LWE A;  3CM5 A;  4KBO A;  4A2B A;  3TAF A;  3TAQ A;  3I0S A;  4DR7 K;  1NJZ A;  3NVK A;  1YF5 L;  4KHP K;  3MX5 A;  2E8A A;  4IXC A;  3RRG A;  4PUO A;  2YHY A;  1SZ2 A;  3L6Q A;  3L4Q A;  3GL1 A;  4JS5 A;  2I7P A;  3VGL A;  3CC7 N;  3CCM N;  4H03 B;  1FW6 A;  3THW A;  3HPH A;  4FZX C;  3H1Q A;  4YOT A;  4JHD B;  4CHO A;  1ASW A;  4N56 A;  5KPR A;  4CGJ A;  4XH1 A;  4RW8 A;  1T3V A;  4ISG A;  4YOY A;  1HNX K;  1SV5 A;  3HZ6 A;  2QWQ A;  3ZX2 A;  3ZX3 A;  4HHT A;  3ATU A;  2NRX A;  4R79 A;  4KTQ A;  4Y1D A;  3ENH A;  2YHW A;  3KK1 A;  4BR4 A;  2IS3 A;  3I8D A;  2XY6 A;  1N34 K;  1NBW A;  3QBW A;  3T3F A;  3VMF B;  3MXI A;  2P51 A;  5H1S Q;  4GVE A;  1GLL O;  4DSF A;  5LMU K;  1A5V A;  4OO1 J;  4FJJ A;  3KK3 A;  2VGM A;  3M6G A;  3K9K A;  4IDH A;  1NGG A;  3OYF A;  5BPN A;  1NGI A;  2VWB A;  1YXQ A;  3LP2 A;  4HWI A;  1T6D A;  3ALY A;  2BE2 A;  3WXL A;  2QI2 A;  4MO5 A;  4FK2 A;  4X62 K;  3PSF A;  3AAR A;  4BRH A;  2FSK A;  4M3W A;  1U48 A;  4V19 S;  3BGR A;  3K2P A;  4I2P A;  4DCH A;  1U47 A;  1NG9 A;  2GUI A;  4JI3 K;  1T03 A;  4F2S A;  4H0O A;  3ZET A;  1I94 K;  2D4W A;  3BF1 A;  5HBM A;  1TAQ A;  4Z4E A;  3KLE A;  3ENB A;  5AQM A;  4CJQ A;  5DMR A;  1XHX A;  1NM1 A;  3L2R A;  1ZYQ A;  3ZEU A;  2W42 A;  4YOW A;  3FFI A;  3VQ8 A;  4MLH A;  5M1P A;  3HST B;  3ZLJ A;  3IDH A;  2E1Z A;  4KV8 A;  3HPO A;  4IJA A;  4KRF A;  4I6M A;  1IKY A;  3K5M A;  3SAH A;  2Q2R A;  4LSN A;  2HHU A;  4DSL A;  3HL8 A;  3CCQ N;  1U2V A;  1ZC6 A;  2XHB A;  3OA9 A;  2D0C A;  3WXI A;  2VQE K;  1U4B A;  4ZTJ A;  3LDP A;  1NK7 A;  3ID8 A;  1NOY A;  3ASM A;  3QER A;  2A40 A;  3JYT A;  1KLN A;  4J2B A;  1KAY A;  2UUC K;  3OY9 A;  4CZK A;  2IOC A;  4KKO A;  4BQZ A;  4LFB K;  2XRI A;  4RW9 A;  4JKA A;  4GMJ B;  2IVN A;  3CD6 N;  4RTF D;  4FM2 A;  5AQO A;  1TUY A;  4OKK A;  4O55 A;  1RBU A;  3QES A;  1N32 K;  2DTU A;  3IUC A;  3WNE A;  3DLG A;  3MXM A;  4DQI A;  4C1N K;  5C10 A;  3NH0 A;  4C8L A;  3OYN A;  5IT9 O;  2OPS A;  3VQQ A;  4CHQ A;  3BUZ B;  5MLC Q;  1QZ6 A;  4G9Z A;  3LAK A;  1M90 O;  2HND A;  1S1T A;  3PY8 A;  4B1Z A;  3VET A;  1TVR A;  3MDQ A;  3D2E A;  1V4S A;  4BE1 A;  3P39 A;  4DUY K;  1N36 K;  1WN7 A;  3OVN A;  1S1X A;  3OYA A;  4DS5 A;  1XNR K;  3F2K A;  4FJM A;  3THW B;  4JKF A;  2NRR A;  1RBR A;  3RSE A;  3KZB A;  1EKE A;  3SAG A;  3M5R A;  3KD5 E;  4KH5 A;  3CJC A;  3DM2 A;  3WXK A;  2GWK A;  4OKJ A;  1O13 A;  2HW3 A;  1ATR A;  4I9L A;  1Z25 A;  4CFC A;  2HST A;  2A1S A;  1X1P A;  1QHT A;  2ZWH A;  3EE9 A;  3O08 A;  3PX0 A;  2HMI A;  4OPJ A;  4I2Q A;  3CG7 A;  1F21 A;  4GVM A;  3W3D A;  5HRP A;  3L2V A;  4OKE A;  2WTU A;  5HRO A;  4FPB A;  2P5G A;  2KKZ A;  3CFO A;  1EX4 A;  1IJJ A;  4C8K A;  5HOO A;  1QVG M;  1L3U A;  4RWT A;  4H5W A;  1A5X A;  2ASO A;  3S41 A;  4CF2 A;  1QQM A;  3CQ8 A;  2D0B A;  3ZT3 A;  3QIO A;  2QXL A;  4IBN A;  4B9T A;  3UKR A;  2O8C A;  4XEI A;  3ZX0 A;  4FK4 A;  2D0P A;  4TSX A;  1W9H A;  4F9O A;  1HLU A;  2NZT A;  3NGY A;  3ZET B;  3V1R A;  1XHZ A;  3QB0 A;  4CES A;  1NGE A;  4DSJ A;  1N8R O;  3ZSR A;  5AQG A;  3SAF A;  3CI5 A;  1EWQ A;  4JKH A;  5T7B A;  3ID6 A;  3EL2 A;  1NK0 A;  1KCF A;  4QAG A;  1NGJ A;  3FZK A;  2Y1I A;  4RW6 A;  4GV6 A;  4I6M B;  2E5L K;  1Y64 A;  1VQ7 N;  5J2N A;  3ZT0 A;  1HKB A;  4CF9 A;  5BR8 K;  1GLD G;  2FF6 A;  4A5A A;  1U2V B;  4DS4 A;  3SLC A;  1B92 A;  4QS8 A;  4CD3 A;  5AQF A;  1HRH A;  4FLU A;  1OVY A;  2GWJ A;  2PY5 A;  4DV7 K;  4HCC A;  4KHQ A;  1C1A A;  4QS9 A;  1DEJ A;  4H8K A;  2EHG A;  4JRQ A;  3U3Y A;  3NHG A;  4CHN A;  1BA1 A;  3T7Z A;  4Z4I A;  4PL8 A;  1G15 A;  3WQU A;  2J4R A;  2KQ2 A;  1BO5 O;  1GOA A;  3E01 A;  1C6V A;  2P9P A;  4RG8 A;  1JCE A;  2GBZ A;  3O6W A;  2NRV A;  3AVC A;  1LCU A;  3V1Q A;  5JVH L;  3VPZ A;  2HNY A;  1Q18 A;  3CHW A;  3DOL A;  3EO3 A;  1ITG A;  4RW4 A;  4IJN A;  3CJ7 A;  4FWM A;  5ADX H;  2KZZ A;  2QWR A;  3WQT A;  2YI1 A;  3MK6 A;  1WSH A;  3H1V X;  4CFD A;  5IWA K;  1X3N A;  5AR0 A;  2E2P A;  4E3S A;  5KPT A;  4UQG A;  3U8X A;  4FLV A;  3CF5 L;  5C12 A;  3FE1 A;  5I3U A;  2FC0 A;  5EOY A;  1N5Y A;  1TL1 A;  1SKW A;  4M3Y A;  5B8H A;  3THY A;  3D2E B;  3VQ7 A;  4ZHR A;  2YCH A;  3SV4 A;  4B3O A;  3T1A A;  4AQY K;  3KVG A;  4C8N A;  2VG7 A;  1BOT O;  1FXX A;  2E2Q A;  5LJW A;  3TTC A;  2KZM A;  2YV0 X;  4DTJ A;  3RSE B;  4EFH A;  3SQ2 A;  1K8K A;  1VQM N;  3OYB A;  2FBX A;  3M3Z A;  4IEI A;  1NGH A;  1BCO A;  4DSE A;  5J2P A;  3AA2 A;  5EU7 A;  4KRE A;  4BC5 A;  1KRP A;  3TSQ A;  3EKU A;  5F0X A;  5AQQ A;  2P9L A;  4FOE A;  4O5B A;  2PAV A;  1D9D A;  4YOX A;  3KIO A;  2AJQ A;  3WUH A;  2A5X A;  1BQM A;  4FLY A;  3A0I X;  2OPP A;  1NNE A;  3VQ4 A;  3E1Y A;  1NK8 A;  1RTD A;  3ULE B;  4J2A A;  3CJA A;  5BRD A;  3MMV A;  3O1B A;  4IKF A;  2XO7 A;  3L2W A;  5LMN K;  2GUP A;  3KWG A;  4CCH A;  2O8E B;  3J8A A;  3AA5 X;  5CR4 A;  1UWB A;  2P9K A;  4C1N I;  1S6P A;  2OTJ N;  2PYL A;  2R7Y A;  1EQY A;  4N5S A;  2ITM A;  3S3N A;  2O8F A;  5AQU A;  3QEP A;  3UKR B;  2IC3 A;  5K14 A;  4JYA K;  3WXJ A;  2O8C B;  3Q7B A;  3LAL A;  2UXC K;  3UE5 A;  1TV6 A;  1EWR A;  4AHC A;  4Z94 A;  3ZSZ A;  3E66 A;  4XH5 A;  3QEV A;  3JS6 A;  4M45 A;  3AVM A;  2FLO A;  3ZSV A;  3QIP A;  4DFJ A;  5EXW A;  3VEN A;  4BRP A;  2BUP A;  2YHX A;  4YY3 K;  1HQE A;  3VTI A;  2OAN A;  2ZJR L;  1SL2 A;  3QIN A;  2QA4 N;  2F9W A;  3O9U A;  2V52 B;  1MU2 A;  3CFR A;  3SZ2 A;  2QWM A;  5AQI A;  4CER A;  3OBW A;  2PYJ A;  1QS4 A;  1HNV A;  3HTV A;  5C2F A;  3L8B A;  2D0A A;  3CM6 A;  2KTQ A;  3U9Z A;  4WFA L;  1EET A;  1MDU B;  5GIN A;  1NMN A;  4NXM K;  5D3G A;  4YDU C;  2B4J A;  2HVH A;  3BF3 A;  5J2Q A;  4B9N A;  4E1M A;  4FLW A;  5BPL A;  3I56 N;  4O44 A;  3TAG A;  1HYV A;  2YKN A;  4KHU A;  4BG8 A;  3PUF A;  3SJJ A;  3QEX A;  3H3N O;  3I0R A;  1XWL A;  2JGU A;  1SKR A;  5AQX A;  4AM7 A;  4LF4 K;  2P9P B;  3GBT A;  5C42 A;  2E88 A;  4PKI A;  1ESV A;  2ZD1 A;  4HUE A;  2X78 A;  1YTU A;  3ZSW A;  3MEE A;  3PX6 A;  2VG5 A;  2A3Z A;  4KTZ A;  2EWS A;  3DMJ A;  3CCJ N;  1L3S A;  2Q0U A;  3DLB A;  1Q86 O;  4B9S A;  3WNG A;  1CLQ A;  2V7Z A;  3NH2 A;  1B9F A;  4EZ9 A;  4PKH A;  1VAZ A;  1BG3 A;  4A59 A;  5J1E A;  2HBM A;  5JIC A;  1BGX T;  4CE9 A;  3HXM A;  4M3R A;  1ZBS A;  4BVP A;  4BR0 A;  2CGK A;  4ICL A;  3THY B;  2Q3S A;  4DQS A;  1HR0 K;  3SUP A;  4CBU A;  1IKV A;  2QEX N;  3THX A;  3O3G A;  3AVG A;  4H0T B;  4LSL A;  3R9P A;  4HUF A;  2KLA A;  1TYQ A;  4JK8 A;  3SBT A;  1OH5 A;  3AAQ A;  4CJK A;  4KFB A;  4O4G A;  3OYK A;  1K8K B;  4BC4 A;  2X6S A;  3U3G A;  2OZS A;  1P90 A;  3KK7 A;  3LAN A;  1Q9Y A;  4CF8 A;  2IAJ A;  2BGG A;  1S9G A;  4DV1 K;  3QEI A;  1W2B M;  1KQS M;  4CED A;  3QLH A;  2P9L B;  3QML A;  1NGC A;  1JLF A;  3AVK A;  4FWS A;  1RDD A;  4E19 A;  2Q36 A;  5TKY A;  5BR9 A;  1X9S A;  2DFE A;  4CIE A;  3TSU A;  1T05 A;  4CHY A;  3I55 N;  1VQ8 N;  4DWI A;  4CJS A;  5AQN A;  3C6H A;  2IVO A;  5FPD A;  5BRF A;  3L2Q A;  3LPU A;  3C65 A;  2P5O A;  3OYD A;  3CYM A;  4DKW A;  4JKE A;  4DTO A;  5GAD P;  2ASP A;  3G0Z A;  4M63 C;  3NBP A;  4BDZ A;  3BZK A;  3KJV A;  2CGJ A;  2GTD A;  2P9K B;  4WCE L;  3SI6 A;  4M7X A;  4KTW A;  5CYQ A;  1GLC G;  4HTU A;  4NLB A;  1J5E K;  3D2F A;  3DLR A;  3S3O A;  1NK9 A;  2O8F B;  1JLB A;  1KSP A;  4Z4F A;  2ZGZ A;  3EEQ A;  3C95 A;  2YNG A;  1KD1 O;  3L3U A;  4O5F A;  3OJU A;  1RT7 A;  2VCP A;  4BG9 A;  4FO0 A;  3O3F A;  3C0B A;  1IBL K;  4Q0B A;  2P1J A;  3NGZ A;  5AQW A;  1WUA A;  3FLC O;  1TAU A;  3O1W A;  4O8K A;  3P4I A;  3OTO K;  5M1Q A;  4K0K K;  4CJE A;  2LSN A;  1T8E A;  5AQH A;  3OS2 A;  4XIU A;  4CJ3 A;  2VWJ A;  4DV0 K;  1YJW N;  4IOA L;  3ZSX A;  1EO1 A;  1R59 O;  5DK5 A;  4M3T A;  1X9J A;  3U4L A;  4GNI A;  1VRU A;  4Z0U A;  1E4G T;  4BRI A;  4PY5 A;  3CJ9 A;  5C2D A;  1KVA A;  4EHT A;  3O3H A;  4I7F A;  3OYH A;  2RHK A;  3HP9 A;  5BN8 A;  5AQY A;  3C6U A;  1WSF A;  3IRX A;  4FSV A;  3LP0 A;  4CZG A;  2HF3 A;  1IG8 A;  1QVF M;  3KK2 A;  3QFP A;  3K5O A;  4NO7 A;  4CF1 A;  1NK4 A;  4LF7 K;  3MXJ A;  3SUQ A;  2DPN A;  2UUA K;  1ZBU A;  4FOI A;  2YJE A;  1YVU A;  1RNH A;  2CH6 A;  4CF0 A;  5KI6 A;  4FPA A;  1WSI A;  4ELU A;  1XNQ K;  2OA8 A;  4FJ8 A;  3ITH A;  5JS1 A;  2GX9 A;  1E4F T;  3AO2 A;  2PZS A;  1NJY A;  3OJS A;  3VGM A;  3ZT2 A;  3JSM A;  3FGU A;  1VSM A;  3TTD A;  4DR1 K;  4FLT A;  4YFU A;  4OPH A;  3B8A X;  3QIC A;  1LOT B;  2ZF5 O;  2QW9 A;  3CCL N;  3B6O A;  4CJP A;  2I7N A;  3A2F A;  1IBM K;  1BU6 O;  5CE3 A;  5EVZ A;  3THX B;  1T44 A;  1U04 A;  1KVC A;  4CJW A;  3L2U A;  3CJ1 A;  4JNE A;  1TYQ B;  1YIJ N;  1KLM A;  4NCG A;  3AAP A;  3L3V A;  2QWP A;  5HRR A;  4LFA K;  2FF3 B;  2FSJ A;  3F9M A;  5E84 A;  2UU9 K;  4LF9 K;  5KQD A;  4CJR A;  3HM9 A;  4MLE A;  4FM0 A;  3QET A;  1IO2 A;  4G1Q A;  4BR9 A;  4K43 A;  1GLA G;  3BY5 A;  3QEW A;  1SQK A;  4DR4 K;  3QO9 A;  2QKB A;  1YT3 A;  4CJT A;  4F3O A;  4FWO A;  4CZH A;  5LL6 Z;  4AH9 A;  5AQJ A;  3C6T A;  4GY2 B;  3CQX A;  4JI2 K;  4OPK A;  3LM9 A;  1Q8I A;  4DTM A;  3V81 A;  4DTX A;  4FLX A;  5HLF A;  3RMB A;  1YI2 N;  2XY7 A;  4ISF A;  1RDA A;  4MFB A;  3LP1 A;  4H0X B;  1Z05 A;  2RN2 A;  3PV8 A;  3ZSO A;  3HO1 A;  4E7H A;  5FPN A;  1VSE A;  3DXK A;  1D5A A;  1IG9 A;  4R5P A;  1LW0 A;  1S9E A;  1RTJ A;  1Q7Y O;  4E7K A;  3K59 A;  5KGX A;  2IIR A;  3D2F B;  1FJG K;  2P9U A;  4HTL A;  5E26 A;  3MN7 A;  2IDO A;  1X3M A;  4IWV A;  1OKJ A;  3ISN C;  1ZBI A;  3I33 A;  3UKU A;  2YX6 A;  4CJL A;  3IKM A;  1ATN A;  5FRO A;  1QSL A;  5AZI A;  2YHA A;  1ILY A;  1C1C A;  4CJ4 A;  4IOC L;  4B9Q A;  2QM1 A;  2V51 B;  2DFF A;  5EX5 A;  4E7I A;  4N76 A;  1RFQ A;  4BRF A;  4CZI A;  3E9P A;  3TSP A;  4FJ5 A;  1XUP O;  1C0F A;  3AO3 A;  4O0J A;  2UXB K;  2GV9 A;  3AVB A;  4JI4 K;  4DMN A;  1S6Q A;  3NCI A;  4DU4 A;  1G99 A;  4OGE A;  1WSE A;  4WQ4 A;  4CW7 B;  2DY4 A;  1UAX A;  3A5M C;  5CZ2 A;  1TK8 A;  3AO4 A;  3CCR N;  4ELT A;  1LV5 A;  2OYQ A;  3HRG A;  3H6E A;  3HOS A;  1GOB A;  3MEG A;  3TI0 A;  1D8Y A;  4DF8 A;  3K0S A;  4CD1 A;  1RIL A;  5HL7 L;  3DWL A;  4NXN K;  5M1N A;  2OPQ A;  3THV A;  4HVJ A;  3EE8 A;  1VK0 A;  3CPW M;  3RR7 A;  4FXD A;  2XY8 A;  2HHS A;  1CZB A;  2O4G A;  2G8K A;  1M1K O;  5AQZ A;  3M1F A;  3OW2 M;  4DR6 K;  2KFZ A;  2P9I A;  4DFK A;  2OPR A;  4DG1 A;  3VF4 A;  3ENO A;  4OVL A;  2W41 A;  2Z1G A;  3G6E N;  4GW6 A;  4FYD A;  2RF2 A;  4EHU A;  4K41 A;  4DU3 A;  1RT4 A;  4M7Y A;  4Z4G A;  2BTF A;  3IFR A;  4BE2 A;  5JS2 A;  3IMX A;  3TPQ A;  4OLA A;  2Z1H A;  3CC4 N;  3DJC A;  3FZM A;  1GLF O;  3CC2 N;  3AO1 A;  3LDS A;  2IVP A;  1L3T A;  3AVN A;  1HKG A;  3U6F A;  1K73 O;  1UA1 A;  5EY4 A;  3ZEU B;  2QK9 A;  1VQL N;  1W0H A;  3ZT1 A;  4E89 A;  4OX9 K;  4CBX A;  3TAM A;  2Q1N A;  3TU5 A;  4DQP A;  2VYP A;  2VGN A;  3HPG A;  4H4M A;  1NKC A;  1JLG A;  3TAR A;  4KI6 A;  1T7P A;  3V9W A;  1GLJ O;  3DLE A;  4JKG A;  4EP4 A;  5BRE A;  1U6Z A;  4AHR A;  3TAP A;  1BL3 A;  3DRR A;  3G71 N;  4E0D A;  1P8Z A;  1ASU A;  4FJN A;  5AQT A;  1RGI A;  1Q81 O;  3ATV A;  3F73 A;  3LM2 A;  3H45 C;  1YIT N;  4FJX A;  3NDK A;  3BDP A;  3HVT A;  3HYF A;  4DF4 A;  4E1J A;  4BRK A;  1HJR A;  5F2R A;  4FCY A;  1VQN N;  2D5R A;  4PL7 A;  3R8E A;  3V1O A;  4BGB A;  4C23 A;  3T1H K;  3TAE A;  1REV A;  3PX4 A;  2WFB A;  2FBV A;  3EZW A;  1NGF A;  4CEC A;  3CXC M;  1RT3 A;  4RCH A;  3ZSQ A;  1LW2 A;  3DXK B;  4AIL C;  2KHO A;  2XY5 A;  5C15 A;  5JLH A;  2UYT A;  3OYJ A;  4FJG A;  3PO5 A;  4NYN A;  5AFU A;  4KHY A;  4ILH A;  1QE1 A;  4KH6 A;  2G8I A;  2ITG A;  3TWH A;  2YNH A;  3UKU B;  2V7Y A;  1OH6 A;  3SMS A;  5FRM A;  5AJ3 K;  1WOQ A;  5AZI B;  1RT5 A;  4WQ5 A;  1SL1 A;  4WE1 A;  4CIG A;  3AA4 A;  3QNO A;  1TKD A;  4FWL A;  1HMV A;  4ISE A;  3VQE A;  2HBJ A;  1KXP A;  3NF6 A;  1RTI A;  3HJF A;  4N47 A;  4DV3 K;  4DR2 K;  5I42 A;  3MCP A;  3PLA A;  4H4O A;  4IOX A;  3MCA B;  3J7A P;  4O0I A;  5GAG P;  4NLC A;  2RE2 A;  2RKI A;  4CEQ A;  2FBT A;  4CEO A;  4E1N A;  4JI5 K;  5KRT A;  3GE1 A;  5C24 A;  3SYZ A;  1S22 A;  3G4S N;  3U9D A;  4DSI A;  3DLK A;  3EZ5 A;  4LFC K;  4IG3 A;  4QCL A;  1UA0 A;  4Y1C A;  5AQR A;  2O8D A;  2HHX A;  4FVM A;  4FWQ A;  4FK0 A;  2P9I B;  3CIP A;  1W7A A;  3MX2 A;  4CJ5 A;  1VQ9 N;  1W97 L;  2HOE A;  5LY3 A;  3E9O A;  4H0V B;  4CBW A;  4AHT A;  5AQK A;  4DV6 K;  4BDY A;  4M3Z A;  1RCH A;  3SK3 A;  1MWK A;  3AGR A;  3V9Z A;  3OYL A;  4FWP A;  3LWM A;  4KI4 A;  4B9L A;  1QHA A;  1QQN A;  1NKB A;  4DR5 K;  2G8V A;  5SWM A;  3EY1 A;  4HCB A;  5I9E B;  1WAJ A;  1LWC A;  4CEE A;  4F8R A;  1WSJ A;  4FL9 A;  4W5O A;  5BPM A;  1HPM A;  5FPM A;  2QTD A;  4CEB A;  1IV0 A;  3AY9 A;  5KGW A;  4L8R B;  1ASV A;  4JKG B;  1JKH A;  1C1B A;  2JLE A;  3A8Y A;  3LPT A;  3VF2 A;  4YOV A;  2G8H A;  4J2D A;  3O9T A;  3SQ4 A;  3D6R A;  1WSG A;  1NU0 A;  3FR0 A;  4B8C A;  3NMU A;  4CIF A;  1U45 A;  4EIA A;  3LL3 A;  4JN4 A;  4KAZ A;  4FZY A;  4DFM A;  4JKB A;  4DLG A;  4NB4 A;  1LAW A;  3CQY A;  4L3Q A;  2HHW A;  3FZF A;  3K9J A;  4ILG B;  1NK6 A;  5GIP A;  1K9M O;  1WAF A;  4BWJ A;  2Q0R A;  1XC3 A;  1JL2 A;  2E2O A;  3KLI A;  4Y0W A;  4BRM A;  3O5B A;  3VQ6 A;  4EP5 A;  1Q9X A;  1VSL A;  3V9U A;  5GAE P;  4B3R K;  4ID1 A;  1VSI A;  4ZTF A;  4CJV A;  4BRE A;  1JLA A;  2CH5 A;  2D0O A;  4CEZ A;  4CVN E;  3TAB A;  1VQ6 N;  1QQC A;  4JD2 A;  2A42 A;  4M42 A;  3MWP A;  4BRA A;  1KTQ A;  2FSN A;  3VER A;  1KAZ A;  3N4Q A;  4LY7 A;  1SUQ A;  3DRP A;  1TK0 A;  5M1K A;  4NYF A;  3EKS A;  2BH1 A;  3O4Q A;  4NCB A;  4JV5 K;  3SBG A;  4E7J A;  3KWI A;  3J7Y P;  4DFP A;  4KPY A;  3P38 A;  1BCM A;  3L4I A;  5J2M A;  1RBV A;  1Q82 O;  4DSK A;  3G25 A;  4I9Q A;  4RW7 A;  3VQ9 A;  3PSI A;  1X9W A;  3RMD A;  1T6C A;  4CGD A;  3VTH A;  4HUG A;  1BIS A;  4JEP A;  3IAY A;  2A41 A;  2UXD K;  4C8M A;  5SZT A;  3CFP A;  2F4V K;  3RTV A;  3FFK B;  2UUB K;  1IBK K;  1VSF A;  2ZM6 K;  1U49 A;  4GKJ K;  1TKZ A;  3AVI A;  4DLE A;  1KC8 O;  4OGC A;  4X66 K;  5HP1 A;  2PBD A;  2O8D B;  3WEE A;  5CZ1 A;  3VEZ A;  3T19 A;  4DU1 A;  3VA0 A;  2HB5 A;  2G8W A;  4B3T K;  5F1X A;  3DAW A;  4LF8 K;  1RDB A;  4YHH K;  2QWO A;  2YNI A;  3SPZ A;  2CGL A;  1RBS A;  3V4I A;  1BHL A;  2ASM A;  1YVN A;  3O9Q A;  3AVJ A;  3SUO A;  3AVA A;  4AM6 A;  4BRN A;  3CCU N;  4U7B A;  4IDK A;  4BC3 A;  4BY9 C;  3M8R A;  3L0Q A;  3SMP A;  1RT1 A;  1RBT A;  4CGG A;  2GEM A;  3NGI A;  1FKO A;  3AV9 A;  3KTQ A;  3LDO A;  2NRW A;  5HRN A;  4BRG A;  3CJB A;  4B1V A;  4KHN A;  3SCX A;  4CZF A;  4JI8 K;  2HF4 A;  3MAQ A;  1YJ9 N;  3F5T A;  4CZM A;  3R1X A;  3SPY A;  4BR7 A;  4GV3 A;  3NF7 A;  3HT3 A;  2VWK A;  4LF5 K;  2F8T A;  3DOK A;  1HYS A;  3FZH A;  4FW1 A;  2P9N A;  5FLX O;  1TUU A;  1RT6 A;  1RDC A;  3CME N;  1DTQ A;  2X74 A;  2OZM A;  2W6L A;  3V6D A;  4YNQ A;  1GLB G;  4DTP A;  1NLV A;  3OYM A;  4YOR A;  4BRD A;  1V4T A;  4BQL A;  4CFA A;  4B3M K;  1X9M A;  1BDG A;  3QFU A;  4H0Y B;  4ILJ A;  3MED A;  3DXM A;  4FJ7 A;  4BE0 A;  3ZCM A;  4DTN A;  1KFS A;  2JWL A;  4W5T A;  3RMC A;  4DTS A;  1S1W A;  4BRL A;  1J9A A;  2QWL A;  3OYI A;  3GDQ A;  4LF6 K;  4H5R A;  4JD2 B;  3S9H A;  4MDA A;  3AA3 A;  3CMA N;  1J54 A;  3TTF A;  1HNZ K;  3D7E O;  1I3A A;  3R3L A;  3KLH A;  3GG4 A;  4CGF A;  5M1F A;  4WF9 L;  1KAX A;  4B1U B;  3HBT A;  3G10 A;  3VQD A;  1EP4 A;  2A1R A;  1XMO K;  1A5W A;  3DYA A;  2KW4 A;  1J5O A;  4Q5V A;  4DQQ A;  2G8U A;  1XMQ K;  2RPI A;  2P9S A;  4H5N A;  4B9M A;  3J81 O;  2O8B A;  2E6L A;  5DM6 L;  3VEW A;  3C7N A;  4WFN L;  3DLH A;  4CK3 A;  1NMD A;  1JL1 A;  3O8M A;  5JMV A;  1BIU A;  4W5R A;  4DV2 K;  1IKX A;  1GLE G;  3NH1 A;  4BC2 A;  3KD1 E;  1NGA A;  5ELZ A;  3AO5 A;  4A5B A;  3VA3 A;  3AVH A;  1JXB A;  4IO8 A;  3UIQ A;  2ATQ A;  5GIO A;  3HSC A;  1R0A A;  3M8P A;  3WEE B;  1WNS A;  4B3S K;  3CET A;  4K8Z A;  4H0P A;  3HOT A;  4CEF A;  2NLX A;  1UOC A;  2F8S A;  4LH5 A;  4WYB A;  3FZL A;  1NJI O;  5KTQ A;  2NRZ A;  1XI1 A;  3HP6 A;  3GOI A;  2WOM A;  4DUZ K;  1N33 K;  3NE6 A;  4FJK A;  2HMP A;  4IFE A;  3K58 A;  3P83 D;  3V9X A;  2Y1J A;  4Z4H A;  1H1V A;  4CK1 A;  2I5J A;  1HQU A;  5C0Y A;  3P1G A;  4OLB A;  1HJO A;  4B1W B;  3NF9 A;  1B9D A;  3M8S A;  2Z1J A;  1CXU A;  3WNH A;  1IKW A;  1BI4 A;  4B9V A;  3LDN A;  2FBY A;  4CI6 A;  5JVG L;  3TAN A;  3KHY A;  1O1W A;  4XH4 A;  4FJH A;  1E3M A;  1YTA A;  3BZC A;  2YHB A;  3CCS N;  1TKX A;  4BVO A;  1Y97 A;  1JXE A;  2EX3 A;  4A57 A;  3PO4 A;  4GKK K;  3HM8 A;  4AHU A;  2VG6 A;  4BRQ A;  3KLG A;  1VSJ A;  3SQ0 A;  1Z6R A;  4DB3 A;  2P9N B;  2ETJ A;  4BWM A;  4GV9 A;  5AZJ A;  3J80 O;  1HKC A;  3VQA A;  3SUN A;  4K42 A;  4E7L A;  3NF8 A;  3VES A;  2ZJQ L;  1CZ9 A;  2HHQ A;  1ZXO A;  3QDK A;  3ULE A;  3I8B A;  2A6A A;  1BA0 A;  1BUP A;  2W40 A;  3DXM B;  2O8E A;  4KHS A;  4YDU A;  1NGB A;  1NGD A;  3B6P A;  3RWU A;  3AVF A;  1ZBH A;  4F2R A;  1VQO N;  4DQ8 A;  1FK9 A;  1S5J A;  4DHY A;  5AFU H;  3F9K A;  3A5O C;  4MO4 A;  1D9F A;  3LDQ A;  3O9S A;  3VF6 A;  3VEO A;  2NRH A;  4KO0 A;  4FVU A;  4FWR A;  2NUB A;  1BWF O;  4JLH A;  2GEL A;  2E20 A;  2W6K A;  5KRS A;  4ELV A;  1YHQ N;  2ZE2 A;  3PIP L;  2IGI A;  5CHI A;  3MN5 A;  4DV4 K;  5KQ8 A;  1NKE A;  5HRS A;  4CJF A;  5E41 A;  1YUW A;  5AQP A;  1RT2 A;  2P9S B;  1JCG A;  3AVL A;  4JI1 K;  1YJN N;  3K5L A;  1VSK A;  3OYE A;  3MWT A;  1MWM A;  5LJV A;  1S1U A;  2O8B B;  2JWK A;  4MQ3 A;  3C7N B;  1QSS A;  2Q31 A;  3RVC A; 
#chains in the Genus database with same CATH homology
 3DLG A;  3MXM A;  4DQI A;  4Q0B A;  2P1J A;  4L8R B;  3NGZ A;  3NH0 A;  1ASV A;  3ZSY A;  4C8L A;  4FJ9 A;  1TAU A;  2HNZ A;  3OYN A;  1JKH A;  1C1B A;  2JLE A;  3LP3 A;  3LZJ A;  2OPS A;  3VQQ A;  4CHQ A;  2QKK A;  3LPT A;  4CJE A;  2LSN A;  3LAK A;  2G8H A;  4J2D A;  1T8E A;  3SQ4 A;  2HND A;  1WSG A;  1S1T A;  2PZS A;  1SL0 A;  3PY8 A;  3OS2 A;  4B8C A;  4XIU A;  4CJ3 A;  2VWJ A;  1TVR A;  4CIF A;  4BE1 A;  1U45 A;  3ZSX A;  4KAZ A;  1WN7 A;  3VN5 A;  4FZY A;  5DK5 A;  4M3T A;  4DFM A;  3OVN A;  1S1X A;  3OYA A;  4DS5 A;  1VRU A;  4W5N A;  3K5N A;  4Z0U A;  4DLG A;  4PY5 A;  1KVA A;  1TGO A;  1LAW A;  4FJM A;  3O3H A;  2HHW A;  1ZBF A;  1NK6 A;  1RBR A;  4FM1 A;  4FJL A;  4I7F A;  3OYH A;  3HP9 A;  1WAF A;  4BWJ A;  1NJW A;  1JL2 A;  2E6M A;  3KLI A;  3C6U A;  1WSF A;  1EKE A;  3IRX A;  3VQ6 A;  3LP0 A;  4EP5 A;  3KD5 E;  3DM2 A;  1Q9X A;  3KK2 A;  1VSL A;  3K5O A;  4OKJ A;  4CF1 A;  3V9U A;  1NK4 A;  2HW3 A;  2KFN A;  2X6N A;  4ID1 A;  4I9L A;  3MXJ A;  1BI4 B;  1Z25 A;  4CFC A;  3SUQ A;  4FLZ A;  1VSI A;  4ZTF A;  4CJV A;  2YNF A;  2A1S A;  1JLA A;  1X1P A;  4CEZ A;  3TAB A;  1ZBU A;  1QHT A;  1YVU A;  1QQC A;  1C0T A;  4CFB A;  3KKR A;  3PX0 A;  4BDP A;  4M42 A;  1RNH A;  4OPJ A;  2HMI A;  4I2Q A;  1KTQ A;  1C0M A;  3CG7 A;  4CF0 A;  5KI6 A;  3NFA A;  2G8F A;  1C0U A;  1F21 A;  4KB0 A;  1WSI A;  4ELU A;  4LH4 A;  2BDP A;  2OA8 A;  4GVM A;  4FJ8 A;  3ITH A;  5JS1 A;  3TR8 A;  5HRP A;  4LY7 A;  3L2V A;  4OKE A;  3AO2 A;  5HRO A;  1BIZ A;  1SUQ A;  3DRP A;  3OJS A;  3SQ1 A;  1NJY A;  1TK0 A;  3ZT2 A;  3JSM A;  2P5G A;  1VSM A;  4NYF A;  4M41 A;  3CFO A;  1EX4 A;  3O4Q A;  3VQP A;  3LAM A;  4YFU A;  4FLT A;  4C8K A;  4NCB A;  4E7J A;  1L3U A;  4DFP A;  4KPY A;  2F96 A;  1A5X A;  1BCM A;  4CF2 A;  5J2M A;  3B6O A;  1RBV A;  3CQ8 A;  1JLE A;  2D0B A;  3ZT3 A;  4CJP A;  3ULD A;  4DSK A;  3QIO A;  3KLF A;  4BAC A;  3A2F A;  4B9T A;  4IBN A;  4I9Q A;  4RW7 A;  1BQN A;  3VQ9 A;  4FK4 A;  1U04 A;  1QTM A;  1KVC A;  4CJW A;  1X9W A;  3L2U A;  3RMD A;  4TSX A;  1W9H A;  4CGD A;  4HUG A;  4CGH A;  1BIS A;  3NGY A;  3IAY A;  3V1R A;  3DI6 A;  1HPZ A;  3EYZ A;  1KLM A;  4NCG A;  1XHZ A;  3L3V A;  1Z26 A;  4C8M A;  5FRN A;  5HRR A;  5SZT A;  3CFP A;  2BAN A;  3RTV A;  4CES A;  4CJR A;  2HHV A;  1VSF A;  1U49 A;  4DSJ A;  3ZSR A;  1TKZ A;  3HM9 A;  4B08 A;  4B8A B;  5T7B A;  4FM0 A;  3AVI A;  4DLE A;  1NK0 A;  4OGC A;  3IS9 A;  5HP1 A;  1KCF A;  3QET A;  1IO2 A;  2E4L A;  4G1Q A;  4QAG A;  4B9U A;  3OS1 A;  2Y1I A;  5CZ1 A;  3QEW A;  4RW6 A;  3QO9 A;  2QKB A;  4F4K A;  1YT3 A;  4CJT A;  4OJR A;  4F3O A;  3T19 A;  3LZI A;  4DU1 A;  4AH9 A;  3VA0 A;  3ZT0 A;  5J2N A;  3C6T A;  1L3V A;  3RR8 A;  2HB5 A;  4IFY A;  4CF9 A;  4OPK A;  4DTM A;  1S1V A;  3RRH A;  1Q8I A;  3V81 A;  2YKM A;  4DTX A;  4FLX A;  2G8W A;  4PQU A;  1TKT A;  2WON A;  4DS4 A;  5HLF A;  3RMB A;  1B92 A;  1NOZ A;  1RDB A;  1HRH A;  1JLQ A;  2YNI A;  3D0P A;  4FLU A;  1RBS A;  2XY7 A;  3SPZ A;  4CHP A;  2PY5 A;  3V4I A;  3S3M A;  1BHL A;  3OS0 A;  4HCC A;  1RDA A;  4MFB A;  3LP1 A;  1TK5 A;  3AVJ A;  5CYM A;  4KHQ A;  1C1A A;  2RN2 A;  3PV8 A;  3ZSO A;  3SUO A;  3HO1 A;  4E7H A;  3AVA A;  4H8K A;  2EHG A;  4JRQ A;  1VSE A;  3U3Y A;  1D5A A;  3NHG A;  1IG9 A;  4CHN A;  3M8Q A;  3ZT4 A;  3VQB A;  1LW0 A;  1S9E A;  1RTJ A;  1DTT A;  4R5P A;  1G15 A;  4IDK A;  1ZBL A;  4E7K A;  4Z4I A;  3M8R A;  3K59 A;  4DTR A;  2KQ2 A;  1RT1 A;  1GOA A;  2QXF A;  1C6V A;  3E01 A;  1RBT A;  4RG8 A;  5KGX A;  4CGG A;  1LAV A;  2GBZ A;  3NGI A;  1FKO A;  1J53 A;  2IDO A;  3AVC A;  4JS4 A;  3AV9 A;  3KTQ A;  3VQ5 A;  3V1Q A;  4IG0 A;  3ISN C;  1N6Q A;  1ZBI A;  2HNY A;  3K57 A;  5HRN A;  4EZ6 A;  4KHN A;  4CJL A;  3DOL A;  4KHW A;  5FRO A;  4QOZ B;  1QSL A;  1ITG A;  2YHA A;  4RW4 A;  4LD0 A;  3SCX A;  3LWL A;  1C1C A;  4CJ4 A;  2KZZ A;  3MAQ A;  2HHT A;  1GOC A;  3NAE A;  4F3T A;  3SPY A;  1VRT A;  1HYZ A;  1WSH A;  1NK5 A;  4CFD A;  2DFF A;  3NF7 A;  4E3S A;  2HVI A;  3HT3 A;  2VWK A;  4UQG A;  4E7I A;  4FJI A;  3DOK A;  4N76 A;  1VSH A;  4FLV A;  2F8T A;  4FW1 A;  3SNN A;  1HYS A;  4CGI A;  5I3U A;  4FJ5 A;  3AO3 A;  2FC0 A;  1N5Y A;  1RT6 A;  4O0J A;  1RDC A;  1TL1 A;  4PA1 A;  1DTQ A;  2X74 A;  1SKW A;  2GV9 A;  4M3Y A;  2OZM A;  3AVB A;  3V6D A;  2Z1I A;  1S6Q A;  3VQ7 A;  4DMN A;  4ZHR A;  4YNQ A;  3NCI A;  1JLC A;  3OYC A;  3SV4 A;  3T1A A;  4OGE A;  3OYM A;  4DU4 A;  4DTP A;  1SKS A;  4B3O A;  1WSE A;  2DY4 A;  1UAX A;  4C8N A;  1KFD A;  2VG7 A;  4M3U A;  5CZ2 A;  1FXX A;  3AO4 A;  4CFA A;  1TK8 A;  4ELT A;  1LV5 A;  3P5J A;  4FW2 A;  2OYQ A;  1X9M A;  2KZM A;  4W5Q A;  1GOB A;  3MEG A;  4CJU A;  3MED A;  1TL3 A;  3TI0 A;  1D8Y A;  4DF8 A;  2YV0 X;  4DTJ A;  4FJ7 A;  4BE0 A;  3ZCM A;  4DTN A;  3SQ2 A;  4Z4C A;  3OYG A;  1KFS A;  1HNI A;  3D45 A;  3SV3 A;  3V9S A;  3OYB A;  1RIL A;  2FBX A;  4W5T A;  3RMC A;  1BCO A;  2OPQ A;  4DSE A;  4DTS A;  5J2P A;  3THV A;  3AA2 A;  5EU7 A;  4HVJ A;  1I39 A;  1S1W A;  1K6Y A;  1VK0 A;  3WNF A;  1KRP A;  3H08 A;  4KRE A;  4DTU A;  1J9A A;  3RR7 A;  2XY8 A;  4FXD A;  2HHS A;  1CZB A;  2O4G A;  3QNN A;  3OYI A;  3HVR A;  2ZQB A;  4O5B A;  2G8K A;  5C25 A;  2KFZ A;  4DFK A;  2OPR A;  4DG1 A;  4OVL A;  1D9D A;  3S9H A;  3KIO A;  2AJQ A;  1FKP A;  2Z1G A;  3O4N A;  4GW6 A;  4FYD A;  1BQM A;  2RF2 A;  3AA3 A;  4FLY A;  4DU3 A;  1RT4 A;  1J54 A;  2OPP A;  3HK2 A;  3VQ4 A;  4IFV A;  1NK8 A;  1RTD A;  1I3A A;  4N41 A;  4Z4G A;  3KLH A;  4J2A A;  4IKF A;  2XO7 A;  3L2W A;  5FDL A;  4BE2 A;  4CGF A;  5JS2 A;  2DFH A;  3G10 A;  3VQD A;  1L5U A;  1EP4 A;  1EXQ A;  4OLA A;  2O4I A;  2Z1H A;  2A1R A;  4CCH A;  1A5W A;  3DYA A;  2KW4 A;  1J5O A;  3AA5 X;  4DQR A;  1NJX A;  3AO1 A;  3KKS A;  1UWB A;  4Q5V A;  1S6P A;  3LDS A;  5CY4 A;  4AHS A;  4DQQ A;  3AVN A;  1L3T A;  2G8U A;  2PYL A;  4CK2 A;  4AHV A;  2R7Y A;  1VSD A;  2RPI A;  3U6F A;  4B9M A;  1UA1 A;  3DRS A;  4NCA A;  4CEA A;  2B6A A;  2QK9 A;  4N5S A;  1KVB A;  3S3N A;  3C94 A;  1W0H A;  3QEP A;  3ZT1 A;  2IC3 A;  5K14 A;  4E89 A;  3TAM A;  4K8X A;  3LAL A;  3RMA A;  4PWD A;  2E6L A;  3IG1 A;  4DQP A;  1TV6 A;  4AHC A;  3DLH A;  3ZSZ A;  4CK3 A;  3MEC A;  1IH7 A;  3QEV A;  3HPG A;  4M45 A;  1RTH A;  3AVM A;  1DLO A;  4H4M A;  3ZSV A;  3QIP A;  1JL1 A;  3VQC A;  1JLG A;  4DFJ A;  3TAR A;  1LWF A;  1NKC A;  1QSY A;  4C8O A;  1BIU A;  1HQE A;  4W5R A;  1T7P A;  4KI6 A;  3V9W A;  2B5J A;  1IKX A;  3DLE A;  1SL2 A;  3QIN A;  3NH1 A;  1WLJ A;  4EP4 A;  4JRP A;  4J2E A;  4CHZ A;  4ID5 A;  3KD1 E;  1CXQ A;  1MU2 A;  3CFR A;  3SZ2 A;  4AHR A;  3TAP A;  4M3X A;  3AO5 A;  4CER A;  3VA3 A;  4KB1 A;  3AVH A;  1BL3 A;  1JXB A;  3DRR A;  2PYJ A;  3UIQ A;  1XC9 A;  4E0D A;  1QS4 A;  1HNV A;  1ASU A;  3L8B A;  2ATQ A;  2D0A A;  4FZZ A;  4FJN A;  1R0A A;  1LWE A;  3CM5 A;  3M8P A;  3TAF A;  3TAQ A;  3CM6 A;  3I0S A;  1WNS A;  3F73 A;  1NJZ A;  2KTQ A;  4K8Z A;  4FJX A;  3RRG A;  1EET A;  3NDK A;  4PUO A;  4CEF A;  3BDP A;  3HVT A;  3HYF A;  5D3G A;  4DF4 A;  2B4J A;  2HVH A;  1UOC A;  4JS5 A;  4LH5 A;  2F8S A;  1HJR A;  5J2Q A;  4B9N A;  4E1M A;  4FCY A;  5KTQ A;  4FLW A;  2D5R A;  1XI1 A;  3HP6 A;  2WOM A;  4O44 A;  3V1O A;  3NE6 A;  1HYV A;  3HPH A;  3TAG A;  4FJK A;  2YKN A;  3TAE A;  4FZX C;  1REV A;  3PX4 A;  3K58 A;  3P83 D;  3V9X A;  2Y1J A;  4Z4H A;  2FBV A;  4CHO A;  4CK1 A;  4KHU A;  2I5J A;  4CEC A;  1ASW A;  1HQU A;  4N56 A;  1RT3 A;  3PUF A;  3P1G A;  3SJJ A;  4OLB A;  3QEX A;  4CGJ A;  3ZSQ A;  1LW2 A;  4AIL C;  4RW8 A;  3NF9 A;  2XY5 A;  1SV5 A;  1B9D A;  3M8S A;  3I0R A;  1XWL A;  2JGU A;  1CXU A;  2Z1J A;  4HHT A;  1SKR A;  3WNH A;  1IKW A;  1BI4 A;  4KTQ A;  4Y1D A;  3OYJ A;  4FJG A;  4B9V A;  3PO5 A;  5C42 A;  2FBY A;  4NYN A;  4KHY A;  1QE1 A;  2ZD1 A;  3KK1 A;  4HUE A;  2X78 A;  3TAN A;  1YTU A;  2IS3 A;  3ZSW A;  3I8D A;  3MEE A;  1O1W A;  2ITG A;  3T3F A;  2XY6 A;  4FJH A;  1YTA A;  2G8I A;  3TWH A;  3PX6 A;  2P51 A;  2VG5 A;  2YHB A;  2YNH A;  3MXI A;  4KTZ A;  1TKX A;  1Y97 A;  5FRM A;  1JXE A;  2EX3 A;  3DMJ A;  1L3S A;  4DSF A;  3DLB A;  1RT5 A;  3PO4 A;  1A5V A;  4B9S A;  3WNG A;  4AHU A;  1CLQ A;  2VG6 A;  4FJJ A;  1SL1 A;  4WE1 A;  3KK3 A;  4CIG A;  3NH2 A;  3KLG A;  1VSJ A;  1B9F A;  4EZ9 A;  3SQ0 A;  3AA4 A;  3QNO A;  3OYF A;  5J1E A;  1TKD A;  1HMV A;  3VQE A;  2ETJ A;  1BGX T;  4CE9 A;  4BWM A;  3HXM A;  3NF6 A;  4M3R A;  1RTI A;  3LP2 A;  3HJF A;  3ALY A;  2BE2 A;  3VQA A;  3SUN A;  4N47 A;  4ICL A;  4FK2 A;  2Q3S A;  4DQS A;  3SUP A;  5I42 A;  4E7L A;  4M3W A;  1IKV A;  3NF8 A;  4H4O A;  1U48 A;  3BGR A;  3K2P A;  3O3G A;  1CZ9 A;  2HHQ A;  3AVG A;  4I2P A;  4LSL A;  1U47 A;  2GUI A;  4O0I A;  4HUF A;  1T03 A;  4F2S A;  2RKI A;  5HBM A;  1TAQ A;  4CEQ A;  4Z4E A;  2FBT A;  4CJK A;  4CEO A;  4E1N A;  3KLE A;  4KHS A;  5KRT A;  4KFB A;  4O4G A;  3OYK A;  3B6P A;  3RWU A;  2X6S A;  5C24 A;  5DMR A;  3AVF A;  4CJQ A;  3SYZ A;  4F2R A;  1ZBH A;  1XHX A;  3U3G A;  2OZS A;  1FK9 A;  1S5J A;  3F9K A;  3LAN A;  3L2R A;  1Q9Y A;  4DSI A;  4CF8 A;  1ZYQ A;  3DLK A;  3EZ5 A;  2IAJ A;  2W42 A;  1S9G A;  3FFI A;  4IG3 A;  3QEI A;  1UA0 A;  4Y1C A;  1D9F A;  3VQ8 A;  4CED A;  4QCL A;  2HHX A;  3QLH A;  3HST B;  4FVM A;  4KV8 A;  3HPO A;  4FK0 A;  4KRF A;  1JLF A;  1IKY A;  3AVK A;  4KO0 A;  3K5M A;  4E19 A;  1RDD A;  4LSN A;  2HHU A;  1X9S A;  2DFE A;  2NUB A;  4JLH A;  4CIE A;  1T05 A;  4DSL A;  4CJ5 A;  4CHY A;  4DWI A;  3HL8 A;  5KRS A;  4CJS A;  4ELV A;  4AHT A;  2XHB A;  2D0C A;  2ZE2 A;  4BDY A;  3L2Q A;  2IGI A;  4M3Z A;  1RCH A;  3LPU A;  1U4B A;  4ZTJ A;  2P5O A;  3V9Z A;  1NK7 A;  3OYD A;  3CYM A;  1NOY A;  4DTO A;  3ASM A;  3QER A;  3OYL A;  4J2B A;  3JYT A;  3G0Z A;  1KLN A;  3LWM A;  4KI4 A;  3NBP A;  4BDZ A;  4B9L A;  1NKE A;  3KJV A;  5HRS A;  3OY9 A;  4CJF A;  3SI6 A;  5E41 A;  1NKB A;  2IOC A;  4KKO A;  4KTW A;  5CYQ A;  1RT2 A;  3AVL A;  2XRI A;  4HTU A;  2G8V A;  4RW9 A;  3K5L A;  1NK9 A;  3DLR A;  3S3O A;  1VSK A;  5SWM A;  4GMJ B;  3OYE A;  3EY1 A;  2BGG A;  1JLB A;  4HCB A;  1LWC A;  1WAJ A;  4CEE A;  1KSP A;  4F8R A;  1S1U A;  4Z4F A;  1WSJ A;  3C95 A;  4FM2 A;  2YNG A;  4OKK A;  4W5O A;  4MQ3 A;  3L3U A;  1RBU A;  4O55 A;  3QES A;  3OJU A;  1QSS A;  2DTU A;  1RT7 A;  4CEB A;  3WNE A;  3O3F A;  5KGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...