4CHZA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
155
structure length
151
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 57
structure length 151
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4chzA00
4CGHA 1CZ9A 1HNVA 5C42A 3I8DA 2B5JA 4UQGA 4W5NA 2OPPA 2RPIA 1RBTA 1SV5A 4JS5A 5HRNA 4L8RB 3SPZA 4FLVA 1ZBLA 3KD5E 3V9UA 2D0AA 1KVCA 4CGGA 3P5JA 1XHZA 4B9TA 3RMBA 4M3WA 5HBMA 1BI4A 3DOLA 3O3GA 1C1BA 4ZTFA 4E7KA 3L2WA 4O0IA 1BIZA 1JKHA 4W5RA 1YVUA 1VSHA 3JSMA 4AILC 4DU1A 4CFAA 2XHBA 3NDKA 3AA5X 4FM0A 4BE0A 1TK5A 2F96A 3VQ8A 1NKBA 2PYLA 2WOMA 3HPGA 2YNHA 1ZBHA 5CY4A 1XI1A 3B6PA 1WSHA 2FBVA 2KQ2A 3ZSVA 1KLNA 4NCAA 3HSTB 1WSGA 1TK0A 1IG9A 1L3SA 5J2NA 4OLAA 4I9LA 4CHYA 3QEWA 3SV3A 3MECA 4FLYA 1RTDA 5CZ2A 3DLHA 1RDBA 2G8VA 4RW9A 2IDOA 3SPYA 1GOBA 2RN2A 1K6YA 2YNFA 4CEBA 3LZIA 1U4BA 3O3HA 2P5GA 4OKKA 3HXMA 4NCGA 3OS0A 4FJGA 4CHZA 3L3VA 3OJUA 3ZT2A 3C6TA 1U04A 1TVRA 3TAGA 4KI4A 4HTUA 1IO2A 2RKIA 1HNIA 3AVNA 4E3SA 3LAKA 3DLGA 3AA3A 4OKJA 3LALA 1SKWA 4JRQA 2EHGA 4F2RA 2HHXA 5DMRA 4LY7A 1ZBUA 1S6QA 4DSLA 4Y1DA 4IG0A 3AVIA 2VG5A 2HVIA 5JS2A 3SQ2A 4YFUA 3WNHA 5E41A 1U45A 1C0TA 3OYAA 1RTIA 5FDLA 3VQEA 4FM1A 4BDZA 1X9WA 3D45A 4FVMA 4FYDA 5J2QA 5J2MA 2IC3A 3THVA 4I9QA 2HNZA 4FCYA 2G8WA 3IS9A 4OLBA 4B9VA 4FJ9A 3LP2A 2YNGA 4CJ5A 3TI0A 1EP4A 1S9EA 3SUOA 3RR8A 2ETJA 4DS4A 2KTQA 3KLIA 4DLEA 2E6MA 3CYMA 1QSYA 4NCBA 4CJWA 1C1AA 2Z1IA 5FRNA 2HHWA 4CJEA 2YHAA 3G10A 4HUGA 2HVHA 1J9AA 3QIPA 4F3OA 4PUOA 1TAUA 4DFKA 4N56A 3AVCA 3AO5A 3U3GA 2B4JA 3V6DA 3PO4A 4PQUA 3RRHA 2HHVA 3NGIA 2JGUA 1B92A 1RTHA 3DLEA 1SL2A 4DTNA 4OVLA 2DTUA 5CYQA 3K5MA 2XY6A 1A5VA 1Q8IA 2RF2A 4QAGA 2XY5A 2G8HA 1VSIA 1ZYQA 5CZ1A 5K14A 1RT3A 4ID5A 4CJRA 3TAMA 3LAMA 3QEXA 1YT3A 3RMDA 1U47A 4RG8A 2LSNA 4ZHRA 3AVJA 3C95A 4R5PA 1NK0A 4O44A 4B9NA 3HK2A 3K5LA 1ASUA 3KTQA 4O0JA 4AHRA 3AO1A 4CHOA 4CF1A 3QIOA 1HQUA 5I3UA 4AHSA 2BGGA 1JL2A 3V1QA 3LP0A 4IDKA 1KFSA 3VN5A 3SYZA 2ATQA 1CXQA 1T05A 4Z0UA 3AVKA 3NGZA 3F9KA 2FBXA 1LAVA 3OYLA 4KI6A 4FW1A 3L8BA 3KKRA 2Z1GA 1WLJA 3O4NA 1W9HA 5KRTA 4IG3A 3MXIA 2HB5A 1RT6A 1ZBIA 3L3UA 1QS4A 1QSSA 2ZE2A 3TWHA 4Q5VA 1BISA 1VK0A 3AA2A 4CEFA 4Z4HA 4DSEA 4TSXA 2G8UA 2QKKA 5KGWA 4CJPA 2F8TA 1S1TA 3AVAA 5KI6A 4FM2A 2Y1IA 1TK8A 1RCHA 3SUQA 1SKRA 2Z1JA 3ZT0A 4AHCA 1CLQA 1KVBA 3LPTA 4EP4A 3NH0A 3KK2A 4ELUA 3HVRA 4DTOA 1L5UA 4CEZA 4KHYA 2HW3A 4CEQA 1IH7A 2B6AA 4ICLA 2FC0A 3VQ6A 3EYZA 4FZYA 3TAQA 4DFPA 4CEEA 3V4IA 2ITGA 4Z4CA 1DLOA 3ZSWA 1TV6A 3CM5A 4KHUA 3ZSRA 1S1VA 1HMVA 4FW2A 2KZMA 1X1PA 1J54A 3V9ZA 1BI4B 1CXUA 4BE1A 2QKBA 4F3TA 1UA1A 2OYQA 1C0MA 1IKVA 1RDCA 3TAFA 3T19A 5EU7A 2ZD1A 4FJ7A 5HRPA 1LWEA 1MU2A 4CJVA 4CF8A 3M8PA 3NH1A 1REVA 3KLHA 3QESA 2PYJA 4CESA 4QOZB 1GOAA 4EZ6A 4E7IA 1NK8A 4JS4A 3T3FA 4DQSA 3KKSA 4ZTJA 3OJSA 3DYAA 3KLGA 4DTSA 3HM9A 2OZSA 4DSJA 4DQQA 1J53A 3NF6A 3OYIA 4FLTA 3OYGA 2HHQA 1XC9A 3HP6A 1D9FA 4CFBA 1RBVA 2OPRA 1L3VA 2DFEA 1S1XA 1JL1A 3LWMA 3HJFA 3OYDA 1RT2A 3HO1A 2XY7A 4C8OA 3K5NA 1X9SA 1I39A 4KPYA 4XIUA 2F8SA 1ASVA 4PA1A 4Z4GA 3EY1A 4RW8A 4J2BA 4CJKA 3V1RA 5KGXA 1NOZA 2KZZA 4C8LA 1WAJA 3O4QA 3CFRA 1BCMA 5FROA 5HROA 2P51A 4HCCA 2YNIA 3P83D 4B9MA 4FZZA 1WNSA 3HPHA 2GV9A 4NYFA 4FK4A 4GMJB 4W5TA 3V9SA 1HYSA 3D0PA 3ASMA 3VQQA 3PX6A 1VSMA 1J5OA 3IAYA 3SNNA 1UOCA 4LD0A 1R0AA 1EXQA 4KREA 3HYFA 1NKEA 4RW6A 1KSPA 3DLBA 1FXXA 4DSIA 4E1MA 3DMJA 1VSKA 4B3OA 4EP5A 1A5WA 4FLXA 2VWJA 3DLRA 4CJUA 4CJFA 3AVFA 5HLFA 4CK2A 3C6UA 2X6SA 4BWMA 4DTJA 3DI6A 3QO9A 3U3YA 1T03A 3RWUA 4PWDA 5JS1A 3K5OA 4B8AB 2W42A 3QEVA 3CG7A 3QETA 3RMAA 3RRGA 3L2QA 4DQIA 3G0ZA 4M3YA 4H4OA 1XWLA 3SI6A 3LWLA 3MXMA 4CEOA 3TAEA 1HRHA 1TKDA 4E0DA 3QNNA 3OYFA 1DTQA 2P1JA 3TABA 4M3RA 3AV9A 3CM6A 4DQRA 1SUQA 1TKTA 3DM2A 4DLGA 2X6NA 3MEDA 3KLFA 1L3TA 4BDYA 1KTQA 4FLZA 5I42A 1XHXA 4FZXC 3ZSOA 3M8QA 5C24A 3DRSA 5CYMA 3L2UA 4N41A 4O4GA 3MEGA 4CEAA 4B08A 1NJZA 1RNHA 4F2SA 1NK4A 3S3OA 3NAEA 1BQMA 2JLEA 4KHNA 3WNGA 3ZT3A 4ELTA 4ELVA 4F8RA 1QQCA 4B8CA 2D0BA 3QEIA 2OA8A 4FXDA 1WSFA 4CECA 4CHNA 3K59A 1Q9XA 2HMIA 2X74A 2R7YA 2VWKA 4FJKA 4FJ8A 3E01A 4FLUA 3V81A 1UAXA 5DK5A 1JLAA 2DY4A 4KFBA 3NE6A 4B9LA 1VSEA 3VQAA 4PY5A 4FJHA 3IRXA 2X78A 3BGRA 4RW7A 3KK3A 3MAQA 4BACA 4DTRA 3S3NA 1NJXA 2HHTA 4CJTA 5J2PA 1C0UA 1JLEA 1C6VA 4HHTA 3SJJA 1HYZA 1RBSA 3DRRA 4CIFA 3SUPA 1RDDA 1RT5A 1SL1A 4O55A 1W0HA 2A1SA 3PO5A 3ZSYA 1BHLA 2O4IA 1U48A 1Y97A 4IKFA 2BE2A 1SKSA 4W5QA 1C1CA 4KHWA 3OYMA 3TANA 3V1OA 5KTQA 4GVMA 3PX0A 4I2PA 3AA4A 1TL1A 5C25A 4YNQA 4H4MA 1NK6A 4B9UA 3F73A 3VQ4A 1RT4A 1VSDA 3LP1A 3IG1A 1QTMA 2KFZA 1HYVA 3CQ8A 3HVTA 3OS2A 3BDPA 4FJLA 3NGYA 4MFBA 4M3XA 4Z4FA 3LDSA 4FJXA 3ZCMA 4J2AA 3HL8A 1LW0A 4FJMA 1WAFA 4AHTA 2Y1JA 1UWBA 1Z25A 1Z26A 1RTJA 3CFOA 1RBUA 4FK2A 4HUFA 4BDPA 2OZMA 2IAJA 3ZSZA 4CHQA 4J2DA 4DG1A 3U6FA 1T8EA 4FJNA 4M3TA 2HHUA 3ALYA 3NF7A 1VSJA 2XY8A 1HPZA 1G15A 3TR8A 1LV5A 1D9DA 4QCLA 2Z1HA 4DMNA 4E89A 2O4GA 2XRIA 1NOYA 1LWFA 1S9GA 1UA0A 1QHTA 3C94A 4DTUA 2GUIA 1T7PA 3ZT4A 1EX4A 1NJYA 4IFYA 4Z4EA 3NHGA 3LPUA 1TKXA 1D5AA 1Q9YA 1NK7A 3L2VA 3ZT1A 2DFHA 3VA3A 2AJQA 1BCOA 2YKNA 4C8NA 4AH9A 4DTXA 2A1RA 3VQ5A 4E7LA 4JRPA 4KAZA 4KTWA 1BIUA 2KW4A 3AVGA 3AVLA 5D3GA 2EX3A 5FRMA 3VQ7A 2QXFA 1WSJA 2Q3SA 2D5RA 4DFMA 3HP9A 3SQ0A 1D8YA 2BDPA 4CCHA 3OYJA 4DSKA 4KKOA 1KVAA 4CF0A 5HP1A 4CGIA 1JLCA 3QNOA 1LWCA 1TGOA 1S1WA 1DTTA 4N5SA 4CE9A 4N76A 1S6PA 3DLKA 3I0RA 4I7FA 4OGEA 2HNYA 2HHSA 4E19A 4DTPA 4KV8A 3KIOA 3QLHA 4DFJA 3WNEA 3VQBA 3QERA 4KTZA 4B9SA 4RW4A 2PZSA 4F4KA 2IGIA 2BANA 3M8RA 5HRSA 2I5JA 3KJVA 3ZSQA 4DF4A 3P1GA 5J1EA 3B6OA 3MXJA 4LH5A 3S9HA 1EKEA 1F21A 2DFFA 3OY9A 1NK9A 4CGFA 1KCFA 2E6LA 4MQ3A 4LH4A 1BL3A 4FJJA 1A5XA 1KLMA 1WSEA 3HT3A 1ZBFA 1SL0A 3K2PA 1NJWA 4CIGA 2KFNA 3AVMA 1JLQA 3OYBA 4G1QA 4DWIA 4DS5A 2G8KA 4OPKA 4IBNA 4CK3A 5T7BA 1YTAA 1RT7A 3ZSXA 1FK9A 3AO2A 2G8FA 4CFDA 4JLHA 3OYNA 4E7JA 4LSNA 4FK0A 4CHPA 4M3UA 1RBRA 3NCIA 1WN7A 4CIEA 2YV0X 3AO4A 4CFCA 4H8KA 1ASWA 2YKMA 3QINA 3UIQA 3CFPA 3NF9A 1JLGA 4AHUA 4M42A 1VRTA 3KD1E 2ZQBA 1CZBA 2FBYA 3VQ9A 1RT1A 5SZTA 3K58A 5SWMA 3DOKA 3PUFA 3VQDA 3TAPA 4WE1A 3VQCA 1VSFA 1IKYA 4CEDA 3EZ5A 1JXEA 2YHBA 4KRFA 3K57A 1EETA 4HVJA 1YTUA 1RILA 3A2FA 3AO3A 4E1NA 4W5OA 3ITHA 3V9XA 4DTMA 4EZ9A 2HNDA 3OVNA 3TARA 4CJSA 3S3MA 1NKCA 2IS3A 2D0CA 2VG6A 4Z4IA 1B9FA 4FJ5A 3FFIA 3H08A 1JXBA 4DSFA 3T1AA 4K8ZA 3OYKA 4E7HA 2FBTA 1GOCA 4BWJA 4N47A 3VQPA 4CJ3A 1VSLA 5KRSA 1IKWA 4CF9A 3SUNA 4DQPA 1U49A 3SQ4A 4HCBA 2OPQA 4OGCA 3OS1A 3SV4A 2NUBA 3SCXA 4DU4A 3SQ1A 1ITGA 1KRPA 3KLEA 3OYHA 3AVBA 3RR7A 4KO0A 4K8XA 1HJRA 2E4LA 1FKPA 3HPOA 4HUEA 4AHVA 1LAWA 4CK1A 3LP3A 4CGDA 1TKZA 3PV8A 4KTQA 4IFVA 4C8MA 4KHQA 1BQNA 1I3AA 3NBPA 1KFDA 4J2EA 4BE2A 4FLWA 2PY5A 4DF8A 3JYTA 3OYCA 4OKEA 1RDAA 1WSIA 3NFAA 4I2QA 2P5OA 4Q0BA 1TL3A 1NK5A 1JLBA 2WONA 4OJRA 4LSLA 4O5BA 1N5YA 3PX4A 3O3FA 3OYEA 1N6QA 4M41A 3WNFA 4NYNA 4ID1A 2IOCA 1B9DA 1QSLA 4KB0A 2QK9A 2XO7A 4KHSA 1QE1A 4Y1CA 1BGXT 4M45A 2OPSA 3ULDA 3QEPA 4KB1A 4FJIA 4CERA 4CJ4A 3AVHA 3VA0A 3I0SA 1TAQA 4CF2A 1FKOA 3LANA 3M8SA 2G8IA 3KK1A 1IKXA 4GW6A 3V9WA 3DRPA 3PY8A 5HRRA 3NF8A 3MEEA 1X9MA 1S1UA 1S5JA 1VRUA 2VG7A 3ISNC 3LZJA 4CGJA 1HQEA 3SZ2A 4C8KA 3L2RA 2GBZA 1LW2A 3RMCA 4OPJA 1JLFA 1O1WA 3NH2A 1L3UA 4DU3A 4CJQA 4M3ZA 3RTVA 4CJLA
chains in the Genus database with same CATH superfamily
1HNVA 3VEWA 2RPIA 1SV5A 2ASOA 4BRAA 4YY3K 3V9UA 1KVCA 4B9TA 3P5JA 1OH7A 3ZX2A 3UKRB 1BI4A 4E7KA 3AGKA 4AILC 5A2QO 5M1FA 4IWVA 3EL2A 4WQ5A 4FM0A 3A5MC 3VQ8A 2FF3B 3HPGA 3B6PA 1WSHA 2O8BB 4BRPA 1IG9A 4CHYA 3HRGA 3T69A 1RDBA 1K8KB 2IDOA 5BRHA 3SPYA 1GOBA 2RN2A 1K6YA 1NMDA 1U4BA 4HWIA 4OKKA 4NCGA 2UU9K 4FJGA 4BRQA 4JV5K 1DGKN 3ZETB 1U04A 1S22A 4HTUA 3DLLL 4CD3A 3AVNA 4WQ5C 4JKEA 3LAKA 3DLGA 3LALA 3TSPA 5DMRA 2H3GX 1RFQA 4DSLA 4Y1DA 4IG0A 4NXMK 4DQ8A 4AF1A 4YFUA 1U45A 5E41A 1RTIA 4CZFA 4FYDA 3D45A 4FVMA 5J2QA 2WTUA 2IC3A 4I9QA 1XMQK 4FCYA 4BC5A 3IS9A 4A61A 3NVMA 4IJNA 4OLBA 3LP2A 2YNGA 4CJ5A 2O8DB 3EO3A 1S9EA 3TI0A 3RR8A 1ESVA 3KLIA 4RTFD 1XNRK 4DLEA 3QFPA 1C1AA 2Z1IA 5AQYA 5AQPA 4DFKA 3AVCA 2B4JA 3V6DA 4DR4K 3PSFA 4DTNA 1TUUA 2RF2A 4G9ZA 3CHWA 4DKWA 5CR4A 4DB3A 4R5PA 3C95A 5MLCQ 1VQMN 3LDNA 1NNEA 3KTQA 1HQUA 1JL2A 1TYQB 4IDKA 4JKAA 2IIRA 1N32K 3O6WA 3UKUA 2YI1A 5BRFA 3L8BA 5KRTA 1ZBIA 1QS4A 1QSSA 2W6KA 4CBUA 4DV1K 4TSXA 5KGWA 3VERA 1S1TA 1TK8A 1KAXA 3WXKA 1NJIO 3EE8A 4BRDA 3PLAA 4EP4A 4ELUA 3HVRA 3I8BA 1IH7A 3WQTA 2B6AA 4MLHA 3VQ6A 4FZYA 2GELA 3E9OA 2QWMA 4ISGA 2ITGA 2HBJA 4Z4CA 4PKGA 1DLOA 3ZSWA 3ATVA 5C0YA 3ZSRA 3IUCA 1N34K 1NGIA 4LF9K 4IOCL 4EHTA 4BE1A 3S41A 2O8DA 4LF6K 4CF8A 1NGDA 2OTJN 4CESA 4JI6K 4ZTJA 4DTSA 4WCEL 3HM9A 4DQQA 3OYIA 5IWAK 1E4FT 1JCGA 3HTVA 3BF1A 2XY7A 4C8OA 1GLJO 4BGAA 4KPYA 3K0SA 1IBLK 4PA1A 4J2BA 5GINA 4KH5A 1NOZA 5FROA 2ASMA 2YJFA 2P51A 4QS8A 4HCCA 5FPEA 1WBDA 3UB5A 5AQGA 1LCUA 1WNSA 4FK4A 2GV9A 3IKMA 3K9KA 3D0PA 2P9SA 3ASMA 3DXMA 4JKBA 4YOYA 3IAYA 3SNNA 1R0AA 3OHRA 4E1MA 3DMJA 1VSKA 3DXMB 1A5WA 1VQLN 1KXPA 4CJUA 1EWRA 3THXB 4LFBK 3AVFA 4CK2A 4RWTA 3RWUA 4IJAA 4DTJA 3H6EA 3I56N 5JS1A 2ZGYA 3QEVA 3RMAA 3L2QA 3G0ZA 5AQFA 3H46O 3TAEA 5F2RA 4M3RA 3AV9A 4DQRA 1TKTA 2E88A 3DM2A 3KLFA 3MWTA 4BDYA 2HF3A 2W40A 2DPNA 5CYMA 2V7ZA 3J81O 4F2SA 3NAEA 2JLEA 4ELVA 4JAXA 1QQCA 3QEIA 1WSFA 4BROA 4EAHD 2VWKA 4FJKA 1MWMA 1YHQN 4PY5A 2UYTA 3A0IX 1HKBA 3M3ZA 3TPQA 4IKFA 2X78A 4RW7A 4DTRA 1NJXA 2HHTA 4CJTA 1C0UA 2E2OA 4DR5K 1JLEA 1C6VA 5HL7L 3DRRA 4GKKK 3SUPA 1RT5A 1W0HA 3HOTA 1S72N 1BHLA 1T3VA 3SAFA 5EOYA 2BE2A 3ENBA 1C1CA 3M6GA 3TANA 5C25A 4H4MA 3CJ7A 1NK6A 4IEEA 3KWGA 5E84A 2UUBK 4EIAA 5AQNA 2KFZA 3HVTA 1NGGA 3IMXA 4MFBA 3KWIA 4FJXA 2P9PA 4GY2B 4JI3K 1WAFA 3ZEUA 5LMNK 1RTJA 1RBUA 3MCAB 4HUFA 4CD1A 2A6AA 3VEZA 1T8EA 5AZJA 2A5XA 1H1VA 1C0GA 2Z1HA 2ZGZA 2XRIA 4JKHA 3ZT4A 1EX4A 4ISEA 4IFYA 3VEYA 4Z4EA 3VGKA 3OTOK 3ZT1A 3CJAA 5AZJB 4DTXA 2A1RA 3VQ5A 4JRPA 4KTWA 1BIUA 3AVGA 1W7AA 3QB0A 3QMLA 1D8YA 3OYJA 4CF0A 1KVAA 3O1BA 3TTFA 1LWCA 1S1WA 4N5SA 4N76A 2YHWA 4OGEA 2CGJA 2HNYA 4H03B 1BA0A 3KIOA 4B1VA 4A62A 3CXCM 4B9SA 4RW4A 2IGIA 1K8KA 3KJVA 2I5JA 2FSNA 4XEIA 4DF4A 3P1GA 4LH5A 1F21A 3OY9A 2DFFA 4LH4A 3DJCA 1ZBFA 2HF4A 5FPNA 4CIGA 3OYBA 4G1QA 4JHDA 3CMEN 4DWIA 2UXDK 1T6CA 1MA9B 2GEMA 4LSNA 4FK0A 5BR9A 5TKWA 4CHPA 1RBRA 5BPNA 2YV0X 4DR6K 2A42A 3UIQA 4AHUA 3UKRA 2ZQBA 3VQ9A 1RT1A 3P38A 3DOKA 3VQCA 3GDQA 3CJCA 4BQZA 4JHDB 2O8BA 1IKYA 4CEDA 4ILJA 1JXEA 2YHBA 3ULEA 3EZ5A 2NNWA 1EETA 4MLEA 1HLUA 4HVJA 1YTUA 3AO3A 3V9XA 4EZ9A 1NKCA 2IS3A 2VG6A 3FFIA 3H08A 4IEIA 2FBTA 3VESA 5KRSA 4CJ3A 5HOOA 1VSLA 3MN9A 3SUNA 4CF9A 3E66A 5DM7L 4DU4A 1HNZK 3KLEA 1QVGM 4JN4A 4BR7A 1K8AO 4CGDA 4KTQA 4KHQA 4IFVA 1I3AA 1RDWX 5C2FA 3AARA 5LJVA 4DF8A 4OKEA 3NFAA 2P5OA 5AQLA 4FO0A 1NK5A 4JI4K 5AQZA 4M41A 3PSIA 3WNFA 1J5EK 5CE3A 2IOCA 1BGXT 3CCRN 3VETA 2D0OA 3AVHA 3I55N 1ATSA 4CF2A 1FKOA 3WXJA 1GLAG 3D2FA 3M8SA 3PY8A 4BRFA 4BRIA 1S1UA 1S5JA 5GADP 2QWPA 3SZ2A 3L2RA 3RMCA 4J8FA 3NH2A 1L3UA 3QBWA 4M3ZA 3MN5A 4CZLA 3I8DA 3D2EB 2B5JA 4FWOA 1RBTA 2O8FA 3VEVA 4FLVA 1ZBLA 4CGGA 3O3GA 5F1XA 1S3XA 4O0IA 2YHXA 3G71N 4DV7K 2QXLA 2UXCK 1JCEA 1NKBA 2PYLA 3D6RA 1XI1A 1NLVA 2CGKA 4BRHA 4X65K 3HSTB 3LDLA 4I9LA 3SV3A 3MECA 4FLYA 1RTDA 5CZ2A 3DLHA 2P9UB 1W97L 2YNFA 4CEBA 1W2BM 4KBOA 4FPBA 2ZM6K 1TVRA 3TAGA 1IO2A 2RKIA 3JS6A 4BRLA 1SKWA 2HHXA 4LY7A 3HOSA 1R59O 3AVIA 4FOIA 5JS2A 1IJJA 3WNHA 3VTHA 1C0TA 1E3MA 2NRHA 4FM1A 1VQKN 1X9WA 5J2MA 1SAZA 1G99A 3ULEB 4B1WB 2G8WA 1J6ZA 4B3SK 4DS4A 3W3DA 4WQ4A 3SMSA 3FE1A 2E6MA 3W0LA 4NCBA 1HR0K 2YHAA 1YITN 1ZC6A 1WBBA 1HUXA 3AO5A 2HHVA 1SL2A 2DTUA 5CYQA 3K5MA 5ADXH 1A5VA 1Q8IA 1ZYQA 3ID6A 1XQSC 3ZX3A 3RMDA 2ZWHA 3FZFA 3QEXA 2LSNA 3WXLA 3AVJA 3HK2A 4O44A 4GNIA 2HOEA 3OBWA 3AO1A 4CF1A 3QIOA 5I3UA 2BGGA 4AHSA 2GTDA 4X64K 1KFSA 2UUAK 4Z0UA 3R9PA 2FBXA 4BRCA 2P9NA 4KI6A 4FWLA 4IG3A 5JLFA 3MXIA 3L3UA 3AA2A 2G8UA 2F8TA 1T6DA 4DR1K 2Y1IA 1CLQA 3ZT0A 4AHCA 2QWQA 5AR0A 2VQFK 3NH0A 3KK2A 3HI0A 1L5UA 4KHYA 2HW3A 3MN7A 4CZIA 4B1YB 3THWA 1TV6A 4OPHA 4KHUA 3ZX0A 4DCHA 3V9ZA 3CCUN 4F3TA 2OYQA 3J80O 3DWLA 5EU7A 2ZD1A 2FSJA 3MX5A 3NH1A 3MK6A 3KLHA 3QESA 1GOAA 1OVQA 3EKUA 4E7IA 1NK8A 4JS4A 5AQVA 1NGEA 3AAQA 3KLGA 3NVKA 2OZSA 3E9PA 3CQXA 3NF6A 2HHQA 1XC9A 2W41A 4CFBA 2DFEA 1S1XA 1RT2A 4H0TB 2E1ZA 2Q36A 5AQKA 1ASVA 3O5BA 3PIOL 3CFRA 3MDQA 1WB9A 4LF4K 4B1UB 3FZHA 1Z05A 3HPHA 4GV3A 4GMJB 4W5TA 4BREA 3PX6A 1VSMA 2BH1A 1UOCA 1NKEA 1KSPA 3DLBA 5AQJA 1XMOK 4EP5A 3CCMN 5KPTA 5HLFA 3C6UA 2X6SA 3DI6A 3QO9A 3K5OA 4B8AB 2W42A 1VQ6N 3QETA 3J7ZO 4FWSA 3SI6A 2OTLN 3LWLA 4CEOA 4E0DA 1TKDA 1Q18A 2F9TA 3CM6A 1L3TA 2X6NA 1KTQA 1EO1A 4FLZA 5I42A 4FZXC 2Q31A 4YOUA 3M8QA 3DRSA 4O4GA 3MEGA 2F7TA 1BQMA 4KHNA 3WNGA 2HBLA 3ZT3A 4F8RA 4B8CA 4FXDA 2D0BA 5KQ8A 2PFUA 2PAVA 1Q9XA 2HMIA 2X74A 3E01A 4FLUA 3V81A 4KFBA 3NE6A 4JI1K 1VSEA 3O1WA 1O13A 5BREA 4FJHA 3IRXA 3MAQA 3BGRA 3KK3A 3S3NA 4BRNA 4X62K 4YHHK 3C7NA 5J2PA 3WXMB 3SJJA 3SBGA 4B1ZA 4O55A 4NB4A 3J7AP 3K9JA 5KPRA 1TUYA 3H3NO 1Q82O 3VGLA 3O08A 2P9LB 3EKSA 1Y97A 1QZ5A 4JI2K 1BWFO 1YXQA 4IOXA 5AQSA 3LP1A 5EXWA 1DKGD 3CQ8A 4FJLA 4CJ7A 5C12A 3LDSA 3ZETA 5JVHL 4FJMA 1Z25A 1Z26A 1QQOA 3CFOA 3ZSZA 4CHQA 4M3TA 3T1HK 4JI8K 4BR4A 2XY8A 1WUAA 1D9DA 3CMAN 4QCLA 1HNXK 4E89A 3GBTA 1QHTA 3C94A 4XH4A 2GUIA 1V4SA 4AM6A 1X3MA 3WUHA 4EHUA 2NRXA 5AQUA 1NK7A 2I7PA 2DFHA 4B9QA 1BCOA 2YKNA 4AH9A 4KAZA 2RE2A 2QEXN 2KW4A 2VGNA 3AVLA 4FWQA 5FRMA 3VQ7A 4JK7A 2JWLA 1C0FA 1WSJA 2Q3SA 3P31A 3SQ0A 3F2KA 1NU0A 4RCHA 5M1OA 1QQMA 4A57A 4KKOA 5HP1A 4CGIA 1JLCA 4DUZK 3QNOA 2V51B 4CBXA 4PL8A 1S6PA 2QWRA 1YF5L 3WQUA 3I0RA 4I7FA 4JI5K 2VCPA 4E19A 4DTPA 2HHSA 4KV8A 4DFJA 1NGJA 1WOQA 2BANA 1HKCA 2P9UA 2EWSA 3ZSQA 2P9LA 4YORA 3S9HA 2NRRA 3B6OA 3MXJA 4IXCA 1EKEA 4CGFA 1KCFA 4BC2A 4QS7A 4MQ3A 5BPLA 1A5XA 1KLMA 4H5NA 3HT3A 1DEJA 1P90A 4DS5A 2G8KA 4CK3A 5T7BA 3ZSXA 2G8FA 3AO2A 3LDQA 3J8AA 3OYNA 1I94K 4I6MA 2BUPA 1WN7A 3AO4A 4H8KA 2YKMA 4M42A 3KD1E 3JAMO 4MDBA 3K58A 4A5BA 4WE1A 3QBXA 4V19S 2NLXA 3THYA 1RILA 3A2FA 2QW9A 3ITHA 3ENHA 5EY4A 4CJSA 3S3MA 4Z4IA 1B9FA 2I7NA 3U8XA 2E2PA 2HMPA 2NRZA 3E9LA 3SAGA 5GAHP 3ZEUB 1HPMA 3D7EO 1NGFA 2E2NA 4HCBA 2IVPA 3SCXA 3SQ1A 1ITGA 4JKDA 4KO0A 1HJRA 4HUEA 4NLCA 4IFEA 4BRGA 2QTDA 3THYB 1MWKA 4J2EA 1XNQK 1GLFO 3FR0A 3D2FB 2HBMA 4Q0BA 1TL3A 1JLBA 2WONA 1OH8A 3Q7BA 4O5BA 3OYEA 1GLBG 2ASPA 5KQDA 1QSLA 2QK9A 3H1QA 2IVOA 4Y1CA 5JICA 3GG4A 3L4QA 4FJIA 4CERA 4CJ4A 4PL7A 3A5NC 3FGUA 3DRPA 3HZ6A 3NF8A 2YHYA 5C15A 2Q2RA 1IBMK 4OPJA 1JLFA 1O1WA 3RTVA 3SMPA 3HSCA 4CJLA 1CZ9A 2OPPA 4JS5A 5HRNA 5AJ3K 4L8RB 3SPZA 2O8CB 3KD5E 4FWPA 4M3WA 3DOLA 3L2WA 2BTFA 1BIZA 1VSHA 3JSMA 3C7NB 2O8EA 3AA5X 4BE0A 4JKGA 1TK5A 2F96A 3EEQA 1BO5O 2WOMA 2YNHA 3LDPA 2FBVA 3H1VX 1KLNA 1IBKK 1WSGA 5EVZA 4C1NI 1NBWA 5BN8A 1BG3A 2P9SB 4H0XB 3BEXA 3O3HA 5M1NA 2P5GA 3HXMA 3TU5A 5EX5A 4CHZA 3EE9A 3L3VA 2P9NB 3MN6A 4KI4A 1HJOA 4E3SA 4NO7A 3AA3A 4OKJA 5LJWA 4JRQA 2EHGA 4IZ9A 4X66K 1ZBUA 2FLOA 3I33A 4M63C 2VG5A 2HVIA 4WF9L 1OVYA 4BRKA 4YOTA 1VQON 3THVA 4O5FA 4A2AA 2YJEA 1VAZA 3AGRA 1NGHA 4JEPA 2ETJA 2WUSA 2KTQA 5FRNA 3CYMA 2FXUA 4DV4K 4CJEA 2HHWA 5FPMA 2HVHA 4F3OA 1K73O 4PUOA 5AQRA 1TAUA 3U3GA 1NGBA 3PO4A 3RRHA 3SLCA 1B92A 3KK7A 1RTHA 5JLHA 2XY6A 5AQIA 2G8HA 4QAGA 2ZJPL 1U2VA 1N8RO 4JNEA 5CZ1A 3UE5A 4A59A 4ID5A 4CJRA 3TAMA 1YT3A 2P9KB 4RG8A 3PIPL 5AQOA 4ZHRA 1Q86O 3EN9A 1ATRA 1VQ4N 3LP0A 3GOIA 3N4PA 3VN5A 3CCLN 1BDGA 3U9ZA 1CXQA 1T05A 5BR8K 2VWBA 1SS6A 3NGZA 3F9KA 1LAVA 3P4IA 4IO9L 3OYLA 4FW1A 1NGAA 3KKRA 1EQYA 3O4NA 1VQ7N 1NWKA 1W9HA 2HB5A 4IDHA 3THWB 1LOTB 4PHTX 4DSEA 4CJPA 3AVAA 5KI6A 3SUQA 1SKRA 3LPTA 2NZTA 3CIPA 4DTOA 5GIPA 4CEQA 2FC0A 4L3QA 3T7ZA 4CEEA 3CETA 1QZ6A 3QICA 1S1VA 1HMVA 4FW2A 2KZMA 1X1PA 1J54A 2QKBA 2E1YA 1UA1A 3GE1A 1C0MA 1IKVA 2NRVA 3TAFA 3J7YP 3MMVA 4FJ7A 3BZCA 2O8FB 4CJVA 2PYJA 4FVUA 1X3NA 3KHYA 1OH5A 3T3FA 3KKSA 3OJSA 1XUPO 4MDAA 3OYGA 1D9FA 1RBVA 2A3ZA 4DR2K 1L3VA 3HJFA 3OYDA 2A40A 2V7YA 3CCQN 3E1YA 4R79A 4Z4GA 4GV6A 3EY1A 4CJKA 2KZZA 4C8LA 1WAJA 2YCHA 4CZGA 4Z94A 3OBYA 2YNIA 2VYPA 5M1PA 3THXA 4FZZA 1HNWK 3RSEB 3V9SA 4CW7B 1HYSA 2ZJRL 3FZKA 1VQNN 3VQQA 3CCVN 4DV5K 1J5OA 1ILYA 2CH5A 1GLCG 1EXQA 4H0OA 3HYFA 4KREA 2PBDA 4B3OA 1QQNA 1SQKA 2VWJA 2AP1A 3DLRA 4YOXA 4LF5K 3O8MA 5AQXA 4BWMA 4UY8O 3U3YA 5AQQA 4PWDA 3CG7A 3RRGA 4DQIA 4H4OA 4CZHA 1HRHA 4BGBA 3OYFA 2P1JA 3NMUA 1M90O 2O8CA 2KLAA 5AFUH 1VQ8N 1XHXA 3SBTA 3O80A 3L0QA 3QDKA 4MO5A 4QS9A 4BRMA 3L2UA 5IT9O 2KHOA 3VMFB 4B08A 1RNHA 1NK4A 3S3OA 4ELTA 2OA8A 4CECA 4DR3K 3K59A 3EZWA 4BQLA 4FWMA 4K25A 2QWNA 1FJGK 2R7YA 4B3RK 1JLAA 1N33K 4FPAA 1OKJA 1SZ2A 2WC9A 4GV9A 3VENA 5ADXA 3CJ9A 4BC3A 1HYZA 3CQYA 1RDDA 1VQ5N 2A1SA 3ZSYA 4BG9A 3F5TA 2O4IA 4KHWA 3PX0A 4YNQA 4B9UA 3CCJN 4YOVA 1GLLO 3LDOA 1VSDA 4AQYK 4CZJA 1QTMA 1HYVA 3OA9A 3OS2A 3UKUB 4M3XA 4MO4A 3R3LA 4AHTA 1KC8O 1UWBA 1TYQA 4DV2K 3MWPA 4FJNA 2QWLA 4OX9K 3VEXA 2E20A 2RHKA 3WXIA 1G15A 5AQMA 1LV5A 4GKJK 4DMNA 1NOYA 1S9GA 4DTUA 2FSKA 4FSVA 1YUWA 4ISFA 1NJYA 1U2VB 5AQTA 3CC2N 3LPUA 3VEOA 3CC4N 3CI5A 4E7LA 5D3GA 2EX3A 3WEEB 2QXFA 3CC7N 4DFMA 3HP9A 3FLCO 4DSKA 5LMUK 4KH6A 1TGOA 3BY5A 1DTTA 4CE9A 4CBWA 3DLKA 1YIJN 3QLHA 5AZIA 3WNEA 4F4KA 2PZSA 2NRWA 3G4SN 1KD1O 1NG9A 4NXNK 1NK9A 1QVFM 1WSEA 1SL0A 1KQSM 1RDUA 3K2PA 1NJWA 3BUZB 4K41A 4PKHA 3Q7CA 2OANA 4JK8A 3JXUA 3NCIA 4CIEA 1ASWA 3QINA 3NF9A 1JLGA 2J4RA 2E5LK 1JJ2M 5SWMA 3TAPA 1U6ZA 4KRFA 3K57A 3N4QA 4E1NA 4JD2B 1EWQA 3CCEN 3OVNA 2CGLA 2D0CA 4FJ5A 4DSFA 1YJWN 4O8UA 4GVEA 2F9WA 4BWJA 1GOCA 1Z6RA 3VQPA 1JCFA 4XH1A 3WT0A 1U49A 3SQ4A 3OS1A 2NUBA 4FOEA 3HPOA 1FKPA 4AHVA 5I9EB 2AA4A 1X9JA 3B8AX 5BRDA 3QFUA 1KFDA 4K0KK 4BE2A 3JYTA 1RDAA 1WSIA 4YDUA 4OPAA 4A2BA 4OJRA 2KKZA 4LSLA 1N5YA 2OCEA 3PX4A 4LFAK 1N6QA 2WFBA 4CZKA 4ID1A 1FW6A 1B9DA 2XO7A 1QE1A 3H45C 2OPSA 5FPDA 3QEPA 2NRTA 3VA0A 3I0SA 4LF8K 4DHYA 3LANA 2YX6A 3KK1A 4GW6A 5HRRA 3LM9A 3TSUA 1MDUB 3H3OB 2QM1A 1VRUA 2VG7A 3AY9A 3TTDA 2GBZA 1GLEG 4DU3A 3U4LA 4A5AA 4CGHA 5C42A 4H5WA 4W5NA 4UQGA 2WBNA 2D0AA 2E2QA 1XHZA 3RMBA 2D0PA 5HBMA 1C1BA 4ZTFA 3P39A 1JKHA 4W5RA 1YVUA 4DU1A 3C0BA 4CFAA 2XHBA 3NDKA 4IOAL 5KPZA 2HBKA 2GUPA 4LF7K 3IFRA 1ZBHA 2F4VK 5CY4A 4NCAA 2KQ2A 3ZSVA 4H0PA 1TK0A 5FLXO 1L3SA 3O9RA 3M1FA 5J2NA 4OLAA 3QEWA 2G8VA 1M1KO 4RW9A 4AM7A 4K43A 2P9IB 3TTCA 2UXBK 3LZIA 4BG8A 4I6MB 3OS0A 3OJUA 3ZT2A 3C6TA 2P9PB 3DXKA 4BVOA 1HNIA 4F2RA 3T1YK 4CZEA 1S6QA 1YI2N 2E8AA 4LFCK 3ZLJA 5TKYA 3SQ2A 2FF6A 4IO8A 3OYAA 5H1SQ 5FDLA 3VQEA 1QHAA 4BDZA 3R1XA 2A41A 5JVGL 3VTIA 2HNZA 4M7XA 3HBTA 4B9VA 4FJ9A 3FZLA 3CJBA 3SK3A 4LC9B 1EP4A 3MX2A 2GWJA 3SUOA 5LY3A 3VGMA 1QSYA 4CJWA 4HUGA 3G10A 1J9AA 3QIPA 4N56A 4PQUA 3NGIA 2JGUA 4BY9C 3DLEA 4OVLA 3AAPA 3VF6A 2XY5A 1VSIA 5K14A 1RT3A 2VQEK 4M7YA 1U47A 3LAMA 1HKGA 1V4TA 3BZKA 4HTLA 1NK0A 4B9NA 3A5LC 3K5LA 1ASUA 4ILGB 4O0JA 4AHRA 4CHOA 3ZYYX 3V1QA 3VF2A 3SYZA 2ATQA 4BR9A 4B3MK 5CHIA 3AVKA 5GAEP 2VGMA 2Z1GA 1WLJA 4JK9A 3KZBA 1RT6A 2ZE2A 2HSTA 4Q5VA 3TWHA 1BISA 1VK0A 4CEFA 4Z4HA 2QKKA 4H5RA 4FM2A 1RCHA 1YAGA 2Z1JA 1KVBA 4CEZA 4ICLA 1BOTO 5C10A 3EYZA 2V52B 3TAQA 4DFPA 2QI2A 3V4IA 4B3TK 3CM5A 2CH6A 5M1KA 1BI4B 1CXUA 5BPMA 1RDCA 4F9OA 3T19A 1ATNA 5HRPA 1LWEA 1MU2A 3M8PA 4QOZB 1REVA 3LM2A 3O9UA 4EZ6A 4DQSA 4EFHA 3DYAA 4DSJA 1J53A 5B8HA 4FLTA 3HP6A 2P9KA 2OPRA 4WFBL 1JL1A 3LWMA 3HO1A 3L6QA 5AQHA 3K5NA 1X9SA 1I39A 1Q81O 4XIUA 2F8SA 4RW8A 5KGXA 3V1RA 1VHXA 4C1NK 3O4QA 1BCMA 5HROA 1P8ZA 3A8YA 3CCSN 4BR0A 3OW2M 3P83D 4B9MA 3O9QA 4NYFA 3G6EN 4NLBA 1D4XA 1OH6A 4WFNL 4LD0A 3KVGA 1BU6O 4RW6A 4BC4A 1FXXA 4DSIA 4O8KA 2IVNA 2Q0UA 3R8EA 4FLXA 3CF5L 4H0YB 4CJFA 1DT9A 3CERA 1T03A 1KAZA 4U67L 2UUCK 1YVNA 4M3YA 1XWLA 3CJ1A 3MXMA 5GIOA 3QNNA 1DTQA 3TABA 4JI7K 1SUQA 2D4WA 4DLGA 3ENOA 3MEDA 2Q97A 3ZSOA 5C24A 4N41A 4CEAA 3G25A 1RGIA 1NJZA 1Q7YO 4FWKA 3L4IA 1BA1A 5JMVA 4CI6A 4CHNA 4WYBA 4H5VA 4DUYK 4FJ8A 1UAXA 3RSEA 5DK5A 2DY4A 4B9LA 3VQAA 2HHHK 5ELZA 2Q1NA 4BACA 4BVPA 4FWNA 2O8EB 2JWKA 4KHPK 4HHTA 1RBSA 4CIFA 5DM6L 1SL1A 3PO5A 3CPEA 3BP8A 3SJHA 4U7BA 1U48A 1SKSA 4W5QA 3OYMA 3V1OA 5KTQA 4GVMA 4I2PA 3AA4A 1TL1A 3F73A 3VQ4A 1RT4A 3CPWM 3ATUA 3IG1A 4ILHA 3BDPA 3NGYA 3R6MA 4Z4FA 1Y64A 3ZCMA 4J2AA 3HL8A 1LW0A 4DV3K 2Y1JA 1K9MO 3C65A 4FK2A 4BDPA 2OZMA 2IAJA 4J2DA 4DG1A 3U6FA 2HHUA 3VOVA 3ALYA 3NF7A 4OO1J 1VSJA 1HPZA 3TR8A 2GX9A 1KAYA 2O4GA 1T7PA 1LWFA 1UA0A 5BN9A 1NM1A 3O4WA 3DAWA 3RVCA 3NHGA 1XC3A 1TKXA 1D5AA 3O9TA 1Q9YA 3L2VA 3VA3A 4JKGB 2AJQA 4C8NA 1NMNA 2D5RA 2BDPA 1ZBSA 2GWKA 4CCHA 4WQ4C 4DV0K 3DXKB 3U9DA 1YJNN 1VQPN 3WEEA 3VQBA 3QERA 4KTZA 2P9IA 3M8RA 5HRSA 5J1EA 3IDHA 4Y0WA 2E6LA 1BL3A 4FJJA 5AZIB 2KFNA 2D1KA 1JLQA 3AVMA 4XH5A 2W6LA 5AFUA 3TSQA 4IBNA 3A5OC 4OPKA 1CZAN 1YTAA 1RT7A 1FK9A 3M5RA 4K42A 1GLDG 4CFDA 4JLHA 2ZJQL 5AQWA 4E7JA 3ID8A 4M3UA 4H5TA 1T44A 4CFCA 3CFPA 5C2DA 1VRTA 4B1XB 4BR5A 1CZBA 2FBYA 3CD6N 5SZTA 3SAHA 4YOWA 4C23A 3PUFA 3VQDA 4WFAL 3D2EA 1VSFA 1VQ9N 4E1JA 4JYAK 1E4GT 4W5OA 1N36K 4DTMA 2HNDA 4KH4A 3TARA 4BR2A 1JXBA 4FL9A 3T1AA 4K8ZA 3OYKA 4E7HA 3F9MA 3MCPA 3FFKB 4JKCA 4N47A 5GAGP 4CZMA 1IKWA 1YJ9N 2ITMA 4DQPA 2OPQA 4OGCA 4JI0K 3SV4A 2ZF5O 5E26A 1KRPA 3OYHA 3AVBA 3RR7A 4K8XA 2E4LA 5F0XA 1LAWA 4CK1A 3LP3A 1TKZA 3PV8A 4C8MA 3HM8A 1BQNA 3NBPA 4FLWA 2PY5A 2QWOA 3OYCA 4I2QA 3C6AA 3FZMA 3LL3A 1ZXOA 3O3FA 4DV6K 2QA4N 4NYNA 4KB0A 4KHSA 3VF4A 2Q0RA 4M45A 5M1QA 3ULDA 4KB1A 3BF3A 3GL1A 1NGCA 1TAQA 4CVNE 4JKFA 2G8IA 4FWRA 1IKXA 3V9WA 4YDUC 5LL6Z 3O9SA 3MEEA 1X9MA 3ISNC 4DR7K 1IG8A 3LZJA 4CGJA 3C6HA 1HQEA 4JD2A 4C8KA 1BUPA 1LW2A 3VPZA 4H0VB 1HX1A 4CJQA 1IV0A 4PKIA
chains in the Genus database with same CATH topology
4CGHA 1CZ9A 1HNVA 5C42A 3I8DA 2B5JA 4UQGA 4W5NA 2OPPA 2RPIA 1RBTA 1SV5A 4JS5A 5HRNA 4L8RB 3SPZA 4FLVA 1ZBLA 3KD5E 3V9UA 2D0AA 1KVCA 4CGGA 3P5JA 1XHZA 4B9TA 3RMBA 4M3WA 5HBMA 1BI4A 3DOLA 3O3GA 1C1BA 4ZTFA 4E7KA 3L2WA 4O0IA 1BIZA 1JKHA 4W5RA 1YVUA 1VSHA 3JSMA 4AILC 4DU1A 4CFAA 2XHBA 3NDKA 3AA5X 4FM0A 4BE0A 1TK5A 2F96A 3VQ8A 1NKBA 2PYLA 2WOMA 3HPGA 2YNHA 1ZBHA 5CY4A 1XI1A 3B6PA 1WSHA 2FBVA 2KQ2A 3ZSVA 1KLNA 4NCAA 3HSTB 1WSGA 1TK0A 1IG9A 1L3SA 5J2NA 4OLAA 4I9LA 4CHYA 3QEWA 3SV3A 3MECA 4FLYA 1RTDA 5CZ2A 3DLHA 1RDBA 2G8VA 4RW9A 2IDOA 3SPYA 1GOBA 2RN2A 1K6YA 2YNFA 4CEBA 3LZIA 1U4BA 3O3HA 2P5GA 4OKKA 3HXMA 4NCGA 3OS0A 4FJGA 4CHZA 3L3VA 3OJUA 3ZT2A 3C6TA 1U04A 1TVRA 3TAGA 4KI4A 4HTUA 1IO2A 2RKIA 1HNIA 3AVNA 4E3SA 3LAKA 3DLGA 3AA3A 4OKJA 3LALA 1SKWA 4JRQA 2EHGA 4F2RA 2HHXA 5DMRA 4LY7A 1ZBUA 1S6QA 4DSLA 4Y1DA 4IG0A 3AVIA 2VG5A 2HVIA 5JS2A 3SQ2A 4YFUA 3WNHA 5E41A 1U45A 1C0TA 3OYAA 1RTIA 5FDLA 3VQEA 4FM1A 4BDZA 1X9WA 3D45A 4FVMA 4FYDA 5J2QA 5J2MA 2IC3A 3THVA 4I9QA 2HNZA 4FCYA 2G8WA 3IS9A 4OLBA 4B9VA 4FJ9A 3LP2A 2YNGA 4CJ5A 3TI0A 1EP4A 1S9EA 3SUOA 3RR8A 2ETJA 4DS4A 2KTQA 3KLIA 4DLEA 2E6MA 3CYMA 1QSYA 4NCBA 4CJWA 1C1AA 2Z1IA 5FRNA 2HHWA 4CJEA 2YHAA 3G10A 4HUGA 2HVHA 1J9AA 3QIPA 4F3OA 4PUOA 1TAUA 4DFKA 4N56A 3AVCA 3AO5A 3U3GA 2B4JA 3V6DA 3PO4A 4PQUA 3RRHA 2HHVA 3NGIA 2JGUA 1B92A 1RTHA 3DLEA 1SL2A 4DTNA 4OVLA 2DTUA 5CYQA 3K5MA 2XY6A 1A5VA 1Q8IA 2RF2A 4QAGA 2XY5A 2G8HA 1VSIA 1ZYQA 5CZ1A 5K14A 1RT3A 4ID5A 4CJRA 3TAMA 3LAMA 3QEXA 1YT3A 3RMDA 1U47A 4RG8A 2LSNA 4ZHRA 3AVJA 3C95A 4R5PA 1NK0A 4O44A 4B9NA 3HK2A 3K5LA 1ASUA 3KTQA 4O0JA 4AHRA 3AO1A 4CHOA 4CF1A 3QIOA 1HQUA 5I3UA 4AHSA 2BGGA 1JL2A 3V1QA 3LP0A 4IDKA 1KFSA 3VN5A 3SYZA 2ATQA 1CXQA 1T05A 4Z0UA 3AVKA 3NGZA 3F9KA 2FBXA 1LAVA 3OYLA 4KI6A 4FW1A 3L8BA 3KKRA 2Z1GA 1WLJA 3O4NA 1W9HA 5KRTA 4IG3A 3MXIA 2HB5A 1RT6A 1ZBIA 3L3UA 1QS4A 1QSSA 2ZE2A 3TWHA 4Q5VA 1BISA 1VK0A 3AA2A 4CEFA 4Z4HA 4DSEA 4TSXA 2G8UA 2QKKA 5KGWA 4CJPA 2F8TA 1S1TA 3AVAA 5KI6A 4FM2A 2Y1IA 1TK8A 1RCHA 3SUQA 1SKRA 2Z1JA 3ZT0A 4AHCA 1CLQA 1KVBA 3LPTA 4EP4A 3NH0A 3KK2A 4ELUA 3HVRA 4DTOA 1L5UA 4CEZA 4KHYA 2HW3A 4CEQA 1IH7A 2B6AA 4ICLA 2FC0A 3VQ6A 3EYZA 4FZYA 3TAQA 4DFPA 4CEEA 3V4IA 2ITGA 4Z4CA 1DLOA 3ZSWA 1TV6A 3CM5A 4KHUA 3ZSRA 1S1VA 1HMVA 4FW2A 2KZMA 1X1PA 1J54A 3V9ZA 1BI4B 1CXUA 4BE1A 2QKBA 4F3TA 1UA1A 2OYQA 1C0MA 1IKVA 1RDCA 3TAFA 3T19A 5EU7A 2ZD1A 4FJ7A 5HRPA 1LWEA 1MU2A 4CJVA 4CF8A 3M8PA 3NH1A 1REVA 3KLHA 3QESA 2PYJA 4CESA 4QOZB 1GOAA 4EZ6A 4E7IA 1NK8A 4JS4A 3T3FA 4DQSA 3KKSA 4ZTJA 3OJSA 3DYAA 3KLGA 4DTSA 3HM9A 2OZSA 4DSJA 4DQQA 1J53A 3NF6A 3OYIA 4FLTA 3OYGA 2HHQA 1XC9A 3HP6A 1D9FA 4CFBA 1RBVA 2OPRA 1L3VA 2DFEA 1S1XA 1JL1A 3LWMA 3HJFA 3OYDA 1RT2A 3HO1A 2XY7A 4C8OA 3K5NA 1X9SA 1I39A 4KPYA 4XIUA 2F8SA 1ASVA 4PA1A 4Z4GA 3EY1A 4RW8A 4J2BA 4CJKA 3V1RA 5KGXA 1NOZA 2KZZA 4C8LA 1WAJA 3O4QA 3CFRA 1BCMA 5FROA 5HROA 2P51A 4HCCA 2YNIA 3P83D 4B9MA 4FZZA 1WNSA 3HPHA 2GV9A 4NYFA 4FK4A 4GMJB 4W5TA 3V9SA 1HYSA 3D0PA 3ASMA 3VQQA 3PX6A 1VSMA 1J5OA 3IAYA 3SNNA 1UOCA 4LD0A 1R0AA 1EXQA 4KREA 3HYFA 1NKEA 4RW6A 1KSPA 3DLBA 1FXXA 4DSIA 4E1MA 3DMJA 1VSKA 4B3OA 4EP5A 1A5WA 4FLXA 2VWJA 3DLRA 4CJUA 4CJFA 3AVFA 5HLFA 4CK2A 3C6UA 2X6SA 4BWMA 4DTJA 3DI6A 3QO9A 3U3YA 1T03A 3RWUA 4PWDA 5JS1A 3K5OA 4B8AB 2W42A 3QEVA 3CG7A 3QETA 3RMAA 3RRGA 3L2QA 4DQIA 3G0ZA 4M3YA 4H4OA 1XWLA 3SI6A 3LWLA 3MXMA 4CEOA 3TAEA 1HRHA 1TKDA 4E0DA 3QNNA 3OYFA 1DTQA 2P1JA 3TABA 4M3RA 3AV9A 3CM6A 4DQRA 1SUQA 1TKTA 3DM2A 4DLGA 2X6NA 3MEDA 3KLFA 1L3TA 4BDYA 1KTQA 4FLZA 5I42A 1XHXA 4FZXC 3ZSOA 3M8QA 5C24A 3DRSA 5CYMA 3L2UA 4N41A 4O4GA 3MEGA 4CEAA 4B08A 1NJZA 1RNHA 4F2SA 1NK4A 3S3OA 3NAEA 1BQMA 2JLEA 4KHNA 3WNGA 3ZT3A 4ELTA 4ELVA 4F8RA 1QQCA 4B8CA 2D0BA 3QEIA 2OA8A 4FXDA 1WSFA 4CECA 4CHNA 3K59A 1Q9XA 2HMIA 2X74A 2R7YA 2VWKA 4FJKA 4FJ8A 3E01A 4FLUA 3V81A 1UAXA 5DK5A 1JLAA 2DY4A 4KFBA 3NE6A 4B9LA 1VSEA 3VQAA 4PY5A 4FJHA 3IRXA 2X78A 3BGRA 4RW7A 3KK3A 3MAQA 4BACA 4DTRA 3S3NA 1NJXA 2HHTA 4CJTA 5J2PA 1C0UA 1JLEA 1C6VA 4HHTA 3SJJA 1HYZA 1RBSA 3DRRA 4CIFA 3SUPA 1RDDA 1RT5A 1SL1A 4O55A 1W0HA 2A1SA 3PO5A 3ZSYA 1BHLA 2O4IA 1U48A 1Y97A 4IKFA 2BE2A 1SKSA 4W5QA 1C1CA 4KHWA 3OYMA 3TANA 3V1OA 5KTQA 4GVMA 3PX0A 4I2PA 3AA4A 1TL1A 5C25A 4YNQA 4H4MA 1NK6A 4B9UA 3F73A 3VQ4A 1RT4A 1VSDA 3LP1A 3IG1A 1QTMA 2KFZA 1HYVA 3CQ8A 3HVTA 3OS2A 3BDPA 4FJLA 3NGYA 4MFBA 4M3XA 4Z4FA 3LDSA 4FJXA 3ZCMA 4J2AA 3HL8A 1LW0A 4FJMA 1WAFA 4AHTA 2Y1JA 1UWBA 1Z25A 1Z26A 1RTJA 3CFOA 1RBUA 4FK2A 4HUFA 4BDPA 2OZMA 2IAJA 3ZSZA 4CHQA 4J2DA 4DG1A 3U6FA 1T8EA 4FJNA 4M3TA 2HHUA 3ALYA 3NF7A 1VSJA 2XY8A 1HPZA 1G15A 3TR8A 1LV5A 1D9DA 4QCLA 2Z1HA 4DMNA 4E89A 2O4GA 2XRIA 1NOYA 1LWFA 1S9GA 1UA0A 1QHTA 3C94A 4DTUA 2GUIA 1T7PA 3ZT4A 1EX4A 1NJYA 4IFYA 4Z4EA 3NHGA 3LPUA 1TKXA 1D5AA 1Q9YA 1NK7A 3L2VA 3ZT1A 2DFHA 3VA3A 2AJQA 1BCOA 2YKNA 4C8NA 4AH9A 4DTXA 2A1RA 3VQ5A 4E7LA 4JRPA 4KAZA 4KTWA 1BIUA 2KW4A 3AVGA 3AVLA 5D3GA 2EX3A 5FRMA 3VQ7A 2QXFA 1WSJA 2Q3SA 2D5RA 4DFMA 3HP9A 3SQ0A 1D8YA 2BDPA 4CCHA 3OYJA 4DSKA 4KKOA 1KVAA 4CF0A 5HP1A 4CGIA 1JLCA 3QNOA 1LWCA 1TGOA 1S1WA 1DTTA 4N5SA 4CE9A 4N76A 1S6PA 3DLKA 3I0RA 4I7FA 4OGEA 2HNYA 2HHSA 4E19A 4DTPA 4KV8A 3KIOA 3QLHA 4DFJA 3WNEA 3VQBA 3QERA 4KTZA 4B9SA 4RW4A 2PZSA 4F4KA 2IGIA 2BANA 3M8RA 5HRSA 2I5JA 3KJVA 3ZSQA 4DF4A 3P1GA 5J1EA 3B6OA 3MXJA 4LH5A 3S9HA 1EKEA 1F21A 2DFFA 3OY9A 1NK9A 4CGFA 1KCFA 2E6LA 4MQ3A 4LH4A 1BL3A 4FJJA 1A5XA 1KLMA 1WSEA 3HT3A 1ZBFA 1SL0A 3K2PA 1NJWA 4CIGA 2KFNA 3AVMA 1JLQA 3OYBA 4G1QA 4DWIA 4DS5A 2G8KA 4OPKA 4IBNA 4CK3A 5T7BA 1YTAA 1RT7A 3ZSXA 1FK9A 3AO2A 2G8FA 4CFDA 4JLHA 3OYNA 4E7JA 4LSNA 4FK0A 4CHPA 4M3UA 1RBRA 3NCIA 1WN7A 4CIEA 2YV0X 3AO4A 4CFCA 4H8KA 1ASWA 2YKMA 3QINA 3UIQA 3CFPA 3NF9A 1JLGA 4AHUA 4M42A 1VRTA 3KD1E 2ZQBA 1CZBA 2FBYA 3VQ9A 1RT1A 5SZTA 3K58A 5SWMA 3DOKA 3PUFA 3VQDA 3TAPA 4WE1A 3VQCA 1VSFA 1IKYA 4CEDA 3EZ5A 1JXEA 2YHBA 4KRFA 3K57A 1EETA 4HVJA 1YTUA 1RILA 3A2FA 3AO3A 4E1NA 4W5OA 3ITHA 3V9XA 4DTMA 4EZ9A 2HNDA 3OVNA 3TARA 4CJSA 3S3MA 1NKCA 2IS3A 2D0CA 2VG6A 4Z4IA 1B9FA 4FJ5A 3FFIA 3H08A 1JXBA 4DSFA 3T1AA 4K8ZA 3OYKA 4E7HA 2FBTA 1GOCA 4BWJA 4N47A 3VQPA 4CJ3A 1VSLA 5KRSA 1IKWA 4CF9A 3SUNA 4DQPA 1U49A 3SQ4A 4HCBA 2OPQA 4OGCA 3OS1A 3SV4A 2NUBA 3SCXA 4DU4A 3SQ1A 1ITGA 1KRPA 3KLEA 3OYHA 3AVBA 3RR7A 4KO0A 4K8XA 1HJRA 2E4LA 1FKPA 3HPOA 4HUEA 4AHVA 1LAWA 4CK1A 3LP3A 4CGDA 1TKZA 3PV8A 4KTQA 4IFVA 4C8MA 4KHQA 1BQNA 1I3AA 3NBPA 1KFDA 4J2EA 4BE2A 4FLWA 2PY5A 4DF8A 3JYTA 3OYCA 4OKEA 1RDAA 1WSIA 3NFAA 4I2QA 2P5OA 4Q0BA 1TL3A 1NK5A 1JLBA 2WONA 4OJRA 4LSLA 4O5BA 1N5YA 3PX4A 3O3FA 3OYEA 1N6QA 4M41A 3WNFA 4NYNA 4ID1A 2IOCA 1B9DA 1QSLA 4KB0A 2QK9A 2XO7A 4KHSA 1QE1A 4Y1CA 1BGXT 4M45A 2OPSA 3ULDA 3QEPA 4KB1A 4FJIA 4CERA 4CJ4A 3AVHA 3VA0A 3I0SA 1TAQA 4CF2A 1FKOA 3LANA 3M8SA 2G8IA 3KK1A 1IKXA 4GW6A 3V9WA 3DRPA 3PY8A 5HRRA 3NF8A 3MEEA 1X9MA 1S1UA 1S5JA 1VRUA 2VG7A 3ISNC 3LZJA 4CGJA 1HQEA 3SZ2A 4C8KA 3L2RA 2GBZA 1LW2A 3RMCA 4OPJA 1JLFA 1O1WA 3NH2A 1L3UA 4DU3A 4CJQA 4M3ZA 3RTVA 4CJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGH A;  1CZ9 A;  1HNV A;  5C42 A;  3I8D A;  2B5J A;  4UQG A;  4W5N A;  2OPP A;  2RPI A;  1RBT A;  1SV5 A;  4JS5 A;  5HRN A;  4L8R B;  3SPZ A;  4FLV A;  1ZBL A;  3KD5 E;  3V9U A;  2D0A A;  1KVC A;  4CGG A;  3P5J A;  1XHZ A;  4B9T A;  3RMB A;  4M3W A;  5HBM A;  1BI4 A;  3DOL A;  3O3G A;  1C1B A;  4ZTF A;  4E7K A;  3L2W A;  4O0I A;  1BIZ A;  1JKH A;  4W5R A;  1YVU A;  1VSH A;  3JSM A;  4AIL C;  4DU1 A;  4CFA A;  2XHB A;  3NDK A;  3AA5 X;  4FM0 A;  4BE0 A;  1TK5 A;  2F96 A;  3VQ8 A;  1NKB A;  2PYL A;  2WOM A;  3HPG A;  2YNH A;  1ZBH A;  5CY4 A;  1XI1 A;  3B6P A;  1WSH A;  2FBV A;  2KQ2 A;  3ZSV A;  1KLN A;  4NCA A;  3HST B;  1WSG A;  1TK0 A;  1IG9 A;  1L3S A;  5J2N A;  4OLA A;  4I9L A;  4CHY A;  3QEW A;  3SV3 A;  3MEC A;  4FLY A;  1RTD A;  5CZ2 A;  3DLH A;  1RDB A;  2G8V A;  4RW9 A;  2IDO A;  3SPY A;  1GOB A;  2RN2 A;  1K6Y A;  2YNF A;  4CEB A;  3LZI A;  1U4B A;  3O3H A;  2P5G A;  4OKK A;  3HXM A;  4NCG A;  3OS0 A;  4FJG A;  4CHZ A;  3L3V A;  3OJU A;  3ZT2 A;  3C6T A;  1U04 A;  1TVR A;  3TAG A;  4KI4 A;  4HTU A;  1IO2 A;  2RKI A;  1HNI A;  3AVN A;  4E3S A;  3LAK A;  3DLG A;  3AA3 A;  4OKJ A;  3LAL A;  1SKW A;  4JRQ A;  2EHG A;  4F2R A;  2HHX A;  5DMR A;  4LY7 A;  1ZBU A;  1S6Q A;  4DSL A;  4Y1D A;  4IG0 A;  3AVI A;  2VG5 A;  2HVI A;  5JS2 A;  3SQ2 A;  4YFU A;  3WNH A;  5E41 A;  1U45 A;  1C0T A;  3OYA A;  1RTI A;  5FDL A;  3VQE A;  4FM1 A;  4BDZ A;  1X9W A;  3D45 A;  4FVM A;  4FYD A;  5J2Q A;  5J2M A;  2IC3 A;  3THV A;  4I9Q A;  2HNZ A;  4FCY A;  2G8W A;  3IS9 A;  4OLB A;  4B9V A;  4FJ9 A;  3LP2 A;  2YNG A;  4CJ5 A;  3TI0 A;  1EP4 A;  1S9E A;  3SUO A;  3RR8 A;  2ETJ A;  4DS4 A;  2KTQ A;  3KLI A;  4DLE A;  2E6M A;  3CYM A;  1QSY A;  4NCB A;  4CJW A;  1C1A A;  2Z1I A;  5FRN A;  2HHW A;  4CJE A;  2YHA A;  3G10 A;  4HUG A;  2HVH A;  1J9A A;  3QIP A;  4F3O A;  4PUO A;  1TAU A;  4DFK A;  4N56 A;  3AVC A;  3AO5 A;  3U3G A;  2B4J A;  3V6D A;  3PO4 A;  4PQU A;  3RRH A;  2HHV A;  3NGI A;  2JGU A;  1B92 A;  1RTH A;  3DLE A;  1SL2 A;  4DTN A;  4OVL A;  2DTU A;  5CYQ A;  3K5M A;  2XY6 A;  1A5V A;  1Q8I A;  2RF2 A;  4QAG A;  2XY5 A;  2G8H A;  1VSI A;  1ZYQ A;  5CZ1 A;  5K14 A;  1RT3 A;  4ID5 A;  4CJR A;  3TAM A;  3LAM A;  3QEX A;  1YT3 A;  3RMD A;  1U47 A;  4RG8 A;  2LSN A;  4ZHR A;  3AVJ A;  3C95 A;  4R5P A;  1NK0 A;  4O44 A;  4B9N A;  3HK2 A;  3K5L A;  1ASU A;  3KTQ A;  4O0J A;  4AHR A;  3AO1 A;  4CHO A;  4CF1 A;  3QIO A;  1HQU A;  5I3U A;  4AHS A;  2BGG A;  1JL2 A;  3V1Q A;  3LP0 A;  4IDK A;  1KFS A;  3VN5 A;  3SYZ A;  2ATQ A;  1CXQ A;  1T05 A;  4Z0U A;  3AVK A;  3NGZ A;  3F9K A;  2FBX A;  1LAV A;  3OYL A;  4KI6 A;  4FW1 A;  3L8B A;  3KKR A;  2Z1G A;  1WLJ A;  3O4N A;  1W9H A;  5KRT A;  4IG3 A;  3MXI A;  2HB5 A;  1RT6 A;  1ZBI A;  3L3U A;  1QS4 A;  1QSS A;  2ZE2 A;  3TWH A;  4Q5V A;  1BIS A;  1VK0 A;  3AA2 A;  4CEF A;  4Z4H A;  4DSE A;  4TSX A;  2G8U A;  2QKK A;  5KGW A;  4CJP A;  2F8T A;  1S1T A;  3AVA A;  5KI6 A;  4FM2 A;  2Y1I A;  1TK8 A;  1RCH A;  3SUQ A;  1SKR A;  2Z1J A;  3ZT0 A;  4AHC A;  1CLQ A;  1KVB A;  3LPT A;  4EP4 A;  3NH0 A;  3KK2 A;  4ELU A;  3HVR A;  4DTO A;  1L5U A;  4CEZ A;  4KHY A;  2HW3 A;  4CEQ A;  1IH7 A;  2B6A A;  4ICL A;  2FC0 A;  3VQ6 A;  3EYZ A;  4FZY A;  3TAQ A;  4DFP A;  4CEE A;  3V4I A;  2ITG A;  4Z4C A;  1DLO A;  3ZSW A;  1TV6 A;  3CM5 A;  4KHU A;  3ZSR A;  1S1V A;  1HMV A;  4FW2 A;  2KZM A;  1X1P A;  1J54 A;  3V9Z A;  1BI4 B;  1CXU A;  4BE1 A;  2QKB A;  4F3T A;  1UA1 A;  2OYQ A;  1C0M A;  1IKV A;  1RDC A;  3TAF A;  3T19 A;  5EU7 A;  2ZD1 A;  4FJ7 A;  5HRP A;  1LWE A;  1MU2 A;  4CJV A;  4CF8 A;  3M8P A;  3NH1 A;  1REV A;  3KLH A;  3QES A;  2PYJ A;  4CES A;  4QOZ B;  1GOA A;  4EZ6 A;  4E7I A;  1NK8 A;  4JS4 A;  3T3F A;  4DQS A;  3KKS A;  4ZTJ A;  3OJS A;  3DYA A;  3KLG A;  4DTS A;  3HM9 A;  2OZS A;  4DSJ A;  4DQQ A;  1J53 A;  3NF6 A;  3OYI A;  4FLT A;  3OYG A;  2HHQ A;  1XC9 A;  3HP6 A;  1D9F A;  4CFB A;  1RBV A;  2OPR A;  1L3V A;  2DFE A;  1S1X A;  1JL1 A;  3LWM A;  3HJF A;  3OYD A;  1RT2 A;  3HO1 A;  2XY7 A;  4C8O A;  3K5N A;  1X9S A;  1I39 A;  4KPY A;  4XIU A;  2F8S A;  1ASV A;  4PA1 A;  4Z4G A;  3EY1 A;  4RW8 A;  4J2B A;  4CJK A;  3V1R A;  5KGX A;  1NOZ A;  2KZZ A;  4C8L A;  1WAJ A;  3O4Q A;  3CFR A;  1BCM A;  5FRO A;  5HRO A;  2P51 A;  4HCC A;  2YNI A;  3P83 D;  4B9M A;  4FZZ A;  1WNS A;  3HPH A;  2GV9 A;  4NYF A;  4FK4 A;  4GMJ B;  4W5T A;  3V9S A;  1HYS A;  3D0P A;  3ASM A;  3VQQ A;  3PX6 A;  1VSM A;  1J5O A;  3IAY A;  3SNN A;  1UOC A;  4LD0 A;  1R0A A;  1EXQ A;  4KRE A;  3HYF A;  1NKE A;  4RW6 A;  1KSP A;  3DLB A;  1FXX A;  4DSI A;  4E1M A;  3DMJ A;  1VSK A;  4B3O A;  4EP5 A;  1A5W A;  4FLX A;  2VWJ A;  3DLR A;  4CJU A;  4CJF A;  3AVF A;  5HLF A;  4CK2 A;  3C6U A;  2X6S A;  4BWM A;  4DTJ A;  3DI6 A;  3QO9 A;  3U3Y A;  1T03 A;  3RWU A;  4PWD A;  5JS1 A;  3K5O A;  4B8A B;  2W42 A;  3QEV A;  3CG7 A;  3QET A;  3RMA A;  3RRG A;  3L2Q A;  4DQI A;  3G0Z A;  4M3Y A;  4H4O A;  1XWL A;  3SI6 A;  3LWL A;  3MXM A;  4CEO A;  3TAE A;  1HRH A;  1TKD A;  4E0D A;  3QNN A;  3OYF A;  1DTQ A;  2P1J A;  3TAB A;  4M3R A;  3AV9 A;  3CM6 A;  4DQR A;  1SUQ A;  1TKT A;  3DM2 A;  4DLG A;  2X6N A;  3MED A;  3KLF A;  1L3T A;  4BDY A;  1KTQ A;  4FLZ A;  5I42 A;  1XHX A;  4FZX C;  3ZSO A;  3M8Q A;  5C24 A;  3DRS A;  5CYM A;  3L2U A;  4N41 A;  4O4G A;  3MEG A;  4CEA A;  4B08 A;  1NJZ A;  1RNH A;  4F2S A;  1NK4 A;  3S3O A;  3NAE A;  1BQM A;  2JLE A;  4KHN A;  3WNG A;  3ZT3 A;  4ELT A;  4ELV A;  4F8R A;  1QQC A;  4B8C A;  2D0B A;  3QEI A;  2OA8 A;  4FXD A;  1WSF A;  4CEC A;  4CHN A;  3K59 A;  1Q9X A;  2HMI A;  2X74 A;  2R7Y A;  2VWK A;  4FJK A;  4FJ8 A;  3E01 A;  4FLU A;  3V81 A;  1UAX A;  5DK5 A;  1JLA A;  2DY4 A;  4KFB A;  3NE6 A;  4B9L A;  1VSE A;  3VQA A;  4PY5 A;  4FJH A;  3IRX A;  2X78 A;  3BGR A;  4RW7 A;  3KK3 A;  3MAQ A;  4BAC A;  4DTR A;  3S3N A;  1NJX A;  2HHT A;  4CJT A;  5J2P A;  1C0U A;  1JLE A;  1C6V A;  4HHT A;  3SJJ A;  1HYZ A;  1RBS A;  3DRR A;  4CIF A;  3SUP A;  1RDD A;  1RT5 A;  1SL1 A;  4O55 A;  1W0H A;  2A1S A;  3PO5 A;  3ZSY A;  1BHL A;  2O4I A;  1U48 A;  1Y97 A;  4IKF A;  2BE2 A;  1SKS A;  4W5Q A;  1C1C A;  4KHW A;  3OYM A;  3TAN A;  3V1O A;  5KTQ A;  4GVM A;  3PX0 A;  4I2P A;  3AA4 A;  1TL1 A;  5C25 A;  4YNQ A;  4H4M A;  1NK6 A;  4B9U A;  3F73 A;  3VQ4 A;  1RT4 A;  1VSD A;  3LP1 A;  3IG1 A;  1QTM A;  2KFZ A;  1HYV A;  3CQ8 A;  3HVT A;  3OS2 A;  3BDP A;  4FJL A;  3NGY A;  4MFB A;  4M3X A;  4Z4F A;  3LDS A;  4FJX A;  3ZCM A;  4J2A A;  3HL8 A;  1LW0 A;  4FJM A;  1WAF A;  4AHT A;  2Y1J A;  1UWB A;  1Z25 A;  1Z26 A;  1RTJ A;  3CFO A;  1RBU A;  4FK2 A;  4HUF A;  4BDP A;  2OZM A;  2IAJ A;  3ZSZ A;  4CHQ A;  4J2D A;  4DG1 A;  3U6F A;  1T8E A;  4FJN A;  4M3T A;  2HHU A;  3ALY A;  3NF7 A;  1VSJ A;  2XY8 A;  1HPZ A;  1G15 A;  3TR8 A;  1LV5 A;  1D9D A;  4QCL A;  2Z1H A;  4DMN A;  4E89 A;  2O4G A;  2XRI A;  1NOY A;  1LWF A;  1S9G A;  1UA0 A;  1QHT A;  3C94 A;  4DTU A;  2GUI A;  1T7P A;  3ZT4 A;  1EX4 A;  1NJY A;  4IFY A;  4Z4E A;  3NHG A;  3LPU A;  1TKX A;  1D5A A;  1Q9Y A;  1NK7 A;  3L2V A;  3ZT1 A;  2DFH A;  3VA3 A;  2AJQ A;  1BCO A;  2YKN A;  4C8N A;  4AH9 A;  4DTX A;  2A1R A;  3VQ5 A;  4E7L A;  4JRP A;  4KAZ A;  4KTW A;  1BIU A;  2KW4 A;  3AVG A;  3AVL A;  5D3G A;  2EX3 A;  5FRM A;  3VQ7 A;  2QXF A;  1WSJ A;  2Q3S A;  2D5R A;  4DFM A;  3HP9 A;  3SQ0 A;  1D8Y A;  2BDP A;  4CCH A;  3OYJ A;  4DSK A;  4KKO A;  1KVA A;  4CF0 A;  5HP1 A;  4CGI A;  1JLC A;  3QNO A;  1LWC A;  1TGO A;  1S1W A;  1DTT A;  4N5S A;  4CE9 A;  4N76 A;  1S6P A;  3DLK A;  3I0R A;  4I7F A;  4OGE A;  2HNY A;  2HHS A;  4E19 A;  4DTP A;  4KV8 A;  3KIO A;  3QLH A;  4DFJ A;  3WNE A;  3VQB A;  3QER A;  4KTZ A;  4B9S A;  4RW4 A;  2PZS A;  4F4K A;  2IGI A;  2BAN A;  3M8R A;  5HRS A;  2I5J A;  3KJV A;  3ZSQ A;  4DF4 A;  3P1G A;  5J1E A;  3B6O A;  3MXJ A;  4LH5 A;  3S9H A;  1EKE A;  1F21 A;  2DFF A;  3OY9 A;  1NK9 A;  4CGF A;  1KCF A;  2E6L A;  4MQ3 A;  4LH4 A;  1BL3 A;  4FJJ A;  1A5X A;  1KLM A;  1WSE A;  3HT3 A;  1ZBF A;  1SL0 A;  3K2P A;  1NJW A;  4CIG A;  2KFN A;  3AVM A;  1JLQ A;  3OYB A;  4G1Q A;  4DWI A;  4DS5 A;  2G8K A;  4OPK A;  4IBN A;  4CK3 A;  5T7B A;  1YTA A;  1RT7 A;  3ZSX A;  1FK9 A;  3AO2 A;  2G8F A;  4CFD A;  4JLH A;  3OYN A;  4E7J A;  4LSN A;  4FK0 A;  4CHP A;  4M3U A;  1RBR A;  3NCI A;  1WN7 A;  4CIE A;  2YV0 X;  3AO4 A;  4CFC A;  4H8K A;  1ASW A;  2YKM A;  3QIN A;  3UIQ A;  3CFP A;  3NF9 A;  1JLG A;  4AHU A;  4M42 A;  1VRT A;  3KD1 E;  2ZQB A;  1CZB A;  2FBY A;  3VQ9 A;  1RT1 A;  5SZT A;  3K58 A;  5SWM A;  3DOK A;  3PUF A;  3VQD A;  3TAP A;  4WE1 A;  3VQC A;  1VSF A;  1IKY A;  4CED A;  3EZ5 A;  1JXE A;  2YHB A;  4KRF A;  3K57 A;  1EET A;  4HVJ A;  1YTU A;  1RIL A;  3A2F A;  3AO3 A;  4E1N A;  4W5O A;  3ITH A;  3V9X A;  4DTM A;  4EZ9 A;  2HND A;  3OVN A;  3TAR A;  4CJS A;  3S3M A;  1NKC A;  2IS3 A;  2D0C A;  2VG6 A;  4Z4I A;  1B9F A;  4FJ5 A;  3FFI A;  3H08 A;  1JXB A;  4DSF A;  3T1A A;  4K8Z A;  3OYK A;  4E7H A;  2FBT A;  1GOC A;  4BWJ A;  4N47 A;  3VQP A;  4CJ3 A;  1VSL A;  5KRS A;  1IKW A;  4CF9 A;  3SUN A;  4DQP A;  1U49 A;  3SQ4 A;  4HCB A;  2OPQ A;  4OGC A;  3OS1 A;  3SV4 A;  2NUB A;  3SCX A;  4DU4 A;  3SQ1 A;  1ITG A;  1KRP A;  3KLE A;  3OYH A;  3AVB A;  3RR7 A;  4KO0 A;  4K8X A;  1HJR A;  2E4L A;  1FKP A;  3HPO A;  4HUE A;  4AHV A;  1LAW A;  4CK1 A;  3LP3 A;  4CGD A;  1TKZ A;  3PV8 A;  4KTQ A;  4IFV A;  4C8M A;  4KHQ A;  1BQN A;  1I3A A;  3NBP A;  1KFD A;  4J2E A;  4BE2 A;  4FLW A;  2PY5 A;  4DF8 A;  3JYT A;  3OYC A;  4OKE A;  1RDA A;  1WSI A;  3NFA A;  4I2Q A;  2P5O A;  4Q0B A;  1TL3 A;  1NK5 A;  1JLB A;  2WON A;  4OJR A;  4LSL A;  4O5B A;  1N5Y A;  3PX4 A;  3O3F A;  3OYE A;  1N6Q A;  4M41 A;  3WNF A;  4NYN A;  4ID1 A;  2IOC A;  1B9D A;  1QSL A;  4KB0 A;  2QK9 A;  2XO7 A;  4KHS A;  1QE1 A;  4Y1C A;  1BGX T;  4M45 A;  2OPS A;  3ULD A;  3QEP A;  4KB1 A;  4FJI A;  4CER A;  4CJ4 A;  3AVH A;  3VA0 A;  3I0S A;  1TAQ A;  4CF2 A;  1FKO A;  3LAN A;  3M8S A;  2G8I A;  3KK1 A;  1IKX A;  4GW6 A;  3V9W A;  3DRP A;  3PY8 A;  5HRR A;  3NF8 A;  3MEE A;  1X9M A;  1S1U A;  1S5J A;  1VRU A;  2VG7 A;  3ISN C;  3LZJ A;  4CGJ A;  1HQE A;  3SZ2 A;  4C8K A;  3L2R A;  2GBZ A;  1LW2 A;  3RMC A;  4OPJ A;  1JLF A;  1O1W A;  3NH2 A;  1L3U A;  4DU3 A;  4CJQ A;  4M3Z A;  3RTV A;  4CJL A; 
#chains in the Genus database with same CATH topology
 1HNV A;  3VEW A;  2RPI A;  1SV5 A;  2ASO A;  4BRA A;  4YY3 K;  3V9U A;  1KVC A;  4B9T A;  3P5J A;  1OH7 A;  3ZX2 A;  3UKR B;  1BI4 A;  4E7K A;  3AGK A;  4AIL C;  5A2Q O;  5M1F A;  4IWV A;  3EL2 A;  4WQ5 A;  4FM0 A;  3A5M C;  3VQ8 A;  2FF3 B;  3HPG A;  3B6P A;  1WSH A;  2O8B B;  4BRP A;  1IG9 A;  4CHY A;  3HRG A;  3T69 A;  1RDB A;  1K8K B;  2IDO A;  5BRH A;  3SPY A;  1GOB A;  2RN2 A;  1K6Y A;  1NMD A;  1U4B A;  4HWI A;  4OKK A;  4NCG A;  2UU9 K;  4FJG A;  4BRQ A;  4JV5 K;  1DGK N;  3ZET B;  1U04 A;  1S22 A;  4HTU A;  3DLL L;  4CD3 A;  3AVN A;  4WQ5 C;  4JKE A;  3LAK A;  3DLG A;  3LAL A;  3TSP A;  5DMR A;  2H3G X;  1RFQ A;  4DSL A;  4Y1D A;  4IG0 A;  4NXM K;  4DQ8 A;  4AF1 A;  4YFU A;  1U45 A;  5E41 A;  1RTI A;  4CZF A;  4FYD A;  3D45 A;  4FVM A;  5J2Q A;  2WTU A;  2IC3 A;  4I9Q A;  1XMQ K;  4FCY A;  4BC5 A;  3IS9 A;  4A61 A;  3NVM A;  4IJN A;  4OLB A;  3LP2 A;  2YNG A;  4CJ5 A;  2O8D B;  3EO3 A;  1S9E A;  3TI0 A;  3RR8 A;  1ESV A;  3KLI A;  4RTF D;  1XNR K;  4DLE A;  3QFP A;  1C1A A;  2Z1I A;  5AQY A;  5AQP A;  4DFK A;  3AVC A;  2B4J A;  3V6D A;  4DR4 K;  3PSF A;  4DTN A;  1TUU A;  2RF2 A;  4G9Z A;  3CHW A;  4DKW A;  5CR4 A;  4DB3 A;  4R5P A;  3C95 A;  5MLC Q;  1VQM N;  3LDN A;  1NNE A;  3KTQ A;  1HQU A;  1JL2 A;  1TYQ B;  4IDK A;  4JKA A;  2IIR A;  1N32 K;  3O6W A;  3UKU A;  2YI1 A;  5BRF A;  3L8B A;  5KRT A;  1ZBI A;  1QS4 A;  1QSS A;  2W6K A;  4CBU A;  4DV1 K;  4TSX A;  5KGW A;  3VER A;  1S1T A;  1TK8 A;  1KAX A;  3WXK A;  1NJI O;  3EE8 A;  4BRD A;  3PLA A;  4EP4 A;  4ELU A;  3HVR A;  3I8B A;  1IH7 A;  3WQT A;  2B6A A;  4MLH A;  3VQ6 A;  4FZY A;  2GEL A;  3E9O A;  2QWM A;  4ISG A;  2ITG A;  2HBJ A;  4Z4C A;  4PKG A;  1DLO A;  3ZSW A;  3ATV A;  5C0Y A;  3ZSR A;  3IUC A;  1N34 K;  1NGI A;  4LF9 K;  4IOC L;  4EHT A;  4BE1 A;  3S41 A;  2O8D A;  4LF6 K;  4CF8 A;  1NGD A;  2OTJ N;  4CES A;  4JI6 K;  4ZTJ A;  4DTS A;  4WCE L;  3HM9 A;  4DQQ A;  3OYI A;  5IWA K;  1E4F T;  1JCG A;  3HTV A;  3BF1 A;  2XY7 A;  4C8O A;  1GLJ O;  4BGA A;  4KPY A;  3K0S A;  1IBL K;  4PA1 A;  4J2B A;  5GIN A;  4KH5 A;  1NOZ A;  5FRO A;  2ASM A;  2YJF A;  2P51 A;  4QS8 A;  4HCC A;  5FPE A;  1WBD A;  3UB5 A;  5AQG A;  1LCU A;  1WNS A;  4FK4 A;  2GV9 A;  3IKM A;  3K9K A;  3D0P A;  2P9S A;  3ASM A;  3DXM A;  4JKB A;  4YOY A;  3IAY A;  3SNN A;  1R0A A;  3OHR A;  4E1M A;  3DMJ A;  1VSK A;  3DXM B;  1A5W A;  1VQL N;  1KXP A;  4CJU A;  1EWR A;  3THX B;  4LFB K;  3AVF A;  4CK2 A;  4RWT A;  3RWU A;  4IJA A;  4DTJ A;  3H6E A;  3I56 N;  5JS1 A;  2ZGY A;  3QEV A;  3RMA A;  3L2Q A;  3G0Z A;  5AQF A;  3H46 O;  3TAE A;  5F2R A;  4M3R A;  3AV9 A;  4DQR A;  1TKT A;  2E88 A;  3DM2 A;  3KLF A;  3MWT A;  4BDY A;  2HF3 A;  2W40 A;  2DPN A;  5CYM A;  2V7Z A;  3J81 O;  4F2S A;  3NAE A;  2JLE A;  4ELV A;  4JAX A;  1QQC A;  3QEI A;  1WSF A;  4BRO A;  4EAH D;  2VWK A;  4FJK A;  1MWM A;  1YHQ N;  4PY5 A;  2UYT A;  3A0I X;  1HKB A;  3M3Z A;  3TPQ A;  4IKF A;  2X78 A;  4RW7 A;  4DTR A;  1NJX A;  2HHT A;  4CJT A;  1C0U A;  2E2O A;  4DR5 K;  1JLE A;  1C6V A;  5HL7 L;  3DRR A;  4GKK K;  3SUP A;  1RT5 A;  1W0H A;  3HOT A;  1S72 N;  1BHL A;  1T3V A;  3SAF A;  5EOY A;  2BE2 A;  3ENB A;  1C1C A;  3M6G A;  3TAN A;  5C25 A;  4H4M A;  3CJ7 A;  1NK6 A;  4IEE A;  3KWG A;  5E84 A;  2UUB K;  4EIA A;  5AQN A;  2KFZ A;  3HVT A;  1NGG A;  3IMX A;  4MFB A;  3KWI A;  4FJX A;  2P9P A;  4GY2 B;  4JI3 K;  1WAF A;  3ZEU A;  5LMN K;  1RTJ A;  1RBU A;  3MCA B;  4HUF A;  4CD1 A;  2A6A A;  3VEZ A;  1T8E A;  5AZJ A;  2A5X A;  1H1V A;  1C0G A;  2Z1H A;  2ZGZ A;  2XRI A;  4JKH A;  3ZT4 A;  1EX4 A;  4ISE A;  4IFY A;  3VEY A;  4Z4E A;  3VGK A;  3OTO K;  3ZT1 A;  3CJA A;  5AZJ B;  4DTX A;  2A1R A;  3VQ5 A;  4JRP A;  4KTW A;  1BIU A;  3AVG A;  1W7A A;  3QB0 A;  3QML A;  1D8Y A;  3OYJ A;  4CF0 A;  1KVA A;  3O1B A;  3TTF A;  1LWC A;  1S1W A;  4N5S A;  4N76 A;  2YHW A;  4OGE A;  2CGJ A;  2HNY A;  4H03 B;  1BA0 A;  3KIO A;  4B1V A;  4A62 A;  3CXC M;  4B9S A;  4RW4 A;  2IGI A;  1K8K A;  3KJV A;  2I5J A;  2FSN A;  4XEI A;  4DF4 A;  3P1G A;  4LH5 A;  1F21 A;  3OY9 A;  2DFF A;  4LH4 A;  3DJC A;  1ZBF A;  2HF4 A;  5FPN A;  4CIG A;  3OYB A;  4G1Q A;  4JHD A;  3CME N;  4DWI A;  2UXD K;  1T6C A;  1MA9 B;  2GEM A;  4LSN A;  4FK0 A;  5BR9 A;  5TKW A;  4CHP A;  1RBR A;  5BPN A;  2YV0 X;  4DR6 K;  2A42 A;  3UIQ A;  4AHU A;  3UKR A;  2ZQB A;  3VQ9 A;  1RT1 A;  3P38 A;  3DOK A;  3VQC A;  3GDQ A;  3CJC A;  4BQZ A;  4JHD B;  2O8B A;  1IKY A;  4CED A;  4ILJ A;  1JXE A;  2YHB A;  3ULE A;  3EZ5 A;  2NNW A;  1EET A;  4MLE A;  1HLU A;  4HVJ A;  1YTU A;  3AO3 A;  3V9X A;  4EZ9 A;  1NKC A;  2IS3 A;  2VG6 A;  3FFI A;  3H08 A;  4IEI A;  2FBT A;  3VES A;  5KRS A;  4CJ3 A;  5HOO A;  1VSL A;  3MN9 A;  3SUN A;  4CF9 A;  3E66 A;  5DM7 L;  4DU4 A;  1HNZ K;  3KLE A;  1QVG M;  4JN4 A;  4BR7 A;  1K8A O;  4CGD A;  4KTQ A;  4KHQ A;  4IFV A;  1I3A A;  1RDW X;  5C2F A;  3AAR A;  5LJV A;  4DF8 A;  4OKE A;  3NFA A;  2P5O A;  5AQL A;  4FO0 A;  1NK5 A;  4JI4 K;  5AQZ A;  4M41 A;  3PSI A;  3WNF A;  1J5E K;  5CE3 A;  2IOC A;  1BGX T;  3CCR N;  3VET A;  2D0O A;  3AVH A;  3I55 N;  1ATS A;  4CF2 A;  1FKO A;  3WXJ A;  1GLA G;  3D2F A;  3M8S A;  3PY8 A;  4BRF A;  4BRI A;  1S1U A;  1S5J A;  5GAD P;  2QWP A;  3SZ2 A;  3L2R A;  3RMC A;  4J8F A;  3NH2 A;  1L3U A;  3QBW A;  4M3Z A;  3MN5 A;  4CZL A;  3I8D A;  3D2E B;  2B5J A;  4FWO A;  1RBT A;  2O8F A;  3VEV A;  4FLV A;  1ZBL A;  4CGG A;  3O3G A;  5F1X A;  1S3X A;  4O0I A;  2YHX A;  3G71 N;  4DV7 K;  2QXL A;  2UXC K;  1JCE A;  1NKB A;  2PYL A;  3D6R A;  1XI1 A;  1NLV A;  2CGK A;  4BRH A;  4X65 K;  3HST B;  3LDL A;  4I9L A;  3SV3 A;  3MEC A;  4FLY A;  1RTD A;  5CZ2 A;  3DLH A;  2P9U B;  1W97 L;  2YNF A;  4CEB A;  1W2B M;  4KBO A;  4FPB A;  2ZM6 K;  1TVR A;  3TAG A;  1IO2 A;  2RKI A;  3JS6 A;  4BRL A;  1SKW A;  2HHX A;  4LY7 A;  3HOS A;  1R59 O;  3AVI A;  4FOI A;  5JS2 A;  1IJJ A;  3WNH A;  3VTH A;  1C0T A;  1E3M A;  2NRH A;  4FM1 A;  1VQK N;  1X9W A;  5J2M A;  1SAZ A;  1G99 A;  3ULE B;  4B1W B;  2G8W A;  1J6Z A;  4B3S K;  4DS4 A;  3W3D A;  4WQ4 A;  3SMS A;  3FE1 A;  2E6M A;  3W0L A;  4NCB A;  1HR0 K;  2YHA A;  1YIT N;  1ZC6 A;  1WBB A;  1HUX A;  3AO5 A;  2HHV A;  1SL2 A;  2DTU A;  5CYQ A;  3K5M A;  5ADX H;  1A5V A;  1Q8I A;  1ZYQ A;  3ID6 A;  1XQS C;  3ZX3 A;  3RMD A;  2ZWH A;  3FZF A;  3QEX A;  2LSN A;  3WXL A;  3AVJ A;  3HK2 A;  4O44 A;  4GNI A;  2HOE A;  3OBW A;  3AO1 A;  4CF1 A;  3QIO A;  5I3U A;  2BGG A;  4AHS A;  2GTD A;  4X64 K;  1KFS A;  2UUA K;  4Z0U A;  3R9P A;  2FBX A;  4BRC A;  2P9N A;  4KI6 A;  4FWL A;  4IG3 A;  5JLF A;  3MXI A;  3L3U A;  3AA2 A;  2G8U A;  2F8T A;  1T6D A;  4DR1 K;  2Y1I A;  1CLQ A;  3ZT0 A;  4AHC A;  2QWQ A;  5AR0 A;  2VQF K;  3NH0 A;  3KK2 A;  3HI0 A;  1L5U A;  4KHY A;  2HW3 A;  3MN7 A;  4CZI A;  4B1Y B;  3THW A;  1TV6 A;  4OPH A;  4KHU A;  3ZX0 A;  4DCH A;  3V9Z A;  3CCU N;  4F3T A;  2OYQ A;  3J80 O;  3DWL A;  5EU7 A;  2ZD1 A;  2FSJ A;  3MX5 A;  3NH1 A;  3MK6 A;  3KLH A;  3QES A;  1GOA A;  1OVQ A;  3EKU A;  4E7I A;  1NK8 A;  4JS4 A;  5AQV A;  1NGE A;  3AAQ A;  3KLG A;  3NVK A;  2OZS A;  3E9P A;  3CQX A;  3NF6 A;  2HHQ A;  1XC9 A;  2W41 A;  4CFB A;  2DFE A;  1S1X A;  1RT2 A;  4H0T B;  2E1Z A;  2Q36 A;  5AQK A;  1ASV A;  3O5B A;  3PIO L;  3CFR A;  3MDQ A;  1WB9 A;  4LF4 K;  4B1U B;  3FZH A;  1Z05 A;  3HPH A;  4GV3 A;  4GMJ B;  4W5T A;  4BRE A;  3PX6 A;  1VSM A;  2BH1 A;  1UOC A;  1NKE A;  1KSP A;  3DLB A;  5AQJ A;  1XMO K;  4EP5 A;  3CCM N;  5KPT A;  5HLF A;  3C6U A;  2X6S A;  3DI6 A;  3QO9 A;  3K5O A;  4B8A B;  2W42 A;  1VQ6 N;  3QET A;  3J7Z O;  4FWS A;  3SI6 A;  2OTL N;  3LWL A;  4CEO A;  4E0D A;  1TKD A;  1Q18 A;  2F9T A;  3CM6 A;  1L3T A;  2X6N A;  1KTQ A;  1EO1 A;  4FLZ A;  5I42 A;  4FZX C;  2Q31 A;  4YOU A;  3M8Q A;  3DRS A;  4O4G A;  3MEG A;  2F7T A;  1BQM A;  4KHN A;  3WNG A;  2HBL A;  3ZT3 A;  4F8R A;  4B8C A;  4FXD A;  2D0B A;  5KQ8 A;  2PFU A;  2PAV A;  1Q9X A;  2HMI A;  2X74 A;  3E01 A;  4FLU A;  3V81 A;  4KFB A;  3NE6 A;  4JI1 K;  1VSE A;  3O1W A;  1O13 A;  5BRE A;  4FJH A;  3IRX A;  3MAQ A;  3BGR A;  3KK3 A;  3S3N A;  4BRN A;  4X62 K;  4YHH K;  3C7N A;  5J2P A;  3WXM B;  3SJJ A;  3SBG A;  4B1Z A;  4O55 A;  4NB4 A;  3J7A P;  3K9J A;  5KPR A;  1TUY A;  3H3N O;  1Q82 O;  3VGL A;  3O08 A;  2P9L B;  3EKS A;  1Y97 A;  1QZ5 A;  4JI2 K;  1BWF O;  1YXQ A;  4IOX A;  5AQS A;  3LP1 A;  5EXW A;  1DKG D;  3CQ8 A;  4FJL A;  4CJ7 A;  5C12 A;  3LDS A;  3ZET A;  5JVH L;  4FJM A;  1Z25 A;  1Z26 A;  1QQO A;  3CFO A;  3ZSZ A;  4CHQ A;  4M3T A;  3T1H K;  4JI8 K;  4BR4 A;  2XY8 A;  1WUA A;  1D9D A;  3CMA N;  4QCL A;  1HNX K;  4E89 A;  3GBT A;  1QHT A;  3C94 A;  4XH4 A;  2GUI A;  1V4S A;  4AM6 A;  1X3M A;  3WUH A;  4EHU A;  2NRX A;  5AQU A;  1NK7 A;  2I7P A;  2DFH A;  4B9Q A;  1BCO A;  2YKN A;  4AH9 A;  4KAZ A;  2RE2 A;  2QEX N;  2KW4 A;  2VGN A;  3AVL A;  4FWQ A;  5FRM A;  3VQ7 A;  4JK7 A;  2JWL A;  1C0F A;  1WSJ A;  2Q3S A;  3P31 A;  3SQ0 A;  3F2K A;  1NU0 A;  4RCH A;  5M1O A;  1QQM A;  4A57 A;  4KKO A;  5HP1 A;  4CGI A;  1JLC A;  4DUZ K;  3QNO A;  2V51 B;  4CBX A;  4PL8 A;  1S6P A;  2QWR A;  1YF5 L;  3WQU A;  3I0R A;  4I7F A;  4JI5 K;  2VCP A;  4E19 A;  4DTP A;  2HHS A;  4KV8 A;  4DFJ A;  1NGJ A;  1WOQ A;  2BAN A;  1HKC A;  2P9U A;  2EWS A;  3ZSQ A;  2P9L A;  4YOR A;  3S9H A;  2NRR A;  3B6O A;  3MXJ A;  4IXC A;  1EKE A;  4CGF A;  1KCF A;  4BC2 A;  4QS7 A;  4MQ3 A;  5BPL A;  1A5X A;  1KLM A;  4H5N A;  3HT3 A;  1DEJ A;  1P90 A;  4DS5 A;  2G8K A;  4CK3 A;  5T7B A;  3ZSX A;  2G8F A;  3AO2 A;  3LDQ A;  3J8A A;  3OYN A;  1I94 K;  4I6M A;  2BUP A;  1WN7 A;  3AO4 A;  4H8K A;  2YKM A;  4M42 A;  3KD1 E;  3JAM O;  4MDB A;  3K58 A;  4A5B A;  4WE1 A;  3QBX A;  4V19 S;  2NLX A;  3THY A;  1RIL A;  3A2F A;  2QW9 A;  3ITH A;  3ENH A;  5EY4 A;  4CJS A;  3S3M A;  4Z4I A;  1B9F A;  2I7N A;  3U8X A;  2E2P A;  2HMP A;  2NRZ A;  3E9L A;  3SAG A;  5GAH P;  3ZEU B;  1HPM A;  3D7E O;  1NGF A;  2E2N A;  4HCB A;  2IVP A;  3SCX A;  3SQ1 A;  1ITG A;  4JKD A;  4KO0 A;  1HJR A;  4HUE A;  4NLC A;  4IFE A;  4BRG A;  2QTD A;  3THY B;  1MWK A;  4J2E A;  1XNQ K;  1GLF O;  3FR0 A;  3D2F B;  2HBM A;  4Q0B A;  1TL3 A;  1JLB A;  2WON A;  1OH8 A;  3Q7B A;  4O5B A;  3OYE A;  1GLB G;  2ASP A;  5KQD A;  1QSL A;  2QK9 A;  3H1Q A;  2IVO A;  4Y1C A;  5JIC A;  3GG4 A;  3L4Q A;  4FJI A;  4CER A;  4CJ4 A;  4PL7 A;  3A5N C;  3FGU A;  3DRP A;  3HZ6 A;  3NF8 A;  2YHY A;  5C15 A;  2Q2R A;  1IBM K;  4OPJ A;  1JLF A;  1O1W A;  3RTV A;  3SMP A;  3HSC A;  4CJL A;  1CZ9 A;  2OPP A;  4JS5 A;  5HRN A;  5AJ3 K;  4L8R B;  3SPZ A;  2O8C B;  3KD5 E;  4FWP A;  4M3W A;  3DOL A;  3L2W A;  2BTF A;  1BIZ A;  1VSH A;  3JSM A;  3C7N B;  2O8E A;  3AA5 X;  4BE0 A;  4JKG A;  1TK5 A;  2F96 A;  3EEQ A;  1BO5 O;  2WOM A;  2YNH A;  3LDP A;  2FBV A;  3H1V X;  1KLN A;  1IBK K;  1WSG A;  5EVZ A;  4C1N I;  1NBW A;  5BN8 A;  1BG3 A;  2P9S B;  4H0X B;  3BEX A;  3O3H A;  5M1N A;  2P5G A;  3HXM A;  3TU5 A;  5EX5 A;  4CHZ A;  3EE9 A;  3L3V A;  2P9N B;  3MN6 A;  4KI4 A;  1HJO A;  4E3S A;  4NO7 A;  3AA3 A;  4OKJ A;  5LJW A;  4JRQ A;  2EHG A;  4IZ9 A;  4X66 K;  1ZBU A;  2FLO A;  3I33 A;  4M63 C;  2VG5 A;  2HVI A;  4WF9 L;  1OVY A;  4BRK A;  4YOT A;  1VQO N;  3THV A;  4O5F A;  4A2A A;  2YJE A;  1VAZ A;  3AGR A;  1NGH A;  4JEP A;  2ETJ A;  2WUS A;  2KTQ A;  5FRN A;  3CYM A;  2FXU A;  4DV4 K;  4CJE A;  2HHW A;  5FPM A;  2HVH A;  4F3O A;  1K73 O;  4PUO A;  5AQR A;  1TAU A;  3U3G A;  1NGB A;  3PO4 A;  3RRH A;  3SLC A;  1B92 A;  3KK7 A;  1RTH A;  5JLH A;  2XY6 A;  5AQI A;  2G8H A;  4QAG A;  2ZJP L;  1U2V A;  1N8R O;  4JNE A;  5CZ1 A;  3UE5 A;  4A59 A;  4ID5 A;  4CJR A;  3TAM A;  1YT3 A;  2P9K B;  4RG8 A;  3PIP L;  5AQO A;  4ZHR A;  1Q86 O;  3EN9 A;  1ATR A;  1VQ4 N;  3LP0 A;  3GOI A;  3N4P A;  3VN5 A;  3CCL N;  1BDG A;  3U9Z A;  1CXQ A;  1T05 A;  5BR8 K;  2VWB A;  1SS6 A;  3NGZ A;  3F9K A;  1LAV A;  3P4I A;  4IO9 L;  3OYL A;  4FW1 A;  1NGA A;  3KKR A;  1EQY A;  3O4N A;  1VQ7 N;  1NWK A;  1W9H A;  2HB5 A;  4IDH A;  3THW B;  1LOT B;  4PHT X;  4DSE A;  4CJP A;  3AVA A;  5KI6 A;  3SUQ A;  1SKR A;  3LPT A;  2NZT A;  3CIP A;  4DTO A;  5GIP A;  4CEQ A;  2FC0 A;  4L3Q A;  3T7Z A;  4CEE A;  3CET A;  1QZ6 A;  3QIC A;  1S1V A;  1HMV A;  4FW2 A;  2KZM A;  1X1P A;  1J54 A;  2QKB A;  2E1Y A;  1UA1 A;  3GE1 A;  1C0M A;  1IKV A;  2NRV A;  3TAF A;  3J7Y P;  3MMV A;  4FJ7 A;  3BZC A;  2O8F B;  4CJV A;  2PYJ A;  4FVU A;  1X3N A;  3KHY A;  1OH5 A;  3T3F A;  3KKS A;  3OJS A;  1XUP O;  4MDA A;  3OYG A;  1D9F A;  1RBV A;  2A3Z A;  4DR2 K;  1L3V A;  3HJF A;  3OYD A;  2A40 A;  2V7Y A;  3CCQ N;  3E1Y A;  4R79 A;  4Z4G A;  4GV6 A;  3EY1 A;  4CJK A;  2KZZ A;  4C8L A;  1WAJ A;  2YCH A;  4CZG A;  4Z94 A;  3OBY A;  2YNI A;  2VYP A;  5M1P A;  3THX A;  4FZZ A;  1HNW K;  3RSE B;  3V9S A;  4CW7 B;  1HYS A;  2ZJR L;  3FZK A;  1VQN N;  3VQQ A;  3CCV N;  4DV5 K;  1J5O A;  1ILY A;  2CH5 A;  1GLC G;  1EXQ A;  4H0O A;  3HYF A;  4KRE A;  2PBD A;  4B3O A;  1QQN A;  1SQK A;  2VWJ A;  2AP1 A;  3DLR A;  4YOX A;  4LF5 K;  3O8M A;  5AQX A;  4BWM A;  4UY8 O;  3U3Y A;  5AQQ A;  4PWD A;  3CG7 A;  3RRG A;  4DQI A;  4H4O A;  4CZH A;  1HRH A;  4BGB A;  3OYF A;  2P1J A;  3NMU A;  1M90 O;  2O8C A;  2KLA A;  5AFU H;  1VQ8 N;  1XHX A;  3SBT A;  3O80 A;  3L0Q A;  3QDK A;  4MO5 A;  4QS9 A;  4BRM A;  3L2U A;  5IT9 O;  2KHO A;  3VMF B;  4B08 A;  1RNH A;  1NK4 A;  3S3O A;  4ELT A;  2OA8 A;  4CEC A;  4DR3 K;  3K59 A;  3EZW A;  4BQL A;  4FWM A;  4K25 A;  2QWN A;  1FJG K;  2R7Y A;  4B3R K;  1JLA A;  1N33 K;  4FPA A;  1OKJ A;  1SZ2 A;  2WC9 A;  4GV9 A;  3VEN A;  5ADX A;  3CJ9 A;  4BC3 A;  1HYZ A;  3CQY A;  1RDD A;  1VQ5 N;  2A1S A;  3ZSY A;  4BG9 A;  3F5T A;  2O4I A;  4KHW A;  3PX0 A;  4YNQ A;  4B9U A;  3CCJ N;  4YOV A;  1GLL O;  3LDO A;  1VSD A;  4AQY K;  4CZJ A;  1QTM A;  1HYV A;  3OA9 A;  3OS2 A;  3UKU B;  4M3X A;  4MO4 A;  3R3L A;  4AHT A;  1KC8 O;  1UWB A;  1TYQ A;  4DV2 K;  3MWP A;  4FJN A;  2QWL A;  4OX9 K;  3VEX A;  2E20 A;  2RHK A;  3WXI A;  1G15 A;  5AQM A;  1LV5 A;  4GKJ K;  4DMN A;  1NOY A;  1S9G A;  4DTU A;  2FSK A;  4FSV A;  1YUW A;  4ISF A;  1NJY A;  1U2V B;  5AQT A;  3CC2 N;  3LPU A;  3VEO A;  3CC4 N;  3CI5 A;  4E7L A;  5D3G A;  2EX3 A;  3WEE B;  2QXF A;  3CC7 N;  4DFM A;  3HP9 A;  3FLC O;  4DSK A;  5LMU K;  4KH6 A;  1TGO A;  3BY5 A;  1DTT A;  4CE9 A;  4CBW A;  3DLK A;  1YIJ N;  3QLH A;  5AZI A;  3WNE A;  4F4K A;  2PZS A;  2NRW A;  3G4S N;  1KD1 O;  1NG9 A;  4NXN K;  1NK9 A;  1QVF M;  1WSE A;  1SL0 A;  1KQS M;  1RDU A;  3K2P A;  1NJW A;  3BUZ B;  4K41 A;  4PKH A;  3Q7C A;  2OAN A;  4JK8 A;  3JXU A;  3NCI A;  4CIE A;  1ASW A;  3QIN A;  3NF9 A;  1JLG A;  2J4R A;  2E5L K;  1JJ2 M;  5SWM A;  3TAP A;  1U6Z A;  4KRF A;  3K57 A;  3N4Q A;  4E1N A;  4JD2 B;  1EWQ A;  3CCE N;  3OVN A;  2CGL A;  2D0C A;  4FJ5 A;  4DSF A;  1YJW N;  4O8U A;  4GVE A;  2F9W A;  4BWJ A;  1GOC A;  1Z6R A;  3VQP A;  1JCF A;  4XH1 A;  3WT0 A;  1U49 A;  3SQ4 A;  3OS1 A;  2NUB A;  4FOE A;  3HPO A;  1FKP A;  4AHV A;  5I9E B;  2AA4 A;  1X9J A;  3B8A X;  5BRD A;  3QFU A;  1KFD A;  4K0K K;  4BE2 A;  3JYT A;  1RDA A;  1WSI A;  4YDU A;  4OPA A;  4A2B A;  4OJR A;  2KKZ A;  4LSL A;  1N5Y A;  2OCE A;  3PX4 A;  4LFA K;  1N6Q A;  2WFB A;  4CZK A;  4ID1 A;  1FW6 A;  1B9D A;  2XO7 A;  1QE1 A;  3H45 C;  2OPS A;  5FPD A;  3QEP A;  2NRT A;  3VA0 A;  3I0S A;  4LF8 K;  4DHY A;  3LAN A;  2YX6 A;  3KK1 A;  4GW6 A;  5HRR A;  3LM9 A;  3TSU A;  1MDU B;  3H3O B;  2QM1 A;  1VRU A;  2VG7 A;  3AY9 A;  3TTD A;  2GBZ A;  1GLE G;  4DU3 A;  3U4L A;  4A5A A;  4CGH A;  5C42 A;  4H5W A;  4W5N A;  4UQG A;  2WBN A;  2D0A A;  2E2Q A;  1XHZ A;  3RMB A;  2D0P A;  5HBM A;  1C1B A;  4ZTF A;  3P39 A;  1JKH A;  4W5R A;  1YVU A;  4DU1 A;  3C0B A;  4CFA A;  2XHB A;  3NDK A;  4IOA L;  5KPZ A;  2HBK A;  2GUP A;  4LF7 K;  3IFR A;  1ZBH A;  2F4V K;  5CY4 A;  4NCA A;  2KQ2 A;  3ZSV A;  4H0P A;  1TK0 A;  5FLX O;  1L3S A;  3O9R A;  3M1F A;  5J2N A;  4OLA A;  3QEW A;  2G8V A;  1M1K O;  4RW9 A;  4AM7 A;  4K43 A;  2P9I B;  3TTC A;  2UXB K;  3LZI A;  4BG8 A;  4I6M B;  3OS0 A;  3OJU A;  3ZT2 A;  3C6T A;  2P9P B;  3DXK A;  4BVO A;  1HNI A;  4F2R A;  3T1Y K;  4CZE A;  1S6Q A;  1YI2 N;  2E8A A;  4LFC K;  3ZLJ A;  5TKY A;  3SQ2 A;  2FF6 A;  4IO8 A;  3OYA A;  5H1S Q;  5FDL A;  3VQE A;  1QHA A;  4BDZ A;  3R1X A;  2A41 A;  5JVG L;  3VTI A;  2HNZ A;  4M7X A;  3HBT A;  4B9V A;  4FJ9 A;  3FZL A;  3CJB A;  3SK3 A;  4LC9 B;  1EP4 A;  3MX2 A;  2GWJ A;  3SUO A;  5LY3 A;  3VGM A;  1QSY A;  4CJW A;  4HUG A;  3G10 A;  1J9A A;  3QIP A;  4N56 A;  4PQU A;  3NGI A;  2JGU A;  4BY9 C;  3DLE A;  4OVL A;  3AAP A;  3VF6 A;  2XY5 A;  1VSI A;  5K14 A;  1RT3 A;  2VQE K;  4M7Y A;  1U47 A;  3LAM A;  1HKG A;  1V4T A;  3BZK A;  4HTL A;  1NK0 A;  4B9N A;  3A5L C;  3K5L A;  1ASU A;  4ILG B;  4O0J A;  4AHR A;  4CHO A;  3ZYY X;  3V1Q A;  3VF2 A;  3SYZ A;  2ATQ A;  4BR9 A;  4B3M K;  5CHI A;  3AVK A;  5GAE P;  2VGM A;  2Z1G A;  1WLJ A;  4JK9 A;  3KZB A;  1RT6 A;  2ZE2 A;  2HST A;  4Q5V A;  3TWH A;  1BIS A;  1VK0 A;  4CEF A;  4Z4H A;  2QKK A;  4H5R A;  4FM2 A;  1RCH A;  1YAG A;  2Z1J A;  1KVB A;  4CEZ A;  4ICL A;  1BOT O;  5C10 A;  3EYZ A;  2V52 B;  3TAQ A;  4DFP A;  2QI2 A;  3V4I A;  4B3T K;  3CM5 A;  2CH6 A;  5M1K A;  1BI4 B;  1CXU A;  5BPM A;  1RDC A;  4F9O A;  3T19 A;  1ATN A;  5HRP A;  1LWE A;  1MU2 A;  3M8P A;  4QOZ B;  1REV A;  3LM2 A;  3O9U A;  4EZ6 A;  4DQS A;  4EFH A;  3DYA A;  4DSJ A;  1J53 A;  5B8H A;  4FLT A;  3HP6 A;  2P9K A;  2OPR A;  4WFB L;  1JL1 A;  3LWM A;  3HO1 A;  3L6Q A;  5AQH A;  3K5N A;  1X9S A;  1I39 A;  1Q81 O;  4XIU A;  2F8S A;  4RW8 A;  5KGX A;  3V1R A;  1VHX A;  4C1N K;  3O4Q A;  1BCM A;  5HRO A;  1P8Z A;  3A8Y A;  3CCS N;  4BR0 A;  3OW2 M;  3P83 D;  4B9M A;  3O9Q A;  4NYF A;  3G6E N;  4NLB A;  1D4X A;  1OH6 A;  4WFN L;  4LD0 A;  3KVG A;  1BU6 O;  4RW6 A;  4BC4 A;  1FXX A;  4DSI A;  4O8K A;  2IVN A;  2Q0U A;  3R8E A;  4FLX A;  3CF5 L;  4H0Y B;  4CJF A;  1DT9 A;  3CER A;  1T03 A;  1KAZ A;  4U67 L;  2UUC K;  1YVN A;  4M3Y A;  1XWL A;  3CJ1 A;  3MXM A;  5GIO A;  3QNN A;  1DTQ A;  3TAB A;  4JI7 K;  1SUQ A;  2D4W A;  4DLG A;  3ENO A;  3MED A;  2Q97 A;  3ZSO A;  5C24 A;  4N41 A;  4CEA A;  3G25 A;  1RGI A;  1NJZ A;  1Q7Y O;  4FWK A;  3L4I A;  1BA1 A;  5JMV A;  4CI6 A;  4CHN A;  4WYB A;  4H5V A;  4DUY K;  4FJ8 A;  1UAX A;  3RSE A;  5DK5 A;  2DY4 A;  4B9L A;  3VQA A;  2HHH K;  5ELZ A;  2Q1N A;  4BAC A;  4BVP A;  4FWN A;  2O8E B;  2JWK A;  4KHP K;  4HHT A;  1RBS A;  4CIF A;  5DM6 L;  1SL1 A;  3PO5 A;  3CPE A;  3BP8 A;  3SJH A;  4U7B A;  1U48 A;  1SKS A;  4W5Q A;  3OYM A;  3V1O A;  5KTQ A;  4GVM A;  4I2P A;  3AA4 A;  1TL1 A;  3F73 A;  3VQ4 A;  1RT4 A;  3CPW M;  3ATU A;  3IG1 A;  4ILH A;  3BDP A;  3NGY A;  3R6M A;  4Z4F A;  1Y64 A;  3ZCM A;  4J2A A;  3HL8 A;  1LW0 A;  4DV3 K;  2Y1J A;  1K9M O;  3C65 A;  4FK2 A;  4BDP A;  2OZM A;  2IAJ A;  4J2D A;  4DG1 A;  3U6F A;  2HHU A;  3VOV A;  3ALY A;  3NF7 A;  4OO1 J;  1VSJ A;  1HPZ A;  3TR8 A;  2GX9 A;  1KAY A;  2O4G A;  1T7P A;  1LWF A;  1UA0 A;  5BN9 A;  1NM1 A;  3O4W A;  3DAW A;  3RVC A;  3NHG A;  1XC3 A;  1TKX A;  1D5A A;  3O9T A;  1Q9Y A;  3L2V A;  3VA3 A;  4JKG B;  2AJQ A;  4C8N A;  1NMN A;  2D5R A;  2BDP A;  1ZBS A;  2GWK A;  4CCH A;  4WQ4 C;  4DV0 K;  3DXK B;  3U9D A;  1YJN N;  1VQP N;  3WEE A;  3VQB A;  3QER A;  4KTZ A;  2P9I A;  3M8R A;  5HRS A;  5J1E A;  3IDH A;  4Y0W A;  2E6L A;  1BL3 A;  4FJJ A;  5AZI B;  2KFN A;  2D1K A;  1JLQ A;  3AVM A;  4XH5 A;  2W6L A;  5AFU A;  3TSQ A;  4IBN A;  3A5O C;  4OPK A;  1CZA N;  1YTA A;  1RT7 A;  1FK9 A;  3M5R A;  4K42 A;  1GLD G;  4CFD A;  4JLH A;  2ZJQ L;  5AQW A;  4E7J A;  3ID8 A;  4M3U A;  4H5T A;  1T44 A;  4CFC A;  3CFP A;  5C2D A;  1VRT A;  4B1X B;  4BR5 A;  1CZB A;  2FBY A;  3CD6 N;  5SZT A;  3SAH A;  4YOW A;  4C23 A;  3PUF A;  3VQD A;  4WFA L;  3D2E A;  1VSF A;  1VQ9 N;  4E1J A;  4JYA K;  1E4G T;  4W5O A;  1N36 K;  4DTM A;  2HND A;  4KH4 A;  3TAR A;  4BR2 A;  1JXB A;  4FL9 A;  3T1A A;  4K8Z A;  3OYK A;  4E7H A;  3F9M A;  3MCP A;  3FFK B;  4JKC A;  4N47 A;  5GAG P;  4CZM A;  1IKW A;  1YJ9 N;  2ITM A;  4DQP A;  2OPQ A;  4OGC A;  4JI0 K;  3SV4 A;  2ZF5 O;  5E26 A;  1KRP A;  3OYH A;  3AVB A;  3RR7 A;  4K8X A;  2E4L A;  5F0X A;  1LAW A;  4CK1 A;  3LP3 A;  1TKZ A;  3PV8 A;  4C8M A;  3HM8 A;  1BQN A;  3NBP A;  4FLW A;  2PY5 A;  2QWO A;  3OYC A;  4I2Q A;  3C6A A;  3FZM A;  3LL3 A;  1ZXO A;  3O3F A;  4DV6 K;  2QA4 N;  4NYN A;  4KB0 A;  4KHS A;  3VF4 A;  2Q0R A;  4M45 A;  5M1Q A;  3ULD A;  4KB1 A;  3BF3 A;  3GL1 A;  1NGC A;  1TAQ A;  4CVN E;  4JKF A;  2G8I A;  4FWR A;  1IKX A;  3V9W A;  4YDU C;  5LL6 Z;  3O9S A;  3MEE A;  1X9M A;  3ISN C;  4DR7 K;  1IG8 A;  3LZJ A;  4CGJ A;  3C6H A;  1HQE A;  4JD2 A;  4C8K A;  1BUP A;  1LW2 A;  3VPZ A;  4H0V B;  1HX1 A;  4CJQ A;  1IV0 A;  4PKI A; 
#chains in the Genus database with same CATH homology
 4CGH A;  1CZ9 A;  1HNV A;  5C42 A;  3I8D A;  2B5J A;  4UQG A;  4W5N A;  2OPP A;  2RPI A;  1RBT A;  1SV5 A;  4JS5 A;  5HRN A;  4L8R B;  3SPZ A;  4FLV A;  1ZBL A;  3KD5 E;  3V9U A;  2D0A A;  1KVC A;  4CGG A;  3P5J A;  1XHZ A;  4B9T A;  3RMB A;  4M3W A;  5HBM A;  1BI4 A;  3DOL A;  3O3G A;  1C1B A;  4ZTF A;  4E7K A;  3L2W A;  4O0I A;  1BIZ A;  1JKH A;  4W5R A;  1YVU A;  1VSH A;  3JSM A;  4AIL C;  4DU1 A;  4CFA A;  2XHB A;  3NDK A;  3AA5 X;  4FM0 A;  4BE0 A;  1TK5 A;  2F96 A;  3VQ8 A;  1NKB A;  2PYL A;  2WOM A;  3HPG A;  2YNH A;  1ZBH A;  5CY4 A;  1XI1 A;  3B6P A;  1WSH A;  2FBV A;  2KQ2 A;  3ZSV A;  1KLN A;  4NCA A;  3HST B;  1WSG A;  1TK0 A;  1IG9 A;  1L3S A;  5J2N A;  4OLA A;  4I9L A;  4CHY A;  3QEW A;  3SV3 A;  3MEC A;  4FLY A;  1RTD A;  5CZ2 A;  3DLH A;  1RDB A;  2G8V A;  4RW9 A;  2IDO A;  3SPY A;  1GOB A;  2RN2 A;  1K6Y A;  2YNF A;  4CEB A;  3LZI A;  1U4B A;  3O3H A;  2P5G A;  4OKK A;  3HXM A;  4NCG A;  3OS0 A;  4FJG A;  4CHZ A;  3L3V A;  3OJU A;  3ZT2 A;  3C6T A;  1U04 A;  1TVR A;  3TAG A;  4KI4 A;  4HTU A;  1IO2 A;  2RKI A;  1HNI A;  3AVN A;  4E3S A;  3LAK A;  3DLG A;  3AA3 A;  4OKJ A;  3LAL A;  1SKW A;  4JRQ A;  2EHG A;  4F2R A;  2HHX A;  5DMR A;  4LY7 A;  1ZBU A;  1S6Q A;  4DSL A;  4Y1D A;  4IG0 A;  3AVI A;  2VG5 A;  2HVI A;  5JS2 A;  3SQ2 A;  4YFU A;  3WNH A;  5E41 A;  1U45 A;  1C0T A;  3OYA A;  1RTI A;  5FDL A;  3VQE A;  4FM1 A;  4BDZ A;  1X9W A;  3D45 A;  4FVM A;  4FYD A;  5J2Q A;  5J2M A;  2IC3 A;  3THV A;  4I9Q A;  2HNZ A;  4FCY A;  2G8W A;  3IS9 A;  4OLB A;  4B9V A;  4FJ9 A;  3LP2 A;  2YNG A;  4CJ5 A;  3TI0 A;  1EP4 A;  1S9E A;  3SUO A;  3RR8 A;  2ETJ A;  4DS4 A;  2KTQ A;  3KLI A;  4DLE A;  2E6M A;  3CYM A;  1QSY A;  4NCB A;  4CJW A;  1C1A A;  2Z1I A;  5FRN A;  2HHW A;  4CJE A;  2YHA A;  3G10 A;  4HUG A;  2HVH A;  1J9A A;  3QIP A;  4F3O A;  4PUO A;  1TAU A;  4DFK A;  4N56 A;  3AVC A;  3AO5 A;  3U3G A;  2B4J A;  3V6D A;  3PO4 A;  4PQU A;  3RRH A;  2HHV A;  3NGI A;  2JGU A;  1B92 A;  1RTH A;  3DLE A;  1SL2 A;  4DTN A;  4OVL A;  2DTU A;  5CYQ A;  3K5M A;  2XY6 A;  1A5V A;  1Q8I A;  2RF2 A;  4QAG A;  2XY5 A;  2G8H A;  1VSI A;  1ZYQ A;  5CZ1 A;  5K14 A;  1RT3 A;  4ID5 A;  4CJR A;  3TAM A;  3LAM A;  3QEX A;  1YT3 A;  3RMD A;  1U47 A;  4RG8 A;  2LSN A;  4ZHR A;  3AVJ A;  3C95 A;  4R5P A;  1NK0 A;  4O44 A;  4B9N A;  3HK2 A;  3K5L A;  1ASU A;  3KTQ A;  4O0J A;  4AHR A;  3AO1 A;  4CHO A;  4CF1 A;  3QIO A;  1HQU A;  5I3U A;  4AHS A;  2BGG A;  1JL2 A;  3V1Q A;  3LP0 A;  4IDK A;  1KFS A;  3VN5 A;  3SYZ A;  2ATQ A;  1CXQ A;  1T05 A;  4Z0U A;  3AVK A;  3NGZ A;  3F9K A;  2FBX A;  1LAV A;  3OYL A;  4KI6 A;  4FW1 A;  3L8B A;  3KKR A;  2Z1G A;  1WLJ A;  3O4N A;  1W9H A;  5KRT A;  4IG3 A;  3MXI A;  2HB5 A;  1RT6 A;  1ZBI A;  3L3U A;  1QS4 A;  1QSS A;  2ZE2 A;  3TWH A;  4Q5V A;  1BIS A;  1VK0 A;  3AA2 A;  4CEF A;  4Z4H A;  4DSE A;  4TSX A;  2G8U A;  2QKK A;  5KGW A;  4CJP A;  2F8T A;  1S1T A;  3AVA A;  5KI6 A;  4FM2 A;  2Y1I A;  1TK8 A;  1RCH A;  3SUQ A;  1SKR A;  2Z1J A;  3ZT0 A;  4AHC A;  1CLQ A;  1KVB A;  3LPT A;  4EP4 A;  3NH0 A;  3KK2 A;  4ELU A;  3HVR A;  4DTO A;  1L5U A;  4CEZ A;  4KHY A;  2HW3 A;  4CEQ A;  1IH7 A;  2B6A A;  4ICL A;  2FC0 A;  3VQ6 A;  3EYZ A;  4FZY A;  3TAQ A;  4DFP A;  4CEE A;  3V4I A;  2ITG A;  4Z4C A;  1DLO A;  3ZSW A;  1TV6 A;  3CM5 A;  4KHU A;  3ZSR A;  1S1V A;  1HMV A;  4FW2 A;  2KZM A;  1X1P A;  1J54 A;  3V9Z A;  1BI4 B;  1CXU A;  4BE1 A;  2QKB A;  4F3T A;  1UA1 A;  2OYQ A;  1C0M A;  1IKV A;  1RDC A;  3TAF A;  3T19 A;  5EU7 A;  2ZD1 A;  4FJ7 A;  5HRP A;  1LWE A;  1MU2 A;  4CJV A;  4CF8 A;  3M8P A;  3NH1 A;  1REV A;  3KLH A;  3QES A;  2PYJ A;  4CES A;  4QOZ B;  1GOA A;  4EZ6 A;  4E7I A;  1NK8 A;  4JS4 A;  3T3F A;  4DQS A;  3KKS A;  4ZTJ A;  3OJS A;  3DYA A;  3KLG A;  4DTS A;  3HM9 A;  2OZS A;  4DSJ A;  4DQQ A;  1J53 A;  3NF6 A;  3OYI A;  4FLT A;  3OYG A;  2HHQ A;  1XC9 A;  3HP6 A;  1D9F A;  4CFB A;  1RBV A;  2OPR A;  1L3V A;  2DFE A;  1S1X A;  1JL1 A;  3LWM A;  3HJF A;  3OYD A;  1RT2 A;  3HO1 A;  2XY7 A;  4C8O A;  3K5N A;  1X9S A;  1I39 A;  4KPY A;  4XIU A;  2F8S A;  1ASV A;  4PA1 A;  4Z4G A;  3EY1 A;  4RW8 A;  4J2B A;  4CJK A;  3V1R A;  5KGX A;  1NOZ A;  2KZZ A;  4C8L A;  1WAJ A;  3O4Q A;  3CFR A;  1BCM A;  5FRO A;  5HRO A;  2P51 A;  4HCC A;  2YNI A;  3P83 D;  4B9M A;  4FZZ A;  1WNS A;  3HPH A;  2GV9 A;  4NYF A;  4FK4 A;  4GMJ B;  4W5T A;  3V9S A;  1HYS A;  3D0P A;  3ASM A;  3VQQ A;  3PX6 A;  1VSM A;  1J5O A;  3IAY A;  3SNN A;  1UOC A;  4LD0 A;  1R0A A;  1EXQ A;  4KRE A;  3HYF A;  1NKE A;  4RW6 A;  1KSP A;  3DLB A;  1FXX A;  4DSI A;  4E1M A;  3DMJ A;  1VSK A;  4B3O A;  4EP5 A;  1A5W A;  4FLX A;  2VWJ A;  3DLR A;  4CJU A;  4CJF A;  3AVF A;  5HLF A;  4CK2 A;  3C6U A;  2X6S A;  4BWM A;  4DTJ A;  3DI6 A;  3QO9 A;  3U3Y A;  1T03 A;  3RWU A;  4PWD A;  5JS1 A;  3K5O A;  4B8A B;  2W42 A;  3QEV A;  3CG7 A;  3QET A;  3RMA A;  3RRG A;  3L2Q A;  4DQI A;  3G0Z A;  4M3Y A;  4H4O A;  1XWL A;  3SI6 A;  3LWL A;  3MXM A;  4CEO A;  3TAE A;  1HRH A;  1TKD A;  4E0D A;  3QNN A;  3OYF A;  1DTQ A;  2P1J A;  3TAB A;  4M3R A;  3AV9 A;  3CM6 A;  4DQR A;  1SUQ A;  1TKT A;  3DM2 A;  4DLG A;  2X6N A;  3MED A;  3KLF A;  1L3T A;  4BDY A;  1KTQ A;  4FLZ A;  5I42 A;  1XHX A;  4FZX C;  3ZSO A;  3M8Q A;  5C24 A;  3DRS A;  5CYM A;  3L2U A;  4N41 A;  4O4G A;  3MEG A;  4CEA A;  4B08 A;  1NJZ A;  1RNH A;  4F2S A;  1NK4 A;  3S3O A;  3NAE A;  1BQM A;  2JLE A;  4KHN A;  3WNG A;  3ZT3 A;  4ELT A;  4ELV A;  4F8R A;  1QQC A;  4B8C A;  2D0B A;  3QEI A;  2OA8 A;  4FXD A;  1WSF A;  4CEC A;  4CHN A;  3K59 A;  1Q9X A;  2HMI A;  2X74 A;  2R7Y A;  2VWK A;  4FJK A;  4FJ8 A;  3E01 A;  4FLU A;  3V81 A;  1UAX A;  5DK5 A;  1JLA A;  2DY4 A;  4KFB A;  3NE6 A;  4B9L A;  1VSE A;  3VQA A;  4PY5 A;  4FJH A;  3IRX A;  2X78 A;  3BGR A;  4RW7 A;  3KK3 A;  3MAQ A;  4BAC A;  4DTR A;  3S3N A;  1NJX A;  2HHT A;  4CJT A;  5J2P A;  1C0U A;  1JLE A;  1C6V A;  4HHT A;  3SJJ A;  1HYZ A;  1RBS A;  3DRR A;  4CIF A;  3SUP A;  1RDD A;  1RT5 A;  1SL1 A;  4O55 A;  1W0H A;  2A1S A;  3PO5 A;  3ZSY A;  1BHL A;  2O4I A;  1U48 A;  1Y97 A;  4IKF A;  2BE2 A;  1SKS A;  4W5Q A;  1C1C A;  4KHW A;  3OYM A;  3TAN A;  3V1O A;  5KTQ A;  4GVM A;  3PX0 A;  4I2P A;  3AA4 A;  1TL1 A;  5C25 A;  4YNQ A;  4H4M A;  1NK6 A;  4B9U A;  3F73 A;  3VQ4 A;  1RT4 A;  1VSD A;  3LP1 A;  3IG1 A;  1QTM A;  2KFZ A;  1HYV A;  3CQ8 A;  3HVT A;  3OS2 A;  3BDP A;  4FJL A;  3NGY A;  4MFB A;  4M3X A;  4Z4F A;  3LDS A;  4FJX A;  3ZCM A;  4J2A A;  3HL8 A;  1LW0 A;  4FJM A;  1WAF A;  4AHT A;  2Y1J A;  1UWB A;  1Z25 A;  1Z26 A;  1RTJ A;  3CFO A;  1RBU A;  4FK2 A;  4HUF A;  4BDP A;  2OZM A;  2IAJ A;  3ZSZ A;  4CHQ A;  4J2D A;  4DG1 A;  3U6F A;  1T8E A;  4FJN A;  4M3T A;  2HHU A;  3ALY A;  3NF7 A;  1VSJ A;  2XY8 A;  1HPZ A;  1G15 A;  3TR8 A;  1LV5 A;  1D9D A;  4QCL A;  2Z1H A;  4DMN A;  4E89 A;  2O4G A;  2XRI A;  1NOY A;  1LWF A;  1S9G A;  1UA0 A;  1QHT A;  3C94 A;  4DTU A;  2GUI A;  1T7P A;  3ZT4 A;  1EX4 A;  1NJY A;  4IFY A;  4Z4E A;  3NHG A;  3LPU A;  1TKX A;  1D5A A;  1Q9Y A;  1NK7 A;  3L2V A;  3ZT1 A;  2DFH A;  3VA3 A;  2AJQ A;  1BCO A;  2YKN A;  4C8N A;  4AH9 A;  4DTX A;  2A1R A;  3VQ5 A;  4E7L A;  4JRP A;  4KAZ A;  4KTW A;  1BIU A;  2KW4 A;  3AVG A;  3AVL A;  5D3G A;  2EX3 A;  5FRM A;  3VQ7 A;  2QXF A;  1WSJ A;  2Q3S A;  2D5R A;  4DFM A;  3HP9 A;  3SQ0 A;  1D8Y A;  2BDP A;  4CCH A;  3OYJ A;  4DSK A;  4KKO A;  1KVA A;  4CF0 A;  5HP1 A;  4CGI A;  1JLC A;  3QNO A;  1LWC A;  1TGO A;  1S1W A;  1DTT A;  4N5S A;  4CE9 A;  4N76 A;  1S6P A;  3DLK A;  3I0R A;  4I7F A;  4OGE A;  2HNY A;  2HHS A;  4E19 A;  4DTP A;  4KV8 A;  3KIO A;  3QLH A;  4DFJ A;  3WNE A;  3VQB A;  3QER A;  4KTZ A;  4B9S A;  4RW4 A;  2PZS A;  4F4K A;  2IGI A;  2BAN A;  3M8R A;  5HRS A;  2I5J A;  3KJV A;  3ZSQ A;  4DF4 A;  3P1G A;  5J1E A;  3B6O A;  3MXJ A;  4LH5 A;  3S9H A;  1EKE A;  1F21 A;  2DFF A;  3OY9 A;  1NK9 A;  4CGF A;  1KCF A;  2E6L A;  4MQ3 A;  4LH4 A;  1BL3 A;  4FJJ A;  1A5X A;  1KLM A;  1WSE A;  3HT3 A;  1ZBF A;  1SL0 A;  3K2P A;  1NJW A;  4CIG A;  2KFN A;  3AVM A;  1JLQ A;  3OYB A;  4G1Q A;  4DWI A;  4DS5 A;  2G8K A;  4OPK A;  4IBN A;  4CK3 A;  5T7B A;  1YTA A;  1RT7 A;  3ZSX A;  1FK9 A;  3AO2 A;  2G8F A;  4CFD A;  4JLH A;  3OYN A;  4E7J A;  4LSN A;  4FK0 A;  4CHP A;  4M3U A;  1RBR A;  3NCI A;  1WN7 A;  4CIE A;  2YV0 X;  3AO4 A;  4CFC A;  4H8K A;  1ASW A;  2YKM A;  3QIN A;  3UIQ A;  3CFP A;  3NF9 A;  1JLG A;  4AHU A;  4M42 A;  1VRT A;  3KD1 E;  2ZQB A;  1CZB A;  2FBY A;  3VQ9 A;  1RT1 A;  5SZT A;  3K58 A;  5SWM A;  3DOK A;  3PUF A;  3VQD A;  3TAP A;  4WE1 A;  3VQC A;  1VSF A;  1IKY A;  4CED A;  3EZ5 A;  1JXE A;  2YHB A;  4KRF A;  3K57 A;  1EET A;  4HVJ A;  1YTU A;  1RIL A;  3A2F A;  3AO3 A;  4E1N A;  4W5O A;  3ITH A;  3V9X A;  4DTM A;  4EZ9 A;  2HND A;  3OVN A;  3TAR A;  4CJS A;  3S3M A;  1NKC A;  2IS3 A;  2D0C A;  2VG6 A;  4Z4I A;  1B9F A;  4FJ5 A;  3FFI A;  3H08 A;  1JXB A;  4DSF A;  3T1A A;  4K8Z A;  3OYK A;  4E7H A;  2FBT A;  1GOC A;  4BWJ A;  4N47 A;  3VQP A;  4CJ3 A;  1VSL A;  5KRS A;  1IKW A;  4CF9 A;  3SUN A;  4DQP A;  1U49 A;  3SQ4 A;  4HCB A;  2OPQ A;  4OGC A;  3OS1 A;  3SV4 A;  2NUB A;  3SCX A;  4DU4 A;  3SQ1 A;  1ITG A;  1KRP A;  3KLE A;  3OYH A;  3AVB A;  3RR7 A;  4KO0 A;  4K8X A;  1HJR A;  2E4L A;  1FKP A;  3HPO A;  4HUE A;  4AHV A;  1LAW A;  4CK1 A;  3LP3 A;  4CGD A;  1TKZ A;  3PV8 A;  4KTQ A;  4IFV A;  4C8M A;  4KHQ A;  1BQN A;  1I3A A;  3NBP A;  1KFD A;  4J2E A;  4BE2 A;  4FLW A;  2PY5 A;  4DF8 A;  3JYT A;  3OYC A;  4OKE A;  1RDA A;  1WSI A;  3NFA A;  4I2Q A;  2P5O A;  4Q0B A;  1TL3 A;  1NK5 A;  1JLB A;  2WON A;  4OJR A;  4LSL A;  4O5B A;  1N5Y A;  3PX4 A;  3O3F A;  3OYE A;  1N6Q A;  4M41 A;  3WNF A;  4NYN A;  4ID1 A;  2IOC A;  1B9D A;  1QSL A;  4KB0 A;  2QK9 A;  2XO7 A;  4KHS A;  1QE1 A;  4Y1C A;  1BGX T;  4M45 A;  2OPS A;  3ULD A;  3QEP A;  4KB1 A;  4FJI A;  4CER A;  4CJ4 A;  3AVH A;  3VA0 A;  3I0S A;  1TAQ A;  4CF2 A;  1FKO A;  3LAN A;  3M8S A;  2G8I A;  3KK1 A;  1IKX A;  4GW6 A;  3V9W A;  3DRP A;  3PY8 A;  5HRR A;  3NF8 A;  3MEE A;  1X9M A;  1S1U A;  1S5J A;  1VRU A;  2VG7 A;  3ISN C;  3LZJ A;  4CGJ A;  1HQE A;  3SZ2 A;  4C8K A;  3L2R A;  2GBZ A;  1LW2 A;  3RMC A;  4OPJ A;  1JLF A;  1O1W A;  3NH2 A;  1L3U A;  4DU3 A;  4CJQ A;  4M3Z A;  3RTV A;  4CJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...