4CHZA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
155
structure length
151
Chain Sequence
b'SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
molecule keywords INTEGRASE
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 57
structure length 151
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4chzA00
4CEQA 3OJSA 4KB1A 1YVUA 4E3SA 4GVMA 3PO5A 4KTZA 1UA0A 3OYAA 3LPUA 3VQPA 2HHWA 2B5JA 3QIPA 3DOKA 1WN7A 4CGFA 4EZ9A 4M3WA 2OA8A 1IKYA 4YNQA 2HB5A 4B9MA 1NKEA 1Q9YA 4M3TA 1N6QA 3HT3A 1KVBA 3ITHA 1EETA 1TV6A 4N47A 2R7YA 4RW8A 1NKCA 1RNHA 2ETJA 4DU1A 1VSJA 3AVHA 4HUEA 1EKEA 4CJWA 4CHPA 1KFSA 1A5VA 4CEFA 4FJ8A 5HRPA 3KKSA 1ASWA 1BHLA 3F9KA 3IS9A 3RMCA 3ZT1A 4E1MA 5E41A 4FZYA 4KO0A 1JLGA 4FLUA 4FM1A 3C95A 4BWMA 3AO4A 3MEDA 4I9LA 4B9NA 4LSNA 2HNYA 3KD1E 4FJ7A 2FBXA 1T03A 1VSIA 4DMNA 4ELVA 2F8TA 1RBTA 1A5XA 3AVLA 3RR7A 4OKEA 2VWJA 3V9WA 3V9UA 3K5NA 3SQ0A 2P1JA 1BGXT 4CERA 3KLFA 4E7HA 4DFJA 2X74A 3AA3A 2DFHA 4M45A 1TKZA 3KK2A 4BE0A 5HP1A 1SL1A 1JLQA 2Z1HA 4BDPA 3HP6A 4CF2A 2HW3A 3WNFA 4F2RA 1TVRA 3TI0A 2GV9A 1WNSA 1QTMA 1QSYA 4NCGA 1VSEA 2E4LA 4UQGA 3E01A 3CFOA 3NAEA 1B9DA 2ZQBA 2EHGA 3QO9A 2VG6A 3ZT3A 3V9ZA 4CEAA 4CJ3A 4I7FA 1JL1A 3FFIA 3NF9A 3DM2A 5FROA 4FJKA 1RTIA 4AHSA 3CM6A 4IKFA 4Z4HA 2Z1IA 1BIZA 4KHWA 1RILA 1XHXA 4KKOA 4CK2A 3AA4A 1QQCA 1SL2A 1EXQA 1JXBA 1T8EA 4M3XA 3PX0A 1WSJA 3HPOA 1SL0A 2IC3A 4B9UA 1BI4B 2IAJA 4CFAA 4IFVA 4CJEA 4DFKA 4L8RB 2ZD1A 3O3HA 3LP2A 4BE2A 3TAFA 4OKJA 4JRQA 1RBUA 4C8MA 4CFDA 1CZ9A 1KFDA 3OYEA 3OYJA 1YTAA 3KTQA 2OZMA 3VQDA 2WONA 1T7PA 1F21A 2X6NA 3SPZA 1L3SA 4FLWA 4CCHA 3NHGA 3JYTA 1Z26A 2WOMA 4KPYA 4KV8A 1HMVA 4O5BA 1RT5A 1KTQA 1N5YA 5FRMA 2A1RA 2YNGA 1BIUA 5KI6A 4FK4A 4FCYA 4JLHA 4RG8A 1U49A 1LWCA 4Q0BA 3NH0A 4DLGA 3OYGA 1U48A 3LP0A 4F3TA 4NYFA 2HHUA 3ZSZA 2O4IA 3TR8A 1BQNA 3ZSVA 3JSMA 3NE6A 1HJRA 1KCFA 4CHYA 3HPHA 1BQMA 1LWEA 2YV0X 1VSDA 3AVNA 4I2PA 2Q3SA 3LAKA 1NOYA 2AJQA 1VK0A 4FK0A 4CGIA 1C1BA 1HNVA 1WSGA 3VQ9A 4ICLA 5HROA 2QKKA 4F2SA 4CHOA 1S9EA 4E1NA 4DQSA 2HHTA 2O4GA 5C42A 3TAPA 3K58A 3T1AA 1T05A 3AV9A 3IRXA 1REVA 4NYNA 3KLGA 3CYMA 4QOZB 1RBRA 1HRHA 3ZSWA 4FM0A 3U6FA 2DFEA 3B6PA 5D3GA 3NF6A 3AO5A 4CF8A 1TKXA 4RW6A 1TL1A 1A5WA 1W0HA 3NH1A 4YFUA 1WSIA 4DTJA 1ZYQA 1TGOA 1J5OA 4W5NA 3HVTA 1I39A 1SKSA 3LZJA 3T19A 2XO7A 4KHYA 1RT4A 4CJLA 3SCXA 5CZ1A 4IBNA 3RR8A 4N56A 3P1GA 3NBPA 1S9GA 4OJRA 3QNOA 1VSMA 4DU4A 4FLXA 2XRIA 4KHNA 1IKVA 3AVMA 4JS5A 4CECA 1NK4A 2IOCA 1KLMA 3M8PA 3C6UA 4HCBA 5HBMA 3AVKA 3B6OA 4B8AB 3LANA 1TKTA 4CFCA 2RN2A 1B9FA 1WSHA 1X1PA 4ZHRA 3MXIA 4J2EA 1S6QA 4OPJA 4OPKA 4CF0A 1C1CA 4CGHA 3VQEA 2Y1IA 4E0DA 3SYZA 1J53A 1ASVA 4M3ZA 1WSFA 4JRPA 3PY8A 2D0AA 3VQCA 3NCIA 1HPZA 1FKOA 3C6TA 1XHZA 3MEGA 4B9SA 2XY5A 1HQUA 4Z4EA 5CYQA 3CG7A 4CJQA 3HSTB 1L3VA 3PO4A 4FJIA 3EYZA 3QLHA 2G8UA 1ZBUA 1S1UA 1XC9A 3DRRA 5HRNA 1RTDA 4CIEA 3ZT4A 4CJTA 4Q5VA 3K2PA 3QEPA 2BE2A 3DLRA 1L3TA 2KFNA 2KQ2A 3OS1A 3L2VA 1NK6A 4HCCA 2DTUA 4HHTA 4CHQA 4CHNA 3OS0A 1QE1A 3M8QA 3V1QA 3K59A 1KVAA 1XWLA 2P5OA 3MXJA 3G0ZA 1WAJA 3LALA 2GBZA 4IDKA 3A2FA 3HK2A 3KJVA 4C8NA 4KHUA 3L3UA 4G1QA 4FZXC 4M41A 4EP4A 1IKWA 1TK8A 4NCBA 3AO2A 3AVJA 3LAMA 5DMRA 3SQ1A 2KTQA 1KVCA 1UOCA 3OYMA 4FK2A 4PWDA 5FRNA 1VSKA 3OVNA 5SZTA 1D9FA 3UIQA 4OGCA 1J54A 3DOLA 4E7JA 4DTRA 4K8ZA 2G8FA 4WE1A 3VQAA 4FXDA 1W9HA 4EZ6A 1TAUA 4PQUA 2IS3A 4KI4A 4I2QA 4B9LA 2XHBA 3PX4A 4Z4CA 4DQQA 1FKPA 4EP5A 3I8DA 4O4GA 1NK5A 3AVFA 3SJJA 4AHTA 2JLEA 3RRGA 4FW1A 4FJMA 1IO2A 1BCMA 2DFFA 4W5QA 1S6PA 2RF2A 3VQ5A 3V4IA 1ASUA 4CE9A 4F3OA 3HP9A 5KRTA 2IDOA 3RWUA 3K5MA 2Z1JA 3ALYA 3DRSA 3TARA 1CLQA 2HHVA 5KTQA 1B92A 2E6LA 3QEWA 4FLYA 1RDDA 3NF8A 4AHRA 1RDAA 3O3GA 3RMAA 2KZZA 4BWJA 3AA2A 4B08A 3DLHA 4KI6A 1HYZA 4CEDA 3NGYA 3V1OA 4FM2A 3NH2A 3RRHA 1NJXA 4IG0A 3VA3A 3OS2A 4KTQA 2YKNA 1JKHA 1WAFA 1UWBA 5DK5A 5J2NA 3QEIA 5FDLA 2P51A 4FJ9A 4FYDA 3L3VA 1QSLA 3KLEA 4KHSA 3O4QA 4DLEA 2OYQA 3DRPA 3AO3A 4RW9A 1JXEA 5EU7A 4DFPA 4BE1A 2XY8A 4DTPA 4W5OA 1Q8IA 1U47A 2G8WA 1VRUA 1TK0A 1JLCA 1RT1A 1ITGA 2YNHA 1DTTA 4HVJA 1JLBA 3DLEA 1ZBFA 5CY4A 1RT6A 3NF7A 4W5RA 4FLZA 3U3YA 1U45A 2D5RA 3DLBA 1JL2A 2A1SA 3OY9A 2W42A 3TAGA 1WSEA 5HRRA 4LSLA 4E19A 5J1EA 3L8BA 4BACA 1QS4A 4CEEA 1NJYA 4CJRA 3DI6A 1Z25A 4O0JA 4DQPA 1NK7A 2F96A 3OYIA 2G8IA 1BCOA 3PUFA 4KB0A 2Z1GA 2X78A 2VG7A 1CXUA 2I5JA 4B8CA 4CJPA 1QHTA 3F73A 2VG5A 3TAQA 5CZ2A 1X9MA 3ZSXA 4CJ4A 5I42A 2KZMA 1NK0A 3BDPA 4GW6A 2GUIA 2D0BA 3AVCA 3RMDA 3U3GA 4O0IA 1SKRA 2QKBA 3ZCMA 1LWFA 2ATQA 3DLGA 2FBVA 4CF1A 3OYLA 1LV5A 1C0UA 4M3YA 3HL8A 3HPGA 2PYJA 1DTQA 4DTUA 3M8SA 3KD5E 1BI4A 3P83D 1FK9A 4NCAA 1D5AA 4BDZA 3QEXA 2HHQA 4CK3A 3OYNA 3QESA 4CJSA 4Z0UA 4C8OA 2HMIA 2YHAA 4CESA 3OYKA 1S1XA 4DU3A 4OLAA 2B6AA 1HQEA 1NJWA 4OVLA 4CJVA 4LH5A 2IGIA 1IH7A 4CGJA 4OKKA 1QSSA 4QAGA 4FVMA 3SNNA 5C24A 1LW2A 3DMJA 3KK1A 2EX3A 3OYCA 4B9TA 5JS1A 3ZSRA 1SV5A 4RW4A 2YNFA 3V81A 4CIGA 4E7IA 3SUNA 1R0AA 4DS5A 3WNEA 1J9AA 4PY5A 4LY7A 1VSFA 4PA1A 1RT2A 3C94A 3TAMA 3VQ4A 1BL3A 3AVAA 4CJUA 3NGIA 3THVA 4I9QA 2G8VA 4DTOA 1NJZA 3V9SA 4GMJB 1FXXA 4CEBA 1SKWA 4M3RA 1C6VA 4E89A 5J2QA 4DS4A 4FZZA 4FLVA 2HHSA 3QNNA 1NK9A 1S1TA 2D0CA 1C0TA 1NKBA 3NGZA 4DQIA 2JGUA 1KSPA 2B4JA 4CF9A 3EY1A 4B3OA 3LDSA 3MXMA 1RCHA 4J2BA 4CHZA 4KRFA 4Y1CA 4ID1A 4CFBA 3K57A 4FW2A 1UA1A 2XY6A 4MQ3A 2YKMA 3QERA 2KFZA 4B9VA 2G8KA 3MAQA 4CK1A 4F8RA 1JLFA 3NDKA 4DWIA 4CEOA 3LP1A 1UAXA 3BGRA 3V9XA 1L5UA 4FJXA 4CJ5A 4N76A 3AVIA 4O55A 3VQ8A 3K5LA 4E7KA 4ZTJA 4J2AA 3VQBA 4H4MA 4CJKA 3PX6A 4AHVA 1XI1A 2YHBA 1TAQA 4KFBA 3K5OA 3ZT0A 3EZ5A 4MFBA 3V6DA 2BGGA 3DYAA 1NOZA 3TAEA 4DQRA 1S5JA 4DSIA 4IFYA 1LAWA 4AHCA 3MEEA 1U04A 2FC0A 1D8YA 2E6MA 1WLJA 5K14A 4C8LA 1YTUA 1RT3A 4DSJA 1ZBIA 2Y1JA 5SWMA 4ELTA 4AH9A 2NUBA 4JS4A 3HO1A 1RTHA 3TANA 1D9DA 2OPQA 1VSHA 3CM5A 3HYFA 2PYLA 3VN5A 4BDYA 4PUOA 3AVGA 4KHQA 4AHUA 1CZBA 2YNIA 3QIOA 5T7BA 3SUOA 1LW0A 3KLHA 3CFRA 4H8KA 3T3FA 4LD0A 4ZTFA 4M42A 4IG3A 4OGEA 2P5GA 3H08A 1RDBA 2KW4A 2G8HA 3LWLA 1VRTA 3S3NA 3OYBA 3TWHA 2RPIA 4DTSA 3S9HA 3SPYA 5JS2A 3OYHA 1RBVA 3IAYA 2HVHA 4R5PA 1K6YA 2LSNA 2ZE2A 3D45A 4FJHA 3I0SA 5J2PA 1X9SA 1S1VA 5J2MA 1GOAA 1RBSA 2ITGA 3L2RA 3QEVA 1TK5A 4FJGA 4DTXA 4XIUA 1G15A 3KIOA 5HRSA 3IG1A 3WNGA 3HM9A 4C8KA 5C25A 3VQ6A 2F8SA 1RT7A 1NK8A 3OJUA 4N41A 2FBTA 2HVIA 4DSLA 3HJFA 4CGDA 5I3UA 4DSKA 3QINA 2X6SA 1ZBLA 3S3OA 2QK9A 3HXMA 3V1RA 1JLEA 3OYDA 3SZ2A 3VA0A 3PV8A 3SUQA 1KRPA 4J2DA 3M8RA 1JLAA 3ISNC 3ULDA 1HYSA 4CGGA 1BISA 2HHXA 3SV4A 1C0MA 3O3FA 1I3AA 3DLKA 4M3UA 3KK3A 4CEZA 1VSLA 1RTJA 3WNHA 3RTVA 4QCLA 3S3MA 1C1AA 1EP4A 3G10A 4N5SA 3SUPA 3ZT2A 1MU2A 3ZSOA 2OPSA 3SQ2A 4F4KA 1IKXA 5HLFA 3ASMA 3LP3A 4O44A 4DG1A 3CQ8A 2XY7A 3TABA 2PZSA 3HVRA 2FBYA 3CFPA 1ZBHA 3AVBA 5KGXA 3LWMA 1GOBA 2RKIA 1YT3A 4DSEA 1KLNA 3AA5X 3VQ7A 3LZIA 3D0PA 5KGWA 3ZSYA 2PY5A 4FJNA 4H4OA 1RDCA 3KLIA 4DFMA 3SQ4A 3SI6A 1L3UA 4ELUA 4DF4A 4DTMA 4CIFA 2HNZA 3L2QA 1S1WA 3QETA 4KAZA 4W5TA 1GOCA 5KRSA 3MECA 2OPRA 2HNDA 4HUFA 1TL3A 2VWKA 4Y1DA 4DSFA 4DF8A 4FJLA 3AO1A 3L2UA 4AILC 1DLOA 1X9WA 3P5JA 3NFAA 3O4NA 4HUGA 4ID5A 4KTWA 3SV3A 4Z4IA 1HNIA 4TSXA 2OZSA 3L2WA 4LH4A 4DTNA 1O1WA 5CYMA 2OPPA 4HTUA 4Z4FA 3ZSQA 4KREA 3RMBA 1HYVA 1TKDA 1LAVA 1Q9XA 2QXFA 4Z4GA 3LPTA 3OYFA 1Y97A 2BDPA 4E7LA 2DY4A 4FJ5A 1CXQA 1SUQA 4RW7A 4OLBA 4CJFA 4K8XA 3VQQA 1U4BA 4FJJA 4FLTA 1IG9A 1EX4A 3KKRA 3I0RA 2BANA
chains in the Genus database with same CATH superfamily
3OJSA 3ZX3A 3PO5A 3H6EA 1GLEG 4CGFA 3PLAA 5AQTA 4CZLA 1NKEA 1Q9YA 3QICA 1KVBA 4CVNE 4N47A 2R7YA 4U7BA 4IOXA 1VSJA 1KFSA 1P8ZA 3Q7BA 3ATVA 1BOTO 4IJNA 3ZT1A 3R1XA 4NXMK 4HWIA 5EVZA 4EAHD 3C95A 4FLUA 5BRFA 1QVFM 3OW2M 2HNYA 4BR0A 3KD1E 4FJ7A 3P4IA 1VSIA 1OH8A 1RBTA 1MA9B 4DV5K 2P1JA 3H46O 1NGAA 2VGNA 4H0PA 1BO5O 4DV3K 4NCGA 5LY3A 2E4LA 5AZIB 3QBWA 2ZQBA 3CQXA 1BWFO 2ASPA 5JVGL 3FFIA 3NF9A 4FJKA 2E2NA 2UUCK 1XHXA 4KKOA 5BN8A 3AA4A 3PSFA 1WSJA 3HBTA 1BI4B 2A40A 3J7AP 3LP2A 3VESA 4JRQA 3M5RA 3OYEA 1ATRA 1YTAA 3WEEB 2QWRA 3VQDA 1T7PA 1KAZA 3SPZA 4J8FA 3NHGA 4PKHA 4A62A 2FSNA 3EE9A 3QDKA 5GAHP 4JI7K 4FK4A 2ZGYA 1U49A 3LP0A 4JI6K 3LDNA 4NYFA 4F3TA 4H5NA 3ZSVA 3JSMA 1RFQA 5GIPA 4CBWA 5M1FA 1VSDA 4CZGA 2Q3SA 4FK0A 4CGIA 1HNVA 1WSGA 4QS9A 4ICLA 4CHOA 4DQSA 2CGLA 5AQMA 2O4GA 3AV9A 5CHIA 1VQON 1OVYA 4QOZB 3ZSWA 5D3GA 3H3NO 3NF6A 3MWPA 1TL1A 1A5WA 1W0HA 4DTJA 4YFUA 1SKSA 3LZJA 2UU9K 2XO7A 4KHYA 3RR8A 3MCPA 1VSMA 1OVQA 2O8DB 2KKZA 4JS5A 4DUZK 3C6UA 4HCBA 3B6OA 5C2FA 3C65A 4H0XB 4FL9A 1WSHA 3E1YA 4J2EA 1S6QA 4OPJA 1OH7A 4BRAA 1C1CA 4CF0A 4CGHA 3SBTA 4E0DA 3SYZA 2QWLA 1WSFA 2D0AA 4JK8A 4Y0WA 1HPZA 5FPNA 3C6TA 3E66A 2XY5A 4K0KK 2V7ZA 4Z4EA 5CYQA 4FJIA 3EYZA 4B9QA 1ZBUA 5HRNA 3OA9A 4CIEA 4Q5VA 2DTUA 4HCCA 2IVNA 2GELA 3IUCA 1KVAA 1VQ7N 3LALA 2GBZA 3A2FA 4C8NA 3I33A 3VEYA 4YOXA 1VQNN 3AO2A 3AVJA 4B3SK 3KVGA 1UOCA 2D4WA 4GKJK 4K8ZA 1TUUA 1TAUA 4EZ6A 3WXLA 4KI4A 3QBXA 3PX4A 3O5BA 4BRLA 3TSPA 3MDQA 3ZX2A 5EX5A 3ID8A 3LM9A 2JLEA 1NG9A 2NRZA 3AAPA 1ASUA 5KRTA 4YOYA 5KQDA 3RWUA 3DRSA 4BG9A 3O9RA 3L0QA 1VQ4N 2HBLA 1SQKA 3O8MA 3RMAA 4H5VA 2QWPA 3AA2A 1HYZA 2KLAA 3NH2A 3A0IX 4BRMA 3IKMA 3RRHA 3I8BA 3MWTA 4BR2A 1SZ2A 2P51A 4FYDA 1YUWA 3L3VA 3KLEA 3DRPA 3U9DA 4IJAA 3H45C 4M7YA 1HX1A 1JXEA 5EU7A 4DFPA 4W5OA 4JI3K 1VRUA 1BDGA 1JLCA 1RT1A 4JKGB 3C6AA 1RT6A 3NF7A 2E2OA 4M3TA 1WSEA 4GKKK 4LSLA 1NJYA 4C23A 1Z25A 2VGMA 3ZEUB 3OYIA 3H3OB 2VG7A 2I5JA 3F73A 3CC7N 1GLCG 3ZSXA 2YHXA 4ISEA 3P39A 2PFUA 2WC9A 3EL2A 5AQPA 4PKIA 5FLXO 1VQ8N 3AY9A 4CF1A 1C0UA 2PYJA 4DTUA 2VQEK 2HHQA 3OYNA 4C8OA 3OYKA 1S1XA 1DT9A 2HMPA 1V4TA 2FSJA 4CJVA 3BY5A 4LH5A 2QEXN 5ADXH 4H5TA 1LW2A 5AZJB 3TTFA 1S22A 3SUNA 2QI2A 4CIGA 3NVKA 1J9AA 4LY7A 3A8YA 3C94A 3TAMA 4CJUA 2CH6A 3CPWM 1ATNA 3V9SA 4YDUC 1KAXA 1FXXA 1U6ZA 5CR4A 2HHSA 2D0CA 3AARA 2B4JA 3RVCA 4WQ5A 1RCHA 4J2BA 3CCUN 4KRFA 4BQLA 5AQVA 4MQ3A 2YKMA 3QERA 3NDKA 3I56N 2O8EA 3MMVA 3BGRA 3V9XA 1L5UA 1QHAA 4O55A 3K5LA 2VCPA 3VEZA 4J2AA 3EZ5A 1IV0A 3TAEA 3G4SN 3MEEA 2FC0A 2E6MA 2F7TA 5LJVA 4DSJA 4ELTA 4JS4A 1IG8A 2OPQA 2WBNA 2PYLA 3VN5A 3AVGA 3M6GA 3M1FA 5T7BA 1LW0A 4JD2B 3KLHA 4ZTFA 2D0PA 4OGEA 2P5GA 2G8HA 3LWLA 1VRTA 3IFRA 3TWHA 4DTSA 4WFAL 3L4IA 3SPYA 3S3NA 2IVPA 2NZTA 1K6YA 2LSNA 3SAGA 3D45A 2AA4A 3D7EO 3I0SA 5M1PA 5J2PA 3DXKB 5JVHL 3ZX0A 4FVUA 1WBDA 1FW6A 4XIUA 3VTHA 3IG1A 4C8KA 5C25A 1QVGM 4H0OA 2FBTA 3Q7CA 4KBOA 3E9LA 4IEIA 1S3XA 3VPZA 3HXMA 4CZJA 2F9TA 3PV8A 3ENOA 3M8RA 1JLAA 1NJIO 4CGGA 3SV4A 3O3FA 4CEZA 1RTJA 5AZIA 3RTVA 4QCLA 3CCQN 3S3MA 1HNWK 1EP4A 4F4KA 4N5SA 4JI0K 4O44A 3J80O 2NNWA 3UB5A 4JI8K 4DV1K 3LWMA 1YT3A 3AA5X 4LFBK 4BREA 4DV6K 5BN9A 1RDCA 3KK7A 2ZJPL 4DTMA 2HNZA 3QETA 2D1KA 4W5TA 3MECA 2OPRA 3CI5A 3WEEA 1TL3A 3CD6N 4Y1DA 4DSFA 4FJLA 3AO1A 3L2UA 1X9WA 4DR1K 4HTLA 3NFAA 2PBDA 4KTWA 2O8BB 1HNIA 1N34K 4DUYK 3N4PA 3GE1A 2OPPA 4Z4FA 3ZSQA 3ZLJA 1GLAG 4Z4GA 1LAVA 2QXFA 3K9KA 2FSKA 2YI1A 1XMOK 4CBUA 1Q82O 3FZLA 5EY4A 2NRHA 2BANA 1YVUA 4NB4A 4E3SA 4LF9K 4KTZA 2E20A 2HHWA 2B5JA 4FO0A 4M3WA 2OA8A 4YNQA 4B9MA 1QQNA 4CBXA 1QZ6A 3MK6A 4ISFA 1KQSM 1HJOA 4PKGA 1GLBG 1Z05A 1RDUA 3HOTA 4RW8A 4OO1J 1RNHA 2ETJA 3AVHA 1EKEA 4CJWA 2O8DA 4FWQA 1BHLA 3IS9A 3RMCA 1VQ5N 5E41A 1NBWA 4KO0A 1JLGA 3QMLA 4B9NA 5DM7L 3MEDA 2IVOA 2E1YA 5C12A 1VQKN 2FBXA 2F8TA 3AVLA 3RR7A 4OKEA 2VWJA 3V9WA 1BGXT 2ZWHA 2X74A 3AA3A 2DFHA 1TKZA 1YITN 4BRFA 1JLQA 2YCHA 2NRTA 2HW3A 4NO7A 4F2RA 3IDHA 3TI0A 2UXBK 3CFOA 4B3MK 1B9DA 4WFBL 4MDAA 3T69A 4DCHA 4CEAA 2ZF5O 1JL1A 5FROA 4L3QA 1RTIA 5AQLA 1KXPA 1BIZA 4DR3K 1RILA 3CHWA 3J7YP 1QQCA 4UY8O 1SL0A 2V7YA 2IAJA 4L8RB 1HKBA 1HKGA 4LF6K 4RCHA 2Q97A 1Z26A 1HMVA 4O5BA 1RT5A 1N5YA 4BRKA 2V51B 5KPZA 4WQ4A 4JKFA 3EE8A 2O4IA 1BQNA 3JXUA 1ILYA 1HKCA 3HPHA 2YV0X 4WCEL 4I2PA 2FF3B 2J4RA 1VK0A 3W3DA 5HROA 4F2SA 4E1NA 5E26A 1G99A 3K58A 4IOAL 1T05A 2W40A 3KLGA 3J7ZO 4JI4K 3T7ZA 4AF1A 4FM0A 3U6FA 4MO4A 3CMAN 3B6PA 4BRHA 2UUAK 4RW6A 1XUPO 1EQYA 3DAWA 1OH5A 3NH1A 4JK9A 4O8KA 4W5NA 5AQSA 1GLFO 1NGCA 4CJLA 4JKGA 4N56A 3SLCA 3AGKA 3NBPA 1S9GA 2RE2A 4DU4A 4FLXA 2XRIA 3AVMA 4JI5K 3VF6A 2IOCA 1KLMA 4O5FA 5HBMA 5M1NA 4MLEA 2P9SB 2RN2A 1B9FA 1X1PA 3ZEUA 4OPKA 4O8UA 1J53A 4JRPA 3VQCA 1FKOA 5M1KA 4B9SA 1C0FA 3TSQA 1NGIA 3CG7A 4CJQA 3PO4A 2G8UA 5BRHA 1XC9A 3VETA 1RTDA 3CCMN 3QEPA 5BR9A 3DLRA 2KQ2A 4HHTA 2NRXA 4CHQA 3OS0A 1QE1A 3V1QA 3K59A 1EO1A 2P5OA 3J81O 3KJVA 4KHUA 4FZXC 5FPMA 1J6ZA 3CETA 4GV9A 4FK2A 1VSKA 1D9FA 4C1NK 3HI0A 2HHTA 5AZJA 1GLJO 4ILHA 4WE1A 4DB3A 4FXDA 4I2QA 3A5MC 2OTLN 2FF6A 2XHBA 1ATSA 4LF4K 2HHHK 1JCFA 3AVFA 1NMNA 1BCMA 1SAZA 5TKWA 2DFFA 1YJNN 5GADP 3THXB 3K5MA 3ALYA 4IZ9A 4AHRA 1RDAA 4BWJA 4B08A 1GLLO 4FM2A 4XH5A 5LMUK 1WAFA 1UWBA 5DK5A 3QEIA 4FJ9A 2EWSA 4KHSA 3O4QA 4DLEA 4NXNK 4FWSA 2XY8A 2G8WA 1DTTA 3ZYYX 3U3YA 5BR8K 3DLBA 3OY9A 2A1SA 5AQJA 5J1EA 3L8BA 3DI6A 2ZJQL 3SK3A 4JD2A 3A5LC 1BCOA 1BG3A 4KB0A 4CJPA 2X78A 1CXUA 2VG5A 3DJCA 2KZMA 5F2RA 2D0BA 1CZAN 3U3GA 3DXKA 4OPHA 3ZCMA 3OYLA 4OPAA 4LF8K 1FK9A 1HNXK 1D5AA 3FR0A 3O9TA 4CK3A 5GAGP 4CJSA 4DHYA 2HMIA 4KH6A 3CJCA 2B6AA 3JAMO 3A5OC 4RWTA 1IBLK 5FPDA 2Q36A 5DM6L 4IFEA 1LOTB 2EX3A 1LCUA 4JV5K 4E7IA 2JWKA 3WNEA 1RT2A 3AVAA 4H0VB 1XC3A 4GMJB 5E84A 1P90A 4R79A 1MWMA 4I6MB 3QNNA 1S1TA 1NK9A 1N32K 4DQIA 3GDQA 3MCAB 3LDSA 3MXMA 4Y1CA 1NGHA 4ID1A 3K57A 2AP1A 3B8AX 3THYB 4BC2A 4CZMA 5BPNA 4CW7B 4YDUA 1XNQK 4KHPK 4CEOA 4GV6A 1UAXA 4KH5A 4JKEA 2O8BA 3AVIA 3NMUA 4AHVA 4G9ZA 2YHBA 3P31A 2A42A 5HL7L 4DQRA 4XH1A 1S5JA 4DSIA 1LAWA 1WLJA 2Q2RA 4C8LA 1YTUA 1RT3A 1Y64A 3CQYA 3O6WA 1ZBIA 2NLXA 3HO1A 1YI2N 1RTHA 2F9WA 1NGFA 3LM2A 4LFCK 3AAQA 1CZBA 3QIOA 5JICA 3SAHA 3T3FA 4LD0A 4IG3A 2GWKA 3VERA 2ZJRL 4R5PA 1X9SA 3J8AA 5J2MA 1TK5A 4NLCA 1G15A 3VEOA 1K8KB 1WUAA 4CZKA 1W2BM 2F8SA 1RT7A 3VF2A 4N41A 4DSLA 5I3UA 3EZWA 2X6SA 3LL3A 2QK9A 3V1RA 1JLEA 2ZGZA 3OYDA 2DPNA 1HYSA 1N33K 3H1VX 4YOVA 3OBWA 3KK3A 1OKJA 3GBTA 4K41A 1C1AA 3WQUA 1QZ5A 1IKXA 5HLFA 1X3NA 4IEEA 4DG1A 3CCJN 3HVRA 1TYQB 2YHYA 3CCSN 2UXDK 3N4QA 3K9JA 5KGXA 2RKIA 1ZBSA 3KZBA 3VQ7A 3D0PA 5KGWA 4FJNA 4H4OA 3KLIA 3SQ4A 1VQ9N 1L3UA 5TKYA 4DF4A 4IXCA 3CERA 5KRSA 1NNEA 2VWKA 1JCEA 5IWAK 1DGKN 4AILC 4FPBA 4LF7K 2BTFA 4BROA 4K43A 1O13A 3L2WA 4LH4A 2OZSA 1O1WA 5CYMA 4FWRA 4HTUA 4A2AA 1Q9XA 2O8CB 3GG4A 3THWB 3VGMA 2ITMA 4E7LA 2DY4A 4FSVA 1BA0A 3EKSA 5A2QO 4CJFA 2Q1NA 3VQQA 2NRWA 4FJJA 1YIJN 5JS2A 1YAGA 5AQKA 3BP8A 4GVMA 1UA0A 5I9EB 3VQPA 3DOKA 1IKYA 4JHDB 2HB5A 2O8FB 3ITHA 1TV6A 1DEJA 4DV7K 3O1BA 4HUEA 1RDWX 1A5VA 4CEFA 4FJ8A 5HRPA 4BR5A 1ASWA 3F9KA 4E1MA 3FE1A 2P9LB 4X62K 4FM1A 4BWMA 2BUPA 1JJ2M 3R9PA 2P9SA 3CCEN 5FPEA 4GY2B 4DMNA 4ELVA 4BR7A 1C0GA 4CERA 3CJBA 3KLFA 4DFJA 4BR4A 3KK2A 4M45A 4BC3A 4BE0A 2Z1HA 4BDPA 4EIAA 3HP6A 1H1VA 4CZHA 3WNFA 3FZFA 2HF3A 3VEVA 2GV9A 4YHHK 5KPRA 1QSYA 1VSEA 4UQGA 3E01A 1OH6A 4JEPA 2F4VK 3V9ZA 2P9UB 2E8AA 3E9OA 3BEXA 2HBMA 4FWLA 3CM6A 4IKFA 4Z4HA 2Z1IA 4KHWA 4V19S 4B1ZA 4CK2A 1SL2A 1EXQA 1JXBA 4M3XA 3PX0A 3HPOA 2G8IA 4B9UA 3WXIA 4CFAA 4IFVA 3M3ZA 2D0OA 4DFKA 4BRPA 3O3HA 4JN4A 3R3LA 4BE2A 4OKJA 1RBUA 3OYJA 1CZ9A 1KFDA 5GAEP 3KTQA 2WONA 1F21A 2X6NA 4CCHA 3JYTA 2WOMA 2I7NA 4KPYA 5FRMA 1BIUA 2GX9A 4JKBA 4FCYA 5AR0A 5BRDA 3THXA 4WF9L 2HHUA 3NE6A 1HJRA 3HZ6A 4FOEA 1NOYA 1C1BA 3VQ9A 2YHWA 3D2EB 3VMFB 3TAPA 3T1AA 1REVA 2YJFA 3CYMA 4CI6A 1RBRA 4BQZA 1HRHA 4MLHA 4A59A 3CC4N 5HOOA 4DKWA 1J5OA 1SS6A 1WSIA 1TGOA 3P38A 1I39A 2ZM6K 3SCXA 1NGEA 5CZ1A 3P1GA 5JMVA 4KHNA 1IKVA 5C2DA 2VWBA 3AVKA 4B8AB 3LANA 2RHKA 1TKTA 5AQIA 4ZHRA 2Y1IA 4BR9A 1NWKA 4FPAA 3VQEA 3TPQA 2OCEA 1ASVA 4IO9L 3PY8A 2WFBA 3NCIA 3C6HA 3MEGA 1HQUA 3FZMA 1L3VA 3WXJA 3QLHA 1YHQN 1VQ6N 2E1ZA 1S1UA 1FJGK 3DRRA 3T1HK 3MN7A 3ZT4A 1S72N 4CJTA 3K2PA 5AQWA 2KFNA 3L2VA 1NK6A 2ASOA 4BRNA 4H5RA 1NLVA 1GLDG 1WAJA 4RTFD 4IDKA 4K42A 4M41A 1BA1A 5M1OA 4NCBA 5AQXA 3SQ1A 3LAMA 5DMRA 1KVCA 3KWGA 2P9KB 3UIQA 2FLOA 4OGCA 3DOLA 4DTRA 2QW9A 1W9HA 4PQUA 2IS3A 4B9LA 5AQZA 2HSTA 4B1VA 1E4GT 1FKPA 3I8DA 4O4GA 1NK5A 1NGBA 3MX2A 3UKRB 3KWIA 4I6MA 1S6PA 3ZETB 3V4IA 4CZFA 4F3OA 2IDOA 3TARA 2Z1JA 1CLQA 4XEIA 1B92A 3CXCM 1VHXA 1RDDA 2YX6A 3NF8A 4C1NI 2QWMA 3D6RA 3THYA 1T44A 3I55N 3O3GA 2KZZA 2E2PA 3DLHA 4KI6A 4CEDA 1NJXA 4IG0A 1N36K 4KTQA 2YKNA 2PAVA 5J2NA 1V4SA 1QSLA 3VGLA 4PHTX 3AO3A 2QA4N 2I7PA 1RGIA 2NRRA 4BE1A 4DTPA 1U47A 1E4FT 4BC5A 1ITGA 2YNHA 3EN9A 1JLBA 3PIPL 4W5RA 3MN6A 4FLZA 4GV3A 4FOIA 2D5RA 2CGJA 1JL2A 3F9MA 2W42A 3IMXA 5HRRA 2CH5A 4E19A 4BACA 1QS4A 3SMPA 4CEEA 4JKCA 1NK7A 2F96A 3U8XA 4B8CA 1QHTA 1HUXA 3TAQA 2A3ZA 4M63C 4LC9B 4CJ4A 1NK0A 3BDPA 2GUIA 3AVCA 3RMDA 3VENA 1SKRA 2HBJA 3TU5A 2FBVA 1LV5A 4M3YA 1K8KA 3HPGA 1DTQA 3KD5E 3QEXA 4B3TK 3QESA 1YF5L 4YOWA 4Z0UA 3LDQA 4B1UB 4CESA 4DU3A 1VQMN 3O08A 1K9MO 4YOUA 4BVOA 4OKKA 4QAGA 3FFKB 4FVMA 2P9NB 5EXWA 5C24A 4BRQA 3DMJA 3KK1A 3OYCA 3ENHA 4B9TA 1NGJA 1SV5A 2HBKA 2YNFA 4RW4A 5AQGA 1R0AA 2ASMA 4CJ7A 3NGIA 3THVA 1BL3A 4KH4A 2G8VA 1VQLN 1TYQA 1C6VA 4BGAA 3EEQA 4FZZA 1C0TA 1HPMA 4DV2K 2JGUA 3PSIA 5KPTA 3ID6A 4CF9A 3EY1A 3SAFA 2P9IB 1YVNA 4CFBA 2XY6A 1YXQA 4LFAK 2KFZA 2G8KA 3F5TA 4CK1A 4F8RA 1JLFA 2GUPA 4DWIA 3LP1A 4FJXA 5BPLA 3T1YK 2UXCK 4E7KA 1NM1A 3MX5A 4ZTJA 3VQBA 4H4MA 3PX6A 1XI1A 5B8HA 4KFBA 2AJQA 3K5OA 4MFBA 5AQHA 3DYAA 2O8CA 4WYBA 3THWA 1R59O 1M90O 4IFYA 2Q0UA 1IBKK 1U04A 1VQPN 4M7XA 3E9PA 4QS7A 4ISGA 3G25A 3DWLA 3TANA 1D9DA 1VSHA 3HYFA 1E3MA 2QM1A 3DXMB 4KHQA 4AHUA 4JKHA 2YNIA 3U4LA 4JHDA 5F1XA 4H8KA 3CFRA 3GOIA 2O8FA 4A61A 3H08A 3OYBA 2RPIA 1D4XA 5C10A 4YY3K 3OYHA 1RBVA 3OBYA 3K0SA 1EWQA 1RBSA 3QFUA 3L2RA 1WB9A 2P9LA 4DTXA 3KIOA 5HRSA 3WNGA 3HM9A 4WQ4C 2NRVA 1NK8A 3GL1A 2HVIA 3W0LA 3FGUA 4DSKA 1ZBLA 5BREA 4B1WB 3S3OA 4AM6A 5AQNA 3SZ2A 3SUQA 1KRPA 4J2DA 3ISNC 3ULDA 1T3VA 3QB0A 1C0MA 3DLKA 4DQ8A 4M3UA 1NGDA 4X65K 4EHUA 3G10A 3SUPA 3ZT2A 1MU2A 3ZSOA 2OPSA 4FWOA 2P9UA 3G71N 3ASMA 3O1WA 1NMDA 2FBYA 4CD1A 3CFPA 4JYAK 1ZBHA 2W6KA 1GOBA 3LZIA 3ZSYA 5LJWA 3HSCA 4CIFA 3L2QA 3RSEB 1S1WA 1NGGA 4DF8A 3UKUA 1DLOA 2VYPA 1WOQA 4HUGA 4ID5A 3SV3A 1Q81O 4A5BA 2HF4A 4TSXA 4DTNA 3CC2N 3RMBA 3DLLL 1TKDA 4F9OA 4BRGA 1CXQA 1SUQA 4DV4K 3LDOA 3D2EA 1EX4A 3KKRA 4ILGB 3VEWA 4CEQA 1QQMA 4KB1A 3QFPA 4MO5A 4X64K 3OYAA 3LPUA 2KHOA 3QIPA 1WN7A 4EZ9A 1U2VB 3C0BA 2P9PA 3HT3A 1N6QA 1EETA 2QWOA 4K25A 1NKCA 4DU1A 3BZCA 4CHPA 3KKSA 4FZYA 3ULEB 3AO4A 4I9LA 1Q18A 4LSNA 3FZHA 1T03A 1A5XA 4AQYK 3V9UA 3K5NA 1XQSC 3SQ0A 4E7HA 1SL1A 5HP1A 3HTVA 4CF2A 3UE5A 4OX9K 1TVRA 3BUZB 4EFHA 1WNSA 1QTMA 1EWRA 3C7NB 3SJHA 4CZIA 3NAEA 1K73O 2EHGA 3QO9A 4DR4K 2VG6A 3ZT3A 4CJ3A 4I7FA 2E88A 3DM2A 4U67L 4AHSA 3OTOK 3A5NC 5LL6Z 1ESVA 2GWJA 1T8EA 3SMSA 2IC3A 4CJEA 1WBBA 2P9KA 2ZD1A 1J5EK 1BU6O 3TAFA 4JKAA 2A5XA 4JNEA 4E1JA 4C8MA 4BG8A 4CFDA 3S41A 2OZMA 3NVMA 4AM7A 1L3SA 4FLWA 3CMEN 4KV8A 3MN9A 1X9JA 1KTQA 3UKRA 2A1RA 2YNGA 4B3RK 5KI6A 3ZETA 3CIPA 4JLHA 4RG8A 1K8AO 1LWCA 4Q0BA 3NH0A 4DLGA 3OYGA 1U48A 1Q7YO 3ZSZA 3TR8A 5KQ8A 1KC8O 1KCFA 4CHYA 1BQMA 1LWEA 3OHRA 4H0YB 3AVNA 3LAKA 2QTDA 2QKKA 1S9EA 5C42A 3IRXA 4NYNA 2DFEA 4JKDA 3AO5A 4CF8A 1TKXA 1HR0K 1ZYQA 2W6LA 3HVTA 3T19A 4JI1K 1RT4A 4IBNA 4OJRA 3QNOA 4CECA 2YJEA 3TTCA 1NK4A 4BRIA 3M8PA 2Q31A 4CFCA 3MXIA 4NLBA 4DR7K 2FXUA 4M3ZA 3CPEA 1M1KO 1T6CA 4GVEA 3ATUA 1XHZA 2GEMA 3VTIA 3HSTB 3ENBA 3KHYA 4H0TB 2Q0RA 4H5WA 3WXKA 2BE2A 1L3TA 3OS1A 4CHNA 3M8QA 1W7AA 3FZKA 5M1QA 3O9QA 1XWLA 3MXJA 3G0ZA 1YJWN 5AFUH 3HK2A 3L3UA 4G1QA 4EP4A 1IKWA 3CJAA 3VGKA 3D2FA 1TK8A 3OYMA 2P9NA 4PWDA 3VOVA 5FRNA 5EOYA 1NU0A 4WFNL 3OVNA 5SZTA 5LMNK 1J54A 4E7JA 1XMQK 5GINA 2G8FA 3VQAA 3L4QA 5F0XA 1BUPA 3R6MA 1HNZK 3O9UA 4Z4CA 4DQQA 4JAXA 4EP5A 3SJJA 4AHTA 3RRGA 4FW1A 4FJMA 1IO2A 4W5QA 2CGKA 2RF2A 3VQ5A 3CCLN 4CE9A 3HP9A 4DR6K 4BRDA 1I94K 2HHVA 2P9IA 3JS6A 5KTQA 2E6LA 3TTDA 3QEWA 4FLYA 4GNIA 4PL8A 5CE3A 3R8EA 1KAYA 3NGYA 3V1OA 3CCVN 3VA3A 3OS2A 2E5LK 1JKHA 1Z6RA 5FDLA 3F2KA 3UKUB 4YOTA 4Z94A 2OYQA 4RW9A 3O9SA 3WXMB 1Q8IA 1TK0A 2E2QA 4HVJA 3DLEA 1TUYA 1ZBFA 5CY4A 5AQQA 1U45A 4DV0K 3TSUA 3TAGA 3DXMA 4EHTA 4CJRA 4JI2K 4O0JA 4DQPA 4B1XB 4MDBA 3PUFA 2Z1GA 1QQOA 3L6QA 5CZ2A 1X9MA 5I42A 4BGBA 2H3GX 5H1SQ 4FWMA 4GW6A 4O0IA 4A5AA 2QKBA 1X3MA 1LWFA 2ATQA 3DLGA 4BY9C 2P9PB 3HL8A 3M8SA 3HM8A 1BI4A 3P83D 4CD3A 4NCAA 4BDZA 4IDHA 2OTJN 5ELZA 5MLCQ 2YHAA 4OLAA 5ADXA 1HQEA 1NJWA 4OVLA 4B1YB 4ILJA 2UUBK 2IGIA 1IH7A 3U9ZA 4CGJA 1IBMK 1QSSA 3SNNA 2JWLA 2QWNA 3WUHA 1VAZA 4WQ5C 2OANA 5JS1A 3ZSRA 3V81A 4PY5A 4H03B 4DS5A 3HRGA 1VSFA 4PA1A 4I9QA 3VQ4A 4DTOA 1NJZA 4CEBA 1SKWA 4BC4A 4M3RA 4XH4A 4E89A 3HOSA 2WTUA 5J2QA 4DS4A 5JLFA 4FLVA 4JK7A 5AQYA 5AFUA 1NKBA 3NGZA 3CJ1A 1KSPA 5AJ3K 4B3OA 3RSEA 4CHZA 1UA1A 4FW2A 4X66K 4BRCA 4DR2K 4B9VA 3MAQA 3PIOL 4CJ5A 4N76A 3VQ8A 4CJKA 1TAQA 1W97L 3ZT0A 4A2BA 3V6DA 2BGGA 1NOZA 4FWPA 4FWKA 4AHCA 1D8YA 5K14A 4PL7A 3WT0A 3H1QA 1MDUB 2A41A 5AQOA 3CJ9A 2WUSA 5SWMA 2Y1JA 4AH9A 2NUBA 4QS8A 2QWQA 4CZEA 4DR5K 3BF1A 3O80A 4PUOA 3CM5A 4BDYA 3BF3A 3SUOA 1U2VA 3AGRA 4M42A 1IJJA 5AQRA 3LDLA 1RDBA 2KW4A 1JCGA 1Q86O 3S9HA 2IIRA 3IAYA 2HVHA 2ZE2A 5AQUA 4FJHA 2BH1A 1S1VA 5GIOA 4IOCL 1GOAA 2ITGA 3QEVA 4FJGA 5C0YA 5JLHA 3ULEA 1ZC6A 3VQ6A 3OJUA 1N8RO 3HJFA 2W41A 4CGDA 3CJ7A 4IWVA 3QINA 3EKUA 3FLCO 5AQFA 3CF5L 3WQTA 3VA0A 4YORA 4FWNA 2HHXA 1BISA 1HLUA 3SBGA 3VEXA 1I3AA 1KD1O 1VSLA 1MWKA 3C7NA 3WNHA 4BVPA 4LF5K 3CCRN 3SQ2A 3LP3A 2XY7A 3CQ8A 2PZSA 2UYTA 3TABA 3VF4A 3AVBA 4DSEA 2KTQA 1KLNA 3MN5A 2PY5A 4IO8A 4DFMA 5BPMA 3SI6A 4ELUA 3EO3A 4KAZA 1GOCA 2HOEA 2HNDA 3D2FB 4HUFA 1ZXOA 1XNRK 3LDPA 4A57A 3BZKA 3P5JA 1DKGD 3O4NA 2VQFK 2O8EB 1YJ9N 3G6EN 4Z4IA 2V52B 2A6AA 4KREA 1HYVA 3LPTA 3OYFA 1Y97A 2BDPA 3O4WA 5C15A 4FJ5A 4RW7A 4OLBA 4K8XA 1U4BA 5IT9O 1T6DA 4FLTA 1IG9A 3I0RA 2GTDA 2QXLA
chains in the Genus database with same CATH topology
4CEQA 3OJSA 4KB1A 1YVUA 4E3SA 4GVMA 3PO5A 4KTZA 1UA0A 3OYAA 3LPUA 3VQPA 2HHWA 2B5JA 3QIPA 3DOKA 1WN7A 4CGFA 4EZ9A 4M3WA 2OA8A 1IKYA 4YNQA 2HB5A 4B9MA 1NKEA 1Q9YA 4M3TA 1N6QA 3HT3A 1KVBA 3ITHA 1EETA 1TV6A 4N47A 2R7YA 4RW8A 1NKCA 1RNHA 2ETJA 4DU1A 1VSJA 3AVHA 4HUEA 1EKEA 4CJWA 4CHPA 1KFSA 1A5VA 4CEFA 4FJ8A 5HRPA 3KKSA 1ASWA 1BHLA 3F9KA 3IS9A 3RMCA 3ZT1A 4E1MA 5E41A 4FZYA 4KO0A 1JLGA 4FLUA 4FM1A 3C95A 4BWMA 3AO4A 3MEDA 4I9LA 4B9NA 4LSNA 2HNYA 3KD1E 4FJ7A 2FBXA 1T03A 1VSIA 4DMNA 4ELVA 2F8TA 1RBTA 1A5XA 3AVLA 3RR7A 4OKEA 2VWJA 3V9WA 3V9UA 3K5NA 3SQ0A 2P1JA 1BGXT 4CERA 3KLFA 4E7HA 4DFJA 2X74A 3AA3A 2DFHA 4M45A 1TKZA 3KK2A 4BE0A 5HP1A 1SL1A 1JLQA 2Z1HA 4BDPA 3HP6A 4CF2A 2HW3A 3WNFA 4F2RA 1TVRA 3TI0A 2GV9A 1WNSA 1QTMA 1QSYA 4NCGA 1VSEA 2E4LA 4UQGA 3E01A 3CFOA 3NAEA 1B9DA 2ZQBA 2EHGA 3QO9A 2VG6A 3ZT3A 3V9ZA 4CEAA 4CJ3A 4I7FA 1JL1A 3FFIA 3NF9A 3DM2A 5FROA 4FJKA 1RTIA 4AHSA 3CM6A 4IKFA 4Z4HA 2Z1IA 1BIZA 4KHWA 1RILA 1XHXA 4KKOA 4CK2A 3AA4A 1QQCA 1SL2A 1EXQA 1JXBA 1T8EA 4M3XA 3PX0A 1WSJA 3HPOA 1SL0A 2IC3A 4B9UA 1BI4B 2IAJA 4CFAA 4IFVA 4CJEA 4DFKA 4L8RB 2ZD1A 3O3HA 3LP2A 4BE2A 3TAFA 4OKJA 4JRQA 1RBUA 4C8MA 4CFDA 1CZ9A 1KFDA 3OYEA 3OYJA 1YTAA 3KTQA 2OZMA 3VQDA 2WONA 1T7PA 1F21A 2X6NA 3SPZA 1L3SA 4FLWA 4CCHA 3NHGA 3JYTA 1Z26A 2WOMA 4KPYA 4KV8A 1HMVA 4O5BA 1RT5A 1KTQA 1N5YA 5FRMA 2A1RA 2YNGA 1BIUA 5KI6A 4FK4A 4FCYA 4JLHA 4RG8A 1U49A 1LWCA 4Q0BA 3NH0A 4DLGA 3OYGA 1U48A 3LP0A 4F3TA 4NYFA 2HHUA 3ZSZA 2O4IA 3TR8A 1BQNA 3ZSVA 3JSMA 3NE6A 1HJRA 1KCFA 4CHYA 3HPHA 1BQMA 1LWEA 2YV0X 1VSDA 3AVNA 4I2PA 2Q3SA 3LAKA 1NOYA 2AJQA 1VK0A 4FK0A 4CGIA 1C1BA 1HNVA 1WSGA 3VQ9A 4ICLA 5HROA 2QKKA 4F2SA 4CHOA 1S9EA 4E1NA 4DQSA 2HHTA 2O4GA 5C42A 3TAPA 3K58A 3T1AA 1T05A 3AV9A 3IRXA 1REVA 4NYNA 3KLGA 3CYMA 4QOZB 1RBRA 1HRHA 3ZSWA 4FM0A 3U6FA 2DFEA 3B6PA 5D3GA 3NF6A 3AO5A 4CF8A 1TKXA 4RW6A 1TL1A 1A5WA 1W0HA 3NH1A 4YFUA 1WSIA 4DTJA 1ZYQA 1TGOA 1J5OA 4W5NA 3HVTA 1I39A 1SKSA 3LZJA 3T19A 2XO7A 4KHYA 1RT4A 4CJLA 3SCXA 5CZ1A 4IBNA 3RR8A 4N56A 3P1GA 3NBPA 1S9GA 4OJRA 3QNOA 1VSMA 4DU4A 4FLXA 2XRIA 4KHNA 1IKVA 3AVMA 4JS5A 4CECA 1NK4A 2IOCA 1KLMA 3M8PA 3C6UA 4HCBA 5HBMA 3AVKA 3B6OA 4B8AB 3LANA 1TKTA 4CFCA 2RN2A 1B9FA 1WSHA 1X1PA 4ZHRA 3MXIA 4J2EA 1S6QA 4OPJA 4OPKA 4CF0A 1C1CA 4CGHA 3VQEA 2Y1IA 4E0DA 3SYZA 1J53A 1ASVA 4M3ZA 1WSFA 4JRPA 3PY8A 2D0AA 3VQCA 3NCIA 1HPZA 1FKOA 3C6TA 1XHZA 3MEGA 4B9SA 2XY5A 1HQUA 4Z4EA 5CYQA 3CG7A 4CJQA 3HSTB 1L3VA 3PO4A 4FJIA 3EYZA 3QLHA 2G8UA 1ZBUA 1S1UA 1XC9A 3DRRA 5HRNA 1RTDA 4CIEA 3ZT4A 4CJTA 4Q5VA 3K2PA 3QEPA 2BE2A 3DLRA 1L3TA 2KFNA 2KQ2A 3OS1A 3L2VA 1NK6A 4HCCA 2DTUA 4HHTA 4CHQA 4CHNA 3OS0A 1QE1A 3M8QA 3V1QA 3K59A 1KVAA 1XWLA 2P5OA 3MXJA 3G0ZA 1WAJA 3LALA 2GBZA 4IDKA 3A2FA 3HK2A 3KJVA 4C8NA 4KHUA 3L3UA 4G1QA 4FZXC 4M41A 4EP4A 1IKWA 1TK8A 4NCBA 3AO2A 3AVJA 3LAMA 5DMRA 3SQ1A 2KTQA 1KVCA 1UOCA 3OYMA 4FK2A 4PWDA 5FRNA 1VSKA 3OVNA 5SZTA 1D9FA 3UIQA 4OGCA 1J54A 3DOLA 4E7JA 4DTRA 4K8ZA 2G8FA 4WE1A 3VQAA 4FXDA 1W9HA 4EZ6A 1TAUA 4PQUA 2IS3A 4KI4A 4I2QA 4B9LA 2XHBA 3PX4A 4Z4CA 4DQQA 1FKPA 4EP5A 3I8DA 4O4GA 1NK5A 3AVFA 3SJJA 4AHTA 2JLEA 3RRGA 4FW1A 4FJMA 1IO2A 1BCMA 2DFFA 4W5QA 1S6PA 2RF2A 3VQ5A 3V4IA 1ASUA 4CE9A 4F3OA 3HP9A 5KRTA 2IDOA 3RWUA 3K5MA 2Z1JA 3ALYA 3DRSA 3TARA 1CLQA 2HHVA 5KTQA 1B92A 2E6LA 3QEWA 4FLYA 1RDDA 3NF8A 4AHRA 1RDAA 3O3GA 3RMAA 2KZZA 4BWJA 3AA2A 4B08A 3DLHA 4KI6A 1HYZA 4CEDA 3NGYA 3V1OA 4FM2A 3NH2A 3RRHA 1NJXA 4IG0A 3VA3A 3OS2A 4KTQA 2YKNA 1JKHA 1WAFA 1UWBA 5DK5A 5J2NA 3QEIA 5FDLA 2P51A 4FJ9A 4FYDA 3L3VA 1QSLA 3KLEA 4KHSA 3O4QA 4DLEA 2OYQA 3DRPA 3AO3A 4RW9A 1JXEA 5EU7A 4DFPA 4BE1A 2XY8A 4DTPA 4W5OA 1Q8IA 1U47A 2G8WA 1VRUA 1TK0A 1JLCA 1RT1A 1ITGA 2YNHA 1DTTA 4HVJA 1JLBA 3DLEA 1ZBFA 5CY4A 1RT6A 3NF7A 4W5RA 4FLZA 3U3YA 1U45A 2D5RA 3DLBA 1JL2A 2A1SA 3OY9A 2W42A 3TAGA 1WSEA 5HRRA 4LSLA 4E19A 5J1EA 3L8BA 4BACA 1QS4A 4CEEA 1NJYA 4CJRA 3DI6A 1Z25A 4O0JA 4DQPA 1NK7A 2F96A 3OYIA 2G8IA 1BCOA 3PUFA 4KB0A 2Z1GA 2X78A 2VG7A 1CXUA 2I5JA 4B8CA 4CJPA 1QHTA 3F73A 2VG5A 3TAQA 5CZ2A 1X9MA 3ZSXA 4CJ4A 5I42A 2KZMA 1NK0A 3BDPA 4GW6A 2GUIA 2D0BA 3AVCA 3RMDA 3U3GA 4O0IA 1SKRA 2QKBA 3ZCMA 1LWFA 2ATQA 3DLGA 2FBVA 4CF1A 3OYLA 1LV5A 1C0UA 4M3YA 3HL8A 3HPGA 2PYJA 1DTQA 4DTUA 3M8SA 3KD5E 1BI4A 3P83D 1FK9A 4NCAA 1D5AA 4BDZA 3QEXA 2HHQA 4CK3A 3OYNA 3QESA 4CJSA 4Z0UA 4C8OA 2HMIA 2YHAA 4CESA 3OYKA 1S1XA 4DU3A 4OLAA 2B6AA 1HQEA 1NJWA 4OVLA 4CJVA 4LH5A 2IGIA 1IH7A 4CGJA 4OKKA 1QSSA 4QAGA 4FVMA 3SNNA 5C24A 1LW2A 3DMJA 3KK1A 2EX3A 3OYCA 4B9TA 5JS1A 3ZSRA 1SV5A 4RW4A 2YNFA 3V81A 4CIGA 4E7IA 3SUNA 1R0AA 4DS5A 3WNEA 1J9AA 4PY5A 4LY7A 1VSFA 4PA1A 1RT2A 3C94A 3TAMA 3VQ4A 1BL3A 3AVAA 4CJUA 3NGIA 3THVA 4I9QA 2G8VA 4DTOA 1NJZA 3V9SA 4GMJB 1FXXA 4CEBA 1SKWA 4M3RA 1C6VA 4E89A 5J2QA 4DS4A 4FZZA 4FLVA 2HHSA 3QNNA 1NK9A 1S1TA 2D0CA 1C0TA 1NKBA 3NGZA 4DQIA 2JGUA 1KSPA 2B4JA 4CF9A 3EY1A 4B3OA 3LDSA 3MXMA 1RCHA 4J2BA 4CHZA 4KRFA 4Y1CA 4ID1A 4CFBA 3K57A 4FW2A 1UA1A 2XY6A 4MQ3A 2YKMA 3QERA 2KFZA 4B9VA 2G8KA 3MAQA 4CK1A 4F8RA 1JLFA 3NDKA 4DWIA 4CEOA 3LP1A 1UAXA 3BGRA 3V9XA 1L5UA 4FJXA 4CJ5A 4N76A 3AVIA 4O55A 3VQ8A 3K5LA 4E7KA 4ZTJA 4J2AA 3VQBA 4H4MA 4CJKA 3PX6A 4AHVA 1XI1A 2YHBA 1TAQA 4KFBA 3K5OA 3ZT0A 3EZ5A 4MFBA 3V6DA 2BGGA 3DYAA 1NOZA 3TAEA 4DQRA 1S5JA 4DSIA 4IFYA 1LAWA 4AHCA 3MEEA 1U04A 2FC0A 1D8YA 2E6MA 1WLJA 5K14A 4C8LA 1YTUA 1RT3A 4DSJA 1ZBIA 2Y1JA 5SWMA 4ELTA 4AH9A 2NUBA 4JS4A 3HO1A 1RTHA 3TANA 1D9DA 2OPQA 1VSHA 3CM5A 3HYFA 2PYLA 3VN5A 4BDYA 4PUOA 3AVGA 4KHQA 4AHUA 1CZBA 2YNIA 3QIOA 5T7BA 3SUOA 1LW0A 3KLHA 3CFRA 4H8KA 3T3FA 4LD0A 4ZTFA 4M42A 4IG3A 4OGEA 2P5GA 3H08A 1RDBA 2KW4A 2G8HA 3LWLA 1VRTA 3S3NA 3OYBA 3TWHA 2RPIA 4DTSA 3S9HA 3SPYA 5JS2A 3OYHA 1RBVA 3IAYA 2HVHA 4R5PA 1K6YA 2LSNA 2ZE2A 3D45A 4FJHA 3I0SA 5J2PA 1X9SA 1S1VA 5J2MA 1GOAA 1RBSA 2ITGA 3L2RA 3QEVA 1TK5A 4FJGA 4DTXA 4XIUA 1G15A 3KIOA 5HRSA 3IG1A 3WNGA 3HM9A 4C8KA 5C25A 3VQ6A 2F8SA 1RT7A 1NK8A 3OJUA 4N41A 2FBTA 2HVIA 4DSLA 3HJFA 4CGDA 5I3UA 4DSKA 3QINA 2X6SA 1ZBLA 3S3OA 2QK9A 3HXMA 3V1RA 1JLEA 3OYDA 3SZ2A 3VA0A 3PV8A 3SUQA 1KRPA 4J2DA 3M8RA 1JLAA 3ISNC 3ULDA 1HYSA 4CGGA 1BISA 2HHXA 3SV4A 1C0MA 3O3FA 1I3AA 3DLKA 4M3UA 3KK3A 4CEZA 1VSLA 1RTJA 3WNHA 3RTVA 4QCLA 3S3MA 1C1AA 1EP4A 3G10A 4N5SA 3SUPA 3ZT2A 1MU2A 3ZSOA 2OPSA 3SQ2A 4F4KA 1IKXA 5HLFA 3ASMA 3LP3A 4O44A 4DG1A 3CQ8A 2XY7A 3TABA 2PZSA 3HVRA 2FBYA 3CFPA 1ZBHA 3AVBA 5KGXA 3LWMA 1GOBA 2RKIA 1YT3A 4DSEA 1KLNA 3AA5X 3VQ7A 3LZIA 3D0PA 5KGWA 3ZSYA 2PY5A 4FJNA 4H4OA 1RDCA 3KLIA 4DFMA 3SQ4A 3SI6A 1L3UA 4ELUA 4DF4A 4DTMA 4CIFA 2HNZA 3L2QA 1S1WA 3QETA 4KAZA 4W5TA 1GOCA 5KRSA 3MECA 2OPRA 2HNDA 4HUFA 1TL3A 2VWKA 4Y1DA 4DSFA 4DF8A 4FJLA 3AO1A 3L2UA 4AILC 1DLOA 1X9WA 3P5JA 3NFAA 3O4NA 4HUGA 4ID5A 4KTWA 3SV3A 4Z4IA 1HNIA 4TSXA 2OZSA 3L2WA 4LH4A 4DTNA 1O1WA 5CYMA 2OPPA 4HTUA 4Z4FA 3ZSQA 4KREA 3RMBA 1HYVA 1TKDA 1LAVA 1Q9XA 2QXFA 4Z4GA 3LPTA 3OYFA 1Y97A 2BDPA 4E7LA 2DY4A 4FJ5A 1CXQA 1SUQA 4RW7A 4OLBA 4CJFA 4K8XA 3VQQA 1U4BA 4FJJA 4FLTA 1IG9A 1EX4A 3KKRA 3I0RA 2BANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CEQ A;  3OJS A;  4KB1 A;  1YVU A;  4E3S A;  4GVM A;  3PO5 A;  4KTZ A;  1UA0 A;  3OYA A;  3LPU A;  3VQP A;  2HHW A;  2B5J A;  3QIP A;  3DOK A;  1WN7 A;  4CGF A;  4EZ9 A;  4M3W A;  2OA8 A;  1IKY A;  4YNQ A;  2HB5 A;  4B9M A;  1NKE A;  1Q9Y A;  4M3T A;  1N6Q A;  3HT3 A;  1KVB A;  3ITH A;  1EET A;  1TV6 A;  4N47 A;  2R7Y A;  4RW8 A;  1NKC A;  1RNH A;  2ETJ A;  4DU1 A;  1VSJ A;  3AVH A;  4HUE A;  1EKE A;  4CJW A;  4CHP A;  1KFS A;  1A5V A;  4CEF A;  4FJ8 A;  5HRP A;  3KKS A;  1ASW A;  1BHL A;  3F9K A;  3IS9 A;  3RMC A;  3ZT1 A;  4E1M A;  5E41 A;  4FZY A;  4KO0 A;  1JLG A;  4FLU A;  4FM1 A;  3C95 A;  4BWM A;  3AO4 A;  3MED A;  4I9L A;  4B9N A;  4LSN A;  2HNY A;  3KD1 E;  4FJ7 A;  2FBX A;  1T03 A;  1VSI A;  4DMN A;  4ELV A;  2F8T A;  1RBT A;  1A5X A;  3AVL A;  3RR7 A;  4OKE A;  2VWJ A;  3V9W A;  3V9U A;  3K5N A;  3SQ0 A;  2P1J A;  1BGX T;  4CER A;  3KLF A;  4E7H A;  4DFJ A;  2X74 A;  3AA3 A;  2DFH A;  4M45 A;  1TKZ A;  3KK2 A;  4BE0 A;  5HP1 A;  1SL1 A;  1JLQ A;  2Z1H A;  4BDP A;  3HP6 A;  4CF2 A;  2HW3 A;  3WNF A;  4F2R A;  1TVR A;  3TI0 A;  2GV9 A;  1WNS A;  1QTM A;  1QSY A;  4NCG A;  1VSE A;  2E4L A;  4UQG A;  3E01 A;  3CFO A;  3NAE A;  1B9D A;  2ZQB A;  2EHG A;  3QO9 A;  2VG6 A;  3ZT3 A;  3V9Z A;  4CEA A;  4CJ3 A;  4I7F A;  1JL1 A;  3FFI A;  3NF9 A;  3DM2 A;  5FRO A;  4FJK A;  1RTI A;  4AHS A;  3CM6 A;  4IKF A;  4Z4H A;  2Z1I A;  1BIZ A;  4KHW A;  1RIL A;  1XHX A;  4KKO A;  4CK2 A;  3AA4 A;  1QQC A;  1SL2 A;  1EXQ A;  1JXB A;  1T8E A;  4M3X A;  3PX0 A;  1WSJ A;  3HPO A;  1SL0 A;  2IC3 A;  4B9U A;  1BI4 B;  2IAJ A;  4CFA A;  4IFV A;  4CJE A;  4DFK A;  4L8R B;  2ZD1 A;  3O3H A;  3LP2 A;  4BE2 A;  3TAF A;  4OKJ A;  4JRQ A;  1RBU A;  4C8M A;  4CFD A;  1CZ9 A;  1KFD A;  3OYE A;  3OYJ A;  1YTA A;  3KTQ A;  2OZM A;  3VQD A;  2WON A;  1T7P A;  1F21 A;  2X6N A;  3SPZ A;  1L3S A;  4FLW A;  4CCH A;  3NHG A;  3JYT A;  1Z26 A;  2WOM A;  4KPY A;  4KV8 A;  1HMV A;  4O5B A;  1RT5 A;  1KTQ A;  1N5Y A;  5FRM A;  2A1R A;  2YNG A;  1BIU A;  5KI6 A;  4FK4 A;  4FCY A;  4JLH A;  4RG8 A;  1U49 A;  1LWC A;  4Q0B A;  3NH0 A;  4DLG A;  3OYG A;  1U48 A;  3LP0 A;  4F3T A;  4NYF A;  2HHU A;  3ZSZ A;  2O4I A;  3TR8 A;  1BQN A;  3ZSV A;  3JSM A;  3NE6 A;  1HJR A;  1KCF A;  4CHY A;  3HPH A;  1BQM A;  1LWE A;  2YV0 X;  1VSD A;  3AVN A;  4I2P A;  2Q3S A;  3LAK A;  1NOY A;  2AJQ A;  1VK0 A;  4FK0 A;  4CGI A;  1C1B A;  1HNV A;  1WSG A;  3VQ9 A;  4ICL A;  5HRO A;  2QKK A;  4F2S A;  4CHO A;  1S9E A;  4E1N A;  4DQS A;  2HHT A;  2O4G A;  5C42 A;  3TAP A;  3K58 A;  3T1A A;  1T05 A;  3AV9 A;  3IRX A;  1REV A;  4NYN A;  3KLG A;  3CYM A;  4QOZ B;  1RBR A;  1HRH A;  3ZSW A;  4FM0 A;  3U6F A;  2DFE A;  3B6P A;  5D3G A;  3NF6 A;  3AO5 A;  4CF8 A;  1TKX A;  4RW6 A;  1TL1 A;  1A5W A;  1W0H A;  3NH1 A;  4YFU A;  1WSI A;  4DTJ A;  1ZYQ A;  1TGO A;  1J5O A;  4W5N A;  3HVT A;  1I39 A;  1SKS A;  3LZJ A;  3T19 A;  2XO7 A;  4KHY A;  1RT4 A;  4CJL A;  3SCX A;  5CZ1 A;  4IBN A;  3RR8 A;  4N56 A;  3P1G A;  3NBP A;  1S9G A;  4OJR A;  3QNO A;  1VSM A;  4DU4 A;  4FLX A;  2XRI A;  4KHN A;  1IKV A;  3AVM A;  4JS5 A;  4CEC A;  1NK4 A;  2IOC A;  1KLM A;  3M8P A;  3C6U A;  4HCB A;  5HBM A;  3AVK A;  3B6O A;  4B8A B;  3LAN A;  1TKT A;  4CFC A;  2RN2 A;  1B9F A;  1WSH A;  1X1P A;  4ZHR A;  3MXI A;  4J2E A;  1S6Q A;  4OPJ A;  4OPK A;  4CF0 A;  1C1C A;  4CGH A;  3VQE A;  2Y1I A;  4E0D A;  3SYZ A;  1J53 A;  1ASV A;  4M3Z A;  1WSF A;  4JRP A;  3PY8 A;  2D0A A;  3VQC A;  3NCI A;  1HPZ A;  1FKO A;  3C6T A;  1XHZ A;  3MEG A;  4B9S A;  2XY5 A;  1HQU A;  4Z4E A;  5CYQ A;  3CG7 A;  4CJQ A;  3HST B;  1L3V A;  3PO4 A;  4FJI A;  3EYZ A;  3QLH A;  2G8U A;  1ZBU A;  1S1U A;  1XC9 A;  3DRR A;  5HRN A;  1RTD A;  4CIE A;  3ZT4 A;  4CJT A;  4Q5V A;  3K2P A;  3QEP A;  2BE2 A;  3DLR A;  1L3T A;  2KFN A;  2KQ2 A;  3OS1 A;  3L2V A;  1NK6 A;  4HCC A;  2DTU A;  4HHT A;  4CHQ A;  4CHN A;  3OS0 A;  1QE1 A;  3M8Q A;  3V1Q A;  3K59 A;  1KVA A;  1XWL A;  2P5O A;  3MXJ A;  3G0Z A;  1WAJ A;  3LAL A;  2GBZ A;  4IDK A;  3A2F A;  3HK2 A;  3KJV A;  4C8N A;  4KHU A;  3L3U A;  4G1Q A;  4FZX C;  4M41 A;  4EP4 A;  1IKW A;  1TK8 A;  4NCB A;  3AO2 A;  3AVJ A;  3LAM A;  5DMR A;  3SQ1 A;  2KTQ A;  1KVC A;  1UOC A;  3OYM A;  4FK2 A;  4PWD A;  5FRN A;  1VSK A;  3OVN A;  5SZT A;  1D9F A;  3UIQ A;  4OGC A;  1J54 A;  3DOL A;  4E7J A;  4DTR A;  4K8Z A;  2G8F A;  4WE1 A;  3VQA A;  4FXD A;  1W9H A;  4EZ6 A;  1TAU A;  4PQU A;  2IS3 A;  4KI4 A;  4I2Q A;  4B9L A;  2XHB A;  3PX4 A;  4Z4C A;  4DQQ A;  1FKP A;  4EP5 A;  3I8D A;  4O4G A;  1NK5 A;  3AVF A;  3SJJ A;  4AHT A;  2JLE A;  3RRG A;  4FW1 A;  4FJM A;  1IO2 A;  1BCM A;  2DFF A;  4W5Q A;  1S6P A;  2RF2 A;  3VQ5 A;  3V4I A;  1ASU A;  4CE9 A;  4F3O A;  3HP9 A;  5KRT A;  2IDO A;  3RWU A;  3K5M A;  2Z1J A;  3ALY A;  3DRS A;  3TAR A;  1CLQ A;  2HHV A;  5KTQ A;  1B92 A;  2E6L A;  3QEW A;  4FLY A;  1RDD A;  3NF8 A;  4AHR A;  1RDA A;  3O3G A;  3RMA A;  2KZZ A;  4BWJ A;  3AA2 A;  4B08 A;  3DLH A;  4KI6 A;  1HYZ A;  4CED A;  3NGY A;  3V1O A;  4FM2 A;  3NH2 A;  3RRH A;  1NJX A;  4IG0 A;  3VA3 A;  3OS2 A;  4KTQ A;  2YKN A;  1JKH A;  1WAF A;  1UWB A;  5DK5 A;  5J2N A;  3QEI A;  5FDL A;  2P51 A;  4FJ9 A;  4FYD A;  3L3V A;  1QSL A;  3KLE A;  4KHS A;  3O4Q A;  4DLE A;  2OYQ A;  3DRP A;  3AO3 A;  4RW9 A;  1JXE A;  5EU7 A;  4DFP A;  4BE1 A;  2XY8 A;  4DTP A;  4W5O A;  1Q8I A;  1U47 A;  2G8W A;  1VRU A;  1TK0 A;  1JLC A;  1RT1 A;  1ITG A;  2YNH A;  1DTT A;  4HVJ A;  1JLB A;  3DLE A;  1ZBF A;  5CY4 A;  1RT6 A;  3NF7 A;  4W5R A;  4FLZ A;  3U3Y A;  1U45 A;  2D5R A;  3DLB A;  1JL2 A;  2A1S A;  3OY9 A;  2W42 A;  3TAG A;  1WSE A;  5HRR A;  4LSL A;  4E19 A;  5J1E A;  3L8B A;  4BAC A;  1QS4 A;  4CEE A;  1NJY A;  4CJR A;  3DI6 A;  1Z25 A;  4O0J A;  4DQP A;  1NK7 A;  2F96 A;  3OYI A;  2G8I A;  1BCO A;  3PUF A;  4KB0 A;  2Z1G A;  2X78 A;  2VG7 A;  1CXU A;  2I5J A;  4B8C A;  4CJP A;  1QHT A;  3F73 A;  2VG5 A;  3TAQ A;  5CZ2 A;  1X9M A;  3ZSX A;  4CJ4 A;  5I42 A;  2KZM A;  1NK0 A;  3BDP A;  4GW6 A;  2GUI A;  2D0B A;  3AVC A;  3RMD A;  3U3G A;  4O0I A;  1SKR A;  2QKB A;  3ZCM A;  1LWF A;  2ATQ A;  3DLG A;  2FBV A;  4CF1 A;  3OYL A;  1LV5 A;  1C0U A;  4M3Y A;  3HL8 A;  3HPG A;  2PYJ A;  1DTQ A;  4DTU A;  3M8S A;  3KD5 E;  1BI4 A;  3P83 D;  1FK9 A;  4NCA A;  1D5A A;  4BDZ A;  3QEX A;  2HHQ A;  4CK3 A;  3OYN A;  3QES A;  4CJS A;  4Z0U A;  4C8O A;  2HMI A;  2YHA A;  4CES A;  3OYK A;  1S1X A;  4DU3 A;  4OLA A;  2B6A A;  1HQE A;  1NJW A;  4OVL A;  4CJV A;  4LH5 A;  2IGI A;  1IH7 A;  4CGJ A;  4OKK A;  1QSS A;  4QAG A;  4FVM A;  3SNN A;  5C24 A;  1LW2 A;  3DMJ A;  3KK1 A;  2EX3 A;  3OYC A;  4B9T A;  5JS1 A;  3ZSR A;  1SV5 A;  4RW4 A;  2YNF A;  3V81 A;  4CIG A;  4E7I A;  3SUN A;  1R0A A;  4DS5 A;  3WNE A;  1J9A A;  4PY5 A;  4LY7 A;  1VSF A;  4PA1 A;  1RT2 A;  3C94 A;  3TAM A;  3VQ4 A;  1BL3 A;  3AVA A;  4CJU A;  3NGI A;  3THV A;  4I9Q A;  2G8V A;  4DTO A;  1NJZ A;  3V9S A;  4GMJ B;  1FXX A;  4CEB A;  1SKW A;  4M3R A;  1C6V A;  4E89 A;  5J2Q A;  4DS4 A;  4FZZ A;  4FLV A;  2HHS A;  3QNN A;  1NK9 A;  1S1T A;  2D0C A;  1C0T A;  1NKB A;  3NGZ A;  4DQI A;  2JGU A;  1KSP A;  2B4J A;  4CF9 A;  3EY1 A;  4B3O A;  3LDS A;  3MXM A;  1RCH A;  4J2B A;  4CHZ A;  4KRF A;  4Y1C A;  4ID1 A;  4CFB A;  3K57 A;  4FW2 A;  1UA1 A;  2XY6 A;  4MQ3 A;  2YKM A;  3QER A;  2KFZ A;  4B9V A;  2G8K A;  3MAQ A;  4CK1 A;  4F8R A;  1JLF A;  3NDK A;  4DWI A;  4CEO A;  3LP1 A;  1UAX A;  3BGR A;  3V9X A;  1L5U A;  4FJX A;  4CJ5 A;  4N76 A;  3AVI A;  4O55 A;  3VQ8 A;  3K5L A;  4E7K A;  4ZTJ A;  4J2A A;  3VQB A;  4H4M A;  4CJK A;  3PX6 A;  4AHV A;  1XI1 A;  2YHB A;  1TAQ A;  4KFB A;  3K5O A;  3ZT0 A;  3EZ5 A;  4MFB A;  3V6D A;  2BGG A;  3DYA A;  1NOZ A;  3TAE A;  4DQR A;  1S5J A;  4DSI A;  4IFY A;  1LAW A;  4AHC A;  3MEE A;  1U04 A;  2FC0 A;  1D8Y A;  2E6M A;  1WLJ A;  5K14 A;  4C8L A;  1YTU A;  1RT3 A;  4DSJ A;  1ZBI A;  2Y1J A;  5SWM A;  4ELT A;  4AH9 A;  2NUB A;  4JS4 A;  3HO1 A;  1RTH A;  3TAN A;  1D9D A;  2OPQ A;  1VSH A;  3CM5 A;  3HYF A;  2PYL A;  3VN5 A;  4BDY A;  4PUO A;  3AVG A;  4KHQ A;  4AHU A;  1CZB A;  2YNI A;  3QIO A;  5T7B A;  3SUO A;  1LW0 A;  3KLH A;  3CFR A;  4H8K A;  3T3F A;  4LD0 A;  4ZTF A;  4M42 A;  4IG3 A;  4OGE A;  2P5G A;  3H08 A;  1RDB A;  2KW4 A;  2G8H A;  3LWL A;  1VRT A;  3S3N A;  3OYB A;  3TWH A;  2RPI A;  4DTS A;  3S9H A;  3SPY A;  5JS2 A;  3OYH A;  1RBV A;  3IAY A;  2HVH A;  4R5P A;  1K6Y A;  2LSN A;  2ZE2 A;  3D45 A;  4FJH A;  3I0S A;  5J2P A;  1X9S A;  1S1V A;  5J2M A;  1GOA A;  1RBS A;  2ITG A;  3L2R A;  3QEV A;  1TK5 A;  4FJG A;  4DTX A;  4XIU A;  1G15 A;  3KIO A;  5HRS A;  3IG1 A;  3WNG A;  3HM9 A;  4C8K A;  5C25 A;  3VQ6 A;  2F8S A;  1RT7 A;  1NK8 A;  3OJU A;  4N41 A;  2FBT A;  2HVI A;  4DSL A;  3HJF A;  4CGD A;  5I3U A;  4DSK A;  3QIN A;  2X6S A;  1ZBL A;  3S3O A;  2QK9 A;  3HXM A;  3V1R A;  1JLE A;  3OYD A;  3SZ2 A;  3VA0 A;  3PV8 A;  3SUQ A;  1KRP A;  4J2D A;  3M8R A;  1JLA A;  3ISN C;  3ULD A;  1HYS A;  4CGG A;  1BIS A;  2HHX A;  3SV4 A;  1C0M A;  3O3F A;  1I3A A;  3DLK A;  4M3U A;  3KK3 A;  4CEZ A;  1VSL A;  1RTJ A;  3WNH A;  3RTV A;  4QCL A;  3S3M A;  1C1A A;  1EP4 A;  3G10 A;  4N5S A;  3SUP A;  3ZT2 A;  1MU2 A;  3ZSO A;  2OPS A;  3SQ2 A;  4F4K A;  1IKX A;  5HLF A;  3ASM A;  3LP3 A;  4O44 A;  4DG1 A;  3CQ8 A;  2XY7 A;  3TAB A;  2PZS A;  3HVR A;  2FBY A;  3CFP A;  1ZBH A;  3AVB A;  5KGX A;  3LWM A;  1GOB A;  2RKI A;  1YT3 A;  4DSE A;  1KLN A;  3AA5 X;  3VQ7 A;  3LZI A;  3D0P A;  5KGW A;  3ZSY A;  2PY5 A;  4FJN A;  4H4O A;  1RDC A;  3KLI A;  4DFM A;  3SQ4 A;  3SI6 A;  1L3U A;  4ELU A;  4DF4 A;  4DTM A;  4CIF A;  2HNZ A;  3L2Q A;  1S1W A;  3QET A;  4KAZ A;  4W5T A;  1GOC A;  5KRS A;  3MEC A;  2OPR A;  2HND A;  4HUF A;  1TL3 A;  2VWK A;  4Y1D A;  4DSF A;  4DF8 A;  4FJL A;  3AO1 A;  3L2U A;  4AIL C;  1DLO A;  1X9W A;  3P5J A;  3NFA A;  3O4N A;  4HUG A;  4ID5 A;  4KTW A;  3SV3 A;  4Z4I A;  1HNI A;  4TSX A;  2OZS A;  3L2W A;  4LH4 A;  4DTN A;  1O1W A;  5CYM A;  2OPP A;  4HTU A;  4Z4F A;  3ZSQ A;  4KRE A;  3RMB A;  1HYV A;  1TKD A;  1LAV A;  1Q9X A;  2QXF A;  4Z4G A;  3LPT A;  3OYF A;  1Y97 A;  2BDP A;  4E7L A;  2DY4 A;  4FJ5 A;  1CXQ A;  1SUQ A;  4RW7 A;  4OLB A;  4CJF A;  4K8X A;  3VQQ A;  1U4B A;  4FJJ A;  4FLT A;  1IG9 A;  1EX4 A;  3KKR A;  3I0R A;  2BAN A; 
#chains in the Genus database with same CATH topology
 3OJS A;  3ZX3 A;  3PO5 A;  3H6E A;  1GLE G;  4CGF A;  3PLA A;  5AQT A;  4CZL A;  1NKE A;  1Q9Y A;  3QIC A;  1KVB A;  4CVN E;  4N47 A;  2R7Y A;  4U7B A;  4IOX A;  1VSJ A;  1KFS A;  1P8Z A;  3Q7B A;  3ATV A;  1BOT O;  4IJN A;  3ZT1 A;  3R1X A;  4NXM K;  4HWI A;  5EVZ A;  4EAH D;  3C95 A;  4FLU A;  5BRF A;  1QVF M;  3OW2 M;  2HNY A;  4BR0 A;  3KD1 E;  4FJ7 A;  3P4I A;  1VSI A;  1OH8 A;  1RBT A;  1MA9 B;  4DV5 K;  2P1J A;  3H46 O;  1NGA A;  2VGN A;  4H0P A;  1BO5 O;  4DV3 K;  4NCG A;  5LY3 A;  2E4L A;  5AZI B;  3QBW A;  2ZQB A;  3CQX A;  1BWF O;  2ASP A;  5JVG L;  3FFI A;  3NF9 A;  4FJK A;  2E2N A;  2UUC K;  1XHX A;  4KKO A;  5BN8 A;  3AA4 A;  3PSF A;  1WSJ A;  3HBT A;  1BI4 B;  2A40 A;  3J7A P;  3LP2 A;  3VES A;  4JRQ A;  3M5R A;  3OYE A;  1ATR A;  1YTA A;  3WEE B;  2QWR A;  3VQD A;  1T7P A;  1KAZ A;  3SPZ A;  4J8F A;  3NHG A;  4PKH A;  4A62 A;  2FSN A;  3EE9 A;  3QDK A;  5GAH P;  4JI7 K;  4FK4 A;  2ZGY A;  1U49 A;  3LP0 A;  4JI6 K;  3LDN A;  4NYF A;  4F3T A;  4H5N A;  3ZSV A;  3JSM A;  1RFQ A;  5GIP A;  4CBW A;  5M1F A;  1VSD A;  4CZG A;  2Q3S A;  4FK0 A;  4CGI A;  1HNV A;  1WSG A;  4QS9 A;  4ICL A;  4CHO A;  4DQS A;  2CGL A;  5AQM A;  2O4G A;  3AV9 A;  5CHI A;  1VQO N;  1OVY A;  4QOZ B;  3ZSW A;  5D3G A;  3H3N O;  3NF6 A;  3MWP A;  1TL1 A;  1A5W A;  1W0H A;  4DTJ A;  4YFU A;  1SKS A;  3LZJ A;  2UU9 K;  2XO7 A;  4KHY A;  3RR8 A;  3MCP A;  1VSM A;  1OVQ A;  2O8D B;  2KKZ A;  4JS5 A;  4DUZ K;  3C6U A;  4HCB A;  3B6O A;  5C2F A;  3C65 A;  4H0X B;  4FL9 A;  1WSH A;  3E1Y A;  4J2E A;  1S6Q A;  4OPJ A;  1OH7 A;  4BRA A;  1C1C A;  4CF0 A;  4CGH A;  3SBT A;  4E0D A;  3SYZ A;  2QWL A;  1WSF A;  2D0A A;  4JK8 A;  4Y0W A;  1HPZ A;  5FPN A;  3C6T A;  3E66 A;  2XY5 A;  4K0K K;  2V7Z A;  4Z4E A;  5CYQ A;  4FJI A;  3EYZ A;  4B9Q A;  1ZBU A;  5HRN A;  3OA9 A;  4CIE A;  4Q5V A;  2DTU A;  4HCC A;  2IVN A;  2GEL A;  3IUC A;  1KVA A;  1VQ7 N;  3LAL A;  2GBZ A;  3A2F A;  4C8N A;  3I33 A;  3VEY A;  4YOX A;  1VQN N;  3AO2 A;  3AVJ A;  4B3S K;  3KVG A;  1UOC A;  2D4W A;  4GKJ K;  4K8Z A;  1TUU A;  1TAU A;  4EZ6 A;  3WXL A;  4KI4 A;  3QBX A;  3PX4 A;  3O5B A;  4BRL A;  3TSP A;  3MDQ A;  3ZX2 A;  5EX5 A;  3ID8 A;  3LM9 A;  2JLE A;  1NG9 A;  2NRZ A;  3AAP A;  1ASU A;  5KRT A;  4YOY A;  5KQD A;  3RWU A;  3DRS A;  4BG9 A;  3O9R A;  3L0Q A;  1VQ4 N;  2HBL A;  1SQK A;  3O8M A;  3RMA A;  4H5V A;  2QWP A;  3AA2 A;  1HYZ A;  2KLA A;  3NH2 A;  3A0I X;  4BRM A;  3IKM A;  3RRH A;  3I8B A;  3MWT A;  4BR2 A;  1SZ2 A;  2P51 A;  4FYD A;  1YUW A;  3L3V A;  3KLE A;  3DRP A;  3U9D A;  4IJA A;  3H45 C;  4M7Y A;  1HX1 A;  1JXE A;  5EU7 A;  4DFP A;  4W5O A;  4JI3 K;  1VRU A;  1BDG A;  1JLC A;  1RT1 A;  4JKG B;  3C6A A;  1RT6 A;  3NF7 A;  2E2O A;  4M3T A;  1WSE A;  4GKK K;  4LSL A;  1NJY A;  4C23 A;  1Z25 A;  2VGM A;  3ZEU B;  3OYI A;  3H3O B;  2VG7 A;  2I5J A;  3F73 A;  3CC7 N;  1GLC G;  3ZSX A;  2YHX A;  4ISE A;  3P39 A;  2PFU A;  2WC9 A;  3EL2 A;  5AQP A;  4PKI A;  5FLX O;  1VQ8 N;  3AY9 A;  4CF1 A;  1C0U A;  2PYJ A;  4DTU A;  2VQE K;  2HHQ A;  3OYN A;  4C8O A;  3OYK A;  1S1X A;  1DT9 A;  2HMP A;  1V4T A;  2FSJ A;  4CJV A;  3BY5 A;  4LH5 A;  2QEX N;  5ADX H;  4H5T A;  1LW2 A;  5AZJ B;  3TTF A;  1S22 A;  3SUN A;  2QI2 A;  4CIG A;  3NVK A;  1J9A A;  4LY7 A;  3A8Y A;  3C94 A;  3TAM A;  4CJU A;  2CH6 A;  3CPW M;  1ATN A;  3V9S A;  4YDU C;  1KAX A;  1FXX A;  1U6Z A;  5CR4 A;  2HHS A;  2D0C A;  3AAR A;  2B4J A;  3RVC A;  4WQ5 A;  1RCH A;  4J2B A;  3CCU N;  4KRF A;  4BQL A;  5AQV A;  4MQ3 A;  2YKM A;  3QER A;  3NDK A;  3I56 N;  2O8E A;  3MMV A;  3BGR A;  3V9X A;  1L5U A;  1QHA A;  4O55 A;  3K5L A;  2VCP A;  3VEZ A;  4J2A A;  3EZ5 A;  1IV0 A;  3TAE A;  3G4S N;  3MEE A;  2FC0 A;  2E6M A;  2F7T A;  5LJV A;  4DSJ A;  4ELT A;  4JS4 A;  1IG8 A;  2OPQ A;  2WBN A;  2PYL A;  3VN5 A;  3AVG A;  3M6G A;  3M1F A;  5T7B A;  1LW0 A;  4JD2 B;  3KLH A;  4ZTF A;  2D0P A;  4OGE A;  2P5G A;  2G8H A;  3LWL A;  1VRT A;  3IFR A;  3TWH A;  4DTS A;  4WFA L;  3L4I A;  3SPY A;  3S3N A;  2IVP A;  2NZT A;  1K6Y A;  2LSN A;  3SAG A;  3D45 A;  2AA4 A;  3D7E O;  3I0S A;  5M1P A;  5J2P A;  3DXK B;  5JVH L;  3ZX0 A;  4FVU A;  1WBD A;  1FW6 A;  4XIU A;  3VTH A;  3IG1 A;  4C8K A;  5C25 A;  1QVG M;  4H0O A;  2FBT A;  3Q7C A;  4KBO A;  3E9L A;  4IEI A;  1S3X A;  3VPZ A;  3HXM A;  4CZJ A;  2F9T A;  3PV8 A;  3ENO A;  3M8R A;  1JLA A;  1NJI O;  4CGG A;  3SV4 A;  3O3F A;  4CEZ A;  1RTJ A;  5AZI A;  3RTV A;  4QCL A;  3CCQ N;  3S3M A;  1HNW K;  1EP4 A;  4F4K A;  4N5S A;  4JI0 K;  4O44 A;  3J80 O;  2NNW A;  3UB5 A;  4JI8 K;  4DV1 K;  3LWM A;  1YT3 A;  3AA5 X;  4LFB K;  4BRE A;  4DV6 K;  5BN9 A;  1RDC A;  3KK7 A;  2ZJP L;  4DTM A;  2HNZ A;  3QET A;  2D1K A;  4W5T A;  3MEC A;  2OPR A;  3CI5 A;  3WEE A;  1TL3 A;  3CD6 N;  4Y1D A;  4DSF A;  4FJL A;  3AO1 A;  3L2U A;  1X9W A;  4DR1 K;  4HTL A;  3NFA A;  2PBD A;  4KTW A;  2O8B B;  1HNI A;  1N34 K;  4DUY K;  3N4P A;  3GE1 A;  2OPP A;  4Z4F A;  3ZSQ A;  3ZLJ A;  1GLA G;  4Z4G A;  1LAV A;  2QXF A;  3K9K A;  2FSK A;  2YI1 A;  1XMO K;  4CBU A;  1Q82 O;  3FZL A;  5EY4 A;  2NRH A;  2BAN A;  1YVU A;  4NB4 A;  4E3S A;  4LF9 K;  4KTZ A;  2E20 A;  2HHW A;  2B5J A;  4FO0 A;  4M3W A;  2OA8 A;  4YNQ A;  4B9M A;  1QQN A;  4CBX A;  1QZ6 A;  3MK6 A;  4ISF A;  1KQS M;  1HJO A;  4PKG A;  1GLB G;  1Z05 A;  1RDU A;  3HOT A;  4RW8 A;  4OO1 J;  1RNH A;  2ETJ A;  3AVH A;  1EKE A;  4CJW A;  2O8D A;  4FWQ A;  1BHL A;  3IS9 A;  3RMC A;  1VQ5 N;  5E41 A;  1NBW A;  4KO0 A;  1JLG A;  3QML A;  4B9N A;  5DM7 L;  3MED A;  2IVO A;  2E1Y A;  5C12 A;  1VQK N;  2FBX A;  2F8T A;  3AVL A;  3RR7 A;  4OKE A;  2VWJ A;  3V9W A;  1BGX T;  2ZWH A;  2X74 A;  3AA3 A;  2DFH A;  1TKZ A;  1YIT N;  4BRF A;  1JLQ A;  2YCH A;  2NRT A;  2HW3 A;  4NO7 A;  4F2R A;  3IDH A;  3TI0 A;  2UXB K;  3CFO A;  4B3M K;  1B9D A;  4WFB L;  4MDA A;  3T69 A;  4DCH A;  4CEA A;  2ZF5 O;  1JL1 A;  5FRO A;  4L3Q A;  1RTI A;  5AQL A;  1KXP A;  1BIZ A;  4DR3 K;  1RIL A;  3CHW A;  3J7Y P;  1QQC A;  4UY8 O;  1SL0 A;  2V7Y A;  2IAJ A;  4L8R B;  1HKB A;  1HKG A;  4LF6 K;  4RCH A;  2Q97 A;  1Z26 A;  1HMV A;  4O5B A;  1RT5 A;  1N5Y A;  4BRK A;  2V51 B;  5KPZ A;  4WQ4 A;  4JKF A;  3EE8 A;  2O4I A;  1BQN A;  3JXU A;  1ILY A;  1HKC A;  3HPH A;  2YV0 X;  4WCE L;  4I2P A;  2FF3 B;  2J4R A;  1VK0 A;  3W3D A;  5HRO A;  4F2S A;  4E1N A;  5E26 A;  1G99 A;  3K58 A;  4IOA L;  1T05 A;  2W40 A;  3KLG A;  3J7Z O;  4JI4 K;  3T7Z A;  4AF1 A;  4FM0 A;  3U6F A;  4MO4 A;  3CMA N;  3B6P A;  4BRH A;  2UUA K;  4RW6 A;  1XUP O;  1EQY A;  3DAW A;  1OH5 A;  3NH1 A;  4JK9 A;  4O8K A;  4W5N A;  5AQS A;  1GLF O;  1NGC A;  4CJL A;  4JKG A;  4N56 A;  3SLC A;  3AGK A;  3NBP A;  1S9G A;  2RE2 A;  4DU4 A;  4FLX A;  2XRI A;  3AVM A;  4JI5 K;  3VF6 A;  2IOC A;  1KLM A;  4O5F A;  5HBM A;  5M1N A;  4MLE A;  2P9S B;  2RN2 A;  1B9F A;  1X1P A;  3ZEU A;  4OPK A;  4O8U A;  1J53 A;  4JRP A;  3VQC A;  1FKO A;  5M1K A;  4B9S A;  1C0F A;  3TSQ A;  1NGI A;  3CG7 A;  4CJQ A;  3PO4 A;  2G8U A;  5BRH A;  1XC9 A;  3VET A;  1RTD A;  3CCM N;  3QEP A;  5BR9 A;  3DLR A;  2KQ2 A;  4HHT A;  2NRX A;  4CHQ A;  3OS0 A;  1QE1 A;  3V1Q A;  3K59 A;  1EO1 A;  2P5O A;  3J81 O;  3KJV A;  4KHU A;  4FZX C;  5FPM A;  1J6Z A;  3CET A;  4GV9 A;  4FK2 A;  1VSK A;  1D9F A;  4C1N K;  3HI0 A;  2HHT A;  5AZJ A;  1GLJ O;  4ILH A;  4WE1 A;  4DB3 A;  4FXD A;  4I2Q A;  3A5M C;  2OTL N;  2FF6 A;  2XHB A;  1ATS A;  4LF4 K;  2HHH K;  1JCF A;  3AVF A;  1NMN A;  1BCM A;  1SAZ A;  5TKW A;  2DFF A;  1YJN N;  5GAD P;  3THX B;  3K5M A;  3ALY A;  4IZ9 A;  4AHR A;  1RDA A;  4BWJ A;  4B08 A;  1GLL O;  4FM2 A;  4XH5 A;  5LMU K;  1WAF A;  1UWB A;  5DK5 A;  3QEI A;  4FJ9 A;  2EWS A;  4KHS A;  3O4Q A;  4DLE A;  4NXN K;  4FWS A;  2XY8 A;  2G8W A;  1DTT A;  3ZYY X;  3U3Y A;  5BR8 K;  3DLB A;  3OY9 A;  2A1S A;  5AQJ A;  5J1E A;  3L8B A;  3DI6 A;  2ZJQ L;  3SK3 A;  4JD2 A;  3A5L C;  1BCO A;  1BG3 A;  4KB0 A;  4CJP A;  2X78 A;  1CXU A;  2VG5 A;  3DJC A;  2KZM A;  5F2R A;  2D0B A;  1CZA N;  3U3G A;  3DXK A;  4OPH A;  3ZCM A;  3OYL A;  4OPA A;  4LF8 K;  1FK9 A;  1HNX K;  1D5A A;  3FR0 A;  3O9T A;  4CK3 A;  5GAG P;  4CJS A;  4DHY A;  2HMI A;  4KH6 A;  3CJC A;  2B6A A;  3JAM O;  3A5O C;  4RWT A;  1IBL K;  5FPD A;  2Q36 A;  5DM6 L;  4IFE A;  1LOT B;  2EX3 A;  1LCU A;  4JV5 K;  4E7I A;  2JWK A;  3WNE A;  1RT2 A;  3AVA A;  4H0V B;  1XC3 A;  4GMJ B;  5E84 A;  1P90 A;  4R79 A;  1MWM A;  4I6M B;  3QNN A;  1S1T A;  1NK9 A;  1N32 K;  4DQI A;  3GDQ A;  3MCA B;  3LDS A;  3MXM A;  4Y1C A;  1NGH A;  4ID1 A;  3K57 A;  2AP1 A;  3B8A X;  3THY B;  4BC2 A;  4CZM A;  5BPN A;  4CW7 B;  4YDU A;  1XNQ K;  4KHP K;  4CEO A;  4GV6 A;  1UAX A;  4KH5 A;  4JKE A;  2O8B A;  3AVI A;  3NMU A;  4AHV A;  4G9Z A;  2YHB A;  3P31 A;  2A42 A;  5HL7 L;  4DQR A;  4XH1 A;  1S5J A;  4DSI A;  1LAW A;  1WLJ A;  2Q2R A;  4C8L A;  1YTU A;  1RT3 A;  1Y64 A;  3CQY A;  3O6W A;  1ZBI A;  2NLX A;  3HO1 A;  1YI2 N;  1RTH A;  2F9W A;  1NGF A;  3LM2 A;  4LFC K;  3AAQ A;  1CZB A;  3QIO A;  5JIC A;  3SAH A;  3T3F A;  4LD0 A;  4IG3 A;  2GWK A;  3VER A;  2ZJR L;  4R5P A;  1X9S A;  3J8A A;  5J2M A;  1TK5 A;  4NLC A;  1G15 A;  3VEO A;  1K8K B;  1WUA A;  4CZK A;  1W2B M;  2F8S A;  1RT7 A;  3VF2 A;  4N41 A;  4DSL A;  5I3U A;  3EZW A;  2X6S A;  3LL3 A;  2QK9 A;  3V1R A;  1JLE A;  2ZGZ A;  3OYD A;  2DPN A;  1HYS A;  1N33 K;  3H1V X;  4YOV A;  3OBW A;  3KK3 A;  1OKJ A;  3GBT A;  4K41 A;  1C1A A;  3WQU A;  1QZ5 A;  1IKX A;  5HLF A;  1X3N A;  4IEE A;  4DG1 A;  3CCJ N;  3HVR A;  1TYQ B;  2YHY A;  3CCS N;  2UXD K;  3N4Q A;  3K9J A;  5KGX A;  2RKI A;  1ZBS A;  3KZB A;  3VQ7 A;  3D0P A;  5KGW A;  4FJN A;  4H4O A;  3KLI A;  3SQ4 A;  1VQ9 N;  1L3U A;  5TKY A;  4DF4 A;  4IXC A;  3CER A;  5KRS A;  1NNE A;  2VWK A;  1JCE A;  5IWA K;  1DGK N;  4AIL C;  4FPB A;  4LF7 K;  2BTF A;  4BRO A;  4K43 A;  1O13 A;  3L2W A;  4LH4 A;  2OZS A;  1O1W A;  5CYM A;  4FWR A;  4HTU A;  4A2A A;  1Q9X A;  2O8C B;  3GG4 A;  3THW B;  3VGM A;  2ITM A;  4E7L A;  2DY4 A;  4FSV A;  1BA0 A;  3EKS A;  5A2Q O;  4CJF A;  2Q1N A;  3VQQ A;  2NRW A;  4FJJ A;  1YIJ N;  5JS2 A;  1YAG A;  5AQK A;  3BP8 A;  4GVM A;  1UA0 A;  5I9E B;  3VQP A;  3DOK A;  1IKY A;  4JHD B;  2HB5 A;  2O8F B;  3ITH A;  1TV6 A;  1DEJ A;  4DV7 K;  3O1B A;  4HUE A;  1RDW X;  1A5V A;  4CEF A;  4FJ8 A;  5HRP A;  4BR5 A;  1ASW A;  3F9K A;  4E1M A;  3FE1 A;  2P9L B;  4X62 K;  4FM1 A;  4BWM A;  2BUP A;  1JJ2 M;  3R9P A;  2P9S A;  3CCE N;  5FPE A;  4GY2 B;  4DMN A;  4ELV A;  4BR7 A;  1C0G A;  4CER A;  3CJB A;  3KLF A;  4DFJ A;  4BR4 A;  3KK2 A;  4M45 A;  4BC3 A;  4BE0 A;  2Z1H A;  4BDP A;  4EIA A;  3HP6 A;  1H1V A;  4CZH A;  3WNF A;  3FZF A;  2HF3 A;  3VEV A;  2GV9 A;  4YHH K;  5KPR A;  1QSY A;  1VSE A;  4UQG A;  3E01 A;  1OH6 A;  4JEP A;  2F4V K;  3V9Z A;  2P9U B;  2E8A A;  3E9O A;  3BEX A;  2HBM A;  4FWL A;  3CM6 A;  4IKF A;  4Z4H A;  2Z1I A;  4KHW A;  4V19 S;  4B1Z A;  4CK2 A;  1SL2 A;  1EXQ A;  1JXB A;  4M3X A;  3PX0 A;  3HPO A;  2G8I A;  4B9U A;  3WXI A;  4CFA A;  4IFV A;  3M3Z A;  2D0O A;  4DFK A;  4BRP A;  3O3H A;  4JN4 A;  3R3L A;  4BE2 A;  4OKJ A;  1RBU A;  3OYJ A;  1CZ9 A;  1KFD A;  5GAE P;  3KTQ A;  2WON A;  1F21 A;  2X6N A;  4CCH A;  3JYT A;  2WOM A;  2I7N A;  4KPY A;  5FRM A;  1BIU A;  2GX9 A;  4JKB A;  4FCY A;  5AR0 A;  5BRD A;  3THX A;  4WF9 L;  2HHU A;  3NE6 A;  1HJR A;  3HZ6 A;  4FOE A;  1NOY A;  1C1B A;  3VQ9 A;  2YHW A;  3D2E B;  3VMF B;  3TAP A;  3T1A A;  1REV A;  2YJF A;  3CYM A;  4CI6 A;  1RBR A;  4BQZ A;  1HRH A;  4MLH A;  4A59 A;  3CC4 N;  5HOO A;  4DKW A;  1J5O A;  1SS6 A;  1WSI A;  1TGO A;  3P38 A;  1I39 A;  2ZM6 K;  3SCX A;  1NGE A;  5CZ1 A;  3P1G A;  5JMV A;  4KHN A;  1IKV A;  5C2D A;  2VWB A;  3AVK A;  4B8A B;  3LAN A;  2RHK A;  1TKT A;  5AQI A;  4ZHR A;  2Y1I A;  4BR9 A;  1NWK A;  4FPA A;  3VQE A;  3TPQ A;  2OCE A;  1ASV A;  4IO9 L;  3PY8 A;  2WFB A;  3NCI A;  3C6H A;  3MEG A;  1HQU A;  3FZM A;  1L3V A;  3WXJ A;  3QLH A;  1YHQ N;  1VQ6 N;  2E1Z A;  1S1U A;  1FJG K;  3DRR A;  3T1H K;  3MN7 A;  3ZT4 A;  1S72 N;  4CJT A;  3K2P A;  5AQW A;  2KFN A;  3L2V A;  1NK6 A;  2ASO A;  4BRN A;  4H5R A;  1NLV A;  1GLD G;  1WAJ A;  4RTF D;  4IDK A;  4K42 A;  4M41 A;  1BA1 A;  5M1O A;  4NCB A;  5AQX A;  3SQ1 A;  3LAM A;  5DMR A;  1KVC A;  3KWG A;  2P9K B;  3UIQ A;  2FLO A;  4OGC A;  3DOL A;  4DTR A;  2QW9 A;  1W9H A;  4PQU A;  2IS3 A;  4B9L A;  5AQZ A;  2HST A;  4B1V A;  1E4G T;  1FKP A;  3I8D A;  4O4G A;  1NK5 A;  1NGB A;  3MX2 A;  3UKR B;  3KWI A;  4I6M A;  1S6P A;  3ZET B;  3V4I A;  4CZF A;  4F3O A;  2IDO A;  3TAR A;  2Z1J A;  1CLQ A;  4XEI A;  1B92 A;  3CXC M;  1VHX A;  1RDD A;  2YX6 A;  3NF8 A;  4C1N I;  2QWM A;  3D6R A;  3THY A;  1T44 A;  3I55 N;  3O3G A;  2KZZ A;  2E2P A;  3DLH A;  4KI6 A;  4CED A;  1NJX A;  4IG0 A;  1N36 K;  4KTQ A;  2YKN A;  2PAV A;  5J2N A;  1V4S A;  1QSL A;  3VGL A;  4PHT X;  3AO3 A;  2QA4 N;  2I7P A;  1RGI A;  2NRR A;  4BE1 A;  4DTP A;  1U47 A;  1E4F T;  4BC5 A;  1ITG A;  2YNH A;  3EN9 A;  1JLB A;  3PIP L;  4W5R A;  3MN6 A;  4FLZ A;  4GV3 A;  4FOI A;  2D5R A;  2CGJ A;  1JL2 A;  3F9M A;  2W42 A;  3IMX A;  5HRR A;  2CH5 A;  4E19 A;  4BAC A;  1QS4 A;  3SMP A;  4CEE A;  4JKC A;  1NK7 A;  2F96 A;  3U8X A;  4B8C A;  1QHT A;  1HUX A;  3TAQ A;  2A3Z A;  4M63 C;  4LC9 B;  4CJ4 A;  1NK0 A;  3BDP A;  2GUI A;  3AVC A;  3RMD A;  3VEN A;  1SKR A;  2HBJ A;  3TU5 A;  2FBV A;  1LV5 A;  4M3Y A;  1K8K A;  3HPG A;  1DTQ A;  3KD5 E;  3QEX A;  4B3T K;  3QES A;  1YF5 L;  4YOW A;  4Z0U A;  3LDQ A;  4B1U B;  4CES A;  4DU3 A;  1VQM N;  3O08 A;  1K9M O;  4YOU A;  4BVO A;  4OKK A;  4QAG A;  3FFK B;  4FVM A;  2P9N B;  5EXW A;  5C24 A;  4BRQ A;  3DMJ A;  3KK1 A;  3OYC A;  3ENH A;  4B9T A;  1NGJ A;  1SV5 A;  2HBK A;  2YNF A;  4RW4 A;  5AQG A;  1R0A A;  2ASM A;  4CJ7 A;  3NGI A;  3THV A;  1BL3 A;  4KH4 A;  2G8V A;  1VQL N;  1TYQ A;  1C6V A;  4BGA A;  3EEQ A;  4FZZ A;  1C0T A;  1HPM A;  4DV2 K;  2JGU A;  3PSI A;  5KPT A;  3ID6 A;  4CF9 A;  3EY1 A;  3SAF A;  2P9I B;  1YVN A;  4CFB A;  2XY6 A;  1YXQ A;  4LFA K;  2KFZ A;  2G8K A;  3F5T A;  4CK1 A;  4F8R A;  1JLF A;  2GUP A;  4DWI A;  3LP1 A;  4FJX A;  5BPL A;  3T1Y K;  2UXC K;  4E7K A;  1NM1 A;  3MX5 A;  4ZTJ A;  3VQB A;  4H4M A;  3PX6 A;  1XI1 A;  5B8H A;  4KFB A;  2AJQ A;  3K5O A;  4MFB A;  5AQH A;  3DYA A;  2O8C A;  4WYB A;  3THW A;  1R59 O;  1M90 O;  4IFY A;  2Q0U A;  1IBK K;  1U04 A;  1VQP N;  4M7X A;  3E9P A;  4QS7 A;  4ISG A;  3G25 A;  3DWL A;  3TAN A;  1D9D A;  1VSH A;  3HYF A;  1E3M A;  2QM1 A;  3DXM B;  4KHQ A;  4AHU A;  4JKH A;  2YNI A;  3U4L A;  4JHD A;  5F1X A;  4H8K A;  3CFR A;  3GOI A;  2O8F A;  4A61 A;  3H08 A;  3OYB A;  2RPI A;  1D4X A;  5C10 A;  4YY3 K;  3OYH A;  1RBV A;  3OBY A;  3K0S A;  1EWQ A;  1RBS A;  3QFU A;  3L2R A;  1WB9 A;  2P9L A;  4DTX A;  3KIO A;  5HRS A;  3WNG A;  3HM9 A;  4WQ4 C;  2NRV A;  1NK8 A;  3GL1 A;  2HVI A;  3W0L A;  3FGU A;  4DSK A;  1ZBL A;  5BRE A;  4B1W B;  3S3O A;  4AM6 A;  5AQN A;  3SZ2 A;  3SUQ A;  1KRP A;  4J2D A;  3ISN C;  3ULD A;  1T3V A;  3QB0 A;  1C0M A;  3DLK A;  4DQ8 A;  4M3U A;  1NGD A;  4X65 K;  4EHU A;  3G10 A;  3SUP A;  3ZT2 A;  1MU2 A;  3ZSO A;  2OPS A;  4FWO A;  2P9U A;  3G71 N;  3ASM A;  3O1W A;  1NMD A;  2FBY A;  4CD1 A;  3CFP A;  4JYA K;  1ZBH A;  2W6K A;  1GOB A;  3LZI A;  3ZSY A;  5LJW A;  3HSC A;  4CIF A;  3L2Q A;  3RSE B;  1S1W A;  1NGG A;  4DF8 A;  3UKU A;  1DLO A;  2VYP A;  1WOQ A;  4HUG A;  4ID5 A;  3SV3 A;  1Q81 O;  4A5B A;  2HF4 A;  4TSX A;  4DTN A;  3CC2 N;  3RMB A;  3DLL L;  1TKD A;  4F9O A;  4BRG A;  1CXQ A;  1SUQ A;  4DV4 K;  3LDO A;  3D2E A;  1EX4 A;  3KKR A;  4ILG B;  3VEW A;  4CEQ A;  1QQM A;  4KB1 A;  3QFP A;  4MO5 A;  4X64 K;  3OYA A;  3LPU A;  2KHO A;  3QIP A;  1WN7 A;  4EZ9 A;  1U2V B;  3C0B A;  2P9P A;  3HT3 A;  1N6Q A;  1EET A;  2QWO A;  4K25 A;  1NKC A;  4DU1 A;  3BZC A;  4CHP A;  3KKS A;  4FZY A;  3ULE B;  3AO4 A;  4I9L A;  1Q18 A;  4LSN A;  3FZH A;  1T03 A;  1A5X A;  4AQY K;  3V9U A;  3K5N A;  1XQS C;  3SQ0 A;  4E7H A;  1SL1 A;  5HP1 A;  3HTV A;  4CF2 A;  3UE5 A;  4OX9 K;  1TVR A;  3BUZ B;  4EFH A;  1WNS A;  1QTM A;  1EWR A;  3C7N B;  3SJH A;  4CZI A;  3NAE A;  1K73 O;  2EHG A;  3QO9 A;  4DR4 K;  2VG6 A;  3ZT3 A;  4CJ3 A;  4I7F A;  2E88 A;  3DM2 A;  4U67 L;  4AHS A;  3OTO K;  3A5N C;  5LL6 Z;  1ESV A;  2GWJ A;  1T8E A;  3SMS A;  2IC3 A;  4CJE A;  1WBB A;  2P9K A;  2ZD1 A;  1J5E K;  1BU6 O;  3TAF A;  4JKA A;  2A5X A;  4JNE A;  4E1J A;  4C8M A;  4BG8 A;  4CFD A;  3S41 A;  2OZM A;  3NVM A;  4AM7 A;  1L3S A;  4FLW A;  3CME N;  4KV8 A;  3MN9 A;  1X9J A;  1KTQ A;  3UKR A;  2A1R A;  2YNG A;  4B3R K;  5KI6 A;  3ZET A;  3CIP A;  4JLH A;  4RG8 A;  1K8A O;  1LWC A;  4Q0B A;  3NH0 A;  4DLG A;  3OYG A;  1U48 A;  1Q7Y O;  3ZSZ A;  3TR8 A;  5KQ8 A;  1KC8 O;  1KCF A;  4CHY A;  1BQM A;  1LWE A;  3OHR A;  4H0Y B;  3AVN A;  3LAK A;  2QTD A;  2QKK A;  1S9E A;  5C42 A;  3IRX A;  4NYN A;  2DFE A;  4JKD A;  3AO5 A;  4CF8 A;  1TKX A;  1HR0 K;  1ZYQ A;  2W6L A;  3HVT A;  3T19 A;  4JI1 K;  1RT4 A;  4IBN A;  4OJR A;  3QNO A;  4CEC A;  2YJE A;  3TTC A;  1NK4 A;  4BRI A;  3M8P A;  2Q31 A;  4CFC A;  3MXI A;  4NLB A;  4DR7 K;  2FXU A;  4M3Z A;  3CPE A;  1M1K O;  1T6C A;  4GVE A;  3ATU A;  1XHZ A;  2GEM A;  3VTI A;  3HST B;  3ENB A;  3KHY A;  4H0T B;  2Q0R A;  4H5W A;  3WXK A;  2BE2 A;  1L3T A;  3OS1 A;  4CHN A;  3M8Q A;  1W7A A;  3FZK A;  5M1Q A;  3O9Q A;  1XWL A;  3MXJ A;  3G0Z A;  1YJW N;  5AFU H;  3HK2 A;  3L3U A;  4G1Q A;  4EP4 A;  1IKW A;  3CJA A;  3VGK A;  3D2F A;  1TK8 A;  3OYM A;  2P9N A;  4PWD A;  3VOV A;  5FRN A;  5EOY A;  1NU0 A;  4WFN L;  3OVN A;  5SZT A;  5LMN K;  1J54 A;  4E7J A;  1XMQ K;  5GIN A;  2G8F A;  3VQA A;  3L4Q A;  5F0X A;  1BUP A;  3R6M A;  1HNZ K;  3O9U A;  4Z4C A;  4DQQ A;  4JAX A;  4EP5 A;  3SJJ A;  4AHT A;  3RRG A;  4FW1 A;  4FJM A;  1IO2 A;  4W5Q A;  2CGK A;  2RF2 A;  3VQ5 A;  3CCL N;  4CE9 A;  3HP9 A;  4DR6 K;  4BRD A;  1I94 K;  2HHV A;  2P9I A;  3JS6 A;  5KTQ A;  2E6L A;  3TTD A;  3QEW A;  4FLY A;  4GNI A;  4PL8 A;  5CE3 A;  3R8E A;  1KAY A;  3NGY A;  3V1O A;  3CCV N;  3VA3 A;  3OS2 A;  2E5L K;  1JKH A;  1Z6R A;  5FDL A;  3F2K A;  3UKU B;  4YOT A;  4Z94 A;  2OYQ A;  4RW9 A;  3O9S A;  3WXM B;  1Q8I A;  1TK0 A;  2E2Q A;  4HVJ A;  3DLE A;  1TUY A;  1ZBF A;  5CY4 A;  5AQQ A;  1U45 A;  4DV0 K;  3TSU A;  3TAG A;  3DXM A;  4EHT A;  4CJR A;  4JI2 K;  4O0J A;  4DQP A;  4B1X B;  4MDB A;  3PUF A;  2Z1G A;  1QQO A;  3L6Q A;  5CZ2 A;  1X9M A;  5I42 A;  4BGB A;  2H3G X;  5H1S Q;  4FWM A;  4GW6 A;  4O0I A;  4A5A A;  2QKB A;  1X3M A;  1LWF A;  2ATQ A;  3DLG A;  4BY9 C;  2P9P B;  3HL8 A;  3M8S A;  3HM8 A;  1BI4 A;  3P83 D;  4CD3 A;  4NCA A;  4BDZ A;  4IDH A;  2OTJ N;  5ELZ A;  5MLC Q;  2YHA A;  4OLA A;  5ADX A;  1HQE A;  1NJW A;  4OVL A;  4B1Y B;  4ILJ A;  2UUB K;  2IGI A;  1IH7 A;  3U9Z A;  4CGJ A;  1IBM K;  1QSS A;  3SNN A;  2JWL A;  2QWN A;  3WUH A;  1VAZ A;  4WQ5 C;  2OAN A;  5JS1 A;  3ZSR A;  3V81 A;  4PY5 A;  4H03 B;  4DS5 A;  3HRG A;  1VSF A;  4PA1 A;  4I9Q A;  3VQ4 A;  4DTO A;  1NJZ A;  4CEB A;  1SKW A;  4BC4 A;  4M3R A;  4XH4 A;  4E89 A;  3HOS A;  2WTU A;  5J2Q A;  4DS4 A;  5JLF A;  4FLV A;  4JK7 A;  5AQY A;  5AFU A;  1NKB A;  3NGZ A;  3CJ1 A;  1KSP A;  5AJ3 K;  4B3O A;  3RSE A;  4CHZ A;  1UA1 A;  4FW2 A;  4X66 K;  4BRC A;  4DR2 K;  4B9V A;  3MAQ A;  3PIO L;  4CJ5 A;  4N76 A;  3VQ8 A;  4CJK A;  1TAQ A;  1W97 L;  3ZT0 A;  4A2B A;  3V6D A;  2BGG A;  1NOZ A;  4FWP A;  4FWK A;  4AHC A;  1D8Y A;  5K14 A;  4PL7 A;  3WT0 A;  3H1Q A;  1MDU B;  2A41 A;  5AQO A;  3CJ9 A;  2WUS A;  5SWM A;  2Y1J A;  4AH9 A;  2NUB A;  4QS8 A;  2QWQ A;  4CZE A;  4DR5 K;  3BF1 A;  3O80 A;  4PUO A;  3CM5 A;  4BDY A;  3BF3 A;  3SUO A;  1U2V A;  3AGR A;  4M42 A;  1IJJ A;  5AQR A;  3LDL A;  1RDB A;  2KW4 A;  1JCG A;  1Q86 O;  3S9H A;  2IIR A;  3IAY A;  2HVH A;  2ZE2 A;  5AQU A;  4FJH A;  2BH1 A;  1S1V A;  5GIO A;  4IOC L;  1GOA A;  2ITG A;  3QEV A;  4FJG A;  5C0Y A;  5JLH A;  3ULE A;  1ZC6 A;  3VQ6 A;  3OJU A;  1N8R O;  3HJF A;  2W41 A;  4CGD A;  3CJ7 A;  4IWV A;  3QIN A;  3EKU A;  3FLC O;  5AQF A;  3CF5 L;  3WQT A;  3VA0 A;  4YOR A;  4FWN A;  2HHX A;  1BIS A;  1HLU A;  3SBG A;  3VEX A;  1I3A A;  1KD1 O;  1VSL A;  1MWK A;  3C7N A;  3WNH A;  4BVP A;  4LF5 K;  3CCR N;  3SQ2 A;  3LP3 A;  2XY7 A;  3CQ8 A;  2PZS A;  2UYT A;  3TAB A;  3VF4 A;  3AVB A;  4DSE A;  2KTQ A;  1KLN A;  3MN5 A;  2PY5 A;  4IO8 A;  4DFM A;  5BPM A;  3SI6 A;  4ELU A;  3EO3 A;  4KAZ A;  1GOC A;  2HOE A;  2HND A;  3D2F B;  4HUF A;  1ZXO A;  1XNR K;  3LDP A;  4A57 A;  3BZK A;  3P5J A;  1DKG D;  3O4N A;  2VQF K;  2O8E B;  1YJ9 N;  3G6E N;  4Z4I A;  2V52 B;  2A6A A;  4KRE A;  1HYV A;  3LPT A;  3OYF A;  1Y97 A;  2BDP A;  3O4W A;  5C15 A;  4FJ5 A;  4RW7 A;  4OLB A;  4K8X A;  1U4B A;  5IT9 O;  1T6D A;  4FLT A;  1IG9 A;  3I0R A;  2GTD A;  2QXL A; 
#chains in the Genus database with same CATH homology
 4CEQ A;  3OJS A;  4KB1 A;  1YVU A;  4E3S A;  4GVM A;  3PO5 A;  4KTZ A;  1UA0 A;  3OYA A;  3LPU A;  3VQP A;  2HHW A;  2B5J A;  3QIP A;  3DOK A;  1WN7 A;  4CGF A;  4EZ9 A;  4M3W A;  2OA8 A;  1IKY A;  4YNQ A;  2HB5 A;  4B9M A;  1NKE A;  1Q9Y A;  4M3T A;  1N6Q A;  3HT3 A;  1KVB A;  3ITH A;  1EET A;  1TV6 A;  4N47 A;  2R7Y A;  4RW8 A;  1NKC A;  1RNH A;  2ETJ A;  4DU1 A;  1VSJ A;  3AVH A;  4HUE A;  1EKE A;  4CJW A;  4CHP A;  1KFS A;  1A5V A;  4CEF A;  4FJ8 A;  5HRP A;  3KKS A;  1ASW A;  1BHL A;  3F9K A;  3IS9 A;  3RMC A;  3ZT1 A;  4E1M A;  5E41 A;  4FZY A;  4KO0 A;  1JLG A;  4FLU A;  4FM1 A;  3C95 A;  4BWM A;  3AO4 A;  3MED A;  4I9L A;  4B9N A;  4LSN A;  2HNY A;  3KD1 E;  4FJ7 A;  2FBX A;  1T03 A;  1VSI A;  4DMN A;  4ELV A;  2F8T A;  1RBT A;  1A5X A;  3AVL A;  3RR7 A;  4OKE A;  2VWJ A;  3V9W A;  3V9U A;  3K5N A;  3SQ0 A;  2P1J A;  1BGX T;  4CER A;  3KLF A;  4E7H A;  4DFJ A;  2X74 A;  3AA3 A;  2DFH A;  4M45 A;  1TKZ A;  3KK2 A;  4BE0 A;  5HP1 A;  1SL1 A;  1JLQ A;  2Z1H A;  4BDP A;  3HP6 A;  4CF2 A;  2HW3 A;  3WNF A;  4F2R A;  1TVR A;  3TI0 A;  2GV9 A;  1WNS A;  1QTM A;  1QSY A;  4NCG A;  1VSE A;  2E4L A;  4UQG A;  3E01 A;  3CFO A;  3NAE A;  1B9D A;  2ZQB A;  2EHG A;  3QO9 A;  2VG6 A;  3ZT3 A;  3V9Z A;  4CEA A;  4CJ3 A;  4I7F A;  1JL1 A;  3FFI A;  3NF9 A;  3DM2 A;  5FRO A;  4FJK A;  1RTI A;  4AHS A;  3CM6 A;  4IKF A;  4Z4H A;  2Z1I A;  1BIZ A;  4KHW A;  1RIL A;  1XHX A;  4KKO A;  4CK2 A;  3AA4 A;  1QQC A;  1SL2 A;  1EXQ A;  1JXB A;  1T8E A;  4M3X A;  3PX0 A;  1WSJ A;  3HPO A;  1SL0 A;  2IC3 A;  4B9U A;  1BI4 B;  2IAJ A;  4CFA A;  4IFV A;  4CJE A;  4DFK A;  4L8R B;  2ZD1 A;  3O3H A;  3LP2 A;  4BE2 A;  3TAF A;  4OKJ A;  4JRQ A;  1RBU A;  4C8M A;  4CFD A;  1CZ9 A;  1KFD A;  3OYE A;  3OYJ A;  1YTA A;  3KTQ A;  2OZM A;  3VQD A;  2WON A;  1T7P A;  1F21 A;  2X6N A;  3SPZ A;  1L3S A;  4FLW A;  4CCH A;  3NHG A;  3JYT A;  1Z26 A;  2WOM A;  4KPY A;  4KV8 A;  1HMV A;  4O5B A;  1RT5 A;  1KTQ A;  1N5Y A;  5FRM A;  2A1R A;  2YNG A;  1BIU A;  5KI6 A;  4FK4 A;  4FCY A;  4JLH A;  4RG8 A;  1U49 A;  1LWC A;  4Q0B A;  3NH0 A;  4DLG A;  3OYG A;  1U48 A;  3LP0 A;  4F3T A;  4NYF A;  2HHU A;  3ZSZ A;  2O4I A;  3TR8 A;  1BQN A;  3ZSV A;  3JSM A;  3NE6 A;  1HJR A;  1KCF A;  4CHY A;  3HPH A;  1BQM A;  1LWE A;  2YV0 X;  1VSD A;  3AVN A;  4I2P A;  2Q3S A;  3LAK A;  1NOY A;  2AJQ A;  1VK0 A;  4FK0 A;  4CGI A;  1C1B A;  1HNV A;  1WSG A;  3VQ9 A;  4ICL A;  5HRO A;  2QKK A;  4F2S A;  4CHO A;  1S9E A;  4E1N A;  4DQS A;  2HHT A;  2O4G A;  5C42 A;  3TAP A;  3K58 A;  3T1A A;  1T05 A;  3AV9 A;  3IRX A;  1REV A;  4NYN A;  3KLG A;  3CYM A;  4QOZ B;  1RBR A;  1HRH A;  3ZSW A;  4FM0 A;  3U6F A;  2DFE A;  3B6P A;  5D3G A;  3NF6 A;  3AO5 A;  4CF8 A;  1TKX A;  4RW6 A;  1TL1 A;  1A5W A;  1W0H A;  3NH1 A;  4YFU A;  1WSI A;  4DTJ A;  1ZYQ A;  1TGO A;  1J5O A;  4W5N A;  3HVT A;  1I39 A;  1SKS A;  3LZJ A;  3T19 A;  2XO7 A;  4KHY A;  1RT4 A;  4CJL A;  3SCX A;  5CZ1 A;  4IBN A;  3RR8 A;  4N56 A;  3P1G A;  3NBP A;  1S9G A;  4OJR A;  3QNO A;  1VSM A;  4DU4 A;  4FLX A;  2XRI A;  4KHN A;  1IKV A;  3AVM A;  4JS5 A;  4CEC A;  1NK4 A;  2IOC A;  1KLM A;  3M8P A;  3C6U A;  4HCB A;  5HBM A;  3AVK A;  3B6O A;  4B8A B;  3LAN A;  1TKT A;  4CFC A;  2RN2 A;  1B9F A;  1WSH A;  1X1P A;  4ZHR A;  3MXI A;  4J2E A;  1S6Q A;  4OPJ A;  4OPK A;  4CF0 A;  1C1C A;  4CGH A;  3VQE A;  2Y1I A;  4E0D A;  3SYZ A;  1J53 A;  1ASV A;  4M3Z A;  1WSF A;  4JRP A;  3PY8 A;  2D0A A;  3VQC A;  3NCI A;  1HPZ A;  1FKO A;  3C6T A;  1XHZ A;  3MEG A;  4B9S A;  2XY5 A;  1HQU A;  4Z4E A;  5CYQ A;  3CG7 A;  4CJQ A;  3HST B;  1L3V A;  3PO4 A;  4FJI A;  3EYZ A;  3QLH A;  2G8U A;  1ZBU A;  1S1U A;  1XC9 A;  3DRR A;  5HRN A;  1RTD A;  4CIE A;  3ZT4 A;  4CJT A;  4Q5V A;  3K2P A;  3QEP A;  2BE2 A;  3DLR A;  1L3T A;  2KFN A;  2KQ2 A;  3OS1 A;  3L2V A;  1NK6 A;  4HCC A;  2DTU A;  4HHT A;  4CHQ A;  4CHN A;  3OS0 A;  1QE1 A;  3M8Q A;  3V1Q A;  3K59 A;  1KVA A;  1XWL A;  2P5O A;  3MXJ A;  3G0Z A;  1WAJ A;  3LAL A;  2GBZ A;  4IDK A;  3A2F A;  3HK2 A;  3KJV A;  4C8N A;  4KHU A;  3L3U A;  4G1Q A;  4FZX C;  4M41 A;  4EP4 A;  1IKW A;  1TK8 A;  4NCB A;  3AO2 A;  3AVJ A;  3LAM A;  5DMR A;  3SQ1 A;  2KTQ A;  1KVC A;  1UOC A;  3OYM A;  4FK2 A;  4PWD A;  5FRN A;  1VSK A;  3OVN A;  5SZT A;  1D9F A;  3UIQ A;  4OGC A;  1J54 A;  3DOL A;  4E7J A;  4DTR A;  4K8Z A;  2G8F A;  4WE1 A;  3VQA A;  4FXD A;  1W9H A;  4EZ6 A;  1TAU A;  4PQU A;  2IS3 A;  4KI4 A;  4I2Q A;  4B9L A;  2XHB A;  3PX4 A;  4Z4C A;  4DQQ A;  1FKP A;  4EP5 A;  3I8D A;  4O4G A;  1NK5 A;  3AVF A;  3SJJ A;  4AHT A;  2JLE A;  3RRG A;  4FW1 A;  4FJM A;  1IO2 A;  1BCM A;  2DFF A;  4W5Q A;  1S6P A;  2RF2 A;  3VQ5 A;  3V4I A;  1ASU A;  4CE9 A;  4F3O A;  3HP9 A;  5KRT A;  2IDO A;  3RWU A;  3K5M A;  2Z1J A;  3ALY A;  3DRS A;  3TAR A;  1CLQ A;  2HHV A;  5KTQ A;  1B92 A;  2E6L A;  3QEW A;  4FLY A;  1RDD A;  3NF8 A;  4AHR A;  1RDA A;  3O3G A;  3RMA A;  2KZZ A;  4BWJ A;  3AA2 A;  4B08 A;  3DLH A;  4KI6 A;  1HYZ A;  4CED A;  3NGY A;  3V1O A;  4FM2 A;  3NH2 A;  3RRH A;  1NJX A;  4IG0 A;  3VA3 A;  3OS2 A;  4KTQ A;  2YKN A;  1JKH A;  1WAF A;  1UWB A;  5DK5 A;  5J2N A;  3QEI A;  5FDL A;  2P51 A;  4FJ9 A;  4FYD A;  3L3V A;  1QSL A;  3KLE A;  4KHS A;  3O4Q A;  4DLE A;  2OYQ A;  3DRP A;  3AO3 A;  4RW9 A;  1JXE A;  5EU7 A;  4DFP A;  4BE1 A;  2XY8 A;  4DTP A;  4W5O A;  1Q8I A;  1U47 A;  2G8W A;  1VRU A;  1TK0 A;  1JLC A;  1RT1 A;  1ITG A;  2YNH A;  1DTT A;  4HVJ A;  1JLB A;  3DLE A;  1ZBF A;  5CY4 A;  1RT6 A;  3NF7 A;  4W5R A;  4FLZ A;  3U3Y A;  1U45 A;  2D5R A;  3DLB A;  1JL2 A;  2A1S A;  3OY9 A;  2W42 A;  3TAG A;  1WSE A;  5HRR A;  4LSL A;  4E19 A;  5J1E A;  3L8B A;  4BAC A;  1QS4 A;  4CEE A;  1NJY A;  4CJR A;  3DI6 A;  1Z25 A;  4O0J A;  4DQP A;  1NK7 A;  2F96 A;  3OYI A;  2G8I A;  1BCO A;  3PUF A;  4KB0 A;  2Z1G A;  2X78 A;  2VG7 A;  1CXU A;  2I5J A;  4B8C A;  4CJP A;  1QHT A;  3F73 A;  2VG5 A;  3TAQ A;  5CZ2 A;  1X9M A;  3ZSX A;  4CJ4 A;  5I42 A;  2KZM A;  1NK0 A;  3BDP A;  4GW6 A;  2GUI A;  2D0B A;  3AVC A;  3RMD A;  3U3G A;  4O0I A;  1SKR A;  2QKB A;  3ZCM A;  1LWF A;  2ATQ A;  3DLG A;  2FBV A;  4CF1 A;  3OYL A;  1LV5 A;  1C0U A;  4M3Y A;  3HL8 A;  3HPG A;  2PYJ A;  1DTQ A;  4DTU A;  3M8S A;  3KD5 E;  1BI4 A;  3P83 D;  1FK9 A;  4NCA A;  1D5A A;  4BDZ A;  3QEX A;  2HHQ A;  4CK3 A;  3OYN A;  3QES A;  4CJS A;  4Z0U A;  4C8O A;  2HMI A;  2YHA A;  4CES A;  3OYK A;  1S1X A;  4DU3 A;  4OLA A;  2B6A A;  1HQE A;  1NJW A;  4OVL A;  4CJV A;  4LH5 A;  2IGI A;  1IH7 A;  4CGJ A;  4OKK A;  1QSS A;  4QAG A;  4FVM A;  3SNN A;  5C24 A;  1LW2 A;  3DMJ A;  3KK1 A;  2EX3 A;  3OYC A;  4B9T A;  5JS1 A;  3ZSR A;  1SV5 A;  4RW4 A;  2YNF A;  3V81 A;  4CIG A;  4E7I A;  3SUN A;  1R0A A;  4DS5 A;  3WNE A;  1J9A A;  4PY5 A;  4LY7 A;  1VSF A;  4PA1 A;  1RT2 A;  3C94 A;  3TAM A;  3VQ4 A;  1BL3 A;  3AVA A;  4CJU A;  3NGI A;  3THV A;  4I9Q A;  2G8V A;  4DTO A;  1NJZ A;  3V9S A;  4GMJ B;  1FXX A;  4CEB A;  1SKW A;  4M3R A;  1C6V A;  4E89 A;  5J2Q A;  4DS4 A;  4FZZ A;  4FLV A;  2HHS A;  3QNN A;  1NK9 A;  1S1T A;  2D0C A;  1C0T A;  1NKB A;  3NGZ A;  4DQI A;  2JGU A;  1KSP A;  2B4J A;  4CF9 A;  3EY1 A;  4B3O A;  3LDS A;  3MXM A;  1RCH A;  4J2B A;  4CHZ A;  4KRF A;  4Y1C A;  4ID1 A;  4CFB A;  3K57 A;  4FW2 A;  1UA1 A;  2XY6 A;  4MQ3 A;  2YKM A;  3QER A;  2KFZ A;  4B9V A;  2G8K A;  3MAQ A;  4CK1 A;  4F8R A;  1JLF A;  3NDK A;  4DWI A;  4CEO A;  3LP1 A;  1UAX A;  3BGR A;  3V9X A;  1L5U A;  4FJX A;  4CJ5 A;  4N76 A;  3AVI A;  4O55 A;  3VQ8 A;  3K5L A;  4E7K A;  4ZTJ A;  4J2A A;  3VQB A;  4H4M A;  4CJK A;  3PX6 A;  4AHV A;  1XI1 A;  2YHB A;  1TAQ A;  4KFB A;  3K5O A;  3ZT0 A;  3EZ5 A;  4MFB A;  3V6D A;  2BGG A;  3DYA A;  1NOZ A;  3TAE A;  4DQR A;  1S5J A;  4DSI A;  4IFY A;  1LAW A;  4AHC A;  3MEE A;  1U04 A;  2FC0 A;  1D8Y A;  2E6M A;  1WLJ A;  5K14 A;  4C8L A;  1YTU A;  1RT3 A;  4DSJ A;  1ZBI A;  2Y1J A;  5SWM A;  4ELT A;  4AH9 A;  2NUB A;  4JS4 A;  3HO1 A;  1RTH A;  3TAN A;  1D9D A;  2OPQ A;  1VSH A;  3CM5 A;  3HYF A;  2PYL A;  3VN5 A;  4BDY A;  4PUO A;  3AVG A;  4KHQ A;  4AHU A;  1CZB A;  2YNI A;  3QIO A;  5T7B A;  3SUO A;  1LW0 A;  3KLH A;  3CFR A;  4H8K A;  3T3F A;  4LD0 A;  4ZTF A;  4M42 A;  4IG3 A;  4OGE A;  2P5G A;  3H08 A;  1RDB A;  2KW4 A;  2G8H A;  3LWL A;  1VRT A;  3S3N A;  3OYB A;  3TWH A;  2RPI A;  4DTS A;  3S9H A;  3SPY A;  5JS2 A;  3OYH A;  1RBV A;  3IAY A;  2HVH A;  4R5P A;  1K6Y A;  2LSN A;  2ZE2 A;  3D45 A;  4FJH A;  3I0S A;  5J2P A;  1X9S A;  1S1V A;  5J2M A;  1GOA A;  1RBS A;  2ITG A;  3L2R A;  3QEV A;  1TK5 A;  4FJG A;  4DTX A;  4XIU A;  1G15 A;  3KIO A;  5HRS A;  3IG1 A;  3WNG A;  3HM9 A;  4C8K A;  5C25 A;  3VQ6 A;  2F8S A;  1RT7 A;  1NK8 A;  3OJU A;  4N41 A;  2FBT A;  2HVI A;  4DSL A;  3HJF A;  4CGD A;  5I3U A;  4DSK A;  3QIN A;  2X6S A;  1ZBL A;  3S3O A;  2QK9 A;  3HXM A;  3V1R A;  1JLE A;  3OYD A;  3SZ2 A;  3VA0 A;  3PV8 A;  3SUQ A;  1KRP A;  4J2D A;  3M8R A;  1JLA A;  3ISN C;  3ULD A;  1HYS A;  4CGG A;  1BIS A;  2HHX A;  3SV4 A;  1C0M A;  3O3F A;  1I3A A;  3DLK A;  4M3U A;  3KK3 A;  4CEZ A;  1VSL A;  1RTJ A;  3WNH A;  3RTV A;  4QCL A;  3S3M A;  1C1A A;  1EP4 A;  3G10 A;  4N5S A;  3SUP A;  3ZT2 A;  1MU2 A;  3ZSO A;  2OPS A;  3SQ2 A;  4F4K A;  1IKX A;  5HLF A;  3ASM A;  3LP3 A;  4O44 A;  4DG1 A;  3CQ8 A;  2XY7 A;  3TAB A;  2PZS A;  3HVR A;  2FBY A;  3CFP A;  1ZBH A;  3AVB A;  5KGX A;  3LWM A;  1GOB A;  2RKI A;  1YT3 A;  4DSE A;  1KLN A;  3AA5 X;  3VQ7 A;  3LZI A;  3D0P A;  5KGW A;  3ZSY A;  2PY5 A;  4FJN A;  4H4O A;  1RDC A;  3KLI A;  4DFM A;  3SQ4 A;  3SI6 A;  1L3U A;  4ELU A;  4DF4 A;  4DTM A;  4CIF A;  2HNZ A;  3L2Q A;  1S1W A;  3QET A;  4KAZ A;  4W5T A;  1GOC A;  5KRS A;  3MEC A;  2OPR A;  2HND A;  4HUF A;  1TL3 A;  2VWK A;  4Y1D A;  4DSF A;  4DF8 A;  4FJL A;  3AO1 A;  3L2U A;  4AIL C;  1DLO A;  1X9W A;  3P5J A;  3NFA A;  3O4N A;  4HUG A;  4ID5 A;  4KTW A;  3SV3 A;  4Z4I A;  1HNI A;  4TSX A;  2OZS A;  3L2W A;  4LH4 A;  4DTN A;  1O1W A;  5CYM A;  2OPP A;  4HTU A;  4Z4F A;  3ZSQ A;  4KRE A;  3RMB A;  1HYV A;  1TKD A;  1LAV A;  1Q9X A;  2QXF A;  4Z4G A;  3LPT A;  3OYF A;  1Y97 A;  2BDP A;  4E7L A;  2DY4 A;  4FJ5 A;  1CXQ A;  1SUQ A;  4RW7 A;  4OLB A;  4CJF A;  4K8X A;  3VQQ A;  1U4B A;  4FJJ A;  4FLT A;  1IG9 A;  1EX4 A;  3KKR A;  3I0R A;  2BAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...