4CI0C

Electron cryo-microscopy of f420-reducing nife hydrogenase frh
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
280
structure length
280
Chain Sequence
VLGTYKEIVSARSTDREIQKLAQDGGIVTGLLAYALDEGIIEGAVVAGPGEEFWKPQPMVAMSSDELKAAAGTKYTFSPNVMMLKKAVRQYGIEKLGTVAIPCQTMGIRKMQTYPFGVRFLADKIKLLVGIYCMENFPYTSLQTFICEKLGVSMELVEKMDIGKGKFWVYTQDDVLTLPLKETHGYEQAGCKICKDYVAELADVSTGSVGSPDGWSTVITRTDAGDSIFKQAVEAGLFETKPIEEVKPGLGLLEKLAAQKKEKAEKNIAARKEMGLPTPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F420-REDUCING HYDROGENASE, SUBUNIT ALPHA
publication title Atomic Model of the F420-Reducing [Nife] Hydrogenase by Electron Cryo-Electron Microscopy Using a Direct Electron Detector.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 61
structure length 280
sequence length 280
ec nomenclature ec 1.12.98.1: Coenzyme F420 hydrogenase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04422 FrhB_FdhB_N Coenzyme F420 hydrogenase/dehydrogenase, beta subunit N-term
C PF04432 FrhB_FdhB_C Coenzyme F420 hydrogenase/dehydrogenase, beta subunit C terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1030 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ci0C02
4CI0C 4OMFB
chains in the Genus database with same CATH superfamily
1MMGA 2ZGWA 2EJFA 1OI1A 3JCMe 2CP0A 3A8MB 3HKSA 2YUPA 4JS5A 1GFCA 1YITT 1TOVA 1M1KC 2YT6A 3GNGA 1Y7XA 2Z0WA 2CP7A 3CCMQ 3CCUQ 1WYXA 2O4XB 2QGGA 3EGDA 5C6SA 4HVUA 2JJ9A 2BIVA 2EIFA 2GFAA 4F7UE 4M77B 2DD4A 3C0CA 2YXYA 3UF4A 3V7RA 2JVVA 4N4IA 2JTEA 2F5KA 3CMEA 3L2RA 1ABOA 5M9OA 3CCQQ 3MEWA 3JCMV 2EGAA 1UGPB 4BUGA 3I56T 2FL7A 4LD6A 3VYHB 4P5NA 2X35A 3QPHA 3VU3C 2DD5A 2ABLA 1VQ6Q 4KGXB 3FLGA 1Q86C 3M54A 3PTAA 1R8OB 5IXFA 4F14A 2D0NA 4Y91A 2J6KA 3DLMA 2RK1A 1BI3A 2EYQA 3QIIA 2CZ6B 1VQ9Q 2HZYA 2O88A 1MMAA 3ZL7C 1KHIA 4C92A 2I2LA 4KUDK 1TUDA 2K2MA 1JXOA 4O5VA 5CAIA 1PRMC 4MZPA 2KAFA 1BBZA 2CZ7B 3RR6A 1M2VB 1YFNA 2E3HA 4GY5A 3MP8A 4JS4A 2BE7D 2NWMA 3EGUA 3CCVQ 2BZYA 3CXCP 4JPBW 1Q81C 2MPXC 2DL4A 2RN8A 2BZXA 2O01E 4B9XA 5KCHA 3MKDA 4A4EA 3CC4T 2K5IA 3M9QA 3CCRT 5GMKl 1VIEA 2K6DA 2LQKA 2CZ0B 1B34B 3VS1A 5GJVB 5KYWB 3C12A 1Q82R 5LL6S 4X9CA 2QGFB 5HK3A 1SG5A 4GLMA 4RG8A 4LDXA 4J9DA 1KIKA 1SRMA 5IN1A 2YSQA 4LDWA 4M78C 1QVGP 1HXDA 1OX8A 4M77F 3HRSA 4E7IA 1YI2A 2VKNA 2YWWA 4M7DB 3L2QA 4M78D 1RAAB 1NJIR 1HSQA 1WI7A 1HK9A 4A4FA 1W70A 1UGQB 2Y4YA 2HMAA 3PIPA 1K1ZA 1RADB 5FU7B 1QVPA 2B86A 1M3CA 2LCCA 1VYVA 1MGQA 2DXTA 3OSSC 2DL8A 4ELYC 4YTLA 1H3ZA 2DA9A 1RAIB 3FEOA 1NYGA 3OYMA 4LNPA 2OTJA 1T0HA 2M1HA 4ESRA 2JMAA 2ESWA 1E6HA 5IT9E 4FT2A 3CCSQ 4XQ3A 2XD0A 2RJDA 4OB3B 4F7UB 3V8JA 2EGCA 1UHCA 1HYOA 2MYSA 5FROA 5J39A 4PJOC 4XTWA 2LNHB 1KSWA 3SWNA 1HD3A 2CGHA 4IUTA 1VQOT 3VYGA 2QEXT 5GAOp 1ZSZB 1X2QA 2ZPHB 2OX7A 3OYEA 3I55A 3HL8A 2RQVA 1U5SA 1VA7A 1KD1U 2CREA 2RQUA 2X4YA 1YCYA 4EDUA 1WHLA 2QQAA 1OPLA 4PKCC 1RL2A 5D7UA 2LRQA 3SFMA 2LDMA 3UA7A 3UPUA 1LPLA 3C94A 4JLGA 2WSCE 4XU2A 2RJCA 4OMMA 3JCMf 3E2UA 1UJ0A 3NPFA 3M53A 4J5YA 1TU0B 2XDPA 2RO0A 1NBEB 2KNBB 2J7IA 4M75C 5GAMd 3ZFJA 3A1PA 2KGTA 1FWZA 5CKFA 2QK0A 1TS9A 2J6FA 9ATCB 4M7DF 1N6AA 4JZ4A 3MO8A 5FRMA 2LTOA 1PSEA 4IUUA 3GPLA 4J9BA 2L2PA 3JCMW 5HCKA 2GCXA 3CCLA 3CXCS 1N27A 1FMVA 3SD4A 1YNZA 4QVCA 3BE3A 4FU6A 1YWPA 2HQHA 2FB7A 4WF2A 5A0DA 1Y0MA 1KQSS 3KXTA 3RMSA 3H8ZA 1JU5C 4RTUA 3S6WA 1NYFA 4HCZA 5C0MA 4C0GA 5A2QE 4FW1A 2DJQA 4PNOA 2V1RA 4BB7A 2E3IA 1I07A 4M78E 3P8HA 2GQIA 1XQHA 1VYUA 3CC7Q 1QVGS 3RDVA 2XICA 3M0PA 1VQLT 4E7KA 1V1CA 2P84A 3VS5A 2IG0A 3S3OA 2VASA 5AT1B 4F7UF 2K4YA 2C0IA 3QKJA 1KJWA 3P8BB 3TCJA 2B8AA 3QJYA 2ECZA 3GNFB 2KSSA 4DBHA 1PKTA 2HAXA 1YI2Q 2E5KA 3VKIA 1VQ5T 6AT1B 2A3LA 3JAME 1MMDA 4XTVA 3G6EQ 3EG0A 2DRMA 3OYBA 2V8KA 1Q82C 2OJ2A 5GAMg 3VS3A 4JJBA 3RBBB 5GAOm 4JRPA 1QP2A 2OTLT 2P4RA 2RHZA 1UG1A 4N0AA 2QQ9A 1YJNA 3JV3A 1UGVA 1D0YA 3PMIA 3HRTA 3EFOA 1I1JA 2RD1A 3CMAA 1NJIC 1GL5A 1MHNA 2XDDA 2OTJQ 3HPWA 3OYJA 2HBWA 2EQKA 1JEGA 1M90R 5LJ5e 4M7AC 2GGRA 5GAN4 2W0ZA 2E5QA 3L2UA 4C5EA 3I5RA 4MMLA 2NUTA 1WIEA 1ZBJA 5CO7A 2HBPA 3VRYA 3G4SQ 1K0SA 4ATOA 4NL2A 4C8QG 2RNAA 3HSBA 3O5ZA 1N8RU 3EHQA 3BW1A 4XU1A 2KY9A 2DEQA 2LCSA 2MOXA 2YUOA 3OS2A 1G3WA 2RM4A 1U1SA 4ZN3A 1W4SA 2MWOA 2ZZDA 5KYXA 3QDFA 1K9MR 4L59A 4FSXA 4JRKA 2XHCA 1QVFS 2O2OA 4KBMB 1AOJA 2JUFA 5GANe 3SHWA 3H0FA 4R0KA 1IZ6A 2LZ6B 3CCJQ 2VB6A 1SHFA 3QYGB 1PHTA 4A4KA 2SEMA 3TU4K 2CZ1B 1GBQA 5I11A 1VQMQ 3CCQA 4ORZA 1XJWB 2QQBA 4QQGA 1WJQA 5D6WA 3CD6A 2DF6A 2G6FX 1YBYA 1S1NA 2JMCA 2E6NA 3SDZA 2R5AA 3JB9G 4J6XA 5IH2A 2HL3A 3PT9A 2IIMA 3L2VA 2KMTA 2LX9A 2VGMA 1VQ6A 3R6NA 1W1FA 3CCLQ 4ZGEB 1TUGB 2CSQA 4RUGA 5GANg 4C92C 1AT1B 2FYKA 2L8DA 4FM4B 3F70A 2EQJA 2WACA 3I9QA 5DM7R 1QWFA 5KYUB 1QCOA 2QA4T 4OVAA 1TTHB 2QG9B 3SB2A 1EZZB 2M0YA 2ROLA 2L0AA 3CBOA 3E19A 1PM3A 2O4XA 3JB9I 4FYWB 2FHDA 2EFIA 3KFVA 4RCBA 1YIJQ 2DO3A 3CCVA 1BB9A 1TSFA 4M77A 3QWYA 1M1KU 2A28A 2QTVA 2DX1A 2EKHA 5GAN3 1RI9A 3QSUA 2ENMA 2ED0A 4OF1A 1IXDA 1H8KA 4F7UG 4PLIA 2DRKA 1IREB 2RHUA 1YJWQ 4AMCA 1UUEA 2FPEA 3MP6A 4AFZC 3JCMP 1JRIA 2BZ8A 4K11A 3EFRA 4KT0E 1I5LA 3QBYA 1KC8R 2DVJA 3SEMA 4FYYB 1VQ8Q 1M30A 4PJLA 1YJNQ 2HCKA 4C8QA 1TG0A 1IGQA 1PRLC 1Q86U 2KYBA 3URGA 2CH4W 1VQNQ 1Y71A 3JCMd 1BI2A 5GMKi 4HCKA 3NGPA 5GAOl 4EMGA 2AHJB 1M2VA 2SRCA 2E70A 2XK0A 2E65A 1K0XA 4QVDA 1VQPQ 4C0DB 1FMKA 2XMFA 4M78F 4E2FB 3OA6A 2GBQA 3OSVA 1CSKA 2BUDA 3SWNC 3V7SA 3CC4A 1IB8A 5KYYB 1M90C 1B34A 3QZ9B 3CCSA 2F69A 4FL6A 5L8RE 1WX6A 5KYWA 2FZKB 4C5GA 3OBYA 1Q81U 4II1A 1QMCA 4QQDA 2E4HA 5LJ5f 1YJ9Q 3X25B 3VS2A 5GJWB 2ZPBB 3EG1A 1GCQA 2K3XA 2YDLA 4RTWA 2DAQA 4ME7A 3CBPA 2EYXA 4WCIA 2DXCA 2E41A 3L2ZA 4FYVB 3EGXB 2ED1A 3NTHA 4M7DA 5ECAA 1BYMA 1M2OA 2KBTA 1B3QA 3CD6Q 2R58A 3OS5A 4Q5WA 1Q7YC 3M58A 4BDYA 1K9MC 2BKDN 2K79A 3QJ6A 4FT4A 1W2BS 1B07A 4DBFA 2K3YA 4NOYA 2EWNA 4HCBA 2EAYA 5LJ3j 3S3MA 2C06A 3MHXA 3EG9B 3UWNA 2CUBA 4A4GA 4PL6A 2PVOB 2L3RA 1PD1A 3META 2DVEA 1M9SA 1WHJA 3ZBDA 1K9AA 2RF0A 4O6JA 1WHMA 4F7UA 1YITQ 1KQ2A 2YRVA 3LWHA 2X3XD 5D6XA 5GAOn 1M8MA 4QQ6A 2DLPA 4PK4A 3WVEB 1ZSZA 3DLLA 1VQOA 4E7LA 3EHRA 3JCMh 3DB4A 3EH1A 2F2XA 4BDZA 1BCMA 1H3HA 2CUDA 3QHSA 4J9CA 4RTTA 3C95A 1RAFB 3QO3A 1T3LA 2O9SA 3M0UA 2LVMA 2XG8D 1M3BA 2K5FA 3JCMb 1KQSP 2QYZA 2MF2A 3CC7A 4KRTA 1M1FA 2CKKA 4J6YA 4OGEA 1BCOA 4ZNXA 2RHXA 3EFSA 3I56Q 1BIBA 2FZCB 5KH6A 2YUNA 1JO8A 2JOYA 4PJNA 5LJ3f 2JTMA 2KXCA 1I5OB 3VUZA 4JJDA 4BI4A 4XTZA 2PTKA 1R0CB 1IRXA 3L1AA 4HVWA 3OYNA 5FWBA 2LQ8A 1SSFA 1WQWA 1H641 1VUBA 3EGDB 4N0AC 3G6EA 2DNUA 1G3SA 2DMOA 2KI7A 4DEXA 1R77A 2FPDA 3OYLA 1VQ7T 1Y96B 3CMET 5CK9A 1UHFA 4KULA 2XI9A 1KC8C 2D6FA 1T0JA 3MEAA 4KH0B 2KRMA 4LE9A 3A98A 2C0TA 4JZ3A 1OZ2A 2J06A 3PGGA 1F1BB 1NZ9A 3OW2S 1FXXA 3BY7A 2FG0A 2YLCA 5EG2A 1PG5B 2K7AA 4B9WA 4ZGDB 1WLPB 3CC4Q 1WGSA 3CCRQ 1X75C 2RQWA 5A0LA 1GRIA 2LQNA 4IUQA 5CQXA 1KQ1A 4BY6C 3OYFA 3RMQA 1D1BA 1UE9A 4AG1C 2F5TX 3G4SA 4XTYA 2ZPEB 2HD0A 2WSEE 4E47A 1LVKA 2AT1B 2HEQA 3CXCA 2EJGA 1YHQT 4PJOD 4R55A 3DB3A 3HTRA 1K73R 2X51A 4JRQA 2NUPB 8ATCB 4LDUA 4KGVB 1KQSA 1X6OA 3AHUA 5IHKA 2Y90A 1VQ5A 3H9NA 3QUIA 2KRSA 1M8VA 1ZX6A 2OI3A 1JXMA 4OP0A 3JCMQ 3CC2T 2CP5A 3CCJA 1XTDA 1QVGA 4PFZA 2VXEA 3R6OA 1T3SA 1X6BA 1K8AR 2DM1A 3UDCA 2LNVA 2LJ1A 2QI2A 1Q82U 4FSSA 2GTOA 1VQMA 1QVFP 4ANJA 4M75D 2DETA 1PKSA 3HP9A 4EIKA 2RQTA 4EMKC 1VIFA 3OMCA 1BU1A 1GCPA 5FU6C 1AWJA 1WXTA 1NJIU 1YCSB 1ZUKA 1UJYA 1VQOQ 2QEXQ 1AWXA 4CC7A 3CCET 4E7JA 2LJ0A 1VQKT 5GAN2 5HK0A 3INZA 3ME9A 1BI0A 2LCLA 3RERA 2CYZB 4FIBA 3QXEB 1OV3A 3CPWP 1RLPC 4Z02A 1NLOC 2QAZA 2DYIA 5GAMe 2VYTA 3IQLA 1OQKA 3REBB 3M5AA 4X1VA 3M55A 1NG2A 1YIJA 1JBMA 2F2WA 4MMKA 1RLQC 2YLBA 1C6VX 5A0GA 3KUFA 1G2BA 2DL3A 2GFUA 4J8OA 1Z9ZA 2KR3A 1UGRB 4DOVA 2FPFA 3V7CA 4X9DA 4XU3A 1S72T 4JRIA 3U23A 1E7OA 3I55T 1YJWA 1QQJA 2F1LA 4C8QC 2M9UA 1M3AA 3QYHB 1GXIE 4M77G 1VQ4T 1WHGA 2DTIA 1PC0A 3VS6A 1RI0A 1VQ8A 4IUPA 1QVFA 4C8QD 4ZTJA 1LCKA 1RABB 2ZCFB 5GMKe 3AT1B 4PJOE 1AD5A 2HKNA 5KYUA 4IUVA 2CSIA 1JJ2P 1ZSGA 2EBPA 1UEBA 3OYDA 1VQNA 1VQKQ 1I8FA 3N5BB 1ZA1B 1ABQA 4OMOA 3JCMc 2CP3A 4KH1B 1NEGA 1M27C 2CDTA 3MCAB 4AG2C 5IXBA 1LNXA 1WHHA 1AZEA 2HDAA 1SKUB 2VUBA 1VQLQ 4M7AD 2KVQG 2DIQA 1C1AA 5KE3A 1VQPA 3LLRA 3PVLA 3M56A 5CKEA 3E9GA 2EYYA 4L5GA 3LX7A 2DK3A 5D6YA 2P4TA 5GAN6 4M75E 1JQQA 1GCQC 3JB9D 3WXMB 1VQ5Q 1Y07A 3LH0A 1YJ9A 2GTJA 5CIUA 2E64A 2M02A 4J9EA 4ZN1A 2KEAA 2VGNA 2OTLQ 1K73C 2PNIA 3QG1A 1D3BB 3UT1A 1UTIA 5FRNA 3OS0A 2R57A 2L89A 5AYFA 5J3BA 1KK7A 3PFSA 4OMQA 4EPCA 3DKMA 4C5HA 4F16A 3UATA 3OYIA 4PLLA 5LJ3d 3GBQA 1D09B 4E7HA 2X4XA 4NS5A 1K8AC 1BI1A 1N5ZA 3RESA 2X9HA 1G83A 3CPWS 2A0FB 4OB1B 2DYBA 1JJ2A 4M7DG 1G5VA 1ZUYA 4M78B 3FJPA 2DZ9A 3LYIA 1X69A 1W2BP 1U3OA 4C92D 1D1AA 5LJ5h 5GAN5 3QWXX 1NPPA 4MDWA 3T9NA 1LOJA 2HNIA 3TQ7P 3OS1A 1ZSZC 5FWCA 5GAN7 3JB9J 3VS4A 2IVWA 4DQ2A 3A8HB 1YITA 3JRZA 3GLXA 3BDUA 3EFOB 2A36A 3CMAT 4DA4A 2W10A 2LQWA 3VRZA 4ZGJB 2PUOB 3OB9A 5IAYA 1M90U 1GFDA 2C0OA 5CKHA 2G3RA 5GMKm 2YHTA 1SHGA 4C8QE 2VC8A 1MNDA 3O8VA 3EGXA 4RKUE 2JW4A 1WJRA 2FVUA 3G71T 2RH2A 3ER0A 3D7SB 4J7FA 1WXUA 3MP1A 2K57A 1M5Q1 2D8HA 3RIRA 5L23A 3I56A 2YRCA 4OMLA 1ACMB 1EFNA 5CVIA 4BY6B 4J9GA 2JXBA 5GAMf 2H3EB 1G3TA 1JJ2S 1OYXA 1WA7A 4OB2B 1P92A 4E7ZA 4PJOB 1Q7YU 3Q1JA 3E1SA 4Z89A 5LJ5j 4M7AE 2J6OA 3M4YA 4WTOB 1K9MU 5GAOr 4RTYA 3CCMT 3CCUT 3EG9A 1YP5A 1R0BG 2MI6A 2QTXA 2KE9A 2QA4Q 3JCMX 2H8HA 1GBRA 2DBMA 2ZPGB 4X34A 1ZLMA 3CCQT 4BE1A 4JJCA 3OYGA 4QT7A 4AFSC 1NEBA 1WHKA 3X24B 1W2BA 4NL3A 2DL7A 4M75B 4RTZA 3J80E 2RMOA 1VQ6T 4JUVA 3CEYA 4DBRA 5GANj 5KCOA 5LJ3h 5CR2A 2RB6A 2OAUA 3CCRA 2FZGB 4BI3A 2EYWA 4EMKB 5I21A 1UB4A 2JZ2A 3TVTA 2RJEA 2OAWA 2DEUA 3OW2P 2CT3A 2LX7A 1VQ9T 4LDVA 3H0IA 3PIOA 2M16A 3KBGA 4XU0A 1WFWA 2ZPFB 2D1XA 1FX7A 4HXJA 4KGZB 4C92E 4JDSA 3X28B 4OMPA 1RAEB 3CCVT 4XK8E 4A63B 2JS0A 4RCCA 1Y96A 1IHWA 1VQ7A 1MV0B 2EGEA 5DY9A 4UC4A 1E6GA 4PJOF 5GANf 3JCMg 4AFUC 2DIGA 2H3JA 2DILA 3MJXA 2RA2A 2K9GA 4DOWA 1KC8U 2EQMA 1OEBA 2GF7A 2PUKB 4CI0C 3NFCA 5IHIA 4MZMA 4A4HA 4RG2A 1D0ZA 2D9TA 2DBKA 1MNEA 4J9FA 3FC3A 4D8KA 1IO6A 4C8QB 3M0SA 2EPDA 2HL5C 3M4GA 2L3QA 2NLUA 2V26A 5J26A 2QEXA 1G8XA 2KK4A 1YHQA 2RI5A 4M75F 3HHTB 2NUPA 3G1JA 1N9RA 1KD1R 5CQYA 2KYMA 2KROA 2PZ1A 5DLOA 1BIAA 4PJMA 5CCAA 1X01A 1U8RA 3OW2A 2RPNA 3C4SA 4LUEA 2HQXA 2VWFA 4M7AB 4HT9A 5I2MA 3CC2A 3EG2A 2AKLA 4Z8AA 3OQ5A 4E7SA 3CCST 2AIRB 1U06A 2E12A 2X4JA 3FIFA 3HFOA 2AZVA 3RKYA 3X20B 2DTOA 1LJOA 2BTTA 3NHNA 1UFFA 1JB0E 3P8DA 4LXCA 3OYYA 3BDLA 2QQSA 1M1GA 1UDLA 2CP6A 1BKBA 2JT4A 1OPKA 2IPOB 2FRYA 4BACA 3E9FA 2E6ZA 3H0HA 1D1CA 1NM7A 2P0PA 4QKUA 1KHCA 3CCEA 4F17A 1VQKA 1ZBXA 3RUXA 2NYSA 4HA8A 4XTUA 1V76A 4M4ZA 2LP5A 4V2SA 2EQUA 1AZGB 4XTXA 1TWBA 3ZEHA 2RK2A 4OMNA 2PU9B 4Z88A 1VQLA 2K5LA 3V8KA 1QKXA 3NTKA 4C5IA 3L2WA 4C8QF 1KG1A 1OX9A 4M78G 2LT1A 3GP8A 4C92B 4L6V5 3H6ZA 4CRIA 2DFUA 4RMOA 3RKWA 3J7AF 1QWEA 2O31A 1NE8A 2MIOA 4HT8A 2EQIA 1AWWA 1TH7A 1S72A 1DJ7B 4JLIA 1WJSA 1VYTA 3UA6A 2WSFE 3VV0A 1CKAA 3REAB 4J9HA 4LDYA 4VUBA 1K76A 3LGLA 4M7AF 1YWOA 4CC2A 2M0OA 1VQ7Q 4CC3A 1UECA 1KFZA 2DXBA 4IIMA 3CMEQ 2OTLA 1VQ4A 2VXFA 4EMHA 3GOXA 2V8IA 4JJNK 2VV5A 1U1TA 3CC7T 2LC4A 3TEEA 3EAEA 4MDXA 2PQWA 3H41A 1UGSB 1EIFA 4B6MA 1QW1A 2COWA 3CBMA 4D6WA 3JB9F 3QZ5B 4LN2A 4IURA 4TVRA 2ZAEA 2JN0A 2A7YA 2EYZA 1M4ZA 1N9SA 1NPRA 4C0DC 1PWTA 1YI2T 4PJOG 2ZPIB 5DLQE 1C0MA 2R5MA 4ZTFA 3G6ET 2KT8A 3OYKA 3S3NA 4J7IA 1J3TA 2M51A 1YHQQ 4D8DA 1XOVA 1N8RR 3FB9A 3NMZC 1Z9QA 2JTFA 1FMWA 2E10A 4M77C 3OBWA 2O9VA 1NLPC 2HSEB 3X26B 3ULRB 4C0FA 1I4K1 1WXBA 2DZCA 4M77D 3M57A 2OTJT 3CC2Q 4M75G 3NTIA 1Y57A 4J9IA 4C92F 1CKBA 1D3BA 2ATCB 1KD1C 3TREA 3L42A 2K2VA 2QASA 4MZTA 3MEVA 4QW2A 3PE0A 3G4ST 3SWNB 2EJ9A 2CH4A 1WNLA 1K73U 5LJ5d 4FYXB 2AKKA 5IHNA 5FLXE 4XAXB 5HKCA 2JS2A 2NUZA 4PFOA 2JM8A 8AT1B 1V29B 2PVGB 4IIOA 1RAHB 2MMPA 1PSFA 2A08A 3GF5A 2AZSA 3TSZA 4M78A 3WVDB 2GNCA 4QVZA 1AEYA 2RQRA 3I35A 3CCEQ 2QA4A 3CCJT 2EKOA 1WZOA 1K8AU 1OZ3A 2FO0A 3A8LB 2F2VA 4GBQA 3PVQA 2KRNA 1QKWA 2LT4A 1O9SA 1VOMA 3RNJA 2QDYB 1VQMT 2K3BA 2RI3A 3TSWA 1OOTA 3M0RA 2EVRA 2KQWA 3FRNA 5GANd 4OB0B 4BE0A 1AHJB 1SSHA 2DTHA 1ZHIA 2HKQB 2Y4XA 3CCLT 2HSPA 2DJZA 2DERA 5GAMh 3PNWC 2EW3A 3CPWA 3VS0A 4PFPA 1B7TA 1M1KR 2COYA 4HCCA 3G71A 1RAGB 1QCFA 1H92A 3LW5E 3OMGA 1S72Q 2AK5A 2RHYA 3I55Q 4FCYA 3G7ZA 4C0ZA 4M7DC 1O75A 1PCXA 2JNGA 1IGUA 2KDSA 2MCNA 2XDBA 2L3PA 1AWOA 4PJOA 2MWPA 4RTVA 4A54A 2DE0X 1ARKA 1VQ4Q 1MUZA 4M7DD 2DL5A 5FU7C 5I22A 1I81A 1K4US 1Q7YR 3VS7A 3VJPA 1SEMA 3CQTA 5LJ5g 2YUQA 3FDRA 3CCUA 3CCMA 2D8JA 4A53A 5KE2A 2CS7A 3BFMA 5GAOq 2YRDA 1AVZC 1YIJT 2A37A 2VVKA 3RKXA 2KXDA 4M7AG 1Q86R 3LH5A 4PJJA 4RTXA 2QQRA 5GMKh 5GAN8 4AFQC 4M77E 2LJ3A 5KYNA 1TUCA 5GAMj 1D0XA 1HJDA 1I0CA 1W6XA 3A8OB 4M75A 4CC4B 1YJWT 4GLKA 2E1HA 3MEUA 1EX4A 3MPUB 4BI8B 4N4HA 4AT1B 1MMNA 5EC7A 2QXFA 5KYYA 1A0NB 2ROTA 1VQ8T 4LD9K 4EMKA 3THKA 4ELZC 1YJNT 2P0QA 1RACB 1X43A 1WPYA 2DKGA 1X27A 1QP3A 4DEYA 2DXUA 2X3WD 2RI2A 1VQ9A 4J6WA 2CP2A 1IHVA 1TXQA 2D0QB 2FRWA 1Q81R 4LUDA 1VQNT 3M0QA 4J83A 2V8JA 3J81E 2KT1A 2GQVA 4IKFA 1SF9A 1QCNA 2P0KA 3PMTA 1N8RC 3EH2A 5LJ3e 2MAMA 3CPFA 3JCMJ 2NUTB 3LGFA 1ZQ1A 5GANh 1VQPT 5GMKj 2HQEA 3OYHA 3FJ5A 1BK2A 1FYNA 3A8GB 3OYAA 2RJFA 1WDXA 4OGCA 4Y92A 1MV3A 1YN8A 3LWIA 4DBQA 4C92G 4R56A 1WQ7A 1X6GA 1Q95G 3HFNA 3A5ZB 4BE2A 3QDRB 4OMFB 1OU9A 3M59A 3HRUA 2RHIA 1YJ9T 5KYXB 3JB9H 2COZA 5LJ3g 5CKBA 3OYCA 5I2SA 2LMJA 2V1QA 4KUIA 4F04B 1OU8A 4N4GA 1QLYA 1PNJA 2J05A 5FW9A 2XU8A 4HKEA 1ZUUA 1G3YA 5HY6A 2XKOC 2CT4A 2X4WA 3CD6T 3V8LA 3M0TA 3CMAQ 4FW2A 1ZA2B 1SRLA 3OY9A 5CKDA 7AT1B 1SPKA 4M7DE 2XIDA 4E6RA 2BE9B 1X2KA 1PD0A 3JSCA 2L5QA 2QDLA 3ASKA 4BD3A 2DPPB 3G71Q 1RUWA 4Y28E 2I0NA 1OULA 2FEIA 3GIBA 2L3SA 4HVVA 2PVDB 2MK5A 1XNIA 3VUBA 2JM9A 3I5SA 3EG3A 4M7AA 5FU6B
chains in the Genus database with same CATH topology
2ZGWA 1YBYA 2VYTA 5GAMe 2EJFA 2E6NA 1OI1A 2R5AA 3SDZA 3JB9G 4J6XA 3JCMe 3PT9A 3M5AA 3L2VA 2KMTA 2LX9A 4BACA 2VGMA 3A8MB 3E9FA 3M55A 1VQ6A 3HKSA 4JS5A 1YIJA 1JBMA 2E6ZA 4ZGEB 4MMKA 1YITT 1M1KC 2YLBA 3GNGA 5A0GA 1Y7XA 2P0PA 3KUFA 1KHCA 2GFUA 4C92C 5GANg 3CCEA 2O4XB 4J8OA 5C6SA 1VQKA 2FYKA 2BIVA 2L8DA 1ZBXA 1UGRB 4FM4B 3F70A 3RUXA 2EIFA 4DOVA 2EQJA 2WACA 2GFAA 4HA8A 4XTUA 4X9DA 3V7CA 5DM7R 4XU3A 4M77B 2DD4A 4F7UE 1S72T 3V7RA 4V2SA 2EQUA 2JVVA 4N4IA 2QA4T 4OVAA 4XTXA 4JRIA 2F5KA 3ZEHA 3CMEA 2RK2A 3I55T 2PU9B 1VQLA 1YJWA 3L2RA 1K8AU 2K5LA 5M9OA 3SB2A 3V8KA 3MEWA 3JCMV 3NTKA 4C5IA 3L2WA 4C8QC 2M9UA 4C8QF 3CBOA 1KG1A 3QYHB 3E19A 4M78G 4M77G 1UGPB 2LT1A 2DTIA 4BUGA 4C92B 2FL7A 3I56T 4LD6A 3GP8A 4L6V5 1RI0A 3VYHB 2O4XA 3JB9I 1VQ8A 3H6ZA 4P5NA 2X35A 4CRIA 3QPHA 4IUPA 2FHDA 4RMOA 1QVFA 4C8QD 2EFIA 2DD5A 3RKWA 3VU3C 4ZTJA 3J7AF 4RCBA 2ZCFB 5GMKe 3FLGA 1NE8A 2DO3A 3CCVA 1Q86C 4M77A 4PJOE 4HT8A 1TH7A 4IUVA 3M54A 1M1KU 1S72A 3PTAA 1UEBA 1DJ7B 1R8OB 3OYDA 4JLIA 1WJSA 1VQNA 3VV0A 1I8FA 2WSFE 3N5BB 4Y91A 5GAN3 3QSUA 4LDYA 3DLMA 2RK1A 1BI3A 2EYQA 3QIIA 2CZ6B 4VUBA 3JCMc 4OF1A 3LGLA 4M7AF 2M0OA 1KHIA 4PLIA 3MCAB 2DXBA 4C92A 4F7UG 1LNXA 2I2LA 2OTLA 1VQ4A 2VXFA 1IREB 4EMHA 3GOXA 2V8IA 2RHUA 2VUBA 4KUDK 4JJNK 2VV5A 1U1TA 3CC7T 2LC4A 3MP6A 4O5VA 3TEEA 3EAEA 5CAIA 4MDXA 3JCMP 4M7AD 2KVQG 2DIQA 2PQWA 1JRIA 5KE3A 3EFRA 4KT0E 1UGSB 3LLRA 4MZPA 1EIFA 1VQPA 2KAFA 1I5LA 2CZ7B 3M56A 3QBYA 1QW1A 3E9GA 3CBMA 5CKEA 4D6WA 4L5GA 3JB9F 3QZ5B 4GY5A 3LX7A 3MP8A 4IURA 4TVRA 2DK3A 4JS4A 5D6YA 2JN0A 2P4TA 2A7YA 5GAN6 4M75E 1M4ZA 1N9SA 4C8QA 3JB9D 3WXMB 1Q81C 1NPRA 4C0DC 1Q86U 1YI2T 1Y07A 3URGA 4PJOG 3LH0A 2O01E 5KCHA 4B9XA 1Y71A 3CC4T 4A4EA 2ZPIB 2K5IA 3M9QA 3JCMd 3CCRT 5GMKl 1YJ9A 5DLQE 2R5MA 5CIUA 1VIEA 2LQKA 2E64A 2CZ0B 1B34B 4ZTFA 3CD6A 3G6ET 1BI2A 5GMKi 5GAOl 3OYKA 4EMGA 3S3NA 4ZN1A 4J7IA 2AHJB 2VGNA 3C12A 5LL6S 2E70A 4X9CA 1K73C 3QG1A 2XK0A 2E65A 5HK3A 1D3BB 3UT1A 4RG8A 4LDXA 1XOVA 4QVDA 3FB9A 5FRNA 5IN1A 3OS0A 4C0DB 2JTFA 2R57A 2E10A 1HXDA 3OBWA 2L89A 4LDWA 4M78C 4M77C 4M78F 4M77F 5AYFA 5J3BA 3OA6A 3OSVA 3HRSA 3SWNC 2BUDA 3PFSA 4E7IA 1YI2A 4EPCA 3V7SA 3X26B 3CC4A 4C0FA 1I4K1 4M7DB 3DKMA 1M90C 3L2QA 4C5HA 1B34A 4M78D 3QZ9B 2DZCA 4M77D 3M57A 3CCSA 3OYIA 2F69A 4FL6A 1HK9A 5L8RE 4A4FA 4PLLA 2OTJT 1UGQB 5LJ3d 2Y4YA 4M75G 4C5GA 3OBYA 1Q81U 4E7HA 3NTIA 4II1A 3PIPA 4QQDA 2X4XA 4NS5A 5FU7B 1K8AC 1QVPA 1BI1A 5LJ5f 4C92F 3RESA 3X25B 1D3BA 3CPWS 2ZPBB 4OB1B 1KD1C 2K3XA 3TREA 3L42A 2K2VA 1JJ2A 4M7DG 4MZTA 1G5VA 4M78B 3FJPA 2DAQA 3MEVA 2LCCA 2DZ9A 3LYIA 4ME7A 4C92D 1MGQA 2DXTA 4QW2A 5LJ5h 3CBPA 5GAN5 3G4ST 3OSSC 1NPPA 3SWNB 2DXCA 2EJ9A 2E41A 4MDWA 3T9NA 3L2ZA 1LOJA 1WNLA 4ELYC 1K73U 2HNIA 3NTHA 4YTLA 4M7DA 3OS1A 3JB9J 5GAN7 1BYMA 1H3ZA 3FEOA 5LJ5d 3OYMA 5FLXE 4XAXB 2IVWA 2R58A 3OS5A 4Q5WA 5HKCA 1Q7YC 2OTJA 4DQ2A 3A8HB 1YITA 2M1HA 3M58A 3JRZA 4BDYA 1V29B 2PVGB 1K9MC 3GLXA 3BDUA 2BKDN 3QJ6A 4FT4A 2MMPA 3CMAT 5IT9E 1PSFA 3GF5A 4DA4A 4FT2A 4XQ3A 4ZGJB 1W2BS 2PUOB 3OB9A 5IAYA 1M90U 2XD0A 2RJDA 4M78A 4OB3B 2K3YA 3WVDB 4F7UB 3V8JA 5CKHA 2G3RA 5GMKm 2YHTA 5J39A 4NOYA 4QVZA 5FROA 4PJOC 4XTWA 2EWNA 3SWNA 4C8QE 4IUTA 2CGHA 4HCBA 2VC8A 1VQOT 2EAYA 3VYGA 2QEXT 2EKOA 3O8VA 5GAOp 5LJ3j 3CCJT 2QA4A 3S3MA 4RKUE 3MHXA 1WJRA 1OZ3A 2ZPHB 3OYEA 2FVUA 3I55A 3HL8A 3G71T 2RH2A 3A8LB 3ER0A 4J7FA 3MP1A 3UWNA 1KD1U 2LT4A 1O9SA 4A4GA 2QDYB 2X4YA 2K57A 1YCYA 4PL6A 4EDUA 2PVOB 2L3RA 2QQAA 2RI3A 1M5Q1 1VQMT 3META 3RIRA 4PKCC 1RL2A 3I56A 2LRQA 5CVIA 3SFMA 2DVEA 4BY6B 1M9SA 2KQWA 2LDMA 3FRNA 5GAMf 3ZBDA 5GANd 3UPUA 1G3TA 4OB0B 1JJ2S 3C94A 1OYXA 2WSCE 4JLGA 2RJCA 4XU2A 5D6WA 4BE0A 1AHJB 4O6JA 4OB2B 1P92A 3JCMf 2DTHA 4F7UA 2C06A 1KQ2A 1ZHIA 1Q7YU 3Q1JA 4PJOB 3E1SA 5LJ5j 2Y4XA 2YRVA 3LWHA 3CCLT 2DJZA 5D6XA 4M7AE 5GAMh 5GAOn 3PNWC 3M4YA 4QQ6A 3WVEB 3M53A 3CPWA 1K9MU 4J5YA 3DLLA 1VQOA 4E7LA 5GAOr 3CCMT 3CCUT 2XDPA 3DB4A 3JCMh 2RO0A 4HCCA 3G71A 4BDZA 4M75C 5GAMd 2MI6A 3LW5E 3OMGA 2RHYA 3QHSA 2QTXA 3ZFJA 3C95A 3QO3A 1FWZA 3JCMX 2LVMA 5CKFA 2XG8D 3JCMb 2K5FA 2ZPGB 3G7ZA 2MF2A 4C0ZA 3CC7A 4M7DC 1O75A 4X34A 2JNGA 4M7DF 1M1FA 1N6AA 2KDSA 2XDBA 3MO8A 5FRMA 2LTOA 1PSEA 4IUUA 2CKKA 2MWPA 4J6YA 4OGEA 4A54A 3GPLA 3CCQT 2RHXA 4PJOA 3EFSA 4BE1A 3JCMW 3OYGA 1BIBA 2GCXA 5KH6A 4M7DD 3CCLA 5FU7C 1I81A 3CXCS 2JOYA 1N27A 5LJ3f 3SD4A 3X24B 1W2BA 2JTMA 3VJPA 4NL3A 4M75B 4QVCA 5LJ5g 3FDRA 3CCUA 3CCMA 4FU6A 3VUZA 4A53A 5KE2A 2CS7A 3BFMA 3J80E 1VQ6T 4BI4A 4JUVA 2FB7A 4WF2A 3CEYA 4XTZA 5A0DA 5GAOq 5GANj 1YIJT 3KXTA 1KQSS 3RMSA 3H8ZA 5LJ3h 5KCOA 3L1AA 5CR2A 3OYNA 2RB6A 3RKXA 2OAUA 3CCRA 4M7AG 4BI3A 2LQ8A 3S6WA 4EMKB 5I21A 1UB4A 1SSFA 1WQWA 2JZ2A 4HCZA 5C0MA 2RJEA 1H641 1VUBA 2QQRA 4N0AC 4C0GA 3G6EA 1G3SA 5GMKh 5A2QE 4PNOA 4BB7A 5GAN8 1VQ9T 4M78E 3P8HA 4LDVA 4M77E 3OYLA 5GAMj 1XQHA 1VQ7T 1Y96B 3PIOA 3A8OB 2M16A 3CMET 5CK9A 1QVGS 2XICA 1VQLT 4KULA 4M75A 3KBGA 2XI9A 4GLKA 1YJWT 4E7KA 1KC8C 2E1HA 2D6FA 4XU0A 2IG0A 3MEUA 3MEAA 3S3OA 4F7UF 2ZPFB 2K4YA 4BI8B 4N4HA 3QKJA 3P8BB 1FX7A 3TCJA 1OZ2A 2QXFA 2B8AA 3QJYA 3PGGA 4C92E 1VQ8T 4JDSA 4LD9K 4EMKA 1NZ9A 4ELZC 3GNFB 1YJNT 3OW2S 2P0QA 3X28B 1FXXA 3BY7A 2KSSA 1WPYA 2HAXA 2YLCA 2DKGA 5EG2A 3CCVT 1QP3A 3VKIA 4B9WA 2DXUA 4ZGDB 1VQ5T 2RI2A 1WGSA 4XK8E 1X75C 1VQ9A 2A3LA 5A0LA 4J6WA 4RCCA 3JAME 1Y96A 4XTVA 2D0QB 4IUQA 5CQXA 1KQ1A 1VQNT 1VQ7A 4BY6C 3OYFA 3RMQA 3OYBA 4J83A 2V8JA 2V8KA 1Q82C 5GAMg 5DY9A 4UC4A 2F5TX 4PJOF 3J81E 3G4SA 4XTYA 4JRPA 2ZPEB 2GQVA 5GANf 5GAOm 2HD0A 2WSEE 3JCMg 4IKFA 1QP2A 4E47A 3CXCA 2P0KA 3PMTA 1N8RC 5LJ3e 2DIGA 2EJGA 2H3JA 2OTLT 2RHZA 2MAMA 2RA2A 1YHQT 3CPFA 4N0AA 3JCMJ 4R55A 3LGFA 4PJOD 4DOWA 2QQ9A 3DB3A 1ZQ1A 1KC8U 2EQMA 5GANh 4JRQA 1YJNA 4LDUA 1VQPT 5GMKj 2HQEA 3OYHA 1KQSA 1X6OA 2GF7A 3AHUA 3PMIA 3HRTA 2PUKB 3A8GB 3OYAA 2RJFA 2Y90A 1VQ5A 2RD1A 4OGCA 4CI0C 3CMAA 3NFCA 1NJIC 3LWIA 1MHNA 4MZMA 4A4HA 2XDDA 3QUIA 4RG2A 4C92G 4R56A 1M8VA 3HPWA 3OYJA 2D9TA 2EQKA 3FC3A 1WQ7A 4OP0A 4C8QB 3JCMQ 3CC2T 5LJ5e 3HFNA 3M4GA 4M7AC 3A5ZB 2NLUA 5J26A 4BE2A 2QEXA 3QDRB 3CCJA 4OMFB 5GAN4 1XTDA 1QVGA 2E5QA 2VXEA 3HRUA 3M59A 3R6OA 2RHIA 4C5EA 4MMLA 3L2UA 2KK4A 1YJ9T 1YHQA 3JB9H 2RI5A 4M75F 3HHTB 3UDCA 5LJ3g 2LNVA 5CO7A 2HBPA 1N9RA 2QI2A 5CKBA 1Q82U 3OYCA 5I2SA 1VQMA 5CQYA 4NL2A 4ATOA 4KUIA 4C8QG 5DLOA 4N4GA 1BIAA 4M75D 3HSBA 1N8RU 3HP9A 1X01A 5CCAA 1U8RA 2XU8A 3BW1A 4EMKC 4XU1A 3OW2A 4HKEA 3C4SA 1G3YA 5HY6A 2XKOC 1VIFA 2X4WA 3OMCA 2KY9A 2HQXA 2DEQA 3CD6T 4M7AB 4HT9A 3OS2A 5I2MA 3V8LA 1G3WA 3CC2A 2RM4A 5FU6C 1U1SA 4ZN3A 1W4SA 2MWOA 2ZZDA 3OQ5A 3OY9A 5CKDA 1NJIU 4M7DE 4L59A 4FSXA 2XIDA 4JRKA 2XHCA 3CCST 1QVFS 4KBMB 2JUFA 2E12A 2X4JA 3FIFA 3HFOA 3JSCA 3RKYA 5GANe 3X20B 2DTOA 1LJOA 1IZ6A 2L5QA 3ASKA 3P8DA 1JB0E 4BD3A 2DPPB 4E7JA 3CCET 3QYGB 3OYYA 3BDLA 4A4KA 4Y28E 1VQKT 5GAN2 5HK0A 3INZA 3ME9A 3TU4K 2QQSA 1GXIE 1M1GA 2CZ1B 1BI0A 3GIBA 2LCLA 1VQ4T 2PVDB 2CYZB 3RERA 1BKBA 3QXEB 4FIBA 1XNIA 3VUBA 3CCQA 4Z02A 4M7AA 2QQBA 4QQGA 5FU6B 1WJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CI0 C;  4OMF B; 
#chains in the Genus database with same CATH topology
 1MMG A;  2ZGW A;  2EJF A;  1OI1 A;  3JCM e;  2CP0 A;  3A8M B;  3HKS A;  2YUP A;  4JS5 A;  1GFC A;  1YIT T;  1TOV A;  1M1K C;  2YT6 A;  3GNG A;  1Y7X A;  2Z0W A;  2CP7 A;  3CCM Q;  3CCU Q;  1WYX A;  2O4X B;  2QGG A;  3EGD A;  5C6S A;  4HVU A;  2JJ9 A;  2BIV A;  2EIF A;  2GFA A;  4F7U E;  4M77 B;  2DD4 A;  3C0C A;  2YXY A;  3UF4 A;  3V7R A;  2JVV A;  4N4I A;  2JTE A;  2F5K A;  3CME A;  3L2R A;  1ABO A;  5M9O A;  3CCQ Q;  3MEW A;  3JCM V;  2EGA A;  1UGP B;  4BUG A;  3I56 T;  2FL7 A;  4LD6 A;  3VYH B;  4P5N A;  2X35 A;  3QPH A;  3VU3 C;  2DD5 A;  2ABL A;  1VQ6 Q;  4KGX B;  3FLG A;  1Q86 C;  3M54 A;  3PTA A;  1R8O B;  5IXF A;  4F14 A;  2D0N A;  4Y91 A;  2J6K A;  3DLM A;  2RK1 A;  1BI3 A;  2EYQ A;  3QII A;  2CZ6 B;  1VQ9 Q;  2HZY A;  2O88 A;  1MMA A;  3ZL7 C;  1KHI A;  4C92 A;  2I2L A;  4KUD K;  1TUD A;  2K2M A;  1JXO A;  4O5V A;  5CAI A;  1PRM C;  4MZP A;  2KAF A;  1BBZ A;  2CZ7 B;  3RR6 A;  1M2V B;  1YFN A;  2E3H A;  4GY5 A;  3MP8 A;  4JS4 A;  2BE7 D;  2NWM A;  3EGU A;  3CCV Q;  2BZY A;  3CXC P;  4JPB W;  1Q81 C;  2MPX C;  2DL4 A;  2RN8 A;  2BZX A;  2O01 E;  4B9X A;  5KCH A;  3MKD A;  4A4E A;  3CC4 T;  2K5I A;  3M9Q A;  3CCR T;  5GMK l;  1VIE A;  2K6D A;  2LQK A;  2CZ0 B;  1B34 B;  3VS1 A;  5GJV B;  5KYW B;  3C12 A;  1Q82 R;  5LL6 S;  4X9C A;  2QGF B;  5HK3 A;  1SG5 A;  4GLM A;  4RG8 A;  4LDX A;  4J9D A;  1KIK A;  1SRM A;  5IN1 A;  2YSQ A;  4LDW A;  4M78 C;  1QVG P;  1HXD A;  1OX8 A;  4M77 F;  3HRS A;  4E7I A;  1YI2 A;  2VKN A;  2YWW A;  4M7D B;  3L2Q A;  4M78 D;  1RAA B;  1NJI R;  1HSQ A;  1WI7 A;  1HK9 A;  4A4F A;  1W70 A;  1UGQ B;  2Y4Y A;  2HMA A;  3PIP A;  1K1Z A;  1RAD B;  5FU7 B;  1QVP A;  2B86 A;  1M3C A;  2LCC A;  1VYV A;  1MGQ A;  2DXT A;  3OSS C;  2DL8 A;  4ELY C;  4YTL A;  1H3Z A;  2DA9 A;  1RAI B;  3FEO A;  1NYG A;  3OYM A;  4LNP A;  2OTJ A;  1T0H A;  2M1H A;  4ESR A;  2JMA A;  2ESW A;  1E6H A;  5IT9 E;  4FT2 A;  3CCS Q;  4XQ3 A;  2XD0 A;  2RJD A;  4OB3 B;  4F7U B;  3V8J A;  2EGC A;  1UHC A;  1HYO A;  2MYS A;  5FRO A;  5J39 A;  4PJO C;  4XTW A;  2LNH B;  1KSW A;  3SWN A;  1HD3 A;  2CGH A;  4IUT A;  1VQO T;  3VYG A;  2QEX T;  5GAO p;  1ZSZ B;  1X2Q A;  2ZPH B;  2OX7 A;  3OYE A;  3I55 A;  3HL8 A;  2RQV A;  1U5S A;  1VA7 A;  1KD1 U;  2CRE A;  2RQU A;  2X4Y A;  1YCY A;  4EDU A;  1WHL A;  2QQA A;  1OPL A;  4PKC C;  1RL2 A;  5D7U A;  2LRQ A;  3SFM A;  2LDM A;  3UA7 A;  3UPU A;  1LPL A;  3C94 A;  4JLG A;  2WSC E;  4XU2 A;  2RJC A;  4OMM A;  3JCM f;  3E2U A;  1UJ0 A;  3NPF A;  3M53 A;  4J5Y A;  1TU0 B;  2XDP A;  2RO0 A;  1NBE B;  2KNB B;  2J7I A;  4M75 C;  5GAM d;  3ZFJ A;  3A1P A;  2KGT A;  1FWZ A;  5CKF A;  2QK0 A;  1TS9 A;  2J6F A;  9ATC B;  4M7D F;  1N6A A;  4JZ4 A;  3MO8 A;  5FRM A;  2LTO A;  1PSE A;  4IUU A;  3GPL A;  4J9B A;  2L2P A;  3JCM W;  5HCK A;  2GCX A;  3CCL A;  3CXC S;  1N27 A;  1FMV A;  3SD4 A;  1YNZ A;  4QVC A;  3BE3 A;  4FU6 A;  1YWP A;  2HQH A;  2FB7 A;  4WF2 A;  5A0D A;  1Y0M A;  1KQS S;  3KXT A;  3RMS A;  3H8Z A;  1JU5 C;  4RTU A;  3S6W A;  1NYF A;  4HCZ A;  5C0M A;  4C0G A;  5A2Q E;  4FW1 A;  2DJQ A;  4PNO A;  2V1R A;  4BB7 A;  2E3I A;  1I07 A;  4M78 E;  3P8H A;  2GQI A;  1XQH A;  1VYU A;  3CC7 Q;  1QVG S;  3RDV A;  2XIC A;  3M0P A;  1VQL T;  4E7K A;  1V1C A;  2P84 A;  3VS5 A;  2IG0 A;  3S3O A;  2VAS A;  5AT1 B;  4F7U F;  2K4Y A;  2C0I A;  3QKJ A;  1KJW A;  3P8B B;  3TCJ A;  2B8A A;  3QJY A;  2ECZ A;  3GNF B;  2KSS A;  4DBH A;  1PKT A;  2HAX A;  1YI2 Q;  2E5K A;  3VKI A;  1VQ5 T;  6AT1 B;  2A3L A;  3JAM E;  1MMD A;  4XTV A;  3G6E Q;  3EG0 A;  2DRM A;  3OYB A;  2V8K A;  1Q82 C;  2OJ2 A;  5GAM g;  3VS3 A;  4JJB A;  3RBB B;  5GAO m;  4JRP A;  1QP2 A;  2OTL T;  2P4R A;  2RHZ A;  1UG1 A;  4N0A A;  2QQ9 A;  1YJN A;  3JV3 A;  1UGV A;  1D0Y A;  3PMI A;  3HRT A;  3EFO A;  1I1J A;  2RD1 A;  3CMA A;  1NJI C;  1GL5 A;  1MHN A;  2XDD A;  2OTJ Q;  3HPW A;  3OYJ A;  2HBW A;  2EQK A;  1JEG A;  1M90 R;  5LJ5 e;  4M7A C;  2GGR A;  5GAN 4;  2W0Z A;  2E5Q A;  3L2U A;  4C5E A;  3I5R A;  4MML A;  2NUT A;  1WIE A;  1ZBJ A;  5CO7 A;  2HBP A;  3VRY A;  3G4S Q;  1K0S A;  4ATO A;  4NL2 A;  4C8Q G;  2RNA A;  3HSB A;  3O5Z A;  1N8R U;  3EHQ A;  3BW1 A;  4XU1 A;  2KY9 A;  2DEQ A;  2LCS A;  2MOX A;  2YUO A;  3OS2 A;  1G3W A;  2RM4 A;  1U1S A;  4ZN3 A;  1W4S A;  2MWO A;  2ZZD A;  5KYX A;  3QDF A;  1K9M R;  4L59 A;  4FSX A;  4JRK A;  2XHC A;  1QVF S;  2O2O A;  4KBM B;  1AOJ A;  2JUF A;  5GAN e;  3SHW A;  3H0F A;  4R0K A;  1IZ6 A;  2LZ6 B;  3CCJ Q;  2VB6 A;  1SHF A;  3QYG B;  1PHT A;  4A4K A;  2SEM A;  3TU4 K;  2CZ1 B;  1GBQ A;  5I11 A;  1VQM Q;  3CCQ A;  4ORZ A;  1XJW B;  2QQB A;  4QQG A;  1WJQ A;  5D6W A;  3CD6 A;  2DF6 A;  2G6F X;  1YBY A;  1S1N A;  2JMC A;  2E6N A;  3SDZ A;  2R5A A;  3JB9 G;  4J6X A;  5IH2 A;  2HL3 A;  3PT9 A;  2IIM A;  3L2V A;  2KMT A;  2LX9 A;  2VGM A;  1VQ6 A;  3R6N A;  1W1F A;  3CCL Q;  4ZGE B;  1TUG B;  2CSQ A;  4RUG A;  5GAN g;  4C92 C;  1AT1 B;  2FYK A;  2L8D A;  4FM4 B;  3F70 A;  2EQJ A;  2WAC A;  3I9Q A;  5DM7 R;  1QWF A;  5KYU B;  1QCO A;  2QA4 T;  4OVA A;  1TTH B;  2QG9 B;  3SB2 A;  1EZZ B;  2M0Y A;  2ROL A;  2L0A A;  3CBO A;  3E19 A;  1PM3 A;  2O4X A;  3JB9 I;  4FYW B;  2FHD A;  2EFI A;  3KFV A;  4RCB A;  1YIJ Q;  2DO3 A;  3CCV A;  1BB9 A;  1TSF A;  4M77 A;  3QWY A;  1M1K U;  2A28 A;  2QTV A;  2DX1 A;  2EKH A;  5GAN 3;  1RI9 A;  3QSU A;  2ENM A;  2ED0 A;  4OF1 A;  1IXD A;  1H8K A;  4F7U G;  4PLI A;  2DRK A;  1IRE B;  2RHU A;  1YJW Q;  4AMC A;  1UUE A;  2FPE A;  3MP6 A;  4AFZ C;  3JCM P;  1JRI A;  2BZ8 A;  4K11 A;  3EFR A;  4KT0 E;  1I5L A;  3QBY A;  1KC8 R;  2DVJ A;  3SEM A;  4FYY B;  1VQ8 Q;  1M30 A;  4PJL A;  1YJN Q;  2HCK A;  4C8Q A;  1TG0 A;  1IGQ A;  1PRL C;  1Q86 U;  2KYB A;  3URG A;  2CH4 W;  1VQN Q;  1Y71 A;  3JCM d;  1BI2 A;  5GMK i;  4HCK A;  3NGP A;  5GAO l;  4EMG A;  2AHJ B;  1M2V A;  2SRC A;  2E70 A;  2XK0 A;  2E65 A;  1K0X A;  4QVD A;  1VQP Q;  4C0D B;  1FMK A;  2XMF A;  4M78 F;  4E2F B;  3OA6 A;  2GBQ A;  3OSV A;  1CSK A;  2BUD A;  3SWN C;  3V7S A;  3CC4 A;  1IB8 A;  5KYY B;  1M90 C;  1B34 A;  3QZ9 B;  3CCS A;  2F69 A;  4FL6 A;  5L8R E;  1WX6 A;  5KYW A;  2FZK B;  4C5G A;  3OBY A;  1Q81 U;  4II1 A;  1QMC A;  4QQD A;  2E4H A;  5LJ5 f;  1YJ9 Q;  3X25 B;  3VS2 A;  5GJW B;  2ZPB B;  3EG1 A;  1GCQ A;  2K3X A;  2YDL A;  4RTW A;  2DAQ A;  4ME7 A;  3CBP A;  2EYX A;  4WCI A;  2DXC A;  2E41 A;  3L2Z A;  4FYV B;  3EGX B;  2ED1 A;  3NTH A;  4M7D A;  5ECA A;  1BYM A;  1M2O A;  2KBT A;  1B3Q A;  3CD6 Q;  2R58 A;  3OS5 A;  4Q5W A;  1Q7Y C;  3M58 A;  4BDY A;  1K9M C;  2BKD N;  2K79 A;  3QJ6 A;  4FT4 A;  1W2B S;  1B07 A;  4DBF A;  2K3Y A;  4NOY A;  2EWN A;  4HCB A;  2EAY A;  5LJ3 j;  3S3M A;  2C06 A;  3MHX A;  3EG9 B;  3UWN A;  2CUB A;  4A4G A;  4PL6 A;  2PVO B;  2L3R A;  1PD1 A;  3MET A;  2DVE A;  1M9S A;  1WHJ A;  3ZBD A;  1K9A A;  2RF0 A;  4O6J A;  1WHM A;  4F7U A;  1YIT Q;  1KQ2 A;  2YRV A;  3LWH A;  2X3X D;  5D6X A;  5GAO n;  1M8M A;  4QQ6 A;  2DLP A;  4PK4 A;  3WVE B;  1ZSZ A;  3DLL A;  1VQO A;  4E7L A;  3EHR A;  3JCM h;  3DB4 A;  3EH1 A;  2F2X A;  4BDZ A;  1BCM A;  1H3H A;  2CUD A;  3QHS A;  4J9C A;  4RTT A;  3C95 A;  1RAF B;  3QO3 A;  1T3L A;  2O9S A;  3M0U A;  2LVM A;  2XG8 D;  1M3B A;  2K5F A;  3JCM b;  1KQS P;  2QYZ A;  2MF2 A;  3CC7 A;  4KRT A;  1M1F A;  2CKK A;  4J6Y A;  4OGE A;  1BCO A;  4ZNX A;  2RHX A;  3EFS A;  3I56 Q;  1BIB A;  2FZC B;  5KH6 A;  2YUN A;  1JO8 A;  2JOY A;  4PJN A;  5LJ3 f;  2JTM A;  2KXC A;  1I5O B;  3VUZ A;  4JJD A;  4BI4 A;  4XTZ A;  2PTK A;  1R0C B;  1IRX A;  3L1A A;  4HVW A;  3OYN A;  5FWB A;  2LQ8 A;  1SSF A;  1WQW A;  1H64 1;  1VUB A;  3EGD B;  4N0A C;  3G6E A;  2DNU A;  1G3S A;  2DMO A;  2KI7 A;  4DEX A;  1R77 A;  2FPD A;  3OYL A;  1VQ7 T;  1Y96 B;  3CME T;  5CK9 A;  1UHF A;  4KUL A;  2XI9 A;  1KC8 C;  2D6F A;  1T0J A;  3MEA A;  4KH0 B;  2KRM A;  4LE9 A;  3A98 A;  2C0T A;  4JZ3 A;  1OZ2 A;  2J06 A;  3PGG A;  1F1B B;  1NZ9 A;  3OW2 S;  1FXX A;  3BY7 A;  2FG0 A;  2YLC A;  5EG2 A;  1PG5 B;  2K7A A;  4B9W A;  4ZGD B;  1WLP B;  3CC4 Q;  1WGS A;  3CCR Q;  1X75 C;  2RQW A;  5A0L A;  1GRI A;  2LQN A;  4IUQ A;  5CQX A;  1KQ1 A;  4BY6 C;  3OYF A;  3RMQ A;  1D1B A;  1UE9 A;  4AG1 C;  2F5T X;  3G4S A;  4XTY A;  2ZPE B;  2HD0 A;  2WSE E;  4E47 A;  1LVK A;  2AT1 B;  2HEQ A;  3CXC A;  2EJG A;  1YHQ T;  4PJO D;  4R55 A;  3DB3 A;  3HTR A;  1K73 R;  2X51 A;  4JRQ A;  2NUP B;  8ATC B;  4LDU A;  4KGV B;  1KQS A;  1X6O A;  3AHU A;  5IHK A;  2Y90 A;  1VQ5 A;  3H9N A;  3QUI A;  2KRS A;  1M8V A;  1ZX6 A;  2OI3 A;  1JXM A;  4OP0 A;  3JCM Q;  3CC2 T;  2CP5 A;  3CCJ A;  1XTD A;  1QVG A;  4PFZ A;  2VXE A;  3R6O A;  1T3S A;  1X6B A;  1K8A R;  2DM1 A;  3UDC A;  2LNV A;  2LJ1 A;  2QI2 A;  1Q82 U;  4FSS A;  2GTO A;  1VQM A;  1QVF P;  4ANJ A;  4M75 D;  2DET A;  1PKS A;  3HP9 A;  4EIK A;  2RQT A;  4EMK C;  1VIF A;  3OMC A;  1BU1 A;  1GCP A;  5FU6 C;  1AWJ A;  1WXT A;  1NJI U;  1YCS B;  1ZUK A;  1UJY A;  1VQO Q;  2QEX Q;  1AWX A;  4CC7 A;  3CCE T;  4E7J A;  2LJ0 A;  1VQK T;  5GAN 2;  5HK0 A;  3INZ A;  3ME9 A;  1BI0 A;  2LCL A;  3RER A;  2CYZ B;  4FIB A;  3QXE B;  1OV3 A;  3CPW P;  1RLP C;  4Z02 A;  1NLO C;  2QAZ A;  2DYI A;  5GAM e;  2VYT A;  3IQL A;  1OQK A;  3REB B;  3M5A A;  4X1V A;  3M55 A;  1NG2 A;  1YIJ A;  1JBM A;  2F2W A;  4MMK A;  1RLQ C;  2YLB A;  1C6V X;  5A0G A;  3KUF A;  1G2B A;  2DL3 A;  2GFU A;  4J8O A;  1Z9Z A;  2KR3 A;  1UGR B;  4DOV A;  2FPF A;  3V7C A;  4X9D A;  4XU3 A;  1S72 T;  4JRI A;  3U23 A;  1E7O A;  3I55 T;  1YJW A;  1QQJ A;  2F1L A;  4C8Q C;  2M9U A;  1M3A A;  3QYH B;  1GXI E;  4M77 G;  1VQ4 T;  1WHG A;  2DTI A;  1PC0 A;  3VS6 A;  1RI0 A;  1VQ8 A;  4IUP A;  1QVF A;  4C8Q D;  4ZTJ A;  1LCK A;  1RAB B;  2ZCF B;  5GMK e;  3AT1 B;  4PJO E;  1AD5 A;  2HKN A;  5KYU A;  4IUV A;  2CSI A;  1JJ2 P;  1ZSG A;  2EBP A;  1UEB A;  3OYD A;  1VQN A;  1VQK Q;  1I8F A;  3N5B B;  1ZA1 B;  1ABQ A;  4OMO A;  3JCM c;  2CP3 A;  4KH1 B;  1NEG A;  1M27 C;  2CDT A;  3MCA B;  4AG2 C;  5IXB A;  1LNX A;  1WHH A;  1AZE A;  2HDA A;  1SKU B;  2VUB A;  1VQL Q;  4M7A D;  2KVQ G;  2DIQ A;  1C1A A;  5KE3 A;  1VQP A;  3LLR A;  3PVL A;  3M56 A;  5CKE A;  3E9G A;  2EYY A;  4L5G A;  3LX7 A;  2DK3 A;  5D6Y A;  2P4T A;  5GAN 6;  4M75 E;  1JQQ A;  1GCQ C;  3JB9 D;  3WXM B;  1VQ5 Q;  1Y07 A;  3LH0 A;  1YJ9 A;  2GTJ A;  5CIU A;  2E64 A;  2M02 A;  4J9E A;  4ZN1 A;  2KEA A;  2VGN A;  2OTL Q;  1K73 C;  2PNI A;  3QG1 A;  1D3B B;  3UT1 A;  1UTI A;  5FRN A;  3OS0 A;  2R57 A;  2L89 A;  5AYF A;  5J3B A;  1KK7 A;  3PFS A;  4OMQ A;  4EPC A;  3DKM A;  4C5H A;  4F16 A;  3UAT A;  3OYI A;  4PLL A;  5LJ3 d;  3GBQ A;  1D09 B;  4E7H A;  2X4X A;  4NS5 A;  1K8A C;  1BI1 A;  1N5Z A;  3RES A;  2X9H A;  1G83 A;  3CPW S;  2A0F B;  4OB1 B;  2DYB A;  1JJ2 A;  4M7D G;  1G5V A;  1ZUY A;  4M78 B;  3FJP A;  2DZ9 A;  3LYI A;  1X69 A;  1W2B P;  1U3O A;  4C92 D;  1D1A A;  5LJ5 h;  5GAN 5;  3QWX X;  1NPP A;  4MDW A;  3T9N A;  1LOJ A;  2HNI A;  3TQ7 P;  3OS1 A;  1ZSZ C;  5FWC A;  5GAN 7;  3JB9 J;  3VS4 A;  2IVW A;  4DQ2 A;  3A8H B;  1YIT A;  3JRZ A;  3GLX A;  3BDU A;  3EFO B;  2A36 A;  3CMA T;  4DA4 A;  2W10 A;  2LQW A;  3VRZ A;  4ZGJ B;  2PUO B;  3OB9 A;  5IAY A;  1M90 U;  1GFD A;  2C0O A;  5CKH A;  2G3R A;  5GMK m;  2YHT A;  1SHG A;  4C8Q E;  2VC8 A;  1MND A;  3O8V A;  3EGX A;  4RKU E;  2JW4 A;  1WJR A;  2FVU A;  3G71 T;  2RH2 A;  3ER0 A;  3D7S B;  4J7F A;  1WXU A;  3MP1 A;  2K57 A;  1M5Q 1;  2D8H A;  3RIR A;  5L23 A;  3I56 A;  2YRC A;  4OML A;  1ACM B;  1EFN A;  5CVI A;  4BY6 B;  4J9G A;  2JXB A;  5GAM f;  2H3E B;  1G3T A;  1JJ2 S;  1OYX A;  1WA7 A;  4OB2 B;  1P92 A;  4E7Z A;  4PJO B;  1Q7Y U;  3Q1J A;  3E1S A;  4Z89 A;  5LJ5 j;  4M7A E;  2J6O A;  3M4Y A;  4WTO B;  1K9M U;  5GAO r;  4RTY A;  3CCM T;  3CCU T;  3EG9 A;  1YP5 A;  1R0B G;  2MI6 A;  2QTX A;  2KE9 A;  2QA4 Q;  3JCM X;  2H8H A;  1GBR A;  2DBM A;  2ZPG B;  4X34 A;  1ZLM A;  3CCQ T;  4BE1 A;  4JJC A;  3OYG A;  4QT7 A;  4AFS C;  1NEB A;  1WHK A;  3X24 B;  1W2B A;  4NL3 A;  2DL7 A;  4M75 B;  4RTZ A;  3J80 E;  2RMO A;  1VQ6 T;  4JUV A;  3CEY A;  4DBR A;  5GAN j;  5KCO A;  5LJ3 h;  5CR2 A;  2RB6 A;  2OAU A;  3CCR A;  2FZG B;  4BI3 A;  2EYW A;  4EMK B;  5I21 A;  1UB4 A;  2JZ2 A;  3TVT A;  2RJE A;  2OAW A;  2DEU A;  3OW2 P;  2CT3 A;  2LX7 A;  1VQ9 T;  4LDV A;  3H0I A;  3PIO A;  2M16 A;  3KBG A;  4XU0 A;  1WFW A;  2ZPF B;  2D1X A;  1FX7 A;  4HXJ A;  4KGZ B;  4C92 E;  4JDS A;  3X28 B;  4OMP A;  1RAE B;  3CCV T;  4XK8 E;  4A63 B;  2JS0 A;  4RCC A;  1Y96 A;  1IHW A;  1VQ7 A;  1MV0 B;  2EGE A;  5DY9 A;  4UC4 A;  1E6G A;  4PJO F;  5GAN f;  3JCM g;  4AFU C;  2DIG A;  2H3J A;  2DIL A;  3MJX A;  2RA2 A;  2K9G A;  4DOW A;  1KC8 U;  2EQM A;  1OEB A;  2GF7 A;  2PUK B;  4CI0 C;  3NFC A;  5IHI A;  4MZM A;  4A4H A;  4RG2 A;  1D0Z A;  2D9T A;  2DBK A;  1MNE A;  4J9F A;  3FC3 A;  4D8K A;  1IO6 A;  4C8Q B;  3M0S A;  2EPD A;  2HL5 C;  3M4G A;  2L3Q A;  2NLU A;  2V26 A;  5J26 A;  2QEX A;  1G8X A;  2KK4 A;  1YHQ A;  2RI5 A;  4M75 F;  3HHT B;  2NUP A;  3G1J A;  1N9R A;  1KD1 R;  5CQY A;  2KYM A;  2KRO A;  2PZ1 A;  5DLO A;  1BIA A;  4PJM A;  5CCA A;  1X01 A;  1U8R A;  3OW2 A;  2RPN A;  3C4S A;  4LUE A;  2HQX A;  2VWF A;  4M7A B;  4HT9 A;  5I2M A;  3CC2 A;  3EG2 A;  2AKL A;  4Z8A A;  3OQ5 A;  4E7S A;  3CCS T;  2AIR B;  1U06 A;  2E12 A;  2X4J A;  3FIF A;  3HFO A;  2AZV A;  3RKY A;  3X20 B;  2DTO A;  1LJO A;  2BTT A;  3NHN A;  1UFF A;  1JB0 E;  3P8D A;  4LXC A;  3OYY A;  3BDL A;  2QQS A;  1M1G A;  1UDL A;  2CP6 A;  1BKB A;  2JT4 A;  1OPK A;  2IPO B;  2FRY A;  4BAC A;  3E9F A;  2E6Z A;  3H0H A;  1D1C A;  1NM7 A;  2P0P A;  4QKU A;  1KHC A;  3CCE A;  4F17 A;  1VQK A;  1ZBX A;  3RUX A;  2NYS A;  4HA8 A;  4XTU A;  1V76 A;  4M4Z A;  2LP5 A;  4V2S A;  2EQU A;  1AZG B;  4XTX A;  1TWB A;  3ZEH A;  2RK2 A;  4OMN A;  2PU9 B;  4Z88 A;  1VQL A;  2K5L A;  3V8K A;  1QKX A;  3NTK A;  4C5I A;  3L2W A;  4C8Q F;  1KG1 A;  1OX9 A;  4M78 G;  2LT1 A;  3GP8 A;  4C92 B;  4L6V 5;  3H6Z A;  4CRI A;  2DFU A;  4RMO A;  3RKW A;  3J7A F;  1QWE A;  2O31 A;  1NE8 A;  2MIO A;  4HT8 A;  2EQI A;  1AWW A;  1TH7 A;  1S72 A;  1DJ7 B;  4JLI A;  1WJS A;  1VYT A;  3UA6 A;  2WSF E;  3VV0 A;  1CKA A;  3REA B;  4J9H A;  4LDY A;  4VUB A;  1K76 A;  3LGL A;  4M7A F;  1YWO A;  4CC2 A;  2M0O A;  1VQ7 Q;  4CC3 A;  1UEC A;  1KFZ A;  2DXB A;  4IIM A;  3CME Q;  2OTL A;  1VQ4 A;  2VXF A;  4EMH A;  3GOX A;  2V8I A;  4JJN K;  2VV5 A;  1U1T A;  3CC7 T;  2LC4 A;  3TEE A;  3EAE A;  4MDX A;  2PQW A;  3H41 A;  1UGS B;  1EIF A;  4B6M A;  1QW1 A;  2COW A;  3CBM A;  4D6W A;  3JB9 F;  3QZ5 B;  4LN2 A;  4IUR A;  4TVR A;  2ZAE A;  2JN0 A;  2A7Y A;  2EYZ A;  1M4Z A;  1N9S A;  1NPR A;  4C0D C;  1PWT A;  1YI2 T;  4PJO G;  2ZPI B;  5DLQ E;  1C0M A;  2R5M A;  4ZTF A;  3G6E T;  2KT8 A;  3OYK A;  3S3N A;  4J7I A;  1J3T A;  2M51 A;  1YHQ Q;  4D8D A;  1XOV A;  1N8R R;  3FB9 A;  3NMZ C;  1Z9Q A;  2JTF A;  1FMW A;  2E10 A;  4M77 C;  3OBW A;  2O9V A;  1NLP C;  2HSE B;  3X26 B;  3ULR B;  4C0F A;  1I4K 1;  1WXB A;  2DZC A;  4M77 D;  3M57 A;  2OTJ T;  3CC2 Q;  4M75 G;  3NTI A;  1Y57 A;  4J9I A;  4C92 F;  1CKB A;  1D3B A;  2ATC B;  1KD1 C;  3TRE A;  3L42 A;  2K2V A;  2QAS A;  4MZT A;  3MEV A;  4QW2 A;  3PE0 A;  3G4S T;  3SWN B;  2EJ9 A;  2CH4 A;  1WNL A;  1K73 U;  5LJ5 d;  4FYX B;  2AKK A;  5IHN A;  5FLX E;  4XAX B;  5HKC A;  2JS2 A;  2NUZ A;  4PFO A;  2JM8 A;  8AT1 B;  1V29 B;  2PVG B;  4IIO A;  1RAH B;  2MMP A;  1PSF A;  2A08 A;  3GF5 A;  2AZS A;  3TSZ A;  4M78 A;  3WVD B;  2GNC A;  4QVZ A;  1AEY A;  2RQR A;  3I35 A;  3CCE Q;  2QA4 A;  3CCJ T;  2EKO A;  1WZO A;  1K8A U;  1OZ3 A;  2FO0 A;  3A8L B;  2F2V A;  4GBQ A;  3PVQ A;  2KRN A;  1QKW A;  2LT4 A;  1O9S A;  1VOM A;  3RNJ A;  2QDY B;  1VQM T;  2K3B A;  2RI3 A;  3TSW A;  1OOT A;  3M0R A;  2EVR A;  2KQW A;  3FRN A;  5GAN d;  4OB0 B;  4BE0 A;  1AHJ B;  1SSH A;  2DTH A;  1ZHI A;  2HKQ B;  2Y4X A;  3CCL T;  2HSP A;  2DJZ A;  2DER A;  5GAM h;  3PNW C;  2EW3 A;  3CPW A;  3VS0 A;  4PFP A;  1B7T A;  1M1K R;  2COY A;  4HCC A;  3G71 A;  1RAG B;  1QCF A;  1H92 A;  3LW5 E;  3OMG A;  1S72 Q;  2AK5 A;  2RHY A;  3I55 Q;  4FCY A;  3G7Z A;  4C0Z A;  4M7D C;  1O75 A;  1PCX A;  2JNG A;  1IGU A;  2KDS A;  2MCN A;  2XDB A;  2L3P A;  1AWO A;  4PJO A;  2MWP A;  4RTV A;  4A54 A;  2DE0 X;  1ARK A;  1VQ4 Q;  1MUZ A;  4M7D D;  2DL5 A;  5FU7 C;  5I22 A;  1I81 A;  1K4U S;  1Q7Y R;  3VS7 A;  3VJP A;  1SEM A;  3CQT A;  5LJ5 g;  2YUQ A;  3FDR A;  3CCU A;  3CCM A;  2D8J A;  4A53 A;  5KE2 A;  2CS7 A;  3BFM A;  5GAO q;  2YRD A;  1AVZ C;  1YIJ T;  2A37 A;  2VVK A;  3RKX A;  2KXD A;  4M7A G;  1Q86 R;  3LH5 A;  4PJJ A;  4RTX A;  2QQR A;  5GMK h;  5GAN 8;  4AFQ C;  4M77 E;  2LJ3 A;  5KYN A;  1TUC A;  5GAM j;  1D0X A;  1HJD A;  1I0C A;  1W6X A;  3A8O B;  4M75 A;  4CC4 B;  1YJW T;  4GLK A;  2E1H A;  3MEU A;  1EX4 A;  3MPU B;  4BI8 B;  4N4H A;  4AT1 B;  1MMN A;  5EC7 A;  2QXF A;  5KYY A;  1A0N B;  2ROT A;  1VQ8 T;  4LD9 K;  4EMK A;  3THK A;  4ELZ C;  1YJN T;  2P0Q A;  1RAC B;  1X43 A;  1WPY A;  2DKG A;  1X27 A;  1QP3 A;  4DEY A;  2DXU A;  2X3W D;  2RI2 A;  1VQ9 A;  4J6W A;  2CP2 A;  1IHV A;  1TXQ A;  2D0Q B;  2FRW A;  1Q81 R;  4LUD A;  1VQN T;  3M0Q A;  4J83 A;  2V8J A;  3J81 E;  2KT1 A;  2GQV A;  4IKF A;  1SF9 A;  1QCN A;  2P0K A;  3PMT A;  1N8R C;  3EH2 A;  5LJ3 e;  2MAM A;  3CPF A;  3JCM J;  2NUT B;  3LGF A;  1ZQ1 A;  5GAN h;  1VQP T;  5GMK j;  2HQE A;  3OYH A;  3FJ5 A;  1BK2 A;  1FYN A;  3A8G B;  3OYA A;  2RJF A;  1WDX A;  4OGC A;  4Y92 A;  1MV3 A;  1YN8 A;  3LWI A;  4DBQ A;  4C92 G;  4R56 A;  1WQ7 A;  1X6G A;  1Q95 G;  3HFN A;  3A5Z B;  4BE2 A;  3QDR B;  4OMF B;  1OU9 A;  3M59 A;  3HRU A;  2RHI A;  1YJ9 T;  5KYX B;  3JB9 H;  2COZ A;  5LJ3 g;  5CKB A;  3OYC A;  5I2S A;  2LMJ A;  2V1Q A;  4KUI A;  4F04 B;  1OU8 A;  4N4G A;  1QLY A;  1PNJ A;  2J05 A;  5FW9 A;  2XU8 A;  4HKE A;  1ZUU A;  1G3Y A;  5HY6 A;  2XKO C;  2CT4 A;  2X4W A;  3CD6 T;  3V8L A;  3M0T A;  3CMA Q;  4FW2 A;  1ZA2 B;  1SRL A;  3OY9 A;  5CKD A;  7AT1 B;  1SPK A;  4M7D E;  2XID A;  4E6R A;  2BE9 B;  1X2K A;  1PD0 A;  3JSC A;  2L5Q A;  2QDL A;  3ASK A;  4BD3 A;  2DPP B;  3G71 Q;  1RUW A;  4Y28 E;  2I0N A;  1OUL A;  2FEI A;  3GIB A;  2L3S A;  4HVV A;  2PVD B;  2MK5 A;  1XNI A;  3VUB A;  2JM9 A;  3I5S A;  3EG3 A;  4M7A A;  5FU6 B; 
#chains in the Genus database with same CATH homology
 2ZGW A;  1YBY A;  2VYT A;  5GAM e;  2EJF A;  2E6N A;  1OI1 A;  2R5A A;  3SDZ A;  3JB9 G;  4J6X A;  3JCM e;  3PT9 A;  3M5A A;  3L2V A;  2KMT A;  2LX9 A;  4BAC A;  2VGM A;  3A8M B;  3E9F A;  3M55 A;  1VQ6 A;  3HKS A;  4JS5 A;  1YIJ A;  1JBM A;  2E6Z A;  4ZGE B;  4MMK A;  1YIT T;  1M1K C;  2YLB A;  3GNG A;  5A0G A;  1Y7X A;  2P0P A;  3KUF A;  1KHC A;  2GFU A;  4C92 C;  5GAN g;  3CCE A;  2O4X B;  4J8O A;  5C6S A;  1VQK A;  2FYK A;  2BIV A;  2L8D A;  1ZBX A;  1UGR B;  4FM4 B;  3F70 A;  3RUX A;  2EIF A;  4DOV A;  2EQJ A;  2WAC A;  2GFA A;  4HA8 A;  4XTU A;  4X9D A;  3V7C A;  5DM7 R;  4XU3 A;  4M77 B;  2DD4 A;  4F7U E;  1S72 T;  3V7R A;  4V2S A;  2EQU A;  2JVV A;  4N4I A;  2QA4 T;  4OVA A;  4XTX A;  4JRI A;  2F5K A;  3ZEH A;  3CME A;  2RK2 A;  3I55 T;  2PU9 B;  1VQL A;  1YJW A;  3L2R A;  1K8A U;  2K5L A;  5M9O A;  3SB2 A;  3V8K A;  3MEW A;  3JCM V;  3NTK A;  4C5I A;  3L2W A;  4C8Q C;  2M9U A;  4C8Q F;  3CBO A;  1KG1 A;  3QYH B;  3E19 A;  4M78 G;  4M77 G;  1UGP B;  2LT1 A;  2DTI A;  4BUG A;  4C92 B;  2FL7 A;  3I56 T;  4LD6 A;  3GP8 A;  4L6V 5;  1RI0 A;  3VYH B;  2O4X A;  3JB9 I;  1VQ8 A;  3H6Z A;  4P5N A;  2X35 A;  4CRI A;  3QPH A;  4IUP A;  2FHD A;  4RMO A;  1QVF A;  4C8Q D;  2EFI A;  2DD5 A;  3RKW A;  3VU3 C;  4ZTJ A;  3J7A F;  4RCB A;  2ZCF B;  5GMK e;  3FLG A;  1NE8 A;  2DO3 A;  3CCV A;  1Q86 C;  4M77 A;  4PJO E;  4HT8 A;  1TH7 A;  4IUV A;  3M54 A;  1M1K U;  1S72 A;  3PTA A;  1UEB A;  1DJ7 B;  1R8O B;  3OYD A;  4JLI A;  1WJS A;  1VQN A;  3VV0 A;  1I8F A;  2WSF E;  3N5B B;  4Y91 A;  5GAN 3;  3QSU A;  4LDY A;  3DLM A;  2RK1 A;  1BI3 A;  2EYQ A;  3QII A;  2CZ6 B;  4VUB A;  3JCM c;  4OF1 A;  3LGL A;  4M7A F;  2M0O A;  1KHI A;  4PLI A;  3MCA B;  2DXB A;  4C92 A;  4F7U G;  1LNX A;  2I2L A;  2OTL A;  1VQ4 A;  2VXF A;  1IRE B;  4EMH A;  3GOX A;  2V8I A;  2RHU A;  2VUB A;  4KUD K;  4JJN K;  2VV5 A;  1U1T A;  3CC7 T;  2LC4 A;  3MP6 A;  4O5V A;  3TEE A;  3EAE A;  5CAI A;  4MDX A;  3JCM P;  4M7A D;  2KVQ G;  2DIQ A;  2PQW A;  1JRI A;  5KE3 A;  3EFR A;  4KT0 E;  1UGS B;  3LLR A;  4MZP A;  1EIF A;  1VQP A;  2KAF A;  1I5L A;  2CZ7 B;  3M56 A;  3QBY A;  1QW1 A;  3E9G A;  3CBM A;  5CKE A;  4D6W A;  4L5G A;  3JB9 F;  3QZ5 B;  4GY5 A;  3LX7 A;  3MP8 A;  4IUR A;  4TVR A;  2DK3 A;  4JS4 A;  5D6Y A;  2JN0 A;  2P4T A;  2A7Y A;  5GAN 6;  4M75 E;  1M4Z A;  1N9S A;  4C8Q A;  3JB9 D;  3WXM B;  1Q81 C;  1NPR A;  4C0D C;  1Q86 U;  1YI2 T;  1Y07 A;  3URG A;  4PJO G;  3LH0 A;  2O01 E;  5KCH A;  4B9X A;  1Y71 A;  3CC4 T;  4A4E A;  2ZPI B;  2K5I A;  3M9Q A;  3JCM d;  3CCR T;  5GMK l;  1YJ9 A;  5DLQ E;  2R5M A;  5CIU A;  1VIE A;  2LQK A;  2E64 A;  2CZ0 B;  1B34 B;  4ZTF A;  3CD6 A;  3G6E T;  1BI2 A;  5GMK i;  5GAO l;  3OYK A;  4EMG A;  3S3N A;  4ZN1 A;  4J7I A;  2AHJ B;  2VGN A;  3C12 A;  5LL6 S;  2E70 A;  4X9C A;  1K73 C;  3QG1 A;  2XK0 A;  2E65 A;  5HK3 A;  1D3B B;  3UT1 A;  4RG8 A;  4LDX A;  1XOV A;  4QVD A;  3FB9 A;  5FRN A;  5IN1 A;  3OS0 A;  4C0D B;  2JTF A;  2R57 A;  2E10 A;  1HXD A;  3OBW A;  2L89 A;  4LDW A;  4M78 C;  4M77 C;  4M78 F;  4M77 F;  5AYF A;  5J3B A;  3OA6 A;  3OSV A;  3HRS A;  3SWN C;  2BUD A;  3PFS A;  4E7I A;  1YI2 A;  4EPC A;  3V7S A;  3X26 B;  3CC4 A;  4C0F A;  1I4K 1;  4M7D B;  3DKM A;  1M90 C;  3L2Q A;  4C5H A;  1B34 A;  4M78 D;  3QZ9 B;  2DZC A;  4M77 D;  3M57 A;  3CCS A;  3OYI A;  2F69 A;  4FL6 A;  1HK9 A;  5L8R E;  4A4F A;  4PLL A;  2OTJ T;  1UGQ B;  5LJ3 d;  2Y4Y A;  4M75 G;  4C5G A;  3OBY A;  1Q81 U;  4E7H A;  3NTI A;  4II1 A;  3PIP A;  4QQD A;  2X4X A;  4NS5 A;  5FU7 B;  1K8A C;  1QVP A;  1BI1 A;  5LJ5 f;  4C92 F;  3RES A;  3X25 B;  1D3B A;  3CPW S;  2ZPB B;  4OB1 B;  1KD1 C;  2K3X A;  3TRE A;  3L42 A;  2K2V A;  1JJ2 A;  4M7D G;  4MZT A;  1G5V A;  4M78 B;  3FJP A;  2DAQ A;  3MEV A;  2LCC A;  2DZ9 A;  3LYI A;  4ME7 A;  4C92 D;  1MGQ A;  2DXT A;  4QW2 A;  5LJ5 h;  3CBP A;  5GAN 5;  3G4S T;  3OSS C;  1NPP A;  3SWN B;  2DXC A;  2EJ9 A;  2E41 A;  4MDW A;  3T9N A;  3L2Z A;  1LOJ A;  1WNL A;  4ELY C;  1K73 U;  2HNI A;  3NTH A;  4YTL A;  4M7D A;  3OS1 A;  3JB9 J;  5GAN 7;  1BYM A;  1H3Z A;  3FEO A;  5LJ5 d;  3OYM A;  5FLX E;  4XAX B;  2IVW A;  2R58 A;  3OS5 A;  4Q5W A;  5HKC A;  1Q7Y C;  2OTJ A;  4DQ2 A;  3A8H B;  1YIT A;  2M1H A;  3M58 A;  3JRZ A;  4BDY A;  1V29 B;  2PVG B;  1K9M C;  3GLX A;  3BDU A;  2BKD N;  3QJ6 A;  4FT4 A;  2MMP A;  3CMA T;  5IT9 E;  1PSF A;  3GF5 A;  4DA4 A;  4FT2 A;  4XQ3 A;  4ZGJ B;  1W2B S;  2PUO B;  3OB9 A;  5IAY A;  1M90 U;  2XD0 A;  2RJD A;  4M78 A;  4OB3 B;  2K3Y A;  3WVD B;  4F7U B;  3V8J A;  5CKH A;  2G3R A;  5GMK m;  2YHT A;  5J39 A;  4NOY A;  4QVZ A;  5FRO A;  4PJO C;  4XTW A;  2EWN A;  3SWN A;  4C8Q E;  4IUT A;  2CGH A;  4HCB A;  2VC8 A;  1VQO T;  2EAY A;  3VYG A;  2QEX T;  2EKO A;  3O8V A;  5GAO p;  5LJ3 j;  3CCJ T;  2QA4 A;  3S3M A;  4RKU E;  3MHX A;  1WJR A;  1OZ3 A;  2ZPH B;  3OYE A;  2FVU A;  3I55 A;  3HL8 A;  3G71 T;  2RH2 A;  3A8L B;  3ER0 A;  4J7F A;  3MP1 A;  3UWN A;  1KD1 U;  2LT4 A;  1O9S A;  4A4G A;  2QDY B;  2X4Y A;  2K57 A;  1YCY A;  4PL6 A;  4EDU A;  2PVO B;  2L3R A;  2QQA A;  2RI3 A;  1M5Q 1;  1VQM T;  3MET A;  3RIR A;  4PKC C;  1RL2 A;  3I56 A;  2LRQ A;  5CVI A;  3SFM A;  2DVE A;  4BY6 B;  1M9S A;  2KQW A;  2LDM A;  3FRN A;  5GAM f;  3ZBD A;  5GAN d;  3UPU A;  1G3T A;  4OB0 B;  1JJ2 S;  3C94 A;  1OYX A;  2WSC E;  4JLG A;  2RJC A;  4XU2 A;  5D6W A;  4BE0 A;  1AHJ B;  4O6J A;  4OB2 B;  1P92 A;  3JCM f;  2DTH A;  4F7U A;  2C06 A;  1KQ2 A;  1ZHI A;  1Q7Y U;  3Q1J A;  4PJO B;  3E1S A;  5LJ5 j;  2Y4X A;  2YRV A;  3LWH A;  3CCL T;  2DJZ A;  5D6X A;  4M7A E;  5GAM h;  5GAO n;  3PNW C;  3M4Y A;  4QQ6 A;  3WVE B;  3M53 A;  3CPW A;  1K9M U;  4J5Y A;  3DLL A;  1VQO A;  4E7L A;  5GAO r;  3CCM T;  3CCU T;  2XDP A;  3DB4 A;  3JCM h;  2RO0 A;  4HCC A;  3G71 A;  4BDZ A;  4M75 C;  5GAM d;  2MI6 A;  3LW5 E;  3OMG A;  2RHY A;  3QHS A;  2QTX A;  3ZFJ A;  3C95 A;  3QO3 A;  1FWZ A;  3JCM X;  2LVM A;  5CKF A;  2XG8 D;  3JCM b;  2K5F A;  2ZPG B;  3G7Z A;  2MF2 A;  4C0Z A;  3CC7 A;  4M7D C;  1O75 A;  4X34 A;  2JNG A;  4M7D F;  1M1F A;  1N6A A;  2KDS A;  2XDB A;  3MO8 A;  5FRM A;  2LTO A;  1PSE A;  4IUU A;  2CKK A;  2MWP A;  4J6Y A;  4OGE A;  4A54 A;  3GPL A;  3CCQ T;  2RHX A;  4PJO A;  3EFS A;  4BE1 A;  3JCM W;  3OYG A;  1BIB A;  2GCX A;  5KH6 A;  4M7D D;  3CCL A;  5FU7 C;  1I81 A;  3CXC S;  2JOY A;  1N27 A;  5LJ3 f;  3SD4 A;  3X24 B;  1W2B A;  2JTM A;  3VJP A;  4NL3 A;  4M75 B;  4QVC A;  5LJ5 g;  3FDR A;  3CCU A;  3CCM A;  4FU6 A;  3VUZ A;  4A53 A;  5KE2 A;  2CS7 A;  3BFM A;  3J80 E;  1VQ6 T;  4BI4 A;  4JUV A;  2FB7 A;  4WF2 A;  3CEY A;  4XTZ A;  5A0D A;  5GAO q;  5GAN j;  1YIJ T;  3KXT A;  1KQS S;  3RMS A;  3H8Z A;  5LJ3 h;  5KCO A;  3L1A A;  5CR2 A;  3OYN A;  2RB6 A;  3RKX A;  2OAU A;  3CCR A;  4M7A G;  4BI3 A;  2LQ8 A;  3S6W A;  4EMK B;  5I21 A;  1UB4 A;  1SSF A;  1WQW A;  2JZ2 A;  4HCZ A;  5C0M A;  2RJE A;  1H64 1;  1VUB A;  2QQR A;  4N0A C;  4C0G A;  3G6E A;  1G3S A;  5GMK h;  5A2Q E;  4PNO A;  4BB7 A;  5GAN 8;  1VQ9 T;  4M78 E;  3P8H A;  4LDV A;  4M77 E;  3OYL A;  5GAM j;  1XQH A;  1VQ7 T;  1Y96 B;  3PIO A;  3A8O B;  2M16 A;  3CME T;  5CK9 A;  1QVG S;  2XIC A;  1VQL T;  4KUL A;  4M75 A;  3KBG A;  2XI9 A;  4GLK A;  1YJW T;  4E7K A;  1KC8 C;  2E1H A;  2D6F A;  4XU0 A;  2IG0 A;  3MEU A;  3MEA A;  3S3O A;  4F7U F;  2ZPF B;  2K4Y A;  4BI8 B;  4N4H A;  3QKJ A;  3P8B B;  1FX7 A;  3TCJ A;  1OZ2 A;  2QXF A;  2B8A A;  3QJY A;  3PGG A;  4C92 E;  1VQ8 T;  4JDS A;  4LD9 K;  4EMK A;  1NZ9 A;  4ELZ C;  3GNF B;  1YJN T;  3OW2 S;  2P0Q A;  3X28 B;  1FXX A;  3BY7 A;  2KSS A;  1WPY A;  2HAX A;  2YLC A;  2DKG A;  5EG2 A;  3CCV T;  1QP3 A;  3VKI A;  4B9W A;  2DXU A;  4ZGD B;  1VQ5 T;  2RI2 A;  1WGS A;  4XK8 E;  1X75 C;  1VQ9 A;  2A3L A;  5A0L A;  4J6W A;  4RCC A;  3JAM E;  1Y96 A;  4XTV A;  2D0Q B;  4IUQ A;  5CQX A;  1KQ1 A;  1VQN T;  1VQ7 A;  4BY6 C;  3OYF A;  3RMQ A;  3OYB A;  4J83 A;  2V8J A;  2V8K A;  1Q82 C;  5GAM g;  5DY9 A;  4UC4 A;  2F5T X;  4PJO F;  3J81 E;  3G4S A;  4XTY A;  4JRP A;  2ZPE B;  2GQV A;  5GAN f;  5GAO m;  2HD0 A;  2WSE E;  3JCM g;  4IKF A;  1QP2 A;  4E47 A;  3CXC A;  2P0K A;  3PMT A;  1N8R C;  5LJ3 e;  2DIG A;  2EJG A;  2H3J A;  2OTL T;  2RHZ A;  2MAM A;  2RA2 A;  1YHQ T;  3CPF A;  4N0A A;  3JCM J;  4R55 A;  3LGF A;  4PJO D;  4DOW A;  2QQ9 A;  3DB3 A;  1ZQ1 A;  1KC8 U;  2EQM A;  5GAN h;  4JRQ A;  1YJN A;  4LDU A;  1VQP T;  5GMK j;  2HQE A;  3OYH A;  1KQS A;  1X6O A;  2GF7 A;  3AHU A;  3PMI A;  3HRT A;  2PUK B;  3A8G B;  3OYA A;  2RJF A;  2Y90 A;  1VQ5 A;  2RD1 A;  4OGC A;  4CI0 C;  3CMA A;  3NFC A;  1NJI C;  3LWI A;  1MHN A;  4MZM A;  4A4H A;  2XDD A;  3QUI A;  4RG2 A;  4C92 G;  4R56 A;  1M8V A;  3HPW A;  3OYJ A;  2D9T A;  2EQK A;  3FC3 A;  1WQ7 A;  4OP0 A;  4C8Q B;  3JCM Q;  3CC2 T;  5LJ5 e;  3HFN A;  3M4G A;  4M7A C;  3A5Z B;  2NLU A;  5J26 A;  4BE2 A;  2QEX A;  3QDR B;  3CCJ A;  4OMF B;  5GAN 4;  1XTD A;  1QVG A;  2E5Q A;  2VXE A;  3HRU A;  3M59 A;  3R6O A;  2RHI A;  4C5E A;  4MML A;  3L2U A;  2KK4 A;  1YJ9 T;  1YHQ A;  3JB9 H;  2RI5 A;  4M75 F;  3HHT B;  3UDC A;  5LJ3 g;  2LNV A;  5CO7 A;  2HBP A;  1N9R A;  2QI2 A;  5CKB A;  1Q82 U;  3OYC A;  5I2S A;  1VQM A;  5CQY A;  4NL2 A;  4ATO A;  4KUI A;  4C8Q G;  5DLO A;  4N4G A;  1BIA A;  4M75 D;  3HSB A;  1N8R U;  3HP9 A;  1X01 A;  5CCA A;  1U8R A;  2XU8 A;  3BW1 A;  4EMK C;  4XU1 A;  3OW2 A;  4HKE A;  3C4S A;  1G3Y A;  5HY6 A;  2XKO C;  1VIF A;  2X4W A;  3OMC A;  2KY9 A;  2HQX A;  2DEQ A;  3CD6 T;  4M7A B;  4HT9 A;  3OS2 A;  5I2M A;  3V8L A;  1G3W A;  3CC2 A;  2RM4 A;  5FU6 C;  1U1S A;  4ZN3 A;  1W4S A;  2MWO A;  2ZZD A;  3OQ5 A;  3OY9 A;  5CKD A;  1NJI U;  4M7D E;  4L59 A;  4FSX A;  2XID A;  4JRK A;  2XHC A;  3CCS T;  1QVF S;  4KBM B;  2JUF A;  2E12 A;  2X4J A;  3FIF A;  3HFO A;  3JSC A;  3RKY A;  5GAN e;  3X20 B;  2DTO A;  1LJO A;  1IZ6 A;  2L5Q A;  3ASK A;  3P8D A;  1JB0 E;  4BD3 A;  2DPP B;  4E7J A;  3CCE T;  3QYG B;  3OYY A;  3BDL A;  4A4K A;  4Y28 E;  1VQK T;  5GAN 2;  5HK0 A;  3INZ A;  3ME9 A;  3TU4 K;  2QQS A;  1GXI E;  1M1G A;  2CZ1 B;  1BI0 A;  3GIB A;  2LCL A;  1VQ4 T;  2PVD B;  2CYZ B;  3RER A;  1BKB A;  3QXE B;  4FIB A;  1XNI A;  3VUB A;  3CCQ A;  4Z02 A;  4M7A A;  2QQB A;  4QQG A;  5FU6 B;  1WJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...