4CI0C

Electron cryo-microscopy of f420-reducing nife hydrogenase frh
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
280
structure length
280
Chain Sequence
b'VLGTYKEIVSARSTDREIQKLAQDGGIVTGLLAYALDEGIIEGAVVAGPGEEFWKPQPMVAMSSDELKAAAGTKYTFSPNVMMLKKAVRQYGIEKLGTVAIPCQTMGIRKMQTYPFGVRFLADKIKLLVGIYCMENFPYTSLQTFICEKLGVSMELVEKMDIGKGKFWVYTQDDVLTLPLKETHGYEQAGCKICKDYVAELADVSTGSVGSPDGWSTVITRTDAGDSIFKQAVEAGLFETKPIEEVKPGLGLLEKLAAQKKEKAEKNIAARKEMGLPTPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F420-REDUCING HYDROGENASE, SUBUNIT ALPHA
molecule tags Oxidoreductase
publication title Atomic Model of the F420-Reducing [Nife] Hydrogenase by Electron Cryo-Electron Microscopy Using a Direct Electron Detector.
pubmed doi rcsb
total genus 61
structure length 280
sequence length 280
ec nomenclature ec 1.12.98.1: Coenzyme F420 hydrogenase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04422 FrhB_FdhB_N Coenzyme F420 hydrogenase/dehydrogenase, beta subunit N-term
C PF04432 FrhB_FdhB_C Coenzyme F420 hydrogenase/dehydrogenase, beta subunit C terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1030 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ci0C02
4CI0C 4OMFB
chains in the Genus database with same CATH superfamily
1NM7A 2RM4A 3URGA 1IXDA 2L89A 3M0QA 3H8ZA 5FRMA 1KJWA 5LJ5e 1X01A 1TS9A 4FYWB 4M7DB 2R5MA 4D8KA 2P4TA 2M51A 2XHCA 2BE7D 2KT1A 2NUPB 5KYYA 4AFQC 2X4XA 1ZBJA 2ATCB 4BY6B 3EG2A 2DILA 3BE3A 3A5ZB 1PSEA 4DEXA 1VQMT 4LDVA 3EG3A 4IKFA 2XDDA 1WHGA 1IREB 2RJDA 1JO8A 4LUEA 4HVUA 2KRMA 1UJYA 2E10A 1G5VA 2LMJA 1WQ7A 2KK4A 2J7IA 4L59A 2DL4A 2E65A 2JM9A 2VV5A 4M77A 3LH0A 3CCLT 3HP9A 4FIBA 1BYMA 3VS6A 3CMEA 2MPXC 4M7AA 5GAOm 3J81E 5KCOA 2DEUA 4CC2A 2DXUA 4J7FA 4EPCA 3MEWA 1QVGA 3EAEA 4FYVB 2JNGA 4EMKA 1KQSS 4LD9K 1UEBA 1VA7A 2VGMA 3GOXA 3M4YA 5FWCA 1KFZA 1S72Q 2KY9A 2QA4Q 1B34A 2KXCA 2QA4A 4M75F 1YJNA 1JXOA 2QI2A 4HCCA 2D0NA 3PMTA 1G8XA 2JOYA 2JS0A 4JLGA 2AKKA 3DLMA 1BK2A 2HL3A 4KT0E 1WHHA 2EJ9A 2V8IA 1M90C 3V7SA 4HT8A 2KRSA 2M1HA 1QW1A 4OGCA 2CREA 2KYBA 3JCMV 3JCMc 1I1JA 2VC8A 2CSIA 4GBQA 2PUKB 3CQTA 2CP2A 2FPDA 1VQ4T 4RMOA 1RACB 4DBFA 1QVGP 1NPPA 4F7UA 3G71T 1M3CA 2C06A 1LCKA 3M0PA 4ZGJB 4PLIA 2MWPA 3MEUA 4M77F 4QW2A 3P8HA 4LE9A 3CBOA 2OTJQ 2JTEA 1Q81U 1WGSA 2RJEA 3V8KA 1WLPB 2KVQG 2QQSA 3TSZA 1AD5A 1YI2T 1N27A 1WHMA 1QCNA 5A2QE 4C8QF 3WVEB 3RKXA 3TVTA 5KCHA 3FRNA 2YLBA 1OV3A 4LUDA 1YCYA 2DMOA 1NJIU 2LVMA 2ECZA 1K73C 3QO3A 2MOXA 4M78C 2RI5A 1X6GA 5GAN2 2IG0A 4KGVB 1WNLA 4M75A 5KE2A 4PJOF 2LP5A 3CMEQ 2YUNA 3CCEA 2LX7A 2DEQA 4E7HA 5IT9E 1VQPT 2ZGWA 3OYNA 1I81A 2CZ0B 2HKNA 1KK7A 5IXBA 3KUFA 1HD3A 5DLOA 1ACMB 1YJ9Q 1QQJA 2RO0A 1I5LA 3CD6Q 2LNVA 4Z88A 3PT9A 1BI2A 3CCVQ 2EVRA 4M78E 1LOJA 4F7UB 2NYSA 4MMLA 2E64A 3CCUA 3THKA 3CXCA 3SB2A 1AEYA 2OTJA 4PFPA 3G1JA 4C92F 5I2MA 3OY9A 3CD6A 3CCJA 2GFAA 4EMHA 4BE0A 1VQ6A 3OYAA 1G3SA 2DJQA 2DL8A 3GNGA 1YI2Q 1SRMA 3CPFA 2C0TA 3CC4A 2HMAA 2L3SA 3OYGA 3OW2S 1KHIA 4P5NA 1TOVA 3I5SA 4M7DF 2JZ2A 1ABOA 4Y91A 4ZN3A 3OW2P 1YITA 5GMKh 4QT7A 1U06A 1ZBXA 3OW2A 4X1VA 4C5HA 2EPDA 1YIJT 4HT9A 1YJWT 3M5AA 2SEMA 1Y96B 1EZZB 2DBMA 1ZSGA 2B8AA 1NG2A 3JB9G 1D0ZA 2HBPA 3ZBDA 1M3AA 4OMQA 2I2LA 1X6OA 3HRUA 1EX4A 2YUQA 3N5BB 3RNJA 2DD5A 2E6ZA 1RABB 3QHSA 2W0ZA 3C95A 1W4SA 3FIFA 2P0PA 3EG0A 1Q86C 4BI8B 2K9GA 2OX7A 2RQUA 5CIUA 1YJ9A 4CI0C 2P0KA 3CMAT 1X2KA 3RESA 1WJSA 5CKHA 2HSEB 1W6XA 2D8JA 1UG1A 3AT1B 1ZA2B 2QDYB 5GAOq 4NOYA 3JCMX 4QKUA 2VUBA 1AWWA 2XD0A 3LLRA 4C92B 1VQLA 3RBBB 1UGVA 1G83A 2QDLA 4JRKA 1XJWB 1M9SA 2GQIA 3GIBA 2JS2A 1W1FA 1YITT 4FW2A 3A98A 3C94A 4PJOA 3S3OA 1D0XA 3A8GB 1Z9QA 2VASA 5LJ3g 4GLMA 1PRLC 1YJNQ 3EH2A 2CZ1B 3RUXA 2EYXA 4J9DA 5GAMh 4RG2A 4M7DE 4N4IA 5CCAA 3I56T 2JMAA 1WJRA 2E1HA 3EHQA 1PG5B 3INZA 1EIFA 2DK3A 4EMGA 1VQ6T 2CP7A 2CDTA 3NTKA 1OI1A 2BE9B 1H641 1AWXA 2KMTA 1YHQA 3LW5E 5AYFA 4MDXA 1H8KA 4E47A 3G4ST 3BDUA 4FYXB 1KSWA 3CMAQ 5GAN3 3PMIA 4FCYA 1ZHIA 4RKUE 2BTTA 3NMZC 5C0MA 4QQGA 5CQYA 5KH6A 4ZGDB 1KIKA 2ROTA 2FRYA 3L2ZA 2X35A 2LDMA 4B9XA 2EGCA 3CCET 4CC3A 1YNZA 3V8JA 2X51A 4M7DA 4KULA 4BE2A 2PUOB 2EKOA 2MF2A 3D7SB 3RKYA 5IN1A 2XK0A 2DTOA 4JJCA 2EYQA 5LJ5f 2FVUA 3R6NA 1OZ2A 4Y92A 2GFUA 2V8JA 4M77E 4AG2C 3HFOA 2PVOB 2E41A 4E7JA 2RN8A 5CQXA 3CCRA 2HBWA 4FT4A 1T3LA 2K2VA 4M7AB 2VKNA 4RTXA 4M7AD 2I0NA 3REBB 4C8QE 1KQSA 2D9TA 2E3HA 2LX9A 4M77D 1D1AA 4GY5A 8AT1B 1IHVA 4JJNK 2DX1A 4JLIA 2X4JA 1V76A 2DZ9A 4M7DD 3G4SQ 4ZTJA 3CMAA 1YJ9T 3OS0A 1UGSB 1M1KC 1VQ7Q 2SRCA 2IIMA 5GAN5 4R55A 1Y0MA 1D09B 3J7AF 2O88A 1ZLMA 5FU7B 1H92A 3EGDA 2CZ7B 1PKTA 2JM8A 4HKEA 3GLXA 4JS5A 2MI6A 4E7KA 4A53A 4C92D 2QK0A 1WXTA 1I07A 2K4YA 2MCNA 3EGUA 5LJ5h 4M7AG 2VGNA 4OMMA 1U1SA 4QVZA 2GTJA 5CKFA 4M78A 5KYWB 1IO6A 2CSQA 1WJQA 4XTYA 4LDUA 2P4RA 1WA7A 4KGXB 2EBPA 4M75B 2VWFA 1I5OB 2XG8D 4KBMB 2QA4T 2QEXQ 3OBYA 3UWNA 4WTOB 4ESRA 4C8QC 3I55Q 1UE9A 3OYBA 4E7LA 2EYWA 2K3YA 3NTIA 7AT1B 3CCJT 3JCMP 4KH0B 4Z8AA 3PVLA 4FYYB 1Q7YU 1K9MU 4J8OA 4QVDA 4BDZA 3CCUT 2CT4A 3X24B 2VB6A 2BZXA 1U1TA 1N8RR 3A1PA 1WQWA 3PE0A 5LJ3h 1ZUKA 2K5IA 1JU5C 3CMET 1G3WA 2KI7A 2QGFB 2EQKA 1KC8C 1JJ2A 3CCLA 3ULRB 5GAN7 2RQRA 3VYHB 1B7TA 4LXCA 2X4WA 5FU6C 2D8HA 3MJXA 1RUWA 1UFFA 3EGDB 1ZSZC 4CRIA 1ARKA 1VQPA 3QUIA 2HSPA 2HQXA 1NPRA 3M53A 4XU1A 3NHNA 3HRTA 2BZ8A 3G71Q 4J6XA 3JCMW 2YRVA 1NE8A 1RAIB 3JB9J 1SSHA 4F7UE 1YITQ 3L2RA 2KSSA 2A37A 2QAZA 1JRIA 1SG5A 2KT8A 1AOJA 3CCQT 1TUDA 4IUVA 3ER0A 2ROLA 2F69A 1YIJQ 1YI2A 1Q82C 3TREA 2X3XD 4PJLA 4OMPA 1LPLA 4KH1B 4M75D 1GFCA 3SDZA 1SHFA 4M7DC 1YBYA 1KHCA 4PLLA 1OX8A 1UTIA 2Z0WA 2E4HA 2RHZA 4JDSA 3H0FA 1BIAA 4N4GA 3X20B 4HCBA 2KGTA 3QWXX 2EQJA 1R0BG 3A8HB 3H0IA 2ZPGB 3OYIA 4PL6A 3ME9A 1T3SA 4M75E 2RMOA 3OQ5A 1KC8R 2DZCA 3QSUA 4ZN1A 2X4YA 3R6OA 4MZPA 1Q86U 2GCXA 2H3EB 1RAFB 2Y90A 1M2OA 3BDLA 3CCSQ 4D8DA 3EH1A 4V2SA 1QKWA 5LL6S 5FWBA 1HYOA 3VS3A 3PIPA 3L2VA 2ED0A 5D6WA 1GFDA 1FYNA 5D7UA 2LRQA 2E12A 1Q95G 5KYNA 2NUTB 1FMKA 2OAUA 4C0ZA 2KR3A 1OU8A 1YFNA 3U23A 4IIOA 1OX9A 1MMAA 1W70A 1WX6A 2QEXA 2FHDA 3VS4A 1IGUA 1QMCA 1BI0A 2NUPA 3RR6A 2AIRB 4N0AC 1E6HA 1KQ2A 1YJNT 1K4US 1FXXA 3OYMA 2OI3A 5KYUA 1VUBA 4C5EA 1WHJA 2LCLA 1SHGA 4R56A 2L2PA 2HD0A 2PZ1A 2BUDA 1YHQQ 4J7IA 3VJPA 2DIGA 2O2OA 1AVZC 1IB8A 2O4XA 4LDWA 1TU0B 1X27A 2HDAA 3JCMJ 3ZL7C 3QXEB 1CKBA 1W2BA 1KQ1A 2DERA 4AFUC 1VOMA 2GTOA 2VXFA 4K11A 4J6YA 4JRIA 4BDYA 3L2WA 1G3TA 3TEEA 3OBWA 5J39A 4DOVA 1AZGB 2ZPHB 2EFIA 1GRIA 1Q7YR 1K9MR 5GMKe 2OTLA 2DXBA 1PD1A 2JVVA 4L5GA 3BFMA 3VRZA 8ATCB 1VQLQ 3OYLA 5J3BA 1VQOQ 2A08A 5KYYB 3CCRQ 3G6EQ 4J6WA 1VQKT 2CH4W 2M02A 4E2FB 3RDVA 1TUGB 3CBMA 3KFVA 2BIVA 4ZTFA 2DYIA 3HPWA 4N0AA 5LJ3f 5IHIA 5GAN4 1Q81C 3LWIA 3CCVA 4XU3A 4OVAA 1BB9A 1D1BA 4M78G 2AZVA 3OS2A 4BI4A 3X26B 1VQ9T 3CBPA 1SSFA 1VYUA 1JQQA 1RI9A 2HL5C 2DPPB 3PGGA 3V7RA 2QQAA 4AT1B 1UB4A 2O4XB 5A0GA 2EYZA 1VYTA 9ATCB 1OYXA 1I0CA 2ZZDA 1M5Q1 2FPFA 1S72T 2M0OA 4OP0A 4LDYA 5DY9A 2A36A 2IVWA 1V29B 3I55T 2KROA 1LVKA 2GNCA 4RG8A 2OTLQ 1RAAB 5IHNA 3CCJQ 1AWJA 2J06A 3OB9A 4RTUA 5D6YA 4DBRA 2K3XA 1VQ5A 2L5QA 4WCIA 3I55A 2HQHA 3JCMd 1Y7XA 4B6MA 2KXDA 3WXMB 2F2XA 2GBQA 5IH2A 2FZCB 2QYZA 2JJ9A 4C0DB 2YXYA 2RNAA 4X9DA 2CP0A 3JB9I 1VQ8T 3DB4A 3H6ZA 3I35A 3ZFJA 1EFNA 5GAMj 1K76A 2LQNA 4ME7A 4CC4B 5GANd 3T9NA 3UATA 2B86A 1JBMA 2FO0A 3FJ5A 4A4FA 5FROA 1KD1R 1GCQC 2XI9A 1AHJB 2YUPA 3MP6A 4XTVA 3M0RA 4FT2A 2E5KA 5GMKm 1MV3A 4LNPA 4OF1A 4M7AC 4RTYA 1TTHB 6AT1B 2F1LA 1LJOA 2HQEA 2DVJA 5GAN6 2MAMA 2DVEA 3TU4K 4XU0A 4A4KA 1JB0E 2ZPIB 3L1AA 5CKBA 4JUVA 3RMSA 1JJ2P 2DL5A 4BACA 2NUZA 4JPBW 3SFMA 1VQ6Q 1TWBA 3LWHA 2WSFE 3E9GA 1GCPA 2DTHA 1AWOA 1N8RC 1BCMA 3OYKA 2CKKA 2JW4A 3TCJA 1M90R 2EIFA 5I2SA 4C92C 1BU1A 1YWOA 3NFCA 2EYYA 1K9AA 4HVWA 2O9VA 2JXBA 1VQ8Q 3FC3A 3P8BB 3C0CA 5DM7R 2FEIA 4C92E 1WYXA 2P0QA 5GAN8 4ZNXA 3CCEQ 5HK0A 4PJNA 5HK3A 3SHWA 1RAHB 4R0KA 5LJ3j 3RMQA 1QP2A 1U3OA 3UPUA 1VQ8A 3VS2A 5I22A 2MMPA 4ELYC 2QEXT 3REAB 5I11A 2F2WA 3I9QA 3OYFA 5GAMf 3LH5A 1PCXA 5FW9A 2RF0A 3OA6A 2KBTA 2E6NA 1TXQA 4IUTA 1ZA1B 5LJ5j 2Y4XA 3CCST 4EMKB 2ZAEA 3CCUQ 1QVFS 5HY6A 4EIKA 3JRZA 4ORZA 3OSSC 1VQ7T 3ZEHA 5FU6B 3JCMb 4XAXB 4BE1A 1T0HA 1VQOA 2CS7A 5GJWB 1WIEA 2K5LA 2DJZA 1S72A 4M7AE 1ZSZB 2EAYA 3SD4A 2HKQB 3CPWS 2E3IA 2F5KA 3G7ZA 3OYJA 3CC7Q 1NJIR 5IAYA 3I5RA 1N8RU 2LQWA 1PRMC 1UGPB 5EG2A 2L3RA 2DAQA 4A4EA 1M2VA 4J9GA 3M59A 1VQ9A 1PD0A 4J9IA 2MYSA 3MEVA 3CCVT 2FG0A 2G6FX 2CP6A 1WHLA 2R57A 1JJ2S 3CCQA 2KYMA 2J6FA 5IXFA 3MEAA 1BI3A 4XQ3A 2QQRA 4PFZA 3E2UA 2EJGA 2RPNA 1VQKA 3MHXA 4BUGA 4DBHA 1MMDA 2X3WD 4F14A 3IQLA 2WSEE 2CP3A 1Q7YC 1K9MC 4ATOA 3GNFB 1E6GA 3EFOB 1G2BA 4EDUA 3BW1A 3L42A 3QYGB 2K7AA 1OZ3A 4C92G 1BBZA 2OTLT 4HXJA 2LC4A 2LNHB 4D6WA 2FZKB 3S3MA 3J80E 4KGZB 4XTUA 2CUBA 3OYEA 2GGRA 2VYTA 5GMKi 1W2BS 3X28B 2COYA 5FU7C 1AZEA 2GQVA 2PTKA 3BY7A 2XDBA 4F16A 4M78D 4F7UF 1OOTA 2C0IA 3EG9A 1GL5A 4RTWA 2FB7A 4A63B 1HK9A 2F2VA 4C0GA 1QCOA 1V1CA 1X69A 5GAMd 1BIBA 3OMGA 2R5AA 3G6ET 2EQMA 2L3PA 3UA7A 1HXDA 5FLXE 1U5SA 3WVDB 5A0DA 2P84A 4PNOA 2KEAA 4MDWA 2KNBB 4FM4B 2DL7A 3QPHA 2PVDB 1VQKQ 4C8QA 2CP5A 3OS5A 2DTIA 3C4SA 3NPFA 1PWTA 1M1KU 1WXBA 4AFZC 3CC2T 3M54A 3VS1A 3CPWA 1UGRB 2COWA 1E7OA 1UJ0A 4J5YA 4X34A 3JCMe 4N4HA 5GAOr 2DBKA 1C6VX 4BD3A 2EGEA 3RIRA 3JB9F 3M0SA 1X6BA 3O5ZA 3SWNB 2RHYA 2O01E 4L6V5 2LJ1A 1NBEB 2W10A 2H8HA 1OULA 3MP8A 2R58A 3QG1A 4RTVA 3EG1A 2LZ6B 3SEMA 3CEYA 2XMFA 1D1CA 4HA8A 1NLPC 5FRNA 4NL3A 3F70A 1O75A 1OPLA 3M0TA 4FSXA 2ESWA 1WHKA 3OYYA 4M77B 2RD1A 3S3NA 1GBQA 1YCSB 5KYUB 2JTFA 3M55A 1TH7A 3M0UA 4E7ZA 1N5ZA 3O8VA 2DL3A 4OB0B 3GF5A 1M1GA 1MGQA 4AFSC 4DA4A 2M0YA 3EGXA 3JSCA 1NZ9A 1SKUB 3OSVA 4BB7A 1M8VA 1CKAA 4RTZA 4C8QG 4MZTA 3EHRA 1WZOA 2QQBA 3JV3A 2K5FA 3VS7A 1VQ9Q 1ABQA 1SRLA 3HSBA 3M57A 4PKCC 1VQNT 1YWPA 2V1QA 2RK2A 3VUZA 4A54A 5LJ5g 1ZUYA 4AG1C 1WPYA 5IHKA 3A8OB 1QVPA 1M30A 5KYWA 4M77G 1S1NA 2BZYA 2LTOA 2O9SA 2RA2A 2ZPBB 3SWNA 4C0FA 2BKDN 2QGGA 1RLQC 3QJYA 4PJOG 3CXCP 1IHWA 3FLGA 1FMVA 4IUUA 5LJ5d 2RH2A 1NYFA 3EFRA 3EG9B 3C12A 1CSKA 3M56A 2K2MA 1D3BA 2COZA 1K73R 3DLLA 3CC2A 1YHQT 3CC7T 2DXTA 2JMCA 1OPKA 3HFNA 1TG0A 2RHIA 3A8LB 3S6WA 5GANf 2LQKA 2FL7A 1UECA 2RI2A 2WSCE 4XU2A 5GANh 1XOVA 1ZX6A 1Q82R 1QVFP 4NL2A 2DXCA 4DEYA 1NJIC 3G6EA 1TUCA 1MMNA 3PTAA 2KRNA 2DYBA 4PFOA 3RKWA 3LYIA 3EGXB 4E6RA 1U8RA 3OMCA 1A0NB 4JRPA 3HHTB 3VUBA 5DLQE 1Q82U 1NEBA 1XTDA 3CC7A 1PKSA 1GCQA 3META 1HJDA 1UGQB 5L23A 4NS5A 4RCBA 4PJJA 4PJOC 2CT3A 1WI7A 4M7DG 5GANj 2ZPEB 3QBYA 1VQ4Q 2CUDA 3JAME 2DNUA 3A8MB 4JS4A 2JTMA 1M1KR 1NLOC 2RJCA 1Q86R 1YP5A 3CCQQ 2DE0X 4B9WA 1MNDA 4OB3B 2QXFA 2CH4A 3GPLA 2CGHA 2D6FA 1VQNA 2LQ8A 1VYVA 3QJ6A 4RTTA 4Y28E 5GMKj 4OGEA 4VUBA 1KD1C 4J9EA 2JT4A 3QZ5B 4OMOA 1VIFA 3Q1JA 1H3ZA 1SPKA 4JJDA 3CCRT 1Z9ZA 1KD1U 1YJWA 3CXCS 1YIJA 4FSSA 1SF9A 3FJPA 4Z89A 3P8DA 1QP3A 4M78B 5KE3A 1UDLA 2XDPA 1X2QA 1PM3A 4IURA 5CK9A 3GBQA 2YSQA 2CYZB 2YRDA 2RB6A 3FDRA 1N9RA 4II1A 4BY6C 3OYHA 2YLCA 2G3RA 2WACA 2LCCA 4FU6A 1VQNQ 3FEOA 1FWZA 5HCKA 1C0MA 4BI3A 2VVKA 3VU3C 2KAFA 2RI3A 5GAOp 3KXTA 1VQ5Q 2NWMA 1IRXA 3E1SA 2JUFA 3FB9A 4LDXA 3UF4A 1B3QA 3JCMg 1G3YA 1M27C 4F7UG 3JB9H 1K0SA 1P92A 2VXEA 4Q5WA 1AT1B 3I56Q 1I4K1 1KQSP 3NGPA 1FMWA 3G4SA 2AT1B 2XU8A 1K1ZA 1T0JA 2YUOA 3VYGA 1VIEA 2A28A 3MCAB 2RK1A 4GLKA 3TQ7P 1DJ7B 4OB2B 4QQDA 4C0DC 4RCCA 3PIOA 1M4ZA 3I56A 5AT1B 1Y71A 1KG1A 3H0HA 2Y4YA 4UC4A 3MPUB 1QVFA 2RHXA 1IZ6A 4X9CA 2J05A 4PJOE 3PFSA 2KDSA 4M78F 2HAXA 3VV0A 4Z02A 1K0XA 4J9FA 2AKLA 1OEBA 2CZ6B 2K6DA 3H9NA 5GANe 2YRCA 1QLYA 2AHJB 2NLUA 1N6AA 1VQLT 2OAWA 5CAIA 1NEGA 1K8AR 1VQMQ 4XTWA 4QQ6A 4J9CA 5GAOn 3ASKA 5GAMg 1QWEA 3MP1A 1UHCA 2E70A 2DLPA 2L0AA 2LJ3A 1K8AU 1OU9A 2JN0A 2HCKA 4O5VA 3VS0A 1FX7A 4M4ZA 1Y57A 1RAGB 1O9SA 2LT1A 2J6OA 1ZQ1A 4OMFB 3OYCA 3HTRA 1M90U 1JEGA 1LNXA 1MHNA 3E9FA 1QKXA 1X43A 2F5TX 4JZ4A 3MO8A 3QDFA 3QZ9B 4C5IA 2A7YA 2FYKA 4MMKA 1Q81R 2EW3A 1MNEA 2DIQA 1R77A 2V1RA 2H3JA 2ZPFB 3UT1A 2L8DA 4RUGA 4A4HA 2DFUA 3L2QA 3OS1A 5GAMe 4C8QD 4XTXA 1SEMA 2HNIA 3QKJA 3VS5A 3HRSA 4M7AF 2DF6A 1GBRA 2DRMA 2RQWA 3LGFA 4ZGEB 2QG9B 1PSFA 2ZCFB 1UHFA 1X75C 1YN8A 5CO7A 4LD6A 5GMKl 2AZSA 2HZYA 3CC4T 1PHTA 3HL8A 4YTLA 4KUDK 1M1FA 4XTZA 4F17A 4M75G 1R8OB 2X9HA 1VQOT 4PJOD 3CD6T 3UDCA 4MZMA 1VQ7A 5GJVB 4HVVA 1QWFA 4ELZC 1F1BB 3EFOA 2OTJT 1XNIA 2RHUA 2EQUA 3CCMQ 3CCSA 4J83A 3X25B 2AK5A 2PU9B 3AHUA 3H41A 4IIMA 4AMCA 3JCMh 1R0CB 3SWNC 2LT4A 2C0OA 4EMKC 3CC2Q 2KE9A 2RQVA 4E7IA 1ZUUA 1KC8U 1WFWA 2EJFA 2RQTA 1RADB 2YHTA 4C5GA 3RERA 1RI0A 2YDLA 2M16A 4J9HA 4HCKA 2M9UA 2DKGA 2J6KA 3PVQA 2K79A 4F04B 2MK5A 5A0LA 3DKMA 4WF2A 4JJBA 2FRWA 3NTHA 1YJWQ 4KRTA 4C92A 1MUZA 2DRKA 4J9BA 4QVCA 2XICA 5CR2A 5CKEA 3CC4Q 1B07A 5GAOl 2E5QA 1OQKA 3V8LA 3UA6A 2ED1A 5L8RE 1BI1A 2A3LA 1GXIE 3VRYA 2QQ9A 3LX7A 5I21A 5KYXB 4CC7A 3PNWC 4OMNA 2MWOA 3CCMT 2YWWA 1Y07A 2EKHA 4PJMA 3G71A 2MIOA 3OYDA 1BCOA 1N9SA 2PNIA 2D0QB 1UUEA 1Y96A 2LJ0A 3QIIA 1VQ4A 1MMGA 1D0YA 3KBGA 4LN2A 4DBQA 4XK8E 1WDXA 3MKDA 1BKBA 1RL2A 4A4GA 1W2BP 2QASA 1M8MA 2QTVA 5ECAA 2DETA 1RLPC 1XQHA 4E7SA 3E19A 1J3TA 1B34B 3HKSA 1TSFA 2QTXA 1QCFA 2XKOC 3JCMf 2EGAA 2FPEA 1C1AA 3M9QA 4DQ2A 1NYGA 3TSWA 4M75C 5LJ3e 4OMLA 4OB1B 4IUPA 2RJFA 2HEQA 2YT6A 3VKIA 5KYXA 3JCMQ 3M4GA 2L3QA 4C8QB 2DD4A 5GANg 2K57A 5M9OA 3QYHB 5CKDA 1K73U 1IGQA 2DO3A 4HCZA 3QWYA 2NUTA 4IUQA 2DA9A 5CVIA 1QVGS 1ZSZA 2A0FB 3DB3A 2EWNA 5EC7A 1PC0A 2D1XA 1VQ5T 1VQPQ 4KUIA 4PJOB 2ABLA 5J26A 3L2UA 3QDRB 2EQIA 2FZGB 2K3BA 5D6XA 4O6JA 1RAEB 2PVGB 1M2VB 3JB9D 1K8AC 1D3BB 3CCLQ 5LJ3d 3V7CA 1MV0B 1PNJA 1WXUA 5C6SA 3LGLA 4FL6A 3GP8A 4FW1A 5HKCA 3CCMA 4DOWA 2KQWA 2LCSA 2GF7A 1HSQA 3CPWP 4ANJA 1VQMA 4TVRA 2O31A 2XIDA 2IPOB 3M58A 4M77C 4JRQA 1JXMA 2DM1A 2V8KA 2V26A 1I8FA 1H3HA 3EFSA 4JZ3A 2OJ2A 4PK4A 2ENMA 2PQWA 1M3BA
chains in the Genus database with same CATH topology
3SFMA 1KQSA 2D9TA 2LX9A 4M77D 2RM4A 4OGEA 4VUBA 3URGA 4GY5A 2L89A 1KD1C 3LWHA 3H8ZA 3QZ5B 4JJNK 5FRMA 5LJ5e 4JLIA 2WSFE 2X4JA 3E9GA 1VIFA 2DZ9A 3Q1JA 4M7DD 1X01A 1H3ZA 2DTHA 4ZTJA 3CMAA 1YJ9T 1N8RC 4M7DB 3OS0A 2R5MA 3OYKA 1UGSB 2CKKA 3CCRT 3TCJA 2P4TA 2XHCA 1YJWA 3CXCS 1KD1U 1M1KC 1YIJA 5GAN5 2EIFA 2X4XA 5I2SA 3FJPA 4R55A 4BY6B 4C92C 3P8DA 1QP3A 3A5ZB 1PSEA 1VQMT 4M78B 5KE3A 4LDVA 2XDPA 4IKFA 3J7AF 2XDDA 3NFCA 1IREB 5FU7B 2RJDA 4IURA 2CZ7B 5CK9A 3FC3A 4HKEA 2E10A 3P8BB 2CYZB 3GLXA 4JS5A 1WQ7A 2KK4A 2MI6A 2RB6A 5DM7R 3FDRA 1N9RA 4II1A 4BY6C 4C92E 2P0QA 2YLCA 2G3RA 4L59A 3OYHA 2WACA 4A53A 2LCCA 4M7AE 2E65A 2VV5A 4FU6A 4M77A 3LH0A 4C92D 3HP9A 3CCLT 3FEOA 1FWZA 4FIBA 5GAN8 1BYMA 2K4YA 4M7AG 5HK0A 5LJ5h 3CMEA 2VGNA 4BI3A 1U1SA 4QVZA 5HK3A 4M7AA 5GAOm 3J81E 5KCOA 3VU3C 5CKFA 2KAFA 2RI3A 5LJ3j 2DXUA 3RMQA 4J7FA 4M78A 5GAOp 1QP2A 3KXTA 3UPUA 1WJQA 4XTYA 4LDUA 4EPCA 1VQ8A 3MEWA 1QVGA 3E1SA 3FB9A 2JUFA 3EAEA 4LDXA 2JNGA 2MMPA 4ELYC 4M75B 4EMKA 2QEXT 1KQSS 4LD9K 1UEBA 3JCMg 1G3YA 2XG8D 2VGMA 3GOXA 3M4YA 4KBMB 3OYFA 2QA4T 5GAMf 4F7UG 3OBYA 3UWNA 3JB9H 1P92A 2VXEA 2KY9A 4Q5WA 4C8QC 1I4K1 3OA6A 3OYBA 1B34A 3G4SA 4E7LA 2K3YA 2E6NA 2XU8A 3NTIA 3CCJT 2QA4A 4M75F 3VYGA 4IUTA 1VIEA 5LJ5j 3JCMP 3MCAB 2Y4XA 1YJNA 3CCST 2QI2A 2RK1A 4EMKB 4HCCA 4GLKA 1QVFS 4E7KA 5HY6A 3JRZA 3PMTA 2JOYA 1Q7YU 1K9MU 4J8OA 4QVDA 4BDZA 4JLGA 3CCUT 1DJ7B 4OB2B 4QQDA 3OSSC 3X24B 1VQ7T 1U1TA 3ZEHA 5FU6B 4C0DC 3JCMb 4RCCA 4XAXB 3PIOA 3DLMA 1M4ZA 3I56A 4BE1A 1WQWA 5LJ3h 1VQOA 1Y71A 4KT0E 2CS7A 2K5IA 1KG1A 3CMET 2Y4YA 4UC4A 2K5LA 1G3WA 2DJZA 1S72A 2V8IA 2EJ9A 1M90C 2EAYA 2EQKA 1KC8C 2RHXA 1JJ2A 1QVFA 3SD4A 3V7SA 3CCLA 1IZ6A 5GAN7 3CPWS 4X9CA 3VYHB 4HT8A 2M1HA 1QW1A 2F5KA 3G7ZA 3OYJA 4PJOE 2X4WA 3PFSA 5FU6C 4OGCA 5IAYA 2KDSA 1N8RU 4M78F 2HAXA 3VV0A 1G5VA 1UGPB 4Z02A 5EG2A 3JCMV 2L3RA 2DAQA 3JCMc 4CRIA 3QUIA 1VQPA 2VC8A 4A4EA 2HQXA 1NPRA 3M53A 2CZ6B 2PUKB 4XU1A 3M59A 5GANe 1VQ4T 4RMOA 1VQ9A 3HRTA 2AHJB 2NLUA 4J6XA 3JCMW 1NPPA 1N6AA 2YRVA 1VQLT 1NE8A 3MEVA 4F7UA 3CCVT 5CAIA 3JB9J 3G71T 4F7UE 2C06A 2R57A 1JJ2S 3CCQA 4XTWA 3L2RA 4QQ6A 2KSSA 5GAOn 3ASKA 1BI3A 2QQRA 1JRIA 3MEAA 4XQ3A 4ZGJB 2EJGA 4PLIA 3MP1A 5GAMg 2MWPA 3MEUA 3CCQT 4M77F 4QW2A 3P8HA 1VQKA 3CBOA 4IUVA 3MHXA 2E70A 4BUGA 3ER0A 1K8AU 2F69A 1Q81U 2JN0A 1WGSA 2RJEA 3V8KA 4O5VA 1YI2A 1Q82C 2WSEE 2KVQG 1FX7A 2QQSA 1Q7YC 3TREA 1K9MC 4ATOA 1O9SA 2LT1A 3GNFB 1ZQ1A 4OMFB 3OYCA 1YI2T 4EDUA 3BW1A 1N27A 3L42A 3QYGB 5A2QE 4C8QF 4M75D 1M90U 1OZ3A 3SDZA 4M7DC 1YBYA 1KHCA 4C92G 4PLLA 2OTLT 1MHNA 1LNXA 3WVEB 3E9FA 2LC4A 3RKXA 4D6WA 2F5TX 5KCHA 3S3MA 3FRNA 2YLBA 3J80E 1YCYA 2RHZA 3MO8A 4JDSA 3QZ9B 4XTUA 1BIAA 1NJIU 4C5IA 2LVMA 2A7YA 3OYEA 4N4GA 2FYKA 4MMKA 3X20B 4HCBA 1K73C 2EQJA 3QO3A 2VYTA 5GMKi 4M78C 2RI5A 2DIQA 3A8HB 2H3JA 2ZPGB 1W2BS 3X28B 5FU7C 2ZPFB 3OYIA 4PL6A 3UT1A 3ME9A 4M75E 2L8DA 5GAN2 2GQVA 2IG0A 3OQ5A 1WNLA 2DZCA 4M75A 4A4HA 3L2QA 3QSUA 4ZN1A 5KE2A 2X4YA 3BY7A 4PJOF 3R6OA 4MZPA 4C8QD 5GAMe 3OS1A 2XDBA 1Q86U 4XTXA 2GCXA 2HNIA 3CCEA 2DEQA 3QKJA 4E7HA 5IT9E 1VQPT 2ZGWA 2Y90A 3HRSA 4M78D 4M7AF 3OYNA 4F7UF 3BDLA 3LGFA 4ZGEB 1I81A 1PSFA 2ZCFB 1X75C 5CO7A 4LD6A 2CZ0B 5GMKl 4V2SA 3CC4T 5LL6S 2FB7A 3HL8A 4YTLA 4KUDK 1HK9A 3PIPA 1M1FA 4C0GA 4XTZA 3L2VA 3KUFA 5DLOA 5GAMd 1BIBA 5D6WA 3OMGA 2R5AA 2RO0A 1I5LA 4M75G 3G6ET 2EQMA 2LRQA 2E12A 1R8OB 2LNVA 3PT9A 1BI2A 1VQOT 4PJOD 2OAUA 4M78E 1LOJA 3CD6T 4F7UB 1HXDA 4MZMA 3UDCA 4C0ZA 3WVDB 5FLXE 5A0DA 4MMLA 1VQ7A 2E64A 4PNOA 3CCUA 4MDWA 3SB2A 3CXCA 2QEXA 2FHDA 2OTJA 4FM4B 4ELZC 1BI0A 2PVDB 3QPHA 2OTJT 4C8QA 3OS5A 5I2MA 1XNIA 4C92F 2DTIA 2RHUA 2EQUA 3C4SA 4N0AC 3CCSA 1KQ2A 1YJNT 1M1KU 4J83A 3X25B 2PU9B 3OY9A 3AHUA 3CC2T 3CD6A 1FXXA 2GFAA 3JCMh 4EMHA 3M54A 3CCJA 3SWNC 3CPWA 4BE0A 2LT4A 3OYAA 1VQ6A 4EMKC 1G3SA 1UGRB 3OYMA 3GNGA 1VUBA 4J5YA 4X34A 4C5EA 3JCMe 4N4HA 4E7IA 2LCLA 5GAOr 3CPFA 4R56A 4BD3A 2HD0A 1KC8U 3RIRA 3JB9F 2BUDA 2EJFA 3CC4A 4J7IA 3VJPA 3SWNB 3OYGA 2RHYA 2DIGA 2O01E 4L6V5 2YHTA 4C5GA 2O4XA 1RI0A 4LDWA 3OW2S 3RERA 1KHIA 4P5NA 2M16A 3JCMJ 3MP8A 3QXEB 2R58A 2JZ2A 4Y91A 3QG1A 4ZN3A 1YITA 1W2BA 4M7DF 5GMKh 1KQ1A 2M9UA 2DKGA 1ZBXA 3OW2A 4C5HA 3CEYA 4HA8A 1YIJT 4HT9A 1YJWT 5FRNA 3M5AA 5A0LA 4NL3A 1Y96B 3DKMA 4WF2A 2VXFA 4J6YA 3F70A 3NTHA 4JRIA 4BDYA 2B8AA 3L2WA 4C92A 1O75A 1G3TA 3TEEA 3OBWA 5J39A 4DOVA 3JB9G 4FSXA 2ZPHB 2EFIA 3OYYA 2HBPA 4M77B 4QVCA 2XICA 2RD1A 3ZBDA 5GMKe 3S3NA 5CR2A 5CKEA 2OTLA 2DXBA 5GAOl 2I2LA 1X6OA 3HRUA 2JTFA 2E5QA 3M55A 3N5BB 1TH7A 3V8LA 2JVVA 3O8VA 4OB0B 2DD5A 4L5GA 2E6ZA 3QHSA 3GF5A 1M1GA 3BFMA 1MGQA 3OYLA 3C95A 1W4SA 3FIFA 5J3BA 5L8RE 1BI1A 2P0PA 1Q86C 4BI8B 2A3LA 4DA4A 5CIUA 1YJ9A 4CI0C 2P0KA 3CMAT 2QQ9A 3LX7A 4J6WA 3RESA 5I21A 1GXIE 1VQKT 1WJSA 3JSCA 1NZ9A 5CKHA 3PNWC 3OSVA 3CBMA 4BB7A 2BIVA 2MWOA 1M8VA 3CCMT 4ZTFA 2QDYB 3HPWA 4N0AA 4NOYA 1Y07A 3JCMX 5GAOq 2VUBA 4C8QG 5LJ3f 4MZTA 3G71A 2QQBA 5GAN4 2K5FA 3OYDA 3LLRA 4C92B 3LWIA 3CCVA 1Q81C 4XU3A 4OVAA 2XD0A 3HSBA 1N9SA 3M57A 4M78G 2D0QB 4PKCC 1VQLA 1VQNT 2RK2A 3OS2A 4BI4A 1Y96A 3VUZA 4JRKA 3X26B 3QIIA 1VQ4A 4A54A 1M9SA 5LJ5g 1VQ9T 3GIBA 3CBPA 3KBGA 1WPYA 1SSFA 3A8OB 1QVPA 4XK8E 4M77G 1BKBA 1RL2A 4A4GA 2DPPB 3PGGA 3V7RA 2LTOA 1YITT 2RA2A 2ZPBB 2QQAA 3SWNA 4C0FA 2BKDN 3C94A 1UB4A 4PJOA 3S3OA 1XQHA 3QJYA 2O4XB 3A8GB 3E19A 4PJOG 5LJ3g 1B34B 5A0GA 3HKSA 2QTXA 2CZ1B 3RUXA 2XKOC 3JCMf 3FLGA 1OYXA 2ZZDA 5GAMh 1M5Q1 1S72T 2M0OA 4OP0A 4IUUA 4RG2A 4M7DE 5LJ5d 4N4IA 3M9QA 4LDYA 5DY9A 2RH2A 3EFRA 4DQ2A 5CCAA 2IVWA 4M75C 5LJ3e 3I56T 1WJRA 2E1HA 1V29B 4OB1B 4IUPA 3I55T 3C12A 1EIFA 2DK3A 3INZA 4EMGA 2RJFA 3M56A 1VQ6T 4RG8A 1D3BA 3CC2A 3DLLA 3NTKA 3VKIA 1YHQT 3CC7T 2DXTA 3JCMQ 3M4GA 3HFNA 4C8QB 1OI1A 2DD4A 1H641 2RHIA 3A8LB 3OB9A 2KMTA 3S6WA 5GANf 1YHQA 5D6YA 2LQKA 2K3XA 2FL7A 2RI2A 1VQ5A 3LW5E 2L5QA 5AYFA 2WSCE 3I55A 4MDXA 4XU2A 4E47A 3JCMd 1XOVA 5GANg 2K57A 5GANh 3G4ST 5M9OA 3QYHB 5CKDA 1K73U 2DO3A 3BDUA 1Y7XA 4HCZA 4NL2A 2DXCA 1NJIC 4IUQA 3G6EA 5CVIA 3WXMB 1QVGS 3DB3A 5GAN3 3PTAA 3PMIA 2EWNA 1ZHIA 4RKUE 3RKWA 3LYIA 1VQ5T 4C0DB 5C0MA 4KUIA 4QQGA 4PJOB 1U8RA 3OMCA 5CQYA 5J26A 4X9DA 5KH6A 4ZGDB 3L2UA 3QDRB 3HHTB 4JRPA 3VUBA 3JB9I 5DLQE 1VQ8T 3DB4A 5D6XA 3H6ZA 2X35A 3L2ZA 4O6JA 2LDMA 3ZFJA 4B9XA 1Q82U 1XTDA 3CC7A 5GAMj 4ME7A 3CCET 2PVGB 5GANd 3JB9D 3T9NA 1K8AC 3META 1D3BB 3V8JA 1UGQB 1JBMA 4NS5A 4RCBA 5LJ3d 4KULA 3V7CA 4M7DA 4PJOC 4M7DG 4BE2A 2PUOB 4A4FA 2EKOA 2MF2A 5GANj 5FROA 2ZPEB 3QBYA 2XI9A 3RKYA 3JAME 5C6SA 5IN1A 1AHJB 2XK0A 3LGLA 4FL6A 5HKCA 2DTOA 3MP6A 4XTVA 4FT2A 3GP8A 2EYQA 3CCMA 5LJ5f 2FVUA 3A8MB 4DOWA 4JS4A 2JTMA 2KQWA 2GF7A 2RJCA 5GMKm 1OZ2A 4OF1A 4M7AC 2GFUA 1VQMA 4TVRA 2V8JA 1LJOA 2HQEA 2XIDA 4M77E 3M58A 5GAN6 3HFOA 4M77C 2MAMA 2PVOB 4B9WA 4JRQA 2DVEA 2E41A 4E7JA 4OB3B 3TU4K 5CQXA 3CCRA 2QXFA 2V8KA 4XU0A 3GPLA 4A4KA 4FT4A 2CGHA 1I8FA 2K2VA 2D6FA 3EFSA 4M7AB 1JB0E 2LQ8A 1VQNA 2ZPIB 3QJ6A 4Y28E 4M7AD 2PQWA 3L1AA 5CKBA 4JUVA 3RMSA 5GMKj 4BACA 4C8QE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CI0 C;  4OMF B; 
#chains in the Genus database with same CATH topology
 1NM7 A;  2RM4 A;  3URG A;  1IXD A;  2L89 A;  3M0Q A;  3H8Z A;  5FRM A;  1KJW A;  5LJ5 e;  1X01 A;  1TS9 A;  4FYW B;  4M7D B;  2R5M A;  4D8K A;  2P4T A;  2M51 A;  2XHC A;  2BE7 D;  2KT1 A;  2NUP B;  5KYY A;  4AFQ C;  2X4X A;  1ZBJ A;  2ATC B;  4BY6 B;  3EG2 A;  2DIL A;  3BE3 A;  3A5Z B;  1PSE A;  4DEX A;  1VQM T;  4LDV A;  3EG3 A;  4IKF A;  2XDD A;  1WHG A;  1IRE B;  2RJD A;  1JO8 A;  4LUE A;  4HVU A;  2KRM A;  1UJY A;  2E10 A;  1G5V A;  2LMJ A;  1WQ7 A;  2KK4 A;  2J7I A;  4L59 A;  2DL4 A;  2E65 A;  2JM9 A;  2VV5 A;  4M77 A;  3LH0 A;  3CCL T;  3HP9 A;  4FIB A;  1BYM A;  3VS6 A;  3CME A;  2MPX C;  4M7A A;  5GAO m;  3J81 E;  5KCO A;  2DEU A;  4CC2 A;  2DXU A;  4J7F A;  4EPC A;  3MEW A;  1QVG A;  3EAE A;  4FYV B;  2JNG A;  4EMK A;  1KQS S;  4LD9 K;  1UEB A;  1VA7 A;  2VGM A;  3GOX A;  3M4Y A;  5FWC A;  1KFZ A;  1S72 Q;  2KY9 A;  2QA4 Q;  1B34 A;  2KXC A;  2QA4 A;  4M75 F;  1YJN A;  1JXO A;  2QI2 A;  4HCC A;  2D0N A;  3PMT A;  1G8X A;  2JOY A;  2JS0 A;  4JLG A;  2AKK A;  3DLM A;  1BK2 A;  2HL3 A;  4KT0 E;  1WHH A;  2EJ9 A;  2V8I A;  1M90 C;  3V7S A;  4HT8 A;  2KRS A;  2M1H A;  1QW1 A;  4OGC A;  2CRE A;  2KYB A;  3JCM V;  3JCM c;  1I1J A;  2VC8 A;  2CSI A;  4GBQ A;  2PUK B;  3CQT A;  2CP2 A;  2FPD A;  1VQ4 T;  4RMO A;  1RAC B;  4DBF A;  1QVG P;  1NPP A;  4F7U A;  3G71 T;  1M3C A;  2C06 A;  1LCK A;  3M0P A;  4ZGJ B;  4PLI A;  2MWP A;  3MEU A;  4M77 F;  4QW2 A;  3P8H A;  4LE9 A;  3CBO A;  2OTJ Q;  2JTE A;  1Q81 U;  1WGS A;  2RJE A;  3V8K A;  1WLP B;  2KVQ G;  2QQS A;  3TSZ A;  1AD5 A;  1YI2 T;  1N27 A;  1WHM A;  1QCN A;  5A2Q E;  4C8Q F;  3WVE B;  3RKX A;  3TVT A;  5KCH A;  3FRN A;  2YLB A;  1OV3 A;  4LUD A;  1YCY A;  2DMO A;  1NJI U;  2LVM A;  2ECZ A;  1K73 C;  3QO3 A;  2MOX A;  4M78 C;  2RI5 A;  1X6G A;  5GAN 2;  2IG0 A;  4KGV B;  1WNL A;  4M75 A;  5KE2 A;  4PJO F;  2LP5 A;  3CME Q;  2YUN A;  3CCE A;  2LX7 A;  2DEQ A;  4E7H A;  5IT9 E;  1VQP T;  2ZGW A;  3OYN A;  1I81 A;  2CZ0 B;  2HKN A;  1KK7 A;  5IXB A;  3KUF A;  1HD3 A;  5DLO A;  1ACM B;  1YJ9 Q;  1QQJ A;  2RO0 A;  1I5L A;  3CD6 Q;  2LNV A;  4Z88 A;  3PT9 A;  1BI2 A;  3CCV Q;  2EVR A;  4M78 E;  1LOJ A;  4F7U B;  2NYS A;  4MML A;  2E64 A;  3CCU A;  3THK A;  3CXC A;  3SB2 A;  1AEY A;  2OTJ A;  4PFP A;  3G1J A;  4C92 F;  5I2M A;  3OY9 A;  3CD6 A;  3CCJ A;  2GFA A;  4EMH A;  4BE0 A;  1VQ6 A;  3OYA A;  1G3S A;  2DJQ A;  2DL8 A;  3GNG A;  1YI2 Q;  1SRM A;  3CPF A;  2C0T A;  3CC4 A;  2HMA A;  2L3S A;  3OYG A;  3OW2 S;  1KHI A;  4P5N A;  1TOV A;  3I5S A;  4M7D F;  2JZ2 A;  1ABO A;  4Y91 A;  4ZN3 A;  3OW2 P;  1YIT A;  5GMK h;  4QT7 A;  1U06 A;  1ZBX A;  3OW2 A;  4X1V A;  4C5H A;  2EPD A;  1YIJ T;  4HT9 A;  1YJW T;  3M5A A;  2SEM A;  1Y96 B;  1EZZ B;  2DBM A;  1ZSG A;  2B8A A;  1NG2 A;  3JB9 G;  1D0Z A;  2HBP A;  3ZBD A;  1M3A A;  4OMQ A;  2I2L A;  1X6O A;  3HRU A;  1EX4 A;  2YUQ A;  3N5B B;  3RNJ A;  2DD5 A;  2E6Z A;  1RAB B;  3QHS A;  2W0Z A;  3C95 A;  1W4S A;  3FIF A;  2P0P A;  3EG0 A;  1Q86 C;  4BI8 B;  2K9G A;  2OX7 A;  2RQU A;  5CIU A;  1YJ9 A;  4CI0 C;  2P0K A;  3CMA T;  1X2K A;  3RES A;  1WJS A;  5CKH A;  2HSE B;  1W6X A;  2D8J A;  1UG1 A;  3AT1 B;  1ZA2 B;  2QDY B;  5GAO q;  4NOY A;  3JCM X;  4QKU A;  2VUB A;  1AWW A;  2XD0 A;  3LLR A;  4C92 B;  1VQL A;  3RBB B;  1UGV A;  1G83 A;  2QDL A;  4JRK A;  1XJW B;  1M9S A;  2GQI A;  3GIB A;  2JS2 A;  1W1F A;  1YIT T;  4FW2 A;  3A98 A;  3C94 A;  4PJO A;  3S3O A;  1D0X A;  3A8G B;  1Z9Q A;  2VAS A;  5LJ3 g;  4GLM A;  1PRL C;  1YJN Q;  3EH2 A;  2CZ1 B;  3RUX A;  2EYX A;  4J9D A;  5GAM h;  4RG2 A;  4M7D E;  4N4I A;  5CCA A;  3I56 T;  2JMA A;  1WJR A;  2E1H A;  3EHQ A;  1PG5 B;  3INZ A;  1EIF A;  2DK3 A;  4EMG A;  1VQ6 T;  2CP7 A;  2CDT A;  3NTK A;  1OI1 A;  2BE9 B;  1H64 1;  1AWX A;  2KMT A;  1YHQ A;  3LW5 E;  5AYF A;  4MDX A;  1H8K A;  4E47 A;  3G4S T;  3BDU A;  4FYX B;  1KSW A;  3CMA Q;  5GAN 3;  3PMI A;  4FCY A;  1ZHI A;  4RKU E;  2BTT A;  3NMZ C;  5C0M A;  4QQG A;  5CQY A;  5KH6 A;  4ZGD B;  1KIK A;  2ROT A;  2FRY A;  3L2Z A;  2X35 A;  2LDM A;  4B9X A;  2EGC A;  3CCE T;  4CC3 A;  1YNZ A;  3V8J A;  2X51 A;  4M7D A;  4KUL A;  4BE2 A;  2PUO B;  2EKO A;  2MF2 A;  3D7S B;  3RKY A;  5IN1 A;  2XK0 A;  2DTO A;  4JJC A;  2EYQ A;  5LJ5 f;  2FVU A;  3R6N A;  1OZ2 A;  4Y92 A;  2GFU A;  2V8J A;  4M77 E;  4AG2 C;  3HFO A;  2PVO B;  2E41 A;  4E7J A;  2RN8 A;  5CQX A;  3CCR A;  2HBW A;  4FT4 A;  1T3L A;  2K2V A;  4M7A B;  2VKN A;  4RTX A;  4M7A D;  2I0N A;  3REB B;  4C8Q E;  1KQS A;  2D9T A;  2E3H A;  2LX9 A;  4M77 D;  1D1A A;  4GY5 A;  8AT1 B;  1IHV A;  4JJN K;  2DX1 A;  4JLI A;  2X4J A;  1V76 A;  2DZ9 A;  4M7D D;  3G4S Q;  4ZTJ A;  3CMA A;  1YJ9 T;  3OS0 A;  1UGS B;  1M1K C;  1VQ7 Q;  2SRC A;  2IIM A;  5GAN 5;  4R55 A;  1Y0M A;  1D09 B;  3J7A F;  2O88 A;  1ZLM A;  5FU7 B;  1H92 A;  3EGD A;  2CZ7 B;  1PKT A;  2JM8 A;  4HKE A;  3GLX A;  4JS5 A;  2MI6 A;  4E7K A;  4A53 A;  4C92 D;  2QK0 A;  1WXT A;  1I07 A;  2K4Y A;  2MCN A;  3EGU A;  5LJ5 h;  4M7A G;  2VGN A;  4OMM A;  1U1S A;  4QVZ A;  2GTJ A;  5CKF A;  4M78 A;  5KYW B;  1IO6 A;  2CSQ A;  1WJQ A;  4XTY A;  4LDU A;  2P4R A;  1WA7 A;  4KGX B;  2EBP A;  4M75 B;  2VWF A;  1I5O B;  2XG8 D;  4KBM B;  2QA4 T;  2QEX Q;  3OBY A;  3UWN A;  4WTO B;  4ESR A;  4C8Q C;  3I55 Q;  1UE9 A;  3OYB A;  4E7L A;  2EYW A;  2K3Y A;  3NTI A;  7AT1 B;  3CCJ T;  3JCM P;  4KH0 B;  4Z8A A;  3PVL A;  4FYY B;  1Q7Y U;  1K9M U;  4J8O A;  4QVD A;  4BDZ A;  3CCU T;  2CT4 A;  3X24 B;  2VB6 A;  2BZX A;  1U1T A;  1N8R R;  3A1P A;  1WQW A;  3PE0 A;  5LJ3 h;  1ZUK A;  2K5I A;  1JU5 C;  3CME T;  1G3W A;  2KI7 A;  2QGF B;  2EQK A;  1KC8 C;  1JJ2 A;  3CCL A;  3ULR B;  5GAN 7;  2RQR A;  3VYH B;  1B7T A;  4LXC A;  2X4W A;  5FU6 C;  2D8H A;  3MJX A;  1RUW A;  1UFF A;  3EGD B;  1ZSZ C;  4CRI A;  1ARK A;  1VQP A;  3QUI A;  2HSP A;  2HQX A;  1NPR A;  3M53 A;  4XU1 A;  3NHN A;  3HRT A;  2BZ8 A;  3G71 Q;  4J6X A;  3JCM W;  2YRV A;  1NE8 A;  1RAI B;  3JB9 J;  1SSH A;  4F7U E;  1YIT Q;  3L2R A;  2KSS A;  2A37 A;  2QAZ A;  1JRI A;  1SG5 A;  2KT8 A;  1AOJ A;  3CCQ T;  1TUD A;  4IUV A;  3ER0 A;  2ROL A;  2F69 A;  1YIJ Q;  1YI2 A;  1Q82 C;  3TRE A;  2X3X D;  4PJL A;  4OMP A;  1LPL A;  4KH1 B;  4M75 D;  1GFC A;  3SDZ A;  1SHF A;  4M7D C;  1YBY A;  1KHC A;  4PLL A;  1OX8 A;  1UTI A;  2Z0W A;  2E4H A;  2RHZ A;  4JDS A;  3H0F A;  1BIA A;  4N4G A;  3X20 B;  4HCB A;  2KGT A;  3QWX X;  2EQJ A;  1R0B G;  3A8H B;  3H0I A;  2ZPG B;  3OYI A;  4PL6 A;  3ME9 A;  1T3S A;  4M75 E;  2RMO A;  3OQ5 A;  1KC8 R;  2DZC A;  3QSU A;  4ZN1 A;  2X4Y A;  3R6O A;  4MZP A;  1Q86 U;  2GCX A;  2H3E B;  1RAF B;  2Y90 A;  1M2O A;  3BDL A;  3CCS Q;  4D8D A;  3EH1 A;  4V2S A;  1QKW A;  5LL6 S;  5FWB A;  1HYO A;  3VS3 A;  3PIP A;  3L2V A;  2ED0 A;  5D6W A;  1GFD A;  1FYN A;  5D7U A;  2LRQ A;  2E12 A;  1Q95 G;  5KYN A;  2NUT B;  1FMK A;  2OAU A;  4C0Z A;  2KR3 A;  1OU8 A;  1YFN A;  3U23 A;  4IIO A;  1OX9 A;  1MMA A;  1W70 A;  1WX6 A;  2QEX A;  2FHD A;  3VS4 A;  1IGU A;  1QMC A;  1BI0 A;  2NUP A;  3RR6 A;  2AIR B;  4N0A C;  1E6H A;  1KQ2 A;  1YJN T;  1K4U S;  1FXX A;  3OYM A;  2OI3 A;  5KYU A;  1VUB A;  4C5E A;  1WHJ A;  2LCL A;  1SHG A;  4R56 A;  2L2P A;  2HD0 A;  2PZ1 A;  2BUD A;  1YHQ Q;  4J7I A;  3VJP A;  2DIG A;  2O2O A;  1AVZ C;  1IB8 A;  2O4X A;  4LDW A;  1TU0 B;  1X27 A;  2HDA A;  3JCM J;  3ZL7 C;  3QXE B;  1CKB A;  1W2B A;  1KQ1 A;  2DER A;  4AFU C;  1VOM A;  2GTO A;  2VXF A;  4K11 A;  4J6Y A;  4JRI A;  4BDY A;  3L2W A;  1G3T A;  3TEE A;  3OBW A;  5J39 A;  4DOV A;  1AZG B;  2ZPH B;  2EFI A;  1GRI A;  1Q7Y R;  1K9M R;  5GMK e;  2OTL A;  2DXB A;  1PD1 A;  2JVV A;  4L5G A;  3BFM A;  3VRZ A;  8ATC B;  1VQL Q;  3OYL A;  5J3B A;  1VQO Q;  2A08 A;  5KYY B;  3CCR Q;  3G6E Q;  4J6W A;  1VQK T;  2CH4 W;  2M02 A;  4E2F B;  3RDV A;  1TUG B;  3CBM A;  3KFV A;  2BIV A;  4ZTF A;  2DYI A;  3HPW A;  4N0A A;  5LJ3 f;  5IHI A;  5GAN 4;  1Q81 C;  3LWI A;  3CCV A;  4XU3 A;  4OVA A;  1BB9 A;  1D1B A;  4M78 G;  2AZV A;  3OS2 A;  4BI4 A;  3X26 B;  1VQ9 T;  3CBP A;  1SSF A;  1VYU A;  1JQQ A;  1RI9 A;  2HL5 C;  2DPP B;  3PGG A;  3V7R A;  2QQA A;  4AT1 B;  1UB4 A;  2O4X B;  5A0G A;  2EYZ A;  1VYT A;  9ATC B;  1OYX A;  1I0C A;  2ZZD A;  1M5Q 1;  2FPF A;  1S72 T;  2M0O A;  4OP0 A;  4LDY A;  5DY9 A;  2A36 A;  2IVW A;  1V29 B;  3I55 T;  2KRO A;  1LVK A;  2GNC A;  4RG8 A;  2OTL Q;  1RAA B;  5IHN A;  3CCJ Q;  1AWJ A;  2J06 A;  3OB9 A;  4RTU A;  5D6Y A;  4DBR A;  2K3X A;  1VQ5 A;  2L5Q A;  4WCI A;  3I55 A;  2HQH A;  3JCM d;  1Y7X A;  4B6M A;  2KXD A;  3WXM B;  2F2X A;  2GBQ A;  5IH2 A;  2FZC B;  2QYZ A;  2JJ9 A;  4C0D B;  2YXY A;  2RNA A;  4X9D A;  2CP0 A;  3JB9 I;  1VQ8 T;  3DB4 A;  3H6Z A;  3I35 A;  3ZFJ A;  1EFN A;  5GAM j;  1K76 A;  2LQN A;  4ME7 A;  4CC4 B;  5GAN d;  3T9N A;  3UAT A;  2B86 A;  1JBM A;  2FO0 A;  3FJ5 A;  4A4F A;  5FRO A;  1KD1 R;  1GCQ C;  2XI9 A;  1AHJ B;  2YUP A;  3MP6 A;  4XTV A;  3M0R A;  4FT2 A;  2E5K A;  5GMK m;  1MV3 A;  4LNP A;  4OF1 A;  4M7A C;  4RTY A;  1TTH B;  6AT1 B;  2F1L A;  1LJO A;  2HQE A;  2DVJ A;  5GAN 6;  2MAM A;  2DVE A;  3TU4 K;  4XU0 A;  4A4K A;  1JB0 E;  2ZPI B;  3L1A A;  5CKB A;  4JUV A;  3RMS A;  1JJ2 P;  2DL5 A;  4BAC A;  2NUZ A;  4JPB W;  3SFM A;  1VQ6 Q;  1TWB A;  3LWH A;  2WSF E;  3E9G A;  1GCP A;  2DTH A;  1AWO A;  1N8R C;  1BCM A;  3OYK A;  2CKK A;  2JW4 A;  3TCJ A;  1M90 R;  2EIF A;  5I2S A;  4C92 C;  1BU1 A;  1YWO A;  3NFC A;  2EYY A;  1K9A A;  4HVW A;  2O9V A;  2JXB A;  1VQ8 Q;  3FC3 A;  3P8B B;  3C0C A;  5DM7 R;  2FEI A;  4C92 E;  1WYX A;  2P0Q A;  5GAN 8;  4ZNX A;  3CCE Q;  5HK0 A;  4PJN A;  5HK3 A;  3SHW A;  1RAH B;  4R0K A;  5LJ3 j;  3RMQ A;  1QP2 A;  1U3O A;  3UPU A;  1VQ8 A;  3VS2 A;  5I22 A;  2MMP A;  4ELY C;  2QEX T;  3REA B;  5I11 A;  2F2W A;  3I9Q A;  3OYF A;  5GAM f;  3LH5 A;  1PCX A;  5FW9 A;  2RF0 A;  3OA6 A;  2KBT A;  2E6N A;  1TXQ A;  4IUT A;  1ZA1 B;  5LJ5 j;  2Y4X A;  3CCS T;  4EMK B;  2ZAE A;  3CCU Q;  1QVF S;  5HY6 A;  4EIK A;  3JRZ A;  4ORZ A;  3OSS C;  1VQ7 T;  3ZEH A;  5FU6 B;  3JCM b;  4XAX B;  4BE1 A;  1T0H A;  1VQO A;  2CS7 A;  5GJW B;  1WIE A;  2K5L A;  2DJZ A;  1S72 A;  4M7A E;  1ZSZ B;  2EAY A;  3SD4 A;  2HKQ B;  3CPW S;  2E3I A;  2F5K A;  3G7Z A;  3OYJ A;  3CC7 Q;  1NJI R;  5IAY A;  3I5R A;  1N8R U;  2LQW A;  1PRM C;  1UGP B;  5EG2 A;  2L3R A;  2DAQ A;  4A4E A;  1M2V A;  4J9G A;  3M59 A;  1VQ9 A;  1PD0 A;  4J9I A;  2MYS A;  3MEV A;  3CCV T;  2FG0 A;  2G6F X;  2CP6 A;  1WHL A;  2R57 A;  1JJ2 S;  3CCQ A;  2KYM A;  2J6F A;  5IXF A;  3MEA A;  1BI3 A;  4XQ3 A;  2QQR A;  4PFZ A;  3E2U A;  2EJG A;  2RPN A;  1VQK A;  3MHX A;  4BUG A;  4DBH A;  1MMD A;  2X3W D;  4F14 A;  3IQL A;  2WSE E;  2CP3 A;  1Q7Y C;  1K9M C;  4ATO A;  3GNF B;  1E6G A;  3EFO B;  1G2B A;  4EDU A;  3BW1 A;  3L42 A;  3QYG B;  2K7A A;  1OZ3 A;  4C92 G;  1BBZ A;  2OTL T;  4HXJ A;  2LC4 A;  2LNH B;  4D6W A;  2FZK B;  3S3M A;  3J80 E;  4KGZ B;  4XTU A;  2CUB A;  3OYE A;  2GGR A;  2VYT A;  5GMK i;  1W2B S;  3X28 B;  2COY A;  5FU7 C;  1AZE A;  2GQV A;  2PTK A;  3BY7 A;  2XDB A;  4F16 A;  4M78 D;  4F7U F;  1OOT A;  2C0I A;  3EG9 A;  1GL5 A;  4RTW A;  2FB7 A;  4A63 B;  1HK9 A;  2F2V A;  4C0G A;  1QCO A;  1V1C A;  1X69 A;  5GAM d;  1BIB A;  3OMG A;  2R5A A;  3G6E T;  2EQM A;  2L3P A;  3UA7 A;  1HXD A;  5FLX E;  1U5S A;  3WVD B;  5A0D A;  2P84 A;  4PNO A;  2KEA A;  4MDW A;  2KNB B;  4FM4 B;  2DL7 A;  3QPH A;  2PVD B;  1VQK Q;  4C8Q A;  2CP5 A;  3OS5 A;  2DTI A;  3C4S A;  3NPF A;  1PWT A;  1M1K U;  1WXB A;  4AFZ C;  3CC2 T;  3M54 A;  3VS1 A;  3CPW A;  1UGR B;  2COW A;  1E7O A;  1UJ0 A;  4J5Y A;  4X34 A;  3JCM e;  4N4H A;  5GAO r;  2DBK A;  1C6V X;  4BD3 A;  2EGE A;  3RIR A;  3JB9 F;  3M0S A;  1X6B A;  3O5Z A;  3SWN B;  2RHY A;  2O01 E;  4L6V 5;  2LJ1 A;  1NBE B;  2W10 A;  2H8H A;  1OUL A;  3MP8 A;  2R58 A;  3QG1 A;  4RTV A;  3EG1 A;  2LZ6 B;  3SEM A;  3CEY A;  2XMF A;  1D1C A;  4HA8 A;  1NLP C;  5FRN A;  4NL3 A;  3F70 A;  1O75 A;  1OPL A;  3M0T A;  4FSX A;  2ESW A;  1WHK A;  3OYY A;  4M77 B;  2RD1 A;  3S3N A;  1GBQ A;  1YCS B;  5KYU B;  2JTF A;  3M55 A;  1TH7 A;  3M0U A;  4E7Z A;  1N5Z A;  3O8V A;  2DL3 A;  4OB0 B;  3GF5 A;  1M1G A;  1MGQ A;  4AFS C;  4DA4 A;  2M0Y A;  3EGX A;  3JSC A;  1NZ9 A;  1SKU B;  3OSV A;  4BB7 A;  1M8V A;  1CKA A;  4RTZ A;  4C8Q G;  4MZT A;  3EHR A;  1WZO A;  2QQB A;  3JV3 A;  2K5F A;  3VS7 A;  1VQ9 Q;  1ABQ A;  1SRL A;  3HSB A;  3M57 A;  4PKC C;  1VQN T;  1YWP A;  2V1Q A;  2RK2 A;  3VUZ A;  4A54 A;  5LJ5 g;  1ZUY A;  4AG1 C;  1WPY A;  5IHK A;  3A8O B;  1QVP A;  1M30 A;  5KYW A;  4M77 G;  1S1N A;  2BZY A;  2LTO A;  2O9S A;  2RA2 A;  2ZPB B;  3SWN A;  4C0F A;  2BKD N;  2QGG A;  1RLQ C;  3QJY A;  4PJO G;  3CXC P;  1IHW A;  3FLG A;  1FMV A;  4IUU A;  5LJ5 d;  2RH2 A;  1NYF A;  3EFR A;  3EG9 B;  3C12 A;  1CSK A;  3M56 A;  2K2M A;  1D3B A;  2COZ A;  1K73 R;  3DLL A;  3CC2 A;  1YHQ T;  3CC7 T;  2DXT A;  2JMC A;  1OPK A;  3HFN A;  1TG0 A;  2RHI A;  3A8L B;  3S6W A;  5GAN f;  2LQK A;  2FL7 A;  1UEC A;  2RI2 A;  2WSC E;  4XU2 A;  5GAN h;  1XOV A;  1ZX6 A;  1Q82 R;  1QVF P;  4NL2 A;  2DXC A;  4DEY A;  1NJI C;  3G6E A;  1TUC A;  1MMN A;  3PTA A;  2KRN A;  2DYB A;  4PFO A;  3RKW A;  3LYI A;  3EGX B;  4E6R A;  1U8R A;  3OMC A;  1A0N B;  4JRP A;  3HHT B;  3VUB A;  5DLQ E;  1Q82 U;  1NEB A;  1XTD A;  3CC7 A;  1PKS A;  1GCQ A;  3MET A;  1HJD A;  1UGQ B;  5L23 A;  4NS5 A;  4RCB A;  4PJJ A;  4PJO C;  2CT3 A;  1WI7 A;  4M7D G;  5GAN j;  2ZPE B;  3QBY A;  1VQ4 Q;  2CUD A;  3JAM E;  2DNU A;  3A8M B;  4JS4 A;  2JTM A;  1M1K R;  1NLO C;  2RJC A;  1Q86 R;  1YP5 A;  3CCQ Q;  2DE0 X;  4B9W A;  1MND A;  4OB3 B;  2QXF A;  2CH4 A;  3GPL A;  2CGH A;  2D6F A;  1VQN A;  2LQ8 A;  1VYV A;  3QJ6 A;  4RTT A;  4Y28 E;  5GMK j;  4OGE A;  4VUB A;  1KD1 C;  4J9E A;  2JT4 A;  3QZ5 B;  4OMO A;  1VIF A;  3Q1J A;  1H3Z A;  1SPK A;  4JJD A;  3CCR T;  1Z9Z A;  1KD1 U;  1YJW A;  3CXC S;  1YIJ A;  4FSS A;  1SF9 A;  3FJP A;  4Z89 A;  3P8D A;  1QP3 A;  4M78 B;  5KE3 A;  1UDL A;  2XDP A;  1X2Q A;  1PM3 A;  4IUR A;  5CK9 A;  3GBQ A;  2YSQ A;  2CYZ B;  2YRD A;  2RB6 A;  3FDR A;  1N9R A;  4II1 A;  4BY6 C;  3OYH A;  2YLC A;  2G3R A;  2WAC A;  2LCC A;  4FU6 A;  1VQN Q;  3FEO A;  1FWZ A;  5HCK A;  1C0M A;  4BI3 A;  2VVK A;  3VU3 C;  2KAF A;  2RI3 A;  5GAO p;  3KXT A;  1VQ5 Q;  2NWM A;  1IRX A;  3E1S A;  2JUF A;  3FB9 A;  4LDX A;  3UF4 A;  1B3Q A;  3JCM g;  1G3Y A;  1M27 C;  4F7U G;  3JB9 H;  1K0S A;  1P92 A;  2VXE A;  4Q5W A;  1AT1 B;  3I56 Q;  1I4K 1;  1KQS P;  3NGP A;  1FMW A;  3G4S A;  2AT1 B;  2XU8 A;  1K1Z A;  1T0J A;  2YUO A;  3VYG A;  1VIE A;  2A28 A;  3MCA B;  2RK1 A;  4GLK A;  3TQ7 P;  1DJ7 B;  4OB2 B;  4QQD A;  4C0D C;  4RCC A;  3PIO A;  1M4Z A;  3I56 A;  5AT1 B;  1Y71 A;  1KG1 A;  3H0H A;  2Y4Y A;  4UC4 A;  3MPU B;  1QVF A;  2RHX A;  1IZ6 A;  4X9C A;  2J05 A;  4PJO E;  3PFS A;  2KDS A;  4M78 F;  2HAX A;  3VV0 A;  4Z02 A;  1K0X A;  4J9F A;  2AKL A;  1OEB A;  2CZ6 B;  2K6D A;  3H9N A;  5GAN e;  2YRC A;  1QLY A;  2AHJ B;  2NLU A;  1N6A A;  1VQL T;  2OAW A;  5CAI A;  1NEG A;  1K8A R;  1VQM Q;  4XTW A;  4QQ6 A;  4J9C A;  5GAO n;  3ASK A;  5GAM g;  1QWE A;  3MP1 A;  1UHC A;  2E70 A;  2DLP A;  2L0A A;  2LJ3 A;  1K8A U;  1OU9 A;  2JN0 A;  2HCK A;  4O5V A;  3VS0 A;  1FX7 A;  4M4Z A;  1Y57 A;  1RAG B;  1O9S A;  2LT1 A;  2J6O A;  1ZQ1 A;  4OMF B;  3OYC A;  3HTR A;  1M90 U;  1JEG A;  1LNX A;  1MHN A;  3E9F A;  1QKX A;  1X43 A;  2F5T X;  4JZ4 A;  3MO8 A;  3QDF A;  3QZ9 B;  4C5I A;  2A7Y A;  2FYK A;  4MMK A;  1Q81 R;  2EW3 A;  1MNE A;  2DIQ A;  1R77 A;  2V1R A;  2H3J A;  2ZPF B;  3UT1 A;  2L8D A;  4RUG A;  4A4H A;  2DFU A;  3L2Q A;  3OS1 A;  5GAM e;  4C8Q D;  4XTX A;  1SEM A;  2HNI A;  3QKJ A;  3VS5 A;  3HRS A;  4M7A F;  2DF6 A;  1GBR A;  2DRM A;  2RQW A;  3LGF A;  4ZGE B;  2QG9 B;  1PSF A;  2ZCF B;  1UHF A;  1X75 C;  1YN8 A;  5CO7 A;  4LD6 A;  5GMK l;  2AZS A;  2HZY A;  3CC4 T;  1PHT A;  3HL8 A;  4YTL A;  4KUD K;  1M1F A;  4XTZ A;  4F17 A;  4M75 G;  1R8O B;  2X9H A;  1VQO T;  4PJO D;  3CD6 T;  3UDC A;  4MZM A;  1VQ7 A;  5GJV B;  4HVV A;  1QWF A;  4ELZ C;  1F1B B;  3EFO A;  2OTJ T;  1XNI A;  2RHU A;  2EQU A;  3CCM Q;  3CCS A;  4J83 A;  3X25 B;  2AK5 A;  2PU9 B;  3AHU A;  3H41 A;  4IIM A;  4AMC A;  3JCM h;  1R0C B;  3SWN C;  2LT4 A;  2C0O A;  4EMK C;  3CC2 Q;  2KE9 A;  2RQV A;  4E7I A;  1ZUU A;  1KC8 U;  1WFW A;  2EJF A;  2RQT A;  1RAD B;  2YHT A;  4C5G A;  3RER A;  1RI0 A;  2YDL A;  2M16 A;  4J9H A;  4HCK A;  2M9U A;  2DKG A;  2J6K A;  3PVQ A;  2K79 A;  4F04 B;  2MK5 A;  5A0L A;  3DKM A;  4WF2 A;  4JJB A;  2FRW A;  3NTH A;  1YJW Q;  4KRT A;  4C92 A;  1MUZ A;  2DRK A;  4J9B A;  4QVC A;  2XIC A;  5CR2 A;  5CKE A;  3CC4 Q;  1B07 A;  5GAO l;  2E5Q A;  1OQK A;  3V8L A;  3UA6 A;  2ED1 A;  5L8R E;  1BI1 A;  2A3L A;  1GXI E;  3VRY A;  2QQ9 A;  3LX7 A;  5I21 A;  5KYX B;  4CC7 A;  3PNW C;  4OMN A;  2MWO A;  3CCM T;  2YWW A;  1Y07 A;  2EKH A;  4PJM A;  3G71 A;  2MIO A;  3OYD A;  1BCO A;  1N9S A;  2PNI A;  2D0Q B;  1UUE A;  1Y96 A;  2LJ0 A;  3QII A;  1VQ4 A;  1MMG A;  1D0Y A;  3KBG A;  4LN2 A;  4DBQ A;  4XK8 E;  1WDX A;  3MKD A;  1BKB A;  1RL2 A;  4A4G A;  1W2B P;  2QAS A;  1M8M A;  2QTV A;  5ECA A;  2DET A;  1RLP C;  1XQH A;  4E7S A;  3E19 A;  1J3T A;  1B34 B;  3HKS A;  1TSF A;  2QTX A;  1QCF A;  2XKO C;  3JCM f;  2EGA A;  2FPE A;  1C1A A;  3M9Q A;  4DQ2 A;  1NYG A;  3TSW A;  4M75 C;  5LJ3 e;  4OML A;  4OB1 B;  4IUP A;  2RJF A;  2HEQ A;  2YT6 A;  3VKI A;  5KYX A;  3JCM Q;  3M4G A;  2L3Q A;  4C8Q B;  2DD4 A;  5GAN g;  2K57 A;  5M9O A;  3QYH B;  5CKD A;  1K73 U;  1IGQ A;  2DO3 A;  4HCZ A;  3QWY A;  2NUT A;  4IUQ A;  2DA9 A;  5CVI A;  1QVG S;  1ZSZ A;  2A0F B;  3DB3 A;  2EWN A;  5EC7 A;  1PC0 A;  2D1X A;  1VQ5 T;  1VQP Q;  4KUI A;  4PJO B;  2ABL A;  5J26 A;  3L2U A;  3QDR B;  2EQI A;  2FZG B;  2K3B A;  5D6X A;  4O6J A;  1RAE B;  2PVG B;  1M2V B;  3JB9 D;  1K8A C;  1D3B B;  3CCL Q;  5LJ3 d;  3V7C A;  1MV0 B;  1PNJ A;  1WXU A;  5C6S A;  3LGL A;  4FL6 A;  3GP8 A;  4FW1 A;  5HKC A;  3CCM A;  4DOW A;  2KQW A;  2LCS A;  2GF7 A;  1HSQ A;  3CPW P;  4ANJ A;  1VQM A;  4TVR A;  2O31 A;  2XID A;  2IPO B;  3M58 A;  4M77 C;  4JRQ A;  1JXM A;  2DM1 A;  2V8K A;  2V26 A;  1I8F A;  1H3H A;  3EFS A;  4JZ3 A;  2OJ2 A;  4PK4 A;  2ENM A;  2PQW A;  1M3B A; 
#chains in the Genus database with same CATH homology
 3SFM A;  1KQS A;  2D9T A;  2LX9 A;  4M77 D;  2RM4 A;  4OGE A;  4VUB A;  3URG A;  4GY5 A;  2L89 A;  1KD1 C;  3LWH A;  3H8Z A;  3QZ5 B;  4JJN K;  5FRM A;  5LJ5 e;  4JLI A;  2WSF E;  2X4J A;  3E9G A;  1VIF A;  2DZ9 A;  3Q1J A;  4M7D D;  1X01 A;  1H3Z A;  2DTH A;  4ZTJ A;  3CMA A;  1YJ9 T;  1N8R C;  4M7D B;  3OS0 A;  2R5M A;  3OYK A;  1UGS B;  2CKK A;  3CCR T;  3TCJ A;  2P4T A;  2XHC A;  1YJW A;  3CXC S;  1KD1 U;  1M1K C;  1YIJ A;  5GAN 5;  2EIF A;  2X4X A;  5I2S A;  3FJP A;  4R55 A;  4BY6 B;  4C92 C;  3P8D A;  1QP3 A;  3A5Z B;  1PSE A;  1VQM T;  4M78 B;  5KE3 A;  4LDV A;  2XDP A;  4IKF A;  3J7A F;  2XDD A;  3NFC A;  1IRE B;  5FU7 B;  2RJD A;  4IUR A;  2CZ7 B;  5CK9 A;  3FC3 A;  4HKE A;  2E10 A;  3P8B B;  2CYZ B;  3GLX A;  4JS5 A;  1WQ7 A;  2KK4 A;  2MI6 A;  2RB6 A;  5DM7 R;  3FDR A;  1N9R A;  4II1 A;  4BY6 C;  4C92 E;  2P0Q A;  2YLC A;  2G3R A;  4L59 A;  3OYH A;  2WAC A;  4A53 A;  2LCC A;  4M7A E;  2E65 A;  2VV5 A;  4FU6 A;  4M77 A;  3LH0 A;  4C92 D;  3HP9 A;  3CCL T;  3FEO A;  1FWZ A;  4FIB A;  5GAN 8;  1BYM A;  2K4Y A;  4M7A G;  5HK0 A;  5LJ5 h;  3CME A;  2VGN A;  4BI3 A;  1U1S A;  4QVZ A;  5HK3 A;  4M7A A;  5GAO m;  3J81 E;  5KCO A;  3VU3 C;  5CKF A;  2KAF A;  2RI3 A;  5LJ3 j;  2DXU A;  3RMQ A;  4J7F A;  4M78 A;  5GAO p;  1QP2 A;  3KXT A;  3UPU A;  1WJQ A;  4XTY A;  4LDU A;  4EPC A;  1VQ8 A;  3MEW A;  1QVG A;  3E1S A;  3FB9 A;  2JUF A;  3EAE A;  4LDX A;  2JNG A;  2MMP A;  4ELY C;  4M75 B;  4EMK A;  2QEX T;  1KQS S;  4LD9 K;  1UEB A;  3JCM g;  1G3Y A;  2XG8 D;  2VGM A;  3GOX A;  3M4Y A;  4KBM B;  3OYF A;  2QA4 T;  5GAM f;  4F7U G;  3OBY A;  3UWN A;  3JB9 H;  1P92 A;  2VXE A;  2KY9 A;  4Q5W A;  4C8Q C;  1I4K 1;  3OA6 A;  3OYB A;  1B34 A;  3G4S A;  4E7L A;  2K3Y A;  2E6N A;  2XU8 A;  3NTI A;  3CCJ T;  2QA4 A;  4M75 F;  3VYG A;  4IUT A;  1VIE A;  5LJ5 j;  3JCM P;  3MCA B;  2Y4X A;  1YJN A;  3CCS T;  2QI2 A;  2RK1 A;  4EMK B;  4HCC A;  4GLK A;  1QVF S;  4E7K A;  5HY6 A;  3JRZ A;  3PMT A;  2JOY A;  1Q7Y U;  1K9M U;  4J8O A;  4QVD A;  4BDZ A;  4JLG A;  3CCU T;  1DJ7 B;  4OB2 B;  4QQD A;  3OSS C;  3X24 B;  1VQ7 T;  1U1T A;  3ZEH A;  5FU6 B;  4C0D C;  3JCM b;  4RCC A;  4XAX B;  3PIO A;  3DLM A;  1M4Z A;  3I56 A;  4BE1 A;  1WQW A;  5LJ3 h;  1VQO A;  1Y71 A;  4KT0 E;  2CS7 A;  2K5I A;  1KG1 A;  3CME T;  2Y4Y A;  4UC4 A;  2K5L A;  1G3W A;  2DJZ A;  1S72 A;  2V8I A;  2EJ9 A;  1M90 C;  2EAY A;  2EQK A;  1KC8 C;  2RHX A;  1JJ2 A;  1QVF A;  3SD4 A;  3V7S A;  3CCL A;  1IZ6 A;  5GAN 7;  3CPW S;  4X9C A;  3VYH B;  4HT8 A;  2M1H A;  1QW1 A;  2F5K A;  3G7Z A;  3OYJ A;  4PJO E;  2X4W A;  3PFS A;  5FU6 C;  4OGC A;  5IAY A;  2KDS A;  1N8R U;  4M78 F;  2HAX A;  3VV0 A;  1G5V A;  1UGP B;  4Z02 A;  5EG2 A;  3JCM V;  2L3R A;  2DAQ A;  3JCM c;  4CRI A;  3QUI A;  1VQP A;  2VC8 A;  4A4E A;  2HQX A;  1NPR A;  3M53 A;  2CZ6 B;  2PUK B;  4XU1 A;  3M59 A;  5GAN e;  1VQ4 T;  4RMO A;  1VQ9 A;  3HRT A;  2AHJ B;  2NLU A;  4J6X A;  3JCM W;  1NPP A;  1N6A A;  2YRV A;  1VQL T;  1NE8 A;  3MEV A;  4F7U A;  3CCV T;  5CAI A;  3JB9 J;  3G71 T;  4F7U E;  2C06 A;  2R57 A;  1JJ2 S;  3CCQ A;  4XTW A;  3L2R A;  4QQ6 A;  2KSS A;  5GAO n;  3ASK A;  1BI3 A;  2QQR A;  1JRI A;  3MEA A;  4XQ3 A;  4ZGJ B;  2EJG A;  4PLI A;  3MP1 A;  5GAM g;  2MWP A;  3MEU A;  3CCQ T;  4M77 F;  4QW2 A;  3P8H A;  1VQK A;  3CBO A;  4IUV A;  3MHX A;  2E70 A;  4BUG A;  3ER0 A;  1K8A U;  2F69 A;  1Q81 U;  2JN0 A;  1WGS A;  2RJE A;  3V8K A;  4O5V A;  1YI2 A;  1Q82 C;  2WSE E;  2KVQ G;  1FX7 A;  2QQS A;  1Q7Y C;  3TRE A;  1K9M C;  4ATO A;  1O9S A;  2LT1 A;  3GNF B;  1ZQ1 A;  4OMF B;  3OYC A;  1YI2 T;  4EDU A;  3BW1 A;  1N27 A;  3L42 A;  3QYG B;  5A2Q E;  4C8Q F;  4M75 D;  1M90 U;  1OZ3 A;  3SDZ A;  4M7D C;  1YBY A;  1KHC A;  4C92 G;  4PLL A;  2OTL T;  1MHN A;  1LNX A;  3WVE B;  3E9F A;  2LC4 A;  3RKX A;  4D6W A;  2F5T X;  5KCH A;  3S3M A;  3FRN A;  2YLB A;  3J80 E;  1YCY A;  2RHZ A;  3MO8 A;  4JDS A;  3QZ9 B;  4XTU A;  1BIA A;  1NJI U;  4C5I A;  2LVM A;  2A7Y A;  3OYE A;  4N4G A;  2FYK A;  4MMK A;  3X20 B;  4HCB A;  1K73 C;  2EQJ A;  3QO3 A;  2VYT A;  5GMK i;  4M78 C;  2RI5 A;  2DIQ A;  3A8H B;  2H3J A;  2ZPG B;  1W2B S;  3X28 B;  5FU7 C;  2ZPF B;  3OYI A;  4PL6 A;  3UT1 A;  3ME9 A;  4M75 E;  2L8D A;  5GAN 2;  2GQV A;  2IG0 A;  3OQ5 A;  1WNL A;  2DZC A;  4M75 A;  4A4H A;  3L2Q A;  3QSU A;  4ZN1 A;  5KE2 A;  2X4Y A;  3BY7 A;  4PJO F;  3R6O A;  4MZP A;  4C8Q D;  5GAM e;  3OS1 A;  2XDB A;  1Q86 U;  4XTX A;  2GCX A;  2HNI A;  3CCE A;  2DEQ A;  3QKJ A;  4E7H A;  5IT9 E;  1VQP T;  2ZGW A;  2Y90 A;  3HRS A;  4M78 D;  4M7A F;  3OYN A;  4F7U F;  3BDL A;  3LGF A;  4ZGE B;  1I81 A;  1PSF A;  2ZCF B;  1X75 C;  5CO7 A;  4LD6 A;  2CZ0 B;  5GMK l;  4V2S A;  3CC4 T;  5LL6 S;  2FB7 A;  3HL8 A;  4YTL A;  4KUD K;  1HK9 A;  3PIP A;  1M1F A;  4C0G A;  4XTZ A;  3L2V A;  3KUF A;  5DLO A;  5GAM d;  1BIB A;  5D6W A;  3OMG A;  2R5A A;  2RO0 A;  1I5L A;  4M75 G;  3G6E T;  2EQM A;  2LRQ A;  2E12 A;  1R8O B;  2LNV A;  3PT9 A;  1BI2 A;  1VQO T;  4PJO D;  2OAU A;  4M78 E;  1LOJ A;  3CD6 T;  4F7U B;  1HXD A;  4MZM A;  3UDC A;  4C0Z A;  3WVD B;  5FLX E;  5A0D A;  4MML A;  1VQ7 A;  2E64 A;  4PNO A;  3CCU A;  4MDW A;  3SB2 A;  3CXC A;  2QEX A;  2FHD A;  2OTJ A;  4FM4 B;  4ELZ C;  1BI0 A;  2PVD B;  3QPH A;  2OTJ T;  4C8Q A;  3OS5 A;  5I2M A;  1XNI A;  4C92 F;  2DTI A;  2RHU A;  2EQU A;  3C4S A;  4N0A C;  3CCS A;  1KQ2 A;  1YJN T;  1M1K U;  4J83 A;  3X25 B;  2PU9 B;  3OY9 A;  3AHU A;  3CC2 T;  3CD6 A;  1FXX A;  2GFA A;  3JCM h;  4EMH A;  3M54 A;  3CCJ A;  3SWN C;  3CPW A;  4BE0 A;  2LT4 A;  3OYA A;  1VQ6 A;  4EMK C;  1G3S A;  1UGR B;  3OYM A;  3GNG A;  1VUB A;  4J5Y A;  4X34 A;  4C5E A;  3JCM e;  4N4H A;  4E7I A;  2LCL A;  5GAO r;  3CPF A;  4R56 A;  4BD3 A;  2HD0 A;  1KC8 U;  3RIR A;  3JB9 F;  2BUD A;  2EJF A;  3CC4 A;  4J7I A;  3VJP A;  3SWN B;  3OYG A;  2RHY A;  2DIG A;  2O01 E;  4L6V 5;  2YHT A;  4C5G A;  2O4X A;  1RI0 A;  4LDW A;  3OW2 S;  3RER A;  1KHI A;  4P5N A;  2M16 A;  3JCM J;  3MP8 A;  3QXE B;  2R58 A;  2JZ2 A;  4Y91 A;  3QG1 A;  4ZN3 A;  1YIT A;  1W2B A;  4M7D F;  5GMK h;  1KQ1 A;  2M9U A;  2DKG A;  1ZBX A;  3OW2 A;  4C5H A;  3CEY A;  4HA8 A;  1YIJ T;  4HT9 A;  1YJW T;  5FRN A;  3M5A A;  5A0L A;  4NL3 A;  1Y96 B;  3DKM A;  4WF2 A;  2VXF A;  4J6Y A;  3F70 A;  3NTH A;  4JRI A;  4BDY A;  2B8A A;  3L2W A;  4C92 A;  1O75 A;  1G3T A;  3TEE A;  3OBW A;  5J39 A;  4DOV A;  3JB9 G;  4FSX A;  2ZPH B;  2EFI A;  3OYY A;  2HBP A;  4M77 B;  4QVC A;  2XIC A;  2RD1 A;  3ZBD A;  5GMK e;  3S3N A;  5CR2 A;  5CKE A;  2OTL A;  2DXB A;  5GAO l;  2I2L A;  1X6O A;  3HRU A;  2JTF A;  2E5Q A;  3M55 A;  3N5B B;  1TH7 A;  3V8L A;  2JVV A;  3O8V A;  4OB0 B;  2DD5 A;  4L5G A;  2E6Z A;  3QHS A;  3GF5 A;  1M1G A;  3BFM A;  1MGQ A;  3OYL A;  3C95 A;  1W4S A;  3FIF A;  5J3B A;  5L8R E;  1BI1 A;  2P0P A;  1Q86 C;  4BI8 B;  2A3L A;  4DA4 A;  5CIU A;  1YJ9 A;  4CI0 C;  2P0K A;  3CMA T;  2QQ9 A;  3LX7 A;  4J6W A;  3RES A;  5I21 A;  1GXI E;  1VQK T;  1WJS A;  3JSC A;  1NZ9 A;  5CKH A;  3PNW C;  3OSV A;  3CBM A;  4BB7 A;  2BIV A;  2MWO A;  1M8V A;  3CCM T;  4ZTF A;  2QDY B;  3HPW A;  4N0A A;  4NOY A;  1Y07 A;  3JCM X;  5GAO q;  2VUB A;  4C8Q G;  5LJ3 f;  4MZT A;  3G71 A;  2QQB A;  5GAN 4;  2K5F A;  3OYD A;  3LLR A;  4C92 B;  3LWI A;  3CCV A;  1Q81 C;  4XU3 A;  4OVA A;  2XD0 A;  3HSB A;  1N9S A;  3M57 A;  4M78 G;  2D0Q B;  4PKC C;  1VQL A;  1VQN T;  2RK2 A;  3OS2 A;  4BI4 A;  1Y96 A;  3VUZ A;  4JRK A;  3X26 B;  3QII A;  1VQ4 A;  4A54 A;  1M9S A;  5LJ5 g;  1VQ9 T;  3GIB A;  3CBP A;  3KBG A;  1WPY A;  1SSF A;  3A8O B;  1QVP A;  4XK8 E;  4M77 G;  1BKB A;  1RL2 A;  4A4G A;  2DPP B;  3PGG A;  3V7R A;  2LTO A;  1YIT T;  2RA2 A;  2ZPB B;  2QQA A;  3SWN A;  4C0F A;  2BKD N;  3C94 A;  1UB4 A;  4PJO A;  3S3O A;  1XQH A;  3QJY A;  2O4X B;  3A8G B;  3E19 A;  4PJO G;  5LJ3 g;  1B34 B;  5A0G A;  3HKS A;  2QTX A;  2CZ1 B;  3RUX A;  2XKO C;  3JCM f;  3FLG A;  1OYX A;  2ZZD A;  5GAM h;  1M5Q 1;  1S72 T;  2M0O A;  4OP0 A;  4IUU A;  4RG2 A;  4M7D E;  5LJ5 d;  4N4I A;  3M9Q A;  4LDY A;  5DY9 A;  2RH2 A;  3EFR A;  4DQ2 A;  5CCA A;  2IVW A;  4M75 C;  5LJ3 e;  3I56 T;  1WJR A;  2E1H A;  1V29 B;  4OB1 B;  4IUP A;  3I55 T;  3C12 A;  1EIF A;  2DK3 A;  3INZ A;  4EMG A;  2RJF A;  3M56 A;  1VQ6 T;  4RG8 A;  1D3B A;  3CC2 A;  3DLL A;  3NTK A;  3VKI A;  1YHQ T;  3CC7 T;  2DXT A;  3JCM Q;  3M4G A;  3HFN A;  4C8Q B;  1OI1 A;  2DD4 A;  1H64 1;  2RHI A;  3A8L B;  3OB9 A;  2KMT A;  3S6W A;  5GAN f;  1YHQ A;  5D6Y A;  2LQK A;  2K3X A;  2FL7 A;  2RI2 A;  1VQ5 A;  3LW5 E;  2L5Q A;  5AYF A;  2WSC E;  3I55 A;  4MDX A;  4XU2 A;  4E47 A;  3JCM d;  1XOV A;  5GAN g;  2K57 A;  5GAN h;  3G4S T;  5M9O A;  3QYH B;  5CKD A;  1K73 U;  2DO3 A;  3BDU A;  1Y7X A;  4HCZ A;  4NL2 A;  2DXC A;  1NJI C;  4IUQ A;  3G6E A;  5CVI A;  3WXM B;  1QVG S;  3DB3 A;  5GAN 3;  3PTA A;  3PMI A;  2EWN A;  1ZHI A;  4RKU E;  3RKW A;  3LYI A;  1VQ5 T;  4C0D B;  5C0M A;  4KUI A;  4QQG A;  4PJO B;  1U8R A;  3OMC A;  5CQY A;  5J26 A;  4X9D A;  5KH6 A;  4ZGD B;  3L2U A;  3QDR B;  3HHT B;  4JRP A;  3VUB A;  3JB9 I;  5DLQ E;  1VQ8 T;  3DB4 A;  5D6X A;  3H6Z A;  2X35 A;  3L2Z A;  4O6J A;  2LDM A;  3ZFJ A;  4B9X A;  1Q82 U;  1XTD A;  3CC7 A;  5GAM j;  4ME7 A;  3CCE T;  2PVG B;  5GAN d;  3JB9 D;  3T9N A;  1K8A C;  3MET A;  1D3B B;  3V8J A;  1UGQ B;  1JBM A;  4NS5 A;  4RCB A;  5LJ3 d;  4KUL A;  3V7C A;  4M7D A;  4PJO C;  4M7D G;  4BE2 A;  2PUO B;  4A4F A;  2EKO A;  2MF2 A;  5GAN j;  5FRO A;  2ZPE B;  3QBY A;  2XI9 A;  3RKY A;  3JAM E;  5C6S A;  5IN1 A;  1AHJ B;  2XK0 A;  3LGL A;  4FL6 A;  5HKC A;  2DTO A;  3MP6 A;  4XTV A;  4FT2 A;  3GP8 A;  2EYQ A;  3CCM A;  5LJ5 f;  2FVU A;  3A8M B;  4DOW A;  4JS4 A;  2JTM A;  2KQW A;  2GF7 A;  2RJC A;  5GMK m;  1OZ2 A;  4OF1 A;  4M7A C;  2GFU A;  1VQM A;  4TVR A;  2V8J A;  1LJO A;  2HQE A;  2XID A;  4M77 E;  3M58 A;  5GAN 6;  3HFO A;  4M77 C;  2MAM A;  2PVO B;  4B9W A;  4JRQ A;  2DVE A;  2E41 A;  4E7J A;  4OB3 B;  3TU4 K;  5CQX A;  3CCR A;  2QXF A;  2V8K A;  4XU0 A;  3GPL A;  4A4K A;  4FT4 A;  2CGH A;  1I8F A;  2K2V A;  2D6F A;  3EFS A;  4M7A B;  1JB0 E;  2LQ8 A;  1VQN A;  2ZPI B;  3QJ6 A;  4Y28 E;  4M7A D;  2PQW A;  3L1A A;  5CKB A;  4JUV A;  3RMS A;  5GMK j;  4BAC A;  4C8Q E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...