4CI0C

Electron cryo-microscopy of f420-reducing nife hydrogenase frh
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
280
structure length
280
Chain Sequence
b'VLGTYKEIVSARSTDREIQKLAQDGGIVTGLLAYALDEGIIEGAVVAGPGEEFWKPQPMVAMSSDELKAAAGTKYTFSPNVMMLKKAVRQYGIEKLGTVAIPCQTMGIRKMQTYPFGVRFLADKIKLLVGIYCMENFPYTSLQTFICEKLGVSMELVEKMDIGKGKFWVYTQDDVLTLPLKETHGYEQAGCKICKDYVAELADVSTGSVGSPDGWSTVITRTDAGDSIFKQAVEAGLFETKPIEEVKPGLGLLEKLAAQKKEKAEKNIAARKEMGLPTPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F420-REDUCING HYDROGENASE, SUBUNIT ALPHA
publication title Atomic Model of the F420-Reducing [Nife] Hydrogenase by Electron Cryo-Electron Microscopy Using a Direct Electron Detector.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 61
structure length 280
sequence length 280
ec nomenclature ec 1.12.98.1: Coenzyme F420 hydrogenase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04422 FrhB_FdhB_N Coenzyme F420 hydrogenase/dehydrogenase, beta subunit N-term
C PF04432 FrhB_FdhB_C Coenzyme F420 hydrogenase/dehydrogenase, beta subunit C terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1030 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ci0C02
4OMFB 4CI0C
chains in the Genus database with same CATH superfamily
3CBPA 1G3YA 2DXBA 1IGQA 2FZGB 4EMHA 1VIEA 5GJVB 2CUDA 3KUFA 4CC7A 1WA7A 1Z9QA 4PJOB 1BI0A 2G3RA 1ZUUA 2RPNA 2RQWA 2WSCE 5D7UA 1YITQ 2K3YA 4B9WA 3GIBA 1OOTA 2GFUA 3CD6A 1BI2A 1TUGB 3BFMA 1VQKQ 3BE3A 1YHQA 1Z9ZA 3A8MB 1BIBA 3LWHA 5GAOn 4L5GA 2EKHA 2C0IA 2LJ0A 1Q82C 2DJZA 4M77E 5J3BA 3X26B 4FT4A 3CPWS 1KHCA 3L42A 1PM3A 3OYGA 3HRUA 4EPCA 3NGPA 2R5MA 2PVOB 4J7IA 2KROA 2QDLA 4EMGA 1M1KC 4FL6A 1WJSA 2LX9A 2IIMA 2KYMA 1UGPB 5GAN8 3INZA 5GAOl 3OW2S 1GRIA 2B8AA 3VYGA 1M2OA 3QPHA 2K3XA 5CKDA 2MOXA 4A4HA 4ELYC 1MMGA 1VQ9A 3JCMh 2ZPBB 2O4XA 1VQPQ 3VU3C 1I8FA 3JCMg 1U8RA 3QDRB 2KK4A 4C0DB 4OMMA 4NS5A 2QDYB 1YFNA 1ZBXA 2DL3A 2BUDA 1S72A 2KQWA 3H0IA 4M77A 3G6ET 2J05A 1YCSB 3QWYA 4PJOG 3I5SA 1RABB 2XG8D 4J9GA 4HVUA 4RG8A 2QGGA 1JXMA 2A08A 3U23A 2ZPIB 3VS0A 1AOJA 1VQ9Q 2RO0A 4M7AF 5EG2A 1BIAA 4IUVA 1XQHA 1OYXA 2O31A 2KE9A 2FRYA 2YWWA 2HZYA 2C0TA 3L2RA 2OAWA 3UWNA 2D1XA 3JCMb 1Q7YC 1X2QA 3M0RA 3WVDB 2EQJA 1YIJQ 3P8HA 1VQLA 3CQTA 2CT3A 3OS0A 2YUOA 1LCKA 4DA4A 3OY9A 4J5YA 4J9EA 3I35A 5GANd 3R6OA 4WTOB 4L6V5 1KSWA 1YJNA 2CREA 1T3LA 3M4GA 2JMCA 3OB9A 4O5VA 2FPEA 4JDSA 3VUZA 1BYMA 5IHIA 4C5IA 1X75C 4HVWA 5LJ3h 2EQMA 2DF6A 3THKA 1NE8A 5LJ3g 2FPDA 3CCUT 2Y4XA 2JN0A 2CP7A 3HPWA 1NG2A 1MGQA 2L89A 1NJIR 3J7AF 4C8QF 4M75A 3N5BB 4ZTJA 1LOJA 3EG9A 2HL3A 5FU6C 1I1JA 1KIKA 1VQNT 1Q95G 1E6GA 1KQ1A 2F2WA 3EH2A 5GAOq 2E5KA 3QJ6A 2B86A 2BIVA 1KFZA 2GGRA 1W2BA 2JTFA 2X35A 2VGMA 4F7UG 1X6OA 4M77B 2COZA 1FMVA 3TSWA 1JXOA 3PMIA 4BB7A 1I07A 3HFOA 2MCNA 3I56Q 1NYGA 1VQ5T 1QKXA 1RUWA 4PL6A 2EQKA 4AMCA 3RBBB 1KK7A 1D1CA 2CKKA 3S3MA 1LJOA 1K76A 2OTLT 3RMSA 2ENMA 5GAN5 8AT1B 2JTEA 1B07A 3DB4A 5A2QE 2CP6A 3SHWA 3E9GA 4OGEA 3MPUB 1M1FA 1H3HA 3G1JA 1KD1C 2NLUA 2E41A 2J06A 5FRMA 1SF9A 1V76A 2H3EB 3CC2T 3OQ5A 1AZEA 4M78E 4LDWA 4A53A 3RKWA 1RAAB 2NUTB 1W70A 4QQDA 2XU8A 3CCMT 3VS1A 1RAFB 2F69A 2JS0A 2DAQA 1SPKA 3FEOA 3CCJA 2QAZA 2FRWA 4BUGA 1N9SA 2K6DA 3BW1A 2QEXA 2LTOA 2MK5A 2V8KA 3ER0A 1TUDA 3H6ZA 1UHCA 3I55T 4DBRA 2EJGA 3META 4IUTA 3VV0A 2F1LA 2M0OA 4X9CA 2RK1A 1TUCA 5I21A 9ATCB 1K73U 1AT1B 2BZXA 4M77F 4A63B 2QQBA 4OMPA 3CCJQ 5LJ3e 5KYYA 4J9CA 4FU6A 1ZSGA 1QVFS 2YLCA 4M78A 5I11A 3O5ZA 4Y92A 3RDVA 4C5GA 1ACMB 4JJDA 1KC8R 2LNVA 3EFSA 3SFMA 3OYFA 2DFUA 4NOYA 4XTWA 1WJQA 2DX1A 2HCKA 2RNAA 1VQ4T 2OTLQ 2CZ6B 3CCVA 3X28B 1GCQC 1WGSA 1QVFP 5CCAA 1UTIA 1ZX6A 2LNHB 1JO8A 4B6MA 3C94A 3VS3A 1VQ6T 2YRDA 2RI2A 1Q81C 3QO3A 4FCYA 2FYKA 2HD0A 3L2VA 4XU2A 3J80E 3JB9H 5I2MA 2EW3A 1C1AA 3LLRA 5D6YA 2K79A 3CC2Q 2BE9B 2LC4A 4C5HA 1O75A 2BZ8A 2RF0A 4PLIA 5DY9A 1QMCA 1Q86R 5LJ5e 5FU6B 1ZLMA 4D6WA 1YJWT 2LRQA 3G4ST 1B3QA 2ZPGB 1M5Q1 4XU1A 3VYHB 2H8HA 3VS4A 1X43A 1I81A 1W2BP 1AWJA 1N6AA 4J8OA 2GF7A 2NYSA 1Q82U 2KI7A 2LQKA 1MMAA 4M7DD 3TVTA 1BBZA 1IO6A 2OAUA 1WXBA 3QYGB 5GMKl 3EG1A 4LN2A 1D0XA 1D3BA 2LT4A 8ATCB 3BDUA 1XOVA 2WSFE 1M1KU 1H641 4ZGEB 4M75F 2CYZB 2MPXC 1E7OA 5IXBA 1PRLC 1WZOA 5GAN6 2YRCA 2KGTA 2EKOA 1M90R 1PD0A 4NL2A 2BTTA 4RMOA 2RQRA 1JJ2A 4OB2B 5GANj 4FIBA 4XTXA 2ZZDA 3L2QA 2COYA 2FPFA 2C0OA 3GNFB 1HSQA 2CDTA 4M78B 2CP5A 4C92D 5GAMf 1K8AR 2DZ9A 2CZ1B 2K2VA 3HTRA 5KYWB 2EFIA 2RQTA 5KE2A 5D6WA 5HCKA 1V29B 2CSIA 2DTOA 2DEQA 1YJWQ 2KYBA 4OMNA 1SHGA 3G4SQ 1VQMT 3EGXB 4JJBA 4M7AC 3VJPA 1Q7YU 2LJ3A 3SWNA 3FJPA 3ZEHA 4MDWA 2P4TA 1AWOA 2NUPA 4A4FA 4PFZA 1ZSZC 3VS2A 4J6XA 2QQAA 1AEYA 1G2BA 1K9MR 4E6RA 3QYHB 5LJ3d 3CCQA 3OYMA 1KHIA 2X51A 2MWOA 1BK2A 1ARKA 3FJ5A 3QZ9B 2V1RA 2WSEE 2LDMA 1QP3A 2XIDA 5HK0A 2ROLA 1EZZB 1J3TA 3HP9A 4MDXA 5CKEA 4M78F 4RCBA 3EH1A 2EYZA 4J9HA 1FXXA 1WHGA 3Q1JA 4KGZB 1VOMA 3CCST 1MHNA 1AZGB 2KT1A 2QI2A 3CXCS 3CC4T 2KMTA 2K9GA 3M55A 3NFCA 2DVEA 4C8QE 5GAMj 1PHTA 3CMAT 1VQOA 3UDCA 2GFAA 5GAOp 1NJIC 4DQ2A 4C8QC 3CCET 3H8ZA 3JB9F 2HQEA 1AWWA 2JUFA 2YUQA 1Y0MA 4HT9A 1M4ZA 2JMAA 2M16A 3R6NA 1MMDA 3LH5A 2MYSA 1UHFA 2DXTA 5L8RE 1X2KA 2AK5A 3CBOA 2K5IA 3GBQA 2YHTA 4E7HA 3ZFJA 4PK4A 2K5LA 2LMJA 3PIPA 1WPYA 2F2XA 2VASA 1JJ2P 1H3ZA 1KD1U 4N4HA 2O01E 1YWOA 3DB3A 6AT1B 1I5OB 1QVGA 1YITA 1UGVA 2DETA 1YHQT 1M8MA 1VQKA 3CC7Q 2NUPB 1M3BA 3JCMP 2PZ1A 4N0AA 1KG1A 2H3JA 3WXMB 3V7RA 2RJEA 2DL7A 2FHDA 4ZN3A 2HBWA 1VQ8T 1PD1A 2GTOA 4E7LA 4GY5A 4LD6A 3RUXA 2VGNA 3M9QA 4QKUA 1NEGA 3VKIA 1PG5B 4KULA 3CCSQ 1M9SA 3CCLQ 4XU0A 1BKBA 3CC4Q 2DYIA 2D9TA 4Y28E 4F17A 1G3TA 1W4SA 3T9NA 3M59A 4M7AB 2DXUA 3CMAQ 2AKKA 4CC4B 4ANJA 1M3CA 1MNEA 3QIIA 2DBKA 4RTUA 1ABQA 3CCEQ 1SRMA 2DL4A 2GBQA 1NLPC 1M8VA 1K0SA 1ZSZB 1A0NB 2L3RA 5GMKe 1KQSP 3NHNA 3H0FA 2E64A 3UPUA 1VQPA 4M77C 4IUQA 3CMET 3DKMA 1TTHB 4PJOD 2Y90A 5LL6S 2RHIA 1TXQA 3SEMA 2QASA 2HEQA 1QKWA 4XTUA 2Z0WA 1KC8C 4IIOA 2A7YA 2IPOB 3FC3A 4ZGDB 3CEYA 2ABLA 4J6WA 2X4JA 3RR6A 3VRZA 4LXCA 3URGA 2RQUA 2XHCA 1B34A 3LYIA 2OJ2A 3EFOB 4RG2A 3OMGA 1VQLT 3ASKA 2M9UA 3NTIA 1YIJA 1Y96A 1VQ8Q 3EGDA 4ORZA 4C8QB 1U1TA 1Q86C 3MKDA 3NPFA 4J9DA 5AT1B 4E7JA 4BDYA 2JVVA 5LJ5f 3GNGA 2M1HA 1YJNT 5J26A 4M7AG 2RHYA 2KXDA 4HCBA 2CT4A 4NL3A 4OMQA 3L1AA 1H92A 2RMOA 5GMKi 1R8OB 4PJNA 4XTVA 1YJ9T 4M75E 2RHUA 2LZ6B 1GBRA 4GBQA 3OS5A 4M75C 1QVGP 4C0GA 5IT9E 1ZA2B 1IRXA 3CMEQ 3H0HA 2FVUA 4YTLA 4ZNXA 2V26A 3G6EA 4DBHA 4A4KA 2QA4T 5LJ3j 1SRLA 4XTYA 2MI6A 2EYXA 1RLPC 2LCLA 2HBPA 3EG0A 1N9RA 3HKSA 4RTYA 3UA7A 2XD0A 3PNWC 2LQWA 1VQ7T 2DRKA 2CP3A 1K8AC 3I56A 1T0HA 2BKDN 4F16A 2RI3A 4IKFA 4DOVA 3G6EQ 1RAEB 2P4RA 1M30A 5CQXA 1PKSA 4L59A 3VS7A 4C8QG 4ESRA 2EYYA 2YUPA 4F14A 2O4XB 2XI9A 1B34B 3CCRT 1VYVA 4Y91A 2CP0A 3JCMe 5DLOA 2KBTA 3EFRA 2CZ0B 1AWXA 7AT1B 2BZYA 2F5KA 5LJ5j 2K2MA 5CQYA 4Z02A 3OMCA 4X9DA 2DPPB 3EGDB 2J6OA 4FW2A 4JLGA 2EBPA 2E10A 2V1QA 3OBWA 1ZBJA 4M7DA 1UEBA 3HRSA 1R77A 1K9MC 4C92E 4R0KA 1GBQA 4JS4A 3CCUA 1OX8A 1K73R 4J9BA 5I2SA 2ZCFB 3E9FA 1PCXA 1H8KA 2R58A 3D7SB 5DLQE 3UT1A 4ZGJB 1YI2T 2QA4Q 3S3OA 3PVQA 4Z89A 4M77D 1N8RU 2E3HA 1UG1A 5GAN4 2KRNA 1RAHB 4M78C 2DZCA 1OPKA 2FZCB 3X24B 4JJNK 4RTZA 1S1NA 2L3SA 1NJIU 2OX7A 4LNPA 4R56A 3FRNA 4DBFA 3CCUQ 3LX7A 1YCYA 4PJLA 2IVWA 5HY6A 4FM4B 1VQ7Q 2EPDA 4EMKA 1VQ5A 3JCMV 1TS9A 4PFOA 2KSSA 1OV3A 3GPLA 2E5QA 1WX6A 4C92A 2OTLA 1VQNQ 1WLPB 3MP1A 1HJDA 1G5VA 2KXCA 1KQ2A 1NM7A 1YWPA 3CCRQ 2YDLA 4J6YA 5DM7R 3OS1A 2ROTA 4UC4A 4M77G 2A0FB 4HT8A 3LGFA 2I0NA 1EX4A 4WCIA 4M75B 3EHRA 4Z88A 3EG9B 1PNJA 1TG0A 1Q82R 1IHVA 3MEVA 4KGXB 5GANf 3CC2A 1VQ5Q 4JRKA 3V8JA 3OBYA 1WI7A 1N5ZA 4LUEA 1UUEA 1NPPA 3M0QA 5KYUA 3OYAA 3FIFA 3BY7A 1Y07A 1HXDA 1QCFA 5EC7A 2YSQA 4RCCA 2P0KA 3PT9A 1M1KR 2PTKA 5FROA 2L3QA 3RMQA 1MV3A 2L3PA 4JLIA 4KRTA 1W2BS 2L2PA 3I55A 1AD5A 2MMPA 1YI2Q 4KH0B 2A3LA 1G3WA 2XK0A 2LP5A 4A54A 3OA6A 2ESWA 1D1AA 4JRIA 2RK2A 4LD9K 4CRIA 3KXTA 3CCMQ 2COWA 1BB9A 2SEMA 3QXEB 3JAME 2E12A 4JS5A 1OPLA 4ME7A 2QGFB 1HK9A 3MP6A 3EG2A 1SSFA 5FRNA 1OZ3A 5A0DA 4FYWB 2P0PA 3I55Q 4X34A 4OMFB 1VQ4A 2EGEA 4DEXA 1K1ZA 2E6ZA 3QUIA 3JCMc 2FZKB 1IHWA 4WF2A 1VQ6A 1BI1A 3JCMd 4M75G 5L23A 5FWBA 4EMKB 5CKFA 1Q7YR 1G8XA 4FYXB 2KY9A 2D8JA 2WACA 2HNIA 4PFPA 5C6SA 1UGQB 4GLKA 5FLXE 3NMZC 3NTKA 3V8KA 3MCAB 3OYYA 2P0QA 1VQ4Q 1PC0A 2K3BA 3SWNC 3JCMJ 1WIEA 1YJWA 4N4IA 3G4SA 5A0GA 5KYYB 4C0ZA 2JOYA 3OS2A 1IREB 4RTWA 1VQ6Q 2HQXA 1U3OA 3ME9A 4ELZC 1SKUB 2YLBA 4M7DF 3RESA 1X01A 4MZPA 5IHNA 5GAN7 1I5LA 2A36A 4J9FA 3UF4A 4IURA 2J6KA 1HD3A 3RKXA 2EQIA 3M5AA 3PGGA 1R0CB 1FWZA 3LW5E 4J7FA 1RAIB 2LT1A 4JUVA 4OP0A 2E65A 3REAB 3I5RA 1M2VA 3QBYA 1X27A 3J81E 2GQIA 3UATA 3X20B 2DJQA 4M78D 1OQKA 5FU7C 1ZUKA 1NBEB 1X6BA 2CP2A 2EIFA 1M1GA 2DM1A 1UJYA 1YBYA 2ATCB 4PKCC 4XQ3A 2DKGA 3F70A 3CPFA 1WQ7A 2AZVA 2JXBA 3H41A 4X1VA 2OI3A 4C92F 5CKHA 1JU5C 1WQWA 3EAEA 3JCMX 2M0YA 5GMKj 1ABOA 1D3BB 2F2VA 1OU8A 2KRSA 4PJJA 1UGSB 4E7KA 2QTVA 3OYJA 1QCOA 4PJOA 2RHZA 1K8AU 3X25B 4OF1A 5FW9A 2KEAA 4D8DA 2ZGWA 4M78G 2A28A 1TSFA 1KD1R 3ZBDA 1OX9A 3G71T 4MMKA 1VQMA 1WHLA 3OYNA 4BE0A 2DNUA 2OTJT 5KH6A 1K9AA 2CSQA 5A0LA 2Y4YA 4FYVB 5C0MA 3OYIA 3TSZA 3OYDA 2D0QB 2PUOB 3CPWA 5KYXA 2QXFA 4QQ6A 2AZSA 4DEYA 4II1A 3HRTA 1T0JA 1SEMA 1YITT 2F5TX 2MF2A 2QG9B 3OW2A 1JJ2S 4PLLA 2HDAA 1VQMQ 4N0AC 4B9XA 2KRMA 3CC7A 4OB0B 1GFCA 4XU3A 3RIRA 3JCMf 4CC2A 5GAMh 1IGUA 2MWPA 5IN1A 2K7AA 3OYHA 4E7ZA 5GAMg 2X3WD 4F7UE 1NLOC 3I9QA 4N4GA 3OYCA 3E19A 4RTVA 1DJ7B 5FWCA 3CD6T 2KT8A 4LUDA 1WXUA 3CCSA 1BCMA 3CCLA 3SWNB 3LGLA 4IUUA 3CC4A 1JB0E 3P8DA 4JRPA 3G7ZA 3PVLA 2PU9B 1I4K1 3CMAA 2HQHA 1QLYA 4EIKA 2PVDB 2ZAEA 3JB9I 1JRIA 1KJWA 3CCEA 2YRVA 2VVKA 4HXJA 3PMTA 2YT6A 4FSXA 1VQPT 1QP2A 1PRMC 2MIOA 2BE7D 4BI8B 3TQ7P 1BI3A 1KQSS 3FDRA 2OTJQ 4E47A 3MHXA 1LNXA 2LCSA 1WXTA 4F7UA 4KUDK 1SHFA 1JBMA 3SD4A 2EVRA 2RQVA 1MNDA 4QVDA 4KT0E 2FL7A 3TREA 1VQ9T 2RN8A 2X4YA 2ZPEB 4MMLA 3GP8A 5FU7B 1E6HA 4KUIA 2RM4A 1SSHA 3BDLA 4HCKA 1UB4A 3SB2A 2RI5A 1MUZA 5KYNA 1S72T 1K4US 4QT7A 2V8JA 3MEUA 5LJ3f 4C0FA 2RD1A 4E2FB 3OYBA 3S3NA 2DVJA 2D8HA 2O9VA 4DBQA 2RH2A 5KYXB 4LDVA 1YIJT 2RHXA 1X69A 3C4SA 2GNCA 1X6GA 1Q81U 1VQ8A 4M7AD 4OB1B 2VB6A 1WHKA 2VWFA 1ZA1B 3CD6Q 4OMLA 4A4EA 2LQ8A 2AKLA 1WHHA 5CAIA 5CO7A 1CKAA 1YHQQ 1BCOA 1UFFA 4RTTA 3V8LA 5HKCA 4BY6C 3VS6A 2K5FA 3CPWP 1W1FA 3A98A 2JT4A 5GAMe 3C12A 3RERA 1F1BB 1MMNA 2ZPHB 1QQJA 1QW1A 2YUNA 1D1BA 1VIFA 1K0XA 2HMAA 3OW2P 2M51A 3CMEA 3M57A 4PJOF 1OI1A 1QVGS 2QTXA 2EJFA 2HSEB 2VYTA 2CZ7B 1Y71A 5J39A 3A5ZB 1IB8A 1TWBA 1RL2A 3M0UA 3PFSA 3O8VA 1AVZC 1ZUYA 2SRCA 2JM9A 4F7UB 3I56T 4HA8A 1S72Q 1R0BG 4C8QD 5CR2A 4LDXA 2W0ZA 1V1CA 4F04B 1LVKA 3OSSC 4OVAA 1I0CA 2HKQB 1M90C 4BDZA 2NUTA 2DERA 3MJXA 3TU4K 4IUPA 3VUBA 4RUGA 2X4XA 3HHTB 4M7DE 2DXCA 1G83A 2QQSA 4K11A 1U1SA 4Z8AA 4MZMA 4M7DC 2ED0A 2DL8A 3QJYA 5KCOA 1TOVA 4BD3A 1QVFA 1VQLQ 5KE3A 1VUBA 3QKJA 2J6FA 3EGUA 2W10A 1YJ9A 1N8RR 1RLQC 1Y7XA 1JQQA 2AT1B 1RI9A 2DK3A 4QW2A 2R5AA 2CS7A 4O6JA 2E70A 4AG1C 5M9OA 1YJNQ 1G3SA 4P5NA 1OULA 2FEIA 5GAOm 2EQUA 1ZHIA 2JNGA 4ZN1A 2EYQA 2QA4A 1Y96B 4QVZA 3VS5A 1XNIA 4V2SA 4F7UF 3QWXX 3CCJT 2E6NA 4RTXA 4VUBA 1GCPA 1YJ9Q 3EG3A 2XICA 1HYOA 1FMKA 4EMKC 5KCHA 2QEXT 4OGCA 2M02A 2KDSA 4C92C 4JZ4A 2LCCA 3H9NA 1VQ7A 1RI0A 3P8BB 2RJFA 5LJ5h 1ZQ1A 1C6VX 5CVIA 4CC3A 1QCNA 5LJ5g 4M4ZA 3TEEA 1VQNA 1T3SA 1BU1A 4ATOA 2QYZA 2DO3A 4BY6B 2DTHA 5D6XA 1EFNA 2L5QA 4LE9A 3CCRA 5GJWB 2A37A 5IXFA 4PJMA 2EAYA 4LDYA 2O88A 1NEBA 1D09B 4IIMA 3TCJA 3HL8A 2DLPA 2R57A 3AHUA 2VXFA 5GAMd 1RACB 2JM8A 3CCVT 4OMOA 2ECZA 4D8KA 4HKEA 2K57A 2O2OA 3PTAA 3GOXA 4BACA 3MEAA 2EGCA 2K4YA 2CUBA 1TU0B 3KFVA 2IG0A 3QHSA 2FO0A 4BI3A 1Y57A 4GLMA 1YI2A 3JRZA 4BE2A 4JZ3A 2DBMA 1B7TA 3M54A 2MAMA 3MP8A 1OZ2A 3JB9J 4FYYB 3OYLA 2QK0A 3V7CA 3CCMA 2CGHA 3OYKA 1MV0B 2DYBA 1W6XA 4OB3B 2DEUA 2EWNA 4J9IA 2L0AA 2QEXQ 3L2ZA 4J83A 1D0YA 2DTIA 5KYWA 4KBMB 1OU9A 4TVRA 3LWIA 4BE1A 2EGAA 4M75D 1UJ0A 4M7DB 3WVEB 4MZTA 1XJWB 3E2UA 1WJRA 2HSPA 4QVCA 3EGXA 2FB7A 3M4YA 1NZ9A 4PNOA 3DLLA 4RKUE 4CI0C 2VXEA 2LVMA 2JTMA 3M58A 2VV5A 1M3AA 4HVVA 2EJ9A 5GAOr 5CKBA 1TH7A 5IAYA 2ZPFB 3CCVQ 3EHQA 1NPRA 3PIOA 4XTZA 1JEGA 1LPLA 5ECAA 3PE0A 3M0SA 3UA6A 2PQWA 1KC8U 1GCQA 2HAXA 2QQ9A 1WYXA 2PUKB 3A8HB 3CBMA 1WHJA 3OSVA 3C95A 1CKBA 2GTJA 2X3XD 4LDUA 4BI4A 1IXDA 2PVGB 1YP5A 2ED1A 1VA7A 2HKNA 4C92B 3QDFA 3CXCA 2I2LA 3JV3A 2EYWA 3RKYA 3ZL7C 4XAXB 3HSBA 3A8GB 1XTDA 4EDUA 4HCCA 2DE0X 4AFQC 3V7SA 4JRQA 2DD4A 3MO8A 2GCXA 2J7IA 1PWTA 1Q86U 5CK9A 2GQVA 4XK8E 1O9SA 4M7DG 1PSFA 5KYUB 3A8LB 2O9SA 2VUBA 3CCQT 5GANh 2E4HA 2KR3A 3L2WA 4E7SA 4QQGA 2VC8A 5GANg 1QVPA 1UE9A 4PJOE 3JCMW 2NUZA 4AT1B 4E7IA 3AT1B 2X9HA 3E1SA 3M53A 3JSCA 4PJOC 1AHJB 1NYFA 3HFNA 3L2UA 4A4GA 2DD5A 3DLMA 4M7AE 1N27A 3M56A 1PSEA 5IHKA 1OEBA 1UGRB 2AIRB 4FT2A 4FSSA 2DIGA 4AFSC 2X4WA 1RAGB 1M90U 3JCMQ 2P84A 2VKNA 2RA2A 1VQOT 4HCZA 4C92G 3JB9D 1EIFA 2XDBA 1C0MA 3M0PA 1FMWA 5I22A 1KQSA 2XDPA 2G6FX 1UDLA 2FG0A 3A8OB 3VRYA 3FLGA 1D0ZA 2XKOC 2V8IA 2YXYA 3GF5A 4Q5WA 2JS2A 1U06A 3CC7T 2XDDA 1QWFA 1QWEA 5GAN2 1SG5A 1WFWA 5IH2A 3KBGA 5GMKm 4M7AA 1U5SA 3QG1A 3RNJA 4C5EA 5GMKh 2LX7A 2DMOA 5AYFA 4C0DC 3GLXA 2KVQG 2PNIA 1ZSZA 3QZ5B 2JZ2A 3JB9G 3CCQQ 3CCLT 1PKTA 1UECA 1N8RC 2CH4A 2DL5A 2CH4W 1IZ6A 4AG2C 1VQKT 2DA9A 1GL5A 2QQRA 2AHJB 2D6FA 5GAN3 2RJCA 3QSUA 1VYTA 3ULRB 1FX7A 4AFZC 3C0CA 2LJ1A 1WDXA 2LQNA 4FW1A 1M27C 1K9MU 5HK3A 4AFUC 4R55A 2L8DA 5LJ5d 2HL5C 3CXCP 2KNBB 4JJCA 2KAFA 3FB9A 4ZTFA 2DIQA 2JW4A 3G71A 5GANe 4DOWA 1M2VB 2OTJA 1K73C 2RJDA 2DRMA 3REBB 1FYNA 2E1HA 4KH1B 1VQOQ 3NTHA 3EFOA 2XMFA 2NWMA 1P92A 1GFDA 2RB6A 1GXIE 2JJ9A 3SDZA 1VYUA 3OYEA 1YNZA 3IQLA 1RADB 1CSKA 5CIUA 4C8QA 2C06A 3LH0A 2D0NA 4JPBW 1Q81R 2E3IA 3M0TA 3A1PA 3MEWA 1WNLA 3S6WA 3G71Q 1YN8A 1WHMA 4KGVB 2DILA
chains in the Genus database with same CATH topology
3CBPA 3TU4K 1G3YA 2DXBA 3MEVA 1VQMT 5GANf 3CC2A 4EMHA 4IUPA 4M7AC 1VIEA 4JRKA 3VJPA 1Q7YU 3VUBA 3KUFA 3V8JA 3OBYA 3SWNA 2X4XA 3HSBA 3HHTB 4PJOB 4M7DE 1NPPA 3FJPA 1BI0A 3ZEHA 2DXCA 2QQSA 2G3RA 3OYAA 3FIFA 3BY7A 1U1SA 1Y07A 1HXDA 2P4TA 4MDWA 4A4FA 4MZMA 4M7DC 2WSCE 3GIBA 4J6XA 2K3YA 4RCCA 2P0KA 3PT9A 4B9WA 2GFUA 3QJYA 5KCOA 2QQAA 4BD3A 1BI2A 3CD6A 5FROA 3BFMA 1QVFA 5KE3A 3RMQA 1VUBA 3QKJA 1YHQA 4JLIA 3QYHB 1YJ9A 1W2BS 3A8MB 3I55A 5LJ3d 1Y7XA 3CCQA 2MMPA 1BIBA 3LWHA 3OYMA 1KHIA 5GAOn 2MWOA 4L5GA 1Q82C 2A3LA 2DJZA 1G3WA 4M77E 2DK3A 2XK0A 5J3BA 4QW2A 2R5AA 4A54A 2CS7A 3OA6A 3QZ9B 4JRIA 4O6JA 2E70A 2RK2A 5M9OA 4LD9K 1G3SA 4P5NA 2WSEE 2LDMA 3X26B 4CRIA 5GAOm 2EQUA 3KXTA 1QP3A 1ZHIA 4FT4A 3CPWS 1KHCA 2XIDA 3L42A 2JNGA 4ZN1A 5HK0A 3OYGA 2EYQA 3HRUA 2QA4A 3QXEB 4EPCA 3HP9A 4MDXA 2R5MA 2PVOB 4J7IA 3JAME 1Y96B 2E12A 4M78F 4QVZA 5CKEA 4JS5A 1XNIA 4ME7A 4RCBA 4EMGA 4V2SA 1M1KC 4FL6A 4F7UF 3CCJT 1WJSA 2LX9A 1HK9A 1UGPB 2E6NA 1FXXA 3MP6A 3INZA 3Q1JA 4VUBA 5GAN8 5GAOl 1SSFA 5FRNA 3OW2S 1OZ3A 2B8AA 5A0DA 2P0PA 3CCST 1MHNA 2XICA 3VYGA 4EMKC 5KCHA 2QEXT 2QI2A 4OGCA 3CXCS 3QPHA 2K3XA 5CKDA 3CC4T 2KMTA 4X34A 3M55A 3NFCA 4OMFB 2KDSA 2DVEA 1VQ4A 4A4HA 1VQ9T 4ELYC 4C8QE 4C92C 5GAMj 1VQ9A 2LCCA 3JCMh 1VQOA 3UDCA 1VQ7A 3CMAT 2ZPBB 2GFAA 2O4XA 1RI0A 3P8BB 5GAOp 2RJFA 5LJ5h 1NJIC 1ZQ1A 2E6ZA 3QUIA 5CVIA 3JCMc 1I8FA 3JCMg 3VU3C 3QDRB 2KK4A 4C8QC 4DQ2A 1U8RA 4WF2A 3H8ZA 1BI1A 4C0DB 3CCET 3JCMd 1VQ6A 3JB9F 5LJ5g 2HQEA 2JUFA 4NS5A 2QDYB 4HT9A 1ZBXA 1M4ZA 4M75G 2BUDA 3TEEA 1S72A 1VQNA 2KQWA 4EMKB 5CKFA 4ATOA 2M16A 2DO3A 4M77A 4BY6B 3G6ET 2DTHA 5D6XA 2KY9A 2L5QA 2WACA 3CCRA 2HNIA 4PJOG 2DXTA 5L8RE 2EAYA 2XG8D 5C6SA 4LDYA 4RG8A 1UGQB 4GLKA 5FLXE 3CBOA 3NTKA 2K5IA 3MCAB 3V8KA 2YHTA 3OYYA 2P0QA 2ZPIB 3ZFJA 4E7HA 3SWNC 3JCMJ 1YJWA 4N4IA 3TCJA 4M7AF 2RO0A 3G4SA 5A0GA 4C0ZA 2JOYA 2K5LA 5EG2A 3OS2A 3HL8A 1IREB 3PIPA 1BIAA 4IUVA 1XQHA 1OYXA 1WPYA 2R57A 3AHUA 2VXFA 5GAMd 3CCVT 1H3ZA 1KD1U 2HQXA 4N4HA 3ME9A 4ELZC 2O01E 3DB3A 2YLBA 4M7DF 4HKEA 3RESA 2K57A 3L2RA 1X01A 4MZPA 1QVGA 5GAN7 3UWNA 1YITA 1I5LA 3JCMb 3PTAA 1Q7YC 3GOXA 3WVDB 4BACA 1YHQT 2EQJA 3P8HA 4IURA 1VQLA 3MEAA 1VQKA 2K4YA 3OS0A 3JCMP 2IG0A 3RKXA 4DA4A 3QHSA 3M5AA 3PGGA 4BI3A 4N0AA 1KG1A 3OY9A 1FWZA 2H3JA 3WXMB 3LW5E 4J5YA 2LT1A 4J7FA 4JUVA 4OP0A 3JRZA 5GANd 4BE2A 3R6OA 3V7RA 1YI2A 2RJEA 2FHDA 4ZN3A 1VQ8T 2E65A 2MAMA 3M54A 1OZ2A 3MP8A 4GY5A 4L6V5 4LD6A 3RUXA 4E7LA 3QBYA 2VGNA 3OYLA 3M9QA 3JB9J 1YJNA 3V7CA 3M4GA 3J81E 3OB9A 3CCMA 2CGHA 3VKIA 4KULA 3OYKA 3X20B 4M78D 4O5VA 4OB3B 2EWNA 5FU7C 1M9SA 4XU0A 3L2ZA 4JDSA 1BKBA 2EIFA 1M1GA 3VUZA 1BYMA 4J83A 2D9TA 4Y28E 1X75C 4C5IA 1G3TA 5LJ3h 1W4SA 3T9NA 2EQMA 1YBYA 3M59A 4PKCC 1NE8A 2DTIA 4XQ3A 4M7AB 2DXUA 2DKGA 3F70A 5LJ3g 3CPFA 1WQ7A 3CCUT 4KBMB 2Y4XA 2JN0A 3QIIA 4TVRA 3LWIA 4C92F 4BE1A 5CKHA 3HPWA 1WQWA 1MGQA 3EAEA 2L89A 4M75D 1M8VA 4M7DB 2L3RA 3WVEB 4MZTA 5GMKe 3JCMX 3J7AF 4C8QF 5GMKj 1WJRA 4M75A 2E64A 1D3BB 1LOJA 3N5BB 3UPUA 4ZTJA 4QVCA 1VQPA 5FU6C 4M77C 2FB7A 1VQNT 3M4YA 1NZ9A 1KQ1A 4IUQA 3CMET 3DKMA 4PJOD 1UGSB 2Y90A 5LL6S 4E7KA 3OYJA 4PNOA 5GAOq 2RHIA 4PJOA 2RHZA 3DLLA 3QJ6A 3X25B 4RKUE 4CI0C 4OF1A 1K8AU 2BIVA 1W2BA 2VXEA 2ZGWA 4M78G 2LVMA 2JTMA 3ZBDA 2JTFA 4XTUA 4MMKA 3G71T 2X35A 1VQMA 3M58A 1KC8C 2VGMA 4F7UG 2VV5A 1X6OA 2EJ9A 3OYNA 5GAOr 4BE0A 5CKBA 4M77B 2A7YA 1TH7A 5KH6A 2OTJT 3FC3A 3PMIA 4BB7A 2ZPFB 4ZGDB 3CEYA 3HFOA 5IAYA 4J6WA 5A0LA 1NPRA 2Y4YA 3PIOA 1VQ5T 4XTZA 2X4JA 5C0MA 3OYIA 4PL6A 3OYBA 3S3NA 2EQKA 2D0QB 2PUOB 3URGA 3OYDA 3CPWA 2XHCA 1B34A 2CKKA 2PQWA 3LYIA 3S3MA 1LJOA 2QXFA 4QQ6A 1KC8U 2OTLT 3RMSA 5GAN5 2QQ9A 2HAXA 2PUKB 3A8HB 3CBMA 4II1A 3HRTA 3OSVA 3DB4A 5A2QE 3C95A 1YITT 2F5TX 2MF2A 4LDUA 4RG2A 4BI4A 3OMGA 2PVGB 3E9GA 4OGEA 3OW2A 1VQLT 1JJ2S 3ASKA 4C92B 4PLLA 2M9UA 1M1FA 4N0AC 3NTIA 4B9XA 1YIJA 3CXCA 2I2LA 1KD1C 1Y96A 2E41A 2NLUA 4C8QB 3CC7A 1U1TA 3RKYA 4OB0B 1Q86C 5FRMA 4XAXB 4XU3A 3RIRA 3JCMf 3OQ5A 5GAMh 4E7JA 3CC2T 2MWPA 3A8GB 4BDYA 1XTDA 4M78E 5IN1A 4EDUA 2JVVA 5LJ5f 3GNGA 3OYHA 4HCCA 4LDWA 2M1HA 4A53A 5GAMg 3RKWA 3V7SA 4F7UE 1YJNT 4JRQA 5J26A 2DD4A 4M7AG 4QQDA 2XU8A 4N4GA 3MO8A 3OYCA 2RHYA 3E19A 3CCMT 2F69A 2DAQA 1DJ7B 2GCXA 3FEOA 3CCJA 4HCBA 1Q86U 5CK9A 4NL3A 4BUGA 1N9SA 3L1AA 2GQVA 4XK8E 3CD6T 3CCSA 3BW1A 2QEXA 1O9SA 2LTOA 3SWNB 3LGLA 4IUUA 1PSFA 5GMKi 3CC4A 1JB0E 1R8OB 4M7DG 2V8KA 3A8LB 2VUBA 3ER0A 3P8DA 4XTVA 3H6ZA 1YJ9T 4M75E 4JRPA 3G7ZA 2PU9B 3I55T 1I4K1 2RHUA 3CMAA 3CCQT 5GANh 3L2WA 2PVDB 3OS5A 4QQGA 1JRIA 3JB9I 2EJGA 4M75C 2VC8A 3META 5GANg 4C0GA 1QVPA 5IT9E 3CCEA 2YRVA 4IUTA 3VV0A 2M0OA 4X9CA 2RK1A 4PJOE 3JCMW 3PMTA 5I21A 1K73U 2FVUA 4FSXA 4YTLA 4E7IA 1VQPT 4M77F 3E1SA 2QQBA 3JSCA 3M53A 3G6EA 1AHJB 1QP2A 3HFNA 4A4KA 5LJ3e 3L2UA 4PJOC 2QA4T 5LJ3j 4BI8B 4A4GA 4XTYA 4FU6A 2MI6A 1QVFS 1BI3A 2YLCA 2DD5A 4M78A 1KQSS 3DLMA 2LCLA 4M7AE 3FDRA 1N27A 2HBPA 3M56A 4E47A 1PSEA 1LNXA 3MHXA 4C5GA 4F7UA 4KUDK 1JBMA 1UGRB 4FT2A 2LNVA 3EFSA 2DIGA 3SD4A 3SFMA 1N9RA 3OYFA 2X4WA 3HKSA 2XD0A 3PNWC 4NOYA 1WJQA 4XTWA 1M90U 1VQ4T 4QVDA 3JCMQ 4KT0E 2CZ6B 2FL7A 3TREA 2RA2A 3X28B 3CCVA 1VQOT 1WGSA 2X4YA 4MMLA 2ZPEB 3I56A 3GP8A 1K8AC 5FU7B 3CCLA 2BKDN 4HCZA 4C92G 5CCAA 3JB9D 2RI3A 2RM4A 4KUIA 4IKFA 3C94A 1EIFA 3BDLA 4DOVA 1VQ6T 2XDBA 1UB4A 3SB2A 2RI5A 5CQXA 2RI2A 1Q81C 4C8QG 4L59A 1S72T 3QO3A 1KQSA 2XDPA 2FYKA 2HD0A 3L2VA 2V8JA 2O4XB 3MEUA 2XI9A 2RD1A 4XU2A 5I2MA 5LJ3f 4C0FA 3A8OB 1B34B 3J80E 3CCRT 3JB9H 3FLGA 3LLRA 2RH2A 1VQ7T 2XKOC 2V8IA 5D6YA 4LDVA 3GF5A 4Q5WA 1YIJT 2RHXA 3C4SA 4Y91A 2LC4A 4C5HA 1O75A 5DY9A 5DLOA 4PLIA 3JCMe 3EFRA 3CC7T 2CZ0B 2XDDA 1Q81U 5GAN2 5LJ5e 1VQ8A 5FU6B 2F5KA 4OB1B 4D6WA 5LJ5j 2LRQA 1YJWT 4M7AD 3G4ST 3KBGA 2ZPGB 1M5Q1 4XU1A 5CQYA 4Z02A 3VYHB 5GMKm 4M7AA 3QG1A 4C5EA 1I81A 3OMCA 4X9DA 5GMKh 2DPPB 1N6AA 4J8OA 5AYFA 2GF7A 4A4EA 1Q82U 4JLGA 2LQKA 4M7DD 4C0DC 2LQ8A 2E10A 5CAIA 5CO7A 3GLXA 2KVQG 3OBWA 4M7DA 1UEBA 2OAUA 3HRSA 3QZ5B 1K9MC 2JZ2A 3QYGB 5GMKl 3JB9G 3V8LA 4C92E 3CCLT 1D3BA 5HKCA 4JS4A 3CCUA 1N8RC 4BY6C 2K5FA 2LT4A 5I2SA 2ZCFB 1IZ6A 5GAMe 3C12A 1VQKT 3BDUA 3RERA 2QQRA 3E9FA 1XOVA 2AHJB 2ZPHB 1QW1A 2WSFE 2D6FA 1M1KU 5GAN3 2RJCA 3QSUA 1H641 2R58A 4ZGEB 4M75F 1FX7A 5DLQE 3UT1A 4ZGJB 1K9MU 1YI2T 1VIFA 5HK3A 2CYZB 4R55A 3S3OA 2L8DA 5LJ5d 4M77D 1N8RU 3CMEA 3M57A 5GAN6 5GAN4 4PJOF 3X24B 4M78C 2DZCA 4JJNK 1OI1A 1QVGS 2KAFA 2QTXA 2EJFA 2EKOA 2VYTA 3FB9A 4ZTFA 1NJIU 2CZ7B 4NL2A 1Y71A 2DIQA 4R56A 3FRNA 4RMOA 3G71A 5J39A 3A5ZB 1JJ2A 4OB2B 5GANe 3LX7A 1YCYA 4DOWA 5GANj 4FIBA 4XTXA 2OTJA 1K73C 2IVWA 2RJDA 2ZZDA 1RL2A 3PFSA 4FM4B 2E1HA 5HY6A 3L2QA 3NTHA 3O8VA 4EMKA 1P92A 3JCMV 1VQ5A 2RB6A 3GNFB 1GXIE 4C92D 4M78B 5GAMf 2KSSA 3GPLA 2E5QA 3SDZA 4C92A 3OYEA 4F7UB 2DZ9A 3I56T 2CZ1B 4HA8A 2OTLA 4C8QD 3MP1A 2K2VA 5CR2A 4LDXA 5CIUA 1G5VA 4C8QA 2C06A 3LH0A 1KQ2A 2EFIA 4J6YA 5KE2A 5DM7R 3OS1A 3MEWA 3OSSC 4OVAA 4UC4A 5D6WA 4M77G 1WNLA 1M90C 1V29B 3S6WA 4BDZA 4HT8A 3LGFA 2DTOA 2DEQA 4M75B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OMF B;  4CI0 C; 
#chains in the Genus database with same CATH topology
 3CBP A;  1G3Y A;  2DXB A;  1IGQ A;  2FZG B;  4EMH A;  1VIE A;  5GJV B;  2CUD A;  3KUF A;  4CC7 A;  1WA7 A;  1Z9Q A;  4PJO B;  1BI0 A;  2G3R A;  1ZUU A;  2RPN A;  2RQW A;  2WSC E;  5D7U A;  1YIT Q;  2K3Y A;  4B9W A;  3GIB A;  1OOT A;  2GFU A;  3CD6 A;  1BI2 A;  1TUG B;  3BFM A;  1VQK Q;  3BE3 A;  1YHQ A;  1Z9Z A;  3A8M B;  1BIB A;  3LWH A;  5GAO n;  4L5G A;  2EKH A;  2C0I A;  2LJ0 A;  1Q82 C;  2DJZ A;  4M77 E;  5J3B A;  3X26 B;  4FT4 A;  3CPW S;  1KHC A;  3L42 A;  1PM3 A;  3OYG A;  3HRU A;  4EPC A;  3NGP A;  2R5M A;  2PVO B;  4J7I A;  2KRO A;  2QDL A;  4EMG A;  1M1K C;  4FL6 A;  1WJS A;  2LX9 A;  2IIM A;  2KYM A;  1UGP B;  5GAN 8;  3INZ A;  5GAO l;  3OW2 S;  1GRI A;  2B8A A;  3VYG A;  1M2O A;  3QPH A;  2K3X A;  5CKD A;  2MOX A;  4A4H A;  4ELY C;  1MMG A;  1VQ9 A;  3JCM h;  2ZPB B;  2O4X A;  1VQP Q;  3VU3 C;  1I8F A;  3JCM g;  1U8R A;  3QDR B;  2KK4 A;  4C0D B;  4OMM A;  4NS5 A;  2QDY B;  1YFN A;  1ZBX A;  2DL3 A;  2BUD A;  1S72 A;  2KQW A;  3H0I A;  4M77 A;  3G6E T;  2J05 A;  1YCS B;  3QWY A;  4PJO G;  3I5S A;  1RAB B;  2XG8 D;  4J9G A;  4HVU A;  4RG8 A;  2QGG A;  1JXM A;  2A08 A;  3U23 A;  2ZPI B;  3VS0 A;  1AOJ A;  1VQ9 Q;  2RO0 A;  4M7A F;  5EG2 A;  1BIA A;  4IUV A;  1XQH A;  1OYX A;  2O31 A;  2KE9 A;  2FRY A;  2YWW A;  2HZY A;  2C0T A;  3L2R A;  2OAW A;  3UWN A;  2D1X A;  3JCM b;  1Q7Y C;  1X2Q A;  3M0R A;  3WVD B;  2EQJ A;  1YIJ Q;  3P8H A;  1VQL A;  3CQT A;  2CT3 A;  3OS0 A;  2YUO A;  1LCK A;  4DA4 A;  3OY9 A;  4J5Y A;  4J9E A;  3I35 A;  5GAN d;  3R6O A;  4WTO B;  4L6V 5;  1KSW A;  1YJN A;  2CRE A;  1T3L A;  3M4G A;  2JMC A;  3OB9 A;  4O5V A;  2FPE A;  4JDS A;  3VUZ A;  1BYM A;  5IHI A;  4C5I A;  1X75 C;  4HVW A;  5LJ3 h;  2EQM A;  2DF6 A;  3THK A;  1NE8 A;  5LJ3 g;  2FPD A;  3CCU T;  2Y4X A;  2JN0 A;  2CP7 A;  3HPW A;  1NG2 A;  1MGQ A;  2L89 A;  1NJI R;  3J7A F;  4C8Q F;  4M75 A;  3N5B B;  4ZTJ A;  1LOJ A;  3EG9 A;  2HL3 A;  5FU6 C;  1I1J A;  1KIK A;  1VQN T;  1Q95 G;  1E6G A;  1KQ1 A;  2F2W A;  3EH2 A;  5GAO q;  2E5K A;  3QJ6 A;  2B86 A;  2BIV A;  1KFZ A;  2GGR A;  1W2B A;  2JTF A;  2X35 A;  2VGM A;  4F7U G;  1X6O A;  4M77 B;  2COZ A;  1FMV A;  3TSW A;  1JXO A;  3PMI A;  4BB7 A;  1I07 A;  3HFO A;  2MCN A;  3I56 Q;  1NYG A;  1VQ5 T;  1QKX A;  1RUW A;  4PL6 A;  2EQK A;  4AMC A;  3RBB B;  1KK7 A;  1D1C A;  2CKK A;  3S3M A;  1LJO A;  1K76 A;  2OTL T;  3RMS A;  2ENM A;  5GAN 5;  8AT1 B;  2JTE A;  1B07 A;  3DB4 A;  5A2Q E;  2CP6 A;  3SHW A;  3E9G A;  4OGE A;  3MPU B;  1M1F A;  1H3H A;  3G1J A;  1KD1 C;  2NLU A;  2E41 A;  2J06 A;  5FRM A;  1SF9 A;  1V76 A;  2H3E B;  3CC2 T;  3OQ5 A;  1AZE A;  4M78 E;  4LDW A;  4A53 A;  3RKW A;  1RAA B;  2NUT B;  1W70 A;  4QQD A;  2XU8 A;  3CCM T;  3VS1 A;  1RAF B;  2F69 A;  2JS0 A;  2DAQ A;  1SPK A;  3FEO A;  3CCJ A;  2QAZ A;  2FRW A;  4BUG A;  1N9S A;  2K6D A;  3BW1 A;  2QEX A;  2LTO A;  2MK5 A;  2V8K A;  3ER0 A;  1TUD A;  3H6Z A;  1UHC A;  3I55 T;  4DBR A;  2EJG A;  3MET A;  4IUT A;  3VV0 A;  2F1L A;  2M0O A;  4X9C A;  2RK1 A;  1TUC A;  5I21 A;  9ATC B;  1K73 U;  1AT1 B;  2BZX A;  4M77 F;  4A63 B;  2QQB A;  4OMP A;  3CCJ Q;  5LJ3 e;  5KYY A;  4J9C A;  4FU6 A;  1ZSG A;  1QVF S;  2YLC A;  4M78 A;  5I11 A;  3O5Z A;  4Y92 A;  3RDV A;  4C5G A;  1ACM B;  4JJD A;  1KC8 R;  2LNV A;  3EFS A;  3SFM A;  3OYF A;  2DFU A;  4NOY A;  4XTW A;  1WJQ A;  2DX1 A;  2HCK A;  2RNA A;  1VQ4 T;  2OTL Q;  2CZ6 B;  3CCV A;  3X28 B;  1GCQ C;  1WGS A;  1QVF P;  5CCA A;  1UTI A;  1ZX6 A;  2LNH B;  1JO8 A;  4B6M A;  3C94 A;  3VS3 A;  1VQ6 T;  2YRD A;  2RI2 A;  1Q81 C;  3QO3 A;  4FCY A;  2FYK A;  2HD0 A;  3L2V A;  4XU2 A;  3J80 E;  3JB9 H;  5I2M A;  2EW3 A;  1C1A A;  3LLR A;  5D6Y A;  2K79 A;  3CC2 Q;  2BE9 B;  2LC4 A;  4C5H A;  1O75 A;  2BZ8 A;  2RF0 A;  4PLI A;  5DY9 A;  1QMC A;  1Q86 R;  5LJ5 e;  5FU6 B;  1ZLM A;  4D6W A;  1YJW T;  2LRQ A;  3G4S T;  1B3Q A;  2ZPG B;  1M5Q 1;  4XU1 A;  3VYH B;  2H8H A;  3VS4 A;  1X43 A;  1I81 A;  1W2B P;  1AWJ A;  1N6A A;  4J8O A;  2GF7 A;  2NYS A;  1Q82 U;  2KI7 A;  2LQK A;  1MMA A;  4M7D D;  3TVT A;  1BBZ A;  1IO6 A;  2OAU A;  1WXB A;  3QYG B;  5GMK l;  3EG1 A;  4LN2 A;  1D0X A;  1D3B A;  2LT4 A;  8ATC B;  3BDU A;  1XOV A;  2WSF E;  1M1K U;  1H64 1;  4ZGE B;  4M75 F;  2CYZ B;  2MPX C;  1E7O A;  5IXB A;  1PRL C;  1WZO A;  5GAN 6;  2YRC A;  2KGT A;  2EKO A;  1M90 R;  1PD0 A;  4NL2 A;  2BTT A;  4RMO A;  2RQR A;  1JJ2 A;  4OB2 B;  5GAN j;  4FIB A;  4XTX A;  2ZZD A;  3L2Q A;  2COY A;  2FPF A;  2C0O A;  3GNF B;  1HSQ A;  2CDT A;  4M78 B;  2CP5 A;  4C92 D;  5GAM f;  1K8A R;  2DZ9 A;  2CZ1 B;  2K2V A;  3HTR A;  5KYW B;  2EFI A;  2RQT A;  5KE2 A;  5D6W A;  5HCK A;  1V29 B;  2CSI A;  2DTO A;  2DEQ A;  1YJW Q;  2KYB A;  4OMN A;  1SHG A;  3G4S Q;  1VQM T;  3EGX B;  4JJB A;  4M7A C;  3VJP A;  1Q7Y U;  2LJ3 A;  3SWN A;  3FJP A;  3ZEH A;  4MDW A;  2P4T A;  1AWO A;  2NUP A;  4A4F A;  4PFZ A;  1ZSZ C;  3VS2 A;  4J6X A;  2QQA A;  1AEY A;  1G2B A;  1K9M R;  4E6R A;  3QYH B;  5LJ3 d;  3CCQ A;  3OYM A;  1KHI A;  2X51 A;  2MWO A;  1BK2 A;  1ARK A;  3FJ5 A;  3QZ9 B;  2V1R A;  2WSE E;  2LDM A;  1QP3 A;  2XID A;  5HK0 A;  2ROL A;  1EZZ B;  1J3T A;  3HP9 A;  4MDX A;  5CKE A;  4M78 F;  4RCB A;  3EH1 A;  2EYZ A;  4J9H A;  1FXX A;  1WHG A;  3Q1J A;  4KGZ B;  1VOM A;  3CCS T;  1MHN A;  1AZG B;  2KT1 A;  2QI2 A;  3CXC S;  3CC4 T;  2KMT A;  2K9G A;  3M55 A;  3NFC A;  2DVE A;  4C8Q E;  5GAM j;  1PHT A;  3CMA T;  1VQO A;  3UDC A;  2GFA A;  5GAO p;  1NJI C;  4DQ2 A;  4C8Q C;  3CCE T;  3H8Z A;  3JB9 F;  2HQE A;  1AWW A;  2JUF A;  2YUQ A;  1Y0M A;  4HT9 A;  1M4Z A;  2JMA A;  2M16 A;  3R6N A;  1MMD A;  3LH5 A;  2MYS A;  1UHF A;  2DXT A;  5L8R E;  1X2K A;  2AK5 A;  3CBO A;  2K5I A;  3GBQ A;  2YHT A;  4E7H A;  3ZFJ A;  4PK4 A;  2K5L A;  2LMJ A;  3PIP A;  1WPY A;  2F2X A;  2VAS A;  1JJ2 P;  1H3Z A;  1KD1 U;  4N4H A;  2O01 E;  1YWO A;  3DB3 A;  6AT1 B;  1I5O B;  1QVG A;  1YIT A;  1UGV A;  2DET A;  1YHQ T;  1M8M A;  1VQK A;  3CC7 Q;  2NUP B;  1M3B A;  3JCM P;  2PZ1 A;  4N0A A;  1KG1 A;  2H3J A;  3WXM B;  3V7R A;  2RJE A;  2DL7 A;  2FHD A;  4ZN3 A;  2HBW A;  1VQ8 T;  1PD1 A;  2GTO A;  4E7L A;  4GY5 A;  4LD6 A;  3RUX A;  2VGN A;  3M9Q A;  4QKU A;  1NEG A;  3VKI A;  1PG5 B;  4KUL A;  3CCS Q;  1M9S A;  3CCL Q;  4XU0 A;  1BKB A;  3CC4 Q;  2DYI A;  2D9T A;  4Y28 E;  4F17 A;  1G3T A;  1W4S A;  3T9N A;  3M59 A;  4M7A B;  2DXU A;  3CMA Q;  2AKK A;  4CC4 B;  4ANJ A;  1M3C A;  1MNE A;  3QII A;  2DBK A;  4RTU A;  1ABQ A;  3CCE Q;  1SRM A;  2DL4 A;  2GBQ A;  1NLP C;  1M8V A;  1K0S A;  1ZSZ B;  1A0N B;  2L3R A;  5GMK e;  1KQS P;  3NHN A;  3H0F A;  2E64 A;  3UPU A;  1VQP A;  4M77 C;  4IUQ A;  3CME T;  3DKM A;  1TTH B;  4PJO D;  2Y90 A;  5LL6 S;  2RHI A;  1TXQ A;  3SEM A;  2QAS A;  2HEQ A;  1QKW A;  4XTU A;  2Z0W A;  1KC8 C;  4IIO A;  2A7Y A;  2IPO B;  3FC3 A;  4ZGD B;  3CEY A;  2ABL A;  4J6W A;  2X4J A;  3RR6 A;  3VRZ A;  4LXC A;  3URG A;  2RQU A;  2XHC A;  1B34 A;  3LYI A;  2OJ2 A;  3EFO B;  4RG2 A;  3OMG A;  1VQL T;  3ASK A;  2M9U A;  3NTI A;  1YIJ A;  1Y96 A;  1VQ8 Q;  3EGD A;  4ORZ A;  4C8Q B;  1U1T A;  1Q86 C;  3MKD A;  3NPF A;  4J9D A;  5AT1 B;  4E7J A;  4BDY A;  2JVV A;  5LJ5 f;  3GNG A;  2M1H A;  1YJN T;  5J26 A;  4M7A G;  2RHY A;  2KXD A;  4HCB A;  2CT4 A;  4NL3 A;  4OMQ A;  3L1A A;  1H92 A;  2RMO A;  5GMK i;  1R8O B;  4PJN A;  4XTV A;  1YJ9 T;  4M75 E;  2RHU A;  2LZ6 B;  1GBR A;  4GBQ A;  3OS5 A;  4M75 C;  1QVG P;  4C0G A;  5IT9 E;  1ZA2 B;  1IRX A;  3CME Q;  3H0H A;  2FVU A;  4YTL A;  4ZNX A;  2V26 A;  3G6E A;  4DBH A;  4A4K A;  2QA4 T;  5LJ3 j;  1SRL A;  4XTY A;  2MI6 A;  2EYX A;  1RLP C;  2LCL A;  2HBP A;  3EG0 A;  1N9R A;  3HKS A;  4RTY A;  3UA7 A;  2XD0 A;  3PNW C;  2LQW A;  1VQ7 T;  2DRK A;  2CP3 A;  1K8A C;  3I56 A;  1T0H A;  2BKD N;  4F16 A;  2RI3 A;  4IKF A;  4DOV A;  3G6E Q;  1RAE B;  2P4R A;  1M30 A;  5CQX A;  1PKS A;  4L59 A;  3VS7 A;  4C8Q G;  4ESR A;  2EYY A;  2YUP A;  4F14 A;  2O4X B;  2XI9 A;  1B34 B;  3CCR T;  1VYV A;  4Y91 A;  2CP0 A;  3JCM e;  5DLO A;  2KBT A;  3EFR A;  2CZ0 B;  1AWX A;  7AT1 B;  2BZY A;  2F5K A;  5LJ5 j;  2K2M A;  5CQY A;  4Z02 A;  3OMC A;  4X9D A;  2DPP B;  3EGD B;  2J6O A;  4FW2 A;  4JLG A;  2EBP A;  2E10 A;  2V1Q A;  3OBW A;  1ZBJ A;  4M7D A;  1UEB A;  3HRS A;  1R77 A;  1K9M C;  4C92 E;  4R0K A;  1GBQ A;  4JS4 A;  3CCU A;  1OX8 A;  1K73 R;  4J9B A;  5I2S A;  2ZCF B;  3E9F A;  1PCX A;  1H8K A;  2R58 A;  3D7S B;  5DLQ E;  3UT1 A;  4ZGJ B;  1YI2 T;  2QA4 Q;  3S3O A;  3PVQ A;  4Z89 A;  4M77 D;  1N8R U;  2E3H A;  1UG1 A;  5GAN 4;  2KRN A;  1RAH B;  4M78 C;  2DZC A;  1OPK A;  2FZC B;  3X24 B;  4JJN K;  4RTZ A;  1S1N A;  2L3S A;  1NJI U;  2OX7 A;  4LNP A;  4R56 A;  3FRN A;  4DBF A;  3CCU Q;  3LX7 A;  1YCY A;  4PJL A;  2IVW A;  5HY6 A;  4FM4 B;  1VQ7 Q;  2EPD A;  4EMK A;  1VQ5 A;  3JCM V;  1TS9 A;  4PFO A;  2KSS A;  1OV3 A;  3GPL A;  2E5Q A;  1WX6 A;  4C92 A;  2OTL A;  1VQN Q;  1WLP B;  3MP1 A;  1HJD A;  1G5V A;  2KXC A;  1KQ2 A;  1NM7 A;  1YWP A;  3CCR Q;  2YDL A;  4J6Y A;  5DM7 R;  3OS1 A;  2ROT A;  4UC4 A;  4M77 G;  2A0F B;  4HT8 A;  3LGF A;  2I0N A;  1EX4 A;  4WCI A;  4M75 B;  3EHR A;  4Z88 A;  3EG9 B;  1PNJ A;  1TG0 A;  1Q82 R;  1IHV A;  3MEV A;  4KGX B;  5GAN f;  3CC2 A;  1VQ5 Q;  4JRK A;  3V8J A;  3OBY A;  1WI7 A;  1N5Z A;  4LUE A;  1UUE A;  1NPP A;  3M0Q A;  5KYU A;  3OYA A;  3FIF A;  3BY7 A;  1Y07 A;  1HXD A;  1QCF A;  5EC7 A;  2YSQ A;  4RCC A;  2P0K A;  3PT9 A;  1M1K R;  2PTK A;  5FRO A;  2L3Q A;  3RMQ A;  1MV3 A;  2L3P A;  4JLI A;  4KRT A;  1W2B S;  2L2P A;  3I55 A;  1AD5 A;  2MMP A;  1YI2 Q;  4KH0 B;  2A3L A;  1G3W A;  2XK0 A;  2LP5 A;  4A54 A;  3OA6 A;  2ESW A;  1D1A A;  4JRI A;  2RK2 A;  4LD9 K;  4CRI A;  3KXT A;  3CCM Q;  2COW A;  1BB9 A;  2SEM A;  3QXE B;  3JAM E;  2E12 A;  4JS5 A;  1OPL A;  4ME7 A;  2QGF B;  1HK9 A;  3MP6 A;  3EG2 A;  1SSF A;  5FRN A;  1OZ3 A;  5A0D A;  4FYW B;  2P0P A;  3I55 Q;  4X34 A;  4OMF B;  1VQ4 A;  2EGE A;  4DEX A;  1K1Z A;  2E6Z A;  3QUI A;  3JCM c;  2FZK B;  1IHW A;  4WF2 A;  1VQ6 A;  1BI1 A;  3JCM d;  4M75 G;  5L23 A;  5FWB A;  4EMK B;  5CKF A;  1Q7Y R;  1G8X A;  4FYX B;  2KY9 A;  2D8J A;  2WAC A;  2HNI A;  4PFP A;  5C6S A;  1UGQ B;  4GLK A;  5FLX E;  3NMZ C;  3NTK A;  3V8K A;  3MCA B;  3OYY A;  2P0Q A;  1VQ4 Q;  1PC0 A;  2K3B A;  3SWN C;  3JCM J;  1WIE A;  1YJW A;  4N4I A;  3G4S A;  5A0G A;  5KYY B;  4C0Z A;  2JOY A;  3OS2 A;  1IRE B;  4RTW A;  1VQ6 Q;  2HQX A;  1U3O A;  3ME9 A;  4ELZ C;  1SKU B;  2YLB A;  4M7D F;  3RES A;  1X01 A;  4MZP A;  5IHN A;  5GAN 7;  1I5L A;  2A36 A;  4J9F A;  3UF4 A;  4IUR A;  2J6K A;  1HD3 A;  3RKX A;  2EQI A;  3M5A A;  3PGG A;  1R0C B;  1FWZ A;  3LW5 E;  4J7F A;  1RAI B;  2LT1 A;  4JUV A;  4OP0 A;  2E65 A;  3REA B;  3I5R A;  1M2V A;  3QBY A;  1X27 A;  3J81 E;  2GQI A;  3UAT A;  3X20 B;  2DJQ A;  4M78 D;  1OQK A;  5FU7 C;  1ZUK A;  1NBE B;  1X6B A;  2CP2 A;  2EIF A;  1M1G A;  2DM1 A;  1UJY A;  1YBY A;  2ATC B;  4PKC C;  4XQ3 A;  2DKG A;  3F70 A;  3CPF A;  1WQ7 A;  2AZV A;  2JXB A;  3H41 A;  4X1V A;  2OI3 A;  4C92 F;  5CKH A;  1JU5 C;  1WQW A;  3EAE A;  3JCM X;  2M0Y A;  5GMK j;  1ABO A;  1D3B B;  2F2V A;  1OU8 A;  2KRS A;  4PJJ A;  1UGS B;  4E7K A;  2QTV A;  3OYJ A;  1QCO A;  4PJO A;  2RHZ A;  1K8A U;  3X25 B;  4OF1 A;  5FW9 A;  2KEA A;  4D8D A;  2ZGW A;  4M78 G;  2A28 A;  1TSF A;  1KD1 R;  3ZBD A;  1OX9 A;  3G71 T;  4MMK A;  1VQM A;  1WHL A;  3OYN A;  4BE0 A;  2DNU A;  2OTJ T;  5KH6 A;  1K9A A;  2CSQ A;  5A0L A;  2Y4Y A;  4FYV B;  5C0M A;  3OYI A;  3TSZ A;  3OYD A;  2D0Q B;  2PUO B;  3CPW A;  5KYX A;  2QXF A;  4QQ6 A;  2AZS A;  4DEY A;  4II1 A;  3HRT A;  1T0J A;  1SEM A;  1YIT T;  2F5T X;  2MF2 A;  2QG9 B;  3OW2 A;  1JJ2 S;  4PLL A;  2HDA A;  1VQM Q;  4N0A C;  4B9X A;  2KRM A;  3CC7 A;  4OB0 B;  1GFC A;  4XU3 A;  3RIR A;  3JCM f;  4CC2 A;  5GAM h;  1IGU A;  2MWP A;  5IN1 A;  2K7A A;  3OYH A;  4E7Z A;  5GAM g;  2X3W D;  4F7U E;  1NLO C;  3I9Q A;  4N4G A;  3OYC A;  3E19 A;  4RTV A;  1DJ7 B;  5FWC A;  3CD6 T;  2KT8 A;  4LUD A;  1WXU A;  3CCS A;  1BCM A;  3CCL A;  3SWN B;  3LGL A;  4IUU A;  3CC4 A;  1JB0 E;  3P8D A;  4JRP A;  3G7Z A;  3PVL A;  2PU9 B;  1I4K 1;  3CMA A;  2HQH A;  1QLY A;  4EIK A;  2PVD B;  2ZAE A;  3JB9 I;  1JRI A;  1KJW A;  3CCE A;  2YRV A;  2VVK A;  4HXJ A;  3PMT A;  2YT6 A;  4FSX A;  1VQP T;  1QP2 A;  1PRM C;  2MIO A;  2BE7 D;  4BI8 B;  3TQ7 P;  1BI3 A;  1KQS S;  3FDR A;  2OTJ Q;  4E47 A;  3MHX A;  1LNX A;  2LCS A;  1WXT A;  4F7U A;  4KUD K;  1SHF A;  1JBM A;  3SD4 A;  2EVR A;  2RQV A;  1MND A;  4QVD A;  4KT0 E;  2FL7 A;  3TRE A;  1VQ9 T;  2RN8 A;  2X4Y A;  2ZPE B;  4MML A;  3GP8 A;  5FU7 B;  1E6H A;  4KUI A;  2RM4 A;  1SSH A;  3BDL A;  4HCK A;  1UB4 A;  3SB2 A;  2RI5 A;  1MUZ A;  5KYN A;  1S72 T;  1K4U S;  4QT7 A;  2V8J A;  3MEU A;  5LJ3 f;  4C0F A;  2RD1 A;  4E2F B;  3OYB A;  3S3N A;  2DVJ A;  2D8H A;  2O9V A;  4DBQ A;  2RH2 A;  5KYX B;  4LDV A;  1YIJ T;  2RHX A;  1X69 A;  3C4S A;  2GNC A;  1X6G A;  1Q81 U;  1VQ8 A;  4M7A D;  4OB1 B;  2VB6 A;  1WHK A;  2VWF A;  1ZA1 B;  3CD6 Q;  4OML A;  4A4E A;  2LQ8 A;  2AKL A;  1WHH A;  5CAI A;  5CO7 A;  1CKA A;  1YHQ Q;  1BCO A;  1UFF A;  4RTT A;  3V8L A;  5HKC A;  4BY6 C;  3VS6 A;  2K5F A;  3CPW P;  1W1F A;  3A98 A;  2JT4 A;  5GAM e;  3C12 A;  3RER A;  1F1B B;  1MMN A;  2ZPH B;  1QQJ A;  1QW1 A;  2YUN A;  1D1B A;  1VIF A;  1K0X A;  2HMA A;  3OW2 P;  2M51 A;  3CME A;  3M57 A;  4PJO F;  1OI1 A;  1QVG S;  2QTX A;  2EJF A;  2HSE B;  2VYT A;  2CZ7 B;  1Y71 A;  5J39 A;  3A5Z B;  1IB8 A;  1TWB A;  1RL2 A;  3M0U A;  3PFS A;  3O8V A;  1AVZ C;  1ZUY A;  2SRC A;  2JM9 A;  4F7U B;  3I56 T;  4HA8 A;  1S72 Q;  1R0B G;  4C8Q D;  5CR2 A;  4LDX A;  2W0Z A;  1V1C A;  4F04 B;  1LVK A;  3OSS C;  4OVA A;  1I0C A;  2HKQ B;  1M90 C;  4BDZ A;  2NUT A;  2DER A;  3MJX A;  3TU4 K;  4IUP A;  3VUB A;  4RUG A;  2X4X A;  3HHT B;  4M7D E;  2DXC A;  1G83 A;  2QQS A;  4K11 A;  1U1S A;  4Z8A A;  4MZM A;  4M7D C;  2ED0 A;  2DL8 A;  3QJY A;  5KCO A;  1TOV A;  4BD3 A;  1QVF A;  1VQL Q;  5KE3 A;  1VUB A;  3QKJ A;  2J6F A;  3EGU A;  2W10 A;  1YJ9 A;  1N8R R;  1RLQ C;  1Y7X A;  1JQQ A;  2AT1 B;  1RI9 A;  2DK3 A;  4QW2 A;  2R5A A;  2CS7 A;  4O6J A;  2E70 A;  4AG1 C;  5M9O A;  1YJN Q;  1G3S A;  4P5N A;  1OUL A;  2FEI A;  5GAO m;  2EQU A;  1ZHI A;  2JNG A;  4ZN1 A;  2EYQ A;  2QA4 A;  1Y96 B;  4QVZ A;  3VS5 A;  1XNI A;  4V2S A;  4F7U F;  3QWX X;  3CCJ T;  2E6N A;  4RTX A;  4VUB A;  1GCP A;  1YJ9 Q;  3EG3 A;  2XIC A;  1HYO A;  1FMK A;  4EMK C;  5KCH A;  2QEX T;  4OGC A;  2M02 A;  2KDS A;  4C92 C;  4JZ4 A;  2LCC A;  3H9N A;  1VQ7 A;  1RI0 A;  3P8B B;  2RJF A;  5LJ5 h;  1ZQ1 A;  1C6V X;  5CVI A;  4CC3 A;  1QCN A;  5LJ5 g;  4M4Z A;  3TEE A;  1VQN A;  1T3S A;  1BU1 A;  4ATO A;  2QYZ A;  2DO3 A;  4BY6 B;  2DTH A;  5D6X A;  1EFN A;  2L5Q A;  4LE9 A;  3CCR A;  5GJW B;  2A37 A;  5IXF A;  4PJM A;  2EAY A;  4LDY A;  2O88 A;  1NEB A;  1D09 B;  4IIM A;  3TCJ A;  3HL8 A;  2DLP A;  2R57 A;  3AHU A;  2VXF A;  5GAM d;  1RAC B;  2JM8 A;  3CCV T;  4OMO A;  2ECZ A;  4D8K A;  4HKE A;  2K57 A;  2O2O A;  3PTA A;  3GOX A;  4BAC A;  3MEA A;  2EGC A;  2K4Y A;  2CUB A;  1TU0 B;  3KFV A;  2IG0 A;  3QHS A;  2FO0 A;  4BI3 A;  1Y57 A;  4GLM A;  1YI2 A;  3JRZ A;  4BE2 A;  4JZ3 A;  2DBM A;  1B7T A;  3M54 A;  2MAM A;  3MP8 A;  1OZ2 A;  3JB9 J;  4FYY B;  3OYL A;  2QK0 A;  3V7C A;  3CCM A;  2CGH A;  3OYK A;  1MV0 B;  2DYB A;  1W6X A;  4OB3 B;  2DEU A;  2EWN A;  4J9I A;  2L0A A;  2QEX Q;  3L2Z A;  4J83 A;  1D0Y A;  2DTI A;  5KYW A;  4KBM B;  1OU9 A;  4TVR A;  3LWI A;  4BE1 A;  2EGA A;  4M75 D;  1UJ0 A;  4M7D B;  3WVE B;  4MZT A;  1XJW B;  3E2U A;  1WJR A;  2HSP A;  4QVC A;  3EGX A;  2FB7 A;  3M4Y A;  1NZ9 A;  4PNO A;  3DLL A;  4RKU E;  4CI0 C;  2VXE A;  2LVM A;  2JTM A;  3M58 A;  2VV5 A;  1M3A A;  4HVV A;  2EJ9 A;  5GAO r;  5CKB A;  1TH7 A;  5IAY A;  2ZPF B;  3CCV Q;  3EHQ A;  1NPR A;  3PIO A;  4XTZ A;  1JEG A;  1LPL A;  5ECA A;  3PE0 A;  3M0S A;  3UA6 A;  2PQW A;  1KC8 U;  1GCQ A;  2HAX A;  2QQ9 A;  1WYX A;  2PUK B;  3A8H B;  3CBM A;  1WHJ A;  3OSV A;  3C95 A;  1CKB A;  2GTJ A;  2X3X D;  4LDU A;  4BI4 A;  1IXD A;  2PVG B;  1YP5 A;  2ED1 A;  1VA7 A;  2HKN A;  4C92 B;  3QDF A;  3CXC A;  2I2L A;  3JV3 A;  2EYW A;  3RKY A;  3ZL7 C;  4XAX B;  3HSB A;  3A8G B;  1XTD A;  4EDU A;  4HCC A;  2DE0 X;  4AFQ C;  3V7S A;  4JRQ A;  2DD4 A;  3MO8 A;  2GCX A;  2J7I A;  1PWT A;  1Q86 U;  5CK9 A;  2GQV A;  4XK8 E;  1O9S A;  4M7D G;  1PSF A;  5KYU B;  3A8L B;  2O9S A;  2VUB A;  3CCQ T;  5GAN h;  2E4H A;  2KR3 A;  3L2W A;  4E7S A;  4QQG A;  2VC8 A;  5GAN g;  1QVP A;  1UE9 A;  4PJO E;  3JCM W;  2NUZ A;  4AT1 B;  4E7I A;  3AT1 B;  2X9H A;  3E1S A;  3M53 A;  3JSC A;  4PJO C;  1AHJ B;  1NYF A;  3HFN A;  3L2U A;  4A4G A;  2DD5 A;  3DLM A;  4M7A E;  1N27 A;  3M56 A;  1PSE A;  5IHK A;  1OEB A;  1UGR B;  2AIR B;  4FT2 A;  4FSS A;  2DIG A;  4AFS C;  2X4W A;  1RAG B;  1M90 U;  3JCM Q;  2P84 A;  2VKN A;  2RA2 A;  1VQO T;  4HCZ A;  4C92 G;  3JB9 D;  1EIF A;  2XDB A;  1C0M A;  3M0P A;  1FMW A;  5I22 A;  1KQS A;  2XDP A;  2G6F X;  1UDL A;  2FG0 A;  3A8O B;  3VRY A;  3FLG A;  1D0Z A;  2XKO C;  2V8I A;  2YXY A;  3GF5 A;  4Q5W A;  2JS2 A;  1U06 A;  3CC7 T;  2XDD A;  1QWF A;  1QWE A;  5GAN 2;  1SG5 A;  1WFW A;  5IH2 A;  3KBG A;  5GMK m;  4M7A A;  1U5S A;  3QG1 A;  3RNJ A;  4C5E A;  5GMK h;  2LX7 A;  2DMO A;  5AYF A;  4C0D C;  3GLX A;  2KVQ G;  2PNI A;  1ZSZ A;  3QZ5 B;  2JZ2 A;  3JB9 G;  3CCQ Q;  3CCL T;  1PKT A;  1UEC A;  1N8R C;  2CH4 A;  2DL5 A;  2CH4 W;  1IZ6 A;  4AG2 C;  1VQK T;  2DA9 A;  1GL5 A;  2QQR A;  2AHJ B;  2D6F A;  5GAN 3;  2RJC A;  3QSU A;  1VYT A;  3ULR B;  1FX7 A;  4AFZ C;  3C0C A;  2LJ1 A;  1WDX A;  2LQN A;  4FW1 A;  1M27 C;  1K9M U;  5HK3 A;  4AFU C;  4R55 A;  2L8D A;  5LJ5 d;  2HL5 C;  3CXC P;  2KNB B;  4JJC A;  2KAF A;  3FB9 A;  4ZTF A;  2DIQ A;  2JW4 A;  3G71 A;  5GAN e;  4DOW A;  1M2V B;  2OTJ A;  1K73 C;  2RJD A;  2DRM A;  3REB B;  1FYN A;  2E1H A;  4KH1 B;  1VQO Q;  3NTH A;  3EFO A;  2XMF A;  2NWM A;  1P92 A;  1GFD A;  2RB6 A;  1GXI E;  2JJ9 A;  3SDZ A;  1VYU A;  3OYE A;  1YNZ A;  3IQL A;  1RAD B;  1CSK A;  5CIU A;  4C8Q A;  2C06 A;  3LH0 A;  2D0N A;  4JPB W;  1Q81 R;  2E3I A;  3M0T A;  3A1P A;  3MEW A;  1WNL A;  3S6W A;  3G71 Q;  1YN8 A;  1WHM A;  4KGV B;  2DIL A; 
#chains in the Genus database with same CATH homology
 3CBP A;  3TU4 K;  1G3Y A;  2DXB A;  3MEV A;  1VQM T;  5GAN f;  3CC2 A;  4EMH A;  4IUP A;  4M7A C;  1VIE A;  4JRK A;  3VJP A;  1Q7Y U;  3VUB A;  3KUF A;  3V8J A;  3OBY A;  3SWN A;  2X4X A;  3HSB A;  3HHT B;  4PJO B;  4M7D E;  1NPP A;  3FJP A;  1BI0 A;  3ZEH A;  2DXC A;  2QQS A;  2G3R A;  3OYA A;  3FIF A;  3BY7 A;  1U1S A;  1Y07 A;  1HXD A;  2P4T A;  4MDW A;  4A4F A;  4MZM A;  4M7D C;  2WSC E;  3GIB A;  4J6X A;  2K3Y A;  4RCC A;  2P0K A;  3PT9 A;  4B9W A;  2GFU A;  3QJY A;  5KCO A;  2QQA A;  4BD3 A;  1BI2 A;  3CD6 A;  5FRO A;  3BFM A;  1QVF A;  5KE3 A;  3RMQ A;  1VUB A;  3QKJ A;  1YHQ A;  4JLI A;  3QYH B;  1YJ9 A;  1W2B S;  3A8M B;  3I55 A;  5LJ3 d;  1Y7X A;  3CCQ A;  2MMP A;  1BIB A;  3LWH A;  3OYM A;  1KHI A;  5GAO n;  2MWO A;  4L5G A;  1Q82 C;  2A3L A;  2DJZ A;  1G3W A;  4M77 E;  2DK3 A;  2XK0 A;  5J3B A;  4QW2 A;  2R5A A;  4A54 A;  2CS7 A;  3OA6 A;  3QZ9 B;  4JRI A;  4O6J A;  2E70 A;  2RK2 A;  5M9O A;  4LD9 K;  1G3S A;  4P5N A;  2WSE E;  2LDM A;  3X26 B;  4CRI A;  5GAO m;  2EQU A;  3KXT A;  1QP3 A;  1ZHI A;  4FT4 A;  3CPW S;  1KHC A;  2XID A;  3L42 A;  2JNG A;  4ZN1 A;  5HK0 A;  3OYG A;  2EYQ A;  3HRU A;  2QA4 A;  3QXE B;  4EPC A;  3HP9 A;  4MDX A;  2R5M A;  2PVO B;  4J7I A;  3JAM E;  1Y96 B;  2E12 A;  4M78 F;  4QVZ A;  5CKE A;  4JS5 A;  1XNI A;  4ME7 A;  4RCB A;  4EMG A;  4V2S A;  1M1K C;  4FL6 A;  4F7U F;  3CCJ T;  1WJS A;  2LX9 A;  1HK9 A;  1UGP B;  2E6N A;  1FXX A;  3MP6 A;  3INZ A;  3Q1J A;  4VUB A;  5GAN 8;  5GAO l;  1SSF A;  5FRN A;  3OW2 S;  1OZ3 A;  2B8A A;  5A0D A;  2P0P A;  3CCS T;  1MHN A;  2XIC A;  3VYG A;  4EMK C;  5KCH A;  2QEX T;  2QI2 A;  4OGC A;  3CXC S;  3QPH A;  2K3X A;  5CKD A;  3CC4 T;  2KMT A;  4X34 A;  3M55 A;  3NFC A;  4OMF B;  2KDS A;  2DVE A;  1VQ4 A;  4A4H A;  1VQ9 T;  4ELY C;  4C8Q E;  4C92 C;  5GAM j;  1VQ9 A;  2LCC A;  3JCM h;  1VQO A;  3UDC A;  1VQ7 A;  3CMA T;  2ZPB B;  2GFA A;  2O4X A;  1RI0 A;  3P8B B;  5GAO p;  2RJF A;  5LJ5 h;  1NJI C;  1ZQ1 A;  2E6Z A;  3QUI A;  5CVI A;  3JCM c;  1I8F A;  3JCM g;  3VU3 C;  3QDR B;  2KK4 A;  4C8Q C;  4DQ2 A;  1U8R A;  4WF2 A;  3H8Z A;  1BI1 A;  4C0D B;  3CCE T;  3JCM d;  1VQ6 A;  3JB9 F;  5LJ5 g;  2HQE A;  2JUF A;  4NS5 A;  2QDY B;  4HT9 A;  1ZBX A;  1M4Z A;  4M75 G;  2BUD A;  3TEE A;  1S72 A;  1VQN A;  2KQW A;  4EMK B;  5CKF A;  4ATO A;  2M16 A;  2DO3 A;  4M77 A;  4BY6 B;  3G6E T;  2DTH A;  5D6X A;  2KY9 A;  2L5Q A;  2WAC A;  3CCR A;  2HNI A;  4PJO G;  2DXT A;  5L8R E;  2EAY A;  2XG8 D;  5C6S A;  4LDY A;  4RG8 A;  1UGQ B;  4GLK A;  5FLX E;  3CBO A;  3NTK A;  2K5I A;  3MCA B;  3V8K A;  2YHT A;  3OYY A;  2P0Q A;  2ZPI B;  3ZFJ A;  4E7H A;  3SWN C;  3JCM J;  1YJW A;  4N4I A;  3TCJ A;  4M7A F;  2RO0 A;  3G4S A;  5A0G A;  4C0Z A;  2JOY A;  2K5L A;  5EG2 A;  3OS2 A;  3HL8 A;  1IRE B;  3PIP A;  1BIA A;  4IUV A;  1XQH A;  1OYX A;  1WPY A;  2R57 A;  3AHU A;  2VXF A;  5GAM d;  3CCV T;  1H3Z A;  1KD1 U;  2HQX A;  4N4H A;  3ME9 A;  4ELZ C;  2O01 E;  3DB3 A;  2YLB A;  4M7D F;  4HKE A;  3RES A;  2K57 A;  3L2R A;  1X01 A;  4MZP A;  1QVG A;  5GAN 7;  3UWN A;  1YIT A;  1I5L A;  3JCM b;  3PTA A;  1Q7Y C;  3GOX A;  3WVD B;  4BAC A;  1YHQ T;  2EQJ A;  3P8H A;  4IUR A;  1VQL A;  3MEA A;  1VQK A;  2K4Y A;  3OS0 A;  3JCM P;  2IG0 A;  3RKX A;  4DA4 A;  3QHS A;  3M5A A;  3PGG A;  4BI3 A;  4N0A A;  1KG1 A;  3OY9 A;  1FWZ A;  2H3J A;  3WXM B;  3LW5 E;  4J5Y A;  2LT1 A;  4J7F A;  4JUV A;  4OP0 A;  3JRZ A;  5GAN d;  4BE2 A;  3R6O A;  3V7R A;  1YI2 A;  2RJE A;  2FHD A;  4ZN3 A;  1VQ8 T;  2E65 A;  2MAM A;  3M54 A;  1OZ2 A;  3MP8 A;  4GY5 A;  4L6V 5;  4LD6 A;  3RUX A;  4E7L A;  3QBY A;  2VGN A;  3OYL A;  3M9Q A;  3JB9 J;  1YJN A;  3V7C A;  3M4G A;  3J81 E;  3OB9 A;  3CCM A;  2CGH A;  3VKI A;  4KUL A;  3OYK A;  3X20 B;  4M78 D;  4O5V A;  4OB3 B;  2EWN A;  5FU7 C;  1M9S A;  4XU0 A;  3L2Z A;  4JDS A;  1BKB A;  2EIF A;  1M1G A;  3VUZ A;  1BYM A;  4J83 A;  2D9T A;  4Y28 E;  1X75 C;  4C5I A;  1G3T A;  5LJ3 h;  1W4S A;  3T9N A;  2EQM A;  1YBY A;  3M59 A;  4PKC C;  1NE8 A;  2DTI A;  4XQ3 A;  4M7A B;  2DXU A;  2DKG A;  3F70 A;  5LJ3 g;  3CPF A;  1WQ7 A;  3CCU T;  4KBM B;  2Y4X A;  2JN0 A;  3QII A;  4TVR A;  3LWI A;  4C92 F;  4BE1 A;  5CKH A;  3HPW A;  1WQW A;  1MGQ A;  3EAE A;  2L89 A;  4M75 D;  1M8V A;  4M7D B;  2L3R A;  3WVE B;  4MZT A;  5GMK e;  3JCM X;  3J7A F;  4C8Q F;  5GMK j;  1WJR A;  4M75 A;  2E64 A;  1D3B B;  1LOJ A;  3N5B B;  3UPU A;  4ZTJ A;  4QVC A;  1VQP A;  5FU6 C;  4M77 C;  2FB7 A;  1VQN T;  3M4Y A;  1NZ9 A;  1KQ1 A;  4IUQ A;  3CME T;  3DKM A;  4PJO D;  1UGS B;  2Y90 A;  5LL6 S;  4E7K A;  3OYJ A;  4PNO A;  5GAO q;  2RHI A;  4PJO A;  2RHZ A;  3DLL A;  3QJ6 A;  3X25 B;  4RKU E;  4CI0 C;  4OF1 A;  1K8A U;  2BIV A;  1W2B A;  2VXE A;  2ZGW A;  4M78 G;  2LVM A;  2JTM A;  3ZBD A;  2JTF A;  4XTU A;  4MMK A;  3G71 T;  2X35 A;  1VQM A;  3M58 A;  1KC8 C;  2VGM A;  4F7U G;  2VV5 A;  1X6O A;  2EJ9 A;  3OYN A;  5GAO r;  4BE0 A;  5CKB A;  4M77 B;  2A7Y A;  1TH7 A;  5KH6 A;  2OTJ T;  3FC3 A;  3PMI A;  4BB7 A;  2ZPF B;  4ZGD B;  3CEY A;  3HFO A;  5IAY A;  4J6W A;  5A0L A;  1NPR A;  2Y4Y A;  3PIO A;  1VQ5 T;  4XTZ A;  2X4J A;  5C0M A;  3OYI A;  4PL6 A;  3OYB A;  3S3N A;  2EQK A;  2D0Q B;  2PUO B;  3URG A;  3OYD A;  3CPW A;  2XHC A;  1B34 A;  2CKK A;  2PQW A;  3LYI A;  3S3M A;  1LJO A;  2QXF A;  4QQ6 A;  1KC8 U;  2OTL T;  3RMS A;  5GAN 5;  2QQ9 A;  2HAX A;  2PUK B;  3A8H B;  3CBM A;  4II1 A;  3HRT A;  3OSV A;  3DB4 A;  5A2Q E;  3C95 A;  1YIT T;  2F5T X;  2MF2 A;  4LDU A;  4RG2 A;  4BI4 A;  3OMG A;  2PVG B;  3E9G A;  4OGE A;  3OW2 A;  1VQL T;  1JJ2 S;  3ASK A;  4C92 B;  4PLL A;  2M9U A;  1M1F A;  4N0A C;  3NTI A;  4B9X A;  1YIJ A;  3CXC A;  2I2L A;  1KD1 C;  1Y96 A;  2E41 A;  2NLU A;  4C8Q B;  3CC7 A;  1U1T A;  3RKY A;  4OB0 B;  1Q86 C;  5FRM A;  4XAX B;  4XU3 A;  3RIR A;  3JCM f;  3OQ5 A;  5GAM h;  4E7J A;  3CC2 T;  2MWP A;  3A8G B;  4BDY A;  1XTD A;  4M78 E;  5IN1 A;  4EDU A;  2JVV A;  5LJ5 f;  3GNG A;  3OYH A;  4HCC A;  4LDW A;  2M1H A;  4A53 A;  5GAM g;  3RKW A;  3V7S A;  4F7U E;  1YJN T;  4JRQ A;  5J26 A;  2DD4 A;  4M7A G;  4QQD A;  2XU8 A;  4N4G A;  3MO8 A;  3OYC A;  2RHY A;  3E19 A;  3CCM T;  2F69 A;  2DAQ A;  1DJ7 B;  2GCX A;  3FEO A;  3CCJ A;  4HCB A;  1Q86 U;  5CK9 A;  4NL3 A;  4BUG A;  1N9S A;  3L1A A;  2GQV A;  4XK8 E;  3CD6 T;  3CCS A;  3BW1 A;  2QEX A;  1O9S A;  2LTO A;  3SWN B;  3LGL A;  4IUU A;  1PSF A;  5GMK i;  3CC4 A;  1JB0 E;  1R8O B;  4M7D G;  2V8K A;  3A8L B;  2VUB A;  3ER0 A;  3P8D A;  4XTV A;  3H6Z A;  1YJ9 T;  4M75 E;  4JRP A;  3G7Z A;  2PU9 B;  3I55 T;  1I4K 1;  2RHU A;  3CMA A;  3CCQ T;  5GAN h;  3L2W A;  2PVD B;  3OS5 A;  4QQG A;  1JRI A;  3JB9 I;  2EJG A;  4M75 C;  2VC8 A;  3MET A;  5GAN g;  4C0G A;  1QVP A;  5IT9 E;  3CCE A;  2YRV A;  4IUT A;  3VV0 A;  2M0O A;  4X9C A;  2RK1 A;  4PJO E;  3JCM W;  3PMT A;  5I21 A;  1K73 U;  2FVU A;  4FSX A;  4YTL A;  4E7I A;  1VQP T;  4M77 F;  3E1S A;  2QQB A;  3JSC A;  3M53 A;  3G6E A;  1AHJ B;  1QP2 A;  3HFN A;  4A4K A;  5LJ3 e;  3L2U A;  4PJO C;  2QA4 T;  5LJ3 j;  4BI8 B;  4A4G A;  4XTY A;  4FU6 A;  2MI6 A;  1QVF S;  1BI3 A;  2YLC A;  2DD5 A;  4M78 A;  1KQS S;  3DLM A;  2LCL A;  4M7A E;  3FDR A;  1N27 A;  2HBP A;  3M56 A;  4E47 A;  1PSE A;  1LNX A;  3MHX A;  4C5G A;  4F7U A;  4KUD K;  1JBM A;  1UGR B;  4FT2 A;  2LNV A;  3EFS A;  2DIG A;  3SD4 A;  3SFM A;  1N9R A;  3OYF A;  2X4W A;  3HKS A;  2XD0 A;  3PNW C;  4NOY A;  1WJQ A;  4XTW A;  1M90 U;  1VQ4 T;  4QVD A;  3JCM Q;  4KT0 E;  2CZ6 B;  2FL7 A;  3TRE A;  2RA2 A;  3X28 B;  3CCV A;  1VQO T;  1WGS A;  2X4Y A;  4MML A;  2ZPE B;  3I56 A;  3GP8 A;  1K8A C;  5FU7 B;  3CCL A;  2BKD N;  4HCZ A;  4C92 G;  5CCA A;  3JB9 D;  2RI3 A;  2RM4 A;  4KUI A;  4IKF A;  3C94 A;  1EIF A;  3BDL A;  4DOV A;  1VQ6 T;  2XDB A;  1UB4 A;  3SB2 A;  2RI5 A;  5CQX A;  2RI2 A;  1Q81 C;  4C8Q G;  4L59 A;  1S72 T;  3QO3 A;  1KQS A;  2XDP A;  2FYK A;  2HD0 A;  3L2V A;  2V8J A;  2O4X B;  3MEU A;  2XI9 A;  2RD1 A;  4XU2 A;  5I2M A;  5LJ3 f;  4C0F A;  3A8O B;  1B34 B;  3J80 E;  3CCR T;  3JB9 H;  3FLG A;  3LLR A;  2RH2 A;  1VQ7 T;  2XKO C;  2V8I A;  5D6Y A;  4LDV A;  3GF5 A;  4Q5W A;  1YIJ T;  2RHX A;  3C4S A;  4Y91 A;  2LC4 A;  4C5H A;  1O75 A;  5DY9 A;  5DLO A;  4PLI A;  3JCM e;  3EFR A;  3CC7 T;  2CZ0 B;  2XDD A;  1Q81 U;  5GAN 2;  5LJ5 e;  1VQ8 A;  5FU6 B;  2F5K A;  4OB1 B;  4D6W A;  5LJ5 j;  2LRQ A;  1YJW T;  4M7A D;  3G4S T;  3KBG A;  2ZPG B;  1M5Q 1;  4XU1 A;  5CQY A;  4Z02 A;  3VYH B;  5GMK m;  4M7A A;  3QG1 A;  4C5E A;  1I81 A;  3OMC A;  4X9D A;  5GMK h;  2DPP B;  1N6A A;  4J8O A;  5AYF A;  2GF7 A;  4A4E A;  1Q82 U;  4JLG A;  2LQK A;  4M7D D;  4C0D C;  2LQ8 A;  2E10 A;  5CAI A;  5CO7 A;  3GLX A;  2KVQ G;  3OBW A;  4M7D A;  1UEB A;  2OAU A;  3HRS A;  3QZ5 B;  1K9M C;  2JZ2 A;  3QYG B;  5GMK l;  3JB9 G;  3V8L A;  4C92 E;  3CCL T;  1D3B A;  5HKC A;  4JS4 A;  3CCU A;  1N8R C;  4BY6 C;  2K5F A;  2LT4 A;  5I2S A;  2ZCF B;  1IZ6 A;  5GAM e;  3C12 A;  1VQK T;  3BDU A;  3RER A;  2QQR A;  3E9F A;  1XOV A;  2AHJ B;  2ZPH B;  1QW1 A;  2WSF E;  2D6F A;  1M1K U;  5GAN 3;  2RJC A;  3QSU A;  1H64 1;  2R58 A;  4ZGE B;  4M75 F;  1FX7 A;  5DLQ E;  3UT1 A;  4ZGJ B;  1K9M U;  1YI2 T;  1VIF A;  5HK3 A;  2CYZ B;  4R55 A;  3S3O A;  2L8D A;  5LJ5 d;  4M77 D;  1N8R U;  3CME A;  3M57 A;  5GAN 6;  5GAN 4;  4PJO F;  3X24 B;  4M78 C;  2DZC A;  4JJN K;  1OI1 A;  1QVG S;  2KAF A;  2QTX A;  2EJF A;  2EKO A;  2VYT A;  3FB9 A;  4ZTF A;  1NJI U;  2CZ7 B;  4NL2 A;  1Y71 A;  2DIQ A;  4R56 A;  3FRN A;  4RMO A;  3G71 A;  5J39 A;  3A5Z B;  1JJ2 A;  4OB2 B;  5GAN e;  3LX7 A;  1YCY A;  4DOW A;  5GAN j;  4FIB A;  4XTX A;  2OTJ A;  1K73 C;  2IVW A;  2RJD A;  2ZZD A;  1RL2 A;  3PFS A;  4FM4 B;  2E1H A;  5HY6 A;  3L2Q A;  3NTH A;  3O8V A;  4EMK A;  1P92 A;  3JCM V;  1VQ5 A;  2RB6 A;  3GNF B;  1GXI E;  4C92 D;  4M78 B;  5GAM f;  2KSS A;  3GPL A;  2E5Q A;  3SDZ A;  4C92 A;  3OYE A;  4F7U B;  2DZ9 A;  3I56 T;  2CZ1 B;  4HA8 A;  2OTL A;  4C8Q D;  3MP1 A;  2K2V A;  5CR2 A;  4LDX A;  5CIU A;  1G5V A;  4C8Q A;  2C06 A;  3LH0 A;  1KQ2 A;  2EFI A;  4J6Y A;  5KE2 A;  5DM7 R;  3OS1 A;  3MEW A;  3OSS C;  4OVA A;  4UC4 A;  5D6W A;  4M77 G;  1WNL A;  1M90 C;  1V29 B;  3S6W A;  4BDZ A;  4HT8 A;  3LGF A;  2DTO A;  2DEQ A;  4M75 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...