4CI9A

Crystal structure of cathepsin a, apo-structure
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
455
structure length
415
Chain Sequence
SRAPDQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSOSOMAL PROTECTIVE PROTEIN
publication title Crystal structure of cathepsin A, a novel target for the treatment of cardiovascular diseases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 151
structure length 415
sequence length 455
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 2013-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ci9A00
3QVMA 5JAOA 4GW3A 4QDTA 4M0EA 1EINA 3IUQA 3RKSA 5EGNA 4LYDA 5FUMA 1CUGA 5JARA 3WZLA 2O2IA 5ALYA 4DNQA 4X97A 1LPSA 3WKDA 5E4JA 2PKYX 4DMHA 3R40A 5E2IA 3ZPXA 5ALTA 3I2FA 2XQGA 2DQZA 4QEKA 5ALIA 3PUIA 4BATA 4AMYA 1WB4A 1CEXA 4UBMA 3B5EA 4DM7A 1ZI6A 4X3CA 3T4UA 5FV4A 2B20A 1DX6A 4ZREA 1ACLA 5AJHA 3EF3A 5JZBA 5AIAA 5YASA 1QONA 3LS2A 2XUDA 2WUDA 1MT3A 1VE7A 3H2HA 3K9BA 3AJAA 3C5WP 3G0BA 1CUVA 1QTIA 3DJYA 4H7IA 2EDAA 5HQ3B 2QJRA 4JYMA 2WU3A 4PSCA 3STXA 2H7XA 1HL7A 5EI5A 3WI7A 4YK7A 1BROA 3C6ZA 1IUOA 4AXBA 1ZJ5A 4Y2YA 5LZ4A 1R9NA 4K6HA 4OU5A 2IIVA 4C01A 3E4DA 2QTBA 4H77A 5HF5A 4HTAA 2DQYA 2X8BA 4E46A 4Y2JA 3KWFA 4HZGA 1MX1A 2W6CX 4BCCA 2G4LA 3TJMA 5BV7A 4DNOA 3MGAA 1YB6A 4W9RA 4AN0A 1LPMA 5ALDA 3H0CA 4ITVA 3I6ZA 5IVKA 3A70A 2XDWA 4C4ZA 2WILA 1R3DA 5JADA 1DTEA 3WL5A 4J3JA 5ALZA 2XUQA 2Y6UA 3DCNA 5JZ9A 3D3NA 4ZXFA 3PF9A 4MYDA 5ALUA 2WIGA 3ED1A 3C70A 2HL6A 2CMFA 3QPAA 2ACKA 5CT5A 2HU8A 4P93A 1CUBA 1E66A 1EK2A 1CQZA 3ZI7A 3QBJA 2FX5A 4C89A 4H7DA 1K8QA 5BOVA 1RP1A 5IVHA 3D2AA 4ARBA 1QZ3A 3WWEA 5JYCA 4FOLA 2WFZA 3OM8A 2QZPA 3GROA 4UHFA 1CLEA 3F67A 2PX6A 3KDAA 4G4GA 4I19A 4Y2VA 3IVMA 3PFBA 1FFCA 1XZGA 1BN6A 1BS9A 3PUHA 4ETWA 2C5FA 4OB7A 4CG1A 5JD4A 5AI4A 4KAFA 4BZZA 3JWEA 2QRUA 3FBWA 2GYWA 5HQ3A 5CXXA 1YB7A 3RLIA 3FVTA 2AJ8A 4PO3X 1GPKA 4O08A 4FMPA 5D3ZA 3O4GA 1YAJA 2Q0XA 2OCIA 5AKIA 1QFSA 4WFKA 1FFBA 5ALKA 1H2XA 3O9VA 4BTVA 3FSGD 2RGUA 1OXMA 4IH4A 3HZOA 2WIJA 4XJVA 2V96A 3WZMA 4N8DA 5AK5A 3KOOA 3C87A 5IH7A 4X00A 3HJUA 3B12A 1XQXA 1U65A 4QNNA 5AHXA 2JGEA 1C7JA 3C5VA 1USWA 2XT0A 3D59A 3IUJA 3E0XA 5AOAA 4BCDA 1N5RA 3WK5A 1MO2A 4I3FA 4P9NA 2WG1A 2PL5A 2OXEA 3H1AA 3FLBA 2WU4A 3OOSA 3DL4A 4TVKA 1Q0ZA 1DT3A 4U2BA 3R3UA 3QH4A 2CZQA 1Y37A 2OGTA 3F8SA 5CH8A 3ESBA 5EHQA 4FLEA 4I4CA 2JBWA 3WK9A 5HF9A 4S0XA 4U2FA 5E4YA 2ROQA 4FKBA 2HA4A 2O7RA 2ZYRA 3V1KA 1R4ZA 1Q83A 1YR2A 4M0FA 3W06A 3WQHA 1XLVA 4L9AA 5EFZA 1R50A 1L7RA 1PV1A 5AOCA 1UOPA 1JJBA 1IMJA 5ALPA 1MN6A 1TRHA 4W1SA 3W04A 1ZI9A 4CFSA 4KAAA 4OCZA 2WJ3A 4AN1A 2Z3ZA 4GLBA 1AGYA 2AJDA 4X7BA 1XLUA 3V1NA 1JU3A 2WFLB 1XQWA 3F98A 3QITA 4Q3OA 2GZRA 2PSEA 5CW2A 3HRHA 5I7UA 1SCIA 1T4MA 3AZPA 4KAJA 2WUFA 4N8EA 4WFJA 2DCMA 1XZAA 3T52A 2BJHA 4RE6A 2HA7A 2JF0A 3SWWA 2BGRA 4L0CA 1Q0RA 4X90A 3C43A 2OPHA 4QZVA 4OU4A 1QIEA 5ALHA 4ZGBA 1AC5A 1N1MA 1WB5A 2OCKA 2JGMA 3K2IA 4X93A 3VISA 4G8DA 3O4IA 1JJFA 4Y7DA 1VE6A 4B83A 3AFIA 5C8ZA 3R0VA 4WDQA 5FXMA 2O2HA 1QIGA 2DFPA 3G9UA 1O6FA 2CEKA 3F96A 4Q34A 3YASA 1TCAA 4Q1VA 3PE6A 1HLGA 1ZOIA 4UHDA 4UHHA 4UBNA 4OUKX 2XMGA 1I6WA 4X71A 1UK7A 1XLWA 2WIDA 3STVA 1E89A 2HRRA 3DYVA 5AKLA 1XZLA 2C4HA 1AMNA 3I28A 2C5GA 4K6KA 5CT4A 1X70A 4MWSA 4JEIA 1TAHA 2WJ4A 4BRSA 1IUPA 2J4CA 2HA5A 1P0MA 3NUZA 2XUAA 3D0KA 1ZIXA 1LBTA 2PU5A 1UFOA 1CRLA 2XMSA 1VXOA 4EB0A 4GWLA 3GFFA 1XRLA 4H7FA 1N5MA 1J07A 1MTZA 5LYYA 5AI0A 2Z3WA 5A7FA 4X6XA 4UHBA 5JAPA 4M0MA 4RPCA 2QMQA 3SC2A 5LKAA 2WQZA 2WFLA 1WHTA 1IZ7A 1X2BA 3TGLA 2Y6VA 3FLEA 4Y2TA 3M3DA 2RAUA 4K6GA 1P0IA 5HKBA 1QLWA 3H2KA 3GZJA 4ZWNA 5ALRA 1XZJA 3IUNA 1EB9A 3G7NA 1UZAA 5I9IA 4KACA 2PBLA 4FLFA 1WPXA 1LZKA 2J4FA 2G63A 4D9JA 4LXHA 1Y7HA 1OCEA 4HXGA 4FNMA 2OAGA 4BZWA 3C6XA 4QWWA 1Z68A 1X2EA 4QDOA 4EY6A 2BCEA 2RIPA 1UOOA 1RYYA 5CMLA 3AINA 2IX9A 4Y2UA 1TCBA 1SCKA 3D2BA 5C7YA 1MJ5A 3HLKA 2XI4A 3W9BA 1DQYA 4DSZA 4LHEA 1UOQA 3IDAA 3ESDA 1H2ZA 3EBLA 1C7IA 1F0NA 2XUOA 3AZQA 4PW0A 3CXUA 1CUXA 5K3EA 1LPBB 5EIEA 1KEZA 1IUNA 3S8YA 1R1DA 3WIBA 2BUCA 5FPPA 4QE3A 3ANSA 1LBSA 3QPDA 1AQLA 3SK0A 2CB9A 1DWOA 3STUA 2VSQA 1T2NA 2XMRA 3HEAA 4YX9A 1EX9A 3OTQA 3L1JA 5AKEA 1QIFA 3VJLA 3WK8A 2HA2A 4FTWA 2PM8A 4EA6A 2QXTA 3K6KA 3SX4A 3RARA 5DYTA 2AXEA 4IH1A 4UPDA 2DHEA 1JI3A 3O95A 3LP5A 4LXIA 2XUPA 4DGQA 1L7AA 3IBTA 2RI6A 3ESAA 5H3HA 4MEAA 3G8YA 1CV2A 2CKMA 3N2ZB 4U2EA 3WWOA 4DTCA 1QJ4A 3EQ7A 4G9GA 5AH0A 2GYVA 3FAKA 4BE4A 2WG0A 1MU0A 2PPLA 4B9EA 2GYUA 3TRDA 5LP1A 1W75A 1ZGBA 3H19A 2GBIA 5JAHA 4MYSA 4A23A 3R3YA 2DHDA 5CXUA 5FKJA 4XX1A 1MNAA 2QM0A 2Y1KA 5ISMA 5IKXA 3ICWA 1VZ2A 2BKLA 3FYUB 4IH9A 1XQYA 5DYWA 3OURA 2XMDA 4RE5A 2PSHA 1FFDA 3M82A 2VJDA 4DMFA 4KE9A 1YSCA 5ALNA 4AZ3A 2QKYA 2XUHA 5AO9A 1UKAA 2DHCA 4Y2XA 1ZIYA 4N5HX 2RHWA 2G5PA 2HA0A 2K2QB 5AI6A 3AILA 1SFRA 2RHTA 4B84A 4V2IA 3HSSA 4FHZA 4H7EA 1UKCA 1CFJA 1MAHA 3DKRA 4MXDA 3CCCA 3MUNA 3C6YA 3FSGA 4G4IA 1EDBA 4C6HA 3I1YA 2I3ZA 4GHWA 2WUGA 1MNQA 4PV7A 1G4HA 3DL7A 3V1MA 1CUSA 4HXEB 4BAUA 2HIHA 1K63A 4N5IX 4OYLA 5AM5A 2H9YA 4F0JA 2C7BA 3F97A 1XRNA 4UFNA 5DJ5A 1M33A 5JZSA 4DLNA 2H1IA 1A8SA 1DX4A 1TCCA 1MX9A 5ALOA 1G42A 1LPNA 1PFQA 3E3AA 3I1IA 3KXPA 2OQIA 5DTJA 4UFPA 2NW6A 1DQZA 3WLAA 3VVMA 5A7GA 1ZD4A 4HS9A 4J0KA 2XMBA 4G5XA 1H2YA 5CT6A 1P0QA 1R88A 5KWIA 2C58A 5AK4A 2QXUA 2XMCA 1SOMA 2OG1A 1CUHA 1R9MA 4KE8A 4C87A 4JYPA 2Z8XA 4Y2QA 4PNZA 3FYUA 5D3KA 3UMJA 2WKWA 1JT2A 3V9AA 1Y7IA 5CBKA 4X94A 3WKAA 2QOEA 1A7UA 5LLSA 1WOMA 5AKYA 1CR6A 3DD5A 5KREA 4ARAA 3L1IA 3RM3A 4EHBA 4TGLA 3VXKA 4C88A 3H1BA 1XZMA 4BAGA 4P08A 4QDXA 4W1PA 1YCDA 5J3JA 1BN7A 2ZYHA 3IULA 3G0IA 3ZLTA 4DNPA 1KU0A 3EIOA 2WIKA 3A2NA 3D4LA 5ALLA 2OCGA 3V1LA 1CUZA 4EY5A 1VXRA 3VVLA 1ORVA 4Z49A 1HKHA 5HK9A 2J3DA 5EIAA 3FNBA 1QFMA 3BJMA 4G8BA 2ZJFA 2WIFA 2ONCA 4MQMA 5K3BA 5T4FA 3Q8WA 3LIIA 3WJ1A 4OB8A 3A2MA 5FP0A 1QIMA 1GKKA 1VLQA 4E14A 1F0PA 3FCYA 4BP9A 3WK4A 4AO6A 2PU7A 1DWPA 4OD0A 4PSUA 5D7BA 1N8SA 3KD2A 5CH3A 5ALQA 1QIJA 3W05A 4B81A 1P0PA 5AP9A 3IA2A 1BCSA 1E8NA 2VJBA 4EBBA 5SYNA 4XWGA 5EHNA 2I3DA 2VTVA 1JKMA 1LPOA 2X76A 1ETHA 1G5FA 1EVEA 2HRQA 5AK6A 3WIOA 1KU6A 3BXPA 4CCYB 1HBJA 3IIIA 2JEYA 5ALXA 1XZCA 4B7ZA 1D07A 1XKLA 4FFWA 1A8QA 1WM1A 3BF7A 5K3CA 3AIMA 4YASA 1AKNA 4Q05A 5FRDA 4X6YA 1AZWA 1YS2X 5ALEA 4KYVA 1BEEA 2ZJ7A 2OLEA 3G0DA 4AO8A 1OILA 4DSAA 3ESCA 4F60A 3QMVA 1XRPA 1ZGCA 2ECFA 3TEJA 1EI9A 2WJ6A 3ZLUA 4OYYA 4X95A 1NU8A 1SCQA 1XZEA 2ZSIA 3WA7A 4X85A 2R8BA 3H18A 4EY7A 5FOQA 1XZIA 1EDDA 3AUKA 4EY8A 1YASA 2HHAA 1GT6A 1H22A 5AM3A 2QJWA 5AOBA 1ZI8A 5AM4A 5JAUA 2BUBA 2WM2A 2XUJA 1EA5A 4EZIA 3HXKA 4BVLA 4BYMA 4FDMA 2VATA 1C4XA 2XQJA 4QA9A 4BBZA 1TQHA 1XZBA 2G5TA 4DIUA 2W22A 1THGA 3FWHA 4FNGA 3RK4A 1RWQA 1W4LA 1B41A 4NS4A 4F5ZA 1QO7A 2EDCA 4OB6A 1XRMA 1BCRA 4B80A 1HQDA 4W1QA 4G9EA 4AMZA 1K4YA 2PUJA 3X3HA 2ZSHA 4AX4A 1UK9A 4L72A 3H04A 3MVEA 3P2MA 4CCYA 2XLCA 5DYYA 3S2ZA 4WY5A 4BVJA 2GBFA 5AI8A 2HFJA 3QMWA 1TK3A 5FDFA 4BCBA 5LZ8A 4J7AA 4GEGA 4OPMA 4U2DA 5E4TA 4H35A 2OGSA 3DKKA 3DOIA 3STYA 1E8MA 1BU8A 2BGNA 3JW8A 4UBLA 2WTNA 5HKAA 1YA8A 1E3QA 4ZV9A 2BFNA 4ZV7A 3BDIA 5K3DA 4EY4A 1K6EA 2Y2VA 4WFIA 1XFDA 3OG9A 2H7CA 1CUAA 1THTA 4J0IA 2Z8ZA 2HADA 5I8PA 4Y9SA 4QDUA 3C45A 2Y2UA 5ALWA 1ACJA 2OGZA 5ALGA 1F6WA 4CIAA 4FBMA 4JNCA 4B0PA 3BL8A 3FCXA 3VJMA 3E1GA 3FLAA 2XQFA 3R3WA 3FYTA 3GUUA 5KBYA 1CQWA 3O0DA 4UHCA 1LLFA 1EHYA 3VDXA 4C4YA 1VZ3A 1MAAA 2VAVA 2CBGA 3UUEA 3G9ZA 4MWTA 1JMYA 3VKFA 5AKZA 5JD6A 1XZFA 4UUQA 4YPVA 2WHRA 4XVCA 1CUFA 4B9AA 1J2EA 1U4NA 1EXWA 1GQSA 1MPXA 1TKRA 3DNMA 2C0QA 1FFAA 2P8SA 2WG2A 2XLBA 2QS9A 1LPAB 4F21A 1YA4A 3BDVA 3KWJA 3DOHA 5AM0A 5JD5A 3PICA 3BJRA 4HXFB 5JALA 4UFOA 5K5EA 2HU7A 4MQLA 5ALFA 5HF6A 5C81A 5AIBA 2JGKA 5ALSA 1GZ7A 2XE4A 1J06A 3L1HA 3WYDA 1VKHA 3QZUA 5KWJA 1UKBA 2B61A 4INZA 4KE6A 5BWBA 2HA6A 3FYUC 4IHAA 4HAIA 2I78A 4C4XA 4U2CA 4H0CA 4BTLA 1AURA 2B9VA 5LZ7A 3BIWA 3WL7A 2BAGA 1E8DA 3M83A 1VA4A 1ISPA 1G66A 1WB6A 2XB6A 1MX5A 1K5PA 3STWA 3WWPA 4UBIA 3WWDA 4AB1A 5LZ5A 5A7HA 1VOTA 3G0CA 3WKEA 4KEAA 1U8EA 4K2AA 1LPPA 3D7RA 5AKJA 3LLCA 4Y2PA 5C8XA 3W9UA 1PJAA 2JEZA 3I2IA 3C8HA 4OSEA 1CUWA 3H2GA 4QLOA 2LIPA 3GELA 2PUHA 5IVDA 4GDMA 4HRXA 5A6VA 2FJ0A 4QWMA 5DNUA 4IQ4A 4J0GA 2ZYIA 1CUEA 2DR0A 1BEZA 4H18A 4A16A 4P92A 2YXPX 1XRRA 3EQ8A 1A88A 4J0CA 4DMCA 1FSSA 1W6RA 3G0GA 1CUJA 2WUEA 2WLSA 1FFEA 3D2CA 4Q3LA 5DWDA 2WSLA 3R3XA 3C8DA 3N0TA 4AQDA 2RONA 1ZJ4A 2C0PA 2PVSA 1UWCA 1XZDA 2XUKA 5HCUA 5D6OA 4HVTA 1BE0A 5AM2A 1GXSA 4FWBA 3HACA 1JU4A 3F9CA 2AJCA 2V9ZA 1ZD2P 5EIHA 1LZLA 4WY8A 4BRZA 3WJ2A 2QR5A 2XMZA 5LIPA 3G02A 1QE3A 3I2GA 4X91A 5EHXA 2B4KA 2VEOA 4ZI5A 3R41A 4KE7A 1EH5A 1ZD5A 4W63A 1FJ2A 5ESRA 1DT5A 1AX9A 3VJKA 1A8UA 2OAEA 3HABA 4BC1A 2I03A 1B6GA 5EHZA 5AI9A 4K5QA 3LIPA 4CCWA 1W1IA 4Q82A 1YAHA 3NWOA 1O6GA 4E15A 3BE8A 4J0DA 1E5TA 1WHSA 5A71A 4XIIA 1NX9A 2XQIA 5AICA 3A6ZA 3PI6A 2VJCA 4H7KA 1GQRA 3UUFA 1XZKA 1NU6A 4MEBA 5HK8A 2WHPB 3NOXA 4PSDA 5CT9A 5SYMA 1CPYA 2AJLI 4FBLA 4GXNA 3ILSA 4KJXA 4LXGA 3EQ9A 2ZVDA 1EDEA 4DMKA 3OPMA 5T4BA 1CUUA 4GI1A 1XROA 1CVLA 1ZICA 4LYEA 4X6UA 1CUIA 1HPLA 3G9TA 5FPQA 1GPLA 4QDZA 1LGYA 4UBJA 4BDSA 2FJPA 4RGYA 1BRTA 3V48A 1JJIA 3PF8A 2GBGA 1F8UA 4AZ0A 4BC0A 4EUSA 4BDTA 4L3WA 5C8VA 4BAZA 3GBSA 5K3FB 4W1RA 2VJAA 2WHQA 4A5SA 4FFVA 3QMMA 7YASA 3STTA 6YASA 2VF2A 4ZRDA 4IO0A 3WK7A 4DYHA 2WTMA 3DQZA 1UXOA 1XZHA 2OCLA 4KRYA 5AK3A 1W52X 3I2HA 2EEPA 1GKLA 1XQVA 4JUIA 3FVRA 1S8OA 4BP8A 4CIBA 2YH2A 4WDRA 2ES4A 1QGED 4N8SA 2UZ0A 3M81A 3ZV7A 2H7YA 2CJPA 5DLPA 2D5LA 1DINA 1QOZA 3BIXA 1QTRA 4AO7A 3WKCA 1HDEA 4LKOA 5AKXA 3QPCA 2JGIA 3QYJA 2GBCA 5JIBA 4U2GA 5JASA 4WCVA 2V98A 3Q0TA 1XRQA 5AKHA 2XUIA 4Q3KA 3U1TA 3WKBA 4NMWA 5AM1A 1EB8A 4J03A 1H23A 2JGJA 3BWXA 3H2JA 2WHPA 1W76A 4GECA 4B85A 3HC7A 2PSDA 1QO9A 2HFKA 4G1FA 1IVYA 5HFNA 2VAXA 5LZ9A 4J0HA 2PSFA 2YASA 3ZWQA 3I6MA 4J0JA 3CN7A 3GA7A 1AUOA 5LZ2A 2HM7A 2WFMA 1TIBA 1Q84A 5T4HA 1GGVA 2OQVA 3AIOA 5DTIA 5A62A 3R3VA 3DS8A 4FLMA 1VJ5A 2VA9A 2VT7A 5DNWA 3CN9A 1ODCA 5K3FA 4UHEA 3QM1A 3HI4A 4Y2RA 5ALMA 4LIPD 1LNSA 4H7JA 1SC9A 4B82A 2XUFA 3WYNA 3U0VA 3ZLVA 5A2GA 3AIKA 2YYSA 3OC0A 3BF8A 4BB0A 2FUKA 1UT6A 4E11A 4NVRA 1QIDA 5CH5A 3IB3A 4UBOA 3HYSA 3WL6A 5CTAA 5AKKA 5HFAA 3DLTA 2PSJA 3LCRA 5ALVA 4CG2A 3I2KA 1ODSA 3JYHA 1WCYA 5CT8A 4CI9A 3W2TA 5AI5A 1UK8A 2X5XA 3H2IA 4GBGA 2V97A 2ZJ6A 4Y2SA 4TPKA 3A2LA 3WWCA 3ICVA 3DDUA 3I2JA 3CCBA 4WJLA 2XUGA 5BWCA 3DEAA 2R11A 1DU4A 3DYIA 4DNFA 3H17A 2O7VA 4BVKA 2VT6A 2HA3A 5JATA 1L7QA 5CURA 5F4ZA 4PQEA 1CUDA 3AZOA 1UK6A 1IZ8A 2AJBA 4PF1A 5JANA 5AKGA 5K3AA 2D0DA 2XMQA 1VA5A 1QIHA 5IVIA 1U2EA 4JH0A 2ORYA 1QIKA 1ORWA 3C6BA 3ANTA 3G9XA 2E3JA 4X92A 3WL8A 1JFRA 1CUYA 2JGLA 2XQKA 1XKTA 2CUTA 3WMRA 4B6GA 2Z5GA 3O4JA 1J1IA 4ROTA 4CG3A 2ZYSA 5CRIA 5T4EA 2J3QA 2QVBA 1GPNA 4H7HA 2BUAA 1WPRA 4HRYA 3WK6A 2HDWA 4MJ3A 1CIJA 2QUAA 3IURA 2DSNA 2GZSA 2JGFA 4UBKA 1JMKC 4RNCA 3O9MA 3IUMA 2JIDA 4B0OA 3D5EA 1EK1A 2IITA 3NGMA 5HZGA 4QLAA 1DWQA 1ODTC 3MUOA 4BE9A 3KSRA 1EVQA 2ACEA 3B3QA 2QT9A 4KRXA 2QUBA 4KR0A 3O4HA 2VQ6A 3R3ZA 1QIIA 3WA6A 5FLKA 3PDCA 1H2WA 1YS1X 4NZZA 4G8CA 5LKRA 2HU5A 3FOBA 4G4JA 1ZD3A 1CUCA 2O2GA 3I6YA 5DNVA 5HF8A 3PFCA 5ALJA
chains in the Genus database with same CATH superfamily
3CG4A 1JLKA 3OUUA 5JAOA 1KJIA 3L4JA 1R5NA 4NP6A 3NHSA 2PJZA 2CHVA 4QDTA 4M0EA 1NLYA 5AWFC 3V2HA 4JYZA 1P7CA 2WTUA 3OE7D 5KOHB 3WGHA 2K87A 4UNSA 3RKSA 1CVIA 1IYZA 2B37A 3KBBA 4KB5A 3GJ7A 3L7JA 3ZBPA 3SQLA 3R5HA 3AEQA 2PX4A 3DL0A 1X77A 4F3NA 1J7JA 3LNTA 4A7PA 3BMOB 5ICMA 1LPSA 1D6MA 1SQSA 2C61A 3K9NA 2B98A 5FA6A 1R3UA 1C3JA 2HWUA 4WXRA 3JTEA 4ZZ2A 5IWCA 4Y0NA 3PPWA 1E69A 2VEDA 2NO6A 1NE2A 3L9WA 4IDEA 3ZHBA 1YR1A 3LBYA 3Q8MA 5KTPA 1DV2A 3DE1X 4P32A 4P3PA 1SAYA 4A0FA 1HSOA 1JQ5A 2I4TA 2FTKE 2VRNA 3CR7A 1D6NA 5JVDF 4QTTB 2GD6A 3I3OA 1JFLA 1FTYA 1VJRA 3TZHA 2A5LA 1SVWA 3GEDA 1RRKA 1UPCA 5HHTA 2R4TA 4BATA 3DPSA 1TW2A 3I23A 2Y67A 3ZGOA 1MPTA 3HNRA 1S2DA 1CDEA 1QAOA 3CSUA 2I1WA 3T3NA 1CEXA 2BMDA 5K8UA 3IEXA 1C4KA 3QV2A 4BQNA 2NTEA 2VQFB 2BM8A 3EFOA 1RPJA 4MR9A 1SXQA 1ZA1A 2CDBA 3ZC3A 1LSOA 1YC5A 2UKDA 1ZI6A 1OASA 2HWKA 4U6QA 4X3CA 1W30A 2X2EA 1KQFA 2GR9A 3WGVA 3CLTC 2NACA 1M7HA 2QU8A 2V45A 4BMSA 5JI3E 2WSBA 5LQDA 4Q1FA 1DX6A 2WT9A 2ZT7A 3O91A 1R8YA 3ZD8A 1ACLA 1IEXA 4D02A 4L2IA 4YO8A 1TKCA 3RSSA 4CLOA 2V6IA 1YS6A 3OFND 4MRVA 5AJHA 5JZBA 3LUKA 3FM9A 4KBYA 4OLJA 3H8JA 1OLUB 1QH1B 3UBTA 2QNBA 3ND7A 2ECQA 1I0LA 1GADO 1XHLA 3MGKA 3NBMA 2CNOA 1KHTA 3VC3A 1R0SA 1VE7A 2CLOB 3U7HB 3USES 5ERXA 3S29A 3A05A 1KJQA 2WE7A 3HA3A 1IY9A 4C2UA 2X8LA 3PGVA 3DJYA 3HTXA 2K7ZA 4H7IA 1Y6GA 5KWVA 3LT4A 3E3MA 4X24A 1J9ZA 5K0ZA 1XAGA 3KELA 4F84A 5IAOA 2O20A 4F71A 4D26A 3BTUA 2UAGA 1JIVA 2VQSA 2BKUA 2X40A 2Z6VA 4K9KA 6NULA 3ICQB 3UYLA 1E1DA 3C6QA 4LC9A 4WN3A 4LRWA 2IYZA 2B1IA 3L6OO 4EI9A 4XX0A 2H7XA 1W5BA 2X41A 1WCIA 2GK3A 1RD4A 3PIDA 4B74A 4BGDA 3NNSA 4B3SB 5AHWA 2TMGA 2NNWB 3KEFA 3WI7A 5B64A 2A58A 3MJVA 4HTFB 1TL7C 3QHQA 2ZUFA 5BR1A 4O02B 4BNFA 4Q9NA 1T9GR 2XODA 2Z2JA 4XIJA 4C6SA 2IIVA 4G24A 1Q7TA 1JQ3A 1W6UA 5ITVA 2AKEA 3TZKA 3BZUA 2CWWA 3LO5A 3E4DA 2QTBA 1F8YA 1EGHA 1NW6A 1TM4E 16PKA 1NLZA 4CDGA 2RGWA 4HTAA 4IOKA 4WEOA 5AXDA 5GP1A 2X8BA 3GLHE 5CLFA 4IEIA 1XD2B 2GS9A 2LKDA 3LFTA 1KAMA 2O2SA 4OREX 4E0BA 5IJ0A 2ZJ4A 2HPAA 2Q7DA 3CUSA 3PA6A 1MX1A 2R97A 4H27A 2HCBA 3G2OA 4Z4QA 2W6CX 2YYYA 2GBLA 2Q50A 2YICA 3OJCA 1HA3A 2H7VA 4BMVA 3IP9A 4B40A 1DO8A 1SVSA 4FEYA 3S55A 2DOKA 5BV7A 1YB6A 5BPFA 3Q7PA 4Y0AA 1IOVA 2H4HA 5ALDA 2BT4A 3CX3A 3ENVA 3SGLA 1V5IA 3ZH2A 1T2DA 4J0EA 4B7UA 2XDWA 2YFYA 3TVTA 4C4ZA 3EDOA 4HNVA 5CIWA 2WWWA 5HXAA 3WL5A 2JGRA 2PS9A 1F0YA 5F7JA 1ECPA 2GHIA 3QELA 2SBTA 1Z37A 1KK2A 1PR0A 3GGCA 4TLEA 5D5PA 3BT7A 1JJVA 4XFJA 3JQ9C 3HZHA 1MIHA 3KPUA 4KWHA 1YB2A 3BK1A 3VZDA 5TMPA 4N4AA 1O54A 5ALUA 4DA8A 4RZ2A 2WIGA 1UM9B 3E7XA 2P2DA 2ZXEA 2J9ZB 1RYFA 3MQ2A 3PCXA 1K2WA 1Z39A 2CB0A 3U5ZB 1SEVA 2ACKA 1DIOB 1XQ9A 3RUPA 5IYZF 3KJZA 1V7CA 1YQGA 1E2MA 3QK7A 4G1CA 3PXCX 4RZ3A 1UBHS 2BBSA 2GF0A 1L5KA 4C6RA 3NDBB 1QYVA 2ENWA 3QBJA 4CF3A 1U9CA 1KBQA 3RIXA 1U0RA 3F0TA 3VHRA 2QMHA 2EP5A 1E7YA 1V96A 4ZAGA 3PZRA 3BMNA 1N2OA 5M3BA 3O7WA 2ZZMA 1RP1A 1MC4A 3H1FA 3KK0A 5HILA 4F97A 4CBVA 3S99A 2V8BA 3C7CB 3ABRB 3IE0A 3WB9A 1I5OA 4LI0A 5A3SA 1SKQA 1X9IA 3E84A 4IGKA 3BFKA 3TL2A 4DL9A 5LYJF 2AHRA 3WGQA 4PR0A 4FOLA 2YZNA 1HORA 3WWEA 2JLRA 4D6XA 7REQB 3ILVA 1AV6A 3CHYA 2E18A 2J41A 1LNQA 4MMXB 2ZWMA 5CFOA 3L84A 2PX6A 4UJ5A 1Z5VA 2Q5EA 1Y9AA 3KDAA 4TT3D 4Y2VA 2BHLA 4FQ5A 4IIJA 3R0JA 3JD2A 2GXUA 4GL2A 3NWJA 4MW6A 3VV3A 3HJTA 3LVFO 3FCCA 1WW3A 3PFBA 1WDMA 4RTSA 5DNAA 4CTKA 2FR0A 2AFIB 2VZEA 3TN7A 2AW3A 2W7TA 4LDZA 4ONEA 3V7UA 1GG5A 2OBXA 1FFCA 1NVUQ 1P5JA 1BN6A 1BS9A 1U3TA 1D2MA 2YVAA 3B1FA 3E8MA 5ETJA 3X1MA 4C07A 3TH5A 4ABTA 2RHJA 3WGMA 2QL9A 3LPCA 1OYVA 3X2FA 3E18A 3DE7X 3L8DA 4BLUA 1USKA 1GL6A 1X7XB 4CL2A 4Q66C 4GBMA 2W43A 4HYQA 4K1XA 3IR6A 3L4SO 3A28A 2VPYA 1L5YA 1WNFA 4MUKA 1I4EB 2JATA 2OFXA 2DHRA 2VP9A 3KCNA 3NLLA 1G20E 2P2ZA 4WXPA 2P9CA 4DQDA 4L5BA 3VR4D 3RLIA 1YB7A 3EA5A 4A27A 3TG8A 4IVNA 4GDFA 5ER9A 1G6HA 2NUPA 3ZGLA 3GFRA 3MWKA 3HB9A 3QFFA 2LV8A 5SZIA 3THXB 4G81A 2P2SA 2FZVA 2QG4A 1YS7A 2C1EA 1YQEA 4FMPA 3GIWA 1C9MA 4MWEA 1TJYA 1A4UA 5D3ZA 4QULA 3WP0A 3ZDYB 1YAJA 1U1DA 4BN5A 4GPD1 4QYIB 3PQDA 3CNBA 3ZV5A 1KE2A 4QICA 5ALKA 3OX4A 7MDHA 4FMCF 3O84A 1PVVA 2G9VA 4IJWA 4QQNA 3GWZA 5IMSA 3PJEA 4QM6A 1OI2A 2JBAB 2RGUA 1V3UA 4R1UA 1OXMA 4KYUA 4AQYB 1J5PA 3MINA 3TE6A 4MWBA 2C2XA 1G6KA 3JATA 4NHOA 3HDGA 4IH4A 2OSVA 1LLUA 5KNLA 2IYFA 5JEEA 5IM4F 1XLTC 1IFXA 2PKEA 2WIJA 4XJVA 1DOZA 3I39X 5CPBA 3W2IA 1Z5ZA 3WZMA 1T35A 1CT9A 3M4YA 3IUEA 1B2LA 4EVIA 3WLFA 3JQ7B 1JEOA 2HY7A 3BTOA 4X5OA 1P7YA 3HN6A 2MJLA 5GIPE 3B8HA 1CQIA 3V1YA 5IT0A 1GAJA 3O8OA 4AC9A 3L6EA 4WN9A 2VRBA 3KU1A 3L8FA 4ZJZA 3FZYA 5J4YA 3ONEA 4HDSA 2MYNA 4LXUA 4H6WA 1XA0A 3KSZO 1OWNA 2AK3A 3LZ6A 4R1PA 4HLQB 4QBTA 2YZ2A 3T7CA 1BMDA 2Z5FA 2Y1GA 3UVEA 1YZVA 5EA2A 4B8YA 3JRNA 1ZHHA 2CJFA 2A9JA 5AHXA 5I9NA 3NVMB 1USWA 5IT5A 4ZEXA 4HH3C 5KQMA 3D59A 5SY9A 1UDXA 3IUJA 1M6VA 1TMKA 2PKRA 3R20A 2JJMA 2YWXA 4M22A 3OZCA 4TV9A 3CYFA 5B1EA 3RC1A 3Q8XB 4BCDA 3DGFC 2OBNA 1V45E 2ICAA 3WK5A 4X41A 4BC0A 1W0JD 2CK3A 4I3FA 1MJNA 5EZ5A 3UAXA 3ELYA 3TR6A 1OH5A 1X8XA 4R4JA 2PL5A 5ECWA 3ZDDA 2DU8A 1AXGA 3OTWA 1QO0A 2WKRA 3DL4A 1Q0ZA 1DT3A 3DTVB 4Q3NA 3HVJA 1DC4A 1GFIA 1WXXA 2G6TA 2OGTA 1RJWA 4URZR 3FPFA 5EHQA 4BE7B 3A1TA 4ENUA 4I4CA 4IS2A 2PMDA 2JBWA 1TO2E 3O2SB 3WK9A 4UQPA 2J9XB 2B1QA 1PYOA 3GFPA 4HAWA 4HQ6A 4GX5A 5KYUA 1HTTA 4S0XA 1EGMB 3RYIA 3TTYA 1PGPA 5E4YA 2V0GA 1NYLA 3ZJTA 4WKNA 2Q5HA 3H97A 2Q3EA 4LYJA 1J4AA 1JR3D 5CDHA 2PL1A 3V1KA 1R4ZA 4RYDA 1M5UA 2C57A 4IFIA 3R3SA 3RG8A 3WIEA 1UMKA 1ZM9A 3GL9A 5HE9A 4BFLA 2AOUA 1BWRA 3DM5A 1C3XA 3R5JA 4P3YA 4KQGA 1US8A 3RIHA 1VE1A 1SB9A 4NESA 4LJRA 1E2HA 1UPAA 1I32A 2CEAA 5ALPA 3QVSA 1TJ4A 1MN6A 2UUOA 4FFBA 2H5IA 4HN4B 4QXAA 4RK5A 4RK7A 4W1SA 5BSEA 3ND5A 4B3GA 1EG7A 2AEEA 4NYJR 5K0LA 3TSYA 1T3SA 1S96A 2J0UB 2JFPA 2Z9BA 3D5TA 4JQYA 4OXQA 2IUUA 2WJ3A 1A2QA 1V9CA 3M2TA 4O2BF 4KQFA 1SVIA 3W1WA 1KE1A 2FOXA 3KKEA 1AGYA 5BSRA 1SRRA 1HGXA 2VWGA 3DT8A 5FB3A 1U80A 4M0PA 3S1AB 3WNBA 3V8RA 2PX8A 3MRTA 4D43A 5LDDC 5BQ3A 4NCAA 1Z0FA 2GZRA 1B3RA 1UC9A 2N9UA 2PSEA 2YWGA 3E9NA 3LECA 1F51E 3NC0C 4N7MA 5CW2A 4B76A 1EBBA 3AZPA 4KAJA 1KDPA 4ZT5A 1H2RS 2ZRBA 3K05A 3SU8A 3U0BA 4FFPA 1M34E 2DPGA 2HWXA 3RTEA 1EX1A 2CFRA 1BE8A 4DXAA 4LDAA 1G9TA 3DR3A 4CL8A 2ZP1A 2F3RA 1AUPA 1UBSB 5L95A 1HTWA 4RE6A 2XRFA 5HMLA 2PD3A 4LYGA 5TJ9A 1E79A 2FPMA 1RWMA 2HA7A 4I55F 5JH7B 1VYHA 4FP9A 1X1BA 4L0CA 5B4TA 4X90A 2IC5A 4FE3A 5CA0F 5EXPA 1RQPA 2HF2A 4CMCA 1DVRA 2D2XA 3I04A 2JD1A 4KRGA 4MEJA 2R87A 1SG9A 4OU4A 5MN4A 1G4UR 3EZ2A 3RHFA 5L6LB 4C7XA 1WB5A 3U62A 1F8FA 4NULA 5I48A 2OCKA 3ZE8A 2GK4A 3K2IA 1NONA 3CEAA 3KVRA 3M3HA 2VHUA 3OHPA 3ZW8A 1DBRA 3FOWA 5JS1A 2NO4A 3UH1A 1IB6A 2WWGA 3PI7A 4MH0R 4MVJE 4C7OA 5CJ2A 2QSUA 1DMSA 1MB0A 4MTLA 2FFHA 1K7EB 2VXCA 4HNAA 1EP3B 3REOA 1HNWB 4GC9A 1ZK1A 2ZCVA 3ZBTA 3BTVA 4P35A 4RC9A 5FXMA 3KTDA 4NQRA 5LFAA 3W7BA 4KXYA 3RPEA 1ZL2A 1JA0A 2DFPA 3GRAA 1XNHA 3G9UA 2A7XA 1PG2A 3HSKA 4MVYA 3IAEA 5LIRA 1O6FA 3BMCB 2CEKA 4IVPA 1OA1A 1HDRA 2XCLA 3OZUA 4FGSA 4RJIA 5KU7A 1Y9EA 3K5WA 4QTXA 3AEKA 2R7NA 4PO8A 4ZO4A 3UV7A 5ABPA 2NYAA 4J2HA 4FEGA 4P31A 4H6VA 4LSGA 4GVPA 1KGSA 5EWMB 2ZS7A 4IXNA 3ZGXA 3KFVA 1TEVA 1QKKA 4U02A 2WIAA 4R40A 4TLBA 5TX7A 4KZKA 4Q4AA 4DUGD 4P7JA 2W4MA 4OUKX 2D3WA 5DGDA 4ZOBA 1HO3A 4PONA 4Q3CA 2XMGA 3VSBA 1LLQA 3F4LA 3H11A 3IBGA 4WE3A 1YK1A 4DA0A 3L5KA 4U9UA 3VPCA 2WIDA 2WAAA 1PKXA 2XNHA 3E22B 3EISA 1BA3A 4L95C 4LC0A 2GXAA 1N5DA 4L73A 2C4HA 3IIKA 3H5WA 3WYFA 2R8EA 2XVAA 3BD7A 5A3VA 4AKTA 4L9SA 3GP8A 5FD8A 1CE8B 1T5HX 2BWJA 3L0BA 4ITRC 4LYAA 1E4YA 2AS0A 1QPGA 5T67A 1ZBQA 5EESA 5FO0A 4C7MA 1ATIA 1OAOA 1BJTA 1BE1A 4XA8A 4BRSA 1YI8A 2Y4OA 3FJOA 3BHMA 3B1WA 5E9JA 3C6MA 5CLGA 2EFEB 1SZDA 1WABA 2OHGA 4OGKA 1E3SA 1V9LA 1QV9A 1DAKA 1VG1A 3WNQA 1KF0A 3CZ5A 3PPXA 2FB9A 3GT3A 5LP6C 4D9EA 2XW6A 5E7MA 1MO6A 1X15A 4EPYA 3H83A 3NHJA 3C74A 1H2AS 3OE7A 2RIRA 3ZKAA 1I7QB 4FYKA 3FNRA 1D8AA 4ZVNA 1ZCFA 2BGKA 5A7FA 5CXQA 1KEEA 5J4KA 4X6XA 1JH8A 5JAQA 3TZBA 3MD9A 4W5RA 3A1FA 1MT0A 3QKUA 1G18A 3ZK7A 5J4HA 3TCXB 1IXRC 2Z9CA 2A9RA 3HY6A 4W82A 1N9GB 5IHXA 3JQDA 2FEWB 2FG5A 3EW9A 3CR3C 3EXG2 1TT5A 1JIJA 2ATCA 1KNXA 4Z8YA 1F48A 3B48A 4MV0A 3S2GA 5C8YB 3EGDB 3UJ7A 4O3FA 1QH8B 1X2BA 5AW5A 5IWAB 5DM2A 2OZPA 2NZVG 2BGLA 2XXJA 1GPDG 4M76B 3I8OA 4ZVPA 2XVMA 2H2DA 2V7UA 5FTNA 2FG6C 2VVTA 4JLDA 5DX0A 1DOAA 3M3DA 5KI6A 4K6GA 2ZAGA 3SEAA 1M2JA 4KQIA 4CM9D 3PPVA 3SC3A 3FTEA 3DBLA 3PYLA 3IT1A 2E4VA 1MORA 1R5JA 1C0PA 2EP8A 3OWOA 4Q9IA 3T7AA 2XECA 1J97A 1PR9A 1ZSVA 1CTQA 2BEVB 5LP6B 1QLWA 2OHVA 4GM1A 1QPZA 4MVJD 4HY3A 2KI5A 4YMHA 1M2EA 2CUNA 2I2WA 4RUKA 3OQOA 1KH3A 1J2RA 1RABA 3I04M 5B1YA 1S4QA 2FUEA 2H51A 4MYUA 5K05A 2P2CA 3SSMA 2AMLA 5ED0A 1XVUA 5CM8B 4BB5A 2B6HA 3V4SA 3G7NA 1SA0B 5AVTA 1NXTA 4LHYA 1GNPA 4LQ4A 1AN0A 1WZEA 3EXHB 4FLFA 3FPHA 4N3NA 4R1MA 3VR1A 2HJGA 1T6ZA 2X13A 4YAJA 4DBZA 3LP6A 2O3RA 2J4FA 2JGDA 3FGNA 3OFNA 5DMXA 1Y6ZA 2D5BA 1Y7HA 2NUAA 2C4MA 2ZSKA 1RQXA 4M88A 1IAVA 1DFHA 1G5IA 4NFHA 3S1SA 2RKWA 2F00A 3IO5A 3KIPA 4RKFA 2PRKA 2BKVA 3SKXA 2ZREA 2AOTB 1ZG3A 1ZW6A 1V35A 3N07A 4QWWA 3VZPA 4WKPA 1GUBA 4EKDA 5E6SB 1LKZA 2JRLA 5KVQA 3T7TA 4BXOA 3RU3A 1C7EA 3V2IA 4AY4A 1X2EA 1ZUIA 3PVSA 1AK1A 1E7WA 1JG6A 2BCEA 1IRXA 3N7TA 4NU0A 3TNLA 2ZQYA 4EJ2A 5BWLA 5HJ2A 4KGZA 4AX8A 1JAHA 1F4PA 1PFWA 3S44A 3W8EA 2C0CA 4K9SA 3H6HA 4BO0A 3N2GB 4MIOA 1SCKA 1WW8A 1YU6A 1D0IA 5CFQA 4EDFA 2I9KA 2D1FA 2GILA 3OA0A 3JQRA 1I51A 4INAA 4XPIB 3HLKA 2JFWA 3PGA1 4LAFA 4LHEA 2FRVA 3AYZB 1X1CA 3WFJA 1IHOA 4EMTA 1BQEA 3IDAA 1NI3A 3L8ZA 1H0HA 2H2IA 3J7TA 1H2ZA 2N3ZA 2PRSA 4GT1A 4LSZA 4REQB 4ALIA 221PA 2XWJI 3RRFA 2XUOA 5A9RA 1E7SA 3P5SA 3NHYA 1GT91 2X5JO 1PE0A 1NZJA 1PUIA 1T4BA 2VJOA 2ZRMA 3HBLA 1MFPA 4GRDA 4PE5B 4XM2A 5ESXA 4ZVOA 2FE4A 3VVBA 4ESHA 2BMAA 2ZI4A 4Q3BA 4KPUA 1R6VA 1IUNA 2UUAB 1R1DA 4DLBA 1JG4A 3I73A 4I9NA 3T0IA 3LVRE 1CF2O 2Q6VA 3QF7A 2HT1A 3ZKWB 1GD1O 1IXSB 1E99A 4M53A 4BKRA 1ONBA 3OTHA 1CSEE 3PZBA 3IRUA 2P9ZA 3SK0A 1DWOA 1T3LA 1U6KA 3EG9B 3OP1A 2FR8C 1EE9A 1KK1A 3B3AA 1PF7E 4GAEA 2CW5A 1AU9A 1BDHA 2XMRA 4I4NA 3HEAA 4FU0A 4MGZR 4PG7A 4X9XA 4ZRNA 5DLQC 3ITNA 2W70A 5D8DA 3L1JA 2OILA 4LGYA 2QGNA 5AKEA 4YP6A 5KOIA 2AC2A 2YS7A 1YJQA 3WWDA 4P7BA 3NKLA 3HUEA 3AGPA 3KDPA 5KKAA 1BVHA 1RI2A 3R6GA 2ZTMA 5JG7A 2O5EA 2PM8A 3HXTA 3MTEA 1U8TA 2GTPA 5DHRA 5TV2A 1OB2A 3TQTA 4CEIA 5F52A 3RKUA 1VRWA 1Y8CA 3JASA 2JJ2D 1SU7A 3K0CA 4EX6A 1M8KA 1NW3A 3VAZA 3VYVA 2IHKA 1VJCA 1JHQA 3JQBC 1X7YB 4IMJB 3RI3A 3WICA 4EPTA 1JHUA 4WOCA 3MWEA 4IH1A 3RANA 1FYWA 2ZBDA 3IHLA 3LXRA 1GG2A 3A6JA 2ZVPX 3CKKA 4GQAA 3O95A 5TQ2B 3SS8A 1Z2NX 5HS6A 5JYDA 4DGQA 1TO1E 5AW9A 3J81k 4JUAA 1E59A 3W4JA 2XDAA 4MUBA 3KZCA 4YJ3F 3IBTA 1WUJS 3ESAA 5JWHA 3PG5A 4MEAA 1CV2A 2IYOA 3D3EA 4GYYA 1A2KC 4DTCA 4KHPB 2GOYA 2CHQA 3F5DA 4OK5A 1Z2PX 3LYHA 4DQVA 5LUAA 3NIGB 3P0FA 5BQXA 1Y6FA 4BE4A 1EGVB 2GT1A 3GC6A 3JWJA 2WG0A 1COZA 2GYUA 3GCWA 1GDTA 4OF4A 2PQ6A 4P22A 4M1SA 5TJHA 1ZGBA 2GDZA 4IMPA 4HWOA 3LW7A 3IMKA 2JCBA 1NVDA 4MYSA 1C9YA 1G3UA 1IHDA 4RLQA 4HNUA 5C4IA 3ABSB 1LJ8A 2JCGA 1TD9A 2QN1A 3D02A 3GHHA 1WKBA 1GAWA 4NR0A 1PR1A 3D5QA 4TT3A 5FKJA 1CF4A 2WRZA 4B3XA 4ES6A 3OT5A 4R01A 2RHGB 4CIDA 1HT1E 2G1KA 1V11A 2PJRA 3ZV4A 5I7HA 3QYAA 4FOPA 4WQMA 3UMRA 3IAM6 1H6DA 4HDMA 2JAOA 4JJFA 4RY9A 1A9XA 4RWZA 3RRYA 5ISMA 3ZXYA 5K0CA 2Q5CA 4AD8A 3C7AA 4JEMA 1AGXA 1KFCB 1ZGGA 3HEBA 2VT2A 1DAGA 2AX4A 3DVAA 4LNHA 2NZWA 5DBIA 2Q7XA 5JS7A 1XQYA 3NTRA 4FFLA 5DYWA 5THQA 4BMNA 3NHFA 4Y1EA 5KHOC 4DKXA 1S6YA 3OURA 3JQEA 4ME6A 3TW8B 2IH5A 1H66A 1TK9A 3MMXA 4F8EA 3NIDB 3EX7C 4OMUA 2FQ1A 4GUDA 3UOWA 3W34A 1MA0A 1I4LD 2WT8A 4KE9A 1A9RA 1DHRA 1YSCA 4HFJA 1LW6E 5BSUA 1T9GS 3I5UA 4L02A 2XUHA 2QRMA 2Z43A 3RYFA 2GCPA 1UKAA 1RWKA 3QKRB 3VR4A 2VTBA 4TN5A 3GCZA 3TIXB 2ATXA 4RZSA 3NTLA 5G4KB 4KOEC 2O0MA 3DE2X 2QW0X 3W5VA 5KZMB 2GAFA 2G5PA 2OHHA 2PMCA 3D4BA 3MT9A 2H1RA 3VX4A 1RC1A 2ZJ5A 2BTOA 3EHEA 3FDFA 2A2ZA 2QB5A 3CO0S 4IWYA 4EDHA 4ZVKA 2GCGA 1F2TA 4N9QA 4H7EA 3PFKA 2C94A 3D4OA 3BH6A 5LWQA 3HVIA 2PVPA 4HATA 4BFZA 1E3MA 1MJGM 1WDTA 3BMXA 1CS0B 4DQLA 2D2EA 1DKRA 2NTJA 3BWMA 3W1VA 3M4ZA 1B8UA 2P4QA 2V03A 3C6YA 3IDOA 3H7IA 2J8ZA 5H1YA 5A05A 2QQ0A 1XEFA 4YLGA 1TAUA 1EJ2A 1NI4A 2WA1A 1W5SA 2V9PA 3TBHA 3TLZA 2RK6A 1PUXA 5IEJA 1EDBA 3PX7A 3ZXUB 4K6FA 4GHWA 4HQNA 2WUGA 4MP8A 1MNQA 4W8GA 3VX3A 2HZBA 3JQGB 4QUHA 1KORA 4DCSA 4DSOA 1K3UB 3VUEA 4AJKA 2MYUA 1G4HA 1GL9B 3E7WA 2WMDA 3CVUA 2XTMA 3Q1LA 2HIHA 2R6HA 1WX1A 4N82A 1ISSA 3OX2A 4R3WA 5AM5A 1MO3A 1TLFA 1UXGA 4BGIA 4LBWA 2OZEA 2VPQA 1G59A 2KJQA 1ZIDA 1T2VA 3F97A 1SJ9A 1JH9A 4TYWA 5HJ7A 5KOJB 1CQPA 4N0QA 2QW8A 4V03A 4MZDA 1I5EA 5LLTA 1K8YB 1JS1X 1XRNA 4JYCA 5K9ZA 2QRKA 4IDOA 2AQIA 2GEUA 2AUNA 3KXLA 4U7GA 3VKVA 1ZONA 2H1IA 1CZLA 2XTJA 2ZEJA 1RT9A 4O4IA 4NENA 3DMRA 2HEGA 3DEKA 2HPVA 3RRXA 2EFGA 1C29B 1QC5B 2IZ0A 4WRRA 2CNWD 2YWRA 3BRQA 3ZV3A 1IRIA 3SBEA 4QQKA 2GCOB 4BMXA 5CNJA 4DYDA 3CVWA 5ALOA 3GEMA 1K86A 5EJIA 2VTDA 1XVIA 2OUKA 1W0JA 4AI6A 1SKBA 1ZVMA 4HWKA 1AB6A 3C16C 5CDYA 4G37A 1M83A 3MTQA 3SDBA 1YFZA 4UW9A 2YWDA 3K6JA 1DG9A 3A1NA 3JVIA 4RW0A 5DTJA 1JEYA 721PA 1IN7A 2NW6A 5ICEA 5BSHA 3KEGA 3LKDA 2XE6A 1JX6A 2EATA 1XTKA 1KY2A 5DF1A 3EIXA 2UZ1B 2D5IA 5HE8A 1CQXA 3T7SA 3IEMA 10MHA 4HPXB 1E2IA 9LDTA 2XD4A 4IJUA 5K01A 3LX4A 5I9MA 1JFFA 4EEKA 2PRZA 2XMBA 4LFCB 3V97A 3T9FA 1DEHA 2B92A 3GOHA 4JK3A 4OKNA 3P2EA 1JR3A 3GRFA 4F06A 2C8JA 1GWNA 4LJ7A 4ZI3A 4MINA 3HYRA 1BS1A 5EP3A 3ZZNA 4MLCA 3ROMA 4J29A 1U8AA 5K45A 5AK4A 4C30A 4YLYA 2E48A 2QYOA 3K6SB 3HJAA 2DKFA 5CFLA 1OIXA 2XMCA 1F4VA 1SOMA 2OG1A 2ZBGA 4UVIA 1JE0A 1M75A 1W36D 1NWCA 4B3CA 5ED4A 4P4LA 3ZR4B 4C87A 2PYZA 4RK1A 3BPSA 4WZBA 2EGHA 1G20A 4EHDA 2Q8QA 4MRSA 1BWQA 8ADHA 1I9GA 1FPMA 4ZICA 4ED9A 4UXJA 4GKVA 4PNZA 1V1RB 1L1QA 1TMYA 5BR8B 4DV3B 1LF0A 3NV7A 2OEPA 2VK2A 1H69A 4ZJPA 3GJ6A 3W3ZB 3KXDA 3TQIA 2P30A 4WVLA 1SHTX 2JJ1D 3ZOZA 1N5IA 1RHJA 4BUJA 2GVZC 2EZ9A 2C84A 2NNLD 3G49A 3AF5A 3QVOA 2X0DA 1H9AA 1YE8A 2XYRA 5BMVB 3GAMA 2WQ6A 3CLHA 4LJSA 2LE0A 2JIPA 1Z26A 3BH7A 2NUBA 4NAUA 4N3CA 1WOMA 5L3RA 3OJ0A 1SRQA 3AU8A 1PQYA 1BX3A 1OI3A 2I6TA 2REQB 2H54A 3NIBA 5A9SA 4LECA 1FNDA 5GIOE 3DD5A 2A9QA 4JJZA 4RD2A 4Z4FA 3ORYA 3ZUPA 4W5OA 5LJLA 4LCEA 4O4HA 4TGLA 5I8PA 4YRGA 3F46A 2GI4A 5J9FA 4RL6A 2ZT5A 1KTVA 3LPMA 1XR3A 2NIPA 5CHYA 1XZMA 1JXQA 4UAGA 2NSDA 3CLUD 4IHKA 4R1QA 4RKRA 4DJTA 4P38A 1NURA 3L7MA 1ESDA 4MUHA 4W1PA 3WDSA 4B6RA 5AVQA 5IZ4A 1W8DA 1YBHA 3KJGA 1YCDA 3GPIA 2QY6A 1FUYB 4CM3A 5I7VA 2W9XA 3IULA 4FMDF 4G5HA 3KQQA 4HSGA 2B78A 5FQNA 1R0XA 3OZBA 1QF6A 4N40A 3I09A 5LXTF 1KU0A 1FJGB 4NH0A 4JI3B 4ZIRA 4YRSA 2WIKA 4TLAA 2O2EA 5ALLA 1TYEB 4Z4IA 4N5LA 4M9CA 5A4DA 3USCS 1U3VA 3G2HA 2XA9A 1CUZA 3GQBB 1NWHA 3TUZC 4W9MC 1Z83A 4GFDA 3HUFA 2J9FB 2JFFA 4ZPJA 1J70A 1VFNA 2OXCA 2O8FA 2P1RA 3ASUA 3BHJA 1ZHFA 3Q7SA 1FVOA 1A50B 3O03A 1JFTA 2XWPA 2FKNA 1JP7A 3V5NA 3E15A 4E5MA 1P61B 5E6UA 2J3DA 5EIAA 1THMA 5TF0A 5HK9A 2DFKB 3ZQJA 3FNBA 4D4HA 5E9AA 5FBQB 1QFMA 1ZSYA 2WIFA 4JJIA 4BQEA 5T4FA 3Q8WA 3QJGA 5DTMA 2ADOA 2AZXA 2DB3A 2QJTA 3SNKA 2LXNA 2Z6QA 2J3KA 1WBJB 2FGJA 4NCHA 4OB8A 3A2MA 3ZDCA 4JU8A 2QAJA 2PLRA 4DDWA 3ZGYA 4N47A 2C04A 2QNRA 1TM1E 3IDQA 1GKKA 4HQKA 1ILWA 4DUGA 3UOAB 2W11A 3D6UA 3ECSA 5FYQA 5H82A 2YOHA 3UUGA 1NW7A 2C07A 3QE3A 1F0PA 2PNJA 3WE7A 2VDUE 1B7GO 1TPYA 3OT1A 4LRTB 2EVWX 4CKEA 3QGMA 4LV6A 3WK4A 1N6OA 5KPDA 3OLCX 6REQA 4DXHA 3CRNA 4OD0A 4UNQA 4IJ5A 1Y63A 2VXOA 5D7BA 5L51A 1PS9A 5TARA 3R3HA 4UMFA 4XSVA 4D82A 5JQGB 1V4VA 4IKEA 4B81A 5LVAA 1NASA 1A4XA 3EQ2A 1N2JA 2O0KA 5AP9A 3FUXA 4D9BA 4MYHA 1N0HA 4JOCA 1L5NA 2G09A 1JJAA 2VHTA 2E21A 3FWKA 1Q1NA 4N9WA 5G0UA 3WWZA 4K88A 1FEZA 4XYEA 1SC1A 1XZQA 3KT8A 3FR8A 3Q4GA 5SYNA 4WEQA 4EBBA 1ISMA 3R9XB 1TYZA 1EHIA 1EFLA 1ZIOA 4A8JB 3FROA 4CM5A 2C78A 1DLJA 2R1TB 4HRVA 2OKCA 2XCOA 4YVFA 4J49A 3WADA 1AF7A 3DMGA 4Z3DA 1A98A 1ZC4A 4NARA 3PB3A 3NGLA 1QCDA 1FTQA 2HRQA 13PKA 3L6BA 5AK6A 1SU6A 2F62A 4XLTA 1M6YA 4D3FA 1YCFA 2E5FA 3U49A 1PV2A 4G1MB 1GLGA 3T5PA 3WGOA 1BHJA 5LD2B 4US0R 5TDHA 2WE8A 1Z4MA 1TZCA 1L3CA 3TLJA 4MVJI 3ACDA 2JLBA 1PFVA 2I66A 2WKPA 3IAFA 3Q3EA 4HDRB 5DXAA 5IJXA 1MZPA 3N2NA 1YKFA 2EZ4A 4TTJA 5I9BA 1FNNA 3DFFA 1GSHA 3ULKA 2FRDA 4YASA 5DBOA 1XU9A 3C4QA 3VOAA 3RV4A 1CIVA 1VGRA 3MYRA 3OCCA 3LCVB 4M6WA 4QNRA 4IXDA 2Y0PA 4Q05A 4ZVRA 4LZAA 3ZGNA 3T1OA 4ODIA 2XB4A 2C00A 5CA1F 1NMQA 3H9JA 3ZWAA 3EWNA 1G6OA 4GIBA 1YS2X 1ODLA 1J8MF 3P5BA 3U44B 4CM9A 2AFIE 2PD6A 2ZTSA 3K1AB 4RTPA 1XXLA 3O0TA 4KLRA 4WK6A 4MKRA 5FFFA 2BF7A 4RIFA 1QRSA 3OTOB 2OM6A 3OMLA 4MOWA 3U48A 3G0DA 3ENKA 1S3SA 1KSFX 2HD4A 2P11A 3FDZA 4MVJA 4TKZA 5FF9A 5ITZB 3BE6A 5JBNA 1E2JA 3ESCA 4OQEA 3W8RA 3QMVA 1XCLA 4JP2A 4YV7A 1DKNA 1ZUNB 2ZSJA 3PFGA 1G60A 1EP1B 1YT5A 1QYWA 3CLTD 3TXXA 1S2GA 2ACWA 5TVGA 5B7PA 4UEOA 2I3BA 1C1DB 5FUYA 1DAOA 4RDCA 2WJ6A 1QOQB 1AS3A 1L4LA 1W85A 2WKSA 4OYYA 4PNPA 4X95A 5D1NA 4MO2A 4WPGA 1K6XA 3TECE 4Z0NA 5EP2A 3VSCA 4AIIA 4O2AB 1XZEA 3QU5A 3DVQX 4HPJB 4N7RA 3RNLA 5CX4A 1C30B 1YHNA 2GPAA 4X85A 4PFSA 5FOQA 1D9ZA 3D3WA 3LGXA 4YCLA 1HDXA 3INTA 3W6PA 3TAXA 4ZT4A 3ECAA 2WTAA 4TMTA 2PZGA 3KCQA 1OBCA 2OXTA 3W5HA 3ZCTA 1W5EA 2M6LA 3GBVA 2EJBA 3GARA 4LEIA 2QJWA 5FI5A 3OHMA 5AFSA 2ORWA 1U0LA 2FQWA 4HJRA 5IKEA 3KTOA 3Q87B 4IOJA 2XUJA 5B58T 3BZWA 3VPAA 2UVQA 2AN9A 2JIBA 2Y66A 3KZNA 1OMOA 2JFVA 3QY9A 4BVLA 3OCJA 2B25A 4QPPA 2UXBB 2OB1A 2VATA 1H1LB 3A7DA 1W2GA 5BT8A 4ZDIA 3URKA 2D13A 2FSFA 1GEGA 2YUIA 1TCUA 1XN1A 1NQAO 1TQHA 2G9ZA 4GYJA 4IICA 4CV2A 1XZBA 3SOPA 5I4CA 1U5BA 1YMVA 3IGFA 3GJYA 4Q5IA 4D0NA 3OMXA 5A4IS 4GZ6A 3PD1A 4W99A 3E6AA 1VMAA 4FGLA 1NIPA 2G17A 3V46A 4TQAA 3EFEA 4FNGA 1M2FA 1YTUA 2WYIA 2ZYAA 4HQOA 5LBUA 1RWQA 4U7JA 4F2WA 2VQDA 3V3KA 3ICOA 3U6BA 2ID7A 4ZO6A 2ZPTX 1USGA 3R7BA 4JXZA 3IAM1 3TO5A 2Q1UA 4QT0A 3QPWA 1FYFA 1OAAA 4B80A 4W1QA 1VJTA 2HK7A 4OQZA 3HCAA 1Q57A 5DO9A 5GONA 2KLBA 2H18A 3EWIA 2C2BA 3MCUA 4JAVC 3RU7A 1GGNA 1UPTA 4OQXA 1K4YA 4HVLA 3OPYI 3F5SA 3I1FA 4TV8A 1Q91A 3ABIA 1Q6ZA 3CSSA 3LBAA 4JEUA 4BPRA 4E5DA 5EIWA 1QP4A 1A9TA 2VWHA 3GUVA 1II8A 1G55A 3P4XA 4U6NA 3KPYA 1QE0A 2VSXA 4DQ0A 3DZCA 4CIVA 2RHOA 2E4AA 1EVIA 3ORRA 4QAJA 4AX4A 2DY0A 4JXJA 1P8AA 1OPXA 2CXOA 2AC4A 4ICIA 3KYCA 1F2UA 4X3OA 2FMIA 3P2MA 3O8NA 1ZZGA 2HLNA 4CCYA 4EKIA 2RKOA 4WY5A 3VI3B 3WLJA 2UZ4A 1QHNA 5AI8A 4DRXB 2VDWA 1OWLA 1NG9A 3AR9A 1KVRA 2C2MA 1GP2A 1ZH4A 2OP0A 2QAGC 3BH0A 3CQ9A 3RC9A 2JJ2A 4H3HB 1P9NA 3MGGA 4Y2GA 2V0CA 2WU1A 2YTZA 2IYXA 3B82A 1T3GA 1ZLXA 4D8VA 5LZ8A 3WLPA 1IOWA 1DWUA 3OPYA 5BOSA 5E4TA 2PWZA 2ZYUX 2RG7A 2CNLA 2WTXA 1A8PA 3DKKA 1TUGA 2BGNA 3OF5A 3HHEA 3NVDA 1IPEA 4ZV9A 2VNIA 4AWBA 4IL5A 2BFNA 5K3DA 2X6TA 3NTQA 5J2UF 2Y2VA 1ZNQO 1GAXA 4BX2A 1TQ4A 2NVUB 4WFIA 3NT2A 5IC4A 1JQDA 1XFDA 3NALA 4ARZA 1RXVA 1N2IA 4M1MA 4DMLA 2C96A 4Y6OA 4D74A 4E5NA 2QMUA 4X1OA 4G5QA 5TGZA 1E9RA 4KQHA 2OV3A 4GMDA 1FUUA 1V41E 2QEQA 1PFUA 1O5TA 3R0QA 4J0IA 3TQFA 4BB6A 4BEJA 1PNRA 1PZMA 1R8JA 2HADA 1W4BA 2HX1A 1QK5A 3F74A 1FFXA 8OHMA 3FMOB 4UVHA 1HQYE 5IFKA 1N8NA 1U2GA 2O3SA 1H4TA 2Y2UA 5ALWA 2XAAA 1QHHA 2QAGB 2WF7A 3AOGA 1X1DA 3K0EA 4GLFA 2IVFA 4FBMA 4JNCA 4ZKEA 2WJWA 2Z3VA 4YP7A 3CX6A 3QP9A 3NWEA 4E08A 2VJMA 1JZQA 3N75A 1SK9A 3VJMA 1NVWQ 2RGXA 1E0JA 5BN5B 4PG6A 1MJFA 3KUKA 2NAPA 4OBEA 4ZMRA 4G1EB 4J0FA 1ZUD1 3I58A 3GUUA 2H9AA 4MQ5A 3UMBA 5KBYA 3I5XA 1CQWA 1MRSA 1IBLB 1KOJA 1TU3A 1VPEA 4ZCTA 3VDXA 4C4YA 3GX1A 2F8TA 2ALJA 1HT0A 3OZFA 5IBPA 3ZCUA 2KX7A 1CC1S 2KS6A 2FDRA 3JALB 4KQMA 1DX9A 5FV7A 2JFBA 1YB4A 3P26A 4LTMA 2MSNA 3VKFA 5JD6A 1PEAA 4MQ6A 4CMEC 4I50A 1XZFA 3VUFA 1WQ3A 4D5EA 5I7FA 4YJGB 3BIJA 4J3FA 2XNKA 4YPVA 4ARUA 3NT4A 4QXPA 3L7OA 5KTSA 2YV5A 4PLCA 2XKKA 2VWQA 2OO7A 5B2ZA 2ECPA 1VCHA 3N6XA 1YZUA 2QL5A 3A4MA 1I10A 3NHBA 1GQSA 1OREA 1P1JA 3HMKA 1MPXA 3EIQA 3JQAD 4FW8A 2CMGA 4NRDA 2F90A 3WSVA 2OXFA 1MF7A 2GHQA 5E9WA 3UUWA 3QNUA 4PIMA 1F6DA 1Y1SA 1ZA2A 2EGUA 3KV1A 4ZI2A 3UFXB 4OHKA 3T54A 2XBUA 2C0QA 2JFNA 2XLBA 4PLWA 5DB4A 2QS9A 3S3TA 5KYVA 3ROPA 3CNNA 5CYOA 1JXMA 2NU6A 3K7EA 4R2IA 3IHWA 3OO0A 2QTCA 3EUFA 1R2QA 1DC5A 2XZOA 4LBZA 1QP7A 3REQA 4KJZA 3U7IA 5A3JA 2WEKA 1D2HA 3DQPA 5CFZA 1HOTA 3UWPA 2Z30A 5DH9A 4YP1A 1NNLA 3BJRA 4PZ0A 2IVZA 3CUVA 4KDFA 1D5CA 5JXHA 5F9HA 2BTQB 4UFOA 2EWMA 1NOJA 1RYBA 1U0JA 4KCGA 1IM2A 2PZ8A 3LX5A 4UC0A 4O3MA 4X62B 1G3RA 1RFLA 1DELA 2GVNA 5FOWA 3MRSA 3DOCA 4NH4A 1NY5A 2VYQA 2XE4A 1ZW1A 1EM8A 4IHJB 2V7VA 3BMQB 4CM8B 3GLGB 1U9ZA 3TZLA 4WGFA 4L6CA 4MR8A 2IPAB 1XN4A 1VKHA 3S2EA 2CNWA 1IMOA 3WYDA 4D3SA 5KTNA 1DOHA 4ADSG 1G2QA 2O8CA 1RXEA 2Q4OA 1U7XA 2ZIZA 4NG4A 4KE6A 1DQNA 2LWIA 3PS9A 3T38A 5KNBD 1P73A 2BEUB 3KETA 1OYOA 2O8EB 1OE0A 2J48A 3F6EX 3MGCA 3UAZA 1VJ0A 3GFBA 4FT4A 3KJFA 3MJ4A 4A0QA 5L4LA 4LMPA 3RJZA 3E05A 1UJ6A 4BTLA 5LZ7A 2BEWB 2BAGA 3LDGA 4WBNA 4M1TA 3DMTA 4PC3A 3C3PA 3RS7A 2RHHA 3WWPA 4IUCS 3IT0A 2JLUA 3QTBA 4GR9A 3ANLA 1GOTA 2FOIA 3MT8A 3BXOA 4TUYA 3VYWA 4UEJA 1LSJA 1W88B 4DLVA 1U31A 1IONA 1WSBA 1DC7A 2MOKA 4FWTA 4FCWA 3T4XA 4D9CA 2I33A 2ET6A 4FEAA 4A5OA 2FU5C 3G0CA 4K8OA 5ICGA 5CTJA 2XZPA 2VHXA 4M0DA 4I1IA 1MW9X 5T5QA 1Y4ZA 1U8EA 3B89A 4XJTA 4K2AA 3NP7A 3SZLA 1LPPA 3D7RA 1C80A 5AW7A 3W77A 3LLCA 4JI8B 3E9DA 3QI2A 4LZZA 1I7LA 3C98A 1N25A 2QG9A 1EFKA 4INJA 4YECA 1P7PA 1CJUC 2CYBA 3A9VA 4ND2A 3QFSA 4FW9A 3PHCA 2AN3A 2WYVA 1VDZA 3FZEA 4LPSA 1NATA 3C3MA 5TGTA 1GKIA 3RREA 1Z4JA 1RLOA 5A6SA 3WGYA 1SWVA 1VMDA 2OFFA 3JAKA 2ZUUA 3H2GA 2FK8A 3W6OA 2GJ9A 2Q4EA 3L7IA 1QMGA 2J85A 3LK7A 2LIPA 1EUCA 1I2DA 4QLOA 5KTMA 3GELA 3O31A 3PX2A 2VH1A 2B2XA 2AI3A 2WHYA 1PI3A 3G89A 3PUYA 3G6KA 4ZOLB 5DHPA 3RSHA 1CP2A 1FSGA 3G68A 3ZQ6A 4EVSA 4MGYR 4EFNA 2HSEA 2DPLA 1XNRB 3OAAD 2BF4A 3RJMA 1RPNA 4UASA 1P2GA 5DNUA 4IQ4A 5P21A 1X13A 2JJ1A 1PJLA 4Q15A 4YP0A 3FGZA 1UDCA 1YIDA 4J0GA 2WNIA 5DXFA 2BH9A 3ADCA 1UP6A 1JHAA 5JNUA 1RKXA 3FWZA 1VPVA 1PQ4A 2H08A 4MYRA 1NRWA 4A16A 4P92A 4Q1DA 3ZWKA 5C1IA 2CWDA 2F4NA 2WF5A 1PAUA 2IZZA 2JAHA 1U4SA 1R6UA 2P4UA 4JR2A 5JCXA 4KXLA 3DCIA 1GL3A 1SULA 4LWPA 1EVZA 2AQ8A 3EQ8A 4M9QA 2VAMA 2CFIA 1A88A 1LDBA 4J16A 5I7WA 2O3JA 5EWJB 1NLMA 4J0CA 4OI4A 3PC4A 2AE1A 3O8RA 4DSTA 1FSSA 2PO5A 4JB8A 1CRQA 2IYQA 5TE9A 3G0GA 1TE2A 3PVCA 4R98A 5L9AA 5IABA 1CUJA 1T4CB 2WUEA 1MH9A 2VCHA 3DC7A 2VP4A 5MN5A 3KB2A 3D2CA 2NTNA 4QXQA 4EJMA 2NQ2C 1RQNA 1M6NA 2NYVA 4BWFB 4N41A 3V7NA 5DWDA 1E2GA 4YCSA 1UBMS 4UDYX 2C98A 3HDQA 1GJRA 2BKXA 5H3LA 5G53C 2GO1A 2I71A 4UMVA 3TOSA 4OKSA 1OU4A 2C2GA 3VAAA 4AQDA 2I8AA 2G9UA 3UH0A 1ZJ4A 2JAQA 2WAXA 1J09A 1KOGA 1AKWA 4XD7D 3PEVA 4C0LA 4QTYA 2BFEB 3DDZX 4EKEA 1RHMA 4XUCA 3Q8KA 4WLVA 3OU2A 5EE0A 2DBVO 1KI6A 3DB2A 3U81A 5IFLA 1BA2A 3M33A 2FV8A 4MICA 1F7VA 4FQ8A 5D6OA 4HVTA 4KMRA 2CDCA 2ZE6A 1BE0A 1YL5A 3A9UA 3L05A 3ZQUA 3K0AA 4G5OA 4RGVA 2VF5X 4Q18A 4TWJA 3QLJA 4AF7A 1GXSA 4BN0A 1Q1ZA 3L43A 3ZHTA 2I2DA 3DEJA 1C7ZA 2ZSFA 4HFRA 2NT3A 2QRGA 3VU0A 1E2QA 2Q8NA 5E8RA 5EIHA 1ZD2P 2CL0X 1I6KA 1GILA 3VYUB 1PNOA 3BWEA 3E23A 4GRAA 1EPUA 1WWKA 1YR9A 1IBMB 4HQRA 1IK6A 4L7VA 1MB2A 3AJ8A 4TWAA 2J5QA 1UUFA 5EHXA 4Z99A 3FXAA 3QLVA 3LY7A 2ZWIA 4XB2A 3B5IA 5JT1A 3ONVA 1YQXA 4TMVA 5AVKA 3RADC 3BBLA 3X1JA 2A5YB 2Q5IA 1BD4A 4UXHA 1ZD5A 1Z28A 1FJ2A 1GQFA 1NUQA 4BKUA 2IBMA 3VZQA 1S1MA 5K8CA 4ESVA 3SQXA 4YI5A 1SPXA 2HEIA 3NBZC 4DA9A 3HNOA 1A8UA 1P9WA 3NYRA 1JPJA 4ZODA 3T3EA 3HABA 4BC1A 4KN8A 2I03A 1IVNA 3IP8A 3O93A 1ADGA 4M1KA 4I1PA 3KYJB 3MBIA 3VHQA 4CM4B 3UB3A 2P7HA 5IBQA 4G0MA 5CX1B 5GZ1A 2GPYA 4WVFA 1YQTA 3H1EA 4K5QA 1R00A 2JCSA 2I1QA 4N76A 3RIMA 3HKBB 2HV8A 3O82A 2R85A 3M0EA 4CCWA 2CXNA 4Q82A 3AFMA 4D3XA 1YAHA 2OYSA 4IDQA 1YRWA 1ZXBA 1O6GA 3PC8C 2P3OA 3KVOA 3PJRA 3AR4A 1K7XB 2YV4A 2CZCA 2VKTA 2GAAA 1XCMA 1IPHA 2WVAA 3ZHVA 1RM4A 4J0DA 4JT2A 1C41A 2H31A 3UWDA 4NFSA 4DR1B 1ZHOA 2P0AA 1EFVB 4DCCA 3KNZA 2Q2VA 2PY6A 1RAFA 1IN8A 1LI4A 3N53A 3N87A 1IL0A 1IZYA 2P5TB 3HDTA 1JHOA 2XDYA 1SUIA 4AP5A 1LDYA 2N47A 2OCYC 2O8BB 1ZMOA 3IHTA 5J2TB 2OMEA 2DJ5A 2X22A 5ILGA 3CPHA 4H7KA 3MWDB 5HNKA 4KV9A 3VU9B 2WHEA 4PLTA 1GG9A 4GNKA 1VCMA 3VHXB 4MEBA 1O94C 3IERA 1NUAA 2WJAA 3WZ2A 2D2IA 4M1QA 1PLKA 3QU9A 4KQJA 3AM4A 3X1WA 3W2GA 3EEYA 1R37A 4FBLA 4TROA 5FFMA 4PGGA 4LBYA 4F4HA 1PUJA 3B2QA 4JBNA 2V1UA 1IG3A 4P0PB 4ZOAA 3IP5A 3QJYA 4RTKA 2BEJA 2RGNC 3OP4A 2VOJA 421PA 1N5KA 1IZZA 4JX8A 3HA2A 1U0OC 3UT6A 1EUDB 1M2KA 3CUUA 1T1EA 1QCZA 3NBUA 4Y3UA 5HCIA 5EE3A 3SJCA 1SD1A 1HPLA 4K6CA 4XM1A 1NRXA 1Q95A 1WVGA 1YZHA 5FPQA 3QWAA 4MKHA 4ZVTA 4Y9UA 4ZC1A 4EHAA 2VHJA 2ODEA 3ABZA 5IN4A 5KYWA 3M6AA 4TLCA 3GDHA 1GGKA 4JR0A 4UUMA 3IQZA 1SH7A 5JU6A 1SIBE 4EENA 1T25A 4K7JA 4BEWA 1P4RA 4QVGA 3RAPR 2XRMA 2VAPA 2FMHA 3GLVA 3KR2A 3PF8A 1F8UA 4G0YA 3KJXA 4GOKA 4RY8A 1QGDA 3BORA 4XH9B 3EC2A 5AT1A 5LA6F 2CGEA 2O3TA 3B7WA 3CZPA 4LUCA 2V74B 4WECA 5KYYB 5LUBA 3IESA 4NJMB 4CZ2A 2O2ZA 3LUJA 2VSOA 1HFEL 1DJMA 2ZE8A 1M9NA 4MAAA 4NDAA 1KMNA 4IF6A 2Y0EA 2X9GA 3NT5A 3SPXA 4BO9A 1U7PA 3QF4B 4W1RA 1Z35A 2R6JA 1AZSC 3MJFA 3ED5A 2WHQA 3KLPX 4MRNA 4UCWA 4HQFA 4MW9A 5EJMA 3T12A 1QS0A 2YXLA 1AHNA 4B87A 4LX8A 1B14A 3FPCA 4GG1A 3NBQA 1XD2A 1ZN7A 4AMBA 3UW1A 1Y8ZA 4BJHB 2K7FA 3QMMA 7YASA 4JOQA 3WLRA 2VXBA 4MI6A 1U8YA 3STTA 5JSZB 4RHEA 2VF2A 1AV7A 1MP0A 5EJ6A 1Z75A 2J1LA 1LUAA 1RRVA 2DX7A 1FX0B 3N74A 4H3KB 4GVLA 4YDQA 9MHTA 2WTMA 3DQZA 1T1IA 2QX8A 3UGKA 5HRUA 1GCOA 3OE1A 2WABA 4V3CA 3E9MA 4CKZA 3NAQA 5AK3A 5KQRA 2H6EA 3I2HA 1P8JA 3VKWA 2LZ0A 3CVXA 2YQZA 1N75A 1DG3A 2P27A 1VCNA 2QUHA 3KLOA 2BYTA 1XUOA 2WF8A 1TKAA 4JUIA 5A1TA 3OZVA 1OFUA 3BJEA 3RIGA 3N0XA 1XPRA 3EIWA 4V38A 4JB3A 1ITZA 4YAOA 2YH2A 1ENYA 1OIWA 4C5BA 1KH2A 1F9EA 2JLZA 1M2VB 4N8SA 4XM0A 1KQNA 1RRCA 3TW0A 2QUIA 1U8CB 1UM9A 4OY3A 4OQQA 1VJ1A 2JEOA 2OV8A 5CPFA 3QXGA 2Q3LA 3ZCVA 4YRMA 4N49A 4YV2A 3EF0A 2WUWE 3EWAA 1LD3A 5DLPA 1XXHB 3FD8A 1PGOA 1WUTA 2GLUA 1RSZA 1WDKA 2UYGA 1I80A 2WYUA 1C9NA 1QOZA 4ZYUA 3BIXA 5IDXA 1SIWA 4FR0A 1L7DA 4RXUA 3HFJA 1CNMA 1UL1X 3SJZA 4BBPA 5FOTA 5JSFA 4CMKA 2ODAA 5AKXA 4RTOA 3UWKA 4U63A 3I5MA 2VNHA 1PYDA 4LI3X 1L4FA 5KS2A 5TQ0B 1DZ3A 4A3SA 1WY5A 2ZJ2A 3I0NA 4H2DA 5A5DA 2Q4BA 2P9JA 3K09C 2AG0A 2PMEA 4WZAB 4P33A 1AKEA 2GPSA 2HMTA 2XUIA 1QVWA 1YIAA 1EFRD 4PHCA 5WRFA 2FPIB 1YJCA 1AT1A 1IULA 1Q22A 3F3YA 5CDFE 3JQ9A 5E3HA 4KI7A 2YHIB 4NMWA 3ZVKA 4OBXA 2RHMA 4JV5B 1CY1A 3B38A 5BV1A 2EFYA 2GN6A 3AR6A 2QMOA 4A91A 4WKCA 1FDWA 2W0MA 3LVBA 2BD0A 2JGJA 3BWXA 2IXDA 3HG7A 1NMXA 3INGA 3QXSA 4HSEA 3UWMA 3TW6A 4C2AA 1RM5A 2AEFA 1JHMA 2QM3A 3PENA 4YY3B 1W76A 3L4KA 1ULBA 4GECA 2AFIA 3ZG6A 2ESRA 1RM3A 5LBIA 2XHEA 4HPWA 1SUWA 4Q7MB 4P4SB 3W5BA 5IDYA 1PK7A 2YCBA 3DQQA 4JLAA 2C2WA 2IEIA 4TXMA 1HDIA 1PFKA 1CVRA 1OWMA 1JE1A 2EV9A 4HDQB 2XGSA 1RU3A 1YKGA 2JJQA 2OVFA 3UAOA 3IP1A 2R86A 2OHIA 5LZ9A 5EE1A 2YXEA 1G8GA 2YWBA 4J0HA 1RWOA 5FX2A 1X7XA 5FORA 2AF3C 1NJFA 3K70C 2C9YA 1A1SA 4OXNA 4LZJA 4E30A 2GEKA 4D3DA 1M7BA 2ZUTA 3MS2A 1AUOA 3GRPA 2PD4A 3HP1A 5D1HA 2CCJA 2HM7A 3U7QB 2GEVA 5G1NA 1OVMA 3F1LA 4ZTZB 1H94A 2AYZA 3KEMA 4D4KA 1ZS9A 1X7ZB 2FPPB 1ZRNA 4YRJA 4EI7A 2OWDA 3THXA 1P62B 2VZ0A 3JYNA 4YUVA 4OMCA 2TMYA 4QFMA 2ATVA 5K99A 3IP7A 2P3SA 4OL0A 1L5HA 3EC1A 1ZRMA 3N0VA 3BAFA 1T1SA 3GEGA 1LDNA 4QYIA 1YBAA 3FCEA 2QGZA 3DS8A 3FSJX 4GI3A 3L49A 3VAYA 3TG2A 1ZGAA 1F2DA 1GCGA 5M34A 1ZN9A 4M2LA 2IYRA 4R8VA 3GZ4A 1J0DA 3SZ3A 1Q0QA 5K3FA 3AKDA 3VHLB 1LVHA 3W8DA 1J7KA 3IV9A 5BN3A 2RH4A 2HQSA 2B6NA 3MCZA 1RWBA 3NHLA 3C7DB 2HU2A 3HI4A 3LP8A 4IDAA 2EZTA 2G3YA 2QTGA 4Y2RA 3GLTA 3GAFA 3SM3A 5BUQA 3M9XA 2IWRA 2VUIB 3QA9A 1ODIA 1E9SA 3FHJA 1R9GA 3JQ7A 4R2JA 4JKOA 4HAUA 4C7JA 4V0MA 1J8YF 1E6WA 1T0HB 2NZUG 2OHFA 2XUFA 1K6MA 3H2ZA 4Q6BA 4C3VA 4CT4B 3RVNA 1V4BA 3ZLVA 3ZDXB 5IZCC 1H9BA 2E6KA 4PNEA 4TTAA 1X92A 1KZ9A 5B36A 3JVUA 2UYCA 4XW2A 1RAAA 2Z56A 1QZZA 2QPLA 1ESMA 4P34A 3TVYA 4QOIA 3ZCXA 2CYAA 1V16B 2BZ1A 3KB8A 3PUKA 4P6VF 3CVYA 3D3JA 2N46A 4TOIA 1QIDA 1O87A 3JQAA 3CTPA 4UXIA 1L4HA 4UBOA 3HYSA 4W7SA 2HCJB 4FR2A 3PIRA 2OV1A 5AKKA 4B3JA 1FQJA 1XLTA 4PC2A 3MJEA 1GCAA 1DPFA 3BG5A 4R9SA 5B7QA 4PYKA 5LU9A 1JSCA 5HM6A 2AOWA 3JYHA 4HFNA 5LOVF 1QANA 5C37A 2IYTA 1IJEA 2I5PO 1RPZA 4G2NA 4GF5A 3NDRA 3ELWA 3M5DA 1WCXA 1YRQA 4NEHB 5EIOA 4M0UA 3H2IA 2EG9A 2V7TA 4WESA 4E5PA 1VBKA 3V8BA 2Q21A 2D62A 1DGQA 1R0ZA 3I37X 4A4DA 5KX5B 3OFKA 4ZOEA 1V8FA 4GNRA 4B3DA 2PQ0A 4L15A 4KSYA 3K94A 2YFKA 5LMZA 1CZHA 3A2LA 2B4QA 3B13B 3WWCA 4X1IB 1GL7A 1UXIA 2I6FA 3F6BX 3S2IA 3K5PA 5L4SA 5EKDA 3MB8A 3Q88A 5BWCA 3AEQB 1M1YB 2P9EA 2R11A 3MWFA 4KOAA 2CSUA 3H17A 4FCCA 5EKUA 2DLCX 4G3XA 4YRCA 2XF2A 3TNDA 1CB7A 1RTKA 3SZOA 3C8UA 2WNHA 4MS1A 4C29A 2WM3A 4GKAA 1HMPA 3HPRA 3RS3A 5FBLB 3OESA 3F6CA 4LGVA 2W37A 2UU9B 1F6BA 4TKVA 1CUDA 5KNBA 1P1FA 5SICE 3SE7A 4ZP1A 2TMDA 4WFQA 3WDMA 3LLSA 1IZ8A 1QZTA 2P6OA 4M3NA 1NR7A 5DKFA 3VR3D 4X64B 4C43A 4DEVA 5JANA 4UD6A 2I6QA 2X4DA 3S1AA 2XMQA 4S04A 3TZCA 2IBSA 1EUZA 3E5MA 2RI0A 5EXTA 4EF5A 1CYEA 2Y93A 2PT5A 1JPUA 4FB4A 4BPBA 2ORYA 4OLBA 4XVQA 5K8JB 3UCFA 1IG0A 1L7NA 1QIKA 2CDRA 2Q3MA 3AEYA 3INNA 4MGIR 3VOTA 2J0VA 2WNSA 4A92A 3ANTA 3ZDAA 4WAUA 1R10A 3RF6A 1HI9A 4FPXA 1BRMA 1TZ2A 2AKYA 1RIIA 3CSDA 1JFRA 1N34B 1GNQA 3N7AA 1A2BA 2ZUBA 3JPWA 1CUYA 3WMWA 1GNRA 1XKTA 3E5RA 2X1VA 1FTWA 4QQRA 1INLA 1FDUA 1SUEA 4RTQA 5JH7A 2FQXA 3HL4A 2J09A 5GMOA 1Y42X 3VSEA 2P6UA 3L18A 2AZMA 4P2GA 4L85A 1TC2A 4IGEA 4CG3A 1DIGA 2FPUA 3LC1O 1FFYA 1PX0A 4EARA 2SKCA 3HJBA 4O59O 1EVJA 2QVBA 5C1BA 1NFRA 1S5PA 1WXHA 2BUAA 2GN0A 4H7HA 4MR7B 3CB2A 1Z18A 4PQYA 4CT5A 4N48A 3RSOA 1NKTA 1P1RA 1BMQA 4CLHA 4K6MA 4DG9A 3WK6A 1UAAA 3BOSA 1I3KA 4J7XA 5EJ5A 1GLVA 1Z0JA 1CIJA 1RM0A 2Y99A 1QGYA 2GTIA 2WYWA 3DLPX 1QZXA 4EUKA 3OAAA 2JANA 4MV1A 3UWSA 1TVEA 2F59A 3D7NA 3DOJA 1JMKC 1VIAA 3N1UA 4RNCA 1ACMA 4WOJA 4YFVA 3TSWA 5BW4A 2W90A 3CG0A 4LTNA 1NNSA 4KPYA 2CXUA 3DNPA 1DNPA 3KEQA 2BMWA 3MF4A 1WCIB 3NAZA 4XX0B 5GGXA 4EFMA 3D5EA 4YV1A 1EK1A 3HFSA 3OOJA 1RCUA 4KBGA 2AFRA 4MTCA 5EE5B 4PZAA 4CFZA 3R7DA