4CI9A

Crystal structure of cathepsin a, apo-structure
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
455
structure length
415
Chain Sequence
SRAPDQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of cathepsin A, a novel target for the treatment of cardiovascular diseases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords LYSOSOMAL PROTECTIVE PROTEIN
total genus 151
structure length 415
sequence length 455
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 2013-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ci9A00
4ARBA 3W04A 5AICA 4AO7A 3C70A 2V98A 2JGMA 3VDXA 5CXXA 1LPPA 5KBYA 5LKRA 2OXEA 4XWGA 2JGKA 1X70A 4HXGA 1OXMA 3QBJA 1U65A 2WFZA 3ZLVA 3B3QA 3NUZA 2PVSA 1QTIA 2CUTA 1WPRA 4C89A 1CUWA 2Y2VA 3I2JA 3DLTA 4K6GA 4C4XA 4KE9A 5DJ5A 2ZSHA 6YASA 2OG1A 2XUQA 4LXIA 4EY7A 4WFJA 3K6KA 5DNUA 4OSEA 3WI7A 4AN0A 5ALJA 3V1LA 2C5FA 4J0HA 4NVRA 4U2FA 4EB0A 2C58A 5KWJA 5LZ2A 2VQ6A 4HRYA 3EIOA 3BJRA 3G8YA 5EHQA 2ZJ6A 3ANSA 3H0CA 2HA6A 5AIAA 4DSAA 5JD5A 1N8SA 1OILA 5AKGA 3I2IA 1CUXA 1XZMA 4CCWA 1AGYA 4QDZA 4W1PA 1TRHA 1XFDA 5LZ9A 3HACA 4UHFA 5T4EA 3I2HA 5YASA 3GA7A 3K9BA 2JIDA 4BZWA 4Y2UA 4X00A 2GBCA 1YB7A 3HYSA 5HK8A 3WK6A 3G0GA 4X93A 2WJ6A 2PSFA 4UBOA 2RHTA 3AIOA 4QDXA 1YAJA 4KEAA 3LCRA 1VXRA 4B82A 1NU6A 1EX9A 1YCDA 5ALYA 1UXOA 1TCCA 4AZ3A 4WY8A 4Y2SA 3WA6A 4C4ZA 1J06A 2UZ0A 3IUNA 1D07A 1UWCA 1ZJ5A 4Y2JA 5FOQA 5CH8A 4GBGA 1G42A 2WFLB 2VF2A 4M0FA 2RAUA 1QONA 1LPOA 1RYYA 3WIBA 4LXHA 1MAHA 4K5QA 1HPLA 4QA9A 5AKHA 3BF8A 4MQMA 2O2IA 1K4YA 2WHPB 4P08A 3BF7A 4B83A 3C87A 2IIVA 1LPBB 3DL7A 4KAFA 1AZWA 5ESRA 3G02A 3R3ZA 2C0QA 5KWIA 4AZ0A 1AURA 2O2HA 4IO0A 1P0IA 2BUCA 5K3FB 4H77A 5HFAA 1Q0ZA 4BDSA 1O6GA 4DGQA 1DWPA 1QO7A 4TGLA 4E14A 3FLBA 3ZLTA 4FMPA 4H35A 1P0PA 4UBJA 4OB7A 2XB6A 4QE3A 3X3HA 3E3AA 2OAGA 3VVMA 4EY4A 2HM7A 4W9RA 5A7GA 4H7HA 3IBTA 1Q0RA 4ITVA 1GGVA 4GWLA 3D2CA 3S2ZA 4ETWA 4X85A 5HFNA 4J0CA 3STUA 2OCKA 2QVBA 2VJDA 4U2BA 1QFMA 2XE4A 4JEIA 1ZD2P 5ALRA 4DMKA 1YB6A 4BC1A 3TGLA 2XMDA 2R11A 1F6WA 2X5XA 2GBIA 1ZD4A 4LXGA 1XZCA 3FVTA 4D9JA 5LYYA 3D0KA 1XZIA 5JZBA 3MVEA 2WFMA 4OU4A 1H2WA 2BFNA 1GXSA 1VOTA 1BEEA 3W2TA 1X2BA 5CTAA 4ZI5A 1CFJA 2BKLA 3MUOA 3MUNA 2JEYA 4X90A 1OCEA 2AJDA 2ZYSA 1W75A 1SOMA 1VE6A 4UBLA 3WMRA 3DEAA 1ZI9A 5C8ZA 1MN6A 3G0BA 1CV2A 4B7ZA 3AILA 1MU0A 1F8UA 4QWWA 3I2FA 3CCBA 3T4UA 3BDVA 3RM3A 1W76A 3ZI7A 5ISMA 2OCIA 5JD4A 4DMCA 1NU8A 4J0KA 2VT7A 3AIKA 4YASA 3GBSA 5HCUA 3R3VA 1XRMA 3R0VA 4FFWA 4I19A 1HQDA 1SCKA 1DINA 3AINA 1QOZA 5HKBA 3VJKA 4PW0A 2PKYX 4GXNA 4Y2VA 5ALWA 1CPYA 3FOBA 3PF9A 5CT8A 5CW2A 4L72A 1FFDA 1DTEA 4BTVA 1LBSA 2WJ4A 4UHCA 3DKRA 3DCNA 3V48A 1H23A 1HLGA 2ZYRA 3DYIA 2DFPA 1XZLA 3LIPA 4W1SA 5ALVA 4CCYA 4BE4A 2WIKA 4MEAA 4X92A 3C43A 3VKFA 4F0JA 2CKMA 4TPKA 3D2BA 1ISPA 3H1AA 4IQ4A 4H7EA 1XRRA 4KYVA 5ALFA 5ALUA 1XLVA 4IH4A 2QJWA 1ZD5A 1T2NA 2JGEA 2OCGA 2WHPA 1CUYA 4GLBA 4CG2A 3DOHA 2AJLI 5ALZA 1JFRA 4DTCA 3IA2A 5EHZA 2ZYHA 5BWCA 4C87A 4CI9A 2GYUA 5IVDA 2VAVA 3LIIA 2H9YA 1EK1A 5K5EA 3WWOA 5AK6A 2G5TA 4WDRA 4X6UA 3GELA 4ZV9A 4ARAA 4G9EA 3PICA 5EHNA 1ORVA 3C6XA 3STVA 3WWPA 1N5RA 1UT6A 2YASA 3VXKA 3JYHA 4QZVA 4EBBA 2PM8A 4G5XA 3FYUB 4WDQA 5AM2A 3A2MA 2EDAA 1CQWA 3IUJA 4FNMA 3WYNA 5K3AA 2DHDA 4MJ3A 2WUEA 2XMCA 3S8YA 5AM1A 4G8BA 1R88A 3WYDA 4AN1A 1L7AA 4OYLA 4CCYB 1E5TA 3WL5A 4UBIA 2Z3ZA 1CUUA 2FJ0A 3IDAA 3L1JA 5F4ZA 4PSDA 1CUDA 1CUHA 1RWQA 2Q0XA 3FNBA 3HC7A 1EB9A 1QIHA 4OUKX 2AXEA 2ES4A 3YASA 2ZVDA 2DHEA 2CBGA 5HF8A 5D6OA 4Q05A 1UOQA 3H19A 2HFKA 1ZIYA 2JF0A 4Y2XA 2BUBA 4GDMA 3DQZA 2WG1A 3AUKA 1XZKA 3GFFA 4DNOA 4M0MA 2FX5A 2Y6VA 1YR2A 3C6BA 5AOCA 2B61A 4AO8A 4H7DA 1K6EA 5HQ3B 1LZKA 4ZWNA 5I9IA 3F96A 2DR0A 3W9UA 1HKHA 2XUDA 4XX1A 3I1IA 2XQIA 2C5GA 3T52A 2BAGA 4QDOA 1TIBA 3G0IA 1GPLA 2Y6UA 3B5EA 1MAAA 1MX5A 4NS4A 3OPMA 4N8EA 3KDAA 1EH5A 4AB1A 2WJ3A 5AIBA 4BZZA 4B80A 3H2IA 1VZ3A 3A6ZA 4P9NA 2OCLA 4O08A 3WQHA 1VE7A 3OM8A 4QEKA 2DHCA 5T4FA 2D5LA 3HABA 3KD2A 1A8QA 1KU6A 1QIDA 2H7XA 1VZ2A 1K8QA 5JANA 1FFBA 3U1TA 2XI4A 3BL8A 1AMNA 4B81A 2AJ8A 1VA5A 5ALLA 4W1RA 1FJ2A 1IUOA 4OCZA 4Q34A 5CT9A 1G5FA 1A7UA 1T4MA 2QKYA 1XRNA 3IULA 4BVKA 1WCYA 4Q82A 3HLKA 2QMQA 3WK9A 3WL8A 2C4HA 3WJ1A 3FSGD 1A8UA 1SCIA 5K3DA 2XUKA 2OPHA 1LPNA 1NX9A 1GPNA 5C81A 2IITA 3BWXA 2WSLA 3D2AA 1XRLA 1ZIXA 5DNVA 2JBWA 2ONCA 2CJPA 4KE8A 4TVKA 5AM0A 1ZJ4A 1R1DA 3WZMA 4X3CA 1ZOIA 3EQ9A 1CIJA 1EB8A 4W63A 4FHZA 1FFEA 3R3WA 4Q1VA 5JASA 1C7IA 2WTNA 4J0JA 1S8OA 3CN7A 4EHBA 5IH7A 3EF3A 5AM4A 4HRXA 5HZGA 5JZSA 4CG3A 3M82A 1XZGA 3FYTA 2WILA 3IIIA 3G0DA 4G8CA 4BP8A 1UK9A 2V9ZA 2QXUA 4U2CA 1L7QA 2QRUA 2EDCA 3R40A 4UFNA 1U4NA 3QITA 2QS9A 3UUFA 5IVIA 1MX1A 4FTWA 1ZD3A 4GHWA 5CURA 3HSSA 5FUMA 3ZPXA 4HXFB 3ESAA 4Y2QA 3R3UA 4G4GA 3KSRA 3P2MA 4J0IA 4X6YA 3RKSA 5FPQA 5CXUA 1EDBA 2XUFA 3NGMA 1VXOA 4IHAA 5JZ9A 2RIPA 4BAUA 5KREA 4J03A 1JU4A 5CT5A 4HS9A 4MQLA 4NZZA 2XT0A 5ALQA 3BXPA 2XMZA 2QT9A 1RP1A 2PUHA 5FKJA 5E2IA 2QUAA 1UOOA 5HF5A 2QJRA 1GZ7A 1DX4A 5LZ4A 4AO6A 3G0CA 4AX4A 2HA4A 4Z49A 3DD5A 1FFCA 1ETHA 4WFKA 4PQEA 2I3ZA 4B0PA 5JAPA 4W1QA 2JGJA 1ZI8A 1IUPA 5AM5A 5FPPA 1J2EA 4EY5A 1H2ZA 1MO2A 4U2DA 5EGNA 5DLPA 1ACLA 1W52X 2G5PA 1TK3A 2VT6A 3QPAA 1CLEA 2R8BA 3ESCA 3C8DA 3EBLA 4DYHA 1VLQA 1CEXA 1SFRA 2PSJA 3F8SA 1K63A 3Q8WA 3CN9A 4IH1A 3EQ8A 2I03A 5BWBA 4BATA 1AC5A 1KEZA 4MYSA 4C6HA 1PV1A 3OURA 4XJVA 3PUIA 3QM1A 1CQZA 3E0XA 4BP9A 1CUAA 4PO3X 3LLCA 3AZPA 4BE9A 2RHWA 3G9ZA 5AKIA 3B12A 5DTIA 4UHBA 5T4HA 4XVCA 4Q3KA 4OYYA 3W05A 4KRXA 4LYDA 3K2IA 2WG2A 1Y7IA 3FLEA 4X91A 3F98A 3V9AA 4E11A 2AJCA 1JMKC 2CEKA 4AMYA 4DLNA 3D3NA 1CRLA 4S0XA 1Q84A 4YX9A 1QTRA 3OOSA 1AKNA 4RE6A 4FLFA 3WKCA 2C0PA 1QJ4A 4GW3A 4HXEB 4MYDA 4CIAA 4OU5A 4DNFA 1TKRA 5SYNA 1XKLA 1X2EA 2J4CA 1XZEA 1XRPA 3Q0TA 2YYSA 5AKJA 3GROA 2VATA 5ALIA 5EHXA 4BRSA 1FFAA 2H7CA 4KJXA 3HI4A 2J3DA 4RPCA 4YPVA 1YS2X 1JKMA 4AMZA 1MT3A 1LPSA 4FOLA 4BTLA 5AKEA 3QMWA 5ALTA 2PSHA 5AKLA 4I4CA 1E8DA 5ALSA 2WHQA 1TAHA 2XUOA 1UKCA 4I3FA 2QXTA 2PSDA 5AI8A 2OGTA 2WKWA 5I7UA 2D0DA 4RE5A 4J7AA 5A6VA 1P0MA 4WCVA 3FSGA 1W1IA 3AIMA 4HVTA 3WIOA 4CG1A 3H17A 3N2ZB 2QOEA 4ROTA 4Y9SA 3FLAA 2VJAA 4N8SA 4OD0A 4WJLA 4M0EA 1DWQA 1BE0A 2J3QA 1XZFA 2OGZA 1JJFA 3H18A 3STYA 3ANTA 1SCQA 3HJUA 1Q83A 3WL7A 5I8PA 2ZJFA 2XUAA 3CCCA 5AI6A 3WZLA 5ALMA 2XMBA 3SK0A 1B41A 1U8EA 1DT5A 2WU3A 3WK4A 4AXBA 1HBJA 1QIJA 2FUKA 2ORYA 3I2GA 5ALEA 3ICWA 1UKAA 3G9XA 4KR0A 2CZQA 4ZRDA 3STXA 4RNCA 5LIPA 3G9TA 2WUDA 1YAHA 2CMFA 4OPMA 2NW6A 4BBZA 3QYJA 1EDDA 3HEAA 1R3DA 2HFJA 3JW8A 4OB6A 1AX9A 1SC9A 4QLOA 1O6FA 2WLSA 2Z5GA 4C88A 5E4JA 4BRZA 4FLEA 1EK2A 3C6ZA 4G9GA 4NMWA 2ACKA 4Y2YA 3WK8A 1WHTA 3SC2A 3I6MA 1MNQA 2G63A 1CUEA 2WQZA 3I2KA 2HHAA 2HA2A 1LLFA 4ZGBA 3H04A 4H7JA 1DQZA 2ZJ7A 1YSCA 4G1FA 2ROQA 1GKLA 4PV7A 5AH0A 4LYEA 1XKTA 5IKXA 4YK7A 3PFBA 3LP5A 2P8SA 3WKBA 4BCDA 4FWBA 2PU5A 3TEJA 4DMHA 1CUSA 2XUIA 2WIDA 5FLKA 1MNAA 3O4JA 2BGNA 3LS2A 3QMVA 2HIHA 2B9VA 3O4HA 4B0OA 1VJ5A 5JATA 4XIIA 1EVQA 2WUGA 3FBWA 5E4YA 1C4XA 3D4LA 5EIEA 3UUEA 4H18A 5LZ8A 4FBMA 2O7RA 3VJLA 1I6WA 4A5SA 1EVEA 1IUNA 2HU8A 1ODCA 1QIIA 3PDCA 1E3QA 5AKZA 5K3EA 1G4HA 4FKBA 4B85A 2Z8XA 2VEOA 4A16A 1WB6A 5DYTA 4KE6A 4BAZA 2PUJA 2Y1KA 3NOXA 1XLUA 2RGUA 4G4JA 3C45A 1QO9A 1CUFA 1WB5A 5AI5A 1UK6A 4UBMA 4ZXFA 1JT2A 3ESDA 5AI0A 5AO9A 4N5IX 5FRDA 3H2HA 1B6GA 3VJMA 1BS9A 1R4ZA 3O4GA 2XMSA 4PSUA 3E4DA 4KRYA 5HF6A 3IURA 2DCMA 3CXUA 4F60A 1LGYA 4BCBA 3H1BA 4BAGA 2DSNA 3D59A 2WUFA 4QLAA 5EIHA 3DKKA 5ALHA 2O7VA 4A23A 5FP0A 4Y2PA 1EHYA 3H2KA 3L1HA 2XUJA 1GPKA 1CUIA 4GECA 1LBTA 2XLBA 4EZIA 3PUHA 4C01A 2XMGA 2YH2A 3O9VA 3FWHA 3ZV7A 3DJYA 1USWA 1XLWA 2GZRA 3AZQA 3GZJA 7YASA 4JH0A 4KAAA 3ILSA 4DNPA 4P92A 3QVMA 1DWOA 3KWJA 1UFOA 3H2GA 4Q3LA 2JGFA 2X76A 1W6RA 1BRTA 3F9CA 4GI1A 4J0GA 4QNNA 2V97A 3W9BA 4DM7A 3IUQA 5DNWA 4MXDA 5JAOA 2XUHA 1QIMA 1WB4A 3QPDA 4X97A 2AJBA 1JU3A 2J4FA 5DYWA 2ZSIA 3PFCA 4PSCA 5CT6A 3MGAA 3M3DA 3IVMA 4BC0A 5HKAA 1QIFA 5C8VA 3TJMA 5A2GA 3V1KA 5LLSA 5ALKA 2DQZA 2I3DA 3N0TA 2RI6A 1THTA 4BB0A 4WY5A 3C6YA 2VA9A 1JMYA 3A2LA 2VAXA 1UK7A 1Y37A 1VA4A 3WKDA 5LZ5A 4DSZA 1A88A 3BE8A 5K3CA 3I28A 1YASA 4L9AA 1R9MA 5IVHA 1MPXA 5HK9A 2W22A 3WA7A 2JEZA 5AK5A 4U2GA 1MJ5A 4C4YA 4HAIA 3DS8A 3I1YA 1K5PA 1Y7HA 4UHEA 3HZOA 4DNQA 2QUBA 4ZREA 2WIGA 5JAUA 1PFQA 5A62A 1EA5A 5D3KA 3UMJA 4INZA 1QE3A 5ALNA 2K2QB 2HADA 1CUJA 4UPDA 5ALOA 1MTZA 4HTAA 1HL7A 3OC0A 1IVYA 4BYMA 5JALA 1EXWA 1WPXA 4MEBA 4Y7DA 3W06A 2XLCA 4JUIA 4UFPA 1C7JA 4H7KA 5CH3A 1QZ3A 4FFVA 4EY6A 1JI3A 2VJBA 4UHHA 1E8MA 4JYMA 3V1NA 4LHEA 1DU4A 2H7YA 3WWEA 4LKOA 3VISA 3FYUA 3QMMA 4JYPA 1UK8A 4KACA 3A2NA 4QDUA 2EEPA 2XDWA 2OQVA 3PF8A 2ACEA 2XQJA 1WOMA 4KAJA 4QDTA 1DT3A 5JAHA 3PI6A 3NWOA 2GZSA 1QIEA 2Y2UA 4WFIA 2BGRA 1R50A 4GEGA 5EIAA 1CR6A 1U2EA 1J1IA 4H0CA 3ESBA 3D5EA 1CUZA 1HDEA 1XQVA 3WK7A 1XZAA 5AI9A 4L3WA 2OQIA 4BVJA 5HQ3A 3F67A 2XMRA 2RONA 1N1MA 4UBNA 1WM1A 1EINA 1CUGA 4J3JA 1XRQA 2VJCA 3DOIA 4AQDA 5C7YA 1ZGCA 5JD6A 3KOOA 5H3HA 2IX9A 4EA6A 4DMFA 1BN6A 1QFSA 3M81A 1N5MA 2JGLA 4UFOA 1TQHA 3ICVA 2PU7A 3OTQA 2E3JA 3KWFA 3O9MA 2WTMA 4PF1A 1Z68A 4BCCA 2GYVA 1XQYA 4P93A 2QZPA 3IB3A 5J3JA 2PX6A 5LP1A 1QIGA 3QPCA 5JARA 5HF9A 1P0QA 1YA8A 2GBFA 3A70A 4FNGA 4UUQA 1XROA 1FSSA 5AP9A 4B9AA 4B84A 1ODSA 1THGA 1GQRA 5ALPA 3BIXA 1M33A 3STTA 3U0VA 5K3BA 2FJPA 1DX6A 1UZAA 5E4TA 1ZGBA 4UHDA 5CT4A 1F0PA 5EI5A 3O4IA 4F5ZA 2OGSA 3HRHA 3FCXA 2BJHA 4E15A 3WL6A 1F0NA 1MX9A 5LZ7A 5AKYA 1PJAA 4U2EA 3C5VA 5AKKA 3V1MA 1LPMA 1LZLA 3L1IA 1CVLA 1W4LA 1LNSA 1XZDA 4G4IA 4F21A 1E66A 2HU7A 5BOVA 4L0CA 5AOBA 4Q3OA 3RARA 5ALGA 1H2YA 4OB8A 1QGED 1TCAA 1IMJA 2PPLA 1L7RA 4E46A 1XQXA 2YXPX 4MWSA 5ALXA 4Y2RA 2G4LA 4B9EA 3AZOA 4KE7A 5LKAA 1LPAB 2HL6A 2I78A 3O0DA 4X94A 1UOPA 2W6CX 5BV7A 5AK3A 1TCBA 2HRRA 2JGIA 5SYMA 1UKBA 2B4KA 2PSEA 4H7FA 3R3YA 1BCSA 3R3XA 2HA5A 5D3ZA 3BJMA 3IUMA 1BU8A 1GKKA 1XZBA 4X95A 4UBKA 1WHSA 4K6KA 5D7BA 5DWDA 1BN7A 2XUPA 1CUCA 3HXKA 3C8HA 4G8DA 2HA7A 1A8SA 2C7BA 3FYUC 3QH4A 1DQYA 1ZI6A 5CMLA 3WJ2A 4EY8A 4HZGA 4JNCA 3WWCA 4DIUA 3FCYA 2LIPA 3DL4A 1CUVA 4K6HA 4Y2TA 2B20A 4IH9A 1J07A 3WK5A 3WKAA 5AHXA 2XUGA 3E1GA 2XQKA 1KU0A 3ED1A 5FDFA 3FAKA 1H2XA 2WM2A 3ZWQA 5K3FA 5T4BA 1XZJA 3AFIA 2GYWA 5A7FA 4K2AA 3ZLUA 1IZ8A 2ECFA 3G7NA 5DTJA 5ALDA 1ACJA 2CB9A 3WLAA 2X8BA 3RK4A 2HRQA 3DYVA 2HA0A 4FBLA 5AJHA 3SX4A 4B6GA 3WKEA 3BIWA 4N8DA 1GQSA 1QIKA 5AK4A 1YA4A 4BVLA 1YS1X 2HDWA 5AKXA 3C5WP 3QZUA 2GBGA 2HA3A 1BCRA 2QTBA 1H22A 3FVRA 2WHRA 3EQ7A 3BDIA 5FXMA 4X7BA 2WFLA 3WWDA 1EI9A 1G66A 2WG0A 3D7RA 1GT6A 3I6ZA 3VVLA 5IVKA 2PL5A 1JJIA 5CBKA 1XZHA 5FV4A 3H2JA 4J0DA 5EFZA 2HU5A 5AI4A 4QWMA 3STWA 1EDEA 3SWWA 1R9NA 4FLMA 2XQFA 3AJAA 1XQWA 2WIFA 4PNZA 3O95A 3TRDA 4H7IA 2XMQA 2BCEA 1ORWA 3JWEA 2Z8ZA 5C8XA 1E8NA 5CH5A 3RLIA 3DDUA 1BEZA 4BDTA 3OG9A 2WIJA 5AM3A 4RGYA 4ZV7A 5JADA 4EUSA 2OAEA 4FDMA 1ZICA 2BUAA 1E89A 4X6XA 2Z3WA 4N5HX 2XQGA 5A71A 3I6YA 2VSQA 2PBLA 5AOAA 2ZYIA 2O2GA 2OLEA 1AQLA 1ODTC 5DYYA 4V2IA 2DQYA 1VKHA 5A7HA 5JYCA 3M83A 3GUUA 5CRIA 2H1IA 3PE6A 2QR5A 1IZ7A 4X71A 1AUOA 3DNMA 4CFSA 2V96A 4CIBA 2VTVA 4LIPD 4MWTA 2WU4A 1CUBA 1JJBA 3R41A 5JIBA 3KXPA 1QLWA 3F97A 3G9UA 1BROA 2QM0A
chains in the Genus database with same CATH superfamily
1PR6A 4F1WA 5HIKA 1EX1A 4ARBA 4D4KA 4IWXA 4O0LA 3LP6A 4YALA 1A7JA 4LZLA 3PNLA 4M60A 1JWLA 1KYIA 4AO7A 7MHTA 5KJCA 2I4TA 4MVYA 1E5LA 3HR8A 2COKA 3T3NA 1LA2A 4P4NA 4R8KA 2W8BA 3ZWDA 3MHTA 4MCIA 5ECDA 5LKRA 1PX0A 3TNDA 2OXEA 3OQOA 2JGKA 1X70A 3L7KA 1BKSB 1ZH2A 1FNNA 1UEXC 3R20A 3HJFA 1U65A 2WFZA 1CLUA 2CV0A 2XNJA 4OLHA 1NRIA 1QS0B 4YXWA 3CT4A 4KXUA 5DBFA 2MR6A 5TSDA 4D0LB 1UP4A 4AWAA 2CUTA 3AQIA 3MCUA 4GP7A 4TWRA 4L8WB 3TQFA 1CY6A 5KKCA 4LJ9A 3D6TB 4OLJA 2FOXA 1FVFA 4G9BA 2HC9A 4Z5XA 2BR4A 4ABTA 1SXJD 4KE9A 4JUAA 3T15A 4YCNA 4KQHA 1Y8ZA 2AW3A 2GZ3A 4L7QA 1QGOA 2H08A 5KYYA 1XLTC 2XYQA 3FMOB 2EQ5A 3K6KA 2DUMA 1QGAA 3FZYA 4WFJA 1NVVR 5ALJA 3WI7A 2V5AA 3IIJA 3QP9A 3AOGA 1VTKA 4J0HA 4EB0A 1B8UA 3D6VA 3CZ9A 2JPDA 4TV9F 2QIOA 1O95C 4RD2A 2JIQA 2Z2ZA 2ORED 2ERCA 1KZ9A 2QBYA 1KJWA 2IUYA 3FTCA 1QLHA 1M8FA 1SCBA 2PUEA 2I6TA 1B4DA 1FMFA 5EHQA 5B1DA 4QFBA 2ZRFA 2ZJ6A 3H0CA 5IT9A 1U6IA 4UDNA 1MQ9A 4Q7JB 1Q6ZA 4RY2A 4XVRA 3EOBI 5BN3B 5JD5A 2OPHA 3CGWA 2G1JA 2ZRGA 1T8WA 3BE5A 1QFJA 5AKGA 1DMSA 2GLUA 3RD5A 3UMVA 2BFDB 3ETLA 1ML3A 1KFJB 1RYBA 4OM8A 4X9XA 1T4GA 1XK7A 2H0RA 3HZHA 4Y30A 1LBQA 4MS4A 4BX9A 3GJ6A 1IRIA 1JHXA 1XFDA 4DYVA 3UJ6A 5AQ1A 2VQFB 2RJNA 2VP3A 3RSZA 3VV3A 4JXZA 4JI3B 4YJ2B 1G9TA 1J20A 3HACA 4IJKA 4S35A 1PV4A 5IRCD 1LY1A 2H5IA 3L8YA 1FPQA 4QFDA 1I5OA 3NQ41 2P9ZA 4J8PA 4O4IA 1AOXA 3AJDA 4BX0A 1TC2A 1OWMA 1KSJA 2XWPA 3I2HA 4KQ2A 4OJQA 5YASA 3L8ZA 5K99A 1DQPA 3DQPA 3GCDA 1TKAA 4BZWA 4Q3AA 4WBNA 1GFWA 1UXJA 2O5VA 3JQ8B 4MB2A 2GBCA 5IC5A 4V1CA 1OI2A 2HQOA 4QUKA 3C7CB 1Q1GA 1POWA 2GJ9A 2Q1SA 2ZRBA 4L4SA 3DKVA 2Z56A 3T1HB 3HUDA 1U0JA 3P9RA 3RRBA 4M22A 2HR1A 3X0DA 3NYQA 1BNCA 4DMLA 1VBKA 1YHYA 4JP1A 4TSKA 1WUJS 2L82A 1M9NA 2PSFA 2X15A 3WIDA 1IEQA 4CLHA 5BT8A 4HPWA 1LBHA 1TO1E 2BGMA 4RHUA 3QXJA 3TJZA 4OMUA 5J1SB 1YAJA 2G40A 5C7LO 1YKFA 3A0RB 1UKEA 2SBTA 1FQOA 2KJQA 1S7GA 4GUDA 3NDJA 4L8YA 5TQ0B 3E23A 1RBMA 4RL4A 3SPXA 1VXRA 4BMYA 1ECPA 2YDXA 2IEYA 4F46A 1PFKA 1YCDA 1NV9A 5EWJA 3TK1A 1DB3A 4OL0A 4R01A 2WSBA 4A73A 3DKPA 4FC7A 3QTLA 1ZU4A 1LDEA 4DLPA 1J06A 3N8HA 5HXAA 3Q6IA 2G8LA 4MV4A 3T94A 3UGJA 2NZXA 1EXDA 1D07A 1SBYA 1RD4A 1H2AS 1V48A 4JYCA 4XGRA 3QUAA 4DC1A 1QHXA 4GMGA 2QLFA 1DRWA 1EFVA 1UC4B 1ZMRA 2WQ7A 5JO0A 5FOQA 1OTXA 2E37A 1T2DA 2VZEA 1T5IA 4UJ5A 3ZCSA 3EZNA 3KNZA 4GX0A 3X43A 2J67A 4KIJA 3JQRA 1QHYA 1QANA 2FRDC 3A31A 4P4SB 1BWPA 1KQFA 1JFSA 3KEMA 4IBOA 1TYBE 1CVIA 4PLTA 5I9SA 3W3AD 3WRYC 4BNUA 3H5OA 1RYYA 1QYCA 3N2IA 1JALA 2HBQA 3OOWA 4G84A 3DNFA 5BQFA 3DEIA 3T5GA 5DNCA 2OD7A 3DF7A 3ZJTA 1PHRA 1HR0B 2RHOA 3KALA 4KPUB 3BF8A 4UHJA 4U9IS 2O2IA 1K4YA 1P77A 3QE3A 2WU8A 4JSTA 1IIBA 1G8YA 5T67A 4BBPA 3M4ZA 4MHSA 1UFVA 2VYNA 4C04A 2XRYA 3ZYZA 3MJFA 4MYRA 1AS2A 4GSLA 1EA7A 5IAGA 4I5GA 2IOFA 3TNJA 2ZIVB 2VP6A 5BWMA 1C0LA 3A3KA 4EPWA 3TLCA 1AZWA 2Q27A 4H6WA 4KVFA 3D8SA 4IUYA 4NE9A 4ETIA 3R8CA 2FZWA 3BHIA 4AZ0A 5ER9A 1HURA 1YACA 2WB4A 2YRXA 1KVRA 4M8KA 4R69A 4WW0A 2D1YA 2H1LA 1P81A 2OORC 2CLOB 1RC1A 1DBQA 2MTBA 4M0DA 3HDHA 5CCDA 2VDNB 4J43A 4M46A 4POAA 4KR3A 3E9DA 4RSMA 4V3BA 1A9SA 2AFRA 3PXAA 5GZ1A 2QL9A 3UJCA 1G5IA 1M72A 2ST1A 3A1TA 3L02A 3QLVA 1O6GA 4IXNA 4N40A 4QUJA 2ZSJA 1PU2A 4G3XA 2R79A 4DPKA 1Z4JA 1H93A 4ID3A 1Z4OA 4KV7A 1NSTA 4R6WA 4TT3A 3RRMA 2PZ8A 2D0IA 4KW7A 4E14A 3FLBA 2FJUA 1JSCA 3T5PA 4H35A 1XNJA 3ZNQA 3ZW8A 4FMDF 3A7EA 3T1NA 3TDNA 4CCSA 2HO4A 5BSEA 4OB7A 2BGTA 4MHOA 2G07A 2PGOA 2FW8A 5P8WA 2RJOA 3DZDA 4DRYA 4W7SA 1SVOA 3GCXA 5CYGA 3VVMA 2A9PA 1FDTA 4EY4A 3JVIA 4YAUA 1FUKA 3VR1A 2ASEA 4MI6A 3S70A 5FBVB 1VMIA 2C7QA 3IBTA 4MQ5A 4KO2S 1HT2E 1GGVA 4GWLA 2WVHA 1EK5A 2GBPA 3OJEA 2FEPA 1ZJ6A 4GQAA 2CCKA 1JW9B 4IYJA 4W8GA 3TZEA 4CMEC 3RTBA 3EPPA 3E05A 5H7XA 5CCBA 3O0TA 4UE3S 4ZODA 1U2DC 1VIVA 1RYDA 5TMBA 3JQCA 2I1QA 2W4QA 3EMKA 1PV2A 1K5GA 3MJVA 4OK3A 3EDMA 1X87A 1Y3AA 2DQ4A 1PYGA 4YJFA 4U2BA 2QUJA 2VNJA 3BBPA 4I2VA 4E1BA 1I94B 4F71A 1QFMA 4YQZA 2XE4A 5IFLA 1RM0A 5TRTA 4Y7CA 1JF8A 4HUQA 5AT1A 5IAJA 1F8GA 1Q0PA 5AUQA 5CYPA 1RYFA 2BFPA 3ESXA 4DLZA 1LK7A 1PSWA 1XLTA 3IEVA 2DF8A 3SJBA 1XHLA 4C0XA 2QEQA 2X5XA 3HVIA 2GBIA 2B98A 3AR4A 4KFTA 6ABPA 1NBME 2I6QA 5E1DA 4L74A 2HJVA 3OWXA 1KC3A 4AMVA 4YLYA 2IKSA 4D9JA 4KYUA 1I2BA 3HP1A 5LYYA 4KHPB 1DPFA 3I23A 4NJEB 4XE5A 1L5LA 2BFBA 5ED0A 3K9NA 5FL7D 3D0KA 2WNHA 1D6MA 1XZIA 4WBSA 5CNMA 5FTJA 1P7PA 5JZBA 2DXIA 3A27A 3MVEA 1E20A 1H2WA 4P5PA 1M0EA 3WIVA 2JRLA 1P2FA 2BFNA 3KB1A 2CEAA 5DK4A 5KYWB 1BEEA 4PM4A 3QU7A 3W2TA 1K4MA 3NFYA 4HWTA 3IMEA 3UAGA 1NKTA 1G5PA 2OILA 2QN9A 2Z4SA 5FWDA 2BKLA 4B71A 2A3NA 4QQRA 1H66A 1HI9A 1VHWA 3OMLA 1I3OA 4URWR 4RIHA 1Z6ZA 2IW3A 3ZR4B 4JI5B 3TVDA 2JS7A 3EUWA 3K6RA 3Q40A 1KTVA 2A9RA 1FQKA 3KKPA 2W6QA 2PBRA 3T3DA 3OOEA 3HUTA 5I4IA 1OCEA 3GBVA 3ST7A 3N07A 1EPUA 1W85A 2XKBA 4NONA 4BLOA 4B87A 5KX5B 1N33B 5BW5A 2ZYSA 2W90A 5AJZA 4QPPA 4UUMA 3TUIC 2IHNA 2LBPA 3GLFA 3LW8A 1MN6A 1HQKA 1CV2A 4CKWB 1JEYA 3Q4GA 4KQCA 3VI3B 1G60A 4DAEA 2JFUA 3NMUF 1BFDA 1ZIOA 5KWEA 1J70A 1P29A 4KQIA 1NAIA 3IMGA 4AF6A 4WNAB 3CCBA 3PNQA 4CF3A 1VKJA 1H9AA 2G5CA 1FLVA 3A4NA 1Y3FE 3BDVA 4K7JA 2REQA 2W2LA 4XLTA 1W76A 2OTCA 3WGGA 1EVJA 4MQ6A 2VSYA 5A4JA 5JUWA 2YHIA 2SHKA 1L5HB 2Q8PA 3ZI7A 3B1FA 5KTTA 2MCFA 3CBQA 1RKQA 3QA9A 1R9JA 2C7VA 3RDPA 3VYWA 3NORA 1E1RA 3HDVA 3ZTYA 1R8XA 1NW4A 2B5WA 2AR7A 2H2HA 2VI5A 1Q6YA 2XJ9A 3K4HA 5F1KA 2I8LA 3JXEA 3R9XA 4MGKR 2BP7A 1D04A 3H3XA 3R3VA 4R84A 1U28A 2DOKA 3F5FA 1KMQA 4UAGA 1SBHA 5HG0A 5BYAA 1J00A 1F1BA 3FHJA 1IY8A 5EJMA 2Y1GA 3ETNA 3VKWA 1PR1A 5SICE 2IYQA 3DVQX 2FSVC 3EK2A 4BJ5A 4LVOA 4JLMA 2YWGA 1E9DA 3QFCA 2IZOA 2PKYX 2WHYA 2GCEA 2BEWB 3H4TA 3TW8A 4HQLA 5EZYB 3WRWA 2XCQA 2XWJI 2XZPA 3ODGA 1U0HC 3GWGA 5ALWA 4C5AA 1CPYA 1J2RA 5L40A 3GEPA 4DWJA 3VR6H 3PF9A 5HIJA 3OZ7A 5JMTA 4B3GA 3CRNA 4P0PB 1WP9A 2HW8A 2Q0SA 1J9EA 3HWX1 4L72A 5FJJA 3RU3A 5F5XA 1YFLA 1V3UA 1DTEA 2POQX 3C3JA 2VSNA 3QNWA 2WJ4A 3N6RA 5KNBH 3MRSA 1K8YB 2OCYC 2H52A 3DKRA 4JBHA 4UHCA 3UMBA 2AH5A 5FOVA 2Q5IA 2QZZA 2ZT5A 3PQ8A 3ZWNA 4IZOA 5B2EA 1XZLA 3IP8A 4P36A 5FEMA 1GDHA 3ZOKA 1PE0A 2GPJA 3P5SA 1HQYE 2MINB 1FYVA 4PGHA 4RTJA 2FQXA 2GAIA 5KQMA 4X92A 3LLVA 3NHSA 3FX2A 4ASUD 1POXA 2FRDA 1X3LA 1N78A 1IXKA 3F3YA 1T2FA 4WZBB 1KP3A 1NBHA 3OECA 4F0JA 1XN1A 4Z4IA 2IDZA 5JNRA 1X1TA 3WHLA 3FG9A 3GJ8A 3TEJA 3X1WA 4OQXA 3STWA 4DMHA 4EG4A 4F5EA 1VB5A 2VOEA 4ZARA 5HNKA 1ISPA 1TF2A 2PYZA 4AP5A 3ONFA 3R7LA 3SVTA 1E9BA 4O1HA 1U9IC 3RH0A 4BVFA 1CXZA 3ZHVA 4I50B 4U3JA 3I5UA 4MVJF 3BDAA 1LVGA 1LV7A 3C24A 4KYVA 3GU3A 1P3Y1 4PHHA 1DNPA 1XLVA 3WGMA 1JWBB 2Q6LA 4PZYA 1AHNA 3X1YA 3QVGA 5AW8A 3JSAA 1GZSA 3FSJX 2WHPA 4GLBA 4L4ZA 4UD2A 1N6LA 4ZTBA 1KHHA 4BL5A 3ZGZA 2IHZA 2FPGA 1M34A 4DHWA 1N36B 2DAPA 2GS9A 2O1SA 1G6Q1 1MOSA 2JC3A 4M0CA 3RAEC 3SF8B 3FB4A 2Q5QA 4PTYA 5ALZA 1Z0ZA 1VFNA 2FPWA 3WGLA 3A9RA 3S2FA 5K4HA 1OSNA 5FT9A 1DJNA 4C5CA 5JPCA 1VI5A 4TYNA 5DHQA 3BJEA 4I1OA 5EFOA 4KTTE 4Q15A 1DEHA 2ZYHA 5DHPA 1URPA 4C87A 3BD7A 3WMFA 1NNEA 5JROA 1DTSA 1PN3A 4DA6A 5JAMA 1X13A 3RANA 1DKNA 4KUEA 2GZ1A 5DK6A 4HEA1 1V95A 1PUXA 2VHUA 3CY6A 1YR6A 4ZGGA 1GQQA 1JXOA 4MRPA 4REQA 3WWOA 4DVGA 5CA0B 4X6UA 5HQTA 3GELA 2OZLB 4G9EA 5C1IA 3EDRA 1XYYA 1SBNE 3OETA 3TKYA 3EXIA 3N70A 2NSDA 1LQUA 5FBWB 2XF8A 1LF5A 2IXBA 2WSYB 4PGAA 3HV0A 3STVA 4LV8B 3ZHCA 2PL9A 3QFHA 2F17A 4AD8A 1ZOLA 2XCSB 2G5GX 2Q99A 4D5GA 3WNQA 3QBVA 1IWBB 3O82A 2PRJA 4LQDA 2PD3A 3PBKA 5J4VA 3A36A 3MERA 2J5QA 5AM2A 3IV7A 2IV7A 4EHLA 3DE6X 3JRWA 3NBXX 4FS3A 4YRTA 3T0FA 1IJBA 5KSOA 4P0QB 1CQWA 3N9IA 4TWJA 1HA3A 4OG2A 1OX5A 2PS1A 3O74A 1A4UA 5DLYA 1ZA2A 5JZMA 2GVZC 5M29A 5BRJA 3ZLJA 2Q2NA 2UYYA 2VHYA 3PD0A 4N12A 2XMCA 2FV8A 4Y98A 1U1FA 1IBSA 1IMOA 4GR5A 3N2GB 4UXHA 4G8BA 1S7CA 4NEHB 3A1WA 4AN1A 1DCKA 1OLOA 4QFCA 5B1SA 1W4ZA 1STOA 4L16A 3WL5A 4CCYB 2QMHA 3SS9X 4K9SA 4DRZA 3O4VA 3NAGA 3SOZA 2Z6VA 3OX2A 4WVLA 4E33A 3EN0A 5CA1F 5ADHA 1P74A 2FJ0A 1WE2A 1P7VA 2VZ8A 5FORA 1CRWG 1W4RA 5HE9A 3UFBA 2P2SA 3L84A 1A7KA 4HMOA 4C6TB 1CUHA 2BMWA 4ND8B 3L6CA 3UWDA 2JJ1A 4EFMA 1DJQA 2AQ8A 4MYTA 2XTMA 2OZKA 2UUCB 2Q50A 3LDAA 2C3MA 3HB9A 3AR6A 2QPTA 1EFTA 1RLJA 1SO8A 2FLKA 2J3KA 1PBNA 1DXOA 3TH5A 1ONOA 2V7UA 3IC5A 1UOQA 4JJ6A 3H19A 5JD3A 3TJRA 4B43A 2VK4A 2NZJA 4LCJA 1W0CA 4JJ7A 4CM4B 4HQNA 3ACBA 3MBIA 4Y2XA 4QYMA 4JI4B 2BKEA 4GDMA 2WG1A 5CAEA 1G5RA 2WSSA 1Q1EA 2ZTUA 4OMCA 1HMYA 1XZKA 4IINA 2VK1A 4TSFD 3C5HA 1AZTA 4R2MA 4RKQA 2OCPA 3UNXA 4PXSA 3BQNB 4EW3A 2XRFA 2CJYA 3HYCA 3LGAA 1ESCA 1CHNA 1QKKA 2P5SA 3DVAA 3QVSA 3OPVA 4PG5A 2Y6VA 5G0SA 3K1ZA 4HBZA 2OK7A 1YR2A 5LVAA 2IHBA 2EG5A 1XZ8A 5KYYB 2YC2C 1KO5A 3IESA 3LT2A 3FUTA 2IXTA 1TAUA 1OROA 2EGUA 4BIMA 2FR0A 4WOBA 4GLOA 3BEDA 4JA0A 4KTVE 3VPAA 1E63A 3QBEA 4MWZA 1WY5A 3RFCA 1GM5A 2AZMA 3X2SA 4IY1A 4MROA 1M2EA 2EZ8A 1VL6A 5DTQA 5EPEA 3AFGA 4AZTA 1AMOA 3W9UA 1HKHA 2GN4A 4KV9A 3RSHA 5HX7A 3EH1A 4QDOA 1QTNA 5CG1A 3ENQA 2DYKA 3K8OE 5K8IA 3WLOA 5BUQA 1Y48E 3CMCO 5AHRA 3RYIA 2E85A 5KQRA 3BKXA 4MP8A 4US1R 3B5EA 5CDTA 1MX5A 5KTNA 3CRW1 5EUBA 5IU6A 3DBRB 4OHKA 1EFKA 2LGJA 1ZEJA 2H51A 1AUQA 5LA6F 2WJ3A 1VL8A 4HGOA 4B80A 4IOMA 1F17A 2W7TA 1VKNA 3OA2A 1YOVB 2I33A 2WD9A 3AEKA 1VZ3A 4MV6A 3ZGNA 4CYMA 4DBVO 5K6AA 3RAFC 2OCLA 4O08A 3WMXA 1T2UA 4JBNA 3H8WA 4BVHA 1HK7A 4ZAZA 3OIWA 1TU0A 2OMKA 5T4FA 3HABA 3S0JA 1HTBA 3AXSA 3VU8A 4BLVA 5IABA 1E9CA 2TS1A 4C1BA 2WDZA 1GITA 3SWWA 2H7XA 1JDVA 1PT7A 3PZBA 3WSVA 3IVXA 4W5HA 2CHEA 4QASA 3PXEA 3MA0A 4RZHA 5FTWA 3AHJA 4MVWA 3PQ5A 3MFQA 4BNMA 4EJ2A 3R0QA 4CM7A 1MP0A 1U3FA 1X7ZB 3ZWMA 2I9KA 4OMFG 4PFKA 3GT3A 4PX9A 4OCZA 1AJEA 3GGGA 3ZY6A 4Q34A 5E38A 4CKEA 5L9AA 4ZDWA 4JLAA 4MRRA 3MMNA 1SUBA 4X3OA 5EMHA 4DLLA 3KQKA 2WAXA 2OZPA 1JH9A 2C07A 3LUDA 2O2SA 4H1WA 3QVKA 1VE1A 1TEVA 3GJ4A 1IAVA 4XARA 1G55A 2CDRA 3FIUA 3GAAA 4UHKA 1B26A 2VXYA 1NT2A 2DHQA 3BRCA 2BEUB 2G6TA 1F48A 4GAEA 4L0MA 5DOZA 4CNBA 4EMBA 2GXAA 1P80A 1XCMA 3CPJB 3W2EA 2RAPA 1U4SA 2BGWA 2QAGB 1Q92A 1K8XB 2XUKA 1IH8A 3Q72A 1LPNA 2QUZA 3PUZA 4IS3A 4ZAYA 2AC2A 1CQJA 4OEHA 1NX9A 3OI7A 2YCLA 2ZJ8A 4QPJC 4XGNA 1E1NA 3UMFA 4TV9B 4BGUA 3RSLA 4UU7A 4EYSA 3UMMA 4RTOA 1ULUA 3OMWA 1MABA 4OY3A 5FYDA 1S2LA 2PYIA 3OSZA 3MXTA 3BAZA 3BD8A 2WSLA 1E3DA 1HE3A 2M32A 2WAMA 3D2AA 3GFTA 1XRLA 5BN1A 1SXJC 3KFXA 2QSUA 2R6DA 1A97A 1HTTA 1Y8CA 3MXOA 4OLFA 4GBED 2NXWA 4FX2A 1RRVA 3DZ8A 5AM0A 3JASA 1GKIA 1P75A 2A30A 1ZJ4A 4O4IF 1E3WA 4COOA 5F23A 1XAHA 2X2OA 3WZMA 5CB4F 1DBSA 2X1HA 5GJVC 3K0CC 1VHTA 4M0UA 4YPOA 5AW0A 2HF2A 1PTJC 1U0BB 1IQ0A 4WCFC 3GVXA 5JWHA 4D8XA 3SAJA 4O4JB 3Q98A 4IFIA 1Z18A 3EQ9A 2VUTA 5JCOA 1E2DA 2ZULA 4V24A 2R48A 4AKGA 3L79A 2X7XA 3E8MA 5JCJD 2PJZA 3REQA 3PITA 4TV8B 3U4MA 4I5FA 4Y1RA 1N32B 1TVKA 3G85A 3KOZA 1M0SA 1VRWA 2G04A 4PVCA 1BMFA 3NVMB 2AW5A 2Z8YM 1JB1A 3KHKA 1KYXA 3LBAA 4QXPA 4D6YA 4DT1B 4PQRA 2BFEA 1U2PA 3G8CA 3M9LA 1JIXA 2ZSBA 5JASA 2E4AA 2ZREA 4HDKB 3V8VA 2O2CA 4RDHA 3WNVA 4L6CA 5IH7A 2ZM5A 3EF3A 1G3QA 1HG1A 3GI1A 5MGNA 3L0ZA 4BU1A 4FUTA 2P6NA 3R0IA 4JOBA 5JZSA 2PH3A 2ZVJA 1RFGE 1Z47A 1WLSA 3FSEA 3HP7A 3CE6A 5FL3A 3G0DA 4HX2A 1J0BA 3SX0A 3VOTA 1QP4A 1UK9A 3VGPA 5BW6B 3HCOA 1IXZA 3IS3A 1XQ9A 2QQFA 3H2ZA 5A9SB 5JYEA 1ONNA 3KTDA 3T9CA 2P5UA 4WI1A 2XYRA 2I62A 2ZANA 3X1MA 1T9GR 4XIFA 1NFFA 3QYAA 1MH1A 4GPD1 4JELA 2R1TB 1YBVA 1KZYC 3E48A 3KIPA 4M87A 2JIZD 1UBOS 5JCXA 2Y8EA 5DLEA 1DSSG 2ISCA 4JL5A 2BR3A 2V5UA 1PS8A 4GOKA 3FGPA 3ZWPA 4XPZA 3WTBA 3BILA 4LZWA 1M8KA 1Z3CA 3JD2A 1ICIA 1U4NA 2KLBA 4D8YA 4PQYA 2NMVA 3UUFA 3C6QA 3ZGVA 3F8WA 3FCUB 3FNGA 2W48A 3H1EA 1K98A 1MJHA 2WICA 1GOTA 1RLMA 1NXPA 2ATVA 2F2TA 1HSOA 1ZD3A 2W93A 1K3TA 4PYRA 1GU0A 2VRBA 1NLYA 3K20A 3UWKA 4GRDA 3WB2A 1AT1A 3DW1X 3KCQA 1NONA 5D3MB 1OLUA 3AYZB 2HJ9A 3GD7A 1RRKA 2C54A 1S2GA 1IQPA 4G0XA 4PR3A 1FYXA 2F59A 2J0VA 3BTSA 4OV6B 2IU3A 1EEHA 3V8NA 1JXQA 2WM3A 1XCBA 2BDTA 3MHPA 3B52X 1H8EA 3R6TA 4QARA 3VSDA 4BLTA 1N7IA 1WDTA 2IE0A 5PGMA 1L8XA 5JVDA 3ZTTA 2X0JA 2JBHA 3OFND 3OY7A 4PCLA 4CKCB 4YJKA 5GJCA 2DG2A 3GY0A 3NGMA 4JENA 2HJWA 4K88A 1A76A 1VXOA 5E3IA 3H5NA 1YV9A 3HJHA 3PGA1 5K8JB 1PZFA 1WR8A 1EXNA 4CMBA 4CR8A 2X9VA 5LQRA 2XA1A 4FQ5A 3M3PA 3WRVA 1VLZA 4EG5A 4Z53A 3QWAA 1PTJA 1U7PA 2C04A 3CPHA 2YVAA 1YIAA 4D3SA 1GL3A 4WJKB 2E55A 4R1UA 2PVCA 5CT5A 2BTEA 2I4RA 1ZXBA 4Q6WA 1G9SA 1G8FA 3L6UA 4HS9A 3IAXA 4MQLA 1VKZA 4DR2B 1KPGA 1YE3A 3O75A 4HOYA 2QW8A 3U26A 6CHYA 5CHYA 2PUVA 1G8GA 2WWFA 3K16A 4JR2A 2BI7A 1SIWA 1I1QB 3OZEA 5CVTA 1RWMA 5GM2A 3FUWA 3KTFA 4I9NA 4YRBA 5BVHA 2EWVA 4A8HA 2BH2A 4FK8A 5EGSA 3BK1A 2UYOA 3RF6A 2Q49A 2FG5A 1DV2A 4IIJA 3NNSA 3ZZNA 1ZOPA 3W5SA 3N2EA 5DEOA 3QFSA 5C4MA 1Z0DA 2QJRA 3M9WA 4WZBE 3E03A 3H16A 4MCAA 1DX4A 1PFVA 2C03A 5LZ4A 1EM8B 1D4ZA 4AO6A 3ON5A 4RV5A 4D8WA 5K0LA 3T7IA 3OUZA 1DJMA 1IONA 1F2TA 1GG5A 2FSPA 2FWBA 3LTEA 3P0IA 5DV9A 4NOMA 3C1AA 1XAIA 3F74A 4NYIR 1EVZA 2AX4A 1FUYB 4RH0A 3O8DA 2I3ZA 3PHCA 2P9BA 1FTYA 1YI8A 3FPLA 1L7NA 5TPWA 3SLRA 3NEPX 4W1QA 1TW3A 1A50B 5EHGA 2Z5VA 2JGJA 4BLPA 4AKHA 1LI5A 1IUPA 1UXHA 4QRDA 4LBVA 3D6HA 3F6EX 3IH5A 3KK0A 4AN4A 3FDZA 1OU4A 1E3SA 1XV5A 3WNBA 3GB9A 1J2EA 4EY5A 1UBMS 2DPMA 3GA5A 4CKXA 1DBRA 4LHVA 3IUSA 3JQAA 2FKNA 2JL1A 2IY8A 1RQLA 3GW8A 1QVZA 1N92A 3CRZA 4OI2A 4XFDA 3WGZA 1TA9A 1XPRA 4LRXA 1H2ZA 1QBKC 1I9GA 4WFQA 4Y6PA 4DDTA 1EWVA 4U2DA 1N7JA 4TWZA 3ZHZA 1MFPA 5KJ1A 5EGNA 7GPBA 3NDIA 3ADDA 1WNFA 3OE1A 5D2CA 4QOGA 3HHPA 1FX0B 1PR5A 2Q6OA 2VJLA 3FTQA 5DLPA 3TNFA 1TA4A 2G5PA 1TK3A 2VT6A 3QPAA 4JCOA 1J09A 2CXRA 1T3TA 4G5GA 1EVYA 4HB0A 1G21E 1ZMBA 2ZJ4A 4PBRA 3E5RA 4CF6A 2ZYWX 2VK8A 4YEDA 3HGMA 4OM7A 3PX3A 3TRFA 5KU1A 4DR4B 3EXFA 2VVTA 2ON6A 1ZRMA 1KAHA 2VCYA 3WDSA 4JQOA 4UUNA 2FEKA 3Q3HA 2ZRAA 3Q8WA 2FUG1 3CN9A 3MINB 4IH1A 3IXMA 4QGFA 2I03A 4H7PA 4GYYA 4BATA 1W5TA 2HLHA 1C80A 5HM6A 4DWWA 1CDDA 2JFNA 3I0ZA 1PV1A 1JQDA 1YJ5A 4RKRA 2Q3EA 2L17A 3FDFA 4EKDA 4R0VA 2WJIA 3KVOA 4XD7D 5IKOA 3VSEA 3ZBTA 4BP9A 1VP3A 4PO3X 1C4KA 2GQ0A 3QI2A 5IXYA 5DWVA 4KXFB 1Z5PA 3G9ZA 4CQLB 1G3IA 2QT1A 2YHSA 4HLDA 3HH8A 2AS0A 5DGDA 3B12A 1SBIA 2FKAA 1S3FA 2P65A 1JP7A 3HA3A 4UHBA 3FCCA 4QREA 4XGIA 1YL6A 3IT1A 2PZFA 3EEYA 3FOWA 1V5IA 5IMBA 5T4HA 4A26A 1U8ZA 4BFUA 1ZR2A 5JJKA 1CEEA 1G6KA 1R12A 2ODEA 2GUWA 3AM3A 1Z0JA 1FDOA 1YGPA 2Z2JA 4Q3KA 3G3EA 5ELLA 5GGXA 3WGJA 4HQFA 4LYDA 4PSVA 1EFHA 1IN1A 2WWXA 3AUJB 2OGUA 4ZVUA 1Y7IA 1FX1A 1JA1A 1OX6A 2ATCA 1EX6A 2C2XA 2V7VA 4Z4EA 1PR4A 4GMFA 1XZQA 5KZMB 1EU1A 1TT5A 3F98A 4MV3A 2WF5A 3AVXA 3HCCA 5A4MS 2FSHA 4KFCA 3UMSA 1J9ZA 4MQEA 3TR6A 2HYIC 5D7NA 5FX2A 2WEKA 2QTMA 4BXOB 3M6MD 2AR9A 3FMFA 3D7SA 3OE7D 4I5DA 2R6FA 3UB4A 4YX9A 3TG8A 3M2TA 1QH9A 3LOQA 1RACA 1AKNA 5I5EA 3LKBA 5H3LA 5I5GA 4BKOA 2KBEA 1ADGA 1R4MB 1EQ2A 3LPMA 1QF6A 2KPOA 4C3VA 1C81A 4UARA 4YA6A 1SOAA 3T4XA 1E1QD 3DFMA 5H9WA 2CL7X 4HUTA 2JGDB 3FCOA 1C9EA 1Z6TA 3OF5A 5CVCA 4ZQIA 5EKUA 5CDFA 3ZHTA 3FJOA 5DNAA 5ESXA 1J8DA 1E7SA 1SCUA 2RGEA 2C78A 3KVNA 4U7TB 1X2EA 1BJKA 2J4CA 2WR8A 1IM8A 1E58A 4RAQA 2IIPA 1C1DA 4B4UA 4ZC1A 4RABA 4JLDA 3SBDA 1IBRA 1UFRA 2XGSA 1AIPA 5KYWA 4F93B 2WD7A 2O54A 3GJTA 4H59A 5LUBA 2C88A 4S2UA 2ZDHA 2H7CA 1MEEA 2OBFA 1M2OB 3DGEC 1AGXA 3FHLA 3GGCA 3M6WA 4NCJA 3RVKA 5B1HA 2V8BA 4P7KA 1NJ2A 2YFYA 3VYSB 1HZZA 3D4BA 3OY2A 4IMJB 3U44B 4G23A 1SC1A 4ZAVA 2C4WA 2JCXA 4MS3A 1XAGA 2PXCA 1GQFA 4A2WA 4E03A 3GDGA 1U81A 3MUEA 1E1QA 5JS8A 1YS2X 3KB6A 3AUAA 2AXQA 1KBOA 3GEHA 3GXBA 3JPWA 5JDCC 1FJGB 4FINA 4O4LA 3ROQA 3AB7A 3KQYA 4EI8A 3CB4A 2BI4A 3TSWA 4CEJA 1S9HA 4YJFB 4MGYR 4QRHA 1IN4A 3QMWA 4YMVA 2XTZA 3B9BA 2A5YB 4C0JA 3G0OA 4LKRA 4R3UC 1QZTA 3HUFA 4NQRA 4YMHA 1KRWA 3FPAA 1MF7A 1E8DA 2XUOA 3EEBA 4RKFA 4I3FA 2QXTA 3LBIA 4BFZA 2WK1A 4DMMA 3L4EA 1IEWA 1W88A 3VPSA 3WFZA 4GYKA 3SZOA 4RE5A 4S05A 3U7JA 3JPYA 2JAWA 4I9GA 3K2EA 1H05A 1XTTA 1PJ4A 2R25B 3QEMB 4J7AA 2X40A 2PR7A 1KEEB 4F3CA 5A6VA 1HLDA 4IIFA 1RZRD 2AHOA 2REOA 4KMMA 4WESA 4RJLA 1OZGA 3BBLA 1W1IA 5KDDA 1JSXA 4DC0A 1D5CA 4HQOA 4XPIA 3H65A 2NUTA 2AUNA 4EF4A 4N5LA 1NHWA 3OZCA 5KCZA 2IDKA 3N2ZB 3KYCA 4QUDA 2GFHA 4AG3A 5THQA 3CNOA 2VXOA 3VDRA 2F55A 1UPAA 5JWOA 4K87A 4XX0B 1R0XA 1BVUA 5E6SB 4JU8A 5JE8A 2VJAA 4F9GA 1QZXA 2Q41A 3A6LA 1I10A 3DD1A 2I87A 2LTAA 4JLNA 4UNNA 4FDUA 2C2YA 1OUMA 1I7PA 4COKA 5LYJB 4LF4B 1X80A 2OBYA 4YDQA 5COBA 2RG7A 4XYBA 4BE7B 4HADA 3ZHSA 2J3QA 2J5XA 4CMEA 2NNLD 3B38A 2OHOA 3OCCA 2W83A 4PG6A 4XI9A 3VNBA 4OP1A 2Q2OA 3HJGA 3EGOA 5LBIA 4RVOA 4RSGA 3HBJA 2JFHA 3JQPA 3ZIAD 5MHTA 1Q83A 4A2QA 1N4DA 4JC5A 3PEEA 1NR5A 3ZDDA 2YQZA 3VR3D 5GWXA 1QX3A 1FLDA 4CEHA 1J0DA 2FP4A 1QC5B 2OZEA 3AGQA 4EVRA 2ZBUA 5IDQA 2CGEA 1INLA 3RJZA 5ALMA 4IFTA 1O7JA 4QGAA 4Z54A 4PPFA 3UT6A 1Y9ZA 2ZCUA 3ZIUA 4MR9A 2ESRA 4I1SA 3VR5D 1UDBA 4M1TA 3G2KA 5EJ7A 5TDHA 1QIJA 4OJMX 2FUKA 5FWXB 1RM3A 1O6BA 2DUUA 2AV6A 3OAAA 1Z4MA 4RETA 1US8B 1VYTA 4H3HB 3E1SA 3OE7A 3NC0C 3WLRA 5IF3A 3ICWA 1N3BA 3Q12A 1MAVA 4M9CA 5GV7A 5IWCA 1IY0A 2EX1A 1WPGA 4KR0A 3AVOA 1F7VA 3M9XA 3B51X 2W70A 3QXCA 3D1VA 4DCVA 3RK0A 4CUJA 1ETUA 3IVAA 4E0BA 2A9KA 3STXA 1VJTA 5LIPA 2VNSA 3WGIA 2OORA 1CG6A 5A2QA 3NNNA 1RM4A 2JASA 2I71A 4DLTA 3TR5A 3WGTA 3O8QB 4I4LA 1NSFA 4YT4A 4QO8A 1ABEA 6GPBA 3VKHA 1MAWA 3T9EA 4MVJA 4PPNA 4FB4A 1EDDA 1QRRA 2HIMA 1R3DA 4U9HS 2TMGA 3V9PA 3CT6A 2ZIUB 4MITA 4MVJG 4PX5A 3W5VA 3IPAA 1GAJA 5DI9A 4YROA 1DKUA 2F1JA 2Y3IA 1XNGA 4A82A 1SC9A 4QLOA 2C3OA 1F06A 1P2SA 1QVVA 2WLSA 4RORA 4BKPA 1KY5A 4C2AA 2DPYA 3LZCA 1TEXA 2HMTA 1Q57A 3DOFA 4RLHA 4FZ5A 2GM5A 5E7JA 4ENPA 3CKKA 4YT5A 2VHJA 4K03A 5J4HA 4FLEA 3QK7A 2Y0BA 1OBFO 4OH7A 1USKA 1T6BY 1EK2A 1EX7A 3I34X 5BQPA 1R0SA 3WC4A 3H0KA 4DIMA 3I62A 1KQNA 4C7XA 4JBWA 4H6VA 1EXVA 1ZHHA 4TV8A 3RIEA 4BNFA 1WHTA 4J1QA 4RK0A 3NAZA 1H6AA 3U4HA 2Q7DA 3G6KA 3I6MA 1MNQA 3D1LA 2QRVB 2ZSDA 3CR3C 1GCGA 1JYSA 3MQFA 2DQSA 3MTAA 3N8DA 4URUR 2JFXA 4ZVOA 5AW1A 1RQ7A 2HHAA 5BQOA 1W36B 2TSYB 1LLFA 4TYWA 1GYRA 2FVXA 2PX4A 5BR8B 3FDXA 1ESDA 3QWBA 2ZBDA 4LGYA 1BE6A 2JFZA 3OJWA 3RVRA 4G1FA 1L1FA 1GKLA 4C0BA 1BOOA 2GPSA 1QCDA 3EVNA 4YRKA 4MUGA 5EMLA 1C3XA 1EE1A 1XKTA 2QLNA 3M2PA 4FMCF 3PFBA 3GVIA 4F4CA 1C9KA 1P2DA 1YQQA 3HY3A 4Y6QA 2WTUA 4ZVLA 1N6KA 2EAUA 3VTAA 2ISQA 4M99A 1EUZA 4RJIA 4JSRA 1JBQA 4AUKA 3OZUA 4FWBA 4Y67A 5C51B 2NU9A 2J1LA 4MARA 1CUSA 1E1KA 3TQRA 4X0EA 2ZOSA 1N9GA 2Q8NA 2WIDA 3GQBA 4NYMR 5BN5A 4ZCQA 1T0JB 4ZAGA 3GNLA 4RXTA 4LYGA 1EM8A 4KN9S 4UNPA 3FWYA 5A02A 3I12A 3KP1A 5KVAA 3B1ZA 3DMRA 3LS2A 3ELWA 3QMVA 3K71B 3H1PA 1PNTA 3IV9A 3PPXA 2ZK7A 4FQ8A 2HXSA 4JAVC 3VYUB 2GJSA 3I9JA 3UTCA 1OIVA 4M53A 1W5FA 3QOYA 3EFEA 2JIPA 3JCZA 5FD8A 1TM1E 2PXAA 5DNEA 3IRVA 5SY9A 3DXFA 1NUHA 3I0NA 2EP7A 4N0QA 5GINE 3GLGB 3FB1A 4B6EA 1ESZA 1ZXXA 4O2RA 1WKVA 2IUTA 4XIIA 1DCMA 3KSZO 5U4QA 4BLRA 1K08A 4C4PA 4ITRC 4CTJA 3G23A 1CKEA 5E4YA 4WKCA 3R7WB 3OEEA 3ROGA 3WQBA 2VYCA 3Q9SA 4FBMA 2PA0A 2PHZA 3ZE8A 2OHVA 3AF3A 2ZUUA 4YCBA 5IYZF 3RTAA 2LP4Y 5E7QA 4A5SA 3M6XA 5A5GA 3EIUA 2IJGX 3K35A 1YT5A 2HU8A 1YIOA 3GRKA 3NHRA 4TZ6A 4GKJB 1B23P 3IIEA 4BX3A 1ZC4A 2H8GA 4KOEC 1UJ6A 3U60B 5LBTA 4ZALA 3KX2A 3PDCA 2JJ2D 1G8HA 3ROMA 2ZAGA 3EDOA 2PR2A 5AKZA 1PHPA 1QH1B 4JI1B 4CT0A 5K9ZA 1U9JA 5KHLB 2A94A 5EOVA 1YQDA 2NX2A 2VAWA 4QBTA 4IHJF 4FYJA 2VT2A 1C8BA 2PANA 3FRJA 3KWMA 3BE6A 4MO2A 4WEOA 1TO6A 4FXPA 1RI2A 1WB6A 2SKCA 1WABA 5DYTA 4XYMA 2I22A 4F45A 1DTWA 1ZVJA 5FI3A 3KYCB 4LZJA 4NPHA 3T1OA 1Z15A 2G08A 3D4IA 1S1MA 3OLZA 3O8LA 4G4JA 3KSDO 5KTOA 4F8YA 3ORQA 3RFTA 2IEIA 3JY6A 4UUOA 5HCNA 3WGKA 5BXQC 4F92B 1MJFA 3FIJA 5DISB 5AI5A 1JH8A 4BNWA 2CFIA 1GVHA 1UK6A 3I9FA 4UBMA 3ZC3A 4II3A 3LU1A 1JT2A 2OE2A 1Z3IX 5AI0A 1ULZA 1QX4A 4MV1A 1P1JA 2GRJA 4N5IX 3U48A 1H42A 3IX7A 1BS9A 2XCRB 1R4ZA 1U0RA 5J63A 3GFPA 3RVPA 4YP5A 4BO4A 2V9CA 2XMSA 4WA7A 4BO7A 3I73A 1R6TA 2WWGA 3MCAA 3N1UA 1HXHA 5HF6A 4LNUB 2DCMA 3DMDA 4TLEA 2RK3A 2F1IA 3KPVA 4OA5A 3K6SA 4JBIA 1U2TA 1C3EA 3TTSA 1AHHA 4YCLA 2O8DB 3IR7A 1S3SA 3MWJA 5A9TA 4FKMA 4CIDA 4F60A 2O3RA 1CJUC 1PI3A 3LX6A 4BAGA 2DSNA 1YJQA 3QUCA 1SUAA 2BI8A 1I14A 2O0MA 4QLAA 2OECA 2ZE8A 2IEAA 2JIZA 4GI7A 5D5PA 1L8AA 2GN1A 3TUZC 3RIYA 2O7VA 2FXIA 5FP0A 4A23A 3L01A 3NAMA 3KJQA 4RIIA 2B4AA 1LQTA 1WZNA 1F5NA 2Q5HA 2QRVA 3NCTA 2PJUA 3OQIB 5JSZB 3L1HA 2QN2A 4ZVTA 2H5EA 2VPTA 4RL6A 2Y99A 4RYLA 5IEBA 4LYJA 2G36A 4Q7QA 1GPKA 4FJ1A 1R3UA 3CMMA 4GECA 1FYEA 2PV0A 2VYFA 5EE1A 1UJ4A 2XLBA 2YDYA 3DPIA 4O8CA 4PGGA 1F0KA 3ETGA 5B6IA 3O9VA 4JGGA 4FT4A 3OFVA 1P39A 1GNRA 1Q7GA 4WIAA 5JH7A 4ZTZB 2VXBA 1L5KA 3ICEA 4WVFA 1USWA 3KYBA 5TQ2B 4DWOA 1UEIA 3P19A 4YC7A 3HQ4O 1XLWA 1EDOA 1V1JA 3HU5A 4FE3A 1AUPA 5C4GB 3K92A 4CDRA 4MMXB 1AXEA 1QHNA 2V7WA 3AZQA 3PYLA 1K3FA 4JMLA 7YASA 1RADA 4JH0A 1ZVMA 2BPOA 2VP9A 3ZWCA 2PZKA 2A5GA 3HDTA 4MYUA 2GZAA 4RADA 1WV0A 4DAOA 3EUAA 4Q3LA 1YB4A 2IW1A 2YV2A 3KB2A 5B58T 4R8SA 1Q44A 1BRTA 5F64A 4YJ3A 1JAHA 5JH7F 4GI1A 4D99A 3HL0A 3C1OA 3LMKA 3MFYA 4UUPA 1VSTA 1RZVA 2Q2QA 3GRPA 2GBLC 2M9MA 3W9SA 5DXJA 1KHTA 3LECA 1OZFA 1YMVA 3M5WA 4DM7A 3MSCA 5EUQB 4MXDA 3L04A 1SHUX 2HPHA 4JDPA 5IBRA 2B1JA 4Q1EA 4E2WA 3SGLA 5FFMA 1QIMA 1CZKA 2CK3D 1H4SA 1Y63A 3DZGA 4RPJA 2VN8A 1CNEA 2PK3A 3OQBA 4R1LA 4D46A 1JU3A 2J4FA 3SOPA 1J4AA 1O96B 3HKDB 4J1TC 1NGSA 1H0SA 4PSCA 3LT4A 4DBLC 3V46A 3B85A 2I54A 1VE5A 3ZZMA 3PC6A 3L5OA 1A96A 1GGJA 3H99A 3LZDA 2C97A 3DCIA 4RLSA 1EFRD 1P62B 4MCJA 3SR4A 3IELA 4MQEB 4YP1A 4CDGA 3OKFA 5DSXA 5AUOB 1W87A 5CLIA 5IH3A 3NI2A 4CKEB 1B0AA 3DV0B 1WBJB 3RHSA 1BC5A 1BXKA 1Z6XA 2ZIFA 2H2AA 3OTGA 4JS0A 5ES4B 2QTZA 2PGIA 1U0GA 1TZKA 1A9RA 3GLFB 2GX6A 4XA8A 1Q20A 4QYXA 1GN9A 5EL0A 3OJXA 4FHCA 3LKDA 5GONF 4C07A 3HTXA 2NPFA 5A2GA 5CW1A 5IS2A 5G53C 3BMXA 3F6RA 1MLDA 3WJ7A 2NU9B 2I3GA 3COZA 4JY7A 1YUBA 3F7NA 3UC9A 5IWAB 1P0CA 2RI6A 1PJ3A 1CSEE 1SXJB 1GCOA 4BB0A 1E2FA 1HDYA 2NTJA 3C6YA 3MINA 4WY5A 4Y8VA 4LXUA 2UUAB 4EW6A 1VG0B 4Z99A 3DCYA 4MIYA 2A92A 5DGXA 5CA1B 3EPKA 2O8EA 4PYMA 2Z98A 1Y0BA 3RUEA 1KEWA 1OFTA 5FOUA 4F2GA 2FF5A 1F6BA 3SYMA 2J0QA 1RAEA 2WVGA 3CX3A 4RK7A 4JJ8A 1U2RA 5AK0A 3RIHA 1O0CA 3FAZA 4P2GA 2JHAA 5LJIA 2Y27A 2VAMA 1SD2A 3ULKA 1YONA 1B93A 1MGOA 2FVYA 1F60A 2JAPA 4FONA 2QLTA 4W5QA 3SXUB 1Z6GA 3ZV6A 4AC9A 1FSFA 1MOQA 3HKEB 1K6XA 2I76A 2EJCA 1TRKA 1KFCB 2C00A 3UWOA 2QMZA 1BIFA 2Z1DA 4HDKA 2ZB4A 2LRHA 3Q7SA 4BPRA 1YQGA 2MINA 3BM5A 5HDQA 2VHZA 2AMLA 1G63A 4Z1MD 3AVUA 2A5DA 3GP3A 3WA7A 2JEZA 2I2BA 2DLDA 5AK5A 3QVWA 3C0KA 3QY9A 1VDMA 3HVKA 3A10A 4JKYA 2DPLA 3KPUA 2WJHA 3I1YA 1E6EA 4H3VA 3HN6A 4DG8A 2RCNA 1MB9A 3BAFA 3V00A 3EVEA 4C0AC 3AQ4A 3C48A 4KWIA 4UHEA 5KEIA 1J9GA 1UZMA 3BZWA 4CEJB 4P3XA 4UTNA 2YVQA 2D5AA 2VK2A 2WIGA 1QO0D 1PFQA 5JAUA 2H0QA 3L0DA 3MCTA 2JEOA 4CV3A 3RIGA 5A62A 3W5CA 3N5KA 2HSZA 3GJSA 5I7RA 2EFJA 2ZJYA 3E3LA 4D80A 5IUNC 4LPSA 4QFMA 3GPLA 3T1VA 2OPBA 1UM8A 221PA 4Z1OA 5B53A 2IXGA 5KSWB 4MMZB 3BMCA 2B0CA 1C3OA 4INZA 4QOIA 1CJVC 3PUJA 3DE4X 1RWPA 3ZXUB 2BYTA 1UMDA 3LDUA 2AMVA 4HTAA 1PNVA 5SV2A 3RG8A 1BW9B 3IOBA 1JDJA 4FXOA 2FUNB 4H08A 2D2XA 1CQPA 4Q24A 5IT0A 1EXWA 3KXKA 4I6JA 1WPXA 3URMA 5IKEA 2PZLA 1K5HA 3GV0A 3Q5EA 4KPGA 4MJLA 4MX8A 4Y7DA 1U3WA 1JNXX 1Z2PX 3RROA 3W06A 2D2IA 4C2BA 2UZ1A 5FUQA 2QMYA 4KC0A 2XZDA 4JVSB 1OZHA 2BM8A 1C7JA 3CNLA 3IJRA 1IJEA 1SGWA 2JFWA 4L51A 3DO5A 2QTFA 1KI6A 5CH3A 2WJPA 5FI1B 4FYIA 1KI8A 1P19A 1V7PC 4CVNA 3THXB 1ZM2A 5EJFA 3VGJA 3W1EA 4JBLA 4YRGA 1FB5A 4WMLA 1E2HA 2UAGA 3G8DA 1QR2A 2I7TA 5BNIA 3B7PA 2VJBA 3L8MA 4UHHA 4RACA 4QG3A 3I9MA 3WGQA 4UMDA 2DBYA 3SC4A 1WUHS 3NC4A 2W6PA 3WWEA 1SVNA 4CQMD 3SIPA 3TQOA 3IJ5A 4LKOA 3HS3A 1YUNA 3CWCA 1QK4A 2CW5A 3UOAB 1Z8DA 1CZNA 4JYPA 1T3ZA 4GOXA 1A69A 4RTSA 3K5WA 3HBMA 1S8FA 2CJWA 5LYJA 2CMHA 4FFDA 1NW3A 5L4LA 3H2BA 4UC0A 2VJYA 4NU6A 5E1OA 2YVKA 3A2NA 4LHXA 2Q28A 1MVOA 2WYOA 4RBNA 1KOFA 2FN9A 3UK7A 4B5KA 4KODA 1D0VA 5ERYA 4Z7OB 3T1TA 2HCFA 2GNAA 4TWBA 3UXHA 4HDMA 3P5BA 1DJLA 2ACEA 2B34A 3CLRC 2JKZA 2G72A 4YJ3F 1OI7A 4ES6A 3NX4A 4QAQA 4HGQA 1EP3B 1M6NA 4ZV4A 1WOMA 3TI9A 4KAJA 4XPIB 1DT3A 3BL5A 1V45E 1SZCA 3I4LA 3PI6A 2VZLA 1DX9A 1UXGA 3BMCB 2F8SA 3L0SA 3TNLA 1QH8A 3DTNA 3F5SA 3DVRX 1VSVA 2VPYA 4AFNA 1T35A 4M9XA 5EIAA 5CVDA 3OBIA 4D45A 3HM2A 1P5HA 1EGMB 1WCIB 2WZDA 4H0CA 1DDOA 4L50A 5CVEA 4C4OA 5KNBA 3ASZA 3HXPA 4LXXA 5BO5A 5E3HA 1XQVA 1SB8A 2NZWA 3FD8A 3PC3A 1IYZA 1V16B 5L7WA 1FW8A 3G5LA 2ODBA 1SIBE 2ETVA 1HM5A 4L3WA 4NFYA 5HJ7A 4JKIA 4NV3A 3VR6A 1PT8A 1NWCA 1V8DA 4I4TF 4PC1A 5DBGA 3AM1A 1VMKA 1GTSA 3CX7A 2W58A 4IIYA 1JE0A 2QTTA 3W34A 2PGJA 1F3LA 2RONA 3EMBA 3U1BA 3ES9A 3L7NA 1N1MA 6REQB 1ZCFA 1WUKS 5FBHA 3E61A 4I1PA 5K20A 5I8WA 1C4OA 1SVMA 1ZEMA 2VF5X 4M55A 1WM1A 1EINA 1ENOA 1PEYA 1P4AA 4J2TA 4YAIA 3PHHA 4U1RA 1PWHA 3T8YA 4QGSA 3KEGA 1UC5B 1UMKA 5C7YA 3UJ3X 1E6CA 1ZGCA 3FFXA 2XBMA 1B0UA 4JJ4A 2N46A 4OQPA 4YMWA 3TLJA 3KOOA 2B7CA 3UJ7A 2X8LA 2J0UA 4LVCA 1BOFA 4R5HA 1DO8A 3HSYA 2GPWA 2YS7A 3RVNA 4FW9A 4CM4A 4EA6A 5K0TA 4D3XA 5DX0A 1U0TA 3HR7A 3MTIA 4YDRA 1UXKA 2J7PD 4XYEA 1N2CA 4UOZA 1OKKD 2XVMA 2Q29A 3FDZB 4WXEA 1VIMA 3SVZA 1HKUA 1N5MA 5CDGA 5IN4A 3GLGE 4II2A 1PJ2A 4Q7EA 3DMNA 4MW2A 1G1MA 3PJFA 4BO0A 4C20A 3BTVA 5FA6A 3RE1A 4TS4A 4BQEA 1P61B 1PLKA 4PF1A 3TEMA 4BCCA 2AXPA 2VR1A 2QPOA 1WWKA 2HRCA 1QHFA 3ABQB 4KX3A 4PLHA 2NAPA 2ZUBA 5F2EA 3WLNA 5J3JA 2PX6A 3CV3A 1LSJA 1PJBA 4N01A 5LP1A 1IIRA 2PX2A 5JARA 2BGGA 3NHJA 1VIDA 1GPAA 2NIPA 1QHEA 4NESA 1YA8A 3A70A 2IPOA 4UEKA 4WK6A 2CMKA 4K9PA 4PYQA 4YHBA 3U4AA 4EQ6A 5IAOA 3L43A 2GA9A 1BDJA 4LRQA 2BEUA 3Q1KA 3RCBA 2Z1MA 1Y9AA 2PS9A 1GU1A 1OA0A 5G1NA 2Z6AA 1SIUA 3OUTA 4KX5A 4YQFA 2Z2IA 1CJKC 4I3GA 4LOJA 5AP9A 4AKEA 3TW4A 1NFQA 4L3OA 4TL8A 3S7TA 5J4KA 1YVUA 3BIXA 2F8TA 1LNQA 4LISA 1XP5A 3NHKA 4WN9A 4M2LA 5CYFA 5K3BA 5IHPA 3PT9A 5DPMA 4AJLA 5D3QA 1YZ3A 4OQNA 4ON9A 3V80A 1E4EA 2AT1A 5EPOA 2E4WA 3FN4A 3DZFA 1ZGBA 2G7MC 1AQYA 1U6KA 3K9QO 4UHDA 5KB3A 4U7GA 3P2OA 5EI5A 4JV5B 4HLNA 1IWOA 3KOUA 5H0IA 2O5RA 1L5HA 3RVDA 3TMYA 1Q1AA 3SJUA 4F85A 4WLOA 3L1UA 1RQ2A 1M7HA 3PFFA 4PYLA 3WL6A 1U5AA 4BV3A 3OCZA 3ZWYA 1RXSA 1KO8A 3JSXA 1RYEA 1XELA 5D01A 5AKYA 3RC7A 1PGOA 4U7WA 4ZYUA 5B1YA 4DEXA 4C21A 5AKKA 1N2CE 4J9UE 4EKNB 1Y3BE 1V4VA 5FPHA 4KXMA 4ALLA 1D2CA 3ETJA 1U02A 3V2HA 2QGZA 1W4LA 4LRUA 2WE7A 2PKQP 3DV2A 1JHPA 3H2YA 1ORDA 4DGSA 1D2GA 1ODFA 3J80A 4EJ6A 2EXXA 3I6IA 2HF8A 1N2GA 1W581 1M0TA 2IYOA 2RSLA 1E66A 3BICA 4E30A 4Q03A 3KJIA 4B4KA 4AZ3B 3EBOA 4YYEA 4M8LA 2L18A 1JDPA 5HCIA 3KKMA 1FDVA 1UT5A 2DWOA 2R1ZA 3IQZA 3LO5A 3Q1LA 4LWPA 4YLGA 5ALGA 4Z9YA 4OB8A 3RYIB 3HL4A 4ATNA 1I5EA 2WZBA 1H0HA 4B3XA 4E2YA 1L7RA 2Q3FA 1R74A 3UA4A 2JZCA 5A3QA 6PFKA 1BDIA 4NTZA 3PFKA 4DCCA 2CHQA 2NVOA 2ZGVA 4KFSA 2QQ0A 4N5NA 4PZEA 5ALXA 4X20A 2G4LA 4AUNA 5K0CA 3AEKB 1GAQA 3EQZA 3T7SA 3NBAA 3EIQA 4PNEA 3OO0A 1JHAA 1KKLA 3EMVA 3GN2A 2I78A 2ILVA 2BCJQ 4WKNA 4J91A 3ANXA 1JFVA 3FWZA 4IL5A 3RC8A 2D3TA 5MN5A 4JODA 1YHNA 1Z75A 2E7ZA 1T5BA 5SY6A 5D8DA 1KETA 1N9ZA 5I9LA 3OPYB 5AK3A 3CUWA 1TCBA 1VHDA 2JGIA 4WZBA 2PUCA 2EQAA 3I2YX 3I92A 2HPVA 1T9HA 3B13B 1JEEA 1U3GA 4ZQEA 3TQCA 1A72A 1WSBA 4ENRA 1BCSA 2AYYA 1JLSA 3PGKA 5D3ZA 1TDJA 3BJMA 3IUMA 5EQDA 3HVUA 3VH4A 1Z83A 3ONVA 1BU8A 1OT5A 1UODA 1G8PA 3EIHA 4QNMA 3RIMA 1MO5A 2C42A 2O50A 1V47A 4LZOA 4PAGA 1YZFA 5DHAA 1QP7A 3OZGA 1JYEA 5DWDA 1BN7A 3A2KA 4IGFA 4FNOA 2XUPA 1XALA 2E4ZA 1X8XA 3GRCA 3RT1A 1HE5A 2D7CA 2K7FA 4RDCA 4X3PA 2O0HA 1HE2A 2EZTA 3EXEA 3G2QA 3PLNA 1BA3A 1XC7A 3BHMA 4HH0A 4OIMA 5COAA 1P3DA 1U7TA 5HKLA 4L2IB 1GN8A 4NG4A 5AESA 5HSGA 1SAYA 4MAFA 2HA7A 3G1UA 1WW8A 4G8DA 1CC1S 3RTEA 2C7OA 2FHPA 1K7FB 1FVHA 4X62B 2J08A 3UXEA 2D1QA 4CETA 3GGDA 4DJDC 2PX5A 2B2XA 1HX7A 2HNKA 1K2WA 1T8PA 2I5PO 4ILEA 3NYWA 4Y6SA 3IL2A 3CWZA 1V9SA 3WRXA 1PW7A 4DIUA 1L4LA 2E4XA 2I6FA 4G5YA 5GY7A 1FP6A 1VLHA 3DL4A 1CUVA 4BO8A 3WFJA 5BP7A 2ZFUA 3B8HA 3IEIA 4PS0A 5JFOA 4MWDA 5JS7A 1U2ZA 1KDRA 1CRZA 1FL9A 2C7PA 2BP7B 2BFAA 2QTCA 2XDQB 3KZMA 4YGYA 3WK5A 3OEWA 3T54A 2W6JA 3PSAA 4ZYTA 3W5AA 3KXLA 3LNTA 4XOUA 5DT2A 2RGWA 3PEUA 5JC8A 5TT1A 3E1GA 2BW0A 4NX2A 4EPTA 3PHJA 3BIOA 3K1AA 3BGWA 2FH5B 4K28A 2X0EA 3KE9A 4GH5A 1HE8B 3BCUA 2FMTA 3EWAA 5CB4A 2BEKA 3ZWQA 1FY2A 4P4TA 5I8PA 3L82B 1VMEA 4I8DA 3S2GA 5JW6A 1C29B 1GUZA 2GYWA 5KNLA 2XTJA 4D3DA 4H0NA 2LCIA 2B99A 2YJ5A 2QE7A 3QU2A 2B83A 3IKLA 4JQCA 4BFTA 4BWFB 1H3NA 1RABA 1OYYA 2GWHA 2FYTA 5JYDA 3URKA 3HRIA 2OBBA 2OZLA 2VPWA 3JD4A 4YCJA 2Q1XA 5ALDA 2YBEA 5FNVB 1OLUB 5JWRA 5B55A 2Q5OA 1O1YA 4ARVA 5J58A 4Q7KA 3RK4A 1BYIA 2R7MA 3DYVA 4JHXA 4N9QA 1D2HA 3EZ6A 4RGVA 1E7WA 4YI5A 2Z2YA 4F7WA 3E4CA 2O1WA 4G0PA 4Y6OA 4HRAA 4Z9BA 2X0DA 3SX4A 3GF4A 3O91A 4MPPA 3VX4A 5EJ2A 2VSFA 1RAAA 4N8DA 3ZVRA 1GNTA 4KPUA 4IVPA 1G18A 3RFXA 2IODA 2CYCA 2YIMA 4IXTA 2PVPA 1YS1X 3I9KA 5I4KA 4WZAE 4PFJA 3NNDA 1GCAA 2AF4C 4BEBA 3SF8A 1OXSC 3C5WP 3QZUA 4OFWA 1XWIA 4Q01A 3KPJA 2UVQA 3MOGA 4AYWA 2B1GA 5E7MA 3N3BC 5FBLB 3C3CA 2PCLA 1BWRA 4CL8A 3TVTA 3GUZA 1Z6YA 4QEZA 4AG5A 2IBSA 1H22A 3GL9A 2EATA 2ZDGA 2Y71A 5JG7A 5KYUA 3GEBA 3BDIA 2FAXA 3T5MA 3HWWA 3WWDA 3KEFA 1ZR4A 5FO0A 4I50A 3EZYA 2CLIB 2PL5A 4PHGA 1NKSA 1UAYA 3IKJA 3OVMA 4P5DA 3EWNA 3I1JA 5HMMA 3VNAA 2OFPA 2BGIA 5FV4A 2HU5A 2B4RO 1CZRA 4QWMA 4ACAA 1EG7A 2I29A 3GIDA 1HF3A 1R9NA 3DAHA 2P2DA 2EJVA 3WV5A 2XQFA 3K0FB 2PT7A 4XIJA 4CV2A 1ACMA 3NONA 3AY3A 4E5MA 2YJ4A 3GVHA 7REQA 3DEKA 4C7OA 3O2QB 2WIFA 2V0CA 5JSQA 2Q3DA 3TRIA 2ZRJA 5CGQB 3TRDA 3MUFA 4LSWA 4RDIA 4YJGA 2BCEA 3AY0A 3RR2A 3JZDA 1IOZA 3AHDA 1ORWA 3P52A 4QYTA 1YE8A 4PNHA 1G1AA 1OV6A 2PLFA 1L5MA 1L5QA 2X5KO 4U3JB 4I3HA 4DEYA 4EEXA 6LDHA 1X86B 4MK4A 1E8NA 2I0FA 2BSXA 4JITA 5JXJA 3H9EO 1QCCA 3IFSA 1Q2XA 3CVOA 2QD3A 3M34A 4LMRA 4F4UA 3HEBA 1PFWA 3RLIA 4AWXA 4D9NA 3VH2A 2VHCA 3DVAB 2P77A 5K0FA 3OIDA 2R5FA 3AGPA 3V4FA 3SJCA 4G0VA 1GFZA 1I6KA 5EMNA 1XEWY 3MWEA 3W2HA 4LXYA 3ZBQA 1V7QA 2C4TA 2EQBA 1Z56C 2VWPA 2YC4C 4EUSA 1O4VA 1KAEA 4YJHB 2JLYA 3T7TA 4RKWA 1RPJA 4FDMA 5HILA 2FF7A 4KDEA 5C5EA 2HU2A 3JQFA 4OBBA 5K2OA 3PUXA 4V0ME 4IJ5A 4CU5A 1EDZA 2FPPA 2OK8A 1JQBA 1UANA 4N5HX 4TV9A 1TIPA 1D2NA 2X6QA 3UGTA 4MUJA