4CIPA

Spectroscopically-validated structure of ferrous cytochrome c prime from alcaligenes xylosoxidans, reduced using ascorbate
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
b'EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
molecule tags Oxidoreductase
source organism Achromobacter xylosoxidans
publication title Fingerprinting Redox and Ligand States in Haemprotein Crystal Structures Using Resonance Raman Spectroscopy.
pubmed doi rcsb
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4cipA00
4WGYA 3ZTZA 3NMJA 2XLDA 2XL6A 1RCPA 3QVZA 2XLWA 3M79A 4CIPA 3IQ6A 3FOOA 1YZCA 4NC3A 3HNKA 1A7VA 1E83A 1CGNA 1M6TA 4IAQA 5JP7A 1YYJA 3M4BA 3M4CA 4JE9A 2J9BA 1CPQA 3IQ5A 2XM0A 2XLHA 1E86A 3NMIA 3TOMA 1E84A 2XLEA 1EKYA 3HNIA 1E85A 4IARA 3ZWIA 1MQVA 2XLMA 2YLGA 2YL3A 2J8WA 2XM4A 1JAFA 4CDAA 2CCYA 4D4NA 3QW1A 1QQ3A 4U9DA 1GQAA 1APCA 5JVEA 256BA 4WGZA 4JEBA 2XLOA 3ZTMA 4ER9A 2XL8A 3QW0A 3C63A 4CDVA 5JS5A 3DE8A 4JKVA 4L6RA 3TOLA 3QVYA 2XLVA 4ULVA 1QPUA 3L1MA 4JEAA 2QLAA 4CJGA 4EIYA 4N6HA 2YKZA 1LM3B 1S05A 2BC5A 4CJOA 2YL0A 5JLIA 3HNLA 3M15A 3ZQYA 2YLIA 3HNJA 2YL7A 4U9EA 1BBHA 1CPRA 4CX9A 2YL1A 4CDYA 5AGFA 3C62A 3VRCA 1YZAA 5JRAA 4IB4A 5B3IA 5JSLA 2YLDA 4D4XA 5JT4A 1YYXA 3FOPA 3NMKA 1CGOA 3ZQVA 3DE9A 3U8PA 1NBBA 4N4WA 5JUAA
chains in the Genus database with same CATH superfamily
1H9TA 5EK0A 3EPVA 3GWNA 4YT5A 3ZTZA 3A9CA 1Q0DA 4E7ZA 4OIQF 1C02A 2NUPB 3UMKA 2LD6A 1PCXA 4ZLDA 1E2XA 2GFHA 2HV7A 2OU6A 4C3EA 4BJ5C 5A6BD 1O87A 3AG4C 2QE9A 1C17M 4MVZA 3BRJA 3IQ6A 3SNHA 3J06A 5COMA 3JYHA 1WASA 3FOOA 3OWTA 4M63A 1O3UA 1Y6DA 3S27A 4CS9C 4Z9JA 3DZAA 1CGNA 2XXAB 3RH3A 2G3KA 2HZ8A 4JW1A 1M6TA 3TD7A 3V5ZA 5JP7A 5FZTA 3NKDA 4G0HA 1U89A 4NY3A 3M4BA 4JRZA 3RYLA 1H9GA 1HW1A 1WTYA 3N24A 2A69F 1H7IA 1HE9A 2B0JA 3NYLA 4IGGA 1MMDA 5E3AA 1ZVZA 4BJ5A 1OR3A 2GAQA 1M2VB 2H8AA 3QZCA 4LACB 3NMIA 2GA0A 3V7OA 5L0CA 1I4ZA 5DS4A 3GEHA 2HS5A 1Q0KA 3HNIA 1EI7A 3FMSA 4C3DA 2HSQA 2CW0F 4KC9A 3RW0A 1A7EA 3O6XA 4I3MA 2OEVA 3CEXA 1ORJA 2HJMA 1FFHA 2NSFA 3I5PA 3SP1A 3WODF 5A6BA 1FFTC 3C8ZA 5F5HA 1VLSA 4O6YA 2PX0A 3AG3C 1LI5A 2H7BA 2R02A 4IAOA 3PCVA 4G78A 2P7VA 4JIOA 4C7OB 3JTLO 4CSAC 1D1BA 1GQAA 2R7XA 2VCAA 3A11A 4FESA 2QUPA 2PF4E 2XLOA 4IJJA 3ZTMA 2TMVP 3SXKA 2D5RB 3OA1A 2LCHA 4ONSA 3B29A 1UG7A 1MMAA 1TFKB 2LIGA 1NU7D 3MLGA 5COGA 4DBRA 1ZYRF 1GGQA 3DE8A 4EUKB 3U3BA 2KYHA 3ASNC 2XLVA 5L0GA 3K1HA 2OEXA 1QPUA 4XEKA 3C8GD 1D1CA 1WOLA 4MVMA 4E17A 4EIYA 4RD9A 1J8MF 1FMVA 4EBJA 1BZ4A 2OCCC 3AOUA 4PJLA 3E9VA 4CJOA 1LKXA 3GM3A 4B6IA 3ZC4A 4BEMJ 4BJ1A 5HSWA 4MTOA 3S90A 2VB6A 3HNLA 3M15A 3ZQYA 2VH3A 1Q0MA 1XZPA 2AWYA 2NUPA 3N2ZB 4WJ0A 2IXNA 2MHRA 3KL4A 4BEJA 2DB4A 2ETSA 3EFOB 3MFNA 4E18A 5EGYA 2CGEA 1ZHYA 4GQHA 4YJWA 3W4YA 5IY5C 1J8YF 2G62A 3CAXA 3VRCA 1YZAA 2Q9BA 2WZLA 1HMOA 3EQLF 5B1AC 4IB4A 3K33A 3UMHA 4Q5SF 5L3VA 3H2VA 5B3IA 5KYWB 3MYIA 2XSEA 1Q0GA 2YLDA 4MVOA 3EZHA 2IYLD 1YDIA 3ECSA 1I5NA 2R25A 2YHSA 5BQHA 3FOPA 1HW2A 3IPMO 3EHMA 1D0XA 1CGOA 4BJ6C 1VK5A 2KQ9A 1M2VA 1C03A 1ZZPA 4N06A 2CNWA 1FR0A 1H6GA 4E0HA 1Z5ZA 2DYRC 1M56C 1NBBA 2Q9CA 2UUHA 2VC9A 3LEVA 3T6BA 4G7HF 4JJGA 2XLDA 2XL6A 3K1IC 4KNVA 2X51A 1JPNA 3L0IA 4E0IA 1VOMA 4J32B 1D0ZA 3RQEA 3EGXB 1O5HA 2X0CA 1SYQA 5DS5A 4FWVA 4JJFA 3AQCA 3M79A 4YL3A 1TWAA 1Y4CA 2R03A 1YZCA 4DVZA 1V55C 3AGTA 3HNKA 4NC3A 1T9KA 1FMWA 1V74B 3LLKA 1Z7Qc 1VYIA 3DM9B 3RVYA 2Y69C 1ZU4A 4HFKB 4BG0A 4RDAA 2QTVA 4XPYA 3NYJA 1NFOA 2EIMC 2JD3A 2PX3A 3DJUB 3K1IA 4JE9A 3RFYA 3TJ5A 4AL1A 1IW7F 1VTMP 2L6FA 1WN0A 3AG1C 3LESA 1LPEA 1PD0A 2HKVA 1T5OA 2UUIA 3AQBA 3JSEO 5L0FA 2J0XA 3NKEA 1PD1A 5L0JA 3B9QA 2H7VC 1BR4A 3ABLC 2YRFA 2JX0A 3ATPA 4QDLA 1K40A 2FFHA 1EKYA 2ZXPA 2O9XA 4MVQA 3I4UA 4AX2A 4BJTA 1LS1A 1MQVA 3ABKC 4JZAA 3U3FA 5B3SC 2ICWG 1LS4A 1LE2A 1JRAA 4H54A 4BJ6A 3CQZA 5DQTA 1OXKA 3K6BA 2RD9A 2EPNA 1ORSC 4O6MA 2CCYA 2WB7A 2MWQA 2OOCA 3KYIA 1D0YA 1S7ZA 3CSKA 4MW3A 1OW6A 2NG1A 4YL0A 4OINF 4Q4ZF 3EH1A 2VASA 1QQ3A 4A4AA 1TWHA 2W4MA 5T3WA 4U9DA 3WHNA 1R4TA 2LSEA 3OEOA 256BA 1ST6A 3VM6A 2AVKA 2A6HF 2GDCA 2R05A 2R7VA 4ER9A 2P6VA 1I4YA 3JRMO 2XL8A 1MNEA 3B71A 3EG9B 3QW0A 4CS9A 5A69A 3HTKC 2IXOA 3GWLA 4HE8D 4CDVA 4DJ9A 5E33A 5L0DA 3KYJA 1M57C 1OW8A 2Q4FA 1Z6AA 4IRUA 2PBEA 3T9OA 3ZVRA 5JS5A 1G5ZA 3X1OA 2J7PA 4L6RA 4JTDB 1RKCA 3IEEA 1MNDA 3M1CB 2KNHA 3DWWA 3Q6MA 4I1MA 3UNGC 5L3QA 2OQMA 4LDKA 2NUTB 4JEAA 2QLAA 2VCBA 3ZIBA 1ORYA 3L34A 4Z9HA 2Y39A 1SZIA 4N6HA 4OD4A 2AWCA 4AL0A 1OCCC 2LQGA 1MMNA 1R5ID 1A7DA 4MS2A 3SYNA 5F28E 3B0UX 5CI9A 2L81A 3PHF2 2A1DD 5JLIA 3W8HA 5KYUB 5TJ5E 5BUOA 2ZXOA 2Y3DA 1OQCA 4G7OF 3HNJA 2YL7A 4U9EA 2WVOA 1BBHA 4PJNA 4P6IC 4FAPB 5AGFA 2A0UA 4U5DE 5FCLA 5KYWA 3L8JA 3LS1A 1TR2A 1F1MA 2KJGA 1YLMA 4NCQA 4K7BA 3EGDA 2LFDA 1V54C 1HY5A 4H4KC 4XWJA 2NUTA 4A2NB 5JSLA 2J9VA 1JMWA 4U5GA 2L6GA 4U5EE 3FHDA 4Z9IA 3E70C 2R9RB 5KYNA 2DI3A 1K05A 1RKEB 1YYXA 2IXPA 3JCUQ 3LAYA 4E7SA 3EJNA 3NMKA 4KI2A 4WABA 4PACA 1CGME 1KTMA 1KNYA 4NTFA 3W2VA 4YL1A 2OJED 3B0PA 3GM2A 3TJ6A 1Z3IX 1RMVA 3GODA 1RXQA 2EPOA 1YA7O 2J46A 2M64A 2PP4A 2R7RA 2KGOA 3I5QA 3LLIA 4J30B 2KSFA 4XEVA 3VYWA 1OKKA 4Q7CA 1A41A 3QVZA 1RJ9A 3EFOA 4O6NA 4DRHB 3QTHA 3PMRA 2C04A 2YVKA 1U6HA 1ZHZA 3V5XA 3FAPB 3DM5A 4PK4A 4X0RA 5L0IA 4XPXA 3AGUA 1A7VA 2XL4A 3IHUA 2F22A 3SXYA 3L8IA 1ZHXA 3Q6NA 4PR9A 2EPLX 1NG1A 3K7DA 4IAQA 1GS9A 1LIHA 3DI5A 4K1OA 3U2MA 1YYJA 4KNWA 3X2QC 3VAYA 2AP3A 2EINC 3BEHA 3RVZA 3NDBB 1IZMA 1YJGA 2KK1A 2J9BA 5F5FA 4MVUA 2BL2A 1CPQA 2DGJA 3IQ5A 2XM0A 1ZW2A 2FAPB 2EILC 1WATA 1Z23A 2JPUA 1G8XA 2W9YA 2R7UA 3DXJF 4XEFA 2QY9A 3TOMA 1OXBA 2XLEA 4U5BE 4U5CE 5E3CA 3ZSUA 1EA8A 4C3BA 2NPUA 1TWCA 5COFA 1E85A 4IARA 3PDMP 2RSEB 2I15A 2IXMA 4P9TA 3TULA 1SMYF 2XLMA 3C8GB 4MVRA 4ZLCA 2LK4A 3HJCA 1AEPA 2YLGA 2IOQA 1A0BA 1JR8A 2YL3A 1D1AA 2J8WA 3C18A 3NYMA 5DVWA 1LVKA 3DJNB 4CBEA 2Q7RA 3WAQA 3DMDA 4U5HA 5B1BC 1U0BB 3R2PA 4CDAA 5CIVA 2WZFA 4LDQA 3GORA 3SZRA 3H2UA 2LFFA 2A6EF 2W45A 1TFOB 4MTGA 3SXMA 1OCZC 4DBQA 4YWQA 5JVEA 3GEIA 4UDVA 3B0VC 1NZEA 2C03A 3U8VA 3RKOF 3T4RA 3O10A 4K0DA 4MQ9F 3U2LA 2HV6A 2DYSC 3C63A 2YEVA 2ZXWC 4LLCA 1T6UA 3TOLA 1WWPA 4YT4A 1GM5A 4I44A 3S0XA 3U9JA 1M2OA 1N1CA 1TKNA 4CS8A 3C7JA 3CZ6A 2WVQA 1ZW3A 2E87A 2OKUA 3HLZA 4JTAB 4XLPF 2Z15A 3UMIA 1V4AA 3FXHA 2YKZA 5AC5A 1JPJA 1LM3B 1S05A 2BC5A 2B0HA 2ZXRA 3LS0A 2WVNA 4JURI 5HV9A 4DVYP 2MYSA 1ZHTA 2V26A 2P61A 2R7QA 2YLIA 4P9FA 3RQGA 1K04A 1WGWA 5CI8A 4EBKA 4JVSA 2NSGA 5EHHA 1Q0FA 3G4XA 3MX3A 2L7AA 2YL1A 4MW8A 4CDYA 4CIHA 4I1OB 5A6JA 3IQTA 4AK9A 5AC4A 3GEEA 4YT8A 3UGOA 1Z63A 1FAPB 1MMGA 2Y3HA 3IQCA 4G7ZF 1HMDA 2HMQA 3W2WA 2G3VA 4ANJA 4NTAA 4IWBA 3EGXA 1VB5A 3F46A 4D4XA 3DAGA 2A68F 4OD5A 2HFIA 2L6HA 4GYTA 1DOVA 2FGYA 3AJMA 5A6KA 3S29A 1NU9C 3ZQVA 3JZ0A 3FVYA 4PJMA 3ITFA 1ZHWA 4W8PA 5T1DB 2ZPAA 4PFOA 3SXZA 3T6JA 4OIPF 1W2WA 4XPWA 3JYYA 5E2QA 1T6QA 4WGYA 1OKKD 2J9WA 3Q7GA 1L3PA 3US6A 3NMJA 2J0WA 2VCCA 2Y3BA 1RCPA 1T01A 3U5SA 4CS8C 3KH2A 3NRHA 4PFPA 5K0IA 4W8KA 2XLWA 3TQOA 3RQFA 4CSAA 2XS8A 2R7SA 1QKRA 3F47A 5DLJA 3EH2A 3QMKA 2D4UA 4CIPA 4EKWA 1XZQA 3EGDB 2YZSA 3NG1A 4NTBA 3S84A 4AE4B 4C7OA 1EQ1A 1VYKA 1E83A 3SEOA 5D91A 2EIKC 4FX5A 3U0CA 4MTFA 3JSZA 4JCHA 5L0HA 4ULWA 2J45A 2Y3GA 2HSBA 4XQ1A 4PJJA 4F4BA 2LP4A 1OW7A 3LNRA 3M4CA 2Q3TA 1FNTc 1QSPA 5KYXB 4LDRA 4RBNA 1LI7A 2XLHA 4MNDA 2W4BA 1E86A 4MVSA 2V3CC 3O39A 2HJ3A 1VLTA 3EG9A 2ZD9A 3GM1A 3V5YA 1E84A 2J7PD 2IM8A 2KC3A 2CNWD 3ZWIA 4QI2A 1VMAA 1BR1A 2PFDA 2GWWA 1DOWA 3DAFA 3ABMC 4JTCB 5KYYA 4OIOF 1RJ9B 2XM4A 4DXWA 1JAFA 2EPMX 3MBGA 2Q00A 1HE1A 3MYFA 1SF8A 4DOZA 3FAJA 4D4NA 2IBFA 3POVA 5BQIA 1BR2A 3QW1A 2OG2A 3LJBA 4BPMA 4GEHA 1APCA 1YA9A 4O7GA 4WGZA 5GPGB 3WG7C 4JEBA 4YT2A 3T6GB 2J9UA 3AG2C 4CS7A 2HUJA 4R32A 1ZU5A 3G4ZA 1UFBA 5T3TA 1PV3A 1OR2A 4YN0B 2YQYA 2ASRA 4HEAJ 1NFNA 4HFFB 3Q7LA 3O55A 1SR2A 1QZXA 2XRHA 3LNMB 3S28A 2M4EA 4EHPA 2R7TA 4KBLA 3JRTA 4J7TA 1B68A 4O79A 3RF3A 4JKVA 3QVYA 2PNOA 3UGPA 5KYYB 4ULVA 4XTKA 4EBBA 1YVIA 3DKAA 3L1MA 4XLNF 3KMIA 4CJGA 1G4US 3N0TA 3ZG1A 2R7WA 4JCZA 5DQZA 2YWAA 1KU2A 3RIPA 2BE5F 3FDQA 3C8GA 1RKEA 2WL8A 3G50A 3H65A 3LUTB 4N6CA 5BQGA 2AU5A 2YL0A 3TK0A 3UR3C 2CDQA 1LE4A 1TQGA 3ZDLA 2P0NA 3EHNA 1NLXA 5A6AA 2EPKX 2WZGA 3ASOC 5D92A 1CPRA 2OJQA 4CX9A 4LLEA 3KPHA 3HKKA 3KKBA 5DS6A 3C62A 3LEOA 1FTSA 3S9OA 1QVXA 3GANA 5JRAA 4AE4A 2L9JA 3JT1A 4QI0A 4YK5A 3U9MA 3EZIA 3R7CA 5JT4A 4U5FE 4OIRF 2A0BA 2CYDA 4LERA 4NQFA 1JOGA 2HMZA 1AUEA 4J7YA 4DRJB 3VF0A 2EIJC 1YAUO 2Q9AA 5KYXA 1L7CA 1OCRC 2H7OA 4JC7A 4DRIB 1YARO 2QNLA 1AVOB 5KYUA 1NSGB 2XXAA 2R7OA 2KW3C 2XS1A 3DE9A 4EWCA 1TWGA 1OCOC 3DD7A 1BDJB 1QLEC 3U8PA 3W8IA 1T6IA 4N4WA 1XWJA 3K66A 2I8BA 1G4WR 5JUAA 2P1AA
chains in the Genus database with same CATH topology
4WGYA 3ZTZA 3NMJA 2XLDA 2XL6A 1RCPA 3QVZA 2XLWA 3M79A 4CIPA 3IQ6A 3FOOA 1YZCA 4NC3A 3HNKA 1A7VA 1E83A 1CGNA 1M6TA 4IAQA 5JP7A 1YYJA 3M4BA 3M4CA 4JE9A 2J9BA 1CPQA 3IQ5A 2XM0A 2XLHA 1E86A 3NMIA 3TOMA 1E84A 2XLEA 1EKYA 3HNIA 1E85A 4IARA 3ZWIA 1MQVA 2XLMA 2YLGA 2YL3A 2J8WA 2XM4A 1JAFA 4CDAA 2CCYA 4D4NA 3QW1A 1QQ3A 4U9DA 1GQAA 1APCA 5JVEA 256BA 4WGZA 4JEBA 2XLOA 3ZTMA 4ER9A 2XL8A 3QW0A 3C63A 4CDVA 5JS5A 3DE8A 4JKVA 4L6RA 3TOLA 3QVYA 2XLVA 4ULVA 1QPUA 3L1MA 4JEAA 2QLAA 4CJGA 4EIYA 4N6HA 2YKZA 1LM3B 1S05A 2BC5A 4CJOA 2YL0A 5JLIA 3HNLA 3M15A 3ZQYA 2YLIA 3HNJA 2YL7A 4U9EA 1BBHA 1CPRA 4CX9A 2YL1A 4CDYA 5AGFA 3C62A 3VRCA 1YZAA 5JRAA 4IB4A 5B3IA 5JSLA 2YLDA 4D4XA 5JT4A 1YYXA 3FOPA 3NMKA 1CGOA 3ZQVA 3DE9A 3U8PA 1NBBA 4N4WA 5JUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WGY A;  3ZTZ A;  3NMJ A;  2XLD A;  2XL6 A;  1RCP A;  3QVZ A;  2XLW A;  3M79 A;  4CIP A;  3IQ6 A;  3FOO A;  1YZC A;  4NC3 A;  3HNK A;  1A7V A;  1E83 A;  1CGN A;  1M6T A;  4IAQ A;  5JP7 A;  1YYJ A;  3M4B A;  3M4C A;  4JE9 A;  2J9B A;  1CPQ A;  3IQ5 A;  2XM0 A;  2XLH A;  1E86 A;  3NMI A;  3TOM A;  1E84 A;  2XLE A;  1EKY A;  3HNI A;  1E85 A;  4IAR A;  3ZWI A;  1MQV A;  2XLM A;  2YLG A;  2YL3 A;  2J8W A;  2XM4 A;  1JAF A;  4CDA A;  2CCY A;  4D4N A;  3QW1 A;  1QQ3 A;  4U9D A;  1GQA A;  1APC A;  5JVE A;  256B A;  4WGZ A;  4JEB A;  2XLO A;  3ZTM A;  4ER9 A;  2XL8 A;  3QW0 A;  3C63 A;  4CDV A;  5JS5 A;  3DE8 A;  4JKV A;  4L6R A;  3TOL A;  3QVY A;  2XLV A;  4ULV A;  1QPU A;  3L1M A;  4JEA A;  2QLA A;  4CJG A;  4EIY A;  4N6H A;  2YKZ A;  1LM3 B;  1S05 A;  2BC5 A;  4CJO A;  2YL0 A;  5JLI A;  3HNL A;  3M15 A;  3ZQY A;  2YLI A;  3HNJ A;  2YL7 A;  4U9E A;  1BBH A;  1CPR A;  4CX9 A;  2YL1 A;  4CDY A;  5AGF A;  3C62 A;  3VRC A;  1YZA A;  5JRA A;  4IB4 A;  5B3I A;  5JSL A;  2YLD A;  4D4X A;  5JT4 A;  1YYX A;  3FOP A;  3NMK A;  1CGO A;  3ZQV A;  3DE9 A;  3U8P A;  1NBB A;  4N4W A;  5JUA A; 
#chains in the Genus database with same CATH topology
 1H9T A;  5EK0 A;  3EPV A;  3GWN A;  4YT5 A;  3ZTZ A;  3A9C A;  1Q0D A;  4E7Z A;  4OIQ F;  1C02 A;  2NUP B;  3UMK A;  2LD6 A;  1PCX A;  4ZLD A;  1E2X A;  2GFH A;  2HV7 A;  2OU6 A;  4C3E A;  4BJ5 C;  5A6B D;  1O87 A;  3AG4 C;  2QE9 A;  1C17 M;  4MVZ A;  3BRJ A;  3IQ6 A;  3SNH A;  3J06 A;  5COM A;  3JYH A;  1WAS A;  3FOO A;  3OWT A;  4M63 A;  1O3U A;  1Y6D A;  3S27 A;  4CS9 C;  4Z9J A;  3DZA A;  1CGN A;  2XXA B;  3RH3 A;  2G3K A;  2HZ8 A;  4JW1 A;  1M6T A;  3TD7 A;  3V5Z A;  5JP7 A;  5FZT A;  3NKD A;  4G0H A;  1U89 A;  4NY3 A;  3M4B A;  4JRZ A;  3RYL A;  1H9G A;  1HW1 A;  1WTY A;  3N24 A;  2A69 F;  1H7I A;  1HE9 A;  2B0J A;  3NYL A;  4IGG A;  1MMD A;  5E3A A;  1ZVZ A;  4BJ5 A;  1OR3 A;  2GAQ A;  1M2V B;  2H8A A;  3QZC A;  4LAC B;  3NMI A;  2GA0 A;  3V7O A;  5L0C A;  1I4Z A;  5DS4 A;  3GEH A;  2HS5 A;  1Q0K A;  3HNI A;  1EI7 A;  3FMS A;  4C3D A;  2HSQ A;  2CW0 F;  4KC9 A;  3RW0 A;  1A7E A;  3O6X A;  4I3M A;  2OEV A;  3CEX A;  1ORJ A;  2HJM A;  1FFH A;  2NSF A;  3I5P A;  3SP1 A;  3WOD F;  5A6B A;  1FFT C;  3C8Z A;  5F5H A;  1VLS A;  4O6Y A;  2PX0 A;  3AG3 C;  1LI5 A;  2H7B A;  2R02 A;  4IAO A;  3PCV A;  4G78 A;  2P7V A;  4JIO A;  4C7O B;  3JTL O;  4CSA C;  1D1B A;  1GQA A;  2R7X A;  2VCA A;  3A11 A;  4FES A;  2QUP A;  2PF4 E;  2XLO A;  4IJJ A;  3ZTM A;  2TMV P;  3SXK A;  2D5R B;  3OA1 A;  2LCH A;  4ONS A;  3B29 A;  1UG7 A;  1MMA A;  1TFK B;  2LIG A;  1NU7 D;  3MLG A;  5COG A;  4DBR A;  1ZYR F;  1GGQ A;  3DE8 A;  4EUK B;  3U3B A;  2KYH A;  3ASN C;  2XLV A;  5L0G A;  3K1H A;  2OEX A;  1QPU A;  4XEK A;  3C8G D;  1D1C A;  1WOL A;  4MVM A;  4E17 A;  4EIY A;  4RD9 A;  1J8M F;  1FMV A;  4EBJ A;  1BZ4 A;  2OCC C;  3AOU A;  4PJL A;  3E9V A;  4CJO A;  1LKX A;  3GM3 A;  4B6I A;  3ZC4 A;  4BEM J;  4BJ1 A;  5HSW A;  4MTO A;  3S90 A;  2VB6 A;  3HNL A;  3M15 A;  3ZQY A;  2VH3 A;  1Q0M A;  1XZP A;  2AWY A;  2NUP A;  3N2Z B;  4WJ0 A;  2IXN A;  2MHR A;  3KL4 A;  4BEJ A;  2DB4 A;  2ETS A;  3EFO B;  3MFN A;  4E18 A;  5EGY A;  2CGE A;  1ZHY A;  4GQH A;  4YJW A;  3W4Y A;  5IY5 C;  1J8Y F;  2G62 A;  3CAX A;  3VRC A;  1YZA A;  2Q9B A;  2WZL A;  1HMO A;  3EQL F;  5B1A C;  4IB4 A;  3K33 A;  3UMH A;  4Q5S F;  5L3V A;  3H2V A;  5B3I A;  5KYW B;  3MYI A;  2XSE A;  1Q0G A;  2YLD A;  4MVO A;  3EZH A;  2IYL D;  1YDI A;  3ECS A;  1I5N A;  2R25 A;  2YHS A;  5BQH A;  3FOP A;  1HW2 A;  3IPM O;  3EHM A;  1D0X A;  1CGO A;  4BJ6 C;  1VK5 A;  2KQ9 A;  1M2V A;  1C03 A;  1ZZP A;  4N06 A;  2CNW A;  1FR0 A;  1H6G A;  4E0H A;  1Z5Z A;  2DYR C;  1M56 C;  1NBB A;  2Q9C A;  2UUH A;  2VC9 A;  3LEV A;  3T6B A;  4G7H F;  4JJG A;  2XLD A;  2XL6 A;  3K1I C;  4KNV A;  2X51 A;  1JPN A;  3L0I A;  4E0I A;  1VOM A;  4J32 B;  1D0Z A;  3RQE A;  3EGX B;  1O5H A;  2X0C A;  1SYQ A;  5DS5 A;  4FWV A;  4JJF A;  3AQC A;  3M79 A;  4YL3 A;  1TWA A;  1Y4C A;  2R03 A;  1YZC A;  4DVZ A;  1V55 C;  3AGT A;  3HNK A;  4NC3 A;  1T9K A;  1FMW A;  1V74 B;  3LLK A;  1Z7Q c;  1VYI A;  3DM9 B;  3RVY A;  2Y69 C;  1ZU4 A;  4HFK B;  4BG0 A;  4RDA A;  2QTV A;  4XPY A;  3NYJ A;  1NFO A;  2EIM C;  2JD3 A;  2PX3 A;  3DJU B;  3K1I A;  4JE9 A;  3RFY A;  3TJ5 A;  4AL1 A;  1IW7 F;  1VTM P;  2L6F A;  1WN0 A;  3AG1 C;  3LES A;  1LPE A;  1PD0 A;  2HKV A;  1T5O A;  2UUI A;  3AQB A;  3JSE O;  5L0F A;  2J0X A;  3NKE A;  1PD1 A;  5L0J A;  3B9Q A;  2H7V C;  1BR4 A;  3ABL C;  2YRF A;  2JX0 A;  3ATP A;  4QDL A;  1K40 A;  2FFH A;  1EKY A;  2ZXP A;  2O9X A;  4MVQ A;  3I4U A;  4AX2 A;  4BJT A;  1LS1 A;  1MQV A;  3ABK C;  4JZA A;  3U3F A;  5B3S C;  2ICW G;  1LS4 A;  1LE2 A;  1JRA A;  4H54 A;  4BJ6 A;  3CQZ A;  5DQT A;  1OXK A;  3K6B A;  2RD9 A;  2EPN A;  1ORS C;  4O6M A;  2CCY A;  2WB7 A;  2MWQ A;  2OOC A;  3KYI A;  1D0Y A;  1S7Z A;  3CSK A;  4MW3 A;  1OW6 A;  2NG1 A;  4YL0 A;  4OIN F;  4Q4Z F;  3EH1 A;  2VAS A;  1QQ3 A;  4A4A A;  1TWH A;  2W4M A;  5T3W A;  4U9D A;  3WHN A;  1R4T A;  2LSE A;  3OEO A;  256B A;  1ST6 A;  3VM6 A;  2AVK A;  2A6H F;  2GDC A;  2R05 A;  2R7V A;  4ER9 A;  2P6V A;  1I4Y A;  3JRM O;  2XL8 A;  1MNE A;  3B71 A;  3EG9 B;  3QW0 A;  4CS9 A;  5A69 A;  3HTK C;  2IXO A;  3GWL A;  4HE8 D;  4CDV A;  4DJ9 A;  5E33 A;  5L0D A;  3KYJ A;  1M57 C;  1OW8 A;  2Q4F A;  1Z6A A;  4IRU A;  2PBE A;  3T9O A;  3ZVR A;  5JS5 A;  1G5Z A;  3X1O A;  2J7P A;  4L6R A;  4JTD B;  1RKC A;  3IEE A;  1MND A;  3M1C B;  2KNH A;  3DWW A;  3Q6M A;  4I1M A;  3UNG C;  5L3Q A;  2OQM A;  4LDK A;  2NUT B;  4JEA A;  2QLA A;  2VCB A;  3ZIB A;  1ORY A;  3L34 A;  4Z9H A;  2Y39 A;  1SZI A;  4N6H A;  4OD4 A;  2AWC A;  4AL0 A;  1OCC C;  2LQG A;  1MMN A;  1R5I D;  1A7D A;  4MS2 A;  3SYN A;  5F28 E;  3B0U X;  5CI9 A;  2L81 A;  3PHF 2;  2A1D D;  5JLI A;  3W8H A;  5KYU B;  5TJ5 E;  5BUO A;  2ZXO A;  2Y3D A;  1OQC A;  4G7O F;  3HNJ A;  2YL7 A;  4U9E A;  2WVO A;  1BBH A;  4PJN A;  4P6I C;  4FAP B;  5AGF A;  2A0U A;  4U5D E;  5FCL A;  5KYW A;  3L8J A;  3LS1 A;  1TR2 A;  1F1M A;  2KJG A;  1YLM A;  4NCQ A;  4K7B A;  3EGD A;  2LFD A;  1V54 C;  1HY5 A;  4H4K C;  4XWJ A;  2NUT A;  4A2N B;  5JSL A;  2J9V A;  1JMW A;  4U5G A;  2L6G A;  4U5E E;  3FHD A;  4Z9I A;  3E70 C;  2R9R B;  5KYN A;  2DI3 A;  1K05 A;  1RKE B;  1YYX A;  2IXP A;  3JCU Q;  3LAY A;  4E7S A;  3EJN A;  3NMK A;  4KI2 A;  4WAB A;  4PAC A;  1CGM E;  1KTM A;  1KNY A;  4NTF A;  3W2V A;  4YL1 A;  2OJE D;  3B0P A;  3GM2 A;  3TJ6 A;  1Z3I X;  1RMV A;  3GOD A;  1RXQ A;  2EPO A;  1YA7 O;  2J46 A;  2M64 A;  2PP4 A;  2R7R A;  2KGO A;  3I5Q A;  3LLI A;  4J30 B;  2KSF A;  4XEV A;  3VYW A;  1OKK A;  4Q7C A;  1A41 A;  3QVZ A;  1RJ9 A;  3EFO A;  4O6N A;  4DRH B;  3QTH A;  3PMR A;  2C04 A;  2YVK A;  1U6H A;  1ZHZ A;  3V5X A;  3FAP B;  3DM5 A;  4PK4 A;  4X0R A;  5L0I A;  4XPX A;  3AGU A;  1A7V A;  2XL4 A;  3IHU A;  2F22 A;  3SXY A;  3L8I A;  1ZHX A;  3Q6N A;  4PR9 A;  2EPL X;  1NG1 A;  3K7D A;  4IAQ A;  1GS9 A;  1LIH A;  3DI5 A;  4K1O A;  3U2M A;  1YYJ A;  4KNW A;  3X2Q C;  3VAY A;  2AP3 A;  2EIN C;  3BEH A;  3RVZ A;  3NDB B;  1IZM A;  1YJG A;  2KK1 A;  2J9B A;  5F5F A;  4MVU A;  2BL2 A;  1CPQ A;  2DGJ A;  3IQ5 A;  2XM0 A;  1ZW2 A;  2FAP B;  2EIL C;  1WAT A;  1Z23 A;  2JPU A;  1G8X A;  2W9Y A;  2R7U A;  3DXJ F;  4XEF A;  2QY9 A;  3TOM A;  1OXB A;  2XLE A;  4U5B E;  4U5C E;  5E3C A;  3ZSU A;  1EA8 A;  4C3B A;  2NPU A;  1TWC A;  5COF A;  1E85 A;  4IAR A;  3PDM P;  2RSE B;  2I15 A;  2IXM A;  4P9T A;  3TUL A;  1SMY F;  2XLM A;  3C8G B;  4MVR A;  4ZLC A;  2LK4 A;  3HJC A;  1AEP A;  2YLG A;  2IOQ A;  1A0B A;  1JR8 A;  2YL3 A;  1D1A A;  2J8W A;  3C18 A;  3NYM A;  5DVW A;  1LVK A;  3DJN B;  4CBE A;  2Q7R A;  3WAQ A;  3DMD A;  4U5H A;  5B1B C;  1U0B B;  3R2P A;  4CDA A;  5CIV A;  2WZF A;  4LDQ A;  3GOR A;  3SZR A;  3H2U A;  2LFF A;  2A6E F;  2W45 A;  1TFO B;  4MTG A;  3SXM A;  1OCZ C;  4DBQ A;  4YWQ A;  5JVE A;  3GEI A;  4UDV A;  3B0V C;  1NZE A;  2C03 A;  3U8V A;  3RKO F;  3T4R A;  3O10 A;  4K0D A;  4MQ9 F;  3U2L A;  2HV6 A;  2DYS C;  3C63 A;  2YEV A;  2ZXW C;  4LLC A;  1T6U A;  3TOL A;  1WWP A;  4YT4 A;  1GM5 A;  4I44 A;  3S0X A;  3U9J A;  1M2O A;  1N1C A;  1TKN A;  4CS8 A;  3C7J A;  3CZ6 A;  2WVQ A;  1ZW3 A;  2E87 A;  2OKU A;  3HLZ A;  4JTA B;  4XLP F;  2Z15 A;  3UMI A;  1V4A A;  3FXH A;  2YKZ A;  5AC5 A;  1JPJ A;  1LM3 B;  1S05 A;  2BC5 A;  2B0H A;  2ZXR A;  3LS0 A;  2WVN A;  4JUR I;  5HV9 A;  4DVY P;  2MYS A;  1ZHT A;  2V26 A;  2P61 A;  2R7Q A;  2YLI A;  4P9F A;  3RQG A;  1K04 A;  1WGW A;  5CI8 A;  4EBK A;  4JVS A;  2NSG A;  5EHH A;  1Q0F A;  3G4X A;  3MX3 A;  2L7A A;  2YL1 A;  4MW8 A;  4CDY A;  4CIH A;  4I1O B;  5A6J A;  3IQT A;  4AK9 A;  5AC4 A;  3GEE A;  4YT8 A;  3UGO A;  1Z63 A;  1FAP B;  1MMG A;  2Y3H A;  3IQC A;  4G7Z F;  1HMD A;  2HMQ A;  3W2W A;  2G3V A;  4ANJ A;  4NTA A;  4IWB A;  3EGX A;  1VB5 A;  3F46 A;  4D4X A;  3DAG A;  2A68 F;  4OD5 A;  2HFI A;  2L6H A;  4GYT A;  1DOV A;  2FGY A;  3AJM A;  5A6K A;  3S29 A;  1NU9 C;  3ZQV A;  3JZ0 A;  3FVY A;  4PJM A;  3ITF A;  1ZHW A;  4W8P A;  5T1D B;  2ZPA A;  4PFO A;  3SXZ A;  3T6J A;  4OIP F;  1W2W A;  4XPW A;  3JYY A;  5E2Q A;  1T6Q A;  4WGY A;  1OKK D;  2J9W A;  3Q7G A;  1L3P A;  3US6 A;  3NMJ A;  2J0W A;  2VCC A;  2Y3B A;  1RCP A;  1T01 A;  3U5S A;  4CS8 C;  3KH2 A;  3NRH A;  4PFP A;  5K0I A;  4W8K A;  2XLW A;  3TQO A;  3RQF A;  4CSA A;  2XS8 A;  2R7S A;  1QKR A;  3F47 A;  5DLJ A;  3EH2 A;  3QMK A;  2D4U A;  4CIP A;  4EKW A;  1XZQ A;  3EGD B;  2YZS A;  3NG1 A;  4NTB A;  3S84 A;  4AE4 B;  4C7O A;  1EQ1 A;  1VYK A;  1E83 A;  3SEO A;  5D91 A;  2EIK C;  4FX5 A;  3U0C A;  4MTF A;  3JSZ A;  4JCH A;  5L0H A;  4ULW A;  2J45 A;  2Y3G A;  2HSB A;  4XQ1 A;  4PJJ A;  4F4B A;  2LP4 A;  1OW7 A;  3LNR A;  3M4C A;  2Q3T A;  1FNT c;  1QSP A;  5KYX B;  4LDR A;  4RBN A;  1LI7 A;  2XLH A;  4MND A;  2W4B A;  1E86 A;  4MVS A;  2V3C C;  3O39 A;  2HJ3 A;  1VLT A;  3EG9 A;  2ZD9 A;  3GM1 A;  3V5Y A;  1E84 A;  2J7P D;  2IM8 A;  2KC3 A;  2CNW D;  3ZWI A;  4QI2 A;  1VMA A;  1BR1 A;  2PFD A;  2GWW A;  1DOW A;  3DAF A;  3ABM C;  4JTC B;  5KYY A;  4OIO F;  1RJ9 B;  2XM4 A;  4DXW A;  1JAF A;  2EPM X;  3MBG A;  2Q00 A;  1HE1 A;  3MYF A;  1SF8 A;  4DOZ A;  3FAJ A;  4D4N A;  2IBF A;  3POV A;  5BQI A;  1BR2 A;  3QW1 A;  2OG2 A;  3LJB A;  4BPM A;  4GEH A;  1APC A;  1YA9 A;  4O7G A;  4WGZ A;  5GPG B;  3WG7 C;  4JEB A;  4YT2 A;  3T6G B;  2J9U A;  3AG2 C;  4CS7 A;  2HUJ A;  4R32 A;  1ZU5 A;  3G4Z A;  1UFB A;  5T3T A;  1PV3 A;  1OR2 A;  4YN0 B;  2YQY A;  2ASR A;  4HEA J;  1NFN A;  4HFF B;  3Q7L A;  3O55 A;  1SR2 A;  1QZX A;  2XRH A;  3LNM B;  3S28 A;  2M4E A;  4EHP A;  2R7T A;  4KBL A;  3JRT A;  4J7T A;  1B68 A;  4O79 A;  3RF3 A;  4JKV A;  3QVY A;  2PNO A;  3UGP A;  5KYY B;  4ULV A;  4XTK A;  4EBB A;  1YVI A;  3DKA A;  3L1M A;  4XLN F;  3KMI A;  4CJG A;  1G4U S;  3N0T A;  3ZG1 A;  2R7W A;  4JCZ A;  5DQZ A;  2YWA A;  1KU2 A;  3RIP A;  2BE5 F;  3FDQ A;  3C8G A;  1RKE A;  2WL8 A;  3G50 A;  3H65 A;  3LUT B;  4N6C A;  5BQG A;  2AU5 A;  2YL0 A;  3TK0 A;  3UR3 C;  2CDQ A;  1LE4 A;  1TQG A;  3ZDL A;  2P0N A;  3EHN A;  1NLX A;  5A6A A;  2EPK X;  2WZG A;  3ASO C;  5D92 A;  1CPR A;  2OJQ A;  4CX9 A;  4LLE A;  3KPH A;  3HKK A;  3KKB A;  5DS6 A;  3C62 A;  3LEO A;  1FTS A;  3S9O A;  1QVX A;  3GAN A;  5JRA A;  4AE4 A;  2L9J A;  3JT1 A;  4QI0 A;  4YK5 A;  3U9M A;  3EZI A;  3R7C A;  5JT4 A;  4U5F E;  4OIR F;  2A0B A;  2CYD A;  4LER A;  4NQF A;  1JOG A;  2HMZ A;  1AUE A;  4J7Y A;  4DRJ B;  3VF0 A;  2EIJ C;  1YAU O;  2Q9A A;  5KYX A;  1L7C A;  1OCR C;  2H7O A;  4JC7 A;  4DRI B;  1YAR O;  2QNL A;  1AVO B;  5KYU A;  1NSG B;  2XXA A;  2R7O A;  2KW3 C;  2XS1 A;  3DE9 A;  4EWC A;  1TWG A;  1OCO C;  3DD7 A;  1BDJ B;  1QLE C;  3U8P A;  3W8I A;  1T6I A;  4N4W A;  1XWJ A;  3K66 A;  2I8B A;  1G4W R;  5JUA A;  2P1A A; 
#chains in the Genus database with same CATH homology
 4WGY A;  3ZTZ A;  3NMJ A;  2XLD A;  2XL6 A;  1RCP A;  3QVZ A;  2XLW A;  3M79 A;  4CIP A;  3IQ6 A;  3FOO A;  1YZC A;  4NC3 A;  3HNK A;  1A7V A;  1E83 A;  1CGN A;  1M6T A;  4IAQ A;  5JP7 A;  1YYJ A;  3M4B A;  3M4C A;  4JE9 A;  2J9B A;  1CPQ A;  3IQ5 A;  2XM0 A;  2XLH A;  1E86 A;  3NMI A;  3TOM A;  1E84 A;  2XLE A;  1EKY A;  3HNI A;  1E85 A;  4IAR A;  3ZWI A;  1MQV A;  2XLM A;  2YLG A;  2YL3 A;  2J8W A;  2XM4 A;  1JAF A;  4CDA A;  2CCY A;  4D4N A;  3QW1 A;  1QQ3 A;  4U9D A;  1GQA A;  1APC A;  5JVE A;  256B A;  4WGZ A;  4JEB A;  2XLO A;  3ZTM A;  4ER9 A;  2XL8 A;  3QW0 A;  3C63 A;  4CDV A;  5JS5 A;  3DE8 A;  4JKV A;  4L6R A;  3TOL A;  3QVY A;  2XLV A;  4ULV A;  1QPU A;  3L1M A;  4JEA A;  2QLA A;  4CJG A;  4EIY A;  4N6H A;  2YKZ A;  1LM3 B;  1S05 A;  2BC5 A;  4CJO A;  2YL0 A;  5JLI A;  3HNL A;  3M15 A;  3ZQY A;  2YLI A;  3HNJ A;  2YL7 A;  4U9E A;  1BBH A;  1CPR A;  4CX9 A;  2YL1 A;  4CDY A;  5AGF A;  3C62 A;  3VRC A;  1YZA A;  5JRA A;  4IB4 A;  5B3I A;  5JSL A;  2YLD A;  4D4X A;  5JT4 A;  1YYX A;  3FOP A;  3NMK A;  1CGO A;  3ZQV A;  3DE9 A;  3U8P A;  1NBB A;  4N4W A;  5JUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...