4CIPA

Spectroscopically-validated structure of ferrous cytochrome c prime from alcaligenes xylosoxidans, reduced using ascorbate
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fingerprinting Redox and Ligand States in Haemprotein Crystal Structures Using Resonance Raman Spectroscopy.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C'
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4cipA00
2XL8A 4L6RA 3C62A 1CPQA 4IB4A 5JUAA 3NMKA 3QW1A 5JSLA 1APCA 4U9DA 4CX9A 4D4NA 1CPRA 1QQ3A 4CDAA 1CGOA 2J8WA 3IQ6A 2XM0A 3IQ5A 4CDYA 1NBBA 2BC5A 3C63A 3M15A 2YL0A 2XLVA 1E86A 3HNJA 1YZCA 2YLDA 2YLIA 4ER9A 2YKZA 4CJOA 1A7VA 2J9BA 5JRAA 2YL7A 1LM3B 2XLOA 5AGFA 1YZAA 3HNIA 3ZTZA 2YL1A 1S05A 4IARA 3U8PA 3ZQVA 3VRCA 3ZTMA 3QVYA 5JT4A 4WGYA 1BBHA 4IAQA 4JEBA 3HNKA 3L1MA 1YYXA 3ZWIA 3FOOA 4JEAA 1MQVA 4EIYA 1GQAA 3QW0A 4NC3A 2XLDA 3DE9A 4JKVA 4D4XA 4CDVA 3QVZA 1E83A 4CJGA 5B3IA 1JAFA 2XM4A 3DE8A 2XL6A 2XLHA 2YL3A 4ULVA 4WGZA 5JLIA 2XLMA 3NMJA 5JP7A 1M6TA 1QPUA 256BA 1YYJA 3FOPA 3M4BA 4N4WA 4CIPA 4U9EA 1RCPA 3M4CA 2QLAA 3M79A 3TOLA 4N6HA 5JS5A 1EKYA 1CGNA 2XLEA 2YLGA 2CCYA 3HNLA 5JVEA 1E84A 4JE9A 3TOMA 3ZQYA 3NMIA 1E85A 2XLWA
chains in the Genus database with same CATH superfamily
3NYMA 4OD4A 1AVOB 4RDAA 1U6HA 3ITFA 4IRUA 1VYIA 1HW2A 1ORJA 1CPQA 2CDQA 3FAPB 2L81A 1V55C 1LKXA 1Z23A 3NMKA 4JTAB 3A11A 1HW1A 4DOZA 4U9DA 4JTDB 1WOLA 1NU9C 3SEOA 1CPRA 3SNHA 1TKNA 4CS8C 1SYQA 3B9QA 2HV7A 4CDAA 4E7SA 3ECSA 3FDQA 1LS1A 3LNMB 2QNLA 3GODA 1OCOC 4NTBA 5B1BC 1UFBA 2A6EF 4PFPA 1ZVZA 4K1OA 1TR2A 4BJTA 4AL0A 1MMGA 5COMA 5COFA 3LNRA 2A6HF 2YL0A 4XEKA 1E86A 3K66A 5TJ5E 4C3BA 3DXJF 5KYYA 3POVA 4K7BA 5E3AA 1GM5A 3CAXA 4XEVA 2TMVP 4I44A 4ER9A 3W4YA 2CNWA 3KKBA 1NU7D 3RW0A 3VM6A 2YL7A 2J7PA 3GEEA 3JRMO 2R7SA 1M57C 2RD9A 3K1IA 3B71A 1D0ZA 1OR3A 3C8ZA 2OEXA 3KMIA 5AGFA 3ZTZA 2R9RB 4FX5A 5L0JA 2KJGA 1O3UA 4PJNA 3ZSUA 4IARA 5L0HA 1SR2A 2VCBA 3U8PA 3ZQVA 3FAJA 2H7BA 3QVYA 2QE9A 4A2NB 4PACA 1BBHA 4JW1A 1FMVA 1TFKB 3K33A 1XZPA 4U5HA 1ZW2A 4J32B 4NQFA 4IGGA 4BJ6A 4JURI 2NSGA 4GEHA 1H9GA 4G7ZF 1T6IA 2QUPA 3ZVRA 1D0XA 4IWBA 3S28A 2IOQA 4YT8A 1T6QA 3FXHA 3US6A 2RSEB 1G8XA 4LACB 4JEAA 1LS4A 2YEVA 3H2UA 2DYRC 2EIMC 3QW0A 2XLDA 4IAOA 3MYFA 1FTSA 3RYLA 1NZEA 1VTMP 1AEPA 2R03A 3UMIA 1KTMA 4JKVA 4I3MA 1OCZC 4GYTA 5BQGA 5BQHA 2UUIA 3AJMA 3KL4A 3U8VA 2Q9CA 3DI5A 4E18A 2KW3C 2XRHA 3GEHA 4CJGA 4DVYP 4Q4ZF 1L7CA 4K0DA 4OIQF 3DE8A 1OW7A 2XLHA 1N1CA 4C3EA 1F1MA 2D5RB 3B0VC 2XLMA 3K6BA 3HLZA 1HE1A 1G4WR 1C17M 5KYUA 1A7DA 1FR0A 1YYJA 4BJ1A 5DQTA 3J06A 3IQCA 4KBLA 2PBEA 4N4WA 2AWYA 2LD6A 4XLPF 1ZHXA 3ASNC 3M4CA 5D92A 4OINF 3TOLA 4AL1A 3FVYA 2QTVA 3G50A 1OCRC 1U89A 2F22A 3RQEA 1Q0GA 1SZIA 2EILC 2VCCA 4CIHA 4RBNA 1EKYA 2GWWA 5E33A 1ZU5A 4EWCA 4DRIB 1H7IA 3X1OA 2D4UA 2YLGA 3O10A 2ICWG 4EBKA 1GGQA 3MBGA 2HSQA 3L34A 3C8GB 1L3PA 3CEXA 5A69A 1RMVA 3GWLA 4ZLDA 3E70C 4KC9A 2L7AA 3WAQA 2UUHA 2WVOA 5A6KA 3NMIA 1PCXA 1LI5A 3DJUB 1QZXA 1WN0A 2YHSA 3N24A 3K1HA 2KGOA 2XL8A 3UGOA 2M64A 2GAQA 3CSKA 2PFDA 4WJ0A 2XS1A 5KYXA 2H7OA 2BE5F 4O6MA 1MMNA 3GORA 3KH2A 3LAYA 5A6JA 1OXKA 4PK4A 4QI2A 4CX9A 4D4NA 1QQ3A 2IYLD 3L0IA 2C04A 2KSFA 3EFOB 1GS9A 2R7RA 5L3VA 2I8BA 2YWAA 1R4TA 3L8JA 3U2LA 3IQ6A 1ZHWA 2W45A 4EBBA 2HFIA 1V74B 2ZXWC 4CDYA 1NBBA 2BC5A 1WGWA 3LJBA 1HY5A 4FESA 1H6GA 2XLVA 2ETSA 4JTCB 3HJCA 3RIPA 3HNJA 2Y3DA 1KNYA 5DLJA 2XXAA 3S90A 4LERA 2YLIA 4FWVA 1BZ4A 2YKZA 3MLGA 2QY9A 1NSGB 4CJOA 2J9BA 4MVMA 5JRAA 2OJQA 4HFKB 2LFFA 3Q7GA 2PNOA 3NG1A 4U5GA 3EQLF 3KPHA 2XLOA 4F4BA 2HSBA 1YZAA 3HNIA 3QTHA 3GWNA 4JIOA 5T1DB 1ZU4A 2OOCA 2P1AA 2CW0F 3UMKA 4I1MA 4PR9A 1OR2A 1ZHZA 2KYHA 2VH3A 2HUJA 4JCHA 4AX2A 3VRCA 5DS5A 3B0UX 3T4RA 4MVSA 4W8KA 2Y39A 3ZTMA 2Q7RA 4BEJA 4DBQA 4IAQA 4A4AA 4Z9IA 3ATPA 1QSPA 2Q9AA 2FFHA 4LDRA 2IXOA 1BR2A 3DWWA 5F5HA 1EA8A 2CYDA 2PX3A 1O87A 1ST6A 3L1MA 2ZD9A 3NRHA 1Z7Qc 1M2VA 1LE4A 2XS8A 4CS8A 2OKUA 1K40A 1D1CA 2B0JA 1MQVA 1Q0KA 2HJ3A 4YK5A 1GQAA 2VB6A 4NC3A 5T3WA 3DKAA 4YT4A 1V54C 4MW3A 3LS1A 3T9OA 3IPMO 1VLSA 1C03A 1D0YA 4HEAJ 1AUEA 3LUTB 2Q4FA 4C7OB 1WATA 3LLIA 3TK0A 3U9MA 4AE4B 4XPYA 3JT1A 4U5FE 2EINC 5B3IA 1E85A 1DOWA 2LCHA 2EPMX 4G78A 1J8YF 2CGEA 4WGZA 4CS7A 4HFFB 5JLIA 3JTLO 4Q7CA 4U5CE 5K0IA 4QI0A 3AG1C 1QPUA 1RXQA 3JRTA 3AOUA 5KYUB 3TJ6A 3GANA 4KNVA 4QDLA 2A0UA 4G0HA 3M4BA 1ORYA 3JSEO 1BR4A 3EG9B 1TWAA 4BEMJ 2OU6A 3KYIA 5CI9A 3OA1A 4YL1A 2W4MA 3RKOF 2QLAA 1MMAA 3M79A 4LDQA 4YL0A 1K04A 2J9UA 3FHDA 3AG2C 3I4UA 4MTFA 4H54A 4G7OF 2YVKA 3LS0A 4PJLA 1T6UA 1U0BB 3GM3A 3I5PA 3UNGC 2ZXOA 3SYNA 3ABLC 1MMDA 1CGNA 2E87A 2V3CC 2AP3A 2XLEA 5DS6A 4OIRF 2Y69C 2L6FA 5KYNA 1XZQA 3HNLA 3EPVA 3RVZA 2DGJA 1RKEB 3EGDB 3C8GA 1HMDA 1SMYF 4M63A 5CI8A 4Q5SF 1QKRA 4XQ1A 1PD0A 4H4KC 2NUTB 3Q6MA 3R2PA 1MNDA 3TQOA 4C3DA 3SXMA 3O39A 3S84A 3W2VA 4JJGA 3MX3A 4XPWA 2C03A 2ASRA 2NUPA 4MTOA 4BG0A 4L6RA 5HSWA 2MHRA 2P7VA 3C62A 5F5FA 3SXZA 3X2QC 2H8AA 4P6IC 5JUAA 1S7ZA 3DZAA 1PD1A 1RJ9A 2AVKA 2EPKX 2LK4A 3S0XA 3AG3C 1ZHYA 3U2MA 4YJWA 4LLCA 4MVQA 2J9VA 3IEEA 5JSLA 1J8MF 3U3BA 3VF0A 1APCA 3EZIA 2HV6A 5EGYA 2Y3GA 5F28E 3RQGA 5BQIA 1RKEA 2DYSC 1CGOA 2OEVA 3EGDA 2J8WA 4J30B 3U5SA 4BPMA 4YN0B 5T3TA 2R7TA 1ZYRF 2IM8A 3NYJA 4U5EE 2NUTA 2IXNA 4BJ5A 3HTKC 3IQ5A 5A6BD 2JX0A 3C63A 1T01A 2LSEA 2NSFA 3Q6NA 2NUPB 2R7XA 1B68A 3BEHA 3O6XA 2R7UA 5EK0A 3V5ZA 1D1BA 2OJED 3N0TA 4X0RA 1K05A 2YLDA 1MNEA 1RJ9B 4O6NA 1A7VA 3M1CB 1D1AA 2HKVA 1LM3B 2GDCA 2XL4A 2Y3BA 3ZIBA 4NCQA 1YA7O 1PV3A 1JPNA 3WODF 5L0IA 2AWCA 1R5ID 2PF4E 2R25A 4ONSA 5DS4A 1FMWA 1Z3IX 2O9XA 3ASOC 1ZHTA 4N06A 1NG1A 1A0BA 3C18A 3LESA 5L0GA 4WGYA 4DVZA 4IJJA 3FMSA 1Y6DA 5L0FA 4MW8A 1CGME 3JYHA 3EHNA 4KI2A 3EHMA 1T5OA 3MYIA 4NY3A 3DM9B 3EJNA 3HNKA 3NYLA 3V5YA 4Z9HA 1JMWA 1YYXA 3LEVA 4U5DE 4YL3A 3TJ5A 3ZWIA 4CSAA 1Z5ZA 1M2VB 3FOOA 5CIVA 4CSAC 4HE8D 4EIYA 5E2QA 1C02A 3VAYA 3DE9A 4BJ5C 4JC7A 2LIGA 3G4XA 4OIOF 2VCAA 1ZW3A 3MFNA 4NTFA 1EQ1A 2HS5A 2ZXRA 4CDVA 4MVUA 1YVIA 3UR3C 1O5HA 3DM5A 3W2WA 1JR8A 2R05A 1YDIA 3H2VA 3QVZA 4O79A 2IBFA 2VASA 5KYWA 4MTGA 2R7WA 4G7HF 4AE4A 3SXYA 4P9TA 3TD7A 1OW8A 3VYWA 1JAFA 5AC5A 2OQMA 2XL6A 2YL3A 4ULVA 4OIPF 4XEFA 2J46A 3NMJA 1YAUO 1VLTA 3OEOA 2R7QA 4ANJA 1T9KA 256BA 4UDVA 1ORSC 2P0NA 2LP4A 1HMOA 3N2ZB 5EHHA 5E3CA 2J45A 2J7PD 3EG9A 3GM1A 4ZLCA 1OKKA 1IZMA 1RCPA 2KC3A 2Q9BA 2J0XA 3DAFA 3EH1A 3NKDA 4JZAA 5FZTA 3JZ0A 3Q7LA 3IHUA 2FGYA 2JD3A 3A9CA 1VOMA 4I1OB 5BUOA 2WZGA 2Q00A 3AGUA 1I4YA 2WZFA 4KNWA 4CBEA 2J9WA 2IXMA 2KNHA 4U5BE 3RVYA 3SZRA 5L3QA 1OKKD 3T6JA 3AGTA 3EFOA 1XWJA 3RH3A 2KK1A 3ABMC 3EGXA 3O55A 4EUKB 1E84A 3ZG1A 4JE9A 3TOMA 5HV9A 3ZQYA 1BR1A 3W8HA 2GFHA 3B29A 2XLWA 3C8GD 2J0WA 4XTKA 3HKKA 4EHPA 3JCUQ 3PMRA 1YLMA 1TFOB 3F46A 5L0CA 4GQHA 1TWGA 1Q0MA 3S9OA 1WTYA 3S27A 3JYYA 3U3FA 4IB4A 2I15A 3TULA 2W9YA 4PFOA 3U0CA 3QW1A 3SP1A 4WABA 2R7VA 3LLKA 5A6BA 3RF3A 4PJMA 5AC4A 1I4ZA 4MQ9F 5GPGB 2YRFA 4MS2A 4ULWA 2YQYA 4MVRA 1Q0DA 3BRJA 2XM0A 4MNDA 4J7TA 5FCLA 3QMKA 2NPUA 4OD5A 1LI7A 2AU5A 2WB7A 4E17A 4P9FA 2G62A 2Q3TA 3M15A 3C7JA 1IW7F 3PHF2 1TWHA 1KU2A 1YZCA 3EZHA 1Q0FA 1JPJA 2FAPB 3GEIA 3GM2A 4CS9C 5KYXB 3NDBB 4JVSA 1SF8A 3ZDLA 4AK9A 4O6YA 2L6HA 3DAGA 2KQ9A 1M56C 4EKWA 2WL8A 3K1IC 3SXKA 3V5XA 2EPLX 1JRAA 2G3VA 4E7ZA 1Y4CA 2L6GA 2A0BA 2IXPA 1VB5A 2YL1A 4MVZA 3UGPA 1S05A 2L9JA 2HMZA 3ZC4A 2HZ8A 1LE2A 2A1DD 5D91A 1E2XA 3B0PA 4DBRA 2R02A 1A7EA 1BDJB 2EPOA 5JT4A 1FFHA 3QZCA 1I5NA 3U9JA 2OCCC 3UMHA 1TQGA 1V4AA 2LQGA 2W4BA 4JEBA 2Z15A 1VMAA 3EGXB 5A6AA 1OXBA 2LFDA 4N6CA 5B1AC 1Z63A 1RKCA 1LVKA 4NTAA 4PJJA 3T6GB 1ZZPA 2B0HA 5COGA 4FAPB 1NLXA 5B3SC 1H9TA 2XXAB 2G3KA 2CNWD 3L8IA 4Z9JA 2H7VC 2X51A 3ABKC 5IY5C 3CQZA 3RFYA 1G4US 5L0DA 4XPXA 2DI3A 2GA0A 3K7DA 4YWQA 3I5QA 2XSEA 2WVQA 2NG1A 4D4XA 2YZSA 3DD7A 3JSZA 4MVOA 3WG7C 4R32A 2Y3HA 4E0IA 3CZ6A 1UG7A 3E9VA 1W2WA 2A69F 4RD9A 2MYSA 5KYWB 1E83A 4EBJA 2MWQA 2ZXPA 2XM4A 4J7YA 1OCCC 1OQCA 3EH2A 2P61A 1FNTc 1WWPA 1NFNA 3AG4C 2BL2A 4YT5A 2EPNA 4DJ9A 2X0CA 3LEOA 5JP7A 4JRZA 3R7CA 3S29A 1M6TA 1NFOA 2EIKC 4LLEA 4DXWA 2EIJC 4B6IA 5KYYB 4O7GA 1WASA 3FOPA 3H65A 3WHNA 3W8IA 1EI7A 1JOGA 2M4EA 2P6VA 4U9EA 4CIPA 1TWCA 3V7OA 3DMDA 2ZPAA 4DRHB 3RQFA 1DOVA 2V26A 5DQZA 4N6HA 2DB4A 3F47A 3G4ZA 4XLNF 1LIHA 3DJNB 5DVWA 2WVNA 3IQTA 3KYJA 3PCVA 4BJ6C 5JS5A 4JJFA 1QVXA 1Z6AA 4C7OA 1VK5A 1OW6A 2OG2A 3OWTA 4JCZA 4XWJA 1G5ZA 1QLEC 2R7OA 1A41A 1HE9A 2A68F 2HJMA 2WZLA 4LDKA 2CCYA 1FAPB 1VYKA 1YARO 1LPEA 2HMQA 2PX0A 4W8PA 4CS9A 5JVEA 2JPUA 3AQCA 1FFTC 3AQBA 3NKEA 3PDMP 2PP4A 4DRJB 1YA9A 4E0HA 4YT2A 1M2OA 3T6BA 1YJGA 2VC9A
chains in the Genus database with same CATH topology
2XL8A 4L6RA 3C62A 1CPQA 4IB4A 5JUAA 3NMKA 3QW1A 5JSLA 1APCA 4U9DA 4CX9A 4D4NA 1CPRA 1QQ3A 4CDAA 1CGOA 2J8WA 3IQ6A 2XM0A 3IQ5A 4CDYA 1NBBA 2BC5A 3C63A 3M15A 2YL0A 2XLVA 1E86A 3HNJA 1YZCA 2YLDA 2YLIA 4ER9A 2YKZA 4CJOA 1A7VA 2J9BA 5JRAA 2YL7A 1LM3B 2XLOA 5AGFA 1YZAA 3HNIA 3ZTZA 2YL1A 1S05A 4IARA 3U8PA 3ZQVA 3VRCA 3ZTMA 3QVYA 5JT4A 4WGYA 1BBHA 4IAQA 4JEBA 3HNKA 3L1MA 1YYXA 3ZWIA 3FOOA 4JEAA 1MQVA 4EIYA 1GQAA 3QW0A 4NC3A 2XLDA 3DE9A 4JKVA 4D4XA 4CDVA 3QVZA 1E83A 4CJGA 5B3IA 1JAFA 2XM4A 3DE8A 2XL6A 2XLHA 2YL3A 4ULVA 4WGZA 5JLIA 2XLMA 3NMJA 5JP7A 1M6TA 1QPUA 256BA 1YYJA 3FOPA 3M4BA 4N4WA 4CIPA 4U9EA 1RCPA 3M4CA 2QLAA 3M79A 3TOLA 4N6HA 5JS5A 1EKYA 1CGNA 2XLEA 2YLGA 2CCYA 3HNLA 5JVEA 1E84A 4JE9A 3TOMA 3ZQYA 3NMIA 1E85A 2XLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XL8 A;  4L6R A;  3C62 A;  1CPQ A;  4IB4 A;  5JUA A;  3NMK A;  3QW1 A;  5JSL A;  1APC A;  4U9D A;  4CX9 A;  4D4N A;  1CPR A;  1QQ3 A;  4CDA A;  1CGO A;  2J8W A;  3IQ6 A;  2XM0 A;  3IQ5 A;  4CDY A;  1NBB A;  2BC5 A;  3C63 A;  3M15 A;  2YL0 A;  2XLV A;  1E86 A;  3HNJ A;  1YZC A;  2YLD A;  2YLI A;  4ER9 A;  2YKZ A;  4CJO A;  1A7V A;  2J9B A;  5JRA A;  2YL7 A;  1LM3 B;  2XLO A;  5AGF A;  1YZA A;  3HNI A;  3ZTZ A;  2YL1 A;  1S05 A;  4IAR A;  3U8P A;  3ZQV A;  3VRC A;  3ZTM A;  3QVY A;  5JT4 A;  4WGY A;  1BBH A;  4IAQ A;  4JEB A;  3HNK A;  3L1M A;  1YYX A;  3ZWI A;  3FOO A;  4JEA A;  1MQV A;  4EIY A;  1GQA A;  3QW0 A;  4NC3 A;  2XLD A;  3DE9 A;  4JKV A;  4D4X A;  4CDV A;  3QVZ A;  1E83 A;  4CJG A;  5B3I A;  1JAF A;  2XM4 A;  3DE8 A;  2XL6 A;  2XLH A;  2YL3 A;  4ULV A;  4WGZ A;  5JLI A;  2XLM A;  3NMJ A;  5JP7 A;  1M6T A;  1QPU A;  256B A;  1YYJ A;  3FOP A;  3M4B A;  4N4W A;  4CIP A;  4U9E A;  1RCP A;  3M4C A;  2QLA A;  3M79 A;  3TOL A;  4N6H A;  5JS5 A;  1EKY A;  1CGN A;  2XLE A;  2YLG A;  2CCY A;  3HNL A;  5JVE A;  1E84 A;  4JE9 A;  3TOM A;  3ZQY A;  3NMI A;  1E85 A;  2XLW A; 
#chains in the Genus database with same CATH topology
 3NYM A;  4OD4 A;  1AVO B;  4RDA A;  1U6H A;  3ITF A;  4IRU A;  1VYI A;  1HW2 A;  1ORJ A;  1CPQ A;  2CDQ A;  3FAP B;  2L81 A;  1V55 C;  1LKX A;  1Z23 A;  3NMK A;  4JTA B;  3A11 A;  1HW1 A;  4DOZ A;  4U9D A;  4JTD B;  1WOL A;  1NU9 C;  3SEO A;  1CPR A;  3SNH A;  1TKN A;  4CS8 C;  1SYQ A;  3B9Q A;  2HV7 A;  4CDA A;  4E7S A;  3ECS A;  3FDQ A;  1LS1 A;  3LNM B;  2QNL A;  3GOD A;  1OCO C;  4NTB A;  5B1B C;  1UFB A;  2A6E F;  4PFP A;  1ZVZ A;  4K1O A;  1TR2 A;  4BJT A;  4AL0 A;  1MMG A;  5COM A;  5COF A;  3LNR A;  2A6H F;  2YL0 A;  4XEK A;  1E86 A;  3K66 A;  5TJ5 E;  4C3B A;  3DXJ F;  5KYY A;  3POV A;  4K7B A;  5E3A A;  1GM5 A;  3CAX A;  4XEV A;  2TMV P;  4I44 A;  4ER9 A;  3W4Y A;  2CNW A;  3KKB A;  1NU7 D;  3RW0 A;  3VM6 A;  2YL7 A;  2J7P A;  3GEE A;  3JRM O;  2R7S A;  1M57 C;  2RD9 A;  3K1I A;  3B71 A;  1D0Z A;  1OR3 A;  3C8Z A;  2OEX A;  3KMI A;  5AGF A;  3ZTZ A;  2R9R B;  4FX5 A;  5L0J A;  2KJG A;  1O3U A;  4PJN A;  3ZSU A;  4IAR A;  5L0H A;  1SR2 A;  2VCB A;  3U8P A;  3ZQV A;  3FAJ A;  2H7B A;  3QVY A;  2QE9 A;  4A2N B;  4PAC A;  1BBH A;  4JW1 A;  1FMV A;  1TFK B;  3K33 A;  1XZP A;  4U5H A;  1ZW2 A;  4J32 B;  4NQF A;  4IGG A;  4BJ6 A;  4JUR I;  2NSG A;  4GEH A;  1H9G A;  4G7Z F;  1T6I A;  2QUP A;  3ZVR A;  1D0X A;  4IWB A;  3S28 A;  2IOQ A;  4YT8 A;  1T6Q A;  3FXH A;  3US6 A;  2RSE B;  1G8X A;  4LAC B;  4JEA A;  1LS4 A;  2YEV A;  3H2U A;  2DYR C;  2EIM C;  3QW0 A;  2XLD A;  4IAO A;  3MYF A;  1FTS A;  3RYL A;  1NZE A;  1VTM P;  1AEP A;  2R03 A;  3UMI A;  1KTM A;  4JKV A;  4I3M A;  1OCZ C;  4GYT A;  5BQG A;  5BQH A;  2UUI A;  3AJM A;  3KL4 A;  3U8V A;  2Q9C A;  3DI5 A;  4E18 A;  2KW3 C;  2XRH A;  3GEH A;  4CJG A;  4DVY P;  4Q4Z F;  1L7C A;  4K0D A;  4OIQ F;  3DE8 A;  1OW7 A;  2XLH A;  1N1C A;  4C3E A;  1F1M A;  2D5R B;  3B0V C;  2XLM A;  3K6B A;  3HLZ A;  1HE1 A;  1G4W R;  1C17 M;  5KYU A;  1A7D A;  1FR0 A;  1YYJ A;  4BJ1 A;  5DQT A;  3J06 A;  3IQC A;  4KBL A;  2PBE A;  4N4W A;  2AWY A;  2LD6 A;  4XLP F;  1ZHX A;  3ASN C;  3M4C A;  5D92 A;  4OIN F;  3TOL A;  4AL1 A;  3FVY A;  2QTV A;  3G50 A;  1OCR C;  1U89 A;  2F22 A;  3RQE A;  1Q0G A;  1SZI A;  2EIL C;  2VCC A;  4CIH A;  4RBN A;  1EKY A;  2GWW A;  5E33 A;  1ZU5 A;  4EWC A;  4DRI B;  1H7I A;  3X1O A;  2D4U A;  2YLG A;  3O10 A;  2ICW G;  4EBK A;  1GGQ A;  3MBG A;  2HSQ A;  3L34 A;  3C8G B;  1L3P A;  3CEX A;  5A69 A;  1RMV A;  3GWL A;  4ZLD A;  3E70 C;  4KC9 A;  2L7A A;  3WAQ A;  2UUH A;  2WVO A;  5A6K A;  3NMI A;  1PCX A;  1LI5 A;  3DJU B;  1QZX A;  1WN0 A;  2YHS A;  3N24 A;  3K1H A;  2KGO A;  2XL8 A;  3UGO A;  2M64 A;  2GAQ A;  3CSK A;  2PFD A;  4WJ0 A;  2XS1 A;  5KYX A;  2H7O A;  2BE5 F;  4O6M A;  1MMN A;  3GOR A;  3KH2 A;  3LAY A;  5A6J A;  1OXK A;  4PK4 A;  4QI2 A;  4CX9 A;  4D4N A;  1QQ3 A;  2IYL D;  3L0I A;  2C04 A;  2KSF A;  3EFO B;  1GS9 A;  2R7R A;  5L3V A;  2I8B A;  2YWA A;  1R4T A;  3L8J A;  3U2L A;  3IQ6 A;  1ZHW A;  2W45 A;  4EBB A;  2HFI A;  1V74 B;  2ZXW C;  4CDY A;  1NBB A;  2BC5 A;  1WGW A;  3LJB A;  1HY5 A;  4FES A;  1H6G A;  2XLV A;  2ETS A;  4JTC B;  3HJC A;  3RIP A;  3HNJ A;  2Y3D A;  1KNY A;  5DLJ A;  2XXA A;  3S90 A;  4LER A;  2YLI A;  4FWV A;  1BZ4 A;  2YKZ A;  3MLG A;  2QY9 A;  1NSG B;  4CJO A;  2J9B A;  4MVM A;  5JRA A;  2OJQ A;  4HFK B;  2LFF A;  3Q7G A;  2PNO A;  3NG1 A;  4U5G A;  3EQL F;  3KPH A;  2XLO A;  4F4B A;  2HSB A;  1YZA A;  3HNI A;  3QTH A;  3GWN A;  4JIO A;  5T1D B;  1ZU4 A;  2OOC A;  2P1A A;  2CW0 F;  3UMK A;  4I1M A;  4PR9 A;  1OR2 A;  1ZHZ A;  2KYH A;  2VH3 A;  2HUJ A;  4JCH A;  4AX2 A;  3VRC A;  5DS5 A;  3B0U X;  3T4R A;  4MVS A;  4W8K A;  2Y39 A;  3ZTM A;  2Q7R A;  4BEJ A;  4DBQ A;  4IAQ A;  4A4A A;  4Z9I A;  3ATP A;  1QSP A;  2Q9A A;  2FFH A;  4LDR A;  2IXO A;  1BR2 A;  3DWW A;  5F5H A;  1EA8 A;  2CYD A;  2PX3 A;  1O87 A;  1ST6 A;  3L1M A;  2ZD9 A;  3NRH A;  1Z7Q c;  1M2V A;  1LE4 A;  2XS8 A;  4CS8 A;  2OKU A;  1K40 A;  1D1C A;  2B0J A;  1MQV A;  1Q0K A;  2HJ3 A;  4YK5 A;  1GQA A;  2VB6 A;  4NC3 A;  5T3W A;  3DKA A;  4YT4 A;  1V54 C;  4MW3 A;  3LS1 A;  3T9O A;  3IPM O;  1VLS A;  1C03 A;  1D0Y A;  4HEA J;  1AUE A;  3LUT B;  2Q4F A;  4C7O B;  1WAT A;  3LLI A;  3TK0 A;  3U9M A;  4AE4 B;  4XPY A;  3JT1 A;  4U5F E;  2EIN C;  5B3I A;  1E85 A;  1DOW A;  2LCH A;  2EPM X;  4G78 A;  1J8Y F;  2CGE A;  4WGZ A;  4CS7 A;  4HFF B;  5JLI A;  3JTL O;  4Q7C A;  4U5C E;  5K0I A;  4QI0 A;  3AG1 C;  1QPU A;  1RXQ A;  3JRT A;  3AOU A;  5KYU B;  3TJ6 A;  3GAN A;  4KNV A;  4QDL A;  2A0U A;  4G0H A;  3M4B A;  1ORY A;  3JSE O;  1BR4 A;  3EG9 B;  1TWA A;  4BEM J;  2OU6 A;  3KYI A;  5CI9 A;  3OA1 A;  4YL1 A;  2W4M A;  3RKO F;  2QLA A;  1MMA A;  3M79 A;  4LDQ A;  4YL0 A;  1K04 A;  2J9U A;  3FHD A;  3AG2 C;  3I4U A;  4MTF A;  4H54 A;  4G7O F;  2YVK A;  3LS0 A;  4PJL A;  1T6U A;  1U0B B;  3GM3 A;  3I5P A;  3UNG C;  2ZXO A;  3SYN A;  3ABL C;  1MMD A;  1CGN A;  2E87 A;  2V3C C;  2AP3 A;  2XLE A;  5DS6 A;  4OIR F;  2Y69 C;  2L6F A;  5KYN A;  1XZQ A;  3HNL A;  3EPV A;  3RVZ A;  2DGJ A;  1RKE B;  3EGD B;  3C8G A;  1HMD A;  1SMY F;  4M63 A;  5CI8 A;  4Q5S F;  1QKR A;  4XQ1 A;  1PD0 A;  4H4K C;  2NUT B;  3Q6M A;  3R2P A;  1MND A;  3TQO A;  4C3D A;  3SXM A;  3O39 A;  3S84 A;  3W2V A;  4JJG A;  3MX3 A;  4XPW A;  2C03 A;  2ASR A;  2NUP A;  4MTO A;  4BG0 A;  4L6R A;  5HSW A;  2MHR A;  2P7V A;  3C62 A;  5F5F A;  3SXZ A;  3X2Q C;  2H8A A;  4P6I C;  5JUA A;  1S7Z A;  3DZA A;  1PD1 A;  1RJ9 A;  2AVK A;  2EPK X;  2LK4 A;  3S0X A;  3AG3 C;  1ZHY A;  3U2M A;  4YJW A;  4LLC A;  4MVQ A;  2J9V A;  3IEE A;  5JSL A;  1J8M F;  3U3B A;  3VF0 A;  1APC A;  3EZI A;  2HV6 A;  5EGY A;  2Y3G A;  5F28 E;  3RQG A;  5BQI A;  1RKE A;  2DYS C;  1CGO A;  2OEV A;  3EGD A;  2J8W A;  4J30 B;  3U5S A;  4BPM A;  4YN0 B;  5T3T A;  2R7T A;  1ZYR F;  2IM8 A;  3NYJ A;  4U5E E;  2NUT A;  2IXN A;  4BJ5 A;  3HTK C;  3IQ5 A;  5A6B D;  2JX0 A;  3C63 A;  1T01 A;  2LSE A;  2NSF A;  3Q6N A;  2NUP B;  2R7X A;  1B68 A;  3BEH A;  3O6X A;  2R7U A;  5EK0 A;  3V5Z A;  1D1B A;  2OJE D;  3N0T A;  4X0R A;  1K05 A;  2YLD A;  1MNE A;  1RJ9 B;  4O6N A;  1A7V A;  3M1C B;  1D1A A;  2HKV A;  1LM3 B;  2GDC A;  2XL4 A;  2Y3B A;  3ZIB A;  4NCQ A;  1YA7 O;  1PV3 A;  1JPN A;  3WOD F;  5L0I A;  2AWC A;  1R5I D;  2PF4 E;  2R25 A;  4ONS A;  5DS4 A;  1FMW A;  1Z3I X;  2O9X A;  3ASO C;  1ZHT A;  4N06 A;  1NG1 A;  1A0B A;  3C18 A;  3LES A;  5L0G A;  4WGY A;  4DVZ A;  4IJJ A;  3FMS A;  1Y6D A;  5L0F A;  4MW8 A;  1CGM E;  3JYH A;  3EHN A;  4KI2 A;  3EHM A;  1T5O A;  3MYI A;  4NY3 A;  3DM9 B;  3EJN A;  3HNK A;  3NYL A;  3V5Y A;  4Z9H A;  1JMW A;  1YYX A;  3LEV A;  4U5D E;  4YL3 A;  3TJ5 A;  3ZWI A;  4CSA A;  1Z5Z A;  1M2V B;  3FOO A;  5CIV A;  4CSA C;  4HE8 D;  4EIY A;  5E2Q A;  1C02 A;  3VAY A;  3DE9 A;  4BJ5 C;  4JC7 A;  2LIG A;  3G4X A;  4OIO F;  2VCA A;  1ZW3 A;  3MFN A;  4NTF A;  1EQ1 A;  2HS5 A;  2ZXR A;  4CDV A;  4MVU A;  1YVI A;  3UR3 C;  1O5H A;  3DM5 A;  3W2W A;  1JR8 A;  2R05 A;  1YDI A;  3H2V A;  3QVZ A;  4O79 A;  2IBF A;  2VAS A;  5KYW A;  4MTG A;  2R7W A;  4G7H F;  4AE4 A;  3SXY A;  4P9T A;  3TD7 A;  1OW8 A;  3VYW A;  1JAF A;  5AC5 A;  2OQM A;  2XL6 A;  2YL3 A;  4ULV A;  4OIP F;  4XEF A;  2J46 A;  3NMJ A;  1YAU O;  1VLT A;  3OEO A;  2R7Q A;  4ANJ A;  1T9K A;  256B A;  4UDV A;  1ORS C;  2P0N A;  2LP4 A;  1HMO A;  3N2Z B;  5EHH A;  5E3C A;  2J45 A;  2J7P D;  3EG9 A;  3GM1 A;  4ZLC A;  1OKK A;  1IZM A;  1RCP A;  2KC3 A;  2Q9B A;  2J0X A;  3DAF A;  3EH1 A;  3NKD A;  4JZA A;  5FZT A;  3JZ0 A;  3Q7L A;  3IHU A;  2FGY A;  2JD3 A;  3A9C A;  1VOM A;  4I1O B;  5BUO A;  2WZG A;  2Q00 A;  3AGU A;  1I4Y A;  2WZF A;  4KNW A;  4CBE A;  2J9W A;  2IXM A;  2KNH A;  4U5B E;  3RVY A;  3SZR A;  5L3Q A;  1OKK D;  3T6J A;  3AGT A;  3EFO A;  1XWJ A;  3RH3 A;  2KK1 A;  3ABM C;  3EGX A;  3O55 A;  4EUK B;  1E84 A;  3ZG1 A;  4JE9 A;  3TOM A;  5HV9 A;  3ZQY A;  1BR1 A;  3W8H A;  2GFH A;  3B29 A;  2XLW A;  3C8G D;  2J0W A;  4XTK A;  3HKK A;  4EHP A;  3JCU Q;  3PMR A;  1YLM A;  1TFO B;  3F46 A;  5L0C A;  4GQH A;  1TWG A;  1Q0M A;  3S9O A;  1WTY A;  3S27 A;  3JYY A;  3U3F A;  4IB4 A;  2I15 A;  3TUL A;  2W9Y A;  4PFO A;  3U0C A;  3QW1 A;  3SP1 A;  4WAB A;  2R7V A;  3LLK A;  5A6B A;  3RF3 A;  4PJM A;  5AC4 A;  1I4Z A;  4MQ9 F;  5GPG B;  2YRF A;  4MS2 A;  4ULW A;  2YQY A;  4MVR A;  1Q0D A;  3BRJ A;  2XM0 A;  4MND A;  4J7T A;  5FCL A;  3QMK A;  2NPU A;  4OD5 A;  1LI7 A;  2AU5 A;  2WB7 A;  4E17 A;  4P9F A;  2G62 A;  2Q3T A;  3M15 A;  3C7J A;  1IW7 F;  3PHF 2;  1TWH A;  1KU2 A;  1YZC A;  3EZH A;  1Q0F A;  1JPJ A;  2FAP B;  3GEI A;  3GM2 A;  4CS9 C;  5KYX B;  3NDB B;  4JVS A;  1SF8 A;  3ZDL A;  4AK9 A;  4O6Y A;  2L6H A;  3DAG A;  2KQ9 A;  1M56 C;  4EKW A;  2WL8 A;  3K1I C;  3SXK A;  3V5X A;  2EPL X;  1JRA A;  2G3V A;  4E7Z A;  1Y4C A;  2L6G A;  2A0B A;  2IXP A;  1VB5 A;  2YL1 A;  4MVZ A;  3UGP A;  1S05 A;  2L9J A;  2HMZ A;  3ZC4 A;  2HZ8 A;  1LE2 A;  2A1D D;  5D91 A;  1E2X A;  3B0P A;  4DBR A;  2R02 A;  1A7E A;  1BDJ B;  2EPO A;  5JT4 A;  1FFH A;  3QZC A;  1I5N A;  3U9J A;  2OCC C;  3UMH A;  1TQG A;  1V4A A;  2LQG A;  2W4B A;  4JEB A;  2Z15 A;  1VMA A;  3EGX B;  5A6A A;  1OXB A;  2LFD A;  4N6C A;  5B1A C;  1Z63 A;  1RKC A;  1LVK A;  4NTA A;  4PJJ A;  3T6G B;  1ZZP A;  2B0H A;  5COG A;  4FAP B;  1NLX A;  5B3S C;  1H9T A;  2XXA B;  2G3K A;  2CNW D;  3L8I A;  4Z9J A;  2H7V C;  2X51 A;  3ABK C;  5IY5 C;  3CQZ A;  3RFY A;  1G4U S;  5L0D A;  4XPX A;  2DI3 A;  2GA0 A;  3K7D A;  4YWQ A;  3I5Q A;  2XSE A;  2WVQ A;  2NG1 A;  4D4X A;  2YZS A;  3DD7 A;  3JSZ A;  4MVO A;  3WG7 C;  4R32 A;  2Y3H A;  4E0I A;  3CZ6 A;  1UG7 A;  3E9V A;  1W2W A;  2A69 F;  4RD9 A;  2MYS A;  5KYW B;  1E83 A;  4EBJ A;  2MWQ A;  2ZXP A;  2XM4 A;  4J7Y A;  1OCC C;  1OQC A;  3EH2 A;  2P61 A;  1FNT c;  1WWP A;  1NFN A;  3AG4 C;  2BL2 A;  4YT5 A;  2EPN A;  4DJ9 A;  2X0C A;  3LEO A;  5JP7 A;  4JRZ A;  3R7C A;  3S29 A;  1M6T A;  1NFO A;  2EIK C;  4LLE A;  4DXW A;  2EIJ C;  4B6I A;  5KYY B;  4O7G A;  1WAS A;  3FOP A;  3H65 A;  3WHN A;  3W8I A;  1EI7 A;  1JOG A;  2M4E A;  2P6V A;  4U9E A;  4CIP A;  1TWC A;  3V7O A;  3DMD A;  2ZPA A;  4DRH B;  3RQF A;  1DOV A;  2V26 A;  5DQZ A;  4N6H A;  2DB4 A;  3F47 A;  3G4Z A;  4XLN F;  1LIH A;  3DJN B;  5DVW A;  2WVN A;  3IQT A;  3KYJ A;  3PCV A;  4BJ6 C;  5JS5 A;  4JJF A;  1QVX A;  1Z6A A;  4C7O A;  1VK5 A;  1OW6 A;  2OG2 A;  3OWT A;  4JCZ A;  4XWJ A;  1G5Z A;  1QLE C;  2R7O A;  1A41 A;  1HE9 A;  2A68 F;  2HJM A;  2WZL A;  4LDK A;  2CCY A;  1FAP B;  1VYK A;  1YAR O;  1LPE A;  2HMQ A;  2PX0 A;  4W8P A;  4CS9 A;  5JVE A;  2JPU A;  3AQC A;  1FFT C;  3AQB A;  3NKE A;  3PDM P;  2PP4 A;  4DRJ B;  1YA9 A;  4E0H A;  4YT2 A;  1M2O A;  3T6B A;  1YJG A;  2VC9 A; 
#chains in the Genus database with same CATH homology
 2XL8 A;  4L6R A;  3C62 A;  1CPQ A;  4IB4 A;  5JUA A;  3NMK A;  3QW1 A;  5JSL A;  1APC A;  4U9D A;  4CX9 A;  4D4N A;  1CPR A;  1QQ3 A;  4CDA A;  1CGO A;  2J8W A;  3IQ6 A;  2XM0 A;  3IQ5 A;  4CDY A;  1NBB A;  2BC5 A;  3C63 A;  3M15 A;  2YL0 A;  2XLV A;  1E86 A;  3HNJ A;  1YZC A;  2YLD A;  2YLI A;  4ER9 A;  2YKZ A;  4CJO A;  1A7V A;  2J9B A;  5JRA A;  2YL7 A;  1LM3 B;  2XLO A;  5AGF A;  1YZA A;  3HNI A;  3ZTZ A;  2YL1 A;  1S05 A;  4IAR A;  3U8P A;  3ZQV A;  3VRC A;  3ZTM A;  3QVY A;  5JT4 A;  4WGY A;  1BBH A;  4IAQ A;  4JEB A;  3HNK A;  3L1M A;  1YYX A;  3ZWI A;  3FOO A;  4JEA A;  1MQV A;  4EIY A;  1GQA A;  3QW0 A;  4NC3 A;  2XLD A;  3DE9 A;  4JKV A;  4D4X A;  4CDV A;  3QVZ A;  1E83 A;  4CJG A;  5B3I A;  1JAF A;  2XM4 A;  3DE8 A;  2XL6 A;  2XLH A;  2YL3 A;  4ULV A;  4WGZ A;  5JLI A;  2XLM A;  3NMJ A;  5JP7 A;  1M6T A;  1QPU A;  256B A;  1YYJ A;  3FOP A;  3M4B A;  4N4W A;  4CIP A;  4U9E A;  1RCP A;  3M4C A;  2QLA A;  3M79 A;  3TOL A;  4N6H A;  5JS5 A;  1EKY A;  1CGN A;  2XLE A;  2YLG A;  2CCY A;  3HNL A;  5JVE A;  1E84 A;  4JE9 A;  3TOM A;  3ZQY A;  3NMI A;  1E85 A;  2XLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...