4CJ0B

Crystal structure of celd in complex with affitin e12
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
60
Chain Sequence
VKVKFVSSGEEKEVDTSKIKKVWRNLTKYGTIVQFTYDGRGYVRELDAPKELLDMLARAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent and Specific Inhibition of Glycosidases by Small Artificial Binding Proteins (Affitins)
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase/de novo protein
molecule keywords ENDOGLUCANASE D
total genus 10
structure length 60
sequence length 65
ec nomenclature
pdb deposition date 2013-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cj0B00
2Q8RE 2MJ8A 1WD1A 1NR4A 2IL8A 4HAEA 1SDFA 1HFNA 3IL8A 4MN3A 2J7ZA 1WTRA 4X3TA 3Q6SA 1B53A 3LWEA 4QUFA 1EL0A 1KNEA 3G7LA 1S4ZA 2RVLA 3GV3A 1DOMA 2Q8TA 3IFDA 2KEDA 3FPUB 1J8IA 5EPKA 5EKIA 1HA6A 3DEOA 5CBAE 4XT3B 3N52A 1MSHA 1LV9A 2NWGA 2XIWA 4IUTA 5EQ0A 5T1GA 3SVMA 1C8CA 2KECA 2X69A 1Q3LA 1WTWA 2MPMA 2L4NA 2NYZD 1X32A 1TVXA 2MP1A 1ILPA 2MGSA 4R9WA 1IKMA 1HRJA 1U4RA 4U68A 1O7ZA 1HFGA 5E4WC 4OIKA 3DEPA 3KBXA 4RAUC 3DM1A 4RWSC 5EJWA 1DZ1A 4DN4M 2N88A 5E4XA 1QG7A 4IURA 4IUPA 1F9PA 5COYA 2DY7A 1DOKA 2R3ZA 1WD0A 1G6ZA 1SAPA 1AP0A 1MSGA 2KOLA 1AZPA 2EE1A 1QE6A 1MI2A 3KUPA 3UI2A 2L11A 2KVMA 2N55A 4UAIA 2L9HA 4CJ1B 1XYIA 3TZDA 1EIHA 2SDFA 2JYOA 1ILQA 1O80A 1BF4A 2H1EA 2KUMA 2EPBA 3FDTA 4NW2A 1EIGA 3H91A 4LMQD 4MHEA 5T1IA 3I91A 1AZQA 1PLFA 1O7YA 3D6WA 1WTXA 1CM9A 2B2UA 4HSVA 4HCSA 4OIJA 1ML0D 1U4LA 1VMCA 2B2YA 1WTVA 4IUVA 1WTQA 2B2TC 2NZ1D 4RA8A 1IL8A 2HDLA 1X3PA 2B2VC 2FINB 5CORA 1F9QA 1PFMA 2HDMA 2L1BA 4CJ2C 1NR2A 1GUWA 1E0BA 2B2YC 2K01A 4ZKBB 1BNZA 1DOLA 5D14A 4ZK9B 2B2UC 4X3UA 4XT1B 3MWYW 2FJ2A 1U4PA 2K28A 4O42A 1WTPA 1B4OA 1HUNA 1WTOA 2RA4A 1RJTA 1BO0A 5DNFA 1G91A 1KNAA 2FFKB 2X6GA 3P7JA 2B2VA 1F9RA 3GV6A 3I3CA 1EOTA 4X3KA 3MTSA 1XX8A 1RTOA 1SSOA 2B2TA 2CVRA 5CMDA 1ESRA 1MGSA 4CJ0B 2K03A 4X3SA 3I90A 1JE4A 2VXWA 1A15A 1RHPA 2K1BA 1G2TA 4IUUA 5AFWA 2M2LA 1WVLA 3ONAB 1PFNA 1EQTA 1M8AA 3TN2A 2FHTA 1ICWA 2DY8A 1CA5A 3F2UA 2JP1A 1NAPA 5EPLA 4QUCA 2EOTA 1X3QA 5CBEE 4ZAIA 2B2WA 1QNKA 3R93A 1PDQA 1RODA 4R8IA 1CA6A 1B2TA 2HCIA 4XDXA 1VMPA 4ZKCB 1HHVA 4IUQA 1F2LA 2D9UA 2RSNA 5D65A 2HCCA 4ZLTF 3QO2A 1DONA 1RTNA 1ZXTA 2FMMA 2RSOA 1F9SA 4HEDA 1B50A 1NCVA 5EPJA 1HUMA 1G2SA 2X6LA 1B3AA 2K05A 1BBXC 5JJZA 3HP3A 1IKLA 1PFBA 2B2WC 2BDNA 2L12A 3I8ZA 1U4MA 2HUGA 1JICA 1J9OA 2KEEA 2K04A
chains in the Genus database with same CATH superfamily
4C3JG 1TWGH 4FO2A 1LTSD 3TP5A 4I7ZC 3K5LA 2KCNA 4J15A 4JBKA 3FPUB 4A3JH 2IJ0A 4RKLA 4CKEA 4C2MB 2JA9A 2I5LX 3H3VC 1GVPA 5IE8A 5M5YH 3SVMA 5J3BA 3HKZG 3T4AC 2KA7A 5ISRA 2EIFA 5FOBB 1VQLA 1TWAH 2O2LD 2MP1A 1ILPA 3OW7A 2E75C 1HQMC 1TS4A 2AUJD 3TP8A 3DM1A 1DZ1A 4IURA 4C2MH 5I9PA 1B1ZA 2R3ZA 3MFGA 5C3EG 1AP0A 1Q90A 1IBLQ 4NDXA 1UAPA 4IZ8A 2ASBA 1TWAB 2N55A 1TIID 1YJ9A 2UXDL 2B29A 4GOPB 3T13A 3KLSA 3I91A 1ENAA 2FMCA 1UUPA 1L0XB 1B3QA 1EQQA 2F4VL 2EJGC 1E2VA 3R2IA 2B2TC 1X3EA 4RKBA 1A62A 5JVH3 2WKDA 4MTNA 1NSNS 1VQKA 1NR2A 2RF4A 4L8JA 4C3JH 1XNRQ 3RLOA 4JCVE 5D3DA 1E22A 3M4YA 1WTPA 5JPNC 1MHWC 3A7LA 4BBSB 1PH6A 2X6GA 1FJGL 4OO1G 3W3AA 1VQFA 2B2TA 1SYFA 5ELDA 5HGQA 1JB7A 3J7A5 4JI5Q 4C3JB 1JE4A 1SXTA 1A15A 2D62A 4IUUA 4LF6Q 2AWOA 4P73A 4K6LA 3ONAB 5KRUA 4HJAA 3P20A 2DY8A 5K36G 4EX5A 1WI5A 1ESFA 4KLKA 1QCBD 4IPHA 2HCCA 2R7FA 3I56A 4DK3C 2WIIB 1GUOA 3D4RA 3H94A 2ZM6Q 1B7YB 3IKJA 4LFCL 3SK8A 1Y8NB 2IW3A 2VUMH 1HFNA 3HGBA 3K0YA 1W6KA 3BYTB 1NMFA 4X65L 1HNWQ 4LF4Q 3Q6SA 1SNMA 2PPBC 5IYDH 1M4VA 2KJXA 5J1ZA 1JWSD 3IFTA 1VQMA 1BR9A 1RD9D 2EXDA 4DR3L 4B3MQ 3HOYB 4KJNA 4XT3B 3K57A 1EY8A 1PHJA 1C8CA 5GAHC 4EQOA 2X69A 3S1MH 1LUZA 2F0KA 3TZUA 2IPKD 4KD3A 1IKMA 5M3FH 2HIVA 3UDIA 2V1CC 4OWXB 3L9AX 2QILA 3FEWX 1ASYA 1Y1VH 4DXGA 3JAMc 1SYDA 4XQQA 1XMOQ 3A5ZB 1STNA 4KY7A 4RG1A 3A5UA 1RDPD 1P8LA 1ENCA 3QR8A 2UXBL 2JA5B 3DWQA 5CV8A 3CMEA 2EZVA 1JT8A 1TWFH 3BU2A 2PZWA 4NW2A 2BH2A 1WCMH 2OQKA 2QA4A 1XTDA 4HIKA 5E1FA 4A75A 2CCZA 2UUAQ 4A3BH 1J5EQ 4A3CG 4B3TQ 2PQAB 5C3EB 4GN3B 1LLRD 3QWNA 1R4PB 3S14B 4GKKL 2B2VC 3GTJB 1SJHD 4R4OA 4YY3Q 1E2ZA 5ELEA 3K0XA 2RDFA 3PMFA 4A3BB 4R4CA 3L2PA 1A2TA 4A3BG 1E1OA 4C56C 3S14H 1SNOA 2F0EA 1Y8OB 3G6EA 1H9SA 2K03A 2PZTA 4HR7B 4GNXC 2G9HD 1VQGA 4B9WA 1RHPA 2Q2UA 1G2TA 3ERQA 4GKJL 1EY0A 3JAME 4LF4L 3S1NH 2LFNA 2K5HA 2JA7H 1DJRD 3MA2B 4B3ML 1L2FA 2HCIA 2NN6G 1A6XA 4QIWE 1K0SA 3T53B 2JA6B 2JA8G 1VQCA 5EPJA 1K9MC 2K05A 3NK9A 2SNSA 2I5HA 1SE3A 1I5FA 2RDGA 2MJ8A 3NTKA 5GROA 1CKNB 2VS1A 1KIXA 3S16H 4X3TA 1B9NA 3DWAA 1JCKB 1Q1EA 4E6IA 1PV4A 1G51A 4FF3A 2L15A 2Q8TA 4DF7A 1L1OA 3DEOA 5CBAE 3N52A 5A2QE 2XRQD 2MPMA 2MUYA 4YWKA 2L0CA 2NVTH 4K8IA 1HZBA 5FO9B 2YTVA 5C4XH 3TDQA 2OTJA 2UUBQ 3KF8A 5E3FA 3D4WA 3K59A 2XRSD 3D8GA 2B39A 4XQJA 4L63B 3CKIB 2B63B 4EVOA 2EE1A 2EJMA 4JBWA 4O1NA 4PMWA 3AEVA 2F0TA 2NVYB 1JR0D 2M00A 3UDFA 4BWGB 2L9HA 2NVTB 2GN5A 1SLJA 2JYOA 4A3EB 1X56A 4LJZC 1DD2A 4JI0Q 1T9HA 2NZHA 3VR2A 1PFSA 1V1QA 2ICIA 3AU7A 1EFID 1ML0D 4A3FH 4B3SL 5J22A 1Q86C 4LUZA 3JAML 2A69D 4KY5A 5FJ8H 1PVOA 2R92H 2FXQA 1P16A 4H44C 1EOVA 1IYJB 5KNDA 4BBSG 5FO8B 1DOLA 5D14A 2JE6I 3PIO3 3W2DA 1FYCA 5BN4A 4FF1A 3KJOA 3ERSX 3NSWA 3IRBA 2ZTDA 2D2CC 5M5XB 4DV1L 2B2VA 4JI3Q 3I4MH 4X3KA 1TXYA 1NUCA 4KKTA 3WDNA 3CQZH 2R92B 2F0IA 4NP5A 1HNZL 5K36H 2A6HC 3K58A 1GKHA 3D0FA 2UUCQ 1M8AA 2FHTA 1ICWA 2JP1A 1I6HH 4KHVA 3L7ZC 4ALPA 4Q5VA 4YCUA 1IXRA 2F0QA 3VYSA 1F2LA 1IL2A 3GO5A 4NXMQ 4HEDA 1YHAA 4HJ7A 1F9SA 5I6YA 1NY4A 5C4JB 4JI8L 1LTID 2A68C 2PQEA 3NWTA 1IHZA 1LACA 5GQOA 1LABA 3BS1A 2IY5B 2KEEA 2CH4A 4A3LG 3I4NH 4DV6Q 2ENBA 1T5EA 2VQFL 3R2TA 4RFBA 2UU9Q 1PA6A 2Q2HA 4RGOS 2ZJRA 3MXNA 3FHWA 3ZYYX 4DR4L 4LFAQ 5IYBG 1TWHH 2ZXRA 1LTAD 3TMEA 1OTCA 5IODA 1SE2A 3NE5B 1TVXA 1IW7C 4A3GG 4DV7L 3K80C 1BOSA 2HQEA 2NTTA 1UEAB 2K33A 2WACA 3GTLH 1YNNC 2KBNA 4RWSC 1KHIA 3PIOA 2XTIA 2PI2E 2K5QA 4R4QA 3F2BA 3J80c 1BCPD 1AZPA 1R9TH 4DNTB 3PIPA 1XNQQ 1D1KA 1PRTB 4JI3L 3BDCA 4DKAC 4NXNQ 4DK0A 1I3QB 1WCMG 1XYIA 1JJGA 2EYMA 3J7AF 3CC2A 2KUMA 1HNZQ 3D6CA 1EIGA 1I50H 4LMQD 4DNIA 3CCLA 1EU4A 3HOUG 4P75A 1WTXA 4A3DG 1SYGA 1TKWB 4QF4A 5IP7G 1WTQA 4QQBX 1A3UA 4DV5L 1PFMA 1A63A 1RKNA 3QJYA 1BNZA 2ATWA 3SXHA 2A5HA 2VY3A 2LXKA 4A3JG 4HN7A 1HUNA 1B4OA 2IWHA 4QJFA 4LF7L 1KAWA 4JI8Q 5A2QL 2NN6I 2VUMB 1UE5A 2Q8IB 3ULLA 3PSIA 1SNPA 5A35A 4B3TL 2HQLA 1ESRA 2K5VA 4XXEA 3MFYA 4X3SA 5ELBA 1GUGA 4A93G 3S1QB 3W1GA 3KLRA 1HR0L 1WVLA 2AHOB 4B08A 1B70B 4PZ8A 2JA6G 5M3FB 2K4KA 1VMPA 4IN3A 2WAQE 3UDXA 2RBMA 1ASZA 1TT2A 5DM63 5FLXL 2Z6KC 3J7YW 2F1MA 2A8VA 2BDNA 2JA5H 3K5MA 2DN8A 4GN5A 2NBFA 1CHQD 4RCNA 4OHJA 4BY7G 3E0JA 4R8NA 3GTKH 5M3MH 3PIP3 3K5OA 3MXUA 3LWEA 5I2YA 1EL0A 4Y7NB 3HOXG 3CF5A 1BXTA 1IBLL 5EPKA 1EY4A 3KK7A 3HOWG 5CR3A 1EQRA 2XIWA 1L1OB 1KQSA 4FXGC 1PTOB 1Y14B 2R92G 5BR8L 4RH6A 1Q81C 4YY3L 1RF2D 4OIKA 3DEPA 4BY1G 3KF8B 3BVZA 4GLAC 2WAQB 2KOLA 4JV5Q 1PTOH 4JI7L 1CKNA 3UI2A 1AN8A 1QVFA 5BN3A 3Q23A 1F77A 4JOIA 3T1YL 2H4OA 2VUMG 3DWPA 2EQSA 3BZDB 3SE0A 1JOKA 3J80L 3KLWA 2ICEC 3OSOA 4AYBB 2L1BA 5FO7B 3SK4A 3I70A 1QVGA 3NHHA 2VQEL 2B3GA 1HZ9A 1STEA 5DEHA 3HOUH 2UXDQ 1DXMA 2GVAA 2NVQB 4TKOB 4CGYB 5NUCA 3E9HA 1SYCA 3GQBA 3J81i 1EIFA 4X66L 1VQAA 3KF6A 4DAVA 2E76C 1K83B 1CKMA 2LY7A 3V05A 1MBYA 4APVA 4K5VA 1JWUD 1YHQA 4A3GB 1JOOA 2K14A 1PZID 4BS9A 1FVIA 1NAPA 3NBIA 5CBEE 4BY1H 4CDDC 1QNKA 1Q1BA 1KDBA 1B2TA 2LXJA 1VQ8A 3GTGH 2K7VA 4IUQA 2PO4A 2F0MA 1MKHA 1ZXTA 2RCFA 4LF8L 3CU7A 4PQXA 1QUQB 3L3OC 3A54A 3RZOB 2R7ZH 1F2MA 2B2WC 4C3IH 3M3YH 4JI4L 3STBD 4BY1B 1FGBD 1KLGD 5IT9c 5CV6A 2IL8A 5JJLA 1BVSA 4OX9L 3E6ZX 4YCWA 1D8LA 2MO1A 3OYYA 4CHTB 2F3IA 2PMZE 4NXML 1S5CD 4I7AA 3ICEA 1J8IA 2UXBQ 2EY5A 1S40A 1WTWA 5C4HA 1VQ4A 1HRJA 2E2JH 1HZCA 4DR5Q 4V190 2XN9C 4J6HA 2DJFC 2AMCB 4PZ7A 4AYBE 3TREA 3J81j 4A3IH 3HOYH 4PG3A 3EVQA 5LMNQ 5C3XA 2Q2TA 4YCVA 2N49A 5IYCG 4DV1Q 3HZXA 1YNXA 1NTGA 2M9VA 1ZYRD 3BZKA 5DAUA 1N34Q 4BA2I 1OO9B 3PUXA 1SNQA 1YIJA 3VR3A 1JJ2A 3HOZH 4HCSA 5TSSA 1HZAA 4DV4Q 3S2DB 2OF1A 4OL7A 4DV3Q 4KK7A 3KDFB 4HIOA 2R93B 1PH1A 1GUWA 3F1ZA 2K01A 1EFWA 1GOZA 4L5RC 1LT4D 4GOPC 1B9MA 3CAMA 2I5MX 2RCNA 2Y0SG 3I4NB 3RN2A 1SE4A 1TU2B 2J4XA 2K6AA 2Z9HA 2HT1A 1G91A 4IFDI 1GHJA 3P75A 3H3VH 2KCMA 4DV6L 1H9KA 2SNMA 2VQFQ 1SMXA 2B63G 5EAYA 1QZHA 1CK1A 4FXKC 3TN2A 5FLMG 3TS0A 3A74A 4TQUS 4OGQC 5F2DA 5EKKA 3RLNA 3H0GH 1YJWA 1EIYB 4ZKCB 4IPDA 1KDAA 4V0BA 3AQQA 1EWCA 4G7OC 2XWBB 1NCVA 5FJ8G 2CQOA 5M5WB 1B3AA 2KHIA 4A3KH 1R9TB 2E2DC 2EVBA 4HJ9A 1MD2D 4TVAB 2ZJPA 3I2ZA 2JA7B 1WYDA 3E9IA 1N32L 3ND8A 5KYIA 2JA7G 2OT2A 5JAVA 2J7ZA 2NTSA 4TSSA 1C4QA 4HIMA 2UXCL 1X65A 3K7AH 4L5QA 1OXUA 4IALA 3PV0A 3FKIB 1YHBA 1ET9A 4C3HG 5IT9L 1GXDC 3CD6A 1CQVA 4RCOA 1MIUA 5IYDG 3STBC 4JI1Q 2PYKA 1PRTF 2QDBA 3NBHA 5H1SE 2EYLA 2DY7A 3OIQA 4TRDA 1EEFD 4DU9A 1SRUA 3FKIH 3QOJA 4K14A 4OO1I 5FLXc 1Q12A 4G7ZC 1TS3A 2SDFA 1O80A 4X64L 3T51B 2EPBA 5EBDA 3HOVB 4DR3Q 2B8FA 5T1IA 1LTTD 2Z4IA 2B2UA 1VQEA 4GNXA 1JWMD 2F03A 1B44D 3S17B 3AMUA 4K2LA 2HDLA 1LYLA 1VQDA 4A3CH 3CHBD 5IGBA 3HRZC 4DFAA 4O42A 2B8GA 2EJFC 5BN5A 3EFXD 3E0EA 1TWGB 5DNFA 4A3FB 4JI0L 1JB3A 3NXWA 3EBEA 3WWVA 1Y1WG 3G6JB 1C48A 1GUTA 4QIWB 1FR3A 1YI2A 2EY6A 1VQNA 2A73B 1F2YA 1MJCA 2O4XA 5JEAJ 1X54A 4A76A 4GS3A 1DM0B 1QJOA 3V2TA 1SFOH 3HOZG 1XMQL 1JMCA 4B3RL 3C46A 4KI0A 1YNJC 1PYBA 2B2WA 2I46A 4R8IA 3CQZB 3PUVA 3MC0B 3UE1A 1EEID 3KLSX 3CCJA 2D9UA 1D1IA 3ZJYC 4EGVA 2CHBD 4LF5Q 1H9RA 2LMCB 3OIPA 3RZDH 2OWOA 5JJZA 3MXGA 5LMUQ 1QZGA 4FF4A 1PFBA 4NB3A 3JAMi 4IQZA 3BVGA 4JBMA 1EY5A 3NP8A 1PTOC 4GKJQ 1SYEA 5C4JH 4LNQA 1S4ZA 2RQXA 1STBA 1HTLD 2N3SA 3OTOQ 5EKIA 4RHSA 3BG3A 4UP7A 3S1RH 3I73A 3M4PA 2MO0A 4XTCS 1CT1D 1BBWA 2F0JA 3H3VI 2JA8H 1E24A 2MGSA 2NVQH 1TS2A 3GTQB 1O7ZA 1OXTA 2EXZA 4IFDJ 5E4WC 4ZRZA 1ET6A 2WKCA 4AH6A 4HJ8A 4R4IA 4KHPL 4U673 3CW2C 3I4LA 5EBCA 2D0OA 5KYLA 3GTQH 2WAQG 3D6WA 1SNDA 3M85A 1CM9A 4FDBA 5CC4A 4OIJA 2V4DA 4POGA 2PI2A 4IUVA 3SGIA 2SEBD 4HJ5A 4NMZA 4CJ2C 3E3XA 3RZOH 2R7ZB 4J8QA 4LFBQ 1AW7A 5C5LA 1D5ZC 4BY7H 4LF5L 3DLLA 1Q8IA 4KN7C 3GV6A 1H9SB 1PH8A 3U9SA 4Y52H 4DV4L 4CKBA 3MAQA 1EWHA 1LO5D 1B8AA 2F0OA 2Q2IA 2G9DA 4IPCA 2QKIC 4BY7B 1EQTA 1I4HA 4JYAL 1O78A 1OXSC 2EOTA 1X3QA 3VYUA 1V43A 2GA4B 3KDFA 4HIDA 2PCFB 3SEBA 5D65A 2E74C 2E8GA 3J81L 2K50A 4LUVA 1BCPC 1G2SA 4F8MA 2X6LA 3M7NA 1FJGQ 1HPCA 2R7ZG 1WFQA 3ER0A 3TP7A 2QDLA 1HTPA 4DGZA 1BCPB 4C1NK 2C9OA 4QUFA 3NQTA 2RVLA 3EROA 1DOMA 5KIXA 5C3EH 1VF5C 4PMCA 4DUYQ 2R93H 3VDYA 1W6JA 5EQ0A 1GUSA 1NJIC 4WFN3 1EYDA 5IYCH 2KECA 2R7DA 2L4NA 2NYZD 3T56B 1SYBA 4CDEC 1KDCA 4IOAA 2LKVA 4KD4A 4F7XA 1EU3A 2KCTA 4Y7NH 1QG7A 3NELA 1HR0W 1F2ZA 3LWUA 2ZT9C 5COYA 1VQ5A 1DOKA 4CBVA 1Z6HA 1U9RA 1DYQA 3HS0C 2Z6KA 1CTMA 2VW9A 3D31A 1D5XC 2E5LL 4JI6Q 2H1EA 1YNJD 2QW7A 4MHEA 1LTRD 4KTAA 2XVSA 3NTHA 3GD7A 2I07B 2L55A 4HSVA 3HKSA 3C1FA 2B2YA 5JEAH 3R3OA 1Q82C 2EYOA 3MXNB 4H02A 4Q0FA 1K8MA 1S72A 3GP7A 3K7UC 4C3IG 4ZK9B 3I7FA 2OEOA 2DNCA 2R61A 1U4PA 3AYHB 3MWYW 3M4QA 3PO2G 3C1EA 4MTKA 1A3TA 3HOXH 2HD3A 3BJUA 1CZWA 1VQBA 1MGSA 4X6AH 4HMIA 3VR5A 2A69C 5G3LD 1K0RA 3HOUB 3HFZB 2M2LA 1E2WA 1S5BD 1GM5A 3PQIA 1STAA 5IIFA 4AYBG 4DAYB 3A8IE 3S15H 3CP0A 1IBML 2RHQB 3A55A 1HHVA 3VR4A 4BBRB 3VYRA 5C0XG 1HUMA 3GTPH 2DUDA 2CKZB 1EZ8A 3PO3H 1U4MA 2NVYH 3M4OB 2K5NA 1XMQQ 1FGUA 4A3EH 4DR5L 1C0AA 5CV7A 3CRKC 2BA0A 5DM73 4FXDA 1WTRA 3CC4A 1ONLA 3RN5A 1B53A 2EYJA 4DA2A 1O7LA 5IGFA 4P71A 1PH3A 1GD7A 5LMNW 3M4OH 2K52A 2Y0SE 1PYWD 5C0XJ 5IT9E 3CPWA 4LK1C 2E2HB 1BQQT 1Q3LA 2F4VQ 2AQ2B 3T16A 4A3EG 3RNUA 4WJ4A 5JOBA 5M5XH 4UP8A 1E1TA 1PTOF 3DMUA 1TS5A 4IUPA 4DV3L 5M9OA 4FF2A 2F0GA 2VB3X 5C0XH 4PV1C 1E7ZA 2F3VA 4PMBA 2L11A 2KVMA 3RMHA 2JQOA 3TZDA 5AJ3Q 1GUNA 4HSPA 2ID0A 4LF7Q 2BDOA 2I0QA 1O7YA 5IP7H 1HXYD 4O2DA 4WJWA 4A3DH 1A0IA 4Z9CB 1RIPA 3S9WA 1F9QA 2HDMA 1K3BC 5M5YB 2VB2X 4ZKBB 3KJPA 1J6QA 4C1NI 3I4MG 4IO9A 1LM0A 2FJ2A 1N34L 3T1HL 1RJTA 1YBYA 4C3HB 5IGDA 3WOEA 2FFKB 3S2DH 2IHFA 5GADC 2ZXOA 3WOFA 1EQVA 4UP9A 4YHHL 2CVRA 1L0YB 4N9PA 4ME5A 3OWFA 4N8X1 4B3SQ 2F4IA 5IGEA 1OXVA 2F0DA 3PUWA 5ELFA 1N32Q 3MEHA 2EYFA 4ODGA 1R4QB 3CRLC 5CV5A 4KY6A 1K8GA 4DPGA 4FYDA 2SOBA 1S5ED 2K75A 2P5ZX 3GTLB 3S2HB 4AQYQ 1LTLA 2ZTCA 2RSOA 2ZXPA 3K6OA 4JI2L 3I4NG 3EA6A 2HHHQ 1IKLA 2CQAA 4LF9L 3VA5A 2L12A 1TWCH 3J7AV 5HGTA 2F52A 2MFIA 4RGTA 3S24A 1HA5A 3D3RA 1I4RA 2J0TD 2F0PA 4JI1L 2KHJA 1XTCD 1D6EC 3HEJA 3DM3A 1KNEA 1NMGA 3SR1A 2IX3A 2R93G 1IYVA 3D4DA 3IFDA 1KLUD 1I4QA 3ULPA 2UUAL 2WINB 1A8VA 1MSHA 3X3NA 4DK6C 1VDZA 1UE1A 2MHVA 5IYBH 2Y0SB 4LW1A 3URYA 2F0VA 4KV6A 4CKCA 4U68A 3OOCA 4ZUIA 1YVCA 1KABA 2A1AA 2XSCA 2AUKA 3CCSA 3FP9A 3K7AB 3Q24A 4HCEA 1E3PA 3SHLA 3J81c 1TY0A 2UU9L 1MI2A 3KF6B 3OW2A 4RMFA 4F88A 4QGUA 3GTOH 1AE3A 4PNYA 3SK5A 3AFPA 3FMCA 1EIHA 3U4ZA 5CV4A 3NWSA 4DR6Q 1EY7A 1STHA 4KN4C 1Q46A 2C5CA 1SN8A 2TMPA 4FNFA 3K81C 2JXMB 2C35B 1Q8KA 1VQOA 5CORA 4DV7Q 1PH5A 2PMZB 1I4PA 2BA1A 5KEEA 5JJIA 3HOVH 3PCOB 4A4IA 2E5LQ 3HOYG 1QUQA 4B3RQ 3KBGA 3BYYB 1UE7A 1BO0A 1FNWA 4OELB 1SROA 1M1KC 1JORA 1PRTC 1XNQL 4BXXG 1SR3A 1G291 5M3MB 3BVMA 5C44H 1VCIA 3TEHB 1NE3A 5CV9A 4XYOA 3LX0A 2Z1CA 4JI4Q 1GJXA 4JVZA 1CA5A 3F2UA 2E2IB 5JJKA 1ZEQX 2JA5G 4DUYL 1TY2A 4XDXA 5C44B 1C9OA 1N36L 4UHVA 2PNHA 4ZCKA 1FNUA 1Z7TA 1A2UA 1SFOB 1BBXC 4IPGA 4ZUJA 1I94L 3CCRA 2D0PA 2K32A 3F2CA 2F0LA 1EYCA 1PZKD 2F0FA 1QVCA 2QEXA 1RCVD 4GLXA 1XPOA 4MN3A 3C3LA 1L1OC 2PNRC 1O7IA 4CDCC 3MHBA 1RL2A 1V1OA 1KL9A 2IX0A 4JG2A 5I4DA 4DR6L 1HCZA 1HA6A 4H0LC 5IGGA 4M1UB 4DV0L 2DJGC 2NWGA 1L0WA 5D3IB 3G4SA 1QNUA 4O0AA 1YZ6A 3CCQA 3U58A 1EYGA 3CCUA 4DV2L 4QL5A 5CGKA 4DN4M 1CUKA 5E4XA 3VYTA 3RD4A 3A56A 4GLVB 2PZUA 1K83H 3S1RB 4J1MA 1V9PA 2KCCA 1HH2P 1X3GA 4I65A 2K5WA 4G4KA 2JA8B 2BE5D 4A3GH 4OXPA 2KQ3A 3FDTA 2Z4HA 1LT6D 1AEXA 3FPPA 1OXXK 3OPOA 2QEJC 3J80i 1ICFB 3GTGB 1PRTD 2UUCL 3NEMA 5I9OA 3N6RA 2NZ1D 4RA8A 4BBRH 1SEBD 3FRPB 1PH9A 1X3PA 2O5IC 4BA1I 4KHPQ 5M3FG 3DXJC 2JSOA 4RHRA 2AKWB 2N78A 1IBMQ 1VS0A 4A3FG 3E5SA 1QWYA 2YTYA 4JW0A 4L5TA 3M3YB 4MIUA 1WTOA 4LAAA 1VF7A 2RA4A 4QMGA 3TP6A 3TRZA 4CDFC 3I3CA 3OMCA 1I94Q 4ZYSA 4JK1C 1K3RA 5I6WA 3NBHB 4M8AA 5ELNA 1CSPA 2DGYA 4DUZQ 4DR7Q 1S5FD 4DR2L 3EN2A 4YWLA 2KENA 1YITA 3QOLA 3K8AA 5ELOA 4ZAIA 4UDUC 3R93A 4LFAL 2WP8J 4YHHQ 3CXCA 1KTKA 2F0SA 2UXCQ 2FMMA 5IWAL 4KKUA 3AFQA 1BUVT 2BCOA 1SMYD 4QY7A 4IFDH 1AE2A 1NNXA 1J9OA 4HMJA 3J7ZC 2K04A 1WD1A 1SNCA 2Z6BA 4X62Q 5JVG3 1PH4A 4JYAQ 4HAEA 2OXPA 4P2CB 1QB5D 2A6ED 3PO2B 1STYA 5C44G 3IL8A 1JJCB 2Z8LA 2PQAA 3NTIA 2H5XA 3V96A 3CCVA 1EUJA 1VQ6A 2PW5A 3P1HA 3MZ5A 3BDLA 2LS01 5EGTA 2ALYB 1VQIA 4OEMB 3Q22A 1LV9A 2YYZA 3PO2H 1IBKQ 4X64Q 3KFUA 4K0KQ 2EYPA 1UEBA 3CMAA 4C3HH 5DLQE 3U9OA 1S5DD 4RAUC 3QIAA 4AIMA 1F9PA 4KHZA 2F0UA 1D5MC 2IT1A 1CSQA 1G6ZA 1W3SA 2LSSA 4OX9Q 1K8OA 4RGNA 3MXPA 1II3A 3QG1A 4DXFA 4EQPA 3RR5A 4GNXB 3H91A 4IFDG 3BDOA 3B6YA 4WORA 4DR2Q 1HR0Q 3H0GB 2OQ0A 2A6HD 1IL8A 2EDGA 2FINB 5M5WH 4POFA 5JPMC 2B2YC 4A3KB 4XT1B 4X3UA 3RLFA 2K28A 5C6AA 1I6VC 3W1BA 1CZGA 4JI6L 4YWMA 4WRDA 5K5PA 3EIVA 3HKZE 4KKSA 1UWVA 1F9RA 2BOSA 1EOTA 4PZ6A 4LF9Q 1XX8A 3BZCA 4K8JA 1IZ6A 4CJ0B 4P72A 5FLXE 2F0HA 2VXWA 2ZM6L 4DR1L 1XNRL 1T5XD 2XWJB 1VQ7A 4ME3A 1LT3D 2JN4A 2DNEA 1WJJA 3A8JE 4JOIC 1KXLA 3HOXB 2BH8A 1VQPA 1D7QA 1CA6A 1PDQA 1RODA 2NB0A 4K2KA 3TBIB 1PYSB 4OO1H 1HNXL 2CFMA 4JPBW 1SJED 1RTNA 4A3MB 5KGUA 1H9MA 1IYUA 3RUZA 2ES2A 5BR8Q 3HOWB 1PXUA 3O13A 2UUBL 2CW0D 3C2PA 3CCMA 1UNSA 3PUYA 4A3KG 2KHSA 3GTOB 5KNBA 1UE6A 1SBBB 2Q8RE 5FK9C 4ULLA 1SDFA 4NPSA 5C5MA 4L5SA 4ZQ3A 4JI7Q 3G48A 4DK1A 4JBJA 3GTPB 1V1PA 2F0NA 3H6MA 3GV3A 1LTBD 2JJQA 4KMUC 3S17H 2KEDA 1ZYRC 3PO3B 2WB1E 3S1QH 4A3IG 1N9WA 2VZAA 3QB3A 1YEZA 4IUTA 1N33L 2AWNA 2F3WA 4LFCQ 1MJEA 1X32A 3EQLC 1XPUA 4OONA 1HFGA 4UPAA 1EY6A 3KBXA 3H0GG 1J5EL 1AFPA 5GAEC 3J80E 1G6PA 3GDEA 1MSGA 5FLMH 3KUPA 4K5XA 2EY1A 2PW7A 3FKIG 1CFMA 1I4GA 4UAIA 3OMGA 4L6TB 2WB1B 3CCEA 2E2IH 2IX1A 4XQNA 1AZQA 3TS2A 3GTKB 1Y8PB 1X9NA 1VMCA 2JEAI 1Y1VG 4A3JB 4IJHA 1CI3M 1JQYD 3A8KE 3JC66 3RZDB 4QB4A 5EKLA 2RKSA 1JE5A 2WV6D 1LTGD 1WOCA 2CWPA 2RHSB 3S1NB 3UE0A 3P7JA 2IHEA 3DUZA 4A3DB 5C4XG 3DHQA 2TSSA 4F87A 3MTSA 3K5NA 5CMDA 3FVQA 4JI2Q 2MQHA 1Z9FA 2R6GA 2K1BA 4XYQA 2HHHL 2NZOA 4IOCA 1BKBA 1CQFA 1PFNA 2QGQA 5IP9H 3M7GA 1G8ZD 3NENA 3I55A 4QUCA 3H09A 1CKOA 5LHY1 4OWTB 1XWEA 4DV0Q 3S16B 3A0JA 4ZLTF 3ULJA 4EQ5A 1B50A 1QOHA 2L5TA 3VA7A 4DUZL 2YTXA 4OWWB 3HP3A 4EQNA 4LUOA 4IUNA 1VQHA 3I72A 4BBSH 1XPRA 3GTMH 5LMNL 2NN6H 2CH4W 2ZJQA 4GZYC 3S2HH 1HQRD 4B9XA 4ABNA 5LL6X 4LF6L 5HY6A 5C4XB 2A6EC 1LT5D 3G7LA 4LWCA 1WTHA 1ZKOA 2OTLA 4QCLA 2AQ3B 1BCPF 1TWCB 1V1PB 3W5OA 3CC7A 5T1GA 1U0LA 1NBWA 3AB9A 3GTMB 1BBUA 4XIGS 1Y69U 4K6DA 4DNRB 4BBRG 3F2DA 2WB1G 5HURA 4G7HC 1Q7YC 4R9WA 1U4RA 4DV5Q 5L37A 3PF4A 5GAGC 2N88A 2CW0C 2ZTEA 2QF7A 4DAMA 1C7YA 1SAPA 1U5KA 1VQJA 1H9JA 4C3IB 1QE6A 2EYHA 4GOPA 1EZ6A 4DAPA 2G5DA 4CJ1B 4UY8C 4P74A 1ILQA 1BF4A 4K0KL 5FKAC 3OTOL 1X6OA 1PLFA 4DR7L 2Z0SA 5C3WA 1U4LA 1BDOA 3H15A 1GHKA 1ENFA 3NUCA 4DAYA 4JI5L 3I4MB 5C4ZA 3UDGA 5J39A 1TR5A 3Q8DA 5KNCA 4H13C 4R1JA 2B2UC 3U50C 3LNNA 1W2BA 3S1MB 1AH9A 1Z47A 2JK8A 2E2JB 2EY2A 1XMOL 1M90C 1K28A 1I6HB 5IGCA 1KAAA 5E7NA 4A3IB 2AQ1B 1N36Q 1SSOA 1Y1VB 1DGSA 5IY0A 2A74C 3TSSA 3I90A 3ND9A 5CYUA 4X62L 3X3MA 1D2BA 1JOQA 2BE5C 2YV5A 5AFWA 2VL6A 4JC0A 5I2XA 1GO3E 1TWFB 1X55A 3F8TA 2VQEQ 1WCMB 1Y1WH 3MVVA 4GKKQ 3HOZB 2K5DA 5ELCA 1V8QA 4LFBL 4R4TA 5M3MG 4X65Q 2MNAA 1HNWL 3PGZA 2NVXH 4X66Q 2O5JC 3QO2A 1DONA 2XNAC 4N8FA 1FD7D 1PMRA 3R8BA 3GTJH 3VR6A 3IAYA 1FNVA 5G3LF 4DR1Q 4YIJA 4H7BA 3I8ZA 1Y1WB 3PUZA 2HUGA 3L0OA 1TWHB 1PH7A 4G57A 1NR4A 2CWAA 1KRSA 2QCPX 2NVXB 1STGA 4JV5L 3PO3G 1HNXQ 1KC8C 4A3MG 3U4VA 4IJLA 2D5DA 3HOVG 3T1YQ 5IP9G 3HG9A 4NXNL 3KOJA 4AQYL 2YU9H 5AJ3L 3J81E 1VQ9A 1I3QH 1YNND 4BXXH 2WFWA 3OHXC 1XXGA 1CHPD 1IW7D 1I50B 4NKLA 5EJWA 1N8RC 4FP5D 1A3VA 1X3FA 2JA6H 3M9BA 3TQYA 1SMYC 4DR4Q 1WD0A 2YU9B 2A19A 3HKZB 1JC7A 4A93H 2VNUD 3T1HQ 1FL0A 4A3LH 3G71A 1PTOD 3S15B 4DV2Q 1EY9A 4WJ3M 1PH2A 3I4OA 3OWEB 1WTVA 4A3MH 4GN4B 1EYAA 1I4XA 3PF5A 1KD1C 2NUCA 1E0BA 3EJIA 4A93B 1QILA 3HOWH 2HIXA 1YJNA 4MZ9A 1K8AC 1HJPA 5LL6S 5C0XI 3SDZA 3LGJA 3NQIA 4LF8Q 1EWIA 1KNAA 3A7AB 5LMUL 1H95A 1RTOA 1DCZA 5IWAQ 2OCEA 2B63H 2N8NA 1K73C 4KJOA 4RGMA 3KYHC 1SE8A 4ILWA 2JEBI 3MEFA 4S3SA 3CPFA 2F0WA 4N9TA 2E2HH 1S3OA 5IOCA 5EPLA 3SK6A 4ID6A 1TQOA 3NPPA 4MNOA 4K5WA 1N33Q 2RSNA 2RDHA 1KRTA 3ITPA 4HTHA 2GVBA 2A68D 5JEAG 4FVMA 2XGTA 1PZJD 3Q0AA 1JICA 1IBKL 1XJVA
chains in the Genus database with same CATH topology
4C3JG 4FO2A 1LTSD 3TP5A 4I7ZC 3K5LA 2KCNA 3FPUB 3H3VC 2IJ0A 4RKLA 4CKEA 4C2MB 3SVMA 3T4AC 2KA7A 5ISRA 5FOBB 2O2LD 2MP1A 1ILPA 3OW7A 2E75C 1HQMC 1TS4A 2AUJD 3TP8A 3DM1A 1DZ1A 4IURA 5I9PA 1B1ZA 2R3ZA 3MFGA 1AP0A 1Q90A 4NDXA 1UAPA 4IZ8A 1TWAB 2N55A 1TIID 3T13A 3KLSA 3I91A 1ENAA 2FMCA 1UUPA 1L0XB 2EJGC 1E2VA 3R2IA 2B2TC 4RKBA 5JVH3 2WKDA 1NSNS 1NR2A 4L8JA 5D3DA 3M4YA 1WTPA 5JPNC 3A7LA 4BBSB 2X6GA 4OO1G 3W3AA 2B2TA 1SYFA 5ELDA 4C3JB 1JE4A 1SXTA 1A15A 2D62A 4IUUA 2AWOA 4K6LA 3ONAB 5KRUA 3P20A 2DY8A 5K36G 1ESFA 1QCBD 2HCCA 2WIIB 1GUOA 3D4RA 3H94A 3IKJA 3SK8A 1Y8NB 2IW3A 1HFNA 3HGBA 3K0YA 1W6KA 3BYTB 3Q6SA 2PPBC 1SNMA 1M4VA 2KJXA 5J1ZA 1JWSD 3IFTA 1BR9A 1RD9D 3HOYB 4KJNA 4XT3B 3K57A 1EY8A 1C8CA 4EQOA 2X69A 2F0KA 3TZUA 2IPKD 4KD3A 1IKMA 3L9AX 2QILA 3FEWX 4DXGA 1SYDA 4XQQA 1STNA 4KY7A 1RDPD 1ENCA 2JA5B 3DWQA 5CV8A 2EZVA 2PZWA 4NW2A 5E1FA 5C3EB 1LLRD 3QWNA 1R4PB 3S14B 2B2VC 3GTJB 1SJHD 1E2ZA 5ELEA 2RDFA 3PMFA 4A3BB 1A2TA 4C56C 1SNOA 2F0EA 1Y8OB 1H9SA 2K03A 2PZTA 4HR7B 2G9HD 4B9WA 1G2TA 1RHPA 3ERQA 1EY0A 3JAME 2LFNA 1DJRD 3MA2B 2HCIA 2NN6G 1A6XA 3T53B 2JA6B 5EPJA 2K05A 3NK9A 2SNSA 1SE3A 2RDGA 2MJ8A 3NTKA 4X3TA 1B9NA 3DWAA 1JCKB 1Q1EA 4E6IA 4FF3A 2Q8TA 4DF7A 3DEOA 5CBAE 3N52A 5A2QE 2XRQD 2MPMA 2MUYA 2L0CA 4K8IA 5FO9B 3TDQA 3KF8A 5E3FA 3D4WA 3K59A 2XRSD 3D8GA 4XQJA 2B39A 4L63B 3CKIB 2B63B 4EVOA 2EE1A 2EJMA 4JBWA 4O1NA 4PMWA 2F0TA 2NVYB 1JR0D 2M00A 4BWGB 2NVTB 2L9HA 2JYOA 4A3EB 4LJZC 1DD2A 3VR2A 2ICIA 3AU7A 1EFID 1ML0D 5J22A 3JAML 2A69D 4KY5A 4H44C 5KNDA 5FO8B 3PIO3 1DOLA 5D14A 2JE6I 3W2DA 1FYCA 5BN4A 4FF1A 3NSWA 2D2CC 5M5XB 2B2VA 4X3KA 1NUCA 4KKTA 3WDNA 2R92B 2F0IA 4NP5A 5K36H 2A6HC 3K58A 1M8AA 2FHTA 1ICWA 2JP1A 4KHVA 3L7ZC 4Q5VA 2F0QA 3VYSA 1F2LA 3GO5A 4HEDA 1F9SA 5I6YA 5C4JB 1LTID 2A68C 2PQEA 3NWTA 1IHZA 1LACA 1LABA 3BS1A 2KEEA 2ENBA 1T5EA 3R2TA 4RFBA 4RGOS 3MXNA 3ZYYX 2ZXRA 1LTAD 3TMEA 5IODA 1SE2A 3NE5B 1TVXA 1IW7C 1BOSA 2HQEA 2NTTA 1UEAB 2K33A 2WACA 1YNNC 4RWSC 2K5QA 1BCPD 1AZPA 4DNTB 1D1KA 1PRTB 3BDCA 4DK0A 1I3QB 1XYIA 2EYMA 3J7AF 2KUMA 3D6CA 1EIGA 4LMQD 1EU4A 1WTXA 1SYGA 1TKWB 4QF4A 1WTQA 1A3UA 1PFMA 1RKNA 3QJYA 1BNZA 3SXHA 2A5HA 4HN7A 1HUNA 1B4OA 2IWHA 5A2QL 2NN6I 2VUMB 2Q8IB 1SNPA 5A35A 4XXEA 1ESRA 3MFYA 4X3SA 5ELBA 1GUGA 3S1QB 3KLRA 1WVLA 4B08A 5M3FB 1VMPA 4IN3A 2RBMA 1TT2A 5DM63 5FLXL 3J7YW 2F1MA 2BDNA 3K5MA 2DN8A 2NBFA 1CHQD 4RCNA 4OHJA 3E0JA 4R8NA 3PIP3 3K5OA 3MXUA 3LWEA 5I2YA 1EL0A 4Y7NB 1BXTA 5EPKA 1EY4A 3KK7A 5CR3A 2XIWA 4FXGC 1PTOB 4RH6A 1RF2D 4OIKA 3DEPA 3BVZA 2WAQB 2KOLA 1PTOH 3UI2A 1AN8A 5BN3A 3Q23A 1F77A 2H4OA 3DWPA 3BZDB 3SE0A 1JOKA 3J80L 2ICEC 3OSOA 4AYBB 2L1BA 5FO7B 3SK4A 3I70A 3NHHA 1STEA 5DEHA 1DXMA 2NVQB 4TKOB 4CGYB 5NUCA 1SYCA 3GQBA 4DAVA 2E76C 1K83B 2LY7A 3V05A 1MBYA 4K5VA 1JWUD 4A3GB 1JOOA 1PZID 4BS9A 1NAPA 3NBIA 5CBEE 1QNKA 1Q1BA 1KDBA 1B2TA 2K7VA 4IUQA 2PO4A 2F0MA 1ZXTA 3CU7A 4PQXA 3RZOB 3L3OC 3A54A 1F2MA 2B2WC 4BY1B 1FGBD 1KLGD 5CV6A 2IL8A 3E6ZX 4CHTB 1S5CD 1J8IA 2EY5A 1WTWA 5C4HA 1HRJA 4V190 2XN9C 4J6HA 3EVQA 5C3XA 3HZXA 2M9VA 1ZYRD 5DAUA 4BA2I 1OO9B 3PUXA 1SNQA 3VR3A 4HCSA 5TSSA 3S2DB 2OF1A 4OL7A 4KK7A 2R93B 1GUWA 2K01A 1GOZA 1LT4D 1B9MA 3I4NB 1SE4A 1TU2B 2J4XA 2K6AA 1G91A 4IFDI 1GHJA 3P75A 1H9KA 2SNMA 1CK1A 4FXKC 3TN2A 4TQUS 4OGQC 5F2DA 5EKKA 4ZKCB 1KDAA 4V0BA 1EWCA 4G7OC 2XWBB 1NCVA 5M5WB 1B3AA 1R9TB 2E2DC 2EVBA 1MD2D 2JA7B 3ND8A 5KYIA 2OT2A 5JAVA 2J7ZA 2NTSA 4TSSA 1C4QA 1OXUA 4IALA 3PV0A 3FKIB 1ET9A 4C3HG 5IT9L 1GXDC 1CQVA 4RCOA 2PYKA 1PRTF 2QDBA 3NBHA 2EYLA 2DY7A 3OIQA 4TRDA 1EEFD 4DU9A 3QOJA 4K14A 4OO1I 1Q12A 4G7ZC 1TS3A 2SDFA 1O80A 3T51B 2EPBA 5EBDA 3HOVB 2B8FA 5T1IA 1LTTD 2Z4IA 2B2UA 1JWMD 2F03A 1B44D 3S17B 3AMUA 4K2LA 2HDLA 3CHBD 5IGBA 3HRZC 4DFAA 4O42A 2B8GA 2EJFC 5BN5A 3EFXD 1TWGB 5DNFA 4A3FB 1JB3A 3NXWA 3G6JB 1C48A 1GUTA 4QIWB 1FR3A 2EY6A 2A73B 1F2YA 2O4XA 5JEAJ 1DM0B 1QJOA 3V2TA 3C46A 4KI0A 1YNJC 2I46A 2B2WA 4R8IA 3CQZB 3PUVA 3MC0B 1EEID 3KLSX 2D9UA 1D1IA 4EGVA 2CHBD 1H9RA 2LMCB 3OIPA 5JJZA 3MXGA 4FF4A 1PFBA 4IQZA 3BVGA 1EY5A 3NP8A 1PTOC 1SYEA 1S4ZA 2RQXA 1STBA 1HTLD 5EKIA 4RHSA 3BG3A 3I73A 4XTCS 1CT1D 2F0JA 2MGSA 1TS2A 3GTQB 1O7ZA 1OXTA 2EXZA 4IFDJ 5E4WC 4ZRZA 1ET6A 2WKCA 4U673 3I4LA 5EBCA 5KYLA 3D6WA 1SNDA 3M85A 1CM9A 5CC4A 4OIJA 2V4DA 4IUVA 2SEBD 4NMZA 4CJ2C 2R7ZB 4J8QA 1AW7A 5C5LA 1D5ZC 1Q8IA 4KN7C 3GV6A 1H9SB 3U9SA 4CKBA 3MAQA 1EWHA 1LO5D 2F0OA 2G9DA 2QKIC 4BY7B 1EQTA 1I4HA 1O78A 1OXSC 2EOTA 1X3QA 3VYUA 1V43A 2GA4B 2PCFB 3SEBA 5D65A 2E74C 3J81L 1BCPC 1G2SA 4F8MA 2X6LA 3M7NA 1HPCA 3TP7A 1HTPA 4DGZA 1BCPB 4C1NK 2C9OA 4QUFA 3NQTA 2RVLA 3EROA 1DOMA 5KIXA 1VF5C 4PMCA 1W6JA 5EQ0A 1GUSA 4WFN3 1EYDA 2KECA 2L4NA 2NYZD 3T56B 1SYBA 1KDCA 2LKVA 4KD4A 4F7XA 1EU3A 1QG7A 1F2ZA 3LWUA 2ZT9C 5COYA 1DOKA 4CBVA 1Z6HA 1U9RA 1DYQA 3HS0C 1CTMA 3D31A 1D5XC 2H1EA 1YNJD 4MHEA 1LTRD 4KTAA 2XVSA 3NTHA 3GD7A 2I07B 2L55A 4HSVA 3C1FA 2B2YA 5JEAH 3R3OA 2EYOA 4Q0FA 1K8MA 3GP7A 4C3IG 4ZK9B 2OEOA 2DNCA 2R61A 1U4PA 3MWYW 3C1EA 1A3TA 1CZWA 1MGSA 4HMIA 3VR5A 2A69C 5G3LD 3HOUB 2M2LA 1E2WA 1S5BD 5IIFA 1STAA 3A8IE 3A55A 1HHVA 3VR4A 4BBRB 3VYRA 5C0XG 1HUMA 1EZ8A 1U4MA 3M4OB 5CV7A 3CRKC 2BA0A 5DM73 4FXDA 1WTRA 1ONLA 1B53A 2EYJA 4DA2A 1O7LA 5IGFA 1PYWD 5C0XJ 5IT9E 4LK1C 2E2HB 1BQQT 1Q3LA 2AQ2B 3T16A 5JOBA 1PTOF 3DMUA 1TS5A 4IUPA 5M9OA 4FF2A 2F0GA 2VB3X 5C0XH 4PV1C 2F3VA 4PMBA 2L11A 2KVMA 3RMHA 3TZDA 1GUNA 4HSPA 2ID0A 2BDOA 1O7YA 1HXYD 4WJWA 4Z9CB 3S9WA 1F9QA 2HDMA 5M5YB 2VB2X 4ZKBB 4C1NI 2FJ2A 1RJTA 4C3HB 5IGDA 3WOEA 2FFKB 2ZXOA 3WOFA 1EQVA 2CVRA 1L0YB 4N9PA 4ME5A 3OWFA 2F4IA 5IGEA 1OXVA 2F0DA 3PUWA 5ELFA 3MEHA 2EYFA 4ODGA 1R4QB 3CRLC 5CV5A 4KY6A 4FYDA 2SOBA 1S5ED 3GTLB 3S2HB 2RSOA 2ZXPA 3K6OA 3EA6A 1IKLA 2CQAA 3VA5A 2L12A 3J7AV 5HGTA 4RGTA 1HA5A 3D3RA 1I4RA 2J0TD 2F0PA 1XTCD 1D6EC 3HEJA 3SR1A 1KNEA 2IX3A 1IYVA 3D4DA 3IFDA 1KLUD 1I4QA 2WINB 1MSHA 3X3NA 1VDZA 2MHVA 2Y0SB 3URYA 2F0VA 4KV6A 4CKCA 4U68A 3OOCA 4ZUIA 1KABA 2XSCA 2AUKA 3K7AB 3Q24A 4HCEA 3SHLA 1TY0A 1MI2A 4F88A 4PNYA 3SK5A 1EIHA 3FMCA 5CV4A 3NWSA 1EY7A 1STHA 4KN4C 2C5CA 2TMPA 4FNFA 2JXMB 5CORA 2PMZB 1I4PA 2BA1A 5KEEA 3KBGA 3BYYB 1JORA 1BO0A 1FNWA 1PRTC 1G291 5M3MB 3BVMA 1VCIA 5CV9A 4XYOA 3LX0A 2Z1CA 1GJXA 1CA5A 3F2UA 2E2IB 1ZEQX 1TY2A 4XDXA 5C44B 1FNUA 1Z7TA 1A2UA 1SFOB 1BBXC 4ZUJA 2K32A 2F0LA 1EYCA 1PZKD 2F0FA 1RCVD 4MN3A 3C3LA 2PNRC 3MHBA 1V1OA 2IX0A 5I4DA 1HA6A 1HCZA 4H0LC 5IGGA 4M1UB 2NWGA 5D3IB 1QNUA 5CGKA 4DN4M 5E4XA 3VYTA 3RD4A 3A56A 2PZUA 3S1RB 4J1MA 2KCCA 4I65A 2K5WA 4G4KA 2JA8B 2BE5D 2KQ3A 3FDTA 2Z4HA 1LT6D 1AEXA 3FPPA 1OXXK 3OPOA 2QEJC 3GTGB 1PRTD 5I9OA 3N6RA 2NZ1D 4RA8A 1SEBD 3FRPB 1X3PA 2O5IC 4BA1I 3DXJC 2JSOA 4RHRA 3E5SA 1QWYA 3M3YB 4MIUA 1WTOA 4LAAA 1VF7A 2RA4A 4QMGA 3TP6A 3I3CA 3OMCA 4ZYSA 4JK1C 5I6WA 4M8AA 1S5FD 3QOLA 4ZAIA 4UDUC 3R93A 2WP8J 1KTKA 2F0SA 2FMMA 4KKUA 1BUVT 2BCOA 1SMYD 4IFDH 1J9OA 4HMJA 2K04A 1WD1A 1SNCA 5JVG3 4HAEA 2OXPA 4P2CB 1QB5D 2A6ED 3PO2B 1STYA 3IL8A 2Z8LA 3NTIA 3V96A 2PW5A 3P1HA 3MZ5A 3BDLA 2LS01 5EGTA 3Q22A 1LV9A 2YYZA 2EYPA 3U9OA 1S5DD 4RAUC 3QIAA 1F9PA 4KHZA 2F0UA 1D5MC 2IT1A 1G6ZA 1K8OA 4RGNA 3MXPA 1II3A 3QG1A 4DXFA 4EQPA 3H91A 4IFDG 3BDOA 4WORA 3H0GB 2A6HD 1IL8A 2EDGA 2FINB 5JPMC 2B2YC 4A3KB 4XT1B 4X3UA 3RLFA 2K28A 5C6AA 1I6VC 1CZGA 4WRDA 5K5PA 4KKSA 1F9RA 2BOSA 1EOTA 1XX8A 4K8JA 4CJ0B 5FLXE 2F0HA 2VXWA 1T5XD 2XWJB 1LT3D 2DNEA 3A8JE 3HOXB 1CA6A 1PDQA 1RODA 2NB0A 4K2KA 3TBIB 4OO1H 1SJED 1RTNA 4A3MB 5KGUA 1H9MA 1IYUA 3RUZA 3HOWB 1PXUA 3O13A 2CW0D 3C2PA 1UNSA 3PUYA 2KHSA 3GTOB 5KNBA 2Q8RE 1SBBB 5FK9C 4ULLA 1SDFA 5C5MA 4ZQ3A 4DK1A 3GTPB 1V1PA 2F0NA 3H6MA 3GV3A 1LTBD 4KMUC 2KEDA 1ZYRC 3PO3B 3QB3A 4IUTA 2AWNA 2F3WA 1X32A 3EQLC 1HFGA 1EY6A 3KBXA 1AFPA 3J80E 1MSGA 3KUPA 4K5XA 2EY1A 2PW7A 4UAIA 1CFMA 1I4GA 3OMGA 4L6TB 2WB1B 2IX1A 4XQNA 1AZQA 3GTKB 1Y8PB 1VMCA 2JEAI 4A3JB 1CI3M 1JQYD 3A8KE 3RZDB 4QB4A 5EKLA 2RKSA 2WV6D 1LTGD 3S1NB 3P7JA 3DUZA 4A3DB 3DHQA 2TSSA 4F87A 3MTSA 3K5NA 5CMDA 3FVQA 2R6GA 2K1BA 4XYQA 1CQFA 1PFNA 3M7GA 1G8ZD 4QUCA 3H09A 5LHY1 1XWEA 3S16B 4ZLTF 1B50A 1QOHA 2L5TA 3VA7A 3HP3A 4EQNA 4IUNA 3I72A 2NN6H 4GZYC 1HQRD 4B9XA 4ABNA 5LL6X 5C4XB 2A6EC 1LT5D 3G7LA 1ZKOA 4QCLA 2AQ3B 1BCPF 1TWCB 1V1PB 5T1GA 3AB9A 3GTMB 4XIGS 1Y69U 4K6DA 4DNRB 5HURA 4G7HC 4R9WA 1U4RA 2N88A 2CW0C 2QF7A 1SAPA 1H9JA 4C3IB 1QE6A 2EYHA 1EZ6A 4DAPA 4CJ1B 1ILQA 1BF4A 5FKAC 1PLFA 5C3WA 1U4LA 1BDOA 1GHKA 1ENFA 3NUCA 4DAYA 3I4MB 5C4ZA 5J39A 1TR5A 5KNCA 4H13C 2B2UC 3S1MB 3LNNA 1Z47A 2E2JB 2EY2A 1I6HB 5IGCA 1KAAA 4A3IB 2AQ1B 1SSOA 1Y1VB 2A74C 3TSSA 3I90A 3ND9A 5CYUA 1D2BA 3X3MA 1JOQA 2BE5C 5AFWA 5I2XA 1TWFB 1WCMB 3MVVA 3HOZB 2K5DA 5ELCA 1V8QA 2O5JC 3QO2A 1DONA 2XNAC 1FD7D 1PMRA 3R8BA 3VR6A 3IAYA 1FNVA 5G3LF 4YIJA 4H7BA 3I8ZA 1Y1WB 3PUZA 2HUGA 1TWHB 4G57A 1NR4A 2QCPX 2NVXB 1STGA 2D5DA 3HG9A 3J81E 1YNND 3OHXC 1XXGA 1CHPD 1IW7D 1I50B 4NKLA 5EJWA 4FP5D 1A3VA 1SMYC 1WD0A 2YU9B 3HKZB 1JC7A 2VNUD 1PTOD 3S15B 1EY9A 3OWEB 1WTVA 1EYAA 1I4XA 2NUCA 1E0BA 3EJIA 4A93B 1QILA 5LL6S 5C0XI 3SDZA 3NQIA 1KNAA 3A7AB 1RTOA 1DCZA 4KJOA 4RGMA 4ILWA 2JEBI 4S3SA 2F0WA 4N9TA 5IOCA 5EPLA 3SK6A 4ID6A 1TQOA 3NPPA 4K5WA 2RSNA 2RDHA 3ITPA 4HTHA 2A68D 5JEAG 4FVMA 1PZJD 3Q0AA 1JICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q8R E;  2MJ8 A;  1WD1 A;  1NR4 A;  2IL8 A;  4HAE A;  1SDF A;  1HFN A;  3IL8 A;  4MN3 A;  2J7Z A;  1WTR A;  4X3T A;  3Q6S A;  1B53 A;  3LWE A;  4QUF A;  1EL0 A;  1KNE A;  3G7L A;  1S4Z A;  2RVL A;  3GV3 A;  1DOM A;  2Q8T A;  3IFD A;  2KED A;  3FPU B;  1J8I A;  5EPK A;  5EKI A;  1HA6 A;  3DEO A;  5CBA E;  4XT3 B;  3N52 A;  1MSH A;  1LV9 A;  2NWG A;  2XIW A;  4IUT A;  5EQ0 A;  5T1G A;  3SVM A;  1C8C A;  2KEC A;  2X69 A;  1Q3L A;  1WTW A;  2MPM A;  2L4N A;  2NYZ D;  1X32 A;  1TVX A;  2MP1 A;  1ILP A;  2MGS A;  4R9W A;  1IKM A;  1HRJ A;  1U4R A;  4U68 A;  1O7Z A;  1HFG A;  5E4W C;  4OIK A;  3DEP A;  3KBX A;  4RAU C;  3DM1 A;  4RWS C;  5EJW A;  1DZ1 A;  4DN4 M;  2N88 A;  5E4X A;  1QG7 A;  4IUR A;  4IUP A;  1F9P A;  5COY A;  2DY7 A;  1DOK A;  2R3Z A;  1WD0 A;  1G6Z A;  1SAP A;  1AP0 A;  1MSG A;  2KOL A;  1AZP A;  2EE1 A;  1QE6 A;  1MI2 A;  3KUP A;  3UI2 A;  2L11 A;  2KVM A;  2N55 A;  4UAI A;  2L9H A;  4CJ1 B;  1XYI A;  3TZD A;  1EIH A;  2SDF A;  2JYO A;  1ILQ A;  1O80 A;  1BF4 A;  2H1E A;  2KUM A;  2EPB A;  3FDT A;  4NW2 A;  1EIG A;  3H91 A;  4LMQ D;  4MHE A;  5T1I A;  3I91 A;  1AZQ A;  1PLF A;  1O7Y A;  3D6W A;  1WTX A;  1CM9 A;  2B2U A;  4HSV A;  4HCS A;  4OIJ A;  1ML0 D;  1U4L A;  1VMC A;  2B2Y A;  1WTV A;  4IUV A;  1WTQ A;  2B2T C;  2NZ1 D;  4RA8 A;  1IL8 A;  2HDL A;  1X3P A;  2B2V C;  2FIN B;  5COR A;  1F9Q A;  1PFM A;  2HDM A;  2L1B A;  4CJ2 C;  1NR2 A;  1GUW A;  1E0B A;  2B2Y C;  2K01 A;  4ZKB B;  1BNZ A;  1DOL A;  5D14 A;  4ZK9 B;  2B2U C;  4X3U A;  4XT1 B;  3MWY W;  2FJ2 A;  1U4P A;  2K28 A;  4O42 A;  1WTP A;  1B4O A;  1HUN A;  1WTO A;  2RA4 A;  1RJT A;  1BO0 A;  5DNF A;  1G91 A;  1KNA A;  2FFK B;  2X6G A;  3P7J A;  2B2V A;  1F9R A;  3GV6 A;  3I3C A;  1EOT A;  4X3K A;  3MTS A;  1XX8 A;  1RTO A;  1SSO A;  2B2T A;  2CVR A;  5CMD A;  1ESR A;  1MGS A;  4CJ0 B;  2K03 A;  4X3S A;  3I90 A;  1JE4 A;  2VXW A;  1A15 A;  1RHP A;  2K1B A;  1G2T A;  4IUU A;  5AFW A;  2M2L A;  1WVL A;  3ONA B;  1PFN A;  1EQT A;  1M8A A;  3TN2 A;  2FHT A;  1ICW A;  2DY8 A;  1CA5 A;  3F2U A;  2JP1 A;  1NAP A;  5EPL A;  4QUC A;  2EOT A;  1X3Q A;  5CBE E;  4ZAI A;  2B2W A;  1QNK A;  3R93 A;  1PDQ A;  1ROD A;  4R8I A;  1CA6 A;  1B2T A;  2HCI A;  4XDX A;  1VMP A;  4ZKC B;  1HHV A;  4IUQ A;  1F2L A;  2D9U A;  2RSN A;  5D65 A;  2HCC A;  4ZLT F;  3QO2 A;  1DON A;  1RTN A;  1ZXT A;  2FMM A;  2RSO A;  1F9S A;  4HED A;  1B50 A;  1NCV A;  5EPJ A;  1HUM A;  1G2S A;  2X6L A;  1B3A A;  2K05 A;  1BBX C;  5JJZ A;  3HP3 A;  1IKL A;  1PFB A;  2B2W C;  2BDN A;  2L12 A;  3I8Z A;  1U4M A;  2HUG A;  1JIC A;  1J9O A;  2KEE A;  2K04 A; 
#chains in the Genus database with same CATH topology
 4C3J G;  1TWG H;  4FO2 A;  1LTS D;  3TP5 A;  4I7Z C;  3K5L A;  2KCN A;  4J15 A;  4JBK A;  3FPU B;  4A3J H;  2IJ0 A;  4RKL A;  4CKE A;  4C2M B;  2JA9 A;  2I5L X;  3H3V C;  1GVP A;  5IE8 A;  5M5Y H;  3SVM A;  5J3B A;  3HKZ G;  3T4A C;  2KA7 A;  5ISR A;  2EIF A;  5FOB B;  1VQL A;  1TWA H;  2O2L D;  2MP1 A;  1ILP A;  3OW7 A;  2E75 C;  1HQM C;  1TS4 A;  2AUJ D;  3TP8 A;  3DM1 A;  1DZ1 A;  4IUR A;  4C2M H;  5I9P A;  1B1Z A;  2R3Z A;  3MFG A;  5C3E G;  1AP0 A;  1Q90 A;  1IBL Q;  4NDX A;  1UAP A;  4IZ8 A;  2ASB A;  1TWA B;  2N55 A;  1TII D;  1YJ9 A;  2UXD L;  2B29 A;  4GOP B;  3T13 A;  3KLS A;  3I91 A;  1ENA A;  2FMC A;  1UUP A;  1L0X B;  1B3Q A;  1EQQ A;  2F4V L;  2EJG C;  1E2V A;  3R2I A;  2B2T C;  1X3E A;  4RKB A;  1A62 A;  5JVH 3;  2WKD A;  4MTN A;  1NSN S;  1VQK A;  1NR2 A;  2RF4 A;  4L8J A;  4C3J H;  1XNR Q;  3RLO A;  4JCV E;  5D3D A;  1E22 A;  3M4Y A;  1WTP A;  5JPN C;  1MHW C;  3A7L A;  4BBS B;  1PH6 A;  2X6G A;  1FJG L;  4OO1 G;  3W3A A;  1VQF A;  2B2T A;  1SYF A;  5ELD A;  5HGQ A;  1JB7 A;  3J7A 5;  4JI5 Q;  4C3J B;  1JE4 A;  1SXT A;  1A15 A;  2D62 A;  4IUU A;  4LF6 Q;  2AWO A;  4P73 A;  4K6L A;  3ONA B;  5KRU A;  4HJA A;  3P20 A;  2DY8 A;  5K36 G;  4EX5 A;  1WI5 A;  1ESF A;  4KLK A;  1QCB D;  4IPH A;  2HCC A;  2R7F A;  3I56 A;  4DK3 C;  2WII B;  1GUO A;  3D4R A;  3H94 A;  2ZM6 Q;  1B7Y B;  3IKJ A;  4LFC L;  3SK8 A;  1Y8N B;  2IW3 A;  2VUM H;  1HFN A;  3HGB A;  3K0Y A;  1W6K A;  3BYT B;  1NMF A;  4X65 L;  1HNW Q;  4LF4 Q;  3Q6S A;  1SNM A;  2PPB C;  5IYD H;  1M4V A;  2KJX A;  5J1Z A;  1JWS D;  3IFT A;  1VQM A;  1BR9 A;  1RD9 D;  2EXD A;  4DR3 L;  4B3M Q;  3HOY B;  4KJN A;  4XT3 B;  3K57 A;  1EY8 A;  1PHJ A;  1C8C A;  5GAH C;  4EQO A;  2X69 A;  3S1M H;  1LUZ A;  2F0K A;  3TZU A;  2IPK D;  4KD3 A;  1IKM A;  5M3F H;  2HIV A;  3UDI A;  2V1C C;  4OWX B;  3L9A X;  2QIL A;  3FEW X;  1ASY A;  1Y1V H;  4DXG A;  3JAM c;  1SYD A;  4XQQ A;  1XMO Q;  3A5Z B;  1STN A;  4KY7 A;  4RG1 A;  3A5U A;  1RDP D;  1P8L A;  1ENC A;  3QR8 A;  2UXB L;  2JA5 B;  3DWQ A;  5CV8 A;  3CME A;  2EZV A;  1JT8 A;  1TWF H;  3BU2 A;  2PZW A;  4NW2 A;  2BH2 A;  1WCM H;  2OQK A;  2QA4 A;  1XTD A;  4HIK A;  5E1F A;  4A75 A;  2CCZ A;  2UUA Q;  4A3B H;  1J5E Q;  4A3C G;  4B3T Q;  2PQA B;  5C3E B;  4GN3 B;  1LLR D;  3QWN A;  1R4P B;  3S14 B;  4GKK L;  2B2V C;  3GTJ B;  1SJH D;  4R4O A;  4YY3 Q;  1E2Z A;  5ELE A;  3K0X A;  2RDF A;  3PMF A;  4A3B B;  4R4C A;  3L2P A;  1A2T A;  4A3B G;  1E1O A;  4C56 C;  3S14 H;  1SNO A;  2F0E A;  1Y8O B;  3G6E A;  1H9S A;  2K03 A;  2PZT A;  4HR7 B;  4GNX C;  2G9H D;  1VQG A;  4B9W A;  1RHP A;  2Q2U A;  1G2T A;  3ERQ A;  4GKJ L;  1EY0 A;  3JAM E;  4LF4 L;  3S1N H;  2LFN A;  2K5H A;  2JA7 H;  1DJR D;  3MA2 B;  4B3M L;  1L2F A;  2HCI A;  2NN6 G;  1A6X A;  4QIW E;  1K0S A;  3T53 B;  2JA6 B;  2JA8 G;  1VQC A;  5EPJ A;  1K9M C;  2K05 A;  3NK9 A;  2SNS A;  2I5H A;  1SE3 A;  1I5F A;  2RDG A;  2MJ8 A;  3NTK A;  5GRO A;  1CKN B;  2VS1 A;  1KIX A;  3S16 H;  4X3T A;  1B9N A;  3DWA A;  1JCK B;  1Q1E A;  4E6I A;  1PV4 A;  1G51 A;  4FF3 A;  2L15 A;  2Q8T A;  4DF7 A;  1L1O A;  3DEO A;  5CBA E;  3N52 A;  5A2Q E;  2XRQ D;  2MPM A;  2MUY A;  4YWK A;  2L0C A;  2NVT H;  4K8I A;  1HZB A;  5FO9 B;  2YTV A;  5C4X H;  3TDQ A;  2OTJ A;  2UUB Q;  3KF8 A;  5E3F A;  3D4W A;  3K59 A;  2XRS D;  3D8G A;  2B39 A;  4XQJ A;  4L63 B;  3CKI B;  2B63 B;  4EVO A;  2EE1 A;  2EJM A;  4JBW A;  4O1N A;  4PMW A;  3AEV A;  2F0T A;  2NVY B;  1JR0 D;  2M00 A;  3UDF A;  4BWG B;  2L9H A;  2NVT B;  2GN5 A;  1SLJ A;  2JYO A;  4A3E B;  1X56 A;  4LJZ C;  1DD2 A;  4JI0 Q;  1T9H A;  2NZH A;  3VR2 A;  1PFS A;  1V1Q A;  2ICI A;  3AU7 A;  1EFI D;  1ML0 D;  4A3F H;  4B3S L;  5J22 A;  1Q86 C;  4LUZ A;  3JAM L;  2A69 D;  4KY5 A;  5FJ8 H;  1PVO A;  2R92 H;  2FXQ A;  1P16 A;  4H44 C;  1EOV A;  1IYJ B;  5KND A;  4BBS G;  5FO8 B;  1DOL A;  5D14 A;  2JE6 I;  3PIO 3;  3W2D A;  1FYC A;  5BN4 A;  4FF1 A;  3KJO A;  3ERS X;  3NSW A;  3IRB A;  2ZTD A;  2D2C C;  5M5X B;  4DV1 L;  2B2V A;  4JI3 Q;  3I4M H;  4X3K A;  1TXY A;  1NUC A;  4KKT A;  3WDN A;  3CQZ H;  2R92 B;  2F0I A;  4NP5 A;  1HNZ L;  5K36 H;  2A6H C;  3K58 A;  1GKH A;  3D0F A;  2UUC Q;  1M8A A;  2FHT A;  1ICW A;  2JP1 A;  1I6H H;  4KHV A;  3L7Z C;  4ALP A;  4Q5V A;  4YCU A;  1IXR A;  2F0Q A;  3VYS A;  1F2L A;  1IL2 A;  3GO5 A;  4NXM Q;  4HED A;  1YHA A;  4HJ7 A;  1F9S A;  5I6Y A;  1NY4 A;  5C4J B;  4JI8 L;  1LTI D;  2A68 C;  2PQE A;  3NWT A;  1IHZ A;  1LAC A;  5GQO A;  1LAB A;  3BS1 A;  2IY5 B;  2KEE A;  2CH4 A;  4A3L G;  3I4N H;  4DV6 Q;  2ENB A;  1T5E A;  2VQF L;  3R2T A;  4RFB A;  2UU9 Q;  1PA6 A;  2Q2H A;  4RGO S;  2ZJR A;  3MXN A;  3FHW A;  3ZYY X;  4DR4 L;  4LFA Q;  5IYB G;  1TWH H;  2ZXR A;  1LTA D;  3TME A;  1OTC A;  5IOD A;  1SE2 A;  3NE5 B;  1TVX A;  1IW7 C;  4A3G G;  4DV7 L;  3K80 C;  1BOS A;  2HQE A;  2NTT A;  1UEA B;  2K33 A;  2WAC A;  3GTL H;  1YNN C;  2KBN A;  4RWS C;  1KHI A;  3PIO A;  2XTI A;  2PI2 E;  2K5Q A;  4R4Q A;  3F2B A;  3J80 c;  1BCP D;  1AZP A;  1R9T H;  4DNT B;  3PIP A;  1XNQ Q;  1D1K A;  1PRT B;  4JI3 L;  3BDC A;  4DKA C;  4NXN Q;  4DK0 A;  1I3Q B;  1WCM G;  1XYI A;  1JJG A;  2EYM A;  3J7A F;  3CC2 A;  2KUM A;  1HNZ Q;  3D6C A;  1EIG A;  1I50 H;  4LMQ D;  4DNI A;  3CCL A;  1EU4 A;  3HOU G;  4P75 A;  1WTX A;  4A3D G;  1SYG A;  1TKW B;  4QF4 A;  5IP7 G;  1WTQ A;  4QQB X;  1A3U A;  4DV5 L;  1PFM A;  1A63 A;  1RKN A;  3QJY A;  1BNZ A;  2ATW A;  3SXH A;  2A5H A;  2VY3 A;  2LXK A;  4A3J G;  4HN7 A;  1HUN A;  1B4O A;  2IWH A;  4QJF A;  4LF7 L;  1KAW A;  4JI8 Q;  5A2Q L;  2NN6 I;  2VUM B;  1UE5 A;  2Q8I B;  3ULL A;  3PSI A;  1SNP A;  5A35 A;  4B3T L;  2HQL A;  1ESR A;  2K5V A;  4XXE A;  3MFY A;  4X3S A;  5ELB A;  1GUG A;  4A93 G;  3S1Q B;  3W1G A;  3KLR A;  1HR0 L;  1WVL A;  2AHO B;  4B08 A;  1B70 B;  4PZ8 A;  2JA6 G;  5M3F B;  2K4K A;  1VMP A;  4IN3 A;  2WAQ E;  3UDX A;  2RBM A;  1ASZ A;  1TT2 A;  5DM6 3;  5FLX L;  2Z6K C;  3J7Y W;  2F1M A;  2A8V A;  2BDN A;  2JA5 H;  3K5M A;  2DN8 A;  4GN5 A;  2NBF A;  1CHQ D;  4RCN A;  4OHJ A;  4BY7 G;  3E0J A;  4R8N A;  3GTK H;  5M3M H;  3PIP 3;  3K5O A;  3MXU A;  3LWE A;  5I2Y A;  1EL0 A;  4Y7N B;  3HOX G;  3CF5 A;  1BXT A;  1IBL L;  5EPK A;  1EY4 A;  3KK7 A;  3HOW G;  5CR3 A;  1EQR A;  2XIW A;  1L1O B;  1KQS A;  4FXG C;  1PTO B;  1Y14 B;  2R92 G;  5BR8 L;  4RH6 A;  1Q81 C;  4YY3 L;  1RF2 D;  4OIK A;  3DEP A;  4BY1 G;  3KF8 B;  3BVZ A;  4GLA C;  2WAQ B;  2KOL A;  4JV5 Q;  1PTO H;  4JI7 L;  1CKN A;  3UI2 A;  1AN8 A;  1QVF A;  5BN3 A;  3Q23 A;  1F77 A;  4JOI A;  3T1Y L;  2H4O A;  2VUM G;  3DWP A;  2EQS A;  3BZD B;  3SE0 A;  1JOK A;  3J80 L;  3KLW A;  2ICE C;  3OSO A;  4AYB B;  2L1B A;  5FO7 B;  3SK4 A;  3I70 A;  1QVG A;  3NHH A;  2VQE L;  2B3G A;  1HZ9 A;  1STE A;  5DEH A;  3HOU H;  2UXD Q;  1DXM A;  2GVA A;  2NVQ B;  4TKO B;  4CGY B;  5NUC A;  3E9H A;  1SYC A;  3GQB A;  3J81 i;  1EIF A;  4X66 L;  1VQA A;  3KF6 A;  4DAV A;  2E76 C;  1K83 B;  1CKM A;  2LY7 A;  3V05 A;  1MBY A;  4APV A;  4K5V A;  1JWU D;  1YHQ A;  4A3G B;  1JOO A;  2K14 A;  1PZI D;  4BS9 A;  1FVI A;  1NAP A;  3NBI A;  5CBE E;  4BY1 H;  4CDD C;  1QNK A;  1Q1B A;  1KDB A;  1B2T A;  2LXJ A;  1VQ8 A;  3GTG H;  2K7V A;  4IUQ A;  2PO4 A;  2F0M A;  1MKH A;  1ZXT A;  2RCF A;  4LF8 L;  3CU7 A;  4PQX A;  1QUQ B;  3L3O C;  3A54 A;  3RZO B;  2R7Z H;  1F2M A;  2B2W C;  4C3I H;  3M3Y H;  4JI4 L;  3STB D;  4BY1 B;  1FGB D;  1KLG D;  5IT9 c;  5CV6 A;  2IL8 A;  5JJL A;  1BVS A;  4OX9 L;  3E6Z X;  4YCW A;  1D8L A;  2MO1 A;  3OYY A;  4CHT B;  2F3I A;  2PMZ E;  4NXM L;  1S5C D;  4I7A A;  3ICE A;  1J8I A;  2UXB Q;  2EY5 A;  1S40 A;  1WTW A;  5C4H A;  1VQ4 A;  1HRJ A;  2E2J H;  1HZC A;  4DR5 Q;  4V19 0;  2XN9 C;  4J6H A;  2DJF C;  2AMC B;  4PZ7 A;  4AYB E;  3TRE A;  3J81 j;  4A3I H;  3HOY H;  4PG3 A;  3EVQ A;  5LMN Q;  5C3X A;  2Q2T A;  4YCV A;  2N49 A;  5IYC G;  4DV1 Q;  3HZX A;  1YNX A;  1NTG A;  2M9V A;  1ZYR D;  3BZK A;  5DAU A;  1N34 Q;  4BA2 I;  1OO9 B;  3PUX A;  1SNQ A;  1YIJ A;  3VR3 A;  1JJ2 A;  3HOZ H;  4HCS A;  5TSS A;  1HZA A;  4DV4 Q;  3S2D B;  2OF1 A;  4OL7 A;  4DV3 Q;  4KK7 A;  3KDF B;  4HIO A;  2R93 B;  1PH1 A;  1GUW A;  3F1Z A;  2K01 A;  1EFW A;  1GOZ A;  4L5R C;  1LT4 D;  4GOP C;  1B9M A;  3CAM A;  2I5M X;  2RCN A;  2Y0S G;  3I4N B;  3RN2 A;  1SE4 A;  1TU2 B;  2J4X A;  2K6A A;  2Z9H A;  2HT1 A;  1G91 A;  4IFD I;  1GHJ A;  3P75 A;  3H3V H;  2KCM A;  4DV6 L;  1H9K A;  2SNM A;  2VQF Q;  1SMX A;  2B63 G;  5EAY A;  1QZH A;  1CK1 A;  4FXK C;  3TN2 A;  5FLM G;  3TS0 A;  3A74 A;  4TQU S;  4OGQ C;  5F2D A;  5EKK A;  3RLN A;  3H0G H;  1YJW A;  1EIY B;  4ZKC B;  4IPD A;  1KDA A;  4V0B A;  3AQQ A;  1EWC A;  4G7O C;  2XWB B;  1NCV A;  5FJ8 G;  2CQO A;  5M5W B;  1B3A A;  2KHI A;  4A3K H;  1R9T B;  2E2D C;  2EVB A;  4HJ9 A;  1MD2 D;  4TVA B;  2ZJP A;  3I2Z A;  2JA7 B;  1WYD A;  3E9I A;  1N32 L;  3ND8 A;  5KYI A;  2JA7 G;  2OT2 A;  5JAV A;  2J7Z A;  2NTS A;  4TSS A;  1C4Q A;  4HIM A;  2UXC L;  1X65 A;  3K7A H;  4L5Q A;  1OXU A;  4IAL A;  3PV0 A;  3FKI B;  1YHB A;  1ET9 A;  4C3H G;  5IT9 L;  1GXD C;  3CD6 A;  1CQV A;  4RCO A;  1MIU A;  5IYD G;  3STB C;  4JI1 Q;  2PYK A;  1PRT F;  2QDB A;  3NBH A;  5H1S E;  2EYL A;  2DY7 A;  3OIQ A;  4TRD A;  1EEF D;  4DU9 A;  1SRU A;  3FKI H;  3QOJ A;  4K14 A;  4OO1 I;  5FLX c;  1Q12 A;  4G7Z C;  1TS3 A;  2SDF A;  1O80 A;  4X64 L;  3T51 B;  2EPB A;  5EBD A;  3HOV B;  4DR3 Q;  2B8F A;  5T1I A;  1LTT D;  2Z4I A;  2B2U A;  1VQE A;  4GNX A;  1JWM D;  2F03 A;  1B44 D;  3S17 B;  3AMU A;  4K2L A;  2HDL A;  1LYL A;  1VQD A;  4A3C H;  3CHB D;  5IGB A;  3HRZ C;  4DFA A;  4O42 A;  2B8G A;  2EJF C;  5BN5 A;  3EFX D;  3E0E A;  1TWG B;  5DNF A;  4A3F B;  4JI0 L;  1JB3 A;  3NXW A;  3EBE A;  3WWV A;  1Y1W G;  3G6J B;  1C48 A;  1GUT A;  4QIW B;  1FR3 A;  1YI2 A;  2EY6 A;  1VQN A;  2A73 B;  1F2Y A;  1MJC A;  2O4X A;  5JEA J;  1X54 A;  4A76 A;  4GS3 A;  1DM0 B;  1QJO A;  3V2T A;  1SFO H;  3HOZ G;  1XMQ L;  1JMC A;  4B3R L;  3C46 A;  4KI0 A;  1YNJ C;  1PYB A;  2B2W A;  2I46 A;  4R8I A;  3CQZ B;  3PUV A;  3MC0 B;  3UE1 A;  1EEI D;  3KLS X;  3CCJ A;  2D9U A;  1D1I A;  3ZJY C;  4EGV A;  2CHB D;  4LF5 Q;  1H9R A;  2LMC B;  3OIP A;  3RZD H;  2OWO A;  5JJZ A;  3MXG A;  5LMU Q;  1QZG A;  4FF4 A;  1PFB A;  4NB3 A;  3JAM i;  4IQZ A;  3BVG A;  4JBM A;  1EY5 A;  3NP8 A;  1PTO C;  4GKJ Q;  1SYE A;  5C4J H;  4LNQ A;  1S4Z A;  2RQX A;  1STB A;  1HTL D;  2N3S A;  3OTO Q;  5EKI A;  4RHS A;  3BG3 A;  4UP7 A;  3S1R H;  3I73 A;  3M4P A;  2MO0 A;  4XTC S;  1CT1 D;  1BBW A;  2F0J A;  3H3V I;  2JA8 H;  1E24 A;  2MGS A;  2NVQ H;  1TS2 A;  3GTQ B;  1O7Z A;  1OXT A;  2EXZ A;  4IFD J;  5E4W C;  4ZRZ A;  1ET6 A;  2WKC A;  4AH6 A;  4HJ8 A;  4R4I A;  4KHP L;  4U67 3;  3CW2 C;  3I4L A;  5EBC A;  2D0O A;  5KYL A;  3GTQ H;  2WAQ G;  3D6W A;  1SND A;  3M85 A;  1CM9 A;  4FDB A;  5CC4 A;  4OIJ A;  2V4D A;  4POG A;  2PI2 A;  4IUV A;  3SGI A;  2SEB D;  4HJ5 A;  4NMZ A;  4CJ2 C;  3E3X A;  3RZO H;  2R7Z B;  4J8Q A;  4LFB Q;  1AW7 A;  5C5L A;  1D5Z C;  4BY7 H;  4LF5 L;  3DLL A;  1Q8I A;  4KN7 C;  3GV6 A;  1H9S B;  1PH8 A;  3U9S A;  4Y52 H;  4DV4 L;  4CKB A;  3MAQ A;  1EWH A;  1LO5 D;  1B8A A;  2F0O A;  2Q2I A;  2G9D A;  4IPC A;  2QKI C;  4BY7 B;  1EQT A;  1I4H A;  4JYA L;  1O78 A;  1OXS C;  2EOT A;  1X3Q A;  3VYU A;  1V43 A;  2GA4 B;  3KDF A;  4HID A;  2PCF B;  3SEB A;  5D65 A;  2E74 C;  2E8G A;  3J81 L;  2K50 A;  4LUV A;  1BCP C;  1G2S A;  4F8M A;  2X6L A;  3M7N A;  1FJG Q;  1HPC A;  2R7Z G;  1WFQ A;  3ER0 A;  3TP7 A;  2QDL A;  1HTP A;  4DGZ A;  1BCP B;  4C1N K;  2C9O A;  4QUF A;  3NQT A;  2RVL A;  3ERO A;  1DOM A;  5KIX A;  5C3E H;  1VF5 C;  4PMC A;  4DUY Q;  2R93 H;  3VDY A;  1W6J A;  5EQ0 A;  1GUS A;  1NJI C;  4WFN 3;  1EYD A;  5IYC H;  2KEC A;  2R7D A;  2L4N A;  2NYZ D;  3T56 B;  1SYB A;  4CDE C;  1KDC A;  4IOA A;  2LKV A;  4KD4 A;  4F7X A;  1EU3 A;  2KCT A;  4Y7N H;  1QG7 A;  3NEL A;  1HR0 W;  1F2Z A;  3LWU A;  2ZT9 C;  5COY A;  1VQ5 A;  1DOK A;  4CBV A;  1Z6H A;  1U9R A;  1DYQ A;  3HS0 C;  2Z6K A;  1CTM A;  2VW9 A;  3D31 A;  1D5X C;  2E5L L;  4JI6 Q;  2H1E A;  1YNJ D;  2QW7 A;  4MHE A;  1LTR D;  4KTA A;  2XVS A;  3NTH A;  3GD7 A;  2I07 B;  2L55 A;  4HSV A;  3HKS A;  3C1F A;  2B2Y A;  5JEA H;  3R3O A;  1Q82 C;  2EYO A;  3MXN B;  4H02 A;  4Q0F A;  1K8M A;  1S72 A;  3GP7 A;  3K7U C;  4C3I G;  4ZK9 B;  3I7F A;  2OEO A;  2DNC A;  2R61 A;  1U4P A;  3AYH B;  3MWY W;  3M4Q A;  3PO2 G;  3C1E A;  4MTK A;  1A3T A;  3HOX H;  2HD3 A;  3BJU A;  1CZW A;  1VQB A;  1MGS A;  4X6A H;  4HMI A;  3VR5 A;  2A69 C;  5G3L D;  1K0R A;  3HOU B;  3HFZ B;  2M2L A;  1E2W A;  1S5B D;  1GM5 A;  3PQI A;  1STA A;  5IIF A;  4AYB G;  4DAY B;  3A8I E;  3S15 H;  3CP0 A;  1IBM L;  2RHQ B;  3A55 A;  1HHV A;  3VR4 A;  4BBR B;  3VYR A;  5C0X G;  1HUM A;  3GTP H;  2DUD A;  2CKZ B;  1EZ8 A;  3PO3 H;  1U4M A;  2NVY H;  3M4O B;  2K5N A;  1XMQ Q;  1FGU A;  4A3E H;  4DR5 L;  1C0A A;  5CV7 A;  3CRK C;  2BA0 A;  5DM7 3;  4FXD A;  1WTR A;  3CC4 A;  1ONL A;  3RN5 A;  1B53 A;  2EYJ A;  4DA2 A;  1O7L A;  5IGF A;  4P71 A;  1PH3 A;  1GD7 A;  5LMN W;  3M4O H;  2K52 A;  2Y0S E;  1PYW D;  5C0X J;  5IT9 E;  3CPW A;  4LK1 C;  2E2H B;  1BQQ T;  1Q3L A;  2F4V Q;  2AQ2 B;  3T16 A;  4A3E G;  3RNU A;  4WJ4 A;  5JOB A;  5M5X H;  4UP8 A;  1E1T A;  1PTO F;  3DMU A;  1TS5 A;  4IUP A;  4DV3 L;  5M9O A;  4FF2 A;  2F0G A;  2VB3 X;  5C0X H;  4PV1 C;  1E7Z A;  2F3V A;  4PMB A;  2L11 A;  2KVM A;  3RMH A;  2JQO A;  3TZD A;  5AJ3 Q;  1GUN A;  4HSP A;  2ID0 A;  4LF7 Q;  2BDO A;  2I0Q A;  1O7Y A;  5IP7 H;  1HXY D;  4O2D A;  4WJW A;  4A3D H;  1A0I A;  4Z9C B;  1RIP A;  3S9W A;  1F9Q A;  2HDM A;  1K3B C;  5M5Y B;  2VB2 X;  4ZKB B;  3KJP A;  1J6Q A;  4C1N I;  3I4M G;  4IO9 A;  1LM0 A;  2FJ2 A;  1N34 L;  3T1H L;  1RJT A;  1YBY A;  4C3H B;  5IGD A;  3WOE A;  2FFK B;  3S2D H;  2IHF A;  5GAD C;  2ZXO A;  3WOF A;  1EQV A;  4UP9 A;  4YHH L;  2CVR A;  1L0Y B;  4N9P A;  4ME5 A;  3OWF A;  4N8X 1;  4B3S Q;  2F4I A;  5IGE A;  1OXV A;  2F0D A;  3PUW A;  5ELF A;  1N32 Q;  3MEH A;  2EYF A;  4ODG A;  1R4Q B;  3CRL C;  5CV5 A;  4KY6 A;  1K8G A;  4DPG A;  4FYD A;  2SOB A;  1S5E D;  2K75 A;  2P5Z X;  3GTL B;  3S2H B;  4AQY Q;  1LTL A;  2ZTC A;  2RSO A;  2ZXP A;  3K6O A;  4JI2 L;  3I4N G;  3EA6 A;  2HHH Q;  1IKL A;  2CQA A;  4LF9 L;  3VA5 A;  2L12 A;  1TWC H;  3J7A V;  5HGT A;  2F52 A;  2MFI A;  4RGT A;  3S24 A;  1HA5 A;  3D3R A;  1I4R A;  2J0T D;  2F0P A;  4JI1 L;  2KHJ A;  1XTC D;  1D6E C;  3HEJ A;  3DM3 A;  1KNE A;  1NMG A;  3SR1 A;  2IX3 A;  2R93 G;  1IYV A;  3D4D A;  3IFD A;  1KLU D;  1I4Q A;  3ULP A;  2UUA L;  2WIN B;  1A8V A;  1MSH A;  3X3N A;  4DK6 C;  1VDZ A;  1UE1 A;  2MHV A;  5IYB H;  2Y0S B;  4LW1 A;  3URY A;  2F0V A;  4KV6 A;  4CKC A;  4U68 A;  3OOC A;  4ZUI A;  1YVC A;  1KAB A;  2A1A A;  2XSC A;  2AUK A;  3CCS A;  3FP9 A;  3K7A B;  3Q24 A;  4HCE A;  1E3P A;  3SHL A;  3J81 c;  1TY0 A;  2UU9 L;  1MI2 A;  3KF6 B;  3OW2 A;  4RMF A;  4F88 A;  4QGU A;  3GTO H;  1AE3 A;  4PNY A;  3SK5 A;  3AFP A;  3FMC A;  1EIH A;  3U4Z A;  5CV4 A;  3NWS A;  4DR6 Q;  1EY7 A;  1STH A;  4KN4 C;  1Q46 A;  2C5C A;  1SN8 A;  2TMP A;  4FNF A;  3K81 C;  2JXM B;  2C35 B;  1Q8K A;  1VQO A;  5COR A;  4DV7 Q;  1PH5 A;  2PMZ B;  1I4P A;  2BA1 A;  5KEE A;  5JJI A;  3HOV H;  3PCO B;  4A4I A;  2E5L Q;  3HOY G;  1QUQ A;  4B3R Q;  3KBG A;  3BYY B;  1UE7 A;  1BO0 A;  1FNW A;  4OEL B;  1SRO A;  1M1K C;  1JOR A;  1PRT C;  1XNQ L;  4BXX G;  1SR3 A;  1G29 1;  5M3M B;  3BVM A;  5C44 H;  1VCI A;  3TEH B;  1NE3 A;  5CV9 A;  4XYO A;  3LX0 A;  2Z1C A;  4JI4 Q;  1GJX A;  4JVZ A;  1CA5 A;  3F2U A;  2E2I B;  5JJK A;  1ZEQ X;  2JA5 G;  4DUY L;  1TY2 A;  4XDX A;  5C44 B;  1C9O A;  1N36 L;  4UHV A;  2PNH A;  4ZCK A;  1FNU A;  1Z7T A;  1A2U A;  1SFO B;  1BBX C;  4IPG A;  4ZUJ A;  1I94 L;  3CCR A;  2D0P A;  2K32 A;  3F2C A;  2F0L A;  1EYC A;  1PZK D;  2F0F A;  1QVC A;  2QEX A;  1RCV D;  4GLX A;  1XPO A;  4MN3 A;  3C3L A;  1L1O C;  2PNR C;  1O7I A;  4CDC C;  3MHB A;  1RL2 A;  1V1O A;  1KL9 A;  2IX0 A;  4JG2 A;  5I4D A;  4DR6 L;  1HCZ A;  1HA6 A;  4H0L C;  5IGG A;  4M1U B;  4DV0 L;  2DJG C;  2NWG A;  1L0W A;  5D3I B;  3G4S A;  1QNU A;  4O0A A;  1YZ6 A;  3CCQ A;  3U58 A;  1EYG A;  3CCU A;  4DV2 L;  4QL5 A;  5CGK A;  4DN4 M;  1CUK A;  5E4X A;  3VYT A;  3RD4 A;  3A56 A;  4GLV B;  2PZU A;  1K83 H;  3S1R B;  4J1M A;  1V9P A;  2KCC A;  1HH2 P;  1X3G A;  4I65 A;  2K5W A;  4G4K A;  2JA8 B;  2BE5 D;  4A3G H;  4OXP A;  2KQ3 A;  3FDT A;  2Z4H A;  1LT6 D;  1AEX A;  3FPP A;  1OXX K;  3OPO A;  2QEJ C;  3J80 i;  1ICF B;  3GTG B;  1PRT D;  2UUC L;  3NEM A;  5I9O A;  3N6R A;  2NZ1 D;  4RA8 A;  4BBR H;  1SEB D;  3FRP B;  1PH9 A;  1X3P A;  2O5I C;  4BA1 I;  4KHP Q;  5M3F G;  3DXJ C;  2JSO A;  4RHR A;  2AKW B;  2N78 A;  1IBM Q;  1VS0 A;  4A3F G;  3E5S A;  1QWY A;  2YTY A;  4JW0 A;  4L5T A;  3M3Y B;  4MIU A;  1WTO A;  4LAA A;  1VF7 A;  2RA4 A;  4QMG A;  3TP6 A;  3TRZ A;  4CDF C;  3I3C A;  3OMC A;  1I94 Q;  4ZYS A;  4JK1 C;  1K3R A;  5I6W A;  3NBH B;  4M8A A;  5ELN A;  1CSP A;  2DGY A;  4DUZ Q;  4DR7 Q;  1S5F D;  4DR2 L;  3EN2 A;  4YWL A;  2KEN A;  1YIT A;  3QOL A;  3K8A A;  5ELO A;  4ZAI A;  4UDU C;  3R93 A;  4LFA L;  2WP8 J;  4YHH Q;  3CXC A;  1KTK A;  2F0S A;  2UXC Q;  2FMM A;  5IWA L;  4KKU A;  3AFQ A;  1BUV T;  2BCO A;  1SMY D;  4QY7 A;  4IFD H;  1AE2 A;  1NNX A;  1J9O A;  4HMJ A;  3J7Z C;  2K04 A;  1WD1 A;  1SNC A;  2Z6B A;  4X62 Q;  5JVG 3;  1PH4 A;  4JYA Q;  4HAE A;  2OXP A;  4P2C B;  1QB5 D;  2A6E D;  3PO2 B;  1STY A;  5C44 G;  3IL8 A;  1JJC B;  2Z8L A;  2PQA A;  3NTI A;  2H5X A;  3V96 A;  3CCV A;  1EUJ A;  1VQ6 A;  2PW5 A;  3P1H A;  3MZ5 A;  3BDL A;  2LS0 1;  5EGT A;  2ALY B;  1VQI A;  4OEM B;  3Q22 A;  1LV9 A;  2YYZ A;  3PO2 H;  1IBK Q;  4X64 Q;  3KFU A;  4K0K Q;  2EYP A;  1UEB A;  3CMA A;  4C3H H;  5DLQ E;  3U9O A;  1S5D D;  4RAU C;  3QIA A;  4AIM A;  1F9P A;  4KHZ A;  2F0U A;  1D5M C;  2IT1 A;  1CSQ A;  1G6Z A;  1W3S A;  2LSS A;  4OX9 Q;  1K8O A;  4RGN A;  3MXP A;  1II3 A;  3QG1 A;  4DXF A;  4EQP A;  3RR5 A;  4GNX B;  3H91 A;  4IFD G;  3BDO A;  3B6Y A;  4WOR A;  4DR2 Q;  1HR0 Q;  3H0G B;  2OQ0 A;  2A6H D;  1IL8 A;  2EDG A;  2FIN B;  5M5W H;  4POF A;  5JPM C;  2B2Y C;  4A3K B;  4XT1 B;  4X3U A;  3RLF A;  2K28 A;  5C6A A;  1I6V C;  3W1B A;  1CZG A;  4JI6 L;  4YWM A;  4WRD A;  5K5P A;  3EIV A;  3HKZ E;  4KKS A;  1UWV A;  1F9R A;  2BOS A;  1EOT A;  4PZ6 A;  4LF9 Q;  1XX8 A;  3BZC A;  4K8J A;  1IZ6 A;  4CJ0 B;  4P72 A;  5FLX E;  2F0H A;  2VXW A;  2ZM6 L;  4DR1 L;  1XNR L;  1T5X D;  2XWJ B;  1VQ7 A;  4ME3 A;  1LT3 D;  2JN4 A;  2DNE A;  1WJJ A;  3A8J E;  4JOI C;  1KXL A;  3HOX B;  2BH8 A;  1VQP A;  1D7Q A;  1CA6 A;  1PDQ A;  1ROD A;  2NB0 A;  4K2K A;  3TBI B;  1PYS B;  4OO1 H;  1HNX L;  2CFM A;  4JPB W;  1SJE D;  1RTN A;  4A3M B;  5KGU A;  1H9M A;  1IYU A;  3RUZ A;  2ES2 A;  5BR8 Q;  3HOW B;  1PXU A;  3O13 A;  2UUB L;  2CW0 D;  3C2P A;  3CCM A;  1UNS A;  3PUY A;  4A3K G;  2KHS A;  3GTO B;  5KNB A;  1UE6 A;  1SBB B;  2Q8R E;  5FK9 C;  4ULL A;  1SDF A;  4NPS A;  5C5M A;  4L5S A;  4ZQ3 A;  4JI7 Q;  3G48 A;  4DK1 A;  4JBJ A;  3GTP B;  1V1P A;  2F0N A;  3H6M A;  3GV3 A;  1LTB D;  2JJQ A;  4KMU C;  3S17 H;  2KED A;  1ZYR C;  3PO3 B;  2WB1 E;  3S1Q H;  4A3I G;  1N9W A;  2VZA A;  3QB3 A;  1YEZ A;  4IUT A;  1N33 L;  2AWN A;  2F3W A;  4LFC Q;  1MJE A;  1X32 A;  3EQL C;  1XPU A;  4OON A;  1HFG A;  4UPA A;  1EY6 A;  3KBX A;  3H0G G;  1J5E L;  1AFP A;  5GAE C;  3J80 E;  1G6P A;  3GDE A;  1MSG A;  5FLM H;  3KUP A;  4K5X A;  2EY1 A;  2PW7 A;  3FKI G;  1CFM A;  1I4G A;  4UAI A;  3OMG A;  4L6T B;  2WB1 B;  3CCE A;  2E2I H;  2IX1 A;  4XQN A;  1AZQ A;  3TS2 A;  3GTK B;  1Y8P B;  1X9N A;  1VMC A;  2JEA I;  1Y1V G;  4A3J B;  4IJH A;  1CI3 M;  1JQY D;  3A8K E;  3JC6 6;  3RZD B;  4QB4 A;  5EKL A;  2RKS A;  1JE5 A;  2WV6 D;  1LTG D;  1WOC A;  2CWP A;  2RHS B;  3S1N B;  3UE0 A;  3P7J A;  2IHE A;  3DUZ A;  4A3D B;  5C4X G;  3DHQ A;  2TSS A;  4F87 A;  3MTS A;  3K5N A;  5CMD A;  3FVQ A;  4JI2 Q;  2MQH A;  1Z9F A;  2R6G A;  2K1B A;  4XYQ A;  2HHH L;  2NZO A;  4IOC A;  1BKB A;  1CQF A;  1PFN A;  2QGQ A;  5IP9 H;  3M7G A;  1G8Z D;  3NEN A;  3I55 A;  4QUC A;  3H09 A;  1CKO A;  5LHY 1;  4OWT B;  1XWE A;  4DV0 Q;  3S16 B;  3A0J A;  4ZLT F;  3ULJ A;  4EQ5 A;  1B50 A;  1QOH A;  2L5T A;  3VA7 A;  4DUZ L;  2YTX A;  4OWW B;  3HP3 A;  4EQN A;  4LUO A;  4IUN A;  1VQH A;  3I72 A;  4BBS H;  1XPR A;  3GTM H;  5LMN L;  2NN6 H;  2CH4 W;  2ZJQ A;  4GZY C;  3S2H H;  1HQR D;  4B9X A;  4ABN A;  5LL6 X;  4LF6 L;  5HY6 A;  5C4X B;  2A6E C;  1LT5 D;  3G7L A;  4LWC A;  1WTH A;  1ZKO A;  2OTL A;  4QCL A;  2AQ3 B;  1BCP F;  1TWC B;  1V1P B;  3W5O A;  3CC7 A;  5T1G A;  1U0L A;  1NBW A;  3AB9 A;  3GTM B;  1BBU A;  4XIG S;  1Y69 U;  4K6D A;  4DNR B;  4BBR G;  3F2D A;  2WB1 G;  5HUR A;  4G7H C;  1Q7Y C;  4R9W A;  1U4R A;  4DV5 Q;  5L37 A;  3PF4 A;  5GAG C;  2N88 A;  2CW0 C;  2ZTE A;  2QF7 A;  4DAM A;  1C7Y A;  1SAP A;  1U5K A;  1VQJ A;  1H9J A;  4C3I B;  1QE6 A;  2EYH A;  4GOP A;  1EZ6 A;  4DAP A;  2G5D A;  4CJ1 B;  4UY8 C;  4P74 A;  1ILQ A;  1BF4 A;  4K0K L;  5FKA C;  3OTO L;  1X6O A;  1PLF A;  4DR7 L;  2Z0S A;  5C3W A;  1U4L A;  1BDO A;  3H15 A;  1GHK A;  1ENF A;  3NUC A;  4DAY A;  4JI5 L;  3I4M B;  5C4Z A;  3UDG A;  5J39 A;  1TR5 A;  3Q8D A;  5KNC A;  4H13 C;  4R1J A;  2B2U C;  3U50 C;  3LNN A;  1W2B A;  3S1M B;  1AH9 A;  1Z47 A;  2JK8 A;  2E2J B;  2EY2 A;  1XMO L;  1M90 C;  1K28 A;  1I6H B;  5IGC A;  1KAA A;  5E7N A;  4A3I B;  2AQ1 B;  1N36 Q;  1SSO A;  1Y1V B;  1DGS A;  5IY0 A;  2A74 C;  3TSS A;  3I90 A;  3ND9 A;  5CYU A;  4X62 L;  3X3M A;  1D2B A;  1JOQ A;  2BE5 C;  2YV5 A;  5AFW A;  2VL6 A;  4JC0 A;  5I2X A;  1GO3 E;  1TWF B;  1X55 A;  3F8T A;  2VQE Q;  1WCM B;  1Y1W H;  3MVV A;  4GKK Q;  3HOZ B;  2K5D A;  5ELC A;  1V8Q A;  4LFB L;  4R4T A;  5M3M G;  4X65 Q;  2MNA A;  1HNW L;  3PGZ A;  2NVX H;  4X66 Q;  2O5J C;  3QO2 A;  1DON A;  2XNA C;  4N8F A;  1FD7 D;  1PMR A;  3R8B A;  3GTJ H;  3VR6 A;  3IAY A;  1FNV A;  5G3L F;  4DR1 Q;  4YIJ A;  4H7B A;  3I8Z A;  1Y1W B;  3PUZ A;  2HUG A;  3L0O A;  1TWH B;  1PH7 A;  4G57 A;  1NR4 A;  2CWA A;  1KRS A;  2QCP X;  2NVX B;  1STG A;  4JV5 L;  3PO3 G;  1HNX Q;  1KC8 C;  4A3M G;  3U4V A;  4IJL A;  2D5D A;  3HOV G;  3T1Y Q;  5IP9 G;  3HG9 A;  4NXN L;  3KOJ A;  4AQY L;  2YU9 H;  5AJ3 L;  3J81 E;  1VQ9 A;  1I3Q H;  1YNN D;  4BXX H;  2WFW A;  3OHX C;  1XXG A;  1CHP D;  1IW7 D;  1I50 B;  4NKL A;  5EJW A;  1N8R C;  4FP5 D;  1A3V A;  1X3F A;  2JA6 H;  3M9B A;  3TQY A;  1SMY C;  4DR4 Q;  1WD0 A;  2YU9 B;  2A19 A;  3HKZ B;  1JC7 A;  4A93 H;  2VNU D;  3T1H Q;  1FL0 A;  4A3L H;  3G71 A;  1PTO D;  3S15 B;  4DV2 Q;  1EY9 A;  4WJ3 M;  1PH2 A;  3I4O A;  3OWE B;  1WTV A;  4A3M H;  4GN4 B;  1EYA A;  1I4X A;  3PF5 A;  1KD1 C;  2NUC A;  1E0B A;  3EJI A;  4A93 B;  1QIL A;  3HOW H;  2HIX A;  1YJN A;  4MZ9 A;  1K8A C;  1HJP A;  5LL6 S;  5C0X I;  3SDZ A;  3LGJ A;  3NQI A;  4LF8 Q;  1EWI A;  1KNA A;  3A7A B;  5LMU L;  1H95 A;  1RTO A;  1DCZ A;  5IWA Q;  2OCE A;  2B63 H;  2N8N A;  1K73 C;  4KJO A;  4RGM A;  3KYH C;  1SE8 A;  4ILW A;  2JEB I;  3MEF A;  4S3S A;  3CPF A;  2F0W A;  4N9T A;  2E2H H;  1S3O A;  5IOC A;  5EPL A;  3SK6 A;  4ID6 A;  1TQO A;  3NPP A;  4MNO A;  4K5W A;  1N33 Q;  2RSN A;  2RDH A;  1KRT A;  3ITP A;  4HTH A;  2GVB A;  2A68 D;  5JEA G;  4FVM A;  2XGT A;  1PZJ D;  3Q0A A;  1JIC A;  1IBK L;  1XJV A; 
#chains in the Genus database with same CATH homology
 4C3J G;  4FO2 A;  1LTS D;  3TP5 A;  4I7Z C;  3K5L A;  2KCN A;  3FPU B;  3H3V C;  2IJ0 A;  4RKL A;  4CKE A;  4C2M B;  3SVM A;  3T4A C;  2KA7 A;  5ISR A;  5FOB B;  2O2L D;  2MP1 A;  1ILP A;  3OW7 A;  2E75 C;  1HQM C;  1TS4 A;  2AUJ D;  3TP8 A;  3DM1 A;  1DZ1 A;  4IUR A;  5I9P A;  1B1Z A;  2R3Z A;  3MFG A;  1AP0 A;  1Q90 A;  4NDX A;  1UAP A;  4IZ8 A;  1TWA B;  2N55 A;  1TII D;  3T13 A;  3KLS A;  3I91 A;  1ENA A;  2FMC A;  1UUP A;  1L0X B;  2EJG C;  1E2V A;  3R2I A;  2B2T C;  4RKB A;  5JVH 3;  2WKD A;  1NSN S;  1NR2 A;  4L8J A;  5D3D A;  3M4Y A;  1WTP A;  5JPN C;  3A7L A;  4BBS B;  2X6G A;  4OO1 G;  3W3A A;  2B2T A;  1SYF A;  5ELD A;  4C3J B;  1JE4 A;  1SXT A;  1A15 A;  2D62 A;  4IUU A;  2AWO A;  4K6L A;  3ONA B;  5KRU A;  3P20 A;  2DY8 A;  5K36 G;  1ESF A;  1QCB D;  2HCC A;  2WII B;  1GUO A;  3D4R A;  3H94 A;  3IKJ A;  3SK8 A;  1Y8N B;  2IW3 A;  1HFN A;  3HGB A;  3K0Y A;  1W6K A;  3BYT B;  3Q6S A;  2PPB C;  1SNM A;  1M4V A;  2KJX A;  5J1Z A;  1JWS D;  3IFT A;  1BR9 A;  1RD9 D;  3HOY B;  4KJN A;  4XT3 B;  3K57 A;  1EY8 A;  1C8C A;  4EQO A;  2X69 A;  2F0K A;  3TZU A;  2IPK D;  4KD3 A;  1IKM A;  3L9A X;  2QIL A;  3FEW X;  4DXG A;  1SYD A;  4XQQ A;  1STN A;  4KY7 A;  1RDP D;  1ENC A;  2JA5 B;  3DWQ A;  5CV8 A;  2EZV A;  2PZW A;  4NW2 A;  5E1F A;  5C3E B;  1LLR D;  3QWN A;  1R4P B;  3S14 B;  2B2V C;  3GTJ B;  1SJH D;  1E2Z A;  5ELE A;  2RDF A;  3PMF A;  4A3B B;  1A2T A;  4C56 C;  1SNO A;  2F0E A;  1Y8O B;  1H9S A;  2K03 A;  2PZT A;  4HR7 B;  2G9H D;  4B9W A;  1G2T A;  1RHP A;  3ERQ A;  1EY0 A;  3JAM E;  2LFN A;  1DJR D;  3MA2 B;  2HCI A;  2NN6 G;  1A6X A;  3T53 B;  2JA6 B;  5EPJ A;  2K05 A;  3NK9 A;  2SNS A;  1SE3 A;  2RDG A;  2MJ8 A;  3NTK A;  4X3T A;  1B9N A;  3DWA A;  1JCK B;  1Q1E A;  4E6I A;  4FF3 A;  2Q8T A;  4DF7 A;  3DEO A;  5CBA E;  3N52 A;  5A2Q E;  2XRQ D;  2MPM A;  2MUY A;  2L0C A;  4K8I A;  5FO9 B;  3TDQ A;  3KF8 A;  5E3F A;  3D4W A;  3K59 A;  2XRS D;  3D8G A;  4XQJ A;  2B39 A;  4L63 B;  3CKI B;  2B63 B;  4EVO A;  2EE1 A;  2EJM A;  4JBW A;  4O1N A;  4PMW A;  2F0T A;  2NVY B;  1JR0 D;  2M00 A;  4BWG B;  2NVT B;  2L9H A;  2JYO A;  4A3E B;  4LJZ C;  1DD2 A;  3VR2 A;  2ICI A;  3AU7 A;  1EFI D;  1ML0 D;  5J22 A;  3JAM L;  2A69 D;  4KY5 A;  4H44 C;  5KND A;  5FO8 B;  3PIO 3;  1DOL A;  5D14 A;  2JE6 I;  3W2D A;  1FYC A;  5BN4 A;  4FF1 A;  3NSW A;  2D2C C;  5M5X B;  2B2V A;  4X3K A;  1NUC A;  4KKT A;  3WDN A;  2R92 B;  2F0I A;  4NP5 A;  5K36 H;  2A6H C;  3K58 A;  1M8A A;  2FHT A;  1ICW A;  2JP1 A;  4KHV A;  3L7Z C;  4Q5V A;  2F0Q A;  3VYS A;  1F2L A;  3GO5 A;  4HED A;  1F9S A;  5I6Y A;  5C4J B;  1LTI D;  2A68 C;  2PQE A;  3NWT A;  1IHZ A;  1LAC A;  1LAB A;  3BS1 A;  2KEE A;  2ENB A;  1T5E A;  3R2T A;  4RFB A;  4RGO S;  3MXN A;  3ZYY X;  2ZXR A;  1LTA D;  3TME A;  5IOD A;  1SE2 A;  3NE5 B;  1TVX A;  1IW7 C;  1BOS A;  2HQE A;  2NTT A;  1UEA B;  2K33 A;  2WAC A;  1YNN C;  4RWS C;  2K5Q A;  1BCP D;  1AZP A;  4DNT B;  1D1K A;  1PRT B;  3BDC A;  4DK0 A;  1I3Q B;  1XYI A;  2EYM A;  3J7A F;  2KUM A;  3D6C A;  1EIG A;  4LMQ D;  1EU4 A;  1WTX A;  1SYG A;  1TKW B;  4QF4 A;  1WTQ A;  1A3U A;  1PFM A;  1RKN A;  3QJY A;  1BNZ A;  3SXH A;  2A5H A;  4HN7 A;  1HUN A;  1B4O A;  2IWH A;  5A2Q L;  2NN6 I;  2VUM B;  2Q8I B;  1SNP A;  5A35 A;  4XXE A;  1ESR A;  3MFY A;  4X3S A;  5ELB A;  1GUG A;  3S1Q B;  3KLR A;  1WVL A;  4B08 A;  5M3F B;  1VMP A;  4IN3 A;  2RBM A;  1TT2 A;  5DM6 3;  5FLX L;  3J7Y W;  2F1M A;  2BDN A;  3K5M A;  2DN8 A;  2NBF A;  1CHQ D;  4RCN A;  4OHJ A;  3E0J A;  4R8N A;  3PIP 3;  3K5O A;  3MXU A;  3LWE A;  5I2Y A;  1EL0 A;  4Y7N B;  1BXT A;  5EPK A;  1EY4 A;  3KK7 A;  5CR3 A;  2XIW A;  4FXG C;  1PTO B;  4RH6 A;  1RF2 D;  4OIK A;  3DEP A;  3BVZ A;  2WAQ B;  2KOL A;  1PTO H;  3UI2 A;  1AN8 A;  5BN3 A;  3Q23 A;  1F77 A;  2H4O A;  3DWP A;  3BZD B;  3SE0 A;  1JOK A;  3J80 L;  2ICE C;  3OSO A;  4AYB B;  2L1B A;  5FO7 B;  3SK4 A;  3I70 A;  3NHH A;  1STE A;  5DEH A;  1DXM A;  2NVQ B;  4TKO B;  4CGY B;  5NUC A;  1SYC A;  3GQB A;  4DAV A;  2E76 C;  1K83 B;  2LY7 A;  3V05 A;  1MBY A;  4K5V A;  1JWU D;  4A3G B;  1JOO A;  1PZI D;  4BS9 A;  1NAP A;  3NBI A;  5CBE E;  1QNK A;  1Q1B A;  1KDB A;  1B2T A;  2K7V A;  4IUQ A;  2PO4 A;  2F0M A;  1ZXT A;  3CU7 A;  4PQX A;  3RZO B;  3L3O C;  3A54 A;  1F2M A;  2B2W C;  4BY1 B;  1FGB D;  1KLG D;  5CV6 A;  2IL8 A;  3E6Z X;  4CHT B;  1S5C D;  1J8I A;  2EY5 A;  1WTW A;  5C4H A;  1HRJ A;  4V19 0;  2XN9 C;  4J6H A;  3EVQ A;  5C3X A;  3HZX A;  2M9V A;  1ZYR D;  5DAU A;  4BA2 I;  1OO9 B;  3PUX A;  1SNQ A;  3VR3 A;  4HCS A;  5TSS A;  3S2D B;  2OF1 A;  4OL7 A;  4KK7 A;  2R93 B;  1GUW A;  2K01 A;  1GOZ A;  1LT4 D;  1B9M A;  3I4N B;  1SE4 A;  1TU2 B;  2J4X A;  2K6A A;  1G91 A;  4IFD I;  1GHJ A;  3P75 A;  1H9K A;  2SNM A;  1CK1 A;  4FXK C;  3TN2 A;  4TQU S;  4OGQ C;  5F2D A;  5EKK A;  4ZKC B;  1KDA A;  4V0B A;  1EWC A;  4G7O C;  2XWB B;  1NCV A;  5M5W B;  1B3A A;  1R9T B;  2E2D C;  2EVB A;  1MD2 D;  2JA7 B;  3ND8 A;  5KYI A;  2OT2 A;  5JAV A;  2J7Z A;  2NTS A;  4TSS A;  1C4Q A;  1OXU A;  4IAL A;  3PV0 A;  3FKI B;  1ET9 A;  4C3H G;  5IT9 L;  1GXD C;  1CQV A;  4RCO A;  2PYK A;  1PRT F;  2QDB A;  3NBH A;  2EYL A;  2DY7 A;  3OIQ A;  4TRD A;  1EEF D;  4DU9 A;  3QOJ A;  4K14 A;  4OO1 I;  1Q12 A;  4G7Z C;  1TS3 A;  2SDF A;  1O80 A;  3T51 B;  2EPB A;  5EBD A;  3HOV B;  2B8F A;  5T1I A;  1LTT D;  2Z4I A;  2B2U A;  1JWM D;  2F03 A;  1B44 D;  3S17 B;  3AMU A;  4K2L A;  2HDL A;  3CHB D;  5IGB A;  3HRZ C;  4DFA A;  4O42 A;  2B8G A;  2EJF C;  5BN5 A;  3EFX D;  1TWG B;  5DNF A;  4A3F B;  1JB3 A;  3NXW A;  3G6J B;  1C48 A;  1GUT A;  4QIW B;  1FR3 A;  2EY6 A;  2A73 B;  1F2Y A;  2O4X A;  5JEA J;  1DM0 B;  1QJO A;  3V2T A;  3C46 A;  4KI0 A;  1YNJ C;  2I46 A;  2B2W A;  4R8I A;  3CQZ B;  3PUV A;  3MC0 B;  1EEI D;  3KLS X;  2D9U A;  1D1I A;  4EGV A;  2CHB D;  1H9R A;  2LMC B;  3OIP A;  5JJZ A;  3MXG A;  4FF4 A;  1PFB A;  4IQZ A;  3BVG A;  1EY5 A;  3NP8 A;  1PTO C;  1SYE A;  1S4Z A;  2RQX A;  1STB A;  1HTL D;  5EKI A;  4RHS A;  3BG3 A;  3I73 A;  4XTC S;  1CT1 D;  2F0J A;  2MGS A;  1TS2 A;  3GTQ B;  1O7Z A;  1OXT A;  2EXZ A;  4IFD J;  5E4W C;  4ZRZ A;  1ET6 A;  2WKC A;  4U67 3;  3I4L A;  5EBC A;  5KYL A;  3D6W A;  1SND A;  3M85 A;  1CM9 A;  5CC4 A;  4OIJ A;  2V4D A;  4IUV A;  2SEB D;  4NMZ A;  4CJ2 C;  2R7Z B;  4J8Q A;  1AW7 A;  5C5L A;  1D5Z C;  1Q8I A;  4KN7 C;  3GV6 A;  1H9S B;  3U9S A;  4CKB A;  3MAQ A;  1EWH A;  1LO5 D;  2F0O A;  2G9D A;  2QKI C;  4BY7 B;  1EQT A;  1I4H A;  1O78 A;  1OXS C;  2EOT A;  1X3Q A;  3VYU A;  1V43 A;  2GA4 B;  2PCF B;  3SEB A;  5D65 A;  2E74 C;  3J81 L;  1BCP C;  1G2S A;  4F8M A;  2X6L A;  3M7N A;  1HPC A;  3TP7 A;  1HTP A;  4DGZ A;  1BCP B;  4C1N K;  2C9O A;  4QUF A;  3NQT A;  2RVL A;  3ERO A;  1DOM A;  5KIX A;  1VF5 C;  4PMC A;  1W6J A;  5EQ0 A;  1GUS A;  4WFN 3;  1EYD A;  2KEC A;  2L4N A;  2NYZ D;  3T56 B;  1SYB A;  1KDC A;  2LKV A;  4KD4 A;  4F7X A;  1EU3 A;  1QG7 A;  1F2Z A;  3LWU A;  2ZT9 C;  5COY A;  1DOK A;  4CBV A;  1Z6H A;  1U9R A;  1DYQ A;  3HS0 C;  1CTM A;  3D31 A;  1D5X C;  2H1E A;  1YNJ D;  4MHE A;  1LTR D;  4KTA A;  2XVS A;  3NTH A;  3GD7 A;  2I07 B;  2L55 A;  4HSV A;  3C1F A;  2B2Y A;  5JEA H;  3R3O A;  2EYO A;  4Q0F A;  1K8M A;  3GP7 A;  4C3I G;  4ZK9 B;  2OEO A;  2DNC A;  2R61 A;  1U4P A;  3MWY W;  3C1E A;  1A3T A;  1CZW A;  1MGS A;  4HMI A;  3VR5 A;  2A69 C;  5G3L D;  3HOU B;  2M2L A;  1E2W A;  1S5B D;  5IIF A;  1STA A;  3A8I E;  3A55 A;  1HHV A;  3VR4 A;  4BBR B;  3VYR A;  5C0X G;  1HUM A;  1EZ8 A;  1U4M A;  3M4O B;  5CV7 A;  3CRK C;  2BA0 A;  5DM7 3;  4FXD A;  1WTR A;  1ONL A;  1B53 A;  2EYJ A;  4DA2 A;  1O7L A;  5IGF A;  1PYW D;  5C0X J;  5IT9 E;  4LK1 C;  2E2H B;  1BQQ T;  1Q3L A;  2AQ2 B;  3T16 A;  5JOB A;  1PTO F;  3DMU A;  1TS5 A;  4IUP A;  5M9O A;  4FF2 A;  2F0G A;  2VB3 X;  5C0X H;  4PV1 C;  2F3V A;  4PMB A;  2L11 A;  2KVM A;  3RMH A;  3TZD A;  1GUN A;  4HSP A;  2ID0 A;  2BDO A;  1O7Y A;  1HXY D;  4WJW A;  4Z9C B;  3S9W A;  1F9Q A;  2HDM A;  5M5Y B;  2VB2 X;  4ZKB B;  4C1N I;  2FJ2 A;  1RJT A;  4C3H B;  5IGD A;  3WOE A;  2FFK B;  2ZXO A;  3WOF A;  1EQV A;  2CVR A;  1L0Y B;  4N9P A;  4ME5 A;  3OWF A;  2F4I A;  5IGE A;  1OXV A;  2F0D A;  3PUW A;  5ELF A;  3MEH A;  2EYF A;  4ODG A;  1R4Q B;  3CRL C;  5CV5 A;  4KY6 A;  4FYD A;  2SOB A;  1S5E D;  3GTL B;  3S2H B;  2RSO A;  2ZXP A;  3K6O A;  3EA6 A;  1IKL A;  2CQA A;  3VA5 A;  2L12 A;  3J7A V;  5HGT A;  4RGT A;  1HA5 A;  3D3R A;  1I4R A;  2J0T D;  2F0P A;  1XTC D;  1D6E C;  3HEJ A;  3SR1 A;  1KNE A;  2IX3 A;  1IYV A;  3D4D A;  3IFD A;  1KLU D;  1I4Q A;  2WIN B;  1MSH A;  3X3N A;  1VDZ A;  2MHV A;  2Y0S B;  3URY A;  2F0V A;  4KV6 A;  4CKC A;  4U68 A;  3OOC A;  4ZUI A;  1KAB A;  2XSC A;  2AUK A;  3K7A B;  3Q24 A;  4HCE A;  3SHL A;  1TY0 A;  1MI2 A;  4F88 A;  4PNY A;  3SK5 A;  1EIH A;  3FMC A;  5CV4 A;  3NWS A;  1EY7 A;  1STH A;  4KN4 C;  2C5C A;  2TMP A;  4FNF A;  2JXM B;  5COR A;  2PMZ B;  1I4P A;  2BA1 A;  5KEE A;  3KBG A;  3BYY B;  1JOR A;  1BO0 A;  1FNW A;  1PRT C;  1G29 1;  5M3M B;  3BVM A;  1VCI A;  5CV9 A;  4XYO A;  3LX0 A;  2Z1C A;  1GJX A;  1CA5 A;  3F2U A;  2E2I B;  1ZEQ X;  1TY2 A;  4XDX A;  5C44 B;  1FNU A;  1Z7T A;  1A2U A;  1SFO B;  1BBX C;  4ZUJ A;  2K32 A;  2F0L A;  1EYC A;  1PZK D;  2F0F A;  1RCV D;  4MN3 A;  3C3L A;  2PNR C;  3MHB A;  1V1O A;  2IX0 A;  5I4D A;  1HA6 A;  1HCZ A;  4H0L C;  5IGG A;  4M1U B;  2NWG A;  5D3I B;  1QNU A;  5CGK A;  4DN4 M;  5E4X A;  3VYT A;  3RD4 A;  3A56 A;  2PZU A;  3S1R B;  4J1M A;  2KCC A;  4I65 A;  2K5W A;  4G4K A;  2JA8 B;  2BE5 D;  2KQ3 A;  3FDT A;  2Z4H A;  1LT6 D;  1AEX A;  3FPP A;  1OXX K;  3OPO A;  2QEJ C;  3GTG B;  1PRT D;  5I9O A;  3N6R A;  2NZ1 D;  4RA8 A;  1SEB D;  3FRP B;  1X3P A;  2O5I C;  4BA1 I;  3DXJ C;  2JSO A;  4RHR A;  3E5S A;  1QWY A;  3M3Y B;  4MIU A;  1WTO A;  4LAA A;  1VF7 A;  2RA4 A;  4QMG A;  3TP6 A;  3I3C A;  3OMC A;  4ZYS A;  4JK1 C;  5I6W A;  4M8A A;  1S5F D;  3QOL A;  4ZAI A;  4UDU C;  3R93 A;  2WP8 J;  1KTK A;  2F0S A;  2FMM A;  4KKU A;  1BUV T;  2BCO A;  1SMY D;  4IFD H;  1J9O A;  4HMJ A;  2K04 A;  1WD1 A;  1SNC A;  5JVG 3;  4HAE A;  2OXP A;  4P2C B;  1QB5 D;  2A6E D;  3PO2 B;  1STY A;  3IL8 A;  2Z8L A;  3NTI A;  3V96 A;  2PW5 A;  3P1H A;  3MZ5 A;  3BDL A;  2LS0 1;  5EGT A;  3Q22 A;  1LV9 A;  2YYZ A;  2EYP A;  3U9O A;  1S5D D;  4RAU C;  3QIA A;  1F9P A;  4KHZ A;  2F0U A;  1D5M C;  2IT1 A;  1G6Z A;  1K8O A;  4RGN A;  3MXP A;  1II3 A;  3QG1 A;  4DXF A;  4EQP A;  3H91 A;  4IFD G;  3BDO A;  4WOR A;  3H0G B;  2A6H D;  1IL8 A;  2EDG A;  2FIN B;  5JPM C;  2B2Y C;  4A3K B;  4XT1 B;  4X3U A;  3RLF A;  2K28 A;  5C6A A;  1I6V C;  1CZG A;  4WRD A;  5K5P A;  4KKS A;  1F9R A;  2BOS A;  1EOT A;  1XX8 A;  4K8J A;  4CJ0 B;  5FLX E;  2F0H A;  2VXW A;  1T5X D;  2XWJ B;  1LT3 D;  2DNE A;  3A8J E;  3HOX B;  1CA6 A;  1PDQ A;  1ROD A;  2NB0 A;  4K2K A;  3TBI B;  4OO1 H;  1SJE D;  1RTN A;  4A3M B;  5KGU A;  1H9M A;  1IYU A;  3RUZ A;  3HOW B;  1PXU A;  3O13 A;  2CW0 D;  3C2P A;  1UNS A;  3PUY A;  2KHS A;  3GTO B;  5KNB A;  2Q8R E;  1SBB B;  5FK9 C;  4ULL A;  1SDF A;  5C5M A;  4ZQ3 A;  4DK1 A;  3GTP B;  1V1P A;  2F0N A;  3H6M A;  3GV3 A;  1LTB D;  4KMU C;  2KED A;  1ZYR C;  3PO3 B;  3QB3 A;  4IUT A;  2AWN A;  2F3W A;  1X32 A;  3EQL C;  1HFG A;  1EY6 A;  3KBX A;  1AFP A;  3J80 E;  1MSG A;  3KUP A;  4K5X A;  2EY1 A;  2PW7 A;  4UAI A;  1CFM A;  1I4G A;  3OMG A;  4L6T B;  2WB1 B;  2IX1 A;  4XQN A;  1AZQ A;  3GTK B;  1Y8P B;  1VMC A;  2JEA I;  4A3J B;  1CI3 M;  1JQY D;  3A8K E;  3RZD B;  4QB4 A;  5EKL A;  2RKS A;  2WV6 D;  1LTG D;  3S1N B;  3P7J A;  3DUZ A;  4A3D B;  3DHQ A;  2TSS A;  4F87 A;  3MTS A;  3K5N A;  5CMD A;  3FVQ A;  2R6G A;  2K1B A;  4XYQ A;  1CQF A;  1PFN A;  3M7G A;  1G8Z D;  4QUC A;  3H09 A;  5LHY 1;  1XWE A;  3S16 B;  4ZLT F;  1B50 A;  1QOH A;  2L5T A;  3VA7 A;  3HP3 A;  4EQN A;  4IUN A;  3I72 A;  2NN6 H;  4GZY C;  1HQR D;  4B9X A;  4ABN A;  5LL6 X;  5C4X B;  2A6E C;  1LT5 D;  3G7L A;  1ZKO A;  4QCL A;  2AQ3 B;  1BCP F;  1TWC B;  1V1P B;  5T1G A;  3AB9 A;  3GTM B;  4XIG S;  1Y69 U;  4K6D A;  4DNR B;  5HUR A;  4G7H C;  4R9W A;  1U4R A;  2N88 A;  2CW0 C;  2QF7 A;  1SAP A;  1H9J A;  4C3I B;  1QE6 A;  2EYH A;  1EZ6 A;  4DAP A;  4CJ1 B;  1ILQ A;  1BF4 A;  5FKA C;  1PLF A;  5C3W A;  1U4L A;  1BDO A;  1GHK A;  1ENF A;  3NUC A;  4DAY A;  3I4M B;  5C4Z A;  5J39 A;  1TR5 A;  5KNC A;  4H13 C;  2B2U C;  3S1M B;  3LNN A;  1Z47 A;  2E2J B;  2EY2 A;  1I6H B;  5IGC A;  1KAA A;  4A3I B;  2AQ1 B;  1SSO A;  1Y1V B;  2A74 C;  3TSS A;  3I90 A;  3ND9 A;  5CYU A;  1D2B A;  3X3M A;  1JOQ A;  2BE5 C;  5AFW A;  5I2X A;  1TWF B;  1WCM B;  3MVV A;  3HOZ B;  2K5D A;  5ELC A;  1V8Q A;  2O5J C;  3QO2 A;  1DON A;  2XNA C;  1FD7 D;  1PMR A;  3R8B A;  3VR6 A;  3IAY A;  1FNV A;  5G3L F;  4YIJ A;  4H7B A;  3I8Z A;  1Y1W B;  3PUZ A;  2HUG A;  1TWH B;  4G57 A;  1NR4 A;  2QCP X;  2NVX B;  1STG A;  2D5D A;  3HG9 A;  3J81 E;  1YNN D;  3OHX C;  1XXG A;  1CHP D;  1IW7 D;  1I50 B;  4NKL A;  5EJW A;  4FP5 D;  1A3V A;  1SMY C;  1WD0 A;  2YU9 B;  3HKZ B;  1JC7 A;  2VNU D;  1PTO D;  3S15 B;  1EY9 A;  3OWE B;  1WTV A;  1EYA A;  1I4X A;  2NUC A;  1E0B A;  3EJI A;  4A93 B;  1QIL A;  5LL6 S;  5C0X I;  3SDZ A;  3NQI A;  1KNA A;  3A7A B;  1RTO A;  1DCZ A;  4KJO A;  4RGM A;  4ILW A;  2JEB I;  4S3S A;  2F0W A;  4N9T A;  5IOC A;  5EPL A;  3SK6 A;  4ID6 A;  1TQO A;  3NPP A;  4K5W A;  2RSN A;  2RDH A;  3ITP A;  4HTH A;  2A68 D;  5JEA G;  4FVM A;  1PZJ D;  3Q0A A;  1JIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...