4CJ0B

Crystal structure of celd in complex with affitin e12
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
60
Chain Sequence
VKVKFVSSGEEKEVDTSKIKKVWRNLTKYGTIVQFTYDGRGYVRELDAPKELLDMLARAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent and Specific Inhibition of Glycosidases by Small Artificial Binding Proteins (Affitins)
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase/de novo protein
molecule keywords ENDOGLUCANASE D
total genus 10
structure length 60
sequence length 65
ec nomenclature
pdb deposition date 2013-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cj0B00
1U4MA 5EPJA 1DOLA 2MGSA 2X6GA 3P7JA 4XDXA 3R93A 1CA5A 2K04A 1U4LA 3KBXA 5CBEE 1J9OA 4DN4M 1HRJA 1X3PA 5T1GA 1F9RA 1O7ZA 2N55A 4IUQA 2L4NA 2KECA 2D9UA 3DM1A 2EOTA 3N52A 1WTXA 1NR2A 2FJ2A 1S4ZA 1KNEA 2XIWA 4IUPA 2VXWA 1HFNA 1MSGA 4O42A 4UAIA 1HUMA 2FMMA 1MI2A 1ESRA 3QO2A 3DEOA 1PDQA 2NZ1D 1EOTA 4QUFA 5CMDA 2DY7A 1AZQA 1J8IA 1E0BA 2MJ8A 3MTSA 1IKMA 5EPLA 1NCVA 4HEDA 5E4XA 1B50A 4ZAIA 4NW2A 1HFGA 1U4RA 1HA6A 4HCSA 3GV3A 4RA8A 1F9PA 1PLFA 2B2VA 5CBAE 1B53A 1BNZA 1DONA 2N88A 2RVLA 4HAEA 1JE4A 2HUGA 1WTWA 1A15A 1IKLA 4X3KA 1MSHA 1B2TA 2K05A 2B2WC 4RAUC 3LWEA 2L11A 4XT1B 1WTPA 2HDMA 2Q8RE 1BF4A 1DOKA 3HP3A 3IL8A 3KUPA 2RSNA 3G7LA 2K28A 1WTRA 2BDNA 1F9QA 2NWGA 1NAPA 1QNKA 2HCIA 2B2YA 2B2VC 2KEEA 3D6WA 5EJWA 1WTVA 1RODA 1EL0A 4X3SA 1VMCA 1IL8A 3H91A 1JICA 1O7YA 2B2TC 1DOMA 2EE1A 4IUVA 1RHPA 1ML0D 5D14A 1WTOA 4IUUA 2IL8A 1B4OA 1G6ZA 1MGSA 1SDFA 2L9HA 2FINB 2L12A 2B2UC 2NYZD 2R3ZA 2FFKB 3TZDA 1GUWA 1WVLA 2KVMA 2L1BA 1HHVA 2DY8A 4U68A 3IFDA 1NR4A 2K1BA 1U4PA 5T1IA 3I8ZA 2JP1A 3GV6A 1AZPA 1M8AA 4X3UA 4MN3A 3ONAB 1PFNA 1X3QA 1X32A 4R9WA 5JJZA 3Q6SA 4HSVA 1PFMA 3MWYW 2H1EA 1SAPA 1VMPA 2KEDA 5EQ0A 2MP1A 1SSOA 4MHEA 1QG7A 1ICWA 1EIGA 2K01A 4ZKCB 1ZXTA 4IUTA 1CM9A 1C8CA 2K03A 4X3TA 5COYA 4R8IA 2FHTA 1G2SA 4RWSC 4XT3B 1F2LA 5AFWA 1XYIA 2B2TA 1WTQA 1Q3LA 1KNAA 1EQTA 5CORA 1RTNA 5E4WC 1RJTA 5EKIA 1CA6A 1BO0A 4LMQD 1BBXC 1HUNA 2KUMA 2B2UA 5DNFA 3I91A 5EPKA 1ILPA 2CVRA 2SDFA 3UI2A 4ZKBB 2X6LA 2J7ZA 4OIKA 1G2TA 1PFBA 2Q8TA 1XX8A 2HCCA 2M2LA 1TVXA 2KOLA 2MPMA 2RA4A 1RTOA 4CJ2C 4OIJA 1G91A 3I90A 2X69A 3DEPA 1DZ1A 4IURA 1WD0A 1F9SA 1LV9A 2B2YC 3FDTA 3TN2A 2EPBA 4ZK9B 2JYOA 4QUCA 4CJ1B 1ILQA 5D65A 1B3AA 3F2UA 3I3CA 1WD1A 1EIHA 1QE6A 1O80A 2HDLA 2RSOA 4CJ0B 4ZLTF 2B2WA 3SVMA 3FPUB 1AP0A
chains in the Genus database with same CATH superfamily
2UUAL 1JJCB 3JAME 1E22A 5JEAH 3R93A 1MJCA 1YJWA 4DV7L 4FXKC 1X56A 4DR6L 3KYHC 2ZTDA 4BBRG 2NTSA 3TEHB 2Q2UA 3DM1A 1ONLA 2Z6KA 1HR0Q 4GOPC 1YVCA 5DAUA 4DUZQ 4QMGA 2F0EA 2AUKA 4IUPA 4JBMA 3QJYA 1E2VA 5KNDA 1E7ZA 1S5CD 1R9TH 4DAMA 5EPLA 4A3IH 5KEEA 3BZDB 3NTHA 4DGZA 1DGSA 2CWAA 1STAA 1FNVA 2N88A 4L5QA 2JA6H 2E2JB 5KYIA 5E7NA 4HJ5A 3TS0A 3U4VA 3VA5A 4JI0L 1M90C 3S2HH 4KMUC 1SRUA 2F0OA 5I6WA 5A2QE 4JCVE 1MKHA 5ELNA 1TU2B 4LW1A 1NMFA 2K6AA 3A8JE 2K28A 3D3RA 3CCMA 4A3LH 3A5UA 5KYLA 2B2YA 1C7YA 4A3GG 1IL8A 2B29A 1JICA 1DOMA 2R93G 4XIGS 3RZOH 3O13A 2VB2X 5IIFA 4KY6A 1G6PA 2DJFC 3G4SA 1EY0A 4BXXG 5T1IA 2RF4A 4LF4L 4X62Q 1KL9A 2A5HA 4HCEA 1XNRQ 2XSCA 1PFMA 3MWYW 4B08A 2ZM6Q 1VMPA 1TWHH 3TP5A 3PV0A 3TREA 4ZKCB 1ZXTA 2GVBA 2HIXA 1CM9A 3W1GA 1KAAA 3T51B 1C8CA 1IYVA 2CFMA 1TS3A 3TMEA 2EY1A 1EQTA 2VQEL 4DV3Q 1TS5A 3MC0B 4NXML 4A3GB 4GLVB 5JEAG 1E3PA 5DNFA 1I5FA 3LGJA 4JVZA 1IBML 4FF4A 2K4KA 2YU9B 1AFPA 1VQMA 2HCCA 5IP9H 1G91A 1VQNA 3T53B 5C6AA 3J80c 2KCNA 2F0QA 4CKEA 2WAQE 1TWHB 2WFWA 4CJ0B 5M5XH 3E0EA 2F4IA 2B2WA 4CKCA 4C3JB 4NPSA 3ND8A 3UDGA 4JI0Q 4B3SQ 1DOLA 3LWUA 2X6GA 4A3JG 4DV1Q 3J81E 1CZGA 4TRDA 3KJPA 3Q22A 4DUYQ 1UEBA 4ILWA 4A3GH 1BQQT 1GHKA 2OWOA 5LL6S 3M4OB 3M85A 2EOTA 1X54A 1IL2A 1VQDA 4PQXA 3NTKA 1HUMA 1PDQA 3E9HA 4WFN3 1H9KA 3KF6B 2D0OA 2WINB 4GN3B 3CC7A 4DR4L 5CBAE 4UP8A 1HTPA 1TS4A 1VQAA 2UXBL 2J4XA 3RLNA 3S1QH 4DK6C 4F7XA 2UUAQ 5C4XB 1YNND 1KIXA 3E0JA 1R9TB 2QKIC 4GNXB 1ZYRD 2PYKA 3CW2C 5LMUL 3T1HL 4OGQC 5E1FA 3I4NG 1LTTD 4DR5Q 5JVH3 4MNOA 4QL5A 1SYFA 1A63A 2EYLA 3DXJC 4IUUA 3CQZB 1MGSA 1N32L 2R3ZA 1GUWA 1YBYA 2L1BA 3OMCA 2I46A 2F4VL 3GTOH 1Y8NB 3CQZH 3ITPA 1M8AA 2BH2A 1U9RA 4R9WA 4DV2Q 4JBKA 3PUVA 5I9PA 4YY3L 1NJIC 1Z47A 4JI8L 4ID6A 4ZCKA 1QWYA 1SNQA 1EY6A 4KY7A 1VS0A 2NVYH 1G8ZD 2QF7A 3OIQA 4BXXH 2VUMB 1TT2A 4OEMB 1KNAA 1SROA 1RTNA 2NVYB 3A56A 3I4NB 5HGTA 2R93H 1UWVA 5DLQE 3U4ZA 4A3EB 2CVRA 3G6JB 4LF6L 1ICFB 2YTYA 1Z7TA 4FXGC 1SN8A 4RMFA 2MPMA 2KOLA 3H0GB 2F3VA 4PZ6A 2X69A 3DEPA 5M9OA 1D5ZC 2D2CC 4DV6Q 3GTOB 3I4OA 1FGBD 4PZ8A 2XTIA 1D6EC 5I2YA 4P73A 2JA5B 5FOBB 4CDDC 3T4AC 5J39A 1JQYD 1EYAA 1D5MC 4A93B 2MGSA 4RKBA 4J15A 1HJPA 3FPPA 2K04A 2PMZB 4K8JA 3GTJB 3L0OA 4GNXC 1HRJA 4H7BA 5K36H 3PF4A 4KKSA 4APVA 4C3JH 3GTJH 1XNQL 3BDCA 5FO7B 1QILA 3GTKH 3J7AV 2IY5B 4Y7NB 2H4OA 1LTBD 4HIMA 1MBYA 2LMCB 2JA7H 1S5ED 1HFNA 3W2DA 4UAIA 3RLOA 2PZUA 3GO5A 3WDNA 3D6CA 2UUCL 4B3ML 1YNXA 4HN7A 4ZAIA 1YI2A 1SFOH 1PH2A 4FF1A 3K7AH 2VQFQ 5FJ8G 1PLFA 3ZYYX 4DK0A 2RHSB 5IYBH 5EBDA 2MO1A 1LO5D 3RD4A 3K5MA 1SNPA 3S14B 4OO1G 1RDPD 4GZYC 3F1ZA 2K5WA 1PH9A 4AYBB 1E2ZA 1PRTD 4DV0Q 1E1OA 1SBBB 1PTOB 2QA4A 1CI3M 1KAWA 3J7AF 1CHQD 5JOBA 3K5OA 1HNWQ 3NHHA 3SXHA 3VDYA 1KD1C 4A3CH 1EZ6A 3SGIA 1JE5A 2PCFB 4ABNA 4DR5L 1W3SA 4HR7B 1EYDA 3K80C 1AE3A 2HIVA 1HHVA 2VW9A 1VQ8A 1IW7C 4MN3A 4A3KG 3CD6A 4JV5L 3BG3A 4LUZA 2PNHA 3S14H 5EQ0A 1F77A 2PW5A 4IUTA 1Q86C 1FVIA 5COYA 1V1QA 2WAQB 1SEBD 4PG3A 1V1OA 2MQHA 3DWAA 1MHWC 1BDOA 5EKIA 3S2DB 4LMQD 4MZ9A 2YTVA 2E2JH 2R92B 5BR8L 4IPGA 2IX0A 2LSSA 3MXNB 2OEOA 2B2YC 4KI0A 4JI2L 3S17B 5LMNL 1W2BA 3NTIA 4BBRH 4KKUA 1SMYC 5CV9A 4DV1L 1JOOA 3C2PA 5IE8A 5CGKA 4BBSB 4O1NA 2RSOA 1YZ6A 4OO1H 3ULPA 1PTOD 2YTXA 4WJWA 4QJFA 5C0XJ 4XYOA 4JI2Q 4JI4Q 1B9MA 4HJ8A 1HQMC 2VB3X 1WCMB 4DNIA 5C4JB 3CCJA 3QOJA 3CCSA 2N55A 5M5WB 1LABA 3NBHB 4J1MA 1K0RA 1Z9FA 5IOCA 2IX1A 2O4XA 2FJ2A 1IBMQ 2JA6B 4PMBA 1OTCA 1BVSA 3J7ZC 1QVGA 1IZ6A 1VQPA 3HOWB 1TWGH 5IWAL 3D8GA 4OO1I 2EDGA 1RF2D 2Y0SG 3H3VH 4PMWA 2FMCA 1XPOA 4RA8A 3NPPA 3EIVA 2RVLA 3MVVA 3G6EA 1VCIA 3I73A 4K5VA 1MSHA 2K05A 3LNNA 2L11A 2WB1E 4GLAC 1SJED 5GAGC 1XMQQ 3EN2A 3PIO3 2KCMA 1K8OA 2HCIA 2MO0A 2JEAI 4RFBA 3A0JA 3C3LA 1EYGA 2JA6G 1DXMA 3D4DA 3NBHA 3OPOA 2Q8IB 1HNWL 1U0LA 2UXDL 2I5MX 4LF5L 2FFKB 3C1EA 4IOCA 5C3EG 2ZTEA 1JJ2A 5L37A 5NUCA 2N3SA 1VF7A 1HQRD 1CTMA 3FRPB 1DJRD 1JC7A 3HOYG 3CCLA 3K5LA 2HT1A 1F2ZA 4BY7B 3T13A 1UE5A 4K2KA 1QVFA 1VQGA 3GTQH 3HRZC 4RG1A 4H13C 2F0HA 5CV7A 3S15H 4L6TB 2I07B 1BOSA 1O7LA 1QOHA 3HZXA 5BN4A 1SE3A 4LF9Q 2Q8TA 2CCZA 2E2IH 4P75A 4KD4A 1JMCA 4K6LA 4YCUA 1N34Q 2I5HA 3OHXC 3OWEB 4A3IB 2CWPA 1ET6A 3NELA 1B3AA 4DR2L 1WD1A 3GQBA 1XPUA 2E2HB 4C3IB 3RZDH 1PH4A 1JCKB 3A55A 1O7IA 4DV6L 1NMGA 5IP7G 5TSSA 5IGFA 3CRKC 3OOCA 3SEBA 4ODGA 1FJGL 3N52A 1NR2A 1M1KC 5C0XH 2QEJC 4GKJQ 1EWIA 2EJMA 2LXJA 1K83B 1FNUA 2CQAA 2B39A 3NP8A 4X66L 1SNCA 3MXUA 4EQ5A 1HNZQ 4YWMA 4A3IG 1SNOA 1RKNA 1U4RA 1MD2D 3R8BA 1Z6HA 5ELBA 4QCLA 2R92H 2XN9C 1Q81C 2CW0D 1WTPA 3BU2A 4HMJA 4O2DA 5JPMC 1GUSA 1I50H 1AEXA 2DUDA 2EVBA 5EGTA 1F9QA 3URYA 3VYSA 1WTRA 4GKJL 4P72A 5C0XI 2L55A 1CKNB 3I56A 4RKLA 1SLJA 1Y1WG 1KLGD 5IYBG 1KXLA 4G7OC 3GTPH 4XTCS 4OHJA 1N9WA 3PMFA 1VQFA 2DJGC 3GV6A 5G3LF 1LM0A 5JPNC 1I4PA 3F2CA 1RD9D 2EY2A 3TBIB 2SEBD 2F0PA 4DR2Q 3SK5A 3BS1A 4DA2A 1D1KA 1I50B 4RCOA 4XT3B 3TZUA 3G71A 1EU3A 2E2IB 1SYEA 1N33Q 4H0LC 4Q5VA 5FLXL 1ILPA 4ZKBB 5IGCA 1ESFA 1PRTF 5IGEA 2R7ZG 3GTQB 1HR0W 2ZJPA 1LV9A 2DGYA 3FDTA 4BY7H 3PUZA 1X3EA 1BR9A 3PUWA 2F0KA 1SYDA 3SVMA 3GTKB 1U4MA 3E6ZX 1LT4D 1TXYA 1TY2A 4XDXA 1EWCA 4JI3L 3A7LA 2JN4A 2Z6KC 1QVCA 4LF7Q 3S16H 3HOUG 4FF2A 2D9UA 4LFBL 4NDXA 2XIWA 3BDLA 3H09A 1KDCA 3X3NA 1K8MA 4O42A 1F2MA 5LMNQ 2AUJD 1JWMD 1N36L 2ALYB 1NNXA 3CPFA 3G48A 3L9AX 2KA7A 4C56C 1K0SA 5M5WH 1B50A 4AQYQ 2R61A 1O78A 1H9SB 1B1ZA 4IJHA 4UHVA 1XNRL 5IWAQ 1GHJA 2Z8LA 3TRZA 1I3QH 2RSNA 3NENA 5FLXE 1JWUD 1CFMA 4LFCL 1QNKA 4FDBA 1WTVA 4RGOS 5M5YB 1VMCA 3H91A 2WP8J 3RZDB 3UE1A 1V1PB 1I4XA 2R92G 2A6EC 2UXCL 5D14A 2WKDA 3S1NB 3HKZG 2FINB 4JI4L 2B2UC 3UDXA 3KF8B 5M3FH 1LACA 2G9HD 2BA1A 2PMZE 4V0BA 4DNTB 1STYA 3HEJA 1ASZA 1ENAA 4DAYB 1BKBA 4QY7A 3KBGA 3KLWA 3H15A 5M3MG 1HA5A 1K8GA 1WCMG 1RJTA 1BO0A 3TP8A 1AN8A 2MHVA 1VQOA 2E74C 2WACA 1Q46A 4QIWB 5IGDA 1A8VA 2IX3A 3I90A 1Y1VH 3B6YA 1KDAA 2F0WA 2JYOA 2OT2A 5IGBA 4RHSA 3OW2A 4ZLTF 4JV5Q 2N78A 4HIOA 1LTGD 3EA6A 3DLLA 3JAMc 1CA5A 4HJ9A 3TP6A 5M3MB 1J9OA 3PO3B 1E2WA 2B8GA 1XMOL 3CKIB 2B63H 3FHWA 3OYYA 1J5EQ 3PO3H 2UUBQ 1XXGA 1SYGA 4GS3A 5CV8A 4LF8Q 2AQ2B 4JI1L 3P75A 3S17H 1TY0A 1NY4A 4QUFA 2FXQA 1K8AC 3OMGA 3PGZA 4OXPA 1NCVA 4DU9A 3NQTA 4FYDA 3OTOL 5M3FB 1SNDA 3IAYA 1SMXA 4ME3A 1PFSA 4RGTA 2VQFL 3M7GA 4DAVA 4X64Q 2CKZB 2HUGA 3HOYB 3PO2B 4JPBW 5C44B 1L0XB 2C5CA 3K7AB 4BY7G 4G7ZC 4C2MB 1DD2A 2F0GA 3HP3A 2RDGA 4DF7A 2NWGA 1GJXA 3VA7A 2C9OA 3F2DA 1JB3A 1DM0B 1XNQQ 1RHPA 2PO4A 4A4IA 1VQLA 4F8MA 3VYRA 2JA5G 1H9RA 3MEFA 2L12A 4JI1Q 5BN3A 1Q7YC 3H3VI 1WVLA 1EIFA 2NN6I 4DR1Q 2N8NA 5E3FA 4YCVA 1VQCA 2WKCA 3HGBA 3KFUA 5D3IB 3CMEA 1FNWA 1U5KA 3M3YH 2MP1A 3J81i 1A2TA 2R7ZH 1QJOA 1C48A 3T1HQ 4NMZA 3MXGA 1I6HH 2P5ZX 3D31A 4XQJA 2KHJA 2L5TA 2F0MA 1WFQA 3MZ5A 1I4RA 1PH6A 5C4JH 2D0PA 2B2UA 2LKVA 1EFID 4DR3Q 2L0CA 4A3FG 2F03A 2NUCA 4OIKA 2ZXRA 1KTKA 1XX8A 1AE2A 3QOLA 3T16A 1RTOA 3PUYA 4IPHA 1LT6D 1BUVT 1T5XD 2QCPX 4PMCA 3M4PA 4G57A 3V05A 1KRSA 4B9WA 1QE6A 1EZ8A 3J81L 3HOVB 1LYLA 4DV2L 3VYUA 1Y14B 4R4CA 4KKTA 1FGUA 1HPCA 4JK1C 1JJGA 4R4OA 1ENCA 4TKOB 3A74A 2IHFA 4KJNA 4DUYL 2E76C 4L5SA 4R4TA 1J5EL 3KOJA 4NXNL 4L5RC 5HURA 1XMOQ 1N8RC 2F0FA 3S2DH 3CCEA 3HOZG 5C3XA 4KHPQ 1HNXQ 1RCVD 1XTDA 4KV6A 3QG1A 4JYAQ 2F0JA 4DV4Q 1A3VA 1EEID 5CMDA 1FL0A 2DY7A 1IKMA 3CXCA 2UXBQ 4A3EH 1B53A 4IUNA 3HOVG 3BYYB 4AYBE 3PCOB 5I9OA 4X3KA 1KC8C 1IYJB 4IO9A 1B2TA 2JQOA 4EGVA 3G7LA 1EIYB 3HOZH 2ZJRA 3JAMi 2ICEC 4A3DH 5GAHC 5ELOA 3KDFB 2A68C 3D6WA 1Q82C 4UY8C 3QWNA 4X3SA 1S3OA 2ZM6L 1NTGA 1O7YA 3K6OA 3MHBA 2QDLA 2K5VA 1S72A 2R7ZB 1SJHD 2IPKD 2ZJQA 3ULLA 4B3SL 4UP9A 5ELEA 1NUCA 4GLXA 2B63B 3GTLB 4K0KL 1QG7A 1ICWA 2M00A 1STGA 4M1UB 1X3FA 4B3RL 2WB1G 4XYQA 4A3FH 1CQVA 5ISRA 1WTQA 4S3SA 3A7AB 5FJ8H 5EBCA 3I2ZA 3Q8DA 3U9SA 2SNMA 1PZKD 4F87A 3F8TA 4LFCQ 2JA8H 2A6HD 2YV5A 4LK1C 3HOWG 1LTLA 1LLRD 4NXMQ 2Y0SB 4GKKQ 2VQEQ 3R2IA 5FLMH 2MUYA 2M2LA 1JWSD 4A93H 4G4KA 2MNAA 2EXDA 4A3LG 2QDBA 5CR3A 2EQSA 1VDZA 4I7AA 2RCFA 1TKWB 4QUCA 2EJFC 4QQBX 4DUZL 1O80A 2HDLA 2WV6D 2G5DA 1N33L 5H1SE 2A6HC 1NBWA 1N36Q 1CKOA 1ZEQX 2EYMA 1GXDC 3S2HB 1LTRD 3RLFA 3BZCA 3K8AA 3M4QA 2NZOA 4N9TA 1VQBA 5CBEE 4DN4M 2XVSA 5FKAC 1VQKA 3DWPA 4NB3A 1P16A 4FP5D 1H9SA 2LXKA 4OWXB 1Q12A 3NBIA 1PZID 1V8QA 5IYCH 5AJ3Q 2WIIB 1A3TA 2ES2A 4YCWA 3HKZB 1PHJA 3DEOA 4L8JA 4KD3A 4IJLA 1SMYD 2PZTA 1E1TA 5KIXA 4KHPL 3HOXH 1CHPD 2ZXOA 3GV3A 4NXNQ 5KGUA 1K9MC 1JE4A 1TR5A 1A15A 2K32A 4EVOA 4DV5Q 4ALPA 2B2WC 2ASBA 5IODA 4LNQA 2BDNA 2PPBC 2IHEA 2JXMB 4J8QA 5I6YA 3TQYA 1HR0L 4ZUIA 1STHA 3KF8A 4H02A 4BWGB 5CYUA 1ML0D 4Q0FA 2I0QA 2RBMA 2L9HA 2IT1A 5DM63 3UE0A 3WOEA 4DR3L 4K6DA 1IW7D 2A73B 2EYJA 3KLSA 4U68A 1PYBA 1WOCA 4A3JB 3S1MH 3TP7A 3P20A 2H1EA 4A3BH 1SSOA 1CKMA 1JOQA 3CC4A 2F0TA 1EFWA 2Z0SA 4M8AA 3IRBA 2NVXB 2SOBA 2AHOB 2F0NA 2IJ0A 3ERQA 4ME5A 2O5IC 3GTLH 4C3HB 1GOZA 2XRQD 5HGQA 1C4QA 1PRTC 4DR1L 1N34L 4HIDA 2OXPA 3VR4A 4G7HC 2VS1A 3FKIB 5IT9c 3ULJA 1RIPA 4BY1H 2RA4A 1IHZA 4LF9L 1UAPA 1TWAB 1K3RA 2BE5D 4IURA 1WD0A 1I94Q 3CP0A 5GROA 3TN2A 4A3KH 5C4XG 5D65A 5M3FG 5BN5A 4YIJA 1KQSA 3D4RA 1Q1EA 1LUZA 1C9OA 2FMMA 1TWGB 2H5XA 4CKBA 3Q23A 3PO2G 4DV5L 2AMCB 4DR7L 1U4LA 5A35A 1Y1WB 5K5PA 3PF5A 4IOAA 4C3HH 4JI5Q 1X9NA 2XWJB 1HCZA 2AWOA 5IP9G 3J80L 1QZHA 3FKIG 5FO8B 2A8VA 1YITA 5AJ3L 4U673 1GUTA 2UXDQ 4N8X1 2PQAA 5K36G 1ESRA 4CHTB 1E0BA 2RCNA 2ENBA 2R7DA 4KN4C 2M9VA 4OL7A 3H94A 1AW7A 3HOXG 3CPWA 3GP7A 2A6ED 1F9PA 2B2VA 2A69C 2VUMG 4R4QA 2KCTA 1WTWA 5EKLA 2JK8A 1XMQL 2PI2E 4JOIA 2OCEA 4OELB 3SR1A 2V1CC 4LAAA 1B3QA 4OONA 3IL8A 2KENA 4OWWB 4EQOA 3KJOA 2CH4A 3CF5A 3W5OA 3ICEA 2OF1A 2KEEA 4LFAQ 5EJWA 1CZWA 3HKZE 3M4YA 3CCVA 2EY5A 1TWCB 4YHHQ 4GKKL 4C2MH 2YU9H 1K83H 1YHAA 3OIPA 1K3BC 5KNCA 1X6OA 4I65A 4K5WA 2KVMA 4K5XA 2K5DA 5JJZA 1GVPA 1JR0D 1PMRA 2K75A 3S1QB 4JI7Q 2KEDA 2F0SA 4CBVA 1FD7D 1EIGA 3L3OC 2ATWA 3I55A 1QB5D 3K0YA 4P2CB 3HOWH 5FK9C 1Y69U 4C1NI 3K57A 3QIAA 1VQJA 1ZYRC 1D7QA 4A3MH 1CA6A 1VQEA 2MFIA 2J0TD 4OX9Q 3S24A 5EPKA 3T56B 1LTSD 4QIWE 3A5ZB 1EQVA 1SR3A 3RZOB 5JAVA 2JEBI 1PZJD 2EY6A 1ET9A 2K52A 1OXTA 3MFGA 4Y52H 4MTKA 3SK4A 2KJXA 1D2BA 1F9SA 5BR8Q 3S15B 3PSIA 3K81C 2TMPA 5GQOA 2NVXH 1BCPB 3GDEA 1A3UA 2AQ1B 1EEFD 4LJZC 3RN2A 1BXTA 1XWEA 4RHRA 2F3WA 3PO2H 2IWHA 3RN5A 3VR2A 4ZUJA 3I4NH 3GTGB 1OXVA 4FNFA 4NP5A 1OO9B 1F9RA 2HQLA 4YWLA 2F0VA 3S1RB 3BVGA 1MIUA 2KECA 4DV4L 1E24A 1PH8A 4ZYSA 4BY1G 1KABA 1P8LA 1TIID 4A3KB 2XRSD 1UE7A 5F2DA 2F1MA 4E6IA 1EOTA 1IBKQ 2PW7A 3MTSA 2OTLA 4CDFC 3PUXA 3KDFA 4LF7L 2JA5H 4IALA 1HFGA 3UDFA 3RMHA 1Q90A 2QW7A 3RR5A 4LUOA 4HAEA 2IW3A 1IKLA 4JI7L 4QB4A 3WOFA 3ZJYC 1GD7A 5C5MA 5C0XG 4DV0L 2XNAC 1PTOF 4KTAA 3K5NA 4A93G 1NAPA 4A3MB 5FLMG 1GM5A 2GN5A 2OQKA 2CW0C 3E3XA 3K0XA 3C46A 2F0LA 2A68D 1WTHA 2EE1A 2BE5C 4IFDG 1K28A 2IL8A 4CDEC 4X65L 5C3WA 4F88A 5ELCA 4JG2A 3JC66 1VQ4A 2BOSA 1H95A 1AZPA 4X3UA 1X3QA 2RDHA 5CV5A 4JOIC 1QNUA 3PO3G 2K50A 2BCOA 2JA9A 3KF6A 1IXRA 4HMIA 3SHLA 2FHTA 4PNYA 1DCZA 2A1AA 1XYIA 1Q3LA 3LX0A 1F2YA 4A3MG 4UP7A 4IFDH 1FYCA 2G9DA 4RH6A 4POFA 1VQ9A 1VQ7A 5C4XH 4A3DG 1DZ1A 1BCPD 2JA8B 1JOKA 1EQQA 1I4HA 4LUVA 2UUCQ 4KLKA 3M3YB 3GD7A 2QGQA 3F2BA 5LL6X 3M7NA 3I7FA 2NVQB 4X64L 1SE4A 3AB9A 4IFDI 4PV1C 3KBXA 2PI2A 1YNJC 4YY3Q 4UDUC 4IQZA 2RKSA 2K5QA 1O7ZA 1IBLQ 2JE6I 4B3TQ 2VNUD 2WAQG 2ZT9C 4LF8L 3Q24A 5J1ZA 2VUMH 1Y1VB 3J81c 1Y8PB 2JA8G 4O0AA 4HEDA 3NUCA 1B70B 4DNRB 5C44H 3J80i 1II3A 1DYQA 3J81j 3VR6A 1YJ9A 2KQ3A 1L1OC 4XT1B 2SNSA 2HHHL 2KHSA 1T9HA 4BBSG 1DOKA 4A3FB 1BBWA 4KHZA 2A74C 1XJVA 1EY7A 5FLXc 2B2VC 4C3HG 1SE2A 4R4IA 2AWNA 1RODA 4DKAC 1EY8A 4DAPA 3MEHA 1YHBA 4RGNA 4P74A 4Z9CB 4K2LA 1WTOA 4DFAA 4JI8Q 2A19A 2Z9HA 3FVQA 4IZ8A 1QZGA 5IYDH 2DY8A 3HS0C 1NR4A 1HZAA 1U4PA 3NWSA 4JW0A 1BCPC 5IYCG 5IT9E 2RHQB 1UE6A 1LT5D 2EZVA 4RGMA 4ZQ3A 3HOZB 1SE8A 2EYPA 4TVAB 2EJGC 1VQHA 5C5LA 5FO9B 1F2LA 2ZXPA 3UDIA 3EQLC 2B2TA 5M5XB 2GVAA 4IPDA 5E4WC 5LMUQ 4KN7C 4LWCA 1HUNA 2CQOA 1PTOC 3C1FA 2Y0SE 4LF5Q 1ENFA 2UXCQ 1G2TA 1A0IA 1TVXA 1TS2A 4OIJA 4HIKA 2V4DA 2K33A 4GNXA 2R93B 3AU7A 3NXWA 1I6HB 2O5JC 3HOXB 3F2UA 2F0IA 4DXGA 5JJIA 3GTMH 3FPUB 2K14A 5G3LD 4DV3L 1I6VC 4WRDA 5EPJA 3CMAA 4A3CG 4XQNA 1V1PA 2AKWB 3MFYA 3NK9A 4AQYL 5DM73 3V2TA 4HTHA 5I2XA 1ASYA 4X62L 2L4NA 5GADC 3FKIH 3M9BA 3J80E 3FMCA 2YYZA 3I70A 1JORA 1EY9A 3EFXD 1VF5C 2B63G 3A54A 3KK7A 2Z6BA 4LFBQ 1MI2A 1H9JA 3HG9A 1EYCA 2A69D 5IGGA 1PH1A 2WB1B 2K5NA 1HA6A 2Z4HA 2NN6H 4HCSA 4BA1I 4B3RQ 4JI3Q 1QCBD 3AFPA 1GO3E 3FEWX 4K0KQ 3H3VC 3CCRA 4C3JG 4C3IG 2LY7A 3NE5B 3MXPA 1H9MA 3TSSA 1STNA 5JJLA 4IUVA 3HOVH 1CSPA 2PNRC 2NVTH 2QILA 4LFAL 3IKJA 4YWKA 2KBNA 5M3MH 1TWAH 3IFDA 1S40A 1W6KA 4ULLA 1SYCA 1HZ9A 3GTPB 1Y8OB 4K14A 1D5XC 5D3DA 1PVOA 4QGUA 1YHQA 3DUZA 4DV7Q 3ND9A 2AQ3B 4X3TA 4POGA 4DPGA 4B9XA 5IYDG 3NQIA 1STEA 2HHHQ 2JJQA 3SK6A 5M5YH 4DXFA 3IFTA 4J6HA 1STBA 3N6RA 1QUQB 1Q8KA 2C35B 4L5TA 4KK7A 1HNXL 1XTCD 3K59A 3RNUA 4JI5L 4MTNA 4WORA 4TSSA 2N49A 1CQFA 2DNEA 2VZAA 2CHBD 4H44C 1YJNA 1TWFH 3STBD 1B7YB 3CU7A 4B3TL 1AP0A 1IBLL 3AFQA 2DNCA 2BH8A 2PQEA 1RL2A 3CCUA 4FXDA 1I94L 1PA6A 1VQ5A 1UNSA 3S9WA 1HNZL 1D8LA 2JSOA 1SXTA 5I4DA 4BS9A 4X66Q 3GTMB 3I4MG 3QB3A 4P71A 1KDBA 3J7A5 3A8KE 3V96A 1MSGA 3CRLC 3S1NH 3T1YL 2OQ0A 5ELFA 5A2QL 2F3IA 2CH4W 2NZ1D 1J8IA 3SE0A 4A3EG 5C3EH 2VY3A 2HD3A 2F0DA 4HJ7A 4CGYB 3JAML 2ID0A 3H0GG 1DONA 2EYOA 1CSQA 1I3QB 4UPAA 3PIOA 5EKKA 1EUJA 4RAUC 2HDMA 3EROA 1BF4A 2NVTB 4L63B 4R1JA 3WWVA 1UEAB 3QR8A 3MAQA 1YNNC 3BJUA 1YIJA 4BBRB 4JBWA 3D0FA 3H6MA 3I4MB 1EL0A 3BVMA 1QUQA 1S5FD 1CK1A 3X3MA 1SDFA 3HOUB 3TZDA 4A3DB 1X65A 1PYWD 3CAMA 3HKSA 4FO2A 3RUZA 5IY0A 4WJ4A 3AQQA 3Q0AA 2JP1A 1G51A 4X65Q 3ONAB 1PFNA 4EQNA 2F0UA 3CC2A 5HY6A 1WI5A 1S5DD 1PV4A 3BYTB 1LTAD 2RDFA 2Z1CA 3TDQA 5GAEC 3EBEA 4ZRZA 4N9PA 3TS2A 4DK3C 3OTOQ 1G2SA 1PXUA 1JB7A 2I5LX 5CORA 4AYBG 2PZWA 2KUMA 3AMUA 1I4QA 2XWBB 3UI2A 2ZTCA 4HJAA 5LMNW 2X6LA 3DMUA 2D62A 3K7UC 5C4HA 2LFNA 2UUBL 3AEVA 1N32Q 1GKHA 2KHIA 1KLUD 1IBKL 1Y1VG 2NZHA 3OW7A 4MIUA 4IFDJ 2UU9Q 1EIHA 5J22A 1TQOA 3DWQA 2EIFA 2KCCA 5CC4A 3P7JA 4GN5A 2B8FA 4PZ7A 1X55A 2B3GA 1UE1A 4QF4A 1YEZA 4DR4Q 1PRTB 5T1GA 2XGTA 1X3GA 2BDOA 3U58A 1S4ZA 3STBC 4IN3A 1A2UA 4Y7NH 1GUOA 3QO2A 4RCNA 2MJ8A 4EQPA 1FR3A 5E4XA 1LTID 2E5LL 4XXEA 4NW2A 1R4QB 1BNZA 1L1OB 1W6JA 5JJKA 4OX9L 3R3OA 4AIMA 3ER0A 5KNBA 3LWEA 4A76A 1V43A 2Q8RE 3I4MH 4JI6Q 1UUPA 2RQXA 1GUNA 2NTTA 5JVG3 1NSNS 2VL6A 2E5LQ 4JC0A 1TWFB 2B2TC 2Q2TA 1B44D 2E2DC 1G6ZA 1EOVA 3J7YW 1AH9A 2NYZD 1Y1WH 1V9PA 3AYHB 2PQAB 1BCPF 4IPCA 4KHVA 2D5DA 3K58A 1X32A 1HZCA 3S16B 1A62A 1M4VA 3MA2B 3OSOA 4R8NA 4HSVA 1OXXK 4BBSH 1SAPA 3HOYH 1ZKOA 2O2LD 4DAYA 4JBJA 2K01A 3KLSX 2Q2HA 4FVMA 2K03A 2DN8A 4R8IA 4DK1A 4RWSC 3OWFA 5EAYA 3CHBD 3EVQA 1L2FA 5AFWA 4AH6A 3VR5A 2E2HH 1GUGA 3P1HA 4BY1B 1SYBA 5C44G 2OTJA 1KRTA 1WCMH 2EXZA 4TQUS 4LF4Q 4V190 4JYAL 1BBXC 4JI6L 3KLRA 3I91A 1XPRA 3SK8A 2L15A 4GN4B 1EY5A 4KJOA 2HQEA 1PFBA 4CJ2C 3DHQA 3U50C 2QEXA 3BVZA 1EU4A 3A8IE 4BA2I 5ELDA 4ZK9B 1CUKA 4CJ1B 2K5HA 3VR3A 1CKNA 3I3CA 4C1NK 3E5SA 5C3EB 1EWHA 4HSPA 3BDOA 1L1OA 1S5BD 2NN6G 1A6XA 3R2TA 5DEHA 2GA4B 5CV4A 4CDCC 1YNJD 1X3PA 5J3BA 1PH7A 4B3MQ 4YHHL 1I4GA 4C3IH 4IUQA 1G291 3BZKA 1WTXA 2ICIA 2NB0A 3EJIA 1KNEA 1OXUA 2VXWA 4XQQA 1K73C 1Q1BA 1PYSB 2LS01 4NKLA 5JEAJ 2NBFA 3NSWA 5KRUA 4A75A 1AZQA 3SDZA 1PH3A 1PTOH 3M4OH 2UU9L 1D1IA 4WJ3M 1HTLD 1WJJA 1Q8IA 4DR6Q 1EQRA 1LT3D 3I72A 1JT8A 1VQIA 3W3AA 2NVQH 3CCQA 1IYUA 3L2PA 2JA7G 3S1RH 4K8IA 3PIP3 1CT1D 1J6QA 1L0YB 1NE3A 3KUPA 3GTGH 3HOUH 1T5EA 2BA0A 4EX5A 4FF3A 1BBUA 2E8GA 2EYFA 1MJEA 3HFZB 4X6AH 3E9IA 4GOPB 1PH5A 5IT9L 1HXYD 1SNMA 1WYDA 1B4OA 4LF6Q 1B8AA 3T1YQ 3ERSX 3PQIA 1R4PB 2K1BA 2R7FA 1SFOB 3I8ZA 4DR7Q 3W1BA 1TWCH 4OWTB 5LHY1 3I4LA 2EYHA 3Q6SA 1L0WA 3MXNA 2F52A 3NWTA 4A3BG 3VYTA 4MHEA 2R6GA 5CV6A 3L7ZC 2JA7B 5IP7H 2E75C 3H0GH 1C0AA 4A3JH 3S1MB 4I7ZC 1HZBA 2F4VQ 3PIPA 1EY4A 2SDFA 4N8FA 3DM3A 4KY5A 2J7ZA 4GOPA 2Z4IA 1FJGQ 2K7VA 3D4WA 3FP9A 1OXSC 1B9NA 2TSSA 1KHIA 1VQ6A 5C4ZA 2EPBA 3U9OA 1HH2P 1ILQA 2Q2IA 3NEMA 4A3BB
chains in the Genus database with same CATH topology
3JAME 5JEAH 3R93A 4FXKC 2NTSA 3DM1A 1ONLA 5DAUA 4QMGA 2F0EA 2AUKA 4IUPA 3QJYA 1E2VA 5KNDA 1S5CD 5EPLA 5KEEA 3BZDB 3NTHA 4DGZA 1STAA 1FNVA 2N88A 2E2JB 5KYIA 3VA5A 4KMUC 2F0OA 5I6WA 5A2QE 1TU2B 2K6AA 3A8JE 2K28A 3D3RA 5KYLA 2B2YA 1IL8A 1JICA 1DOMA 4XIGS 3O13A 2VB2X 5IIFA 4KY6A 1EY0A 5T1IA 2A5HA 4HCEA 2XSCA 1PFMA 3MWYW 4B08A 1VMPA 3TP5A 3PV0A 4ZKCB 1ZXTA 1IYVA 1CM9A 1KAAA 3T51B 1C8CA 1TS3A 3TMEA 2EY1A 1EQTA 1TS5A 3MC0B 4A3GB 5JEAG 5DNFA 4FF4A 2YU9B 1AFPA 2HCCA 1G91A 3T53B 5C6AA 2KCNA 2F0QA 4CKEA 1TWHB 4CJ0B 2F4IA 2B2WA 4CKCA 4C3JB 3ND8A 1DOLA 3LWUA 2X6GA 3J81E 1CZGA 4TRDA 3Q22A 4ILWA 1BQQT 1GHKA 3M4OB 5LL6S 3M85A 2EOTA 4PQXA 3NTKA 1HUMA 1PDQA 4WFN3 1H9KA 2WINB 5CBAE 1HTPA 1TS4A 2J4XA 4F7XA 5C4XB 1YNND 3E0JA 1R9TB 2QKIC 1ZYRD 2PYKA 4OGQC 5E1FA 1LTTD 5JVH3 1SYFA 2EYLA 3DXJC 4IUUA 3CQZB 1MGSA 2R3ZA 1GUWA 2L1BA 3OMCA 2I46A 1Y8NB 3ITPA 1M8AA 1U9RA 4R9WA 3PUVA 5I9PA 1Z47A 4ID6A 1QWYA 1SNQA 1EY6A 4KY7A 1G8ZD 2QF7A 3OIQA 2VUMB 1TT2A 1KNAA 1RTNA 2NVYB 3A56A 3I4NB 5HGTA 4A3EB 2CVRA 3G6JB 1Z7TA 4FXGC 2MPMA 2KOLA 3H0GB 2F3VA 2X69A 3DEPA 5M9OA 1D5ZC 2D2CC 3GTOB 1FGBD 1D6EC 5I2YA 2JA5B 5FOBB 3T4AC 5J39A 1JQYD 1EYAA 1D5MC 4A93B 2MGSA 4RKBA 3FPPA 2K04A 2PMZB 4K8JA 3GTJB 1HRJA 4H7BA 5K36H 4KKSA 3BDCA 5FO7B 1QILA 3J7AV 4Y7NB 2H4OA 1LTBD 1MBYA 2LMCB 1S5ED 1HFNA 3W2DA 4UAIA 2PZUA 3GO5A 3WDNA 3D6CA 4HN7A 4ZAIA 4FF1A 1PLFA 3ZYYX 4DK0A 5EBDA 1LO5D 3RD4A 3K5MA 1SNPA 3S14B 4OO1G 1RDPD 4GZYC 2K5WA 4AYBB 1E2ZA 1PRTD 1SBBB 1PTOB 1CI3M 3J7AF 1CHQD 5JOBA 3K5OA 3NHHA 3SXHA 1EZ6A 2PCFB 4ABNA 4HR7B 1EYDA 1HHVA 1IW7C 4MN3A 3BG3A 5EQ0A 1F77A 2PW5A 4IUTA 5COYA 2WAQB 1SEBD 1V1OA 3DWAA 1BDOA 5EKIA 3S2DB 4LMQD 2R92B 2IX0A 2OEOA 2B2YC 4KI0A 3S17B 3NTIA 4KKUA 1SMYC 5CV9A 1JOOA 3C2PA 5CGKA 4BBSB 4O1NA 2RSOA 4OO1H 1PTOD 4WJWA 5C0XJ 4XYOA 1B9MA 1HQMC 2VB3X 1WCMB 5C4JB 3QOJA 2N55A 5M5WB 1LABA 4J1MA 5IOCA 2IX1A 2O4XA 2FJ2A 2JA6B 4PMBA 3HOWB 3D8GA 4OO1I 2EDGA 1RF2D 4PMWA 2FMCA 4RA8A 3NPPA 2RVLA 3MVVA 1VCIA 3I73A 4K5VA 1MSHA 2K05A 3LNNA 2L11A 1SJED 3PIO3 1K8OA 2HCIA 2JEAI 4RFBA 3C3LA 1DXMA 3D4DA 3NBHA 3OPOA 2Q8IB 2FFKB 3C1EA 5NUCA 1VF7A 1HQRD 1CTMA 3FRPB 1DJRD 1JC7A 3K5LA 1F2ZA 4BY7B 3T13A 4K2KA 3HRZC 4H13C 2F0HA 5CV7A 4L6TB 2I07B 1BOSA 1O7LA 1QOHA 3HZXA 5BN4A 1SE3A 2Q8TA 4KD4A 4K6LA 3OHXC 3OWEB 4A3IB 1ET6A 1B3AA 1WD1A 3GQBA 2E2HB 4C3IB 1JCKB 3A55A 5TSSA 5IGFA 3CRKC 3OOCA 3SEBA 4ODGA 3N52A 1NR2A 5C0XH 2QEJC 2EJMA 1K83B 1FNUA 2CQAA 2B39A 3NP8A 1SNCA 3MXUA 1SNOA 1RKNA 1U4RA 1MD2D 3R8BA 1Z6HA 5ELBA 4QCLA 2XN9C 2CW0D 1WTPA 4HMJA 5JPMC 1GUSA 1AEXA 2EVBA 5EGTA 1F9QA 3URYA 3VYSA 1WTRA 5C0XI 2L55A 4RKLA 1KLGD 4G7OC 4XTCS 4OHJA 3PMFA 3GV6A 5G3LF 5JPNC 1I4PA 1RD9D 2EY2A 3TBIB 2SEBD 2F0PA 3SK5A 3BS1A 4DA2A 1D1KA 1I50B 4RCOA 4XT3B 3TZUA 1EU3A 2E2IB 1SYEA 4H0LC 4Q5VA 5FLXL 1ILPA 4ZKBB 5IGCA 1ESFA 1PRTF 5IGEA 3GTQB 1LV9A 3FDTA 3PUZA 1BR9A 3PUWA 2F0KA 1SYDA 3SVMA 3GTKB 1U4MA 3E6ZX 1LT4D 1TY2A 4XDXA 1EWCA 3A7LA 4FF2A 2D9UA 4NDXA 2XIWA 3BDLA 3H09A 1KDCA 3X3NA 1K8MA 4O42A 1F2MA 2AUJD 1JWMD 3L9AX 2KA7A 4C56C 1B50A 2R61A 1O78A 1H9SB 1B1ZA 1GHJA 2Z8LA 2RSNA 5FLXE 1JWUD 1CFMA 1QNKA 1WTVA 4RGOS 5M5YB 1VMCA 3H91A 2WP8J 3RZDB 1V1PB 1I4XA 2A6EC 5D14A 2WKDA 3S1NB 2FINB 2B2UC 1LACA 2G9HD 2BA1A 4V0BA 4DNTB 1STYA 3HEJA 1ENAA 3KBGA 1HA5A 1RJTA 1BO0A 3TP8A 1AN8A 2MHVA 2E74C 2WACA 4QIWB 5IGDA 2IX3A 3I90A 1KDAA 2F0WA 2JYOA 2OT2A 5IGBA 4RHSA 4ZLTF 1LTGD 3EA6A 1CA5A 3TP6A 5M3MB 1J9OA 3PO3B 1E2WA 2B8GA 3CKIB 1XXGA 1SYGA 5CV8A 2AQ2B 3P75A 1TY0A 4QUFA 3OMGA 1NCVA 4DU9A 3NQTA 4FYDA 5M3FB 1SNDA 3IAYA 4RGTA 3M7GA 4DAVA 2HUGA 3HOYB 3PO2B 5C44B 1L0XB 2C5CA 3K7AB 4G7ZC 4C2MB 1DD2A 2F0GA 3HP3A 2RDGA 4DF7A 2NWGA 1GJXA 3VA7A 2C9OA 1JB3A 1DM0B 1RHPA 2PO4A 4F8MA 3VYRA 1H9RA 5BN3A 2L12A 1WVLA 2NN6I 5E3FA 2WKCA 3HGBA 5D3IB 1FNWA 2MP1A 1A2TA 1QJOA 1C48A 4NMZA 3MXGA 3D31A 4XQJA 2L5TA 2F0MA 3MZ5A 1I4RA 2B2UA 2LKVA 1EFID 2L0CA 2F03A 2NUCA 4OIKA 2ZXRA 1KTKA 1XX8A 3QOLA 3T16A 1RTOA 3PUYA 1LT6D 1BUVT 1T5XD 2QCPX 4PMCA 4G57A 3V05A 4B9WA 1QE6A 1EZ8A 3J81L 3HOVB 3VYUA 4KKTA 1HPCA 4JK1C 1ENCA 4TKOB 4KJNA 2E76C 5HURA 2F0FA 5C3XA 1RCVD 4KV6A 3QG1A 2F0JA 1A3VA 1EEID 5CMDA 2DY7A 1IKMA 1B53A 4IUNA 3BYYB 5I9OA 4X3KA 1B2TA 4EGVA 3G7LA 2ICEC 2A68C 3D6WA 3QWNA 4X3SA 1O7YA 3K6OA 3MHBA 2R7ZB 1SJHD 2IPKD 5ELEA 1NUCA 2B63B 3GTLB 1QG7A 1ICWA 2M00A 1STGA 4M1UB 4XYQA 1CQVA 5ISRA 1WTQA 4S3SA 3A7AB 5EBCA 3U9SA 2SNMA 1PZKD 4F87A 2A6HD 4LK1C 1LLRD 2Y0SB 3R2IA 2MUYA 2M2LA 1JWSD 4G4KA 2QDBA 5CR3A 1VDZA 1TKWB 4QUCA 2EJFC 1O80A 2HDLA 2WV6D 2A6HC 1ZEQX 2EYMA 1GXDC 3S2HB 1LTRD 3RLFA 4N9TA 5CBEE 4DN4M 2XVSA 5FKAC 3DWPA 4FP5D 1H9SA 1Q12A 3NBIA 1PZID 1V8QA 2WIIB 1A3TA 3HKZB 3DEOA 4L8JA 4KD3A 1SMYD 2PZTA 5KIXA 1CHPD 2ZXOA 3GV3A 5KGUA 1JE4A 1TR5A 1A15A 2K32A 4EVOA 2B2WC 5IODA 2BDNA 2PPBC 2JXMB 4J8QA 5I6YA 4ZUIA 1STHA 3KF8A 4BWGB 5CYUA 1ML0D 4Q0FA 2RBMA 2L9HA 2IT1A 5DM63 3WOEA 4K6DA 1IW7D 2A73B 2EYJA 3KLSA 4U68A 4A3JB 3TP7A 3P20A 2H1EA 1SSOA 1JOQA 2F0TA 4M8AA 2NVXB 2SOBA 2F0NA 2IJ0A 3ERQA 4ME5A 2O5IC 4C3HB 1GOZA 2XRQD 1C4QA 1PRTC 2OXPA 3VR4A 4G7HC 3FKIB 2RA4A 1IHZA 1UAPA 1TWAB 2BE5D 4IURA 1WD0A 3TN2A 5D65A 5BN5A 4YIJA 3D4RA 1Q1EA 2FMMA 1TWGB 4CKBA 3Q23A 1U4LA 5A35A 1Y1WB 5K5PA 2XWJB 1HCZA 2AWOA 3J80L 5FO8B 4U673 1GUTA 5K36G 1ESRA 4CHTB 1E0BA 2ENBA 4KN4C 2M9VA 4OL7A 3H94A 1AW7A 3GP7A 2A6ED 1F9PA 2B2VA 2A69C 1WTWA 5EKLA 3SR1A 4LAAA 3IL8A 4EQOA 2OF1A 2KEEA 5EJWA 1CZWA 3M4YA 2EY5A 1TWCB 3OIPA 5KNCA 4K5WA 4I65A 2KVMA 4K5XA 2K5DA 5JJZA 1JR0D 1PMRA 3S1QB 2KEDA 2F0SA 4CBVA 1FD7D 1EIGA 3L3OC 1QB5D 3K0YA 4P2CB 5FK9C 1Y69U 4C1NI 3K57A 3QIAA 1ZYRC 1CA6A 2J0TD 5EPKA 3T56B 1LTSD 1EQVA 3RZOB 5JAVA 2JEBI 1PZJD 2EY6A 1ET9A 1OXTA 3MFGA 3SK4A 2KJXA 1D2BA 1F9SA 3S15B 2TMPA 1BCPB 1A3UA 2AQ1B 1EEFD 4LJZC 1BXTA 1XWEA 4RHRA 2F3WA 2IWHA 3VR2A 4ZUJA 3GTGB 1OXVA 4FNFA 4NP5A 1OO9B 1F9RA 2F0VA 3S1RB 3BVGA 2KECA 4ZYSA 1KABA 1TIID 4A3KB 2XRSD 5F2DA 2F1MA 4E6IA 1EOTA 2PW7A 3MTSA 3PUXA 4IALA 1HFGA 3RMHA 1Q90A 4HAEA 2IW3A 1IKLA 4QB4A 3WOFA 5C5MA 5C0XG 2XNAC 1PTOF 4KTAA 3K5NA 1NAPA 4A3MB 2CW0C 3C46A 2F0LA 2A68D 2EE1A 2BE5C 4IFDG 2IL8A 5C3WA 4F88A 5ELCA 2BOSA 1AZPA 4X3UA 1X3QA 2RDHA 5CV5A 1QNUA 2BCOA 4HMIA 3SHLA 2FHTA 4PNYA 1DCZA 1XYIA 1Q3LA 3LX0A 1F2YA 4IFDH 1FYCA 2G9DA 4RH6A 1DZ1A 1BCPD 2JA8B 1JOKA 1I4HA 3M3YB 3GD7A 5LL6X 3M7NA 2NVQB 1SE4A 3AB9A 4IFDI 4PV1C 3KBXA 1YNJC 4UDUC 4IQZA 2RKSA 2K5QA 1O7ZA 2JE6I 2VNUD 2ZT9C 3Q24A 5J1ZA 1Y1VB 1Y8PB 4HEDA 3NUCA 4DNRB 1II3A 1DYQA 3VR6A 2KQ3A 4XT1B 2SNSA 2KHSA 1DOKA 4A3FB 4KHZA 2A74C 1EY7A 2B2VC 4C3HG 1SE2A 2AWNA 1RODA 1EY8A 4DAPA 3MEHA 4RGNA 4Z9CB 4K2LA 1WTOA 4DFAA 4IZ8A 3FVQA 2DY8A 3HS0C 1NR4A 1U4PA 3NWSA 1BCPC 5IT9E 1LT5D 2EZVA 4RGMA 4ZQ3A 3HOZB 2EYPA 5C5LA 2EJGC 5FO9B 1F2LA 2ZXPA 3EQLC 2B2TA 5M5XB 5E4WC 4KN7C 1HUNA 1PTOC 3C1FA 1ENFA 1G2TA 1TS2A 1TVXA 4OIJA 2V4DA 2K33A 2R93B 3AU7A 3NXWA 1I6HB 2O5JC 3HOXB 3F2UA 2F0IA 4DXGA 3FPUB 5G3LD 1I6VC 4WRDA 5EPJA 4XQNA 1V1PA 3MFYA 3NK9A 5DM73 3V2TA 4HTHA 5I2XA 2L4NA 3J80E 3FMCA 2YYZA 3I70A 1JORA 1EY9A 3EFXD 1VF5C 3A54A 3KK7A 1MI2A 1H9JA 3HG9A 1EYCA 2A69D 5IGGA 2WB1B 1HA6A 2Z4HA 2NN6H 4HCSA 4BA1I 1QCBD 3FEWX 3H3VC 4C3JG 4C3IG 2LY7A 3NE5B 3MXPA 1H9MA 3TSSA 1STNA 4IUVA 2PNRC 2QILA 3IKJA 3IFDA 1W6KA 4ULLA 1SYCA 3GTPB 1Y8OB 4K14A 1D5XC 5D3DA 3DUZA 3ND9A 2AQ3B 4X3TA 4B9XA 3NQIA 1STEA 3SK6A 4DXFA 3IFTA 4J6HA 1STBA 3N6RA 4KK7A 1XTCD 3K59A 4WORA 4TSSA 1CQFA 2DNEA 2CHBD 4H44C 3CU7A 1AP0A 2DNCA 2PQEA 4FXDA 1UNSA 3S9WA 2JSOA 1SXTA 5I4DA 4BS9A 3GTMB 3QB3A 1KDBA 3A8KE 3V96A 1MSGA 3CRLC 5ELFA 5A2QL 2NZ1D 1J8IA 3SE0A 2F0DA 4CGYB 3JAML 2ID0A 1DONA 2EYOA 1I3QB 5EKKA 4RAUC 2HDMA 3EROA 1BF4A 2NVTB 4L63B 1UEAB 3MAQA 1YNNC 4BBRB 4JBWA 3H6MA 3I4MB 1EL0A 3BVMA 1S5FD 1CK1A 3X3MA 1SDFA 3HOUB 3TZDA 4A3DB 1PYWD 4FO2A 3RUZA 3Q0AA 2JP1A 3ONAB 1PFNA 4EQNA 2F0UA 1S5DD 3BYTB 1LTAD 2RDFA 2Z1CA 3TDQA 4ZRZA 4N9PA 1G2SA 1PXUA 5CORA 2PZWA 2KUMA 3AMUA 1I4QA 2XWBB 3UI2A 2X6LA 3DMUA 2D62A 5C4HA 2LFNA 1KLUD 3OW7A 4MIUA 4IFDJ 1EIHA 5J22A 1TQOA 3DWQA 2KCCA 5CC4A 3P7JA 2B8FA 4QF4A 1PRTB 5T1GA 2BDOA 1S4ZA 4IN3A 1A2UA 1GUOA 3QO2A 4RCNA 2MJ8A 4EQPA 1FR3A 5E4XA 1LTID 4XXEA 4NW2A 1R4QB 1BNZA 1W6JA 3R3OA 5KNBA 3LWEA 1V43A 2Q8RE 1UUPA 2RQXA 1GUNA 2NTTA 5JVG3 1NSNS 1TWFB 2B2TC 1B44D 2E2DC 1G6ZA 3J7YW 2NYZD 1BCPF 4KHVA 2D5DA 3K58A 1X32A 3S16B 1M4VA 3MA2B 3OSOA 4R8NA 4HSVA 1OXXK 1SAPA 1ZKOA 2O2LD 4DAYA 2K01A 3KLSX 4FVMA 2K03A 2DN8A 4R8IA 4DK1A 4RWSC 3OWFA 3CHBD 3EVQA 5AFWA 3VR5A 1GUGA 3P1HA 4BY1B 1SYBA 2EXZA 4TQUS 4V190 1BBXC 3KLRA 3I91A 3SK8A 1EY5A 4KJOA 2HQEA 1PFBA 4CJ2C 3DHQA 3BVZA 1EU4A 3A8IE 4BA2I 5ELDA 4ZK9B 4CJ1B 3VR3A 3I3CA 4C1NK 3E5SA 5C3EB 1EWHA 4HSPA 3BDOA 1S5BD 2NN6G 1A6XA 3R2TA 5DEHA 2GA4B 5CV4A 1YNJD 1X3PA 1I4GA 4IUQA 1G291 1WTXA 2ICIA 2NB0A 3EJIA 1KNEA 1OXUA 2VXWA 4XQQA 1Q1BA 5JEAJ 2LS01 4NKLA 2NBFA 3NSWA 5KRUA 1AZQA 3SDZA 1PTOH 1D1IA 1HTLD 1Q8IA 1LT3D 3I72A 3W3AA 1IYUA 4K8IA 3PIP3 1CT1D 1L0YB 3KUPA 1T5EA 2BA0A 4FF3A 2EYFA 5IT9L 1HXYD 1SNMA 1B4OA 1R4PB 2K1BA 1SFOB 3I8ZA 5LHY1 3I4LA 2EYHA 3Q6SA 3MXNA 3NWTA 3VYTA 4MHEA 2R6GA 5CV6A 3L7ZC 2JA7B 2E75C 3S1MB 4I7ZC 1EY4A 2SDFA 4KY5A 2J7ZA 2Z4IA 2K7VA 3D4WA 1OXSC 1B9NA 2TSSA 5C4ZA 2EPBA 3U9OA 1ILQA 4A3BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U4M A;  5EPJ A;  1DOL A;  2MGS A;  2X6G A;  3P7J A;  4XDX A;  3R93 A;  1CA5 A;  2K04 A;  1U4L A;  3KBX A;  5CBE E;  1J9O A;  4DN4 M;  1HRJ A;  1X3P A;  5T1G A;  1F9R A;  1O7Z A;  2N55 A;  4IUQ A;  2L4N A;  2KEC A;  2D9U A;  3DM1 A;  2EOT A;  3N52 A;  1WTX A;  1NR2 A;  2FJ2 A;  1S4Z A;  1KNE A;  2XIW A;  4IUP A;  2VXW A;  1HFN A;  1MSG A;  4O42 A;  4UAI A;  1HUM A;  2FMM A;  1MI2 A;  1ESR A;  3QO2 A;  3DEO A;  1PDQ A;  2NZ1 D;  1EOT A;  4QUF A;  5CMD A;  2DY7 A;  1AZQ A;  1J8I A;  1E0B A;  2MJ8 A;  3MTS A;  1IKM A;  5EPL A;  1NCV A;  4HED A;  5E4X A;  1B50 A;  4ZAI A;  4NW2 A;  1HFG A;  1U4R A;  1HA6 A;  4HCS A;  3GV3 A;  4RA8 A;  1F9P A;  1PLF A;  2B2V A;  5CBA E;  1B53 A;  1BNZ A;  1DON A;  2N88 A;  2RVL A;  4HAE A;  1JE4 A;  2HUG A;  1WTW A;  1A15 A;  1IKL A;  4X3K A;  1MSH A;  1B2T A;  2K05 A;  2B2W C;  4RAU C;  3LWE A;  2L11 A;  4XT1 B;  1WTP A;  2HDM A;  2Q8R E;  1BF4 A;  1DOK A;  3HP3 A;  3IL8 A;  3KUP A;  2RSN A;  3G7L A;  2K28 A;  1WTR A;  2BDN A;  1F9Q A;  2NWG A;  1NAP A;  1QNK A;  2HCI A;  2B2Y A;  2B2V C;  2KEE A;  3D6W A;  5EJW A;  1WTV A;  1ROD A;  1EL0 A;  4X3S A;  1VMC A;  1IL8 A;  3H91 A;  1JIC A;  1O7Y A;  2B2T C;  1DOM A;  2EE1 A;  4IUV A;  1RHP A;  1ML0 D;  5D14 A;  1WTO A;  4IUU A;  2IL8 A;  1B4O A;  1G6Z A;  1MGS A;  1SDF A;  2L9H A;  2FIN B;  2L12 A;  2B2U C;  2NYZ D;  2R3Z A;  2FFK B;  3TZD A;  1GUW A;  1WVL A;  2KVM A;  2L1B A;  1HHV A;  2DY8 A;  4U68 A;  3IFD A;  1NR4 A;  2K1B A;  1U4P A;  5T1I A;  3I8Z A;  2JP1 A;  3GV6 A;  1AZP A;  1M8A A;  4X3U A;  4MN3 A;  3ONA B;  1PFN A;  1X3Q A;  1X32 A;  4R9W A;  5JJZ A;  3Q6S A;  4HSV A;  1PFM A;  3MWY W;  2H1E A;  1SAP A;  1VMP A;  2KED A;  5EQ0 A;  2MP1 A;  1SSO A;  4MHE A;  1QG7 A;  1ICW A;  1EIG A;  2K01 A;  4ZKC B;  1ZXT A;  4IUT A;  1CM9 A;  1C8C A;  2K03 A;  4X3T A;  5COY A;  4R8I A;  2FHT A;  1G2S A;  4RWS C;  4XT3 B;  1F2L A;  5AFW A;  1XYI A;  2B2T A;  1WTQ A;  1Q3L A;  1KNA A;  1EQT A;  5COR A;  1RTN A;  5E4W C;  1RJT A;  5EKI A;  1CA6 A;  1BO0 A;  4LMQ D;  1BBX C;  1HUN A;  2KUM A;  2B2U A;  5DNF A;  3I91 A;  5EPK A;  1ILP A;  2CVR A;  2SDF A;  3UI2 A;  4ZKB B;  2X6L A;  2J7Z A;  4OIK A;  1G2T A;  1PFB A;  2Q8T A;  1XX8 A;  2HCC A;  2M2L A;  1TVX A;  2KOL A;  2MPM A;  2RA4 A;  1RTO A;  4CJ2 C;  4OIJ A;  1G91 A;  3I90 A;  2X69 A;  3DEP A;  1DZ1 A;  4IUR A;  1WD0 A;  1F9S A;  1LV9 A;  2B2Y C;  3FDT A;  3TN2 A;  2EPB A;  4ZK9 B;  2JYO A;  4QUC A;  4CJ1 B;  1ILQ A;  5D65 A;  1B3A A;  3F2U A;  3I3C A;  1WD1 A;  1EIH A;  1QE6 A;  1O80 A;  2HDL A;  2RSO A;  4CJ0 B;  4ZLT F;  2B2W A;  3SVM A;  3FPU B;  1AP0 A; 
#chains in the Genus database with same CATH topology
 2UUA L;  1JJC B;  3JAM E;  1E22 A;  5JEA H;  3R93 A;  1MJC A;  1YJW A;  4DV7 L;  4FXK C;  1X56 A;  4DR6 L;  3KYH C;  2ZTD A;  4BBR G;  2NTS A;  3TEH B;  2Q2U A;  3DM1 A;  1ONL A;  2Z6K A;  1HR0 Q;  4GOP C;  1YVC A;  5DAU A;  4DUZ Q;  4QMG A;  2F0E A;  2AUK A;  4IUP A;  4JBM A;  3QJY A;  1E2V A;  5KND A;  1E7Z A;  1S5C D;  1R9T H;  4DAM A;  5EPL A;  4A3I H;  5KEE A;  3BZD B;  3NTH A;  4DGZ A;  1DGS A;  2CWA A;  1STA A;  1FNV A;  2N88 A;  4L5Q A;  2JA6 H;  2E2J B;  5KYI A;  5E7N A;  4HJ5 A;  3TS0 A;  3U4V A;  3VA5 A;  4JI0 L;  1M90 C;  3S2H H;  4KMU C;  1SRU A;  2F0O A;  5I6W A;  5A2Q E;  4JCV E;  1MKH A;  5ELN A;  1TU2 B;  4LW1 A;  1NMF A;  2K6A A;  3A8J E;  2K28 A;  3D3R A;  3CCM A;  4A3L H;  3A5U A;  5KYL A;  2B2Y A;  1C7Y A;  4A3G G;  1IL8 A;  2B29 A;  1JIC A;  1DOM A;  2R93 G;  4XIG S;  3RZO H;  3O13 A;  2VB2 X;  5IIF A;  4KY6 A;  1G6P A;  2DJF C;  3G4S A;  1EY0 A;  4BXX G;  5T1I A;  2RF4 A;  4LF4 L;  4X62 Q;  1KL9 A;  2A5H A;  4HCE A;  1XNR Q;  2XSC A;  1PFM A;  3MWY W;  4B08 A;  2ZM6 Q;  1VMP A;  1TWH H;  3TP5 A;  3PV0 A;  3TRE A;  4ZKC B;  1ZXT A;  2GVB A;  2HIX A;  1CM9 A;  3W1G A;  1KAA A;  3T51 B;  1C8C A;  1IYV A;  2CFM A;  1TS3 A;  3TME A;  2EY1 A;  1EQT A;  2VQE L;  4DV3 Q;  1TS5 A;  3MC0 B;  4NXM L;  4A3G B;  4GLV B;  5JEA G;  1E3P A;  5DNF A;  1I5F A;  3LGJ A;  4JVZ A;  1IBM L;  4FF4 A;  2K4K A;  2YU9 B;  1AFP A;  1VQM A;  2HCC A;  5IP9 H;  1G91 A;  1VQN A;  3T53 B;  5C6A A;  3J80 c;  2KCN A;  2F0Q A;  4CKE A;  2WAQ E;  1TWH B;  2WFW A;  4CJ0 B;  5M5X H;  3E0E A;  2F4I A;  2B2W A;  4CKC A;  4C3J B;  4NPS A;  3ND8 A;  3UDG A;  4JI0 Q;  4B3S Q;  1DOL A;  3LWU A;  2X6G A;  4A3J G;  4DV1 Q;  3J81 E;  1CZG A;  4TRD A;  3KJP A;  3Q22 A;  4DUY Q;  1UEB A;  4ILW A;  4A3G H;  1BQQ T;  1GHK A;  2OWO A;  5LL6 S;  3M4O B;  3M85 A;  2EOT A;  1X54 A;  1IL2 A;  1VQD A;  4PQX A;  3NTK A;  1HUM A;  1PDQ A;  3E9H A;  4WFN 3;  1H9K A;  3KF6 B;  2D0O A;  2WIN B;  4GN3 B;  3CC7 A;  4DR4 L;  5CBA E;  4UP8 A;  1HTP A;  1TS4 A;  1VQA A;  2UXB L;  2J4X A;  3RLN A;  3S1Q H;  4DK6 C;  4F7X A;  2UUA Q;  5C4X B;  1YNN D;  1KIX A;  3E0J A;  1R9T B;  2QKI C;  4GNX B;  1ZYR D;  2PYK A;  3CW2 C;  5LMU L;  3T1H L;  4OGQ C;  5E1F A;  3I4N G;  1LTT D;  4DR5 Q;  5JVH 3;  4MNO A;  4QL5 A;  1SYF A;  1A63 A;  2EYL A;  3DXJ C;  4IUU A;  3CQZ B;  1MGS A;  1N32 L;  2R3Z A;  1GUW A;  1YBY A;  2L1B A;  3OMC A;  2I46 A;  2F4V L;  3GTO H;  1Y8N B;  3CQZ H;  3ITP A;  1M8A A;  2BH2 A;  1U9R A;  4R9W A;  4DV2 Q;  4JBK A;  3PUV A;  5I9P A;  4YY3 L;  1NJI C;  1Z47 A;  4JI8 L;  4ID6 A;  4ZCK A;  1QWY A;  1SNQ A;  1EY6 A;  4KY7 A;  1VS0 A;  2NVY H;  1G8Z D;  2QF7 A;  3OIQ A;  4BXX H;  2VUM B;  1TT2 A;  4OEM B;  1KNA A;  1SRO A;  1RTN A;  2NVY B;  3A56 A;  3I4N B;  5HGT A;  2R93 H;  1UWV A;  5DLQ E;  3U4Z A;  4A3E B;  2CVR A;  3G6J B;  4LF6 L;  1ICF B;  2YTY A;  1Z7T A;  4FXG C;  1SN8 A;  4RMF A;  2MPM A;  2KOL A;  3H0G B;  2F3V A;  4PZ6 A;  2X69 A;  3DEP A;  5M9O A;  1D5Z C;  2D2C C;  4DV6 Q;  3GTO B;  3I4O A;  1FGB D;  4PZ8 A;  2XTI A;  1D6E C;  5I2Y A;  4P73 A;  2JA5 B;  5FOB B;  4CDD C;  3T4A C;  5J39 A;  1JQY D;  1EYA A;  1D5M C;  4A93 B;  2MGS A;  4RKB A;  4J15 A;  1HJP A;  3FPP A;  2K04 A;  2PMZ B;  4K8J A;  3GTJ B;  3L0O A;  4GNX C;  1HRJ A;  4H7B A;  5K36 H;  3PF4 A;  4KKS A;  4APV A;  4C3J H;  3GTJ H;  1XNQ L;  3BDC A;  5FO7 B;  1QIL A;  3GTK H;  3J7A V;  2IY5 B;  4Y7N B;  2H4O A;  1LTB D;  4HIM A;  1MBY A;  2LMC B;  2JA7 H;  1S5E D;  1HFN A;  3W2D A;  4UAI A;  3RLO A;  2PZU A;  3GO5 A;  3WDN A;  3D6C A;  2UUC L;  4B3M L;  1YNX A;  4HN7 A;  4ZAI A;  1YI2 A;  1SFO H;  1PH2 A;  4FF1 A;  3K7A H;  2VQF Q;  5FJ8 G;  1PLF A;  3ZYY X;  4DK0 A;  2RHS B;  5IYB H;  5EBD A;  2MO1 A;  1LO5 D;  3RD4 A;  3K5M A;  1SNP A;  3S14 B;  4OO1 G;  1RDP D;  4GZY C;  3F1Z A;  2K5W A;  1PH9 A;  4AYB B;  1E2Z A;  1PRT D;  4DV0 Q;  1E1O A;  1SBB B;  1PTO B;  2QA4 A;  1CI3 M;  1KAW A;  3J7A F;  1CHQ D;  5JOB A;  3K5O A;  1HNW Q;  3NHH A;  3SXH A;  3VDY A;  1KD1 C;  4A3C H;  1EZ6 A;  3SGI A;  1JE5 A;  2PCF B;  4ABN A;  4DR5 L;  1W3S A;  4HR7 B;  1EYD A;  3K80 C;  1AE3 A;  2HIV A;  1HHV A;  2VW9 A;  1VQ8 A;  1IW7 C;  4MN3 A;  4A3K G;  3CD6 A;  4JV5 L;  3BG3 A;  4LUZ A;  2PNH A;  3S14 H;  5EQ0 A;  1F77 A;  2PW5 A;  4IUT A;  1Q86 C;  1FVI A;  5COY A;  1V1Q A;  2WAQ B;  1SEB D;  4PG3 A;  1V1O A;  2MQH A;  3DWA A;  1MHW C;  1BDO A;  5EKI A;  3S2D B;  4LMQ D;  4MZ9 A;  2YTV A;  2E2J H;  2R92 B;  5BR8 L;  4IPG A;  2IX0 A;  2LSS A;  3MXN B;  2OEO A;  2B2Y C;  4KI0 A;  4JI2 L;  3S17 B;  5LMN L;  1W2B A;  3NTI A;  4BBR H;  4KKU A;  1SMY C;  5CV9 A;  4DV1 L;  1JOO A;  3C2P A;  5IE8 A;  5CGK A;  4BBS B;  4O1N A;  2RSO A;  1YZ6 A;  4OO1 H;  3ULP A;  1PTO D;  2YTX A;  4WJW A;  4QJF A;  5C0X J;  4XYO A;  4JI2 Q;  4JI4 Q;  1B9M A;  4HJ8 A;  1HQM C;  2VB3 X;  1WCM B;  4DNI A;  5C4J B;  3CCJ A;  3QOJ A;  3CCS A;  2N55 A;  5M5W B;  1LAB A;  3NBH B;  4J1M A;  1K0R A;  1Z9F A;  5IOC A;  2IX1 A;  2O4X A;  2FJ2 A;  1IBM Q;  2JA6 B;  4PMB A;  1OTC A;  1BVS A;  3J7Z C;  1QVG A;  1IZ6 A;  1VQP A;  3HOW B;  1TWG H;  5IWA L;  3D8G A;  4OO1 I;  2EDG A;  1RF2 D;  2Y0S G;  3H3V H;  4PMW A;  2FMC A;  1XPO A;  4RA8 A;  3NPP A;  3EIV A;  2RVL A;  3MVV A;  3G6E A;  1VCI A;  3I73 A;  4K5V A;  1MSH A;  2K05 A;  3LNN A;  2L11 A;  2WB1 E;  4GLA C;  1SJE D;  5GAG C;  1XMQ Q;  3EN2 A;  3PIO 3;  2KCM A;  1K8O A;  2HCI A;  2MO0 A;  2JEA I;  4RFB A;  3A0J A;  3C3L A;  1EYG A;  2JA6 G;  1DXM A;  3D4D A;  3NBH A;  3OPO A;  2Q8I B;  1HNW L;  1U0L A;  2UXD L;  2I5M X;  4LF5 L;  2FFK B;  3C1E A;  4IOC A;  5C3E G;  2ZTE A;  1JJ2 A;  5L37 A;  5NUC A;  2N3S A;  1VF7 A;  1HQR D;  1CTM A;  3FRP B;  1DJR D;  1JC7 A;  3HOY G;  3CCL A;  3K5L A;  2HT1 A;  1F2Z A;  4BY7 B;  3T13 A;  1UE5 A;  4K2K A;  1QVF A;  1VQG A;  3GTQ H;  3HRZ C;  4RG1 A;  4H13 C;  2F0H A;  5CV7 A;  3S15 H;  4L6T B;  2I07 B;  1BOS A;  1O7L A;  1QOH A;  3HZX A;  5BN4 A;  1SE3 A;  4LF9 Q;  2Q8T A;  2CCZ A;  2E2I H;  4P75 A;  4KD4 A;  1JMC A;  4K6L A;  4YCU A;  1N34 Q;  2I5H A;  3OHX C;  3OWE B;  4A3I B;  2CWP A;  1ET6 A;  3NEL A;  1B3A A;  4DR2 L;  1WD1 A;  3GQB A;  1XPU A;  2E2H B;  4C3I B;  3RZD H;  1PH4 A;  1JCK B;  3A55 A;  1O7I A;  4DV6 L;  1NMG A;  5IP7 G;  5TSS A;  5IGF A;  3CRK C;  3OOC A;  3SEB A;  4ODG A;  1FJG L;  3N52 A;  1NR2 A;  1M1K C;  5C0X H;  2QEJ C;  4GKJ Q;  1EWI A;  2EJM A;  2LXJ A;  1K83 B;  1FNU A;  2CQA A;  2B39 A;  3NP8 A;  4X66 L;  1SNC A;  3MXU A;  4EQ5 A;  1HNZ Q;  4YWM A;  4A3I G;  1SNO A;  1RKN A;  1U4R A;  1MD2 D;  3R8B A;  1Z6H A;  5ELB A;  4QCL A;  2R92 H;  2XN9 C;  1Q81 C;  2CW0 D;  1WTP A;  3BU2 A;  4HMJ A;  4O2D A;  5JPM C;  1GUS A;  1I50 H;  1AEX A;  2DUD A;  2EVB A;  5EGT A;  1F9Q A;  3URY A;  3VYS A;  1WTR A;  4GKJ L;  4P72 A;  5C0X I;  2L55 A;  1CKN B;  3I56 A;  4RKL A;  1SLJ A;  1Y1W G;  1KLG D;  5IYB G;  1KXL A;  4G7O C;  3GTP H;  4XTC S;  4OHJ A;  1N9W A;  3PMF A;  1VQF A;  2DJG C;  3GV6 A;  5G3L F;  1LM0 A;  5JPN C;  1I4P A;  3F2C A;  1RD9 D;  2EY2 A;  3TBI B;  2SEB D;  2F0P A;  4DR2 Q;  3SK5 A;  3BS1 A;  4DA2 A;  1D1K A;  1I50 B;  4RCO A;  4XT3 B;  3TZU A;  3G71 A;  1EU3 A;  2E2I B;  1SYE A;  1N33 Q;  4H0L C;  4Q5V A;  5FLX L;  1ILP A;  4ZKB B;  5IGC A;  1ESF A;  1PRT F;  5IGE A;  2R7Z G;  3GTQ B;  1HR0 W;  2ZJP A;  1LV9 A;  2DGY A;  3FDT A;  4BY7 H;  3PUZ A;  1X3E A;  1BR9 A;  3PUW A;  2F0K A;  1SYD A;  3SVM A;  3GTK B;  1U4M A;  3E6Z X;  1LT4 D;  1TXY A;  1TY2 A;  4XDX A;  1EWC A;  4JI3 L;  3A7L A;  2JN4 A;  2Z6K C;  1QVC A;  4LF7 Q;  3S16 H;  3HOU G;  4FF2 A;  2D9U A;  4LFB L;  4NDX A;  2XIW A;  3BDL A;  3H09 A;  1KDC A;  3X3N A;  1K8M A;  4O42 A;  1F2M A;  5LMN Q;  2AUJ D;  1JWM D;  1N36 L;  2ALY B;  1NNX A;  3CPF A;  3G48 A;  3L9A X;  2KA7 A;  4C56 C;  1K0S A;  5M5W H;  1B50 A;  4AQY Q;  2R61 A;  1O78 A;  1H9S B;  1B1Z A;  4IJH A;  4UHV A;  1XNR L;  5IWA Q;  1GHJ A;  2Z8L A;  3TRZ A;  1I3Q H;  2RSN A;  3NEN A;  5FLX E;  1JWU D;  1CFM A;  4LFC L;  1QNK A;  4FDB A;  1WTV A;  4RGO S;  5M5Y B;  1VMC A;  3H91 A;  2WP8 J;  3RZD B;  3UE1 A;  1V1P B;  1I4X A;  2R92 G;  2A6E C;  2UXC L;  5D14 A;  2WKD A;  3S1N B;  3HKZ G;  2FIN B;  4JI4 L;  2B2U C;  3UDX A;  3KF8 B;  5M3F H;  1LAC A;  2G9H D;  2BA1 A;  2PMZ E;  4V0B A;  4DNT B;  1STY A;  3HEJ A;  1ASZ A;  1ENA A;  4DAY B;  1BKB A;  4QY7 A;  3KBG A;  3KLW A;  3H15 A;  5M3M G;  1HA5 A;  1K8G A;  1WCM G;  1RJT A;  1BO0 A;  3TP8 A;  1AN8 A;  2MHV A;  1VQO A;  2E74 C;  2WAC A;  1Q46 A;  4QIW B;  5IGD A;  1A8V A;  2IX3 A;  3I90 A;  1Y1V H;  3B6Y A;  1KDA A;  2F0W A;  2JYO A;  2OT2 A;  5IGB A;  4RHS A;  3OW2 A;  4ZLT F;  4JV5 Q;  2N78 A;  4HIO A;  1LTG D;  3EA6 A;  3DLL A;  3JAM c;  1CA5 A;  4HJ9 A;  3TP6 A;  5M3M B;  1J9O A;  3PO3 B;  1E2W A;  2B8G A;  1XMO L;  3CKI B;  2B63 H;  3FHW A;  3OYY A;  1J5E Q;  3PO3 H;  2UUB Q;  1XXG A;  1SYG A;  4GS3 A;  5CV8 A;  4LF8 Q;  2AQ2 B;  4JI1 L;  3P75 A;  3S17 H;  1TY0 A;  1NY4 A;  4QUF A;  2FXQ A;  1K8A C;  3OMG A;  3PGZ A;  4OXP A;  1NCV A;  4DU9 A;  3NQT A;  4FYD A;  3OTO L;  5M3F B;  1SND A;  3IAY A;  1SMX A;  4ME3 A;  1PFS A;  4RGT A;  2VQF L;  3M7G A;  4DAV A;  4X64 Q;  2CKZ B;  2HUG A;  3HOY B;  3PO2 B;  4JPB W;  5C44 B;  1L0X B;  2C5C A;  3K7A B;  4BY7 G;  4G7Z C;  4C2M B;  1DD2 A;  2F0G A;  3HP3 A;  2RDG A;  4DF7 A;  2NWG A;  1GJX A;  3VA7 A;  2C9O A;  3F2D A;  1JB3 A;  1DM0 B;  1XNQ Q;  1RHP A;  2PO4 A;  4A4I A;  1VQL A;  4F8M A;  3VYR A;  2JA5 G;  1H9R A;  3MEF A;  2L12 A;  4JI1 Q;  5BN3 A;  1Q7Y C;  3H3V I;  1WVL A;  1EIF A;  2NN6 I;  4DR1 Q;  2N8N A;  5E3F A;  4YCV A;  1VQC A;  2WKC A;  3HGB A;  3KFU A;  5D3I B;  3CME A;  1FNW A;  1U5K A;  3M3Y H;  2MP1 A;  3J81 i;  1A2T A;  2R7Z H;  1QJO A;  1C48 A;  3T1H Q;  4NMZ A;  3MXG A;  1I6H H;  2P5Z X;  3D31 A;  4XQJ A;  2KHJ A;  2L5T A;  2F0M A;  1WFQ A;  3MZ5 A;  1I4R A;  1PH6 A;  5C4J H;  2D0P A;  2B2U A;  2LKV A;  1EFI D;  4DR3 Q;  2L0C A;  4A3F G;  2F03 A;  2NUC A;  4OIK A;  2ZXR A;  1KTK A;  1XX8 A;  1AE2 A;  3QOL A;  3T16 A;  1RTO A;  3PUY A;  4IPH A;  1LT6 D;  1BUV T;  1T5X D;  2QCP X;  4PMC A;  3M4P A;  4G57 A;  3V05 A;  1KRS A;  4B9W A;  1QE6 A;  1EZ8 A;  3J81 L;  3HOV B;  1LYL A;  4DV2 L;  3VYU A;  1Y14 B;  4R4C A;  4KKT A;  1FGU A;  1HPC A;  4JK1 C;  1JJG A;  4R4O A;  1ENC A;  4TKO B;  3A74 A;  2IHF A;  4KJN A;  4DUY L;  2E76 C;  4L5S A;  4R4T A;  1J5E L;  3KOJ A;  4NXN L;  4L5R C;  5HUR A;  1XMO Q;  1N8R C;  2F0F A;  3S2D H;  3CCE A;  3HOZ G;  5C3X A;  4KHP Q;  1HNX Q;  1RCV D;  1XTD A;  4KV6 A;  3QG1 A;  4JYA Q;  2F0J A;  4DV4 Q;  1A3V A;  1EEI D;  5CMD A;  1FL0 A;  2DY7 A;  1IKM A;  3CXC A;  2UXB Q;  4A3E H;  1B53 A;  4IUN A;  3HOV G;  3BYY B;  4AYB E;  3PCO B;  5I9O A;  4X3K A;  1KC8 C;  1IYJ B;  4IO9 A;  1B2T A;  2JQO A;  4EGV A;  3G7L A;  1EIY B;  3HOZ H;  2ZJR A;  3JAM i;  2ICE C;  4A3D H;  5GAH C;  5ELO A;  3KDF B;  2A68 C;  3D6W A;  1Q82 C;  4UY8 C;  3QWN A;  4X3S A;  1S3O A;  2ZM6 L;  1NTG A;  1O7Y A;  3K6O A;  3MHB A;  2QDL A;  2K5V A;  1S72 A;  2R7Z B;  1SJH D;  2IPK D;  2ZJQ A;  3ULL A;  4B3S L;  4UP9 A;  5ELE A;  1NUC A;  4GLX A;  2B63 B;  3GTL B;  4K0K L;  1QG7 A;  1ICW A;  2M00 A;  1STG A;  4M1U B;  1X3F A;  4B3R L;  2WB1 G;  4XYQ A;  4A3F H;  1CQV A;  5ISR A;  1WTQ A;  4S3S A;  3A7A B;  5FJ8 H;  5EBC A;  3I2Z A;  3Q8D A;  3U9S A;  2SNM A;  1PZK D;  4F87 A;  3F8T A;  4LFC Q;  2JA8 H;  2A6H D;  2YV5 A;  4LK1 C;  3HOW G;  1LTL A;  1LLR D;  4NXM Q;  2Y0S B;  4GKK Q;  2VQE Q;  3R2I A;  5FLM H;  2MUY A;  2M2L A;  1JWS D;  4A93 H;  4G4K A;  2MNA A;  2EXD A;  4A3L G;  2QDB A;  5CR3 A;  2EQS A;  1VDZ A;  4I7A A;  2RCF A;  1TKW B;  4QUC A;  2EJF C;  4QQB X;  4DUZ L;  1O80 A;  2HDL A;  2WV6 D;  2G5D A;  1N33 L;  5H1S E;  2A6H C;  1NBW A;  1N36 Q;  1CKO A;  1ZEQ X;  2EYM A;  1GXD C;  3S2H B;  1LTR D;  3RLF A;  3BZC A;  3K8A A;  3M4Q A;  2NZO A;  4N9T A;  1VQB A;  5CBE E;  4DN4 M;  2XVS A;  5FKA C;  1VQK A;  3DWP A;  4NB3 A;  1P16 A;  4FP5 D;  1H9S A;  2LXK A;  4OWX B;  1Q12 A;  3NBI A;  1PZI D;  1V8Q A;  5IYC H;  5AJ3 Q;  2WII B;  1A3T A;  2ES2 A;  4YCW A;  3HKZ B;  1PHJ A;  3DEO A;  4L8J A;  4KD3 A;  4IJL A;  1SMY D;  2PZT A;  1E1T A;  5KIX A;  4KHP L;  3HOX H;  1CHP D;  2ZXO A;  3GV3 A;  4NXN Q;  5KGU A;  1K9M C;  1JE4 A;  1TR5 A;  1A15 A;  2K32 A;  4EVO A;  4DV5 Q;  4ALP A;  2B2W C;  2ASB A;  5IOD A;  4LNQ A;  2BDN A;  2PPB C;  2IHE A;  2JXM B;  4J8Q A;  5I6Y A;  3TQY A;  1HR0 L;  4ZUI A;  1STH A;  3KF8 A;  4H02 A;  4BWG B;  5CYU A;  1ML0 D;  4Q0F A;  2I0Q A;  2RBM A;  2L9H A;  2IT1 A;  5DM6 3;  3UE0 A;  3WOE A;  4DR3 L;  4K6D A;  1IW7 D;  2A73 B;  2EYJ A;  3KLS A;  4U68 A;  1PYB A;  1WOC A;  4A3J B;  3S1M H;  3TP7 A;  3P20 A;  2H1E A;  4A3B H;  1SSO A;  1CKM A;  1JOQ A;  3CC4 A;  2F0T A;  1EFW A;  2Z0S A;  4M8A A;  3IRB A;  2NVX B;  2SOB A;  2AHO B;  2F0N A;  2IJ0 A;  3ERQ A;  4ME5 A;  2O5I C;  3GTL H;  4C3H B;  1GOZ A;  2XRQ D;  5HGQ A;  1C4Q A;  1PRT C;  4DR1 L;  1N34 L;  4HID A;  2OXP A;  3VR4 A;  4G7H C;  2VS1 A;  3FKI B;  5IT9 c;  3ULJ A;  1RIP A;  4BY1 H;  2RA4 A;  1IHZ A;  4LF9 L;  1UAP A;  1TWA B;  1K3R A;  2BE5 D;  4IUR A;  1WD0 A;  1I94 Q;  3CP0 A;  5GRO A;  3TN2 A;  4A3K H;  5C4X G;  5D65 A;  5M3F G;  5BN5 A;  4YIJ A;  1KQS A;  3D4R A;  1Q1E A;  1LUZ A;  1C9O A;  2FMM A;  1TWG B;  2H5X A;  4CKB A;  3Q23 A;  3PO2 G;  4DV5 L;  2AMC B;  4DR7 L;  1U4L A;  5A35 A;  1Y1W B;  5K5P A;  3PF5 A;  4IOA A;  4C3H H;  4JI5 Q;  1X9N A;  2XWJ B;  1HCZ A;  2AWO A;  5IP9 G;  3J80 L;  1QZH A;  3FKI G;  5FO8 B;  2A8V A;  1YIT A;  5AJ3 L;  4U67 3;  1GUT A;  2UXD Q;  4N8X 1;  2PQA A;  5K36 G;  1ESR A;  4CHT B;  1E0B A;  2RCN A;  2ENB A;  2R7D A;  4KN4 C;  2M9V A;  4OL7 A;  3H94 A;  1AW7 A;  3HOX G;  3CPW A;  3GP7 A;  2A6E D;  1F9P A;  2B2V A;  2A69 C;  2VUM G;  4R4Q A;  2KCT A;  1WTW A;  5EKL A;  2JK8 A;  1XMQ L;  2PI2 E;  4JOI A;  2OCE A;  4OEL B;  3SR1 A;  2V1C C;  4LAA A;  1B3Q A;  4OON A;  3IL8 A;  2KEN A;  4OWW B;  4EQO A;  3KJO A;  2CH4 A;  3CF5 A;  3W5O A;  3ICE A;  2OF1 A;  2KEE A;  4LFA Q;  5EJW A;  1CZW A;  3HKZ E;  3M4Y A;  3CCV A;  2EY5 A;  1TWC B;  4YHH Q;  4GKK L;  4C2M H;  2YU9 H;  1K83 H;  1YHA A;  3OIP A;  1K3B C;  5KNC A;  1X6O A;  4I65 A;  4K5W A;  2KVM A;  4K5X A;  2K5D A;  5JJZ A;  1GVP A;  1JR0 D;  1PMR A;  2K75 A;  3S1Q B;  4JI7 Q;  2KED A;  2F0S A;  4CBV A;  1FD7 D;  1EIG A;  3L3O C;  2ATW A;  3I55 A;  1QB5 D;  3K0Y A;  4P2C B;  3HOW H;  5FK9 C;  1Y69 U;  4C1N I;  3K57 A;  3QIA A;  1VQJ A;  1ZYR C;  1D7Q A;  4A3M H;  1CA6 A;  1VQE A;  2MFI A;  2J0T D;  4OX9 Q;  3S24 A;  5EPK A;  3T56 B;  1LTS D;  4QIW E;  3A5Z B;  1EQV A;  1SR3 A;  3RZO B;  5JAV A;  2JEB I;  1PZJ D;  2EY6 A;  1ET9 A;  2K52 A;  1OXT A;  3MFG A;  4Y52 H;  4MTK A;  3SK4 A;  2KJX A;  1D2B A;  1F9S A;  5BR8 Q;  3S15 B;  3PSI A;  3K81 C;  2TMP A;  5GQO A;  2NVX H;  1BCP B;  3GDE A;  1A3U A;  2AQ1 B;  1EEF D;  4LJZ C;  3RN2 A;  1BXT A;  1XWE A;  4RHR A;  2F3W A;  3PO2 H;  2IWH A;  3RN5 A;  3VR2 A;  4ZUJ A;  3I4N H;  3GTG B;  1OXV A;  4FNF A;  4NP5 A;  1OO9 B;  1F9R A;  2HQL A;  4YWL A;  2F0V A;  3S1R B;  3BVG A;  1MIU A;  2KEC A;  4DV4 L;  1E24 A;  1PH8 A;  4ZYS A;  4BY1 G;  1KAB A;  1P8L A;  1TII D;  4A3K B;  2XRS D;  1UE7 A;  5F2D A;  2F1M A;  4E6I A;  1EOT A;  1IBK Q;  2PW7 A;  3MTS A;  2OTL A;  4CDF C;  3PUX A;  3KDF A;  4LF7 L;  2JA5 H;  4IAL A;  1HFG A;  3UDF A;  3RMH A;  1Q90 A;  2QW7 A;  3RR5 A;  4LUO A;  4HAE A;  2IW3 A;  1IKL A;  4JI7 L;  4QB4 A;  3WOF A;  3ZJY C;  1GD7 A;  5C5M A;  5C0X G;  4DV0 L;  2XNA C;  1PTO F;  4KTA A;  3K5N A;  4A93 G;  1NAP A;  4A3M B;  5FLM G;  1GM5 A;  2GN5 A;  2OQK A;  2CW0 C;  3E3X A;  3K0X A;  3C46 A;  2F0L A;  2A68 D;  1WTH A;  2EE1 A;  2BE5 C;  4IFD G;  1K28 A;  2IL8 A;  4CDE C;  4X65 L;  5C3W A;  4F88 A;  5ELC A;  4JG2 A;  3JC6 6;  1VQ4 A;  2BOS A;  1H95 A;  1AZP A;  4X3U A;  1X3Q A;  2RDH A;  5CV5 A;  4JOI C;  1QNU A;  3PO3 G;  2K50 A;  2BCO A;  2JA9 A;  3KF6 A;  1IXR A;  4HMI A;  3SHL A;  2FHT A;  4PNY A;  1DCZ A;  2A1A A;  1XYI A;  1Q3L A;  3LX0 A;  1F2Y A;  4A3M G;  4UP7 A;  4IFD H;  1FYC A;  2G9D A;  4RH6 A;  4POF A;  1VQ9 A;  1VQ7 A;  5C4X H;  4A3D G;  1DZ1 A;  1BCP D;  2JA8 B;  1JOK A;  1EQQ A;  1I4H A;  4LUV A;  2UUC Q;  4KLK A;  3M3Y B;  3GD7 A;  2QGQ A;  3F2B A;  5LL6 X;  3M7N A;  3I7F A;  2NVQ B;  4X64 L;  1SE4 A;  3AB9 A;  4IFD I;  4PV1 C;  3KBX A;  2PI2 A;  1YNJ C;  4YY3 Q;  4UDU C;  4IQZ A;  2RKS A;  2K5Q A;  1O7Z A;  1IBL Q;  2JE6 I;  4B3T Q;  2VNU D;  2WAQ G;  2ZT9 C;  4LF8 L;  3Q24 A;  5J1Z A;  2VUM H;  1Y1V B;  3J81 c;  1Y8P B;  2JA8 G;  4O0A A;  4HED A;  3NUC A;  1B70 B;  4DNR B;  5C44 H;  3J80 i;  1II3 A;  1DYQ A;  3J81 j;  3VR6 A;  1YJ9 A;  2KQ3 A;  1L1O C;  4XT1 B;  2SNS A;  2HHH L;  2KHS A;  1T9H A;  4BBS G;  1DOK A;  4A3F B;  1BBW A;  4KHZ A;  2A74 C;  1XJV A;  1EY7 A;  5FLX c;  2B2V C;  4C3H G;  1SE2 A;  4R4I A;  2AWN A;  1ROD A;  4DKA C;  1EY8 A;  4DAP A;  3MEH A;  1YHB A;  4RGN A;  4P74 A;  4Z9C B;  4K2L A;  1WTO A;  4DFA A;  4JI8 Q;  2A19 A;  2Z9H A;  3FVQ A;  4IZ8 A;  1QZG A;  5IYD H;  2DY8 A;  3HS0 C;  1NR4 A;  1HZA A;  1U4P A;  3NWS A;  4JW0 A;  1BCP C;  5IYC G;  5IT9 E;  2RHQ B;  1UE6 A;  1LT5 D;  2EZV A;  4RGM A;  4ZQ3 A;  3HOZ B;  1SE8 A;  2EYP A;  4TVA B;  2EJG C;  1VQH A;  5C5L A;  5FO9 B;  1F2L A;  2ZXP A;  3UDI A;  3EQL C;  2B2T A;  5M5X B;  2GVA A;  4IPD A;  5E4W C;  5LMU Q;  4KN7 C;  4LWC A;  1HUN A;  2CQO A;  1PTO C;  3C1F A;  2Y0S E;  4LF5 Q;  1ENF A;  2UXC Q;  1G2T A;  1A0I A;  1TVX A;  1TS2 A;  4OIJ A;  4HIK A;  2V4D A;  2K33 A;  4GNX A;  2R93 B;  3AU7 A;  3NXW A;  1I6H B;  2O5J C;  3HOX B;  3F2U A;  2F0I A;  4DXG A;  5JJI A;  3GTM H;  3FPU B;  2K14 A;  5G3L D;  4DV3 L;  1I6V C;  4WRD A;  5EPJ A;  3CMA A;  4A3C G;  4XQN A;  1V1P A;  2AKW B;  3MFY A;  3NK9 A;  4AQY L;  5DM7 3;  3V2T A;  4HTH A;  5I2X A;  1ASY A;  4X62 L;  2L4N A;  5GAD C;  3FKI H;  3M9B A;  3J80 E;  3FMC A;  2YYZ A;  3I70 A;  1JOR A;  1EY9 A;  3EFX D;  1VF5 C;  2B63 G;  3A54 A;  3KK7 A;  2Z6B A;  4LFB Q;  1MI2 A;  1H9J A;  3HG9 A;  1EYC A;  2A69 D;  5IGG A;  1PH1 A;  2WB1 B;  2K5N A;  1HA6 A;  2Z4H A;  2NN6 H;  4HCS A;  4BA1 I;  4B3R Q;  4JI3 Q;  1QCB D;  3AFP A;  1GO3 E;  3FEW X;  4K0K Q;  3H3V C;  3CCR A;  4C3J G;  4C3I G;  2LY7 A;  3NE5 B;  3MXP A;  1H9M A;  3TSS A;  1STN A;  5JJL A;  4IUV A;  3HOV H;  1CSP A;  2PNR C;  2NVT H;  2QIL A;  4LFA L;  3IKJ A;  4YWK A;  2KBN A;  5M3M H;  1TWA H;  3IFD A;  1S40 A;  1W6K A;  4ULL A;  1SYC A;  1HZ9 A;  3GTP B;  1Y8O B;  4K14 A;  1D5X C;  5D3D A;  1PVO A;  4QGU A;  1YHQ A;  3DUZ A;  4DV7 Q;  3ND9 A;  2AQ3 B;  4X3T A;  4POG A;  4DPG A;  4B9X A;  5IYD G;  3NQI A;  1STE A;  2HHH Q;  2JJQ A;  3SK6 A;  5M5Y H;  4DXF A;  3IFT A;  4J6H A;  1STB A;  3N6R A;  1QUQ B;  1Q8K A;  2C35 B;  4L5T A;  4KK7 A;  1HNX L;  1XTC D;  3K59 A;  3RNU A;  4JI5 L;  4MTN A;  4WOR A;  4TSS A;  2N49 A;  1CQF A;  2DNE A;  2VZA A;  2CHB D;  4H44 C;  1YJN A;  1TWF H;  3STB D;  1B7Y B;  3CU7 A;  4B3T L;  1AP0 A;  1IBL L;  3AFQ A;  2DNC A;  2BH8 A;  2PQE A;  1RL2 A;  3CCU A;  4FXD A;  1I94 L;  1PA6 A;  1VQ5 A;  1UNS A;  3S9W A;  1HNZ L;  1D8L A;  2JSO A;  1SXT A;  5I4D A;  4BS9 A;  4X66 Q;  3GTM B;  3I4M G;  3QB3 A;  4P71 A;  1KDB A;  3J7A 5;  3A8K E;  3V96 A;  1MSG A;  3CRL C;  3S1N H;  3T1Y L;  2OQ0 A;  5ELF A;  5A2Q L;  2F3I A;  2CH4 W;  2NZ1 D;  1J8I A;  3SE0 A;  4A3E G;  5C3E H;  2VY3 A;  2HD3 A;  2F0D A;  4HJ7 A;  4CGY B;  3JAM L;  2ID0 A;  3H0G G;  1DON A;  2EYO A;  1CSQ A;  1I3Q B;  4UPA A;  3PIO A;  5EKK A;  1EUJ A;  4RAU C;  2HDM A;  3ERO A;  1BF4 A;  2NVT B;  4L63 B;  4R1J A;  3WWV A;  1UEA B;  3QR8 A;  3MAQ A;  1YNN C;  3BJU A;  1YIJ A;  4BBR B;  4JBW A;  3D0F A;  3H6M A;  3I4M B;  1EL0 A;  3BVM A;  1QUQ A;  1S5F D;  1CK1 A;  3X3M A;  1SDF A;  3HOU B;  3TZD A;  4A3D B;  1X65 A;  1PYW D;  3CAM A;  3HKS A;  4FO2 A;  3RUZ A;  5IY0 A;  4WJ4 A;  3AQQ A;  3Q0A A;  2JP1 A;  1G51 A;  4X65 Q;  3ONA B;  1PFN A;  4EQN A;  2F0U A;  3CC2 A;  5HY6 A;  1WI5 A;  1S5D D;  1PV4 A;  3BYT B;  1LTA D;  2RDF A;  2Z1C A;  3TDQ A;  5GAE C;  3EBE A;  4ZRZ A;  4N9P A;  3TS2 A;  4DK3 C;  3OTO Q;  1G2S A;  1PXU A;  1JB7 A;  2I5L X;  5COR A;  4AYB G;  2PZW A;  2KUM A;  3AMU A;  1I4Q A;  2XWB B;  3UI2 A;  2ZTC A;  4HJA A;  5LMN W;  2X6L A;  3DMU A;  2D62 A;  3K7U C;  5C4H A;  2LFN A;  2UUB L;  3AEV A;  1N32 Q;  1GKH A;  2KHI A;  1KLU D;  1IBK L;  1Y1V G;  2NZH A;  3OW7 A;  4MIU A;  4IFD J;  2UU9 Q;  1EIH A;  5J22 A;  1TQO A;  3DWQ A;  2EIF A;  2KCC A;  5CC4 A;  3P7J A;  4GN5 A;  2B8F A;  4PZ7 A;  1X55 A;  2B3G A;  1UE1 A;  4QF4 A;  1YEZ A;  4DR4 Q;  1PRT B;  5T1G A;  2XGT A;  1X3G A;  2BDO A;  3U58 A;  1S4Z A;  3STB C;  4IN3 A;  1A2U A;  4Y7N H;  1GUO A;  3QO2 A;  4RCN A;  2MJ8 A;  4EQP A;  1FR3 A;  5E4X A;  1LTI D;  2E5L L;  4XXE A;  4NW2 A;  1R4Q B;  1BNZ A;  1L1O B;  1W6J A;  5JJK A;  4OX9 L;  3R3O A;  4AIM A;  3ER0 A;  5KNB A;  3LWE A;  4A76 A;  1V43 A;  2Q8R E;  3I4M H;  4JI6 Q;  1UUP A;  2RQX A;  1GUN A;  2NTT A;  5JVG 3;  1NSN S;  2VL6 A;  2E5L Q;  4JC0 A;  1TWF B;  2B2T C;  2Q2T A;  1B44 D;  2E2D C;  1G6Z A;  1EOV A;  3J7Y W;  1AH9 A;  2NYZ D;  1Y1W H;  1V9P A;  3AYH B;  2PQA B;  1BCP F;  4IPC A;  4KHV A;  2D5D A;  3K58 A;  1X32 A;  1HZC A;  3S16 B;  1A62 A;  1M4V A;  3MA2 B;  3OSO A;  4R8N A;  4HSV A;  1OXX K;  4BBS H;  1SAP A;  3HOY H;  1ZKO A;  2O2L D;  4DAY A;  4JBJ A;  2K01 A;  3KLS X;  2Q2H A;  4FVM A;  2K03 A;  2DN8 A;  4R8I A;  4DK1 A;  4RWS C;  3OWF A;  5EAY A;  3CHB D;  3EVQ A;  1L2F A;  5AFW A;  4AH6 A;  3VR5 A;  2E2H H;  1GUG A;  3P1H A;  4BY1 B;  1SYB A;  5C44 G;  2OTJ A;  1KRT A;  1WCM H;  2EXZ A;  4TQU S;  4LF4 Q;  4V19 0;  4JYA L;  1BBX C;  4JI6 L;  3KLR A;  3I91 A;  1XPR A;  3SK8 A;  2L15 A;  4GN4 B;  1EY5 A;  4KJO A;  2HQE A;  1PFB A;  4CJ2 C;  3DHQ A;  3U50 C;  2QEX A;  3BVZ A;  1EU4 A;  3A8I E;  4BA2 I;  5ELD A;  4ZK9 B;  1CUK A;  4CJ1 B;  2K5H A;  3VR3 A;  1CKN A;  3I3C A;  4C1N K;  3E5S A;  5C3E B;  1EWH A;  4HSP A;  3BDO A;  1L1O A;  1S5B D;  2NN6 G;  1A6X A;  3R2T A;  5DEH A;  2GA4 B;  5CV4 A;  4CDC C;  1YNJ D;  1X3P A;  5J3B A;  1PH7 A;  4B3M Q;  4YHH L;  1I4G A;  4C3I H;  4IUQ A;  1G29 1;  3BZK A;  1WTX A;  2ICI A;  2NB0 A;  3EJI A;  1KNE A;  1OXU A;  2VXW A;  4XQQ A;  1K73 C;  1Q1B A;  1PYS B;  2LS0 1;  4NKL A;  5JEA J;  2NBF A;  3NSW A;  5KRU A;  4A75 A;  1AZQ A;  3SDZ A;  1PH3 A;  1PTO H;  3M4O H;  2UU9 L;  1D1I A;  4WJ3 M;  1HTL D;  1WJJ A;  1Q8I A;  4DR6 Q;  1EQR A;  1LT3 D;  3I72 A;  1JT8 A;  1VQI A;  3W3A A;  2NVQ H;  3CCQ A;  1IYU A;  3L2P A;  2JA7 G;  3S1R H;  4K8I A;  3PIP 3;  1CT1 D;  1J6Q A;  1L0Y B;  1NE3 A;  3KUP A;  3GTG H;  3HOU H;  1T5E A;  2BA0 A;  4EX5 A;  4FF3 A;  1BBU A;  2E8G A;  2EYF A;  1MJE A;  3HFZ B;  4X6A H;  3E9I A;  4GOP B;  1PH5 A;  5IT9 L;  1HXY D;  1SNM A;  1WYD A;  1B4O A;  4LF6 Q;  1B8A A;  3T1Y Q;  3ERS X;  3PQI A;  1R4P B;  2K1B A;  2R7F A;  1SFO B;  3I8Z A;  4DR7 Q;  3W1B A;  1TWC H;  4OWT B;  5LHY 1;  3I4L A;  2EYH A;  3Q6S A;  1L0W A;  3MXN A;  2F52 A;  3NWT A;  4A3B G;  3VYT A;  4MHE A;  2R6G A;  5CV6 A;  3L7Z C;  2JA7 B;  5IP7 H;  2E75 C;  3H0G H;  1C0A A;  4A3J H;  3S1M B;  4I7Z C;  1HZB A;  2F4V Q;  3PIP A;  1EY4 A;  2SDF A;  4N8F A;  3DM3 A;  4KY5 A;  2J7Z A;  4GOP A;  2Z4I A;  1FJG Q;  2K7V A;  3D4W A;  3FP9 A;  1OXS C;  1B9N A;  2TSS A;  1KHI A;  1VQ6 A;  5C4Z A;  2EPB A;  3U9O A;  1HH2 P;  1ILQ A;  2Q2I A;  3NEM A;  4A3B B; 
#chains in the Genus database with same CATH homology
 3JAM E;  5JEA H;  3R93 A;  4FXK C;  2NTS A;  3DM1 A;  1ONL A;  5DAU A;  4QMG A;  2F0E A;  2AUK A;  4IUP A;  3QJY A;  1E2V A;  5KND A;  1S5C D;  5EPL A;  5KEE A;  3BZD B;  3NTH A;  4DGZ A;  1STA A;  1FNV A;  2N88 A;  2E2J B;  5KYI A;  3VA5 A;  4KMU C;  2F0O A;  5I6W A;  5A2Q E;  1TU2 B;  2K6A A;  3A8J E;  2K28 A;  3D3R A;  5KYL A;  2B2Y A;  1IL8 A;  1JIC A;  1DOM A;  4XIG S;  3O13 A;  2VB2 X;  5IIF A;  4KY6 A;  1EY0 A;  5T1I A;  2A5H A;  4HCE A;  2XSC A;  1PFM A;  3MWY W;  4B08 A;  1VMP A;  3TP5 A;  3PV0 A;  4ZKC B;  1ZXT A;  1IYV A;  1CM9 A;  1KAA A;  3T51 B;  1C8C A;  1TS3 A;  3TME A;  2EY1 A;  1EQT A;  1TS5 A;  3MC0 B;  4A3G B;  5JEA G;  5DNF A;  4FF4 A;  2YU9 B;  1AFP A;  2HCC A;  1G91 A;  3T53 B;  5C6A A;  2KCN A;  2F0Q A;  4CKE A;  1TWH B;  4CJ0 B;  2F4I A;  2B2W A;  4CKC A;  4C3J B;  3ND8 A;  1DOL A;  3LWU A;  2X6G A;  3J81 E;  1CZG A;  4TRD A;  3Q22 A;  4ILW A;  1BQQ T;  1GHK A;  3M4O B;  5LL6 S;  3M85 A;  2EOT A;  4PQX A;  3NTK A;  1HUM A;  1PDQ A;  4WFN 3;  1H9K A;  2WIN B;  5CBA E;  1HTP A;  1TS4 A;  2J4X A;  4F7X A;  5C4X B;  1YNN D;  3E0J A;  1R9T B;  2QKI C;  1ZYR D;  2PYK A;  4OGQ C;  5E1F A;  1LTT D;  5JVH 3;  1SYF A;  2EYL A;  3DXJ C;  4IUU A;  3CQZ B;  1MGS A;  2R3Z A;  1GUW A;  2L1B A;  3OMC A;  2I46 A;  1Y8N B;  3ITP A;  1M8A A;  1U9R A;  4R9W A;  3PUV A;  5I9P A;  1Z47 A;  4ID6 A;  1QWY A;  1SNQ A;  1EY6 A;  4KY7 A;  1G8Z D;  2QF7 A;  3OIQ A;  2VUM B;  1TT2 A;  1KNA A;  1RTN A;  2NVY B;  3A56 A;  3I4N B;  5HGT A;  4A3E B;  2CVR A;  3G6J B;  1Z7T A;  4FXG C;  2MPM A;  2KOL A;  3H0G B;  2F3V A;  2X69 A;  3DEP A;  5M9O A;  1D5Z C;  2D2C C;  3GTO B;  1FGB D;  1D6E C;  5I2Y A;  2JA5 B;  5FOB B;  3T4A C;  5J39 A;  1JQY D;  1EYA A;  1D5M C;  4A93 B;  2MGS A;  4RKB A;  3FPP A;  2K04 A;  2PMZ B;  4K8J A;  3GTJ B;  1HRJ A;  4H7B A;  5K36 H;  4KKS A;  3BDC A;  5FO7 B;  1QIL A;  3J7A V;  4Y7N B;  2H4O A;  1LTB D;  1MBY A;  2LMC B;  1S5E D;  1HFN A;  3W2D A;  4UAI A;  2PZU A;  3GO5 A;  3WDN A;  3D6C A;  4HN7 A;  4ZAI A;  4FF1 A;  1PLF A;  3ZYY X;  4DK0 A;  5EBD A;  1LO5 D;  3RD4 A;  3K5M A;  1SNP A;  3S14 B;  4OO1 G;  1RDP D;  4GZY C;  2K5W A;  4AYB B;  1E2Z A;  1PRT D;  1SBB B;  1PTO B;  1CI3 M;  3J7A F;  1CHQ D;  5JOB A;  3K5O A;  3NHH A;  3SXH A;  1EZ6 A;  2PCF B;  4ABN A;  4HR7 B;  1EYD A;  1HHV A;  1IW7 C;  4MN3 A;  3BG3 A;  5EQ0 A;  1F77 A;  2PW5 A;  4IUT A;  5COY A;  2WAQ B;  1SEB D;  1V1O A;  3DWA A;  1BDO A;  5EKI A;  3S2D B;  4LMQ D;  2R92 B;  2IX0 A;  2OEO A;  2B2Y C;  4KI0 A;  3S17 B;  3NTI A;  4KKU A;  1SMY C;  5CV9 A;  1JOO A;  3C2P A;  5CGK A;  4BBS B;  4O1N A;  2RSO A;  4OO1 H;  1PTO D;  4WJW A;  5C0X J;  4XYO A;  1B9M A;  1HQM C;  2VB3 X;  1WCM B;  5C4J B;  3QOJ A;  2N55 A;  5M5W B;  1LAB A;  4J1M A;  5IOC A;  2IX1 A;  2O4X A;  2FJ2 A;  2JA6 B;  4PMB A;  3HOW B;  3D8G A;  4OO1 I;  2EDG A;  1RF2 D;  4PMW A;  2FMC A;  4RA8 A;  3NPP A;  2RVL A;  3MVV A;  1VCI A;  3I73 A;  4K5V A;  1MSH A;  2K05 A;  3LNN A;  2L11 A;  1SJE D;  3PIO 3;  1K8O A;  2HCI A;  2JEA I;  4RFB A;  3C3L A;  1DXM A;  3D4D A;  3NBH A;  3OPO A;  2Q8I B;  2FFK B;  3C1E A;  5NUC A;  1VF7 A;  1HQR D;  1CTM A;  3FRP B;  1DJR D;  1JC7 A;  3K5L A;  1F2Z A;  4BY7 B;  3T13 A;  4K2K A;  3HRZ C;  4H13 C;  2F0H A;  5CV7 A;  4L6T B;  2I07 B;  1BOS A;  1O7L A;  1QOH A;  3HZX A;  5BN4 A;  1SE3 A;  2Q8T A;  4KD4 A;  4K6L A;  3OHX C;  3OWE B;  4A3I B;  1ET6 A;  1B3A A;  1WD1 A;  3GQB A;  2E2H B;  4C3I B;  1JCK B;  3A55 A;  5TSS A;  5IGF A;  3CRK C;  3OOC A;  3SEB A;  4ODG A;  3N52 A;  1NR2 A;  5C0X H;  2QEJ C;  2EJM A;  1K83 B;  1FNU A;  2CQA A;  2B39 A;  3NP8 A;  1SNC A;  3MXU A;  1SNO A;  1RKN A;  1U4R A;  1MD2 D;  3R8B A;  1Z6H A;  5ELB A;  4QCL A;  2XN9 C;  2CW0 D;  1WTP A;  4HMJ A;  5JPM C;  1GUS A;  1AEX A;  2EVB A;  5EGT A;  1F9Q A;  3URY A;  3VYS A;  1WTR A;  5C0X I;  2L55 A;  4RKL A;  1KLG D;  4G7O C;  4XTC S;  4OHJ A;  3PMF A;  3GV6 A;  5G3L F;  5JPN C;  1I4P A;  1RD9 D;  2EY2 A;  3TBI B;  2SEB D;  2F0P A;  3SK5 A;  3BS1 A;  4DA2 A;  1D1K A;  1I50 B;  4RCO A;  4XT3 B;  3TZU A;  1EU3 A;  2E2I B;  1SYE A;  4H0L C;  4Q5V A;  5FLX L;  1ILP A;  4ZKB B;  5IGC A;  1ESF A;  1PRT F;  5IGE A;  3GTQ B;  1LV9 A;  3FDT A;  3PUZ A;  1BR9 A;  3PUW A;  2F0K A;  1SYD A;  3SVM A;  3GTK B;  1U4M A;  3E6Z X;  1LT4 D;  1TY2 A;  4XDX A;  1EWC A;  3A7L A;  4FF2 A;  2D9U A;  4NDX A;  2XIW A;  3BDL A;  3H09 A;  1KDC A;  3X3N A;  1K8M A;  4O42 A;  1F2M A;  2AUJ D;  1JWM D;  3L9A X;  2KA7 A;  4C56 C;  1B50 A;  2R61 A;  1O78 A;  1H9S B;  1B1Z A;  1GHJ A;  2Z8L A;  2RSN A;  5FLX E;  1JWU D;  1CFM A;  1QNK A;  1WTV A;  4RGO S;  5M5Y B;  1VMC A;  3H91 A;  2WP8 J;  3RZD B;  1V1P B;  1I4X A;  2A6E C;  5D14 A;  2WKD A;  3S1N B;  2FIN B;  2B2U C;  1LAC A;  2G9H D;  2BA1 A;  4V0B A;  4DNT B;  1STY A;  3HEJ A;  1ENA A;  3KBG A;  1HA5 A;  1RJT A;  1BO0 A;  3TP8 A;  1AN8 A;  2MHV A;  2E74 C;  2WAC A;  4QIW B;  5IGD A;  2IX3 A;  3I90 A;  1KDA A;  2F0W A;  2JYO A;  2OT2 A;  5IGB A;  4RHS A;  4ZLT F;  1LTG D;  3EA6 A;  1CA5 A;  3TP6 A;  5M3M B;  1J9O A;  3PO3 B;  1E2W A;  2B8G A;  3CKI B;  1XXG A;  1SYG A;  5CV8 A;  2AQ2 B;  3P75 A;  1TY0 A;  4QUF A;  3OMG A;  1NCV A;  4DU9 A;  3NQT A;  4FYD A;  5M3F B;  1SND A;  3IAY A;  4RGT A;  3M7G A;  4DAV A;  2HUG A;  3HOY B;  3PO2 B;  5C44 B;  1L0X B;  2C5C A;  3K7A B;  4G7Z C;  4C2M B;  1DD2 A;  2F0G A;  3HP3 A;  2RDG A;  4DF7 A;  2NWG A;  1GJX A;  3VA7 A;  2C9O A;  1JB3 A;  1DM0 B;  1RHP A;  2PO4 A;  4F8M A;  3VYR A;  1H9R A;  5BN3 A;  2L12 A;  1WVL A;  2NN6 I;  5E3F A;  2WKC A;  3HGB A;  5D3I B;  1FNW A;  2MP1 A;  1A2T A;  1QJO A;  1C48 A;  4NMZ A;  3MXG A;  3D31 A;  4XQJ A;  2L5T A;  2F0M A;  3MZ5 A;  1I4R A;  2B2U A;  2LKV A;  1EFI D;  2L0C A;  2F03 A;  2NUC A;  4OIK A;  2ZXR A;  1KTK A;  1XX8 A;  3QOL A;  3T16 A;  1RTO A;  3PUY A;  1LT6 D;  1BUV T;  1T5X D;  2QCP X;  4PMC A;  4G57 A;  3V05 A;  4B9W A;  1QE6 A;  1EZ8 A;  3J81 L;  3HOV B;  3VYU A;  4KKT A;  1HPC A;  4JK1 C;  1ENC A;  4TKO B;  4KJN A;  2E76 C;  5HUR A;  2F0F A;  5C3X A;  1RCV D;  4KV6 A;  3QG1 A;  2F0J A;  1A3V A;  1EEI D;  5CMD A;  2DY7 A;  1IKM A;  1B53 A;  4IUN A;  3BYY B;  5I9O A;  4X3K A;  1B2T A;  4EGV A;  3G7L A;  2ICE C;  2A68 C;  3D6W A;  3QWN A;  4X3S A;  1O7Y A;  3K6O A;  3MHB A;  2R7Z B;  1SJH D;  2IPK D;  5ELE A;  1NUC A;  2B63 B;  3GTL B;  1QG7 A;  1ICW A;  2M00 A;  1STG A;  4M1U B;  4XYQ A;  1CQV A;  5ISR A;  1WTQ A;  4S3S A;  3A7A B;  5EBC A;  3U9S A;  2SNM A;  1PZK D;  4F87 A;  2A6H D;  4LK1 C;  1LLR D;  2Y0S B;  3R2I A;  2MUY A;  2M2L A;  1JWS D;  4G4K A;  2QDB A;  5CR3 A;  1VDZ A;  1TKW B;  4QUC A;  2EJF C;  1O80 A;  2HDL A;  2WV6 D;  2A6H C;  1ZEQ X;  2EYM A;  1GXD C;  3S2H B;  1LTR D;  3RLF A;  4N9T A;  5CBE E;  4DN4 M;  2XVS A;  5FKA C;  3DWP A;  4FP5 D;  1H9S A;  1Q12 A;  3NBI A;  1PZI D;  1V8Q A;  2WII B;  1A3T A;  3HKZ B;  3DEO A;  4L8J A;  4KD3 A;  1SMY D;  2PZT A;  5KIX A;  1CHP D;  2ZXO A;  3GV3 A;  5KGU A;  1JE4 A;  1TR5 A;  1A15 A;  2K32 A;  4EVO A;  2B2W C;  5IOD A;  2BDN A;  2PPB C;  2JXM B;  4J8Q A;  5I6Y A;  4ZUI A;  1STH A;  3KF8 A;  4BWG B;  5CYU A;  1ML0 D;  4Q0F A;  2RBM A;  2L9H A;  2IT1 A;  5DM6 3;  3WOE A;  4K6D A;  1IW7 D;  2A73 B;  2EYJ A;  3KLS A;  4U68 A;  4A3J B;  3TP7 A;  3P20 A;  2H1E A;  1SSO A;  1JOQ A;  2F0T A;  4M8A A;  2NVX B;  2SOB A;  2F0N A;  2IJ0 A;  3ERQ A;  4ME5 A;  2O5I C;  4C3H B;  1GOZ A;  2XRQ D;  1C4Q A;  1PRT C;  2OXP A;  3VR4 A;  4G7H C;  3FKI B;  2RA4 A;  1IHZ A;  1UAP A;  1TWA B;  2BE5 D;  4IUR A;  1WD0 A;  3TN2 A;  5D65 A;  5BN5 A;  4YIJ A;  3D4R A;  1Q1E A;  2FMM A;  1TWG B;  4CKB A;  3Q23 A;  1U4L A;  5A35 A;  1Y1W B;  5K5P A;  2XWJ B;  1HCZ A;  2AWO A;  3J80 L;  5FO8 B;  4U67 3;  1GUT A;  5K36 G;  1ESR A;  4CHT B;  1E0B A;  2ENB A;  4KN4 C;  2M9V A;  4OL7 A;  3H94 A;  1AW7 A;  3GP7 A;  2A6E D;  1F9P A;  2B2V A;  2A69 C;  1WTW A;  5EKL A;  3SR1 A;  4LAA A;  3IL8 A;  4EQO A;  2OF1 A;  2KEE A;  5EJW A;  1CZW A;  3M4Y A;  2EY5 A;  1TWC B;  3OIP A;  5KNC A;  4K5W A;  4I65 A;  2KVM A;  4K5X A;  2K5D A;  5JJZ A;  1JR0 D;  1PMR A;  3S1Q B;  2KED A;  2F0S A;  4CBV A;  1FD7 D;  1EIG A;  3L3O C;  1QB5 D;  3K0Y A;  4P2C B;  5FK9 C;  1Y69 U;  4C1N I;  3K57 A;  3QIA A;  1ZYR C;  1CA6 A;  2J0T D;  5EPK A;  3T56 B;  1LTS D;  1EQV A;  3RZO B;  5JAV A;  2JEB I;  1PZJ D;  2EY6 A;  1ET9 A;  1OXT A;  3MFG A;  3SK4 A;  2KJX A;  1D2B A;  1F9S A;  3S15 B;  2TMP A;  1BCP B;  1A3U A;  2AQ1 B;  1EEF D;  4LJZ C;  1BXT A;  1XWE A;  4RHR A;  2F3W A;  2IWH A;  3VR2 A;  4ZUJ A;  3GTG B;  1OXV A;  4FNF A;  4NP5 A;  1OO9 B;  1F9R A;  2F0V A;  3S1R B;  3BVG A;  2KEC A;  4ZYS A;  1KAB A;  1TII D;  4A3K B;  2XRS D;  5F2D A;  2F1M A;  4E6I A;  1EOT A;  2PW7 A;  3MTS A;  3PUX A;  4IAL A;  1HFG A;  3RMH A;  1Q90 A;  4HAE A;  2IW3 A;  1IKL A;  4QB4 A;  3WOF A;  5C5M A;  5C0X G;  2XNA C;  1PTO F;  4KTA A;  3K5N A;  1NAP A;  4A3M B;  2CW0 C;  3C46 A;  2F0L A;  2A68 D;  2EE1 A;  2BE5 C;  4IFD G;  2IL8 A;  5C3W A;  4F88 A;  5ELC A;  2BOS A;  1AZP A;  4X3U A;  1X3Q A;  2RDH A;  5CV5 A;  1QNU A;  2BCO A;  4HMI A;  3SHL A;  2FHT A;  4PNY A;  1DCZ A;  1XYI A;  1Q3L A;  3LX0 A;  1F2Y A;  4IFD H;  1FYC A;  2G9D A;  4RH6 A;  1DZ1 A;  1BCP D;  2JA8 B;  1JOK A;  1I4H A;  3M3Y B;  3GD7 A;  5LL6 X;  3M7N A;  2NVQ B;  1SE4 A;  3AB9 A;  4IFD I;  4PV1 C;  3KBX A;  1YNJ C;  4UDU C;  4IQZ A;  2RKS A;  2K5Q A;  1O7Z A;  2JE6 I;  2VNU D;  2ZT9 C;  3Q24 A;  5J1Z A;  1Y1V B;  1Y8P B;  4HED A;  3NUC A;  4DNR B;  1II3 A;  1DYQ A;  3VR6 A;  2KQ3 A;  4XT1 B;  2SNS A;  2KHS A;  1DOK A;  4A3F B;  4KHZ A;  2A74 C;  1EY7 A;  2B2V C;  4C3H G;  1SE2 A;  2AWN A;  1ROD A;  1EY8 A;  4DAP A;  3MEH A;  4RGN A;  4Z9C B;  4K2L A;  1WTO A;  4DFA A;  4IZ8 A;  3FVQ A;  2DY8 A;  3HS0 C;  1NR4 A;  1U4P A;  3NWS A;  1BCP C;  5IT9 E;  1LT5 D;  2EZV A;  4RGM A;  4ZQ3 A;  3HOZ B;  2EYP A;  5C5L A;  2EJG C;  5FO9 B;  1F2L A;  2ZXP A;  3EQL C;  2B2T A;  5M5X B;  5E4W C;  4KN7 C;  1HUN A;  1PTO C;  3C1F A;  1ENF A;  1G2T A;  1TS2 A;  1TVX A;  4OIJ A;  2V4D A;  2K33 A;  2R93 B;  3AU7 A;  3NXW A;  1I6H B;  2O5J C;  3HOX B;  3F2U A;  2F0I A;  4DXG A;  3FPU B;  5G3L D;  1I6V C;  4WRD A;  5EPJ A;  4XQN A;  1V1P A;  3MFY A;  3NK9 A;  5DM7 3;  3V2T A;  4HTH A;  5I2X A;  2L4N A;  3J80 E;  3FMC A;  2YYZ A;  3I70 A;  1JOR A;  1EY9 A;  3EFX D;  1VF5 C;  3A54 A;  3KK7 A;  1MI2 A;  1H9J A;  3HG9 A;  1EYC A;  2A69 D;  5IGG A;  2WB1 B;  1HA6 A;  2Z4H A;  2NN6 H;  4HCS A;  4BA1 I;  1QCB D;  3FEW X;  3H3V C;  4C3J G;  4C3I G;  2LY7 A;  3NE5 B;  3MXP A;  1H9M A;  3TSS A;  1STN A;  4IUV A;  2PNR C;  2QIL A;  3IKJ A;  3IFD A;  1W6K A;  4ULL A;  1SYC A;  3GTP B;  1Y8O B;  4K14 A;  1D5X C;  5D3D A;  3DUZ A;  3ND9 A;  2AQ3 B;  4X3T A;  4B9X A;  3NQI A;  1STE A;  3SK6 A;  4DXF A;  3IFT A;  4J6H A;  1STB A;  3N6R A;  4KK7 A;  1XTC D;  3K59 A;  4WOR A;  4TSS A;  1CQF A;  2DNE A;  2CHB D;  4H44 C;  3CU7 A;  1AP0 A;  2DNC A;  2PQE A;  4FXD A;  1UNS A;  3S9W A;  2JSO A;  1SXT A;  5I4D A;  4BS9 A;  3GTM B;  3QB3 A;  1KDB A;  3A8K E;  3V96 A;  1MSG A;  3CRL C;  5ELF A;  5A2Q L;  2NZ1 D;  1J8I A;  3SE0 A;  2F0D A;  4CGY B;  3JAM L;  2ID0 A;  1DON A;  2EYO A;  1I3Q B;  5EKK A;  4RAU C;  2HDM A;  3ERO A;  1BF4 A;  2NVT B;  4L63 B;  1UEA B;  3MAQ A;  1YNN C;  4BBR B;  4JBW A;  3H6M A;  3I4M B;  1EL0 A;  3BVM A;  1S5F D;  1CK1 A;  3X3M A;  1SDF A;  3HOU B;  3TZD A;  4A3D B;  1PYW D;  4FO2 A;  3RUZ A;  3Q0A A;  2JP1 A;  3ONA B;  1PFN A;  4EQN A;  2F0U A;  1S5D D;  3BYT B;  1LTA D;  2RDF A;  2Z1C A;  3TDQ A;  4ZRZ A;  4N9P A;  1G2S A;  1PXU A;  5COR A;  2PZW A;  2KUM A;  3AMU A;  1I4Q A;  2XWB B;  3UI2 A;  2X6L A;  3DMU A;  2D62 A;  5C4H A;  2LFN A;  1KLU D;  3OW7 A;  4MIU A;  4IFD J;  1EIH A;  5J22 A;  1TQO A;  3DWQ A;  2KCC A;  5CC4 A;  3P7J A;  2B8F A;  4QF4 A;  1PRT B;  5T1G A;  2BDO A;  1S4Z A;  4IN3 A;  1A2U A;  1GUO A;  3QO2 A;  4RCN A;  2MJ8 A;  4EQP A;  1FR3 A;  5E4X A;  1LTI D;  4XXE A;  4NW2 A;  1R4Q B;  1BNZ A;  1W6J A;  3R3O A;  5KNB A;  3LWE A;  1V43 A;  2Q8R E;  1UUP A;  2RQX A;  1GUN A;  2NTT A;  5JVG 3;  1NSN S;  1TWF B;  2B2T C;  1B44 D;  2E2D C;  1G6Z A;  3J7Y W;  2NYZ D;  1BCP F;  4KHV A;  2D5D A;  3K58 A;  1X32 A;  3S16 B;  1M4V A;  3MA2 B;  3OSO A;  4R8N A;  4HSV A;  1OXX K;  1SAP A;  1ZKO A;  2O2L D;  4DAY A;  2K01 A;  3KLS X;  4FVM A;  2K03 A;  2DN8 A;  4R8I A;  4DK1 A;  4RWS C;  3OWF A;  3CHB D;  3EVQ A;  5AFW A;  3VR5 A;  1GUG A;  3P1H A;  4BY1 B;  1SYB A;  2EXZ A;  4TQU S;  4V19 0;  1BBX C;  3KLR A;  3I91 A;  3SK8 A;  1EY5 A;  4KJO A;  2HQE A;  1PFB A;  4CJ2 C;  3DHQ A;  3BVZ A;  1EU4 A;  3A8I E;  4BA2 I;  5ELD A;  4ZK9 B;  4CJ1 B;  3VR3 A;  3I3C A;  4C1N K;  3E5S A;  5C3E B;  1EWH A;  4HSP A;  3BDO A;  1S5B D;  2NN6 G;  1A6X A;  3R2T A;  5DEH A;  2GA4 B;  5CV4 A;  1YNJ D;  1X3P A;  1I4G A;  4IUQ A;  1G29 1;  1WTX A;  2ICI A;  2NB0 A;  3EJI A;  1KNE A;  1OXU A;  2VXW A;  4XQQ A;  1Q1B A;  5JEA J;  2LS0 1;  4NKL A;  2NBF A;  3NSW A;  5KRU A;  1AZQ A;  3SDZ A;  1PTO H;  1D1I A;  1HTL D;  1Q8I A;  1LT3 D;  3I72 A;  3W3A A;  1IYU A;  4K8I A;  3PIP 3;  1CT1 D;  1L0Y B;  3KUP A;  1T5E A;  2BA0 A;  4FF3 A;  2EYF A;  5IT9 L;  1HXY D;  1SNM A;  1B4O A;  1R4P B;  2K1B A;  1SFO B;  3I8Z A;  5LHY 1;  3I4L A;  2EYH A;  3Q6S A;  3MXN A;  3NWT A;  3VYT A;  4MHE A;  2R6G A;  5CV6 A;  3L7Z C;  2JA7 B;  2E75 C;  3S1M B;  4I7Z C;  1EY4 A;  2SDF A;  4KY5 A;  2J7Z A;  2Z4I A;  2K7V A;  3D4W A;  1OXS C;  1B9N A;  2TSS A;  5C4Z A;  2EPB A;  3U9O A;  1ILQ A;  4A3B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...