4CJ0B

Crystal structure of celd in complex with affitin e12
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
60
Chain Sequence
b'VKVKFVSSGEEKEVDTSKIKKVWRNLTKYGTIVQFTYDGRGYVRELDAPKELLDMLARAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE D
publication title Potent and Specific Inhibition of Glycosidases by Small Artificial Binding Proteins (Affitins)
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase/de novo protein
total genus 10
structure length 60
sequence length 65
ec nomenclature
pdb deposition date 2013-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cj0B00
1B3AA 1NCVA 2B2VC 1IL8A 1EIGA 3F2UA 4XT3B 1XX8A 5EPKA 2Q8TA 1O7ZA 2X6LA 5T1GA 1QG7A 2L1BA 1CM9A 4HAEA 4X3TA 1WTQA 4R8IA 1ICWA 2DY8A 2HCIA 1RODA 1BF4A 1EL0A 2KEDA 1PFMA 1ZXTA 2MGSA 3P7JA 2L12A 2RA4A 4OIJA 1HFNA 4HEDA 1EOTA 2K01A 1NAPA 5CBEE 1HUMA 1U4LA 2K04A 3FDTA 3I90A 4RA8A 1F9PA 2B2UA 5CORA 1IKLA 4R9WA 2JYOA 2B2WA 1BNZA 1HHVA 1WTWA 1U4PA 1DOKA 3TZDA 3TN2A 5CBAE 2NZ1D 3I91A 2MPMA 3G7LA 2KUMA 2HUGA 2EPBA 4IURA 2KECA 1MI2A 1ILQA 1F2LA 2EOTA 2RSOA 4DN4M 2J7ZA 1RTNA 2K03A 1F9QA 2KEEA 1G2SA 1O7YA 1CA5A 3SVMA 1LV9A 2B2UC 2NYZD 3H91A 2K28A 4LMQD 3IFDA 3I3CA 1NR2A 1U4RA 2KOLA 2R3ZA 4ZKCB 3DEPA 1VMPA 4ZKBB 1J9OA 5EPJA 1XYIA 1B50A 1WTOA 1WD0A 4ZLTF 4HCSA 3HP3A 1HRJA 2RVLA 3R93A 1MSHA 1DOLA 2XIWA 1G91A 3IL8A 1HA6A 1C8CA 4HSVA 1AZPA 1TVXA 2D9UA 4NW2A 1EIHA 2K05A 1QE6A 4ZK9B 1EQTA 1PDQA 1G6ZA 1F9RA 1JE4A 5COYA 1CA6A 2N55A 3Q6SA 4X3KA 5D14A 2SDFA 2NWGA 5T1IA 1ESRA 2RSNA 1J8IA 1A15A 1B4OA 2K1BA 1WD1A 1PLFA 1RHPA 1SAPA 3KBXA 1E0BA 1JICA 1KNAA 1PFBA 3GV3A 2DY7A 3MTSA 4UAIA 1WTXA 1G2TA 1DZ1A 2HDLA 2X69A 2B2WC 1M8AA 4ZAIA 3D6WA 4CJ2C 1RTOA 4CJ1B 2L4NA 4IUQA 2HDMA 2FJ2A 1X3PA 2KVMA 1QNKA 4XDXA 4O42A 5EKIA 4CJ0B 5JJZA 2B2VA 1SSOA 3UI2A 1WTRA 3QO2A 5DNFA 5EPLA 1X32A 5D65A 2IL8A 2VXWA 4U68A 2BDNA 3GV6A 1HUNA 1B53A 1PFNA 3DEOA 5E4WC 1DOMA 2FMMA 2L9HA 1VMCA 1BBXC 1O80A 2MJ8A 2EE1A 3FPUB 5E4XA 2B2YA 2N88A 2JP1A 1F9SA 4IUPA 4XT1B 4MN3A 4QUFA 2X6GA 5CMDA 4RWSC 1SDFA 1NR4A 3N52A 5AFWA 3I8ZA 3ONAB 2FFKB 1DONA 1ML0D 1WTPA 1RJTA 1WTVA 2FINB 3KUPA 2B2TA 1AZQA 4IUVA 3MWYW 2FHTA 1S4ZA 1MSGA 2CVRA 4X3UA 1HFGA 1GUWA 1IKMA 1BO0A 1KNEA 4MHEA 4OIKA 2B2YC 2MP1A 3DM1A 4IUTA 4RAUC 1ILPA 1AP0A 1U4MA 1B2TA 2HCCA 3LWEA 1X3QA 2B2TC 1WVLA 2M2LA 4QUCA 1MGSA 5EQ0A 4X3SA 2L11A 4IUUA 1Q3LA 5EJWA 2H1EA 2Q8RE
chains in the Genus database with same CATH superfamily
2F0JA 3NELA 4I7ZC 2BDOA 5GADC 4K14A 1KAWA 4R8IA 2JEAI 3D4DA 3CCMA 2KEDA 2HQLA 3AB9A 4G4KA 2K01A 4L8JA 2O5IC 4FF4A 2NVYH 2PYKA 3I90A 1F9PA 4IO9A 2UUCQ 2K5WA 3D4WA 5ELBA 4PZ6A 2UXDQ 1UWVA 1JQYD 4GKKL 3VR6A 3X3NA 2K50A 1CSPA 1I4GA 1KABA 1MI2A 2B8GA 3RZDB 1CQFA 4P73A 2I5HA 3LX0A 1LV9A 3TREA 3GTOB 2BA0A 3I3CA 4BBSB 3TMEA 2R3ZA 1AH9A 1H9SA 1B50A 2DN8A 1VQDA 4BY1G 4CKEA 3T1HL 3BDCA 1EY5A 3BDLA 1U5KA 4CHTB 3ERQA 5IGCA 3U9OA 2Q2HA 3U4VA 2OXPA 1L0WA 1CKMA 2IX1A 1P16A 3TS2A 4WRDA 1WTHA 1XPRA 5CYUA 5EKLA 4GS3A 4DR5Q 2BH8A 3E9HA 4ZAIA 4A3BG 5GAHC 1EIYB 5ELCA 5IIFA 4JI7L 3CF5A 1QNKA 2PNRC 2ICIA 4XQQA 1EY8A 2E2IB 4EQOA 3PO3G 2VXWA 4U68A 2XNAC 1QUQA 3T16A 3DEOA 1WCMB 1BBXC 1IBKQ 1O80A 4K0KL 5FOBB 4GLAC 2F1MA 4GLXA 2YTXA 4PZ7A 1ZYRD 2MQHA 1DGSA 2F0FA 1A0IA 2B63G 3E9IA 4CKBA 4EX5A 4KY6A 3GTJB 3CCVA 4GKJQ 4Q5VA 3L2PA 4RKBA 3D8GA 4IUTA 4LF7L 5DAUA 4LAAA 5JPMC 1Q82C 1B2TA 4K8IA 4A3KH 1XNQQ 1SNMA 4L5RC 1I3QB 4HJ5A 5IGBA 5EQ0A 2O5JC 1UAPA 1G8ZD 4DV6Q 1LTTD 4LF6L 4XT3B 3SDZA 2Q8TA 2X6LA 3PUVA 3KLSA 3FRPB 2NVXH 1TXYA 3M4OB 3A54A 2NVQH 3HKZG 4DR4L 1Y1WB 2ZTDA 4HIKA 2PPBC 3SK4A 3S16H 1Y69U 3ZJYC 3G7LA 1SROA 3OIPA 4DN4M 1XMOQ 2VZAA 3TDQA 4JOIC 1E1TA 5I2XA 2KOLA 4LF9Q 1LABA 2A69C 4AYBG 4RGTA 5M3FG 5FLMH 2KJXA 2A68D 2CWAA 5CC4A 5EKKA 1K73C 2YU9B 1AN8A 1IXRA 1EQTA 2F0OA 4APVA 4OWTB 3HOUH 2OTJA 4YY3Q 5IWAL 1C0AA 2NUCA 1FNVA 2RSNA 1FD7D 1K3RA 3A0JA 1EWHA 2WKDA 1JICA 1G2TA 1HR0Q 3MTSA 2VUMG 3KLRA 1VQFA 3PO2B 1VS0A 4A3CH 2UXCL 2I5MX 1PXUA 2F0SA 2GVAA 3S1RH 1NMFA 1BQQT 2JEBI 2EJMA 4O42A 4HMIA 1LTAD 2ES2A 2Z9HA 1A3UA 1XWEA 1X32A 2QEJC 2JA7G 2CFMA 1B53A 4H44C 1K8OA 1W3SA 3T13A 4QIWB 2R92B 5JPNC 2FFKB 1UE1A 2NTTA 3VR5A 2I46A 1RJTA 3J81L 2JXMB 4C1NK 2VQFL 3OYYA 2KHIA 4IUVA 4CDEC 4IOCA 3CAMA 3HOXB 2UU9L 5A2QE 3CC4A 1Q8KA 3DM1A 1S3OA 2PI2E 4EQPA 1O7LA 1XTCD 5LHY1 1JORA 2R7DA 1R9TH 4JVZA 3NBIA 4LFAL 3KF6A 3Q0AA 2JQOA 3S17H 5C44G 2L15A 3I2ZA 5DLQE 1CUKA 3PF4A 2RCFA 5ELFA 3BVGA 3KF8B 5T1GA 4HAEA 4X3TA 3A5UA 1ICWA 5I9OA 2WKCA 2L5TA 4MZ9A 4X62L 4KLKA 2RBMA 1BDOA 5JOBA 4HEDA 4BY1H 2ENBA 4P72A 3RLFA 2M9VA 1EU4A 3K6OA 2KCNA 2KUMA 4QIWE 1KQSA 2ZJQA 4DR1L 1VQ4A 1CK1A 2AQ3B 2AWOA 3KOJA 2BE5D 1TWHB 3L9AX 3S1QH 3ER0A 1DJRD 4A3BH 1KHIA 3PUXA 1ET6A 1X6OA 2CW0D 5EPJA 5GQOA 5ELDA 2EZVA 3D0FA 3Q8DA 3RZOH 3M4QA 4HIOA 1EEID 3A7LA 1RIPA 4BBRG 5FO8B 3J7AV 4BXXG 3WWVA 1KLUD 4JI5Q 1F9RA 4KKSA 1XMQL 4FXKC 3Q6SA 2D5DA 2E75C 2SDFA 2RDHA 5D14A 4ZRZA 3GTGH 2YV5A 1QJOA 1G6PA 1PLFA 3NK9A 1I6VC 3GV3A 2B63H 2VY3A 2HDLA 4K2KA 3C1EA 1JOKA 4ME3A 4C3JB 4HCEA 4LW1A 2EY2A 1EZ8A 4YWLA 3QG1A 1TKWB 5JVH3 3PO3B 4JYAL 1BOSA 4DK0A 1SE3A 3MHBA 3H94A 3K7AH 1VQMA 1N34Q 2TMPA 1PTOB 1YNND 2VW9A 3QOJA 5EGTA 1EFWA 1GJXA 3J81j 3CRKC 1WTVA 1PH3A 2FINB 3VR4A 3AFPA 3MZ5A 1QILA 3KDFB 2K5NA 1IKMA 1E2VA 1WI5A 5IP7G 3CQZB 1E24A 4HIDA 2C5CA 2FXQA 2PO4A 2I5LX 3AU7A 4OO1G 1BVSA 2KCMA 3K7AB 1SYBA 2ZM6L 4FDBA 3E0EA 2QCPX 4IFDG 3GTMH 2WAQB 1Z7TA 1H9KA 2K52A 3HOWB 2K5HA 1ONLA 5M5YH 3SGIA 3HKZB 4KK7A 5M3FH 1PFMA 2KENA 2MGSA 2Z1CA 4ALPA 2CCZA 5I6YA 1B8AA 3NE5B 4YWMA 1XPOA 1PH1A 1L1OB 2GA4B 4LF4L 1F2YA 2A74C 1Q12A 2RSOA 2OCEA 2WP8J 5C4XG 2VUMH 4LMQD 4UDUC 1ENCA 4LF8Q 1I94Q 4NB3A 3VYSA 4AYBB 4A3FB 2SEBD 3FHWA 3L3OC 5M3MG 4POFA 3R93A 1MSHA 4YHHL 5KYLA 2JA7H 4NPSA 1VQ6A 4V190 2XWBB 2K05A 1VQOA 3OPOA 5C0XJ 4LUZA 1STAA 1NNXA 1J8IA 1B4OA 1A15A 1XTDA 3BU2A 1D5XC 3NWSA 1E0BA 1PFBA 3T51B 1W6JA 1I5FA 1LLRD 3H09A 1Q1EA 1SMXA 3GTLB 2ALYB 4DV0L 4LFCQ 3FPPA 4CJ2C 2L0CA 4A3JG 2WIIB 3RD4A 2HD3A 5KNCA 5AJ3Q 1X3PA 5LMNL 2Q8IB 1ZEQX 3F1ZA 4XDXA 1D5ZC 3KYHC 2EIFA 1HH2P 4X64L 3NQIA 5C44H 1GVPA 4QB4A 3NBHB 2PCFB 4V0BA 1SR3A 3OMCA 2B29A 1FGBD 4KJNA 3KUPA 4B9WA 1EFID 1MKHA 1PYSB 1IBLL 3I72A 2HHHL 4X3UA 4LK1C 2KHSA 2NZHA 1SFOB 1II3A 1BUVT 2B2YC 1SMYC 2VL6A 4P2CB 1DM0B 4DUYQ 1A62A 3I4LA 1OXTA 3K5OA 1N8RC 2UUBL 1UUPA 1KL9A 1JB7A 5EAYA 1N33Q 1JOOA 2Q8RE 4GNXA 2JA5G 3BZDB 1EQVA 2QW7A 3S9WA 1PRTB 3HFZB 1PZJD 1TWAB 1C9OA 3J81i 4DR3Q 4CDFC 1RODA 3FEWX 1ZXTA 2A6HC 4B3RL 1BCPB 1BKBA 2L12A 3H3VC 1CHQD 4IALA 3S1MB 4BXXH 3F2DA 1Q90A 1H9SB 1TWFH 1YNJC 3I4MG 4YCUA 2R7ZH 4DAPA 4A93G 2RHQB 2ZT9C 5C0XH 2E8GA 4Q0FA 5GAEC 5JJIA 4NMZA 2E5LQ 1X54A 2ATWA 2LMCB 3LNNA 1H9RA 1M4VA 4F88A 4DV7Q 1SE2A 1WD0A 5J39A 3C1FA 1EZ6A 1VCIA 2ZXRA 3B6YA 5E1FA 3ULJA 3AYHB 4BBRB 1LT4D 1PMRA 3MXNA 4NW2A 4DV4L 3I4NB 3OW7A 1TWCB 2PZTA 5C4HA 5COYA 2L55A 3BVMA 2QKIC 4X3KA 1TS5A 2N49A 2OT2A 1QZGA 1WD1A 1GD7A 2WACA 1SAPA 2PMZE 3KBXA 4UAIA 3BVZA 2AQ2B 2JE6I 4JI8Q 1I4HA 1AEXA 3NPPA 1J5EL 3NTIA 1HNXL 2L4NA 2ZTCA 5IP7H 4DV2L 3HOVH 3NTKA 1KDAA 5JJZA 4IQZA 1CFMA 2OQ0A 3U9SA 2MFIA 1PHJA 2A73B 3A7AB 1KLGD 1VQLA 1PFSA 1HR0W 3CCRA 3J81c 5E4XA 3CCLA 1JE5A 3FMCA 4LFBQ 2N88A 4DU9A 3ZYYX 4OX9Q 2R93G 1GUGA 1WTPA 4A75A 2GVBA 2PW7A 4DV3L 2BH2A 3F8TA 1BO0A 3RMHA 3D3RA 4HTHA 4J6HA 4PZ8A 1ILPA 5FLMG 1HPCA 4C3IG 1FR3A 4LUVA 3V96A 1D8LA 2VNUD 2PQAB 2PNHA 1G291 1SYGA 1TWGB 4J15A 3GTPH 5L37A 2KA7A 3HOUG 3QB3A 1SLJA 2EXZA 3J81E 3S14H 3A8JE 5E3FA 4WJ4A 1R4QB 2CQAA 2IY5B 5D3IB 3F2UA 5FK9C 1QG7A 4A3CG 1QB5D 5LMUL 2NN6I 1W6KA 3EQLC 1HNWL 2Z4HA 3P7JA 5M3MH 1K83B 1U4LA 3WOEA 3M3YH 1IHZA 4KI0A 4ID6A 4ODGA 2PZUA 3S2DH 1N36L 2JSOA 5M5XH 3GDEA 1JJ2A 4JI4L 2D2CC 5C4XB 1L0XB 2XSCA 3QJYA 2K28A 1SE8A 3K8AA 3H3VI 3DEPA 4A3JH 3MA2B 2E74C 3T1HQ 1WTOA 1A3VA 2N78A 4KHPL 1HRJA 2R6GA 3W2DA 1HNZL 4GN5A 4B9XA 4AIMA 3BJUA 2RKSA 2Z6KC 5KGUA 5BR8L 4JCVE 1V1PB 3UDGA 3U4ZA 5K36G 4O2DA 3BYYB 4JI7Q 4HJAA 4NP5A 3TZUA 3FKIG 2ZTEA 4QMGA 2IJ0A 1Y8PB 3S1NH 2HDMA 1HTPA 3M4PA 2AWNA 5D65A 1E3PA 2NVYB 4K0KQ 1Y1VH 4B3SL 2HQEA 3CMAA 4KV6A 2MJ8A 1SJED 2PW5A 1IBML 4GOPA 2JA5H 4RWSC 1NR4A 4K5WA 1U0LA 1T5XD 4NDXA 2Q2UA 1HTLD 2NVTH 2VQEL 3ULPA 5C3XA 4LF7Q 1H9JA 3OWEB 1FNUA 2MP1A 2AQ1B 3IKJA 1FJGL 1VQNA 3O13A 4Y52H 1EOVA 1X9NA 3AEVA 1EUJA 2NZOA 2AHOB 3I4MH 4JI0Q 1Z47A 4LF6Q 4JK1C 4RH6A 4A93H 2H1EA 1X65A 1Q46A 1KTKA 1CQVA 3I7FA 1TS4A 4EQ5A 4KKTA 1PH8A 2E2JH 3KLWA 3MEHA 1EYAA 4DR4Q 5J3BA 5I4DA 3OSOA 1RDPD 4A3IH 1JJGA 2XWJB 5IYBG 2LSSA 1RD9D 4NXNQ 5EBCA 1WTWA 5CBAE 1S5ED 2QDBA 4R4IA 3J7A5 4IURA 2KECA 1FGUA 5ELNA 1G2SA 1W2BA 1CKNB 4A3MG 4DFAA 1D1IA 4DAVA 4POGA 2Y0SB 3NENA 4KN4C 3R2IA 3GTQH 4GN4B 5KIXA 3AMUA 2D0PA 2K7VA 1DOLA 2F0HA 4LJZC 3PIP3 5IWAQ 5E7NA 1TVXA 4A3KB 1ENFA 1SNCA 4LNQA 1HZBA 4XYOA 2IHEA 2OF1A 4IPDA 1DYQA 1PA6A 3S2HH 4MTKA 2K1BA 4DGZA 2R93H 1VDZA 1I50H 4BY7H 1MHWC 3IRBA 4CDDC 3QOLA 2UXBL 3STBC 1RTOA 3I70A 1PRTF 5HURA 2NVXB 2SOBA 2NVQB 4C3IH 1STHA 1BCPF 1YEZA 4C1NI 2F0EA 3S16B 2L9HA 4DV5L 1MBYA 1F9SA 2VQFQ 1VQIA 3W3AA 1PH9A 2UU9Q 5JAVA 2EYJA 3MWYW 1J6QA 1E2ZA 3SE0A 1PZID 4DV6L 4OIKA 2Q2IA 3HRZC 4B3TL 2K5QA 1S5BD 4DR7L 1P8LA 2F0TA 4LFAQ 3A56A 5HGQA 1NJIC 4RG1A 3TEHB 2HCCA 2K4KA 1X3QA 1SJHD 1UEAB 1MGSA 3HOUB 4PV1C 3MXGA 4X3SA 1WYDA 2RHSB 3OIQA 5EBDA 4YWKA 3A55A 4JI3L 1TIID 2A6EC 4KY5A 1B70B 1EIFA 5C3EH 1PTOC 4UHVA 3KJPA 2A69D 4X62Q 4UY8C 4IOAA 1N32L 3CPWA 1I6HH 3BG3A 4JI1L 3SK5A 3S1RB 3HS0C 1CZGA 1WJJA 1HFNA 1VQAA 3D4RA 3A8KE 4BA2I 2ZXOA 2QILA 2QEXA 4CDCC 2B2UA 2OQKA 1YHBA 3TP6A 3AQQA 4L6TB 4DR1Q 4B3ML 3R3OA 1JOQA 4G7OC 4YY3L 3CCUA 2EDGA 5K36H 4FXGC 3UE0A 2KEEA 1IYVA 3G48A 4JG2A 2OEOA 2K5VA 3FKIH 1NR2A 5IP9G 2Z0SA 5CV7A 2A5HA 1J9OA 1HZCA 4A3GG 3HG9A 4U673 4OGQC 1KAAA 4JV5L 1VQ7A 3N6RA 1KXLA 2XIWA 1XMQQ 2XVSA 2XTIA 4P71A 1EIHA 3ULLA 1R9TB 1OXSC 1SEBD 1G6ZA 2YTYA 3S17B 1VQ8A 4BWGB 4J1MA 5T1IA 5KNBA 3E0JA 5KNDA 1CI3M 4QY7A 1L1OC 4RMFA 3BYTB 4PMWA 2F0QA 2MUYA 5I2YA 2FMCA 3F2BA 4PNYA 3D6WA 3KBGA 1GHJA 1UE7A 3NUCA 4JYAQ 1SYCA 3BZCA 4X66L 5I6WA 1M90C 4BY1B 2IL8A 2WB1G 5E4WC 1EY7A 1VMCA 1LTID 4R8NA 4KD3A 3S24A 5M9OA 3RN2A 2KCCA 4I65A 4XT1B 4DV1L 2V1CC 1DCZA 2R7ZG 2X6GA 2AKWB 1GUNA 5FKAC 1EQRA 3WOFA 5C0XG 1LACA 3CRLC 2B2TA 1AZQA 3S1QB 2JA6H 4A3BB 1HFGA 5CV8A 2VS1A 2CH4A 1Q1BA 5IYBH 1AP0A 1CTMA 3RZOB 1KDBA 2UUAL 4JBWA 4DAYA 4HJ7A 2ZM6Q 1A6XA 3CD6A 4OHJA 1A2UA 1LTLA 3M85A 5EJWA 5K5PA 4K8JA 1VF7A 3GTGB 2Z6BA 1IL8A 1EIGA 4TKOB 1IZ6A 1XX8A 2A19A 3GQBA 1O7ZA 4A3MH 2B63B 1K3BC 2L1BA 3UDXA 2Z6KA 1EY6A 5CR3A 5CV6A 3HOVG 3J7AF 3TP8A 3NQTA 3JAMc 1ZKOA 1X3FA 1BNZA 1U4PA 4LF4Q 2V4DA 3I91A 2F0MA 2HUGA 3PUWA 3DWAA 3MXNB 4RHSA 1F9QA 4DK1A 1CA5A 2PI2A 2G9HD 5G3LF 3T1YL 3K57A 4E6IA 1MD2D 4JI2L 1PRTC 1EEFD 3HOZH 4YHHQ 1OXUA 2IT1A 3IFTA 2WINB 3CP0A 3Q24A 1HA6A 1BCPC 4Z9CB 3I55A 3JAME 4X65L 3MC0B 4N8X1 1SNOA 3TSSA 1IYJB 2GN5A 4C2MH 1VQBA 3LGJA 1SYDA 1GO3E 1EY0A 1TR5A 4DV0Q 3EFXD 3GTMB 2B2WC 5LMNQ 4UP7A 4XXEA 3C46A 2O4XA 5M5YB 4X64Q 2KVMA 1RF2D 1D6EC 3HZXA 5M3FB 2HT1A 1LT3D 3RUZA 1VQCA 3CC7A 4DUZL 2F3IA 4NKLA 3V05A 3PCOB 2F3WA 1CKOA 1Y8OB 4DPGA 1FNWA 1A8VA 1VQHA 2AUJD 3I8ZA 1PRTD 4JC0A 5M5WH 1IBLQ 2HHHQ 2F4VL 1X55A 4A76A 2VUMB 1FYCA 4HN7A 4C3HH 2WAQE 4DR2L 4NXMQ 4DR6L 1BCPD 1RCVD 2CVRA 4AH6A 4XYQA 3JC66 3HKZE 2R7FA 5HY6A 1GUTA 4WORA 3DLLA 5C4JH 2F0DA 3LWEA 4ZUIA 2JA7B 2A8VA 3SK8A 4IUUA 2BOSA 1EWIA 1ASYA 5DEHA 5JVG3 1TS3A 1STGA 1MJCA 1O78A 1VQKA 3I4OA 4M1UB 4B3RQ 5IP9H 1T5EA 1BF4A 1VQPA 4K6LA 4A3GH 2M00A 3KJOA 4AYBE 3S15H 5ISRA 1KRTA 2LXKA 1Y14B 4RA8A 5CORA 2EXDA 4JOIA 3TZDA 3TN2A 1Y1VG 1LT6D 3OHXC 5C44B 1XPUA 1VF5C 2ICEC 3G6EA 2EYPA 1RTNA 1GUSA 2H5XA 1FL0A 1S5DD 5BN4A 3L7ZC 4ZUJA 3PMFA 2CKZB 4AQYL 3DMUA 1XNRL 1U4RA 1B3QA 3KFUA 5LL6S 1C7YA 1VMPA 1KRSA 5BN5A 4HCSA 4DV4Q 3SHLA 4IJLA 1IW7C 2EYLA 2QA4A 1E1OA 1WCMG 2K33A 5J22A 3PIPA 5C4ZA 2ASBA 2JN4A 1EYDA 4A3DH 4FYDA 4LF5L 1ESRA 3VR2A 1EYCA 1S72A 4IPGA 1JMCA 3EA6A 2K6AA 1J5EQ 1HNXQ 4RGNA 2QGQA 4DV2Q 4JI6L 1SE4A 1OO9B 3CC2A 3OWFA 2F4IA 1SMYD 4GOPB 1JWSD 2IPKD 3RN5A 2WFWA 1SSOA 4A3IG 1B44D 1VQEA 4HJ8A 2DJFC 2BDNA 2WB1B 4G7HC 3UE1A 3P20A 1HCZA 4G7ZC 1TWFB 1H95A 1K0SA 4FF1A 2SNSA 1JWUD 4BA1I 1KD1C 3KDFA 3MEFA 4UPAA 2JP1A 2R7ZB 5CMDA 3N52A 4ME5A 4Y7NH 4DV3Q 1Y8NB 4ZCKA 1QUQB 1K8GA 2A6HD 4PG3A 2LFNA 1FVIA 1X3GA 1S4ZA 1PH6A 3PUZA 3QIAA 3GTKH 1Y1WG 5CV9A 1YNJD 1YNXA 1SNDA 3URYA 2R61A 3UDIA 1X3EA 2CQOA 1STNA 1D7QA 1LTSD 2L11A 4N8FA 1LTBD 3UDFA 3K58A 1NCVA 5LMUQ 4EQNA 5HGTA 4BY7G 1HNWQ 2NN6H 3TS0A 1U9RA 4F7XA 1NE3A 4A3EH 2LXJA 4EVOA 3Q23A 3HOVB 2LY7A 2F0PA 1HZAA 4DXGA 1N36Q 1IKLA 2HIXA 3EJIA 4K6DA 2NZ1D 5IGGA 4JI4Q 1XJVA 4ULLA 2E2HH 2EJGC 4OELB 3EBEA 3HOYH 3Q22A 3SVMA 4PMCA 3MVVA 3T4AC 5FO9B 1JT8A 3H3VH 5IODA 4DA2A 4HMJA 4OXPA 1HNZQ 3L0OA 4IN3A 2F3VA 4IUNA 3SR1A 2JA8H 4LUOA 4GKKQ 1VQ9A 4HSVA 3H0GG 1L2FA 4OO1I 5BR8Q 4IPHA 4GN3B 3GTPB 2N55A 3JAML 5G3LD 2R92G 1GHKA 3S14B 5JJLA 1SRUA 4IFDI 4O0AA 1PTOF 4ILWA 2DY7A 5C3EG 1WTXA 2X69A 2F0WA 5IGEA 2IX0A 1BBUA 4FXDA 1K0RA 2Z8LA 4CJ0B 5EKIA 5M3MB 2MO1A 4P75A 1LTGD 1L0YB 5EPLA 4HR7B 4IZ8A 3M3YB 2CWPA 3GV6A 3M7NA 1YBYA 3P1HA 1IBMQ 1E22A 2NTSA 4RHRA 3S2DB 1HXYD 2K14A 3RZDH 5M5XB 4H7BA 2XN9C 3ND9A 1DONA 3GTOH 1R4PB 2VQEQ 4DF7A 3M4YA 4BBSH 1UEBA 3DWPA 3MAQA 1AW7A 1V1QA 1DXMA 1NTGA 4A3JB 1FJGQ 1JC7A 3J80L 3HKSA 3RLOA 4FO2A 4BS9A 3K80C 1ET9A 3OTOL 3R2TA 3AFQA 4OWXB 1Q3LA 1EY9A 5FLXL 3KF6B 4GLVB 5JEAG 1ZYRC 4DKAC 2D62A 4L63B 2RA4A 3S1NB 1VQGA 2E2IH 3FDTA 3NHHA 1STBA 2B2WA 5FJ8H 1HHVA 4FF3A 1DOKA 1WCMH 1F77A 1Y1VB 3HEJA 4IPCA 2MPMA 3NP8A 4H02A 2UUCL 2UXDL 3IAYA 3C2PA 2KQ3A 4N9TA 2DUDA 3K0XA 2N8NA 2JA5B 1QVFA 3GTJH 5DM63 2NYZD 3H91A 4K2LA 2VB2X 4R1JA 1T9HA 2JA6G 2NVTB 4C3JG 4ZKBB 4WFN3 4ABNA 1EQQA 2RVLA 3K81C 1CZWA 3W5OA 3ITPA 4KHVA 2F03A 3VYUA 1YHAA 3I73A 1I3QH 4ZK9B 3X3MA 4C56C 1TT2A 1CA6A 3I4MB 3EVQA 5JJKA 4A93B 3KLSX 2UXBQ 2E2JB 1M8AA 2EYFA 3M4OH 5IT9L 1TS2A 3MXPA 1RKNA 4CJ1B 1EU3A 4MTNA 4DR5L 1Y1WH 1SNPA 1WOCA 5DM73 4A3IB 2CH4W 2DNCA 4DV5Q 1YZ6A 3K5MA 1JB3A 2A68C 5LL6X 1EY4A 3D31A 2NBFA 3FVQA 5GROA 4F87A 3FPUB 1A63A 2EQSA 2B2YA 2EYOA 4QUFA 2B3GA 5LMNW 3GP7A 4DAYB 1IBKL 4JI0L 2UXCQ 4GZYC 1STYA 2WAQG 4R4CA 4H0LC 2AUKA 2PQAA 4DNTB 3HOWG 4B3TQ 4DR7Q 3A5ZB 4MHEA 2P5ZX 3NTHA 3HOZG 1K8AC 2G9DA 1YJ9A 4RAUC 3EN2A 3GTQB 2YU9H 4GKJL 3MXUA 4XQJA 4NXNL 1Z9FA 2YTVA 4JI3Q 5ELOA 4ZYSA 1XNQL 1N32Q 3W1GA 1B3AA 1YVCA 5JEAJ 3S2HB 4MNOA 4JI1Q 2NB0A 3PO2H 1NUCA 2R93B 3PIO3 1I50B 4BY7B 4FNFA 1CM9A 1WTQA 3OMGA 2DY8A 2Y0SE 4KJOA 4A3FG 4X6AH 4FF2A 3MFYA 1QVCA 3ERSX 5CBEE 4GNXC 5IE8A 4C3IB 4B3MQ 1D2BA 3H0GH 2QF7A 1ENAA 1H9MA 2EPBA 2R92H 1ILQA 2J7ZA 3STBD 1OXVA 2Z4IA 2KCTA 1XMOL 3IFDA 4C3HG 3NEMA 4TRDA 3RLNA 4O1NA 3HOXH 2OTLA 2J0TD 2XRSD 4JV5Q 1I4RA 2WV6D 4DNRB 2OWOA 4ZLTF 4LF9L 2IX3A 1G91A 1V1PA 1V43A 3H0GB 1PH2A 1LYLA 2EYMA 3PUYA 1AZPA 4QF4A 1RL2A 3J7YW 2NWGA 2MO0A 4JBKA 1F2MA 3T53B 5TSSA 1YI2A 2B39A 5C3EB 5J1ZA 2JK8A 1E2WA 2RQXA 1M1KC 4RGOS 3K5LA 4DK6C 2BE5C 1HR0L 1I6HB 4X66Q 2MNAA 2CW0C 1EYGA 1D5MC 3K59A 1Q81C 1PFNA 4DV1Q 2A6ED 1NY4A 2DGYA 4S3SA 1PTOD 2D0OA 3CCQA 3H6MA 4MIUA 3E3XA 4YIJA 2EY6A 2MHVA 1GUOA 1V8QA 1TWHH 4KTAA 5AFWA 4DK3C 3OOCA 3ONAB 4L5TA 2N3SA 3JAMi 5JEAH 4WJWA 3FKIB 3QR8A 3SXHA 4R4QA 3A74A 3M9BA 4RGMA 2F0LA 2UUAQ 3BDOA 1B7YB 3G4SA 3CCJA 4ZQ3A 1ASZA 1TY0A 3SEBA 4RCOA 4IJHA 4JPBW 4TVAB 2ZJPA 1STEA 3TQYA 4QUCA 3G6JB 1HQMC 4HSPA 1HJPA 2I07B 4A3DG 2XGTA 1GKHA 3DUZA 2B2VC 5IYDG 1YNNC 1HQRD 3RNUA 1YITA 1V9PA 2EY1A 4XTCS 4C3JH 5KYIA 1TQOA 2E2DC 4GNXB 4PQXA 4QL5A 1IL2A 2YYZA 1NAPA 3PO3H 4H13C 4R9WA 2JYOA 4QJFA 3I4NG 4DAMA 1SXTA 3M7GA 3J80i 1CKNA 3ND8A 1CT1D 1PTOH 3FP9A 4J8QA 3F2CA 2O2LD 4OL7A 1F2LA 1LO5D 2EOTA 1S5FD 2K03A 3T1YQ 4K5VA 3CCSA 3V2TA 1AE3A 4JI2Q 1TU2B 3DHQA 1JR0D 2JA6B 1PZKD 2IW3A 3CQZH 4X65Q 3ICEA 4R4TA 4KMUC 2HIVA 3IL8A 1Z6HA 2IHFA 1JCKB 4RKLA 1JWMD 1I4QA 2D9UA 5H1SE 2VB3X 1PDQA 1NMGA 1CSQA 4JI5L 2A1AA 3EROA 3K5NA 1RHPA 2K32A 3CCEA 1KNAA 3CU7A 4P74A 1DZ1A 3HOWH 4A3MB 2NN6G 3CW2C 4IUQA 5CV4A 4DUZQ 1S40A 4A3EG 2EYHA 1A3TA 1UE6A 3QO2A 5CV5A 5DNFA 3NSWA 1YHQA 1PH7A 1AFPA 4KD4A 1GM5A 4L5SA 2EE1A 3GO5A 1S5CD 2F4VQ 4IUPA 1PH4A 1B1ZA 3DWQA 1SDFA 4DR2Q 3HOYG 4DR6Q 1N34L 5KEEA 4RFBA 2Q2TA 2FHTA 4OONA 3J80c 5IY0A 4A3FH 1GUWA 1LUZA 3HOZB 1HA5A 4JBJA 4GOPC 3WDNA 2DNEA 3BZKA 3MFGA 4EGVA 5C5MA 2JA8G 4RCNA 3QWNA 5IYCG 3CMEA 3TRZA 1WVLA 5FLXc 1LM0A 1PYWD 4C2MB 4G57A 1QZHA 3A8IE 1QNUA 2G5DA 2DJGC 3VA5A 2IWHA 2LS01 2TSSA 1OXXK 1UE5A 3GTLH 1MIUA 2HCIA 3J7ZC 4A3LG 1EL0A 2B8FA 3J80E 1ESFA 1KDCA 1SYEA 4OIJA 1EOTA 5ELEA 3R8BA 2UUBQ 4YCWA 1PH5A 3BS1A 3VYTA 2H4OA 2K5DA 2PZWA 1G51A 4KHZA 5FLXE 5KRUA 3KF8A 1WFQA 2PQEA 1KC8C 1C4QA 2JJQA 4DNIA 2XRQD 3KK7A 4AQYQ 1XNRQ 1F2ZA 1O7YA 5M5WB 1SNQA 1Q86C 1JJCB 3NXWA 4C3HB 4BBSG 1YJNA 1SFOH 3EIVA 4LF8L 1I94L 2RDGA 1SYFA 1A2TA 4K5XA 3P75A 4JW0A 1CHPD 4M8AA 3W1BA 1IYUA 1B9NA 1GXDC 5C4JB 4WJ3M 4LF5Q 4N9PA 1JE4A 5IGDA 1OTCA 1YIJA 4JI6Q 3LWUA 4L5QA 5IT9c 4A4IA 4HIMA 3RR5A 5IOCA 1XXGA 1ICFB 1TWAH 2CHBD 2I0QA 1LTRD 4KKUA 5C5LA 1YJWA 1K9MC 4XIGS 4NXML 4KN7C 4A3GB 2BCOA 2FJ2A 3I56A 4LFCL 2F0IA 1C48A 4CGYB 3S15B 3S1MH 1TY2A 1I4PA 5A2QL 5AJ3L 1PVOA 1HUNA 5GAGC 2KBNA 5FJ8G 1DD2A 4KY7A 1DOMA 2FMMA 4IFDJ 1Q8IA 3CHBD 3HGBA 4CBVA 2RF4A 2PMZB 5IT9E 5IYDH 4JBMA 5F2DA 5I9PA 4TSSA 1PV4A 1QVGA 1QWYA 4R4OA 2ZJRA 1BXTA 1KNEA 1N9WA 1LT5D 4BBRH 1U4MA 3I4NH 1TWCH 2F0UA 1KIXA 1QCBD 5C3WA 3CXCA 4DUYL 4B08A 4QQBX 1K28A 4A3DB 2C35B 3G71A 4UP9A 1N33L 5EPKA 4DXFA 3CPFA 2Y0SG 3TP7A 3PIOA 1IW7D 3E6ZX 4FP5D 3U58A 1VQJA 2JA9A 4DR3L 2EVBA 1HUMA 2K04A 3VR3A 2BA1A 4A3KG 1SN8A 5BN3A 3NWTA 1B9MA 2F0GA 4OWWB 4F8MA 2QDLA 3PV0A 5C0XI 4LWCA 4Y7NB 2B2UC 1BR9A 2F0KA 4I7AA 4PMBA 1VQ5A 4ZKCB 2E5LL 2ID0A 2F0NA 2KHJA 1XYIA 3VDYA 3GTKB 3HP3A 1I4XA 1L1OA 4DV7L 2RDFA 4FVMA 1C8CA 1HZ9A 1TWGH 4OO1H 2C9OA 4TQUS 1QE6A 2RCNA 2WB1E 3CKIB 2E76C 1E7ZA 3U50C 1O7IA 4XQNA 2LKVA 1GOZA 1V1OA 2F0VA 4IFDH 1MJEA 5IGFA 3DM3A 3PO2G 2F52A 3K7UC 1Q7YC 4KHPQ 1EWCA 1SBBB 2AMCB 5A35A 3VA7A 3DXJC 4JI8L 4A3EB 1K83H 1K8MA 2B2VA 3UI2A 1UNSA 1WTRA 4UP8A 5CGKA 4QGUA 5IYCH 1PYBA 1NBWA 3GD7A 1X56A 5D3DA 3PQIA 3T56B 5C4XH 2E2HB 4MN3A 3OW2A 3HOYB 3PF5A 1D1KA 1ML0D 2ZXPA 3E5SA 2EY5A 4LFBL 1BBWA 1AE2A 2J4XA 3TP5A 4OX9L 1QOHA 4A3LH 1MSGA 3HOXG 3C3LA 4YCVA 3PSIA 2EJFC 3K0YA 3NBHA 3OTOQ 4OEMB 4B3SQ 3VYRA 2JA8B 3PGZA 4HJ9A 3H15A 2B2TC 2SNMA 2M2LA 5FO7B 3SK6A 1NSNS 2K75A 5NUCA 3D6CA 3TBIB 4QCLA 5C6AA 4CKCA
chains in the Genus database with same CATH topology
2F0JA 4I7ZC 2BDOA 4K14A 4R8IA 2JEAI 3D4DA 2KEDA 3AB9A 4G4KA 2K01A 4L8JA 2O5IC 4FF4A 2PYKA 3I90A 1F9PA 2K5WA 3D4WA 5ELBA 1JQYD 3VR6A 3X3NA 1I4GA 1KABA 1MI2A 2B8GA 3RZDB 1CQFA 3LX0A 1LV9A 3GTOB 2BA0A 3I3CA 4BBSB 3TMEA 2R3ZA 1H9SA 1B50A 2DN8A 4CKEA 3BDCA 1EY5A 3BDLA 4CHTB 3ERQA 5IGCA 3U9OA 2OXPA 2IX1A 4WRDA 5CYUA 5EKLA 4ZAIA 5ELCA 5IIFA 1QNKA 2PNRC 2ICIA 4XQQA 1EY8A 2E2IB 4EQOA 2VXWA 4U68A 2XNAC 3T16A 3DEOA 1WCMB 1BBXC 1O80A 5FOBB 2F1MA 1ZYRD 2F0FA 3GTJB 4CKBA 4KY6A 4Q5VA 4RKBA 3D8GA 4IUTA 5DAUA 4LAAA 5JPMC 1B2TA 4K8IA 1SNMA 1I3QB 5IGBA 5EQ0A 2O5JC 1UAPA 1G8ZD 1LTTD 4XT3B 3SDZA 2Q8TA 2X6LA 3PUVA 3KLSA 3FRPB 3M4OB 3A54A 1Y1WB 2PPBC 3SK4A 1Y69U 3G7LA 3OIPA 4DN4M 3TDQA 5I2XA 2KOLA 1LABA 2A69C 4RGTA 2KJXA 2A68D 5CC4A 5EKKA 2YU9B 1AN8A 1EQTA 2F0OA 2NUCA 1FNVA 2RSNA 1FD7D 1EWHA 2WKDA 1JICA 1G2TA 3MTSA 3KLRA 3PO2B 1PXUA 2F0SA 1BQQT 2JEBI 2EJMA 4O42A 4HMIA 1LTAD 1A3UA 1XWEA 1X32A 2QEJC 1B53A 4H44C 1K8OA 3T13A 4QIWB 2R92B 5JPNC 2FFKB 2NTTA 3VR5A 2I46A 1RJTA 3J81L 2JXMB 4C1NK 4IUVA 3HOXB 5A2QE 3DM1A 4EQPA 1O7LA 1XTCD 5LHY1 1JORA 3NBIA 3Q0AA 5ELFA 3BVGA 5T1GA 4HAEA 4X3TA 1ICWA 5I9OA 2WKCA 2L5TA 2RBMA 1BDOA 5JOBA 4HEDA 2ENBA 3RLFA 2M9VA 1EU4A 3K6OA 2KCNA 2KUMA 1CK1A 2AQ3B 2AWOA 2BE5D 1TWHB 3L9AX 1DJRD 3PUXA 1ET6A 2CW0D 5EPJA 2EZVA 5ELDA 1EEID 3A7LA 5FO8B 3J7AV 1KLUD 1F9RA 4KKSA 4FXKC 3Q6SA 2D5DA 2E75C 2SDFA 2RDHA 5D14A 4ZRZA 1QJOA 1PLFA 3NK9A 1I6VC 3GV3A 2HDLA 4K2KA 3C1EA 1JOKA 4C3JB 4HCEA 2EY2A 1EZ8A 3QG1A 1TKWB 5JVH3 3PO3B 1BOSA 4DK0A 1SE3A 3MHBA 3H94A 2TMPA 1PTOB 1YNND 3QOJA 5EGTA 1GJXA 3CRKC 1WTVA 2FINB 3VR4A 3MZ5A 1QILA 1IKMA 1E2VA 3CQZB 2C5CA 2PO4A 3AU7A 4OO1G 3K7AB 1SYBA 2QCPX 4IFDG 2WAQB 1Z7TA 1H9KA 3HOWB 1ONLA 3HKZB 4KK7A 1PFMA 2MGSA 2Z1CA 5I6YA 3NE5B 2GA4B 1F2YA 2A74C 1Q12A 2RSOA 2WP8J 4LMQD 4UDUC 1ENCA 3VYSA 4AYBB 4A3FB 2SEBD 3L3OC 3R93A 1MSHA 5KYLA 4V190 2XWBB 2K05A 3OPOA 5C0XJ 1STAA 1J8IA 1A15A 1B4OA 1D5XC 3NWSA 1E0BA 1PFBA 3T51B 1W6JA 1LLRD 3H09A 1Q1EA 3GTLB 3FPPA 4CJ2C 2L0CA 2WIIB 3RD4A 5KNCA 1X3PA 2Q8IB 1ZEQX 4XDXA 1D5ZC 3NQIA 4QB4A 2PCFB 4V0BA 3OMCA 1FGBD 4KJNA 3KUPA 4B9WA 1EFID 3I72A 4X3UA 4LK1C 2KHSA 1SFOB 1II3A 1BUVT 2B2YC 1SMYC 4P2CB 1DM0B 3I4LA 1OXTA 3K5OA 1UUPA 1JOOA 2Q8RE 3BZDB 1EQVA 3S9WA 1PRTB 1PZJD 1TWAB 1RODA 3FEWX 1ZXTA 2A6HC 1BCPB 2L12A 3H3VC 1CHQD 4IALA 3S1MB 1Q90A 1H9SB 1YNJC 4DAPA 2ZT9C 5C0XH 4Q0FA 4NMZA 2LMCB 3LNNA 1H9RA 1M4VA 4F88A 1SE2A 1WD0A 5J39A 3C1FA 1EZ6A 1VCIA 2ZXRA 5E1FA 4BBRB 1LT4D 1PMRA 3MXNA 4NW2A 3I4NB 3OW7A 1TWCB 2PZTA 5C4HA 5COYA 2L55A 3BVMA 2QKIC 4X3KA 1TS5A 2OT2A 1WD1A 2WACA 1SAPA 3KBXA 4UAIA 3BVZA 2AQ2B 2JE6I 1I4HA 1AEXA 3NPPA 3NTIA 2L4NA 3NTKA 1KDAA 5JJZA 4IQZA 1CFMA 3U9SA 2A73B 3A7AB 1KLGD 5E4XA 3FMCA 2N88A 4DU9A 3ZYYX 1GUGA 1WTPA 2PW7A 1BO0A 3RMHA 3D3RA 4HTHA 4J6HA 1ILPA 1HPCA 4C3IG 1FR3A 3V96A 2VNUD 1G291 1SYGA 1TWGB 2KA7A 3QB3A 2EXZA 3J81E 3A8JE 5E3FA 1R4QB 2CQAA 5D3IB 3F2UA 5FK9C 1QG7A 1QB5D 2NN6I 1W6KA 3EQLC 2Z4HA 3P7JA 1K83B 1U4LA 3WOEA 1IHZA 4KI0A 4ID6A 4ODGA 2PZUA 2JSOA 2D2CC 5C4XB 1L0XB 2XSCA 3QJYA 2K28A 3DEPA 3MA2B 2E74C 1WTOA 1A3VA 1HRJA 2R6GA 3W2DA 4B9XA 2RKSA 5KGUA 1V1PB 5K36G 3BYYB 4NP5A 3TZUA 4QMGA 2IJ0A 1Y8PB 2HDMA 1HTPA 2AWNA 5D65A 2NVYB 2HQEA 4KV6A 2MJ8A 1SJED 2PW5A 4RWSC 1NR4A 4K5WA 1T5XD 4NDXA 1HTLD 5C3XA 1H9JA 3OWEB 1FNUA 2MP1A 2AQ1B 3IKJA 3O13A 1Z47A 4JK1C 4RH6A 2H1EA 1KTKA 1CQVA 1TS4A 4KKTA 3MEHA 1EYAA 5I4DA 3OSOA 1RDPD 2XWJB 1RD9D 5EBCA 1WTWA 5CBAE 1S5ED 2QDBA 4IURA 2KECA 1G2SA 4DFAA 1D1IA 4DAVA 2Y0SB 4KN4C 3R2IA 5KIXA 3AMUA 2K7VA 1DOLA 2F0HA 4LJZC 3PIP3 1TVXA 4A3KB 1ENFA 1SNCA 4XYOA 2OF1A 1DYQA 2K1BA 4DGZA 1VDZA 3QOLA 1RTOA 3I70A 1PRTF 5HURA 2NVXB 2SOBA 2NVQB 1STHA 1BCPF 4C1NI 2F0EA 3S16B 2L9HA 1MBYA 1F9SA 3W3AA 5JAVA 2EYJA 3MWYW 1E2ZA 3SE0A 1PZID 4OIKA 3HRZC 2K5QA 1S5BD 2F0TA 3A56A 2HCCA 1X3QA 1SJHD 1UEAB 1MGSA 3HOUB 4PV1C 3MXGA 4X3SA 3OIQA 5EBDA 3A55A 1TIID 2A6EC 4KY5A 1PTOC 2A69D 3BG3A 3SK5A 3S1RB 3HS0C 1CZGA 1HFNA 3D4RA 3A8KE 4BA2I 2ZXOA 2QILA 2B2UA 3TP6A 4L6TB 3R3OA 1JOQA 4G7OC 2EDGA 5K36H 4FXGC 2KEEA 1IYVA 2OEOA 1NR2A 5CV7A 2A5HA 1J9OA 3HG9A 4U673 4OGQC 1KAAA 3N6RA 2XIWA 2XVSA 1EIHA 1R9TB 1OXSC 1SEBD 1G6ZA 3S17B 4BWGB 4J1MA 5T1IA 5KNBA 3E0JA 5KNDA 1CI3M 3BYTB 4PMWA 2F0QA 2MUYA 5I2YA 2FMCA 4PNYA 3D6WA 3KBGA 1GHJA 3NUCA 1SYCA 5I6WA 4BY1B 2IL8A 5E4WC 1EY7A 1VMCA 1LTID 4R8NA 4KD3A 5M9OA 2KCCA 4I65A 4XT1B 1DCZA 2X6GA 1GUNA 5FKAC 3WOFA 5C0XG 1LACA 3CRLC 2B2TA 1AZQA 3S1QB 4A3BB 1HFGA 5CV8A 1Q1BA 1AP0A 1CTMA 3RZOB 1KDBA 4JBWA 4DAYA 1A6XA 4OHJA 1A2UA 3M85A 5EJWA 5K5PA 4K8JA 1VF7A 3GTGB 1IL8A 1EIGA 4TKOB 1XX8A 3GQBA 1O7ZA 2B63B 2L1BA 1EY6A 5CR3A 5CV6A 3J7AF 3TP8A 3NQTA 1ZKOA 1BNZA 1U4PA 2V4DA 3I91A 2F0MA 2HUGA 3PUWA 3DWAA 4RHSA 1F9QA 4DK1A 1CA5A 2G9HD 5G3LF 3K57A 4E6IA 1MD2D 1PRTC 1EEFD 1OXUA 2IT1A 3IFTA 2WINB 3Q24A 1HA6A 1BCPC 4Z9CB 3JAME 3MC0B 1SNOA 3TSSA 1SYDA 1EY0A 1TR5A 3EFXD 3GTMB 2B2WC 4XXEA 3C46A 2O4XA 5M5YB 2KVMA 1RF2D 1D6EC 3HZXA 5M3FB 1LT3D 3RUZA 4NKLA 3V05A 2F3WA 1Y8OB 1FNWA 2AUJD 3I8ZA 1PRTD 2VUMB 1FYCA 4HN7A 1BCPD 1RCVD 2CVRA 4XYQA 1GUTA 4WORA 2F0DA 3LWEA 4ZUIA 2JA7B 3SK8A 4IUUA 2BOSA 5DEHA 5JVG3 1TS3A 1STGA 1O78A 4M1UB 1T5EA 1BF4A 4K6LA 2M00A 5ISRA 4RA8A 5CORA 3TZDA 3TN2A 1LT6D 3OHXC 5C44B 1VF5C 2ICEC 2EYPA 1RTNA 1GUSA 1S5DD 5BN4A 3L7ZC 4ZUJA 3PMFA 3DMUA 1U4RA 5LL6S 1VMPA 5BN5A 4HCSA 3SHLA 1IW7C 2EYLA 2K33A 5J22A 5C4ZA 1EYDA 4FYDA 1ESRA 3VR2A 1EYCA 3EA6A 2K6AA 4RGNA 1SE4A 1OO9B 3OWFA 2F4IA 1SMYD 1JWSD 2IPKD 1SSOA 1B44D 2BDNA 2WB1B 4G7HC 3P20A 1HCZA 4G7ZC 1TWFB 4FF1A 2SNSA 1JWUD 4BA1I 2JP1A 2R7ZB 5CMDA 3N52A 4ME5A 1Y8NB 2A6HD 2LFNA 1S4ZA 3PUZA 3QIAA 5CV9A 1YNJD 1SNDA 3URYA 2R61A 1STNA 1LTSD 2L11A 3K58A 1LTBD 1NCVA 4EQNA 5HGTA 2NN6H 1U9RA 4F7XA 4EVOA 3Q23A 3HOVB 2LY7A 2F0PA 4DXGA 1IKLA 3EJIA 4K6DA 2NZ1D 5IGGA 4ULLA 2EJGC 3Q22A 3SVMA 4PMCA 3MVVA 3T4AC 5FO9B 5IODA 4DA2A 4HMJA 4IN3A 2F3VA 4IUNA 3SR1A 4HSVA 4OO1I 3GTPB 2N55A 3JAML 5G3LD 1GHKA 3S14B 4IFDI 1PTOF 4ILWA 2DY7A 1WTXA 2X69A 2F0WA 5IGEA 2IX0A 4FXDA 2Z8LA 4CJ0B 5EKIA 5M3MB 1LTGD 1L0YB 5EPLA 4HR7B 4IZ8A 3M3YB 3GV6A 3M7NA 3P1HA 2NTSA 4RHRA 3S2DB 1HXYD 5M5XB 4H7BA 2XN9C 3ND9A 1DONA 1R4PB 4DF7A 3M4YA 3DWPA 3MAQA 1AW7A 1DXMA 4A3JB 1JC7A 3J80L 4FO2A 4BS9A 1ET9A 3R2TA 1Q3LA 1EY9A 5FLXL 5JEAG 1ZYRC 2D62A 4L63B 2RA4A 3S1NB 3FDTA 3NHHA 1STBA 2B2WA 1HHVA 4FF3A 1DOKA 1F77A 1Y1VB 3HEJA 2MPMA 3NP8A 3IAYA 3C2PA 2KQ3A 4N9TA 2JA5B 5DM63 2NYZD 3H91A 4K2LA 2VB2X 2NVTB 4C3JG 4ZKBB 4WFN3 4ABNA 2RVLA 1CZWA 3ITPA 4KHVA 2F03A 3VYUA 3I73A 4ZK9B 3X3MA 4C56C 1TT2A 1CA6A 3I4MB 3EVQA 4A93B 3KLSX 2E2JB 1M8AA 2EYFA 5IT9L 1TS2A 3MXPA 1RKNA 4CJ1B 1EU3A 1SNPA 5DM73 4A3IB 2DNCA 3K5MA 1JB3A 2A68C 5LL6X 1EY4A 3D31A 2NBFA 3FVQA 4F87A 3FPUB 2B2YA 4QUFA 2EYOA 3GP7A 4GZYC 1STYA 4H0LC 2AUKA 4DNTB 4MHEA 3NTHA 2G9DA 4RAUC 3GTQB 3MXUA 4XQJA 4ZYSA 1B3AA 5JEAJ 3S2HB 2NB0A 2R93B 1NUCA 3PIO3 1I50B 4BY7B 4FNFA 1CM9A 1WTQA 3OMGA 2DY8A 4KJOA 4FF2A 3MFYA 5CBEE 4C3IB 1D2BA 2QF7A 1ENAA 1H9MA 2EPBA 1ILQA 2J7ZA 1OXVA 2Z4IA 3IFDA 4C3HG 4TRDA 4O1NA 2J0TD 2XRSD 1I4RA 2WV6D 4DNRB 4ZLTF 2IX3A 1G91A 1V1PA 1V43A 3H0GB 1AZPA 2EYMA 3PUYA 4QF4A 3J7YW 2NWGA 1F2MA 3T53B 5TSSA 2B39A 5C3EB 5J1ZA 1E2WA 2RQXA 4RGOS 3K5LA 1I6HB 2BE5C 2CW0C 1D5MC 3K59A 1PFNA 2A6ED 4S3SA 1PTOD 3H6MA 4MIUA 4YIJA 2EY6A 2MHVA 1GUOA 1V8QA 4KTAA 5AFWA 3OOCA 3ONAB 5JEAH 4WJWA 3FKIB 3SXHA 4RGMA 2F0LA 3BDOA 4ZQ3A 1TY0A 3SEBA 4RCOA 1STEA 4QUCA 3G6JB 1HQMC 4HSPA 2I07B 3DUZA 2B2VC 1YNNC 1HQRD 2EY1A 4XTCS 5KYIA 1TQOA 2E2DC 4PQXA 2YYZA 1NAPA 4H13C 4R9WA 2JYOA 1SXTA 3M7GA 3ND8A 1CT1D 1PTOH 4J8QA 2O2LD 4OL7A 1F2LA 1LO5D 2EOTA 1S5FD 2K03A 4K5VA 3V2TA 1TU2B 3DHQA 1JR0D 2JA6B 1PZKD 2IW3A 4KMUC 3IL8A 1Z6HA 1JCKB 4RKLA 1JWMD 1I4QA 2D9UA 2VB3X 1PDQA 3EROA 3K5NA 1RHPA 2K32A 1KNAA 3CU7A 1DZ1A 4A3MB 2NN6G 4IUQA 5CV4A 2EYHA 1A3TA 3QO2A 5CV5A 5DNFA 3NSWA 1AFPA 4KD4A 2EE1A 3GO5A 1S5CD 4IUPA 1B1ZA 3DWQA 1SDFA 5KEEA 4RFBA 2FHTA 1GUWA 3HOZB 1HA5A 3WDNA 2DNEA 3MFGA 4EGVA 5C5MA 4RCNA 3QWNA 1WVLA 1PYWD 4C2MB 4G57A 3A8IE 1QNUA 3VA5A 2IWHA 2LS01 2TSSA 1OXXK 2HCIA 1EL0A 2B8FA 3J80E 1ESFA 1KDCA 1SYEA 4OIJA 1EOTA 5ELEA 3R8BA 3BS1A 3VYTA 2H4OA 2K5DA 2PZWA 4KHZA 5FLXE 5KRUA 3KF8A 2PQEA 1C4QA 2XRQD 3KK7A 1F2ZA 1O7YA 5M5WB 1SNQA 3NXWA 4C3HB 2RDGA 1SYFA 1A2TA 4K5XA 3P75A 1CHPD 4M8AA 1IYUA 1B9NA 1GXDC 5C4JB 4N9PA 1JE4A 5IGDA 3LWUA 5IOCA 1XXGA 2CHBD 1LTRD 4KKUA 5C5LA 4XIGS 4KN7C 4A3GB 2BCOA 2FJ2A 2F0IA 1C48A 4CGYB 3S15B 1TY2A 1I4PA 5A2QL 1HUNA 1DD2A 4KY7A 1DOMA 2FMMA 4IFDJ 1Q8IA 3CHBD 3HGBA 4CBVA 2PMZB 5IT9E 5F2DA 5I9PA 4TSSA 1QWYA 1BXTA 1KNEA 1LT5D 1U4MA 2F0UA 1QCBD 5C3WA 4B08A 4A3DB 5EPKA 4DXFA 3TP7A 1IW7D 3E6ZX 4FP5D 2EVBA 1HUMA 2K04A 3VR3A 2BA1A 5BN3A 3NWTA 1B9MA 2F0GA 4F8MA 3PV0A 5C0XI 4Y7NB 2B2UC 1BR9A 2F0KA 4PMBA 4ZKCB 2ID0A 2F0NA 1XYIA 3GTKB 3HP3A 1I4XA 2RDFA 4FVMA 1C8CA 4OO1H 2C9OA 4TQUS 1QE6A 3CKIB 2E76C 4XQNA 2LKVA 1GOZA 1V1OA 2F0VA 4IFDH 5IGFA 1EWCA 1SBBB 5A35A 3VA7A 3DXJC 4A3EB 1K8MA 2B2VA 3UI2A 1UNSA 1WTRA 5CGKA 3GD7A 5D3DA 3T56B 2E2HB 4MN3A 3HOYB 1D1KA 1ML0D 2ZXPA 3E5SA 2EY5A 2J4XA 3TP5A 1QOHA 1MSGA 3C3LA 2EJFC 3K0YA 3NBHA 3VYRA 2JA8B 2B2TC 2SNMA 2M2LA 5FO7B 3SK6A 1NSNS 5NUCA 3D6CA 3TBIB 4QCLA 5C6AA 4CKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B3A A;  1NCV A;  2B2V C;  1IL8 A;  1EIG A;  3F2U A;  4XT3 B;  1XX8 A;  5EPK A;  2Q8T A;  1O7Z A;  2X6L A;  5T1G A;  1QG7 A;  2L1B A;  1CM9 A;  4HAE A;  4X3T A;  1WTQ A;  4R8I A;  1ICW A;  2DY8 A;  2HCI A;  1ROD A;  1BF4 A;  1EL0 A;  2KED A;  1PFM A;  1ZXT A;  2MGS A;  3P7J A;  2L12 A;  2RA4 A;  4OIJ A;  1HFN A;  4HED A;  1EOT A;  2K01 A;  1NAP A;  5CBE E;  1HUM A;  1U4L A;  2K04 A;  3FDT A;  3I90 A;  4RA8 A;  1F9P A;  2B2U A;  5COR A;  1IKL A;  4R9W A;  2JYO A;  2B2W A;  1BNZ A;  1HHV A;  1WTW A;  1U4P A;  1DOK A;  3TZD A;  3TN2 A;  5CBA E;  2NZ1 D;  3I91 A;  2MPM A;  3G7L A;  2KUM A;  2HUG A;  2EPB A;  4IUR A;  2KEC A;  1MI2 A;  1ILQ A;  1F2L A;  2EOT A;  2RSO A;  4DN4 M;  2J7Z A;  1RTN A;  2K03 A;  1F9Q A;  2KEE A;  1G2S A;  1O7Y A;  1CA5 A;  3SVM A;  1LV9 A;  2B2U C;  2NYZ D;  3H91 A;  2K28 A;  4LMQ D;  3IFD A;  3I3C A;  1NR2 A;  1U4R A;  2KOL A;  2R3Z A;  4ZKC B;  3DEP A;  1VMP A;  4ZKB B;  1J9O A;  5EPJ A;  1XYI A;  1B50 A;  1WTO A;  1WD0 A;  4ZLT F;  4HCS A;  3HP3 A;  1HRJ A;  2RVL A;  3R93 A;  1MSH A;  1DOL A;  2XIW A;  1G91 A;  3IL8 A;  1HA6 A;  1C8C A;  4HSV A;  1AZP A;  1TVX A;  2D9U A;  4NW2 A;  1EIH A;  2K05 A;  1QE6 A;  4ZK9 B;  1EQT A;  1PDQ A;  1G6Z A;  1F9R A;  1JE4 A;  5COY A;  1CA6 A;  2N55 A;  3Q6S A;  4X3K A;  5D14 A;  2SDF A;  2NWG A;  5T1I A;  1ESR A;  2RSN A;  1J8I A;  1A15 A;  1B4O A;  2K1B A;  1WD1 A;  1PLF A;  1RHP A;  1SAP A;  3KBX A;  1E0B A;  1JIC A;  1KNA A;  1PFB A;  3GV3 A;  2DY7 A;  3MTS A;  4UAI A;  1WTX A;  1G2T A;  1DZ1 A;  2HDL A;  2X69 A;  2B2W C;  1M8A A;  4ZAI A;  3D6W A;  4CJ2 C;  1RTO A;  4CJ1 B;  2L4N A;  4IUQ A;  2HDM A;  2FJ2 A;  1X3P A;  2KVM A;  1QNK A;  4XDX A;  4O42 A;  5EKI A;  4CJ0 B;  5JJZ A;  2B2V A;  1SSO A;  3UI2 A;  1WTR A;  3QO2 A;  5DNF A;  5EPL A;  1X32 A;  5D65 A;  2IL8 A;  2VXW A;  4U68 A;  2BDN A;  3GV6 A;  1HUN A;  1B53 A;  1PFN A;  3DEO A;  5E4W C;  1DOM A;  2FMM A;  2L9H A;  1VMC A;  1BBX C;  1O80 A;  2MJ8 A;  2EE1 A;  3FPU B;  5E4X A;  2B2Y A;  2N88 A;  2JP1 A;  1F9S A;  4IUP A;  4XT1 B;  4MN3 A;  4QUF A;  2X6G A;  5CMD A;  4RWS C;  1SDF A;  1NR4 A;  3N52 A;  5AFW A;  3I8Z A;  3ONA B;  2FFK B;  1DON A;  1ML0 D;  1WTP A;  1RJT A;  1WTV A;  2FIN B;  3KUP A;  2B2T A;  1AZQ A;  4IUV A;  3MWY W;  2FHT A;  1S4Z A;  1MSG A;  2CVR A;  4X3U A;  1HFG A;  1GUW A;  1IKM A;  1BO0 A;  1KNE A;  4MHE A;  4OIK A;  2B2Y C;  2MP1 A;  3DM1 A;  4IUT A;  4RAU C;  1ILP A;  1AP0 A;  1U4M A;  1B2T A;  2HCC A;  3LWE A;  1X3Q A;  2B2T C;  1WVL A;  2M2L A;  4QUC A;  1MGS A;  5EQ0 A;  4X3S A;  2L11 A;  4IUU A;  1Q3L A;  5EJW A;  2H1E A;  2Q8R E; 
#chains in the Genus database with same CATH topology
 2F0J A;  3NEL A;  4I7Z C;  2BDO A;  5GAD C;  4K14 A;  1KAW A;  4R8I A;  2JEA I;  3D4D A;  3CCM A;  2KED A;  2HQL A;  3AB9 A;  4G4K A;  2K01 A;  4L8J A;  2O5I C;  4FF4 A;  2NVY H;  2PYK A;  3I90 A;  1F9P A;  4IO9 A;  2UUC Q;  2K5W A;  3D4W A;  5ELB A;  4PZ6 A;  2UXD Q;  1UWV A;  1JQY D;  4GKK L;  3VR6 A;  3X3N A;  2K50 A;  1CSP A;  1I4G A;  1KAB A;  1MI2 A;  2B8G A;  3RZD B;  1CQF A;  4P73 A;  2I5H A;  3LX0 A;  1LV9 A;  3TRE A;  3GTO B;  2BA0 A;  3I3C A;  4BBS B;  3TME A;  2R3Z A;  1AH9 A;  1H9S A;  1B50 A;  2DN8 A;  1VQD A;  4BY1 G;  4CKE A;  3T1H L;  3BDC A;  1EY5 A;  3BDL A;  1U5K A;  4CHT B;  3ERQ A;  5IGC A;  3U9O A;  2Q2H A;  3U4V A;  2OXP A;  1L0W A;  1CKM A;  2IX1 A;  1P16 A;  3TS2 A;  4WRD A;  1WTH A;  1XPR A;  5CYU A;  5EKL A;  4GS3 A;  4DR5 Q;  2BH8 A;  3E9H A;  4ZAI A;  4A3B G;  5GAH C;  1EIY B;  5ELC A;  5IIF A;  4JI7 L;  3CF5 A;  1QNK A;  2PNR C;  2ICI A;  4XQQ A;  1EY8 A;  2E2I B;  4EQO A;  3PO3 G;  2VXW A;  4U68 A;  2XNA C;  1QUQ A;  3T16 A;  3DEO A;  1WCM B;  1BBX C;  1IBK Q;  1O80 A;  4K0K L;  5FOB B;  4GLA C;  2F1M A;  4GLX A;  2YTX A;  4PZ7 A;  1ZYR D;  2MQH A;  1DGS A;  2F0F A;  1A0I A;  2B63 G;  3E9I A;  4CKB A;  4EX5 A;  4KY6 A;  3GTJ B;  3CCV A;  4GKJ Q;  4Q5V A;  3L2P A;  4RKB A;  3D8G A;  4IUT A;  4LF7 L;  5DAU A;  4LAA A;  5JPM C;  1Q82 C;  1B2T A;  4K8I A;  4A3K H;  1XNQ Q;  1SNM A;  4L5R C;  1I3Q B;  4HJ5 A;  5IGB A;  5EQ0 A;  2O5J C;  1UAP A;  1G8Z D;  4DV6 Q;  1LTT D;  4LF6 L;  4XT3 B;  3SDZ A;  2Q8T A;  2X6L A;  3PUV A;  3KLS A;  3FRP B;  2NVX H;  1TXY A;  3M4O B;  3A54 A;  2NVQ H;  3HKZ G;  4DR4 L;  1Y1W B;  2ZTD A;  4HIK A;  2PPB C;  3SK4 A;  3S16 H;  1Y69 U;  3ZJY C;  3G7L A;  1SRO A;  3OIP A;  4DN4 M;  1XMO Q;  2VZA A;  3TDQ A;  4JOI C;  1E1T A;  5I2X A;  2KOL A;  4LF9 Q;  1LAB A;  2A69 C;  4AYB G;  4RGT A;  5M3F G;  5FLM H;  2KJX A;  2A68 D;  2CWA A;  5CC4 A;  5EKK A;  1K73 C;  2YU9 B;  1AN8 A;  1IXR A;  1EQT A;  2F0O A;  4APV A;  4OWT B;  3HOU H;  2OTJ A;  4YY3 Q;  5IWA L;  1C0A A;  2NUC A;  1FNV A;  2RSN A;  1FD7 D;  1K3R A;  3A0J A;  1EWH A;  2WKD A;  1JIC A;  1G2T A;  1HR0 Q;  3MTS A;  2VUM G;  3KLR A;  1VQF A;  3PO2 B;  1VS0 A;  4A3C H;  2UXC L;  2I5M X;  1PXU A;  2F0S A;  2GVA A;  3S1R H;  1NMF A;  1BQQ T;  2JEB I;  2EJM A;  4O42 A;  4HMI A;  1LTA D;  2ES2 A;  2Z9H A;  1A3U A;  1XWE A;  1X32 A;  2QEJ C;  2JA7 G;  2CFM A;  1B53 A;  4H44 C;  1K8O A;  1W3S A;  3T13 A;  4QIW B;  2R92 B;  5JPN C;  2FFK B;  1UE1 A;  2NTT A;  3VR5 A;  2I46 A;  1RJT A;  3J81 L;  2JXM B;  4C1N K;  2VQF L;  3OYY A;  2KHI A;  4IUV A;  4CDE C;  4IOC A;  3CAM A;  3HOX B;  2UU9 L;  5A2Q E;  3CC4 A;  1Q8K A;  3DM1 A;  1S3O A;  2PI2 E;  4EQP A;  1O7L A;  1XTC D;  5LHY 1;  1JOR A;  2R7D A;  1R9T H;  4JVZ A;  3NBI A;  4LFA L;  3KF6 A;  3Q0A A;  2JQO A;  3S17 H;  5C44 G;  2L15 A;  3I2Z A;  5DLQ E;  1CUK A;  3PF4 A;  2RCF A;  5ELF A;  3BVG A;  3KF8 B;  5T1G A;  4HAE A;  4X3T A;  3A5U A;  1ICW A;  5I9O A;  2WKC A;  2L5T A;  4MZ9 A;  4X62 L;  4KLK A;  2RBM A;  1BDO A;  5JOB A;  4HED A;  4BY1 H;  2ENB A;  4P72 A;  3RLF A;  2M9V A;  1EU4 A;  3K6O A;  2KCN A;  2KUM A;  4QIW E;  1KQS A;  2ZJQ A;  4DR1 L;  1VQ4 A;  1CK1 A;  2AQ3 B;  2AWO A;  3KOJ A;  2BE5 D;  1TWH B;  3L9A X;  3S1Q H;  3ER0 A;  1DJR D;  4A3B H;  1KHI A;  3PUX A;  1ET6 A;  1X6O A;  2CW0 D;  5EPJ A;  5GQO A;  5ELD A;  2EZV A;  3D0F A;  3Q8D A;  3RZO H;  3M4Q A;  4HIO A;  1EEI D;  3A7L A;  1RIP A;  4BBR G;  5FO8 B;  3J7A V;  4BXX G;  3WWV A;  1KLU D;  4JI5 Q;  1F9R A;  4KKS A;  1XMQ L;  4FXK C;  3Q6S A;  2D5D A;  2E75 C;  2SDF A;  2RDH A;  5D14 A;  4ZRZ A;  3GTG H;  2YV5 A;  1QJO A;  1G6P A;  1PLF A;  3NK9 A;  1I6V C;  3GV3 A;  2B63 H;  2VY3 A;  2HDL A;  4K2K A;  3C1E A;  1JOK A;  4ME3 A;  4C3J B;  4HCE A;  4LW1 A;  2EY2 A;  1EZ8 A;  4YWL A;  3QG1 A;  1TKW B;  5JVH 3;  3PO3 B;  4JYA L;  1BOS A;  4DK0 A;  1SE3 A;  3MHB A;  3H94 A;  3K7A H;  1VQM A;  1N34 Q;  2TMP A;  1PTO B;  1YNN D;  2VW9 A;  3QOJ A;  5EGT A;  1EFW A;  1GJX A;  3J81 j;  3CRK C;  1WTV A;  1PH3 A;  2FIN B;  3VR4 A;  3AFP A;  3MZ5 A;  1QIL A;  3KDF B;  2K5N A;  1IKM A;  1E2V A;  1WI5 A;  5IP7 G;  3CQZ B;  1E24 A;  4HID A;  2C5C A;  2FXQ A;  2PO4 A;  2I5L X;  3AU7 A;  4OO1 G;  1BVS A;  2KCM A;  3K7A B;  1SYB A;  2ZM6 L;  4FDB A;  3E0E A;  2QCP X;  4IFD G;  3GTM H;  2WAQ B;  1Z7T A;  1H9K A;  2K52 A;  3HOW B;  2K5H A;  1ONL A;  5M5Y H;  3SGI A;  3HKZ B;  4KK7 A;  5M3F H;  1PFM A;  2KEN A;  2MGS A;  2Z1C A;  4ALP A;  2CCZ A;  5I6Y A;  1B8A A;  3NE5 B;  4YWM A;  1XPO A;  1PH1 A;  1L1O B;  2GA4 B;  4LF4 L;  1F2Y A;  2A74 C;  1Q12 A;  2RSO A;  2OCE A;  2WP8 J;  5C4X G;  2VUM H;  4LMQ D;  4UDU C;  1ENC A;  4LF8 Q;  1I94 Q;  4NB3 A;  3VYS A;  4AYB B;  4A3F B;  2SEB D;  3FHW A;  3L3O C;  5M3M G;  4POF A;  3R93 A;  1MSH A;  4YHH L;  5KYL A;  2JA7 H;  4NPS A;  1VQ6 A;  4V19 0;  2XWB B;  2K05 A;  1VQO A;  3OPO A;  5C0X J;  4LUZ A;  1STA A;  1NNX A;  1J8I A;  1B4O A;  1A15 A;  1XTD A;  3BU2 A;  1D5X C;  3NWS A;  1E0B A;  1PFB A;  3T51 B;  1W6J A;  1I5F A;  1LLR D;  3H09 A;  1Q1E A;  1SMX A;  3GTL B;  2ALY B;  4DV0 L;  4LFC Q;  3FPP A;  4CJ2 C;  2L0C A;  4A3J G;  2WII B;  3RD4 A;  2HD3 A;  5KNC A;  5AJ3 Q;  1X3P A;  5LMN L;  2Q8I B;  1ZEQ X;  3F1Z A;  4XDX A;  1D5Z C;  3KYH C;  2EIF A;  1HH2 P;  4X64 L;  3NQI A;  5C44 H;  1GVP A;  4QB4 A;  3NBH B;  2PCF B;  4V0B A;  1SR3 A;  3OMC A;  2B29 A;  1FGB D;  4KJN A;  3KUP A;  4B9W A;  1EFI D;  1MKH A;  1PYS B;  1IBL L;  3I72 A;  2HHH L;  4X3U A;  4LK1 C;  2KHS A;  2NZH A;  1SFO B;  1II3 A;  1BUV T;  2B2Y C;  1SMY C;  2VL6 A;  4P2C B;  1DM0 B;  4DUY Q;  1A62 A;  3I4L A;  1OXT A;  3K5O A;  1N8R C;  2UUB L;  1UUP A;  1KL9 A;  1JB7 A;  5EAY A;  1N33 Q;  1JOO A;  2Q8R E;  4GNX A;  2JA5 G;  3BZD B;  1EQV A;  2QW7 A;  3S9W A;  1PRT B;  3HFZ B;  1PZJ D;  1TWA B;  1C9O A;  3J81 i;  4DR3 Q;  4CDF C;  1ROD A;  3FEW X;  1ZXT A;  2A6H C;  4B3R L;  1BCP B;  1BKB A;  2L12 A;  3H3V C;  1CHQ D;  4IAL A;  3S1M B;  4BXX H;  3F2D A;  1Q90 A;  1H9S B;  1TWF H;  1YNJ C;  3I4M G;  4YCU A;  2R7Z H;  4DAP A;  4A93 G;  2RHQ B;  2ZT9 C;  5C0X H;  2E8G A;  4Q0F A;  5GAE C;  5JJI A;  4NMZ A;  2E5L Q;  1X54 A;  2ATW A;  2LMC B;  3LNN A;  1H9R A;  1M4V A;  4F88 A;  4DV7 Q;  1SE2 A;  1WD0 A;  5J39 A;  3C1F A;  1EZ6 A;  1VCI A;  2ZXR A;  3B6Y A;  5E1F A;  3ULJ A;  3AYH B;  4BBR B;  1LT4 D;  1PMR A;  3MXN A;  4NW2 A;  4DV4 L;  3I4N B;  3OW7 A;  1TWC B;  2PZT A;  5C4H A;  5COY A;  2L55 A;  3BVM A;  2QKI C;  4X3K A;  1TS5 A;  2N49 A;  2OT2 A;  1QZG A;  1WD1 A;  1GD7 A;  2WAC A;  1SAP A;  2PMZ E;  3KBX A;  4UAI A;  3BVZ A;  2AQ2 B;  2JE6 I;  4JI8 Q;  1I4H A;  1AEX A;  3NPP A;  1J5E L;  3NTI A;  1HNX L;  2L4N A;  2ZTC A;  5IP7 H;  4DV2 L;  3HOV H;  3NTK A;  1KDA A;  5JJZ A;  4IQZ A;  1CFM A;  2OQ0 A;  3U9S A;  2MFI A;  1PHJ A;  2A73 B;  3A7A B;  1KLG D;  1VQL A;  1PFS A;  1HR0 W;  3CCR A;  3J81 c;  5E4X A;  3CCL A;  1JE5 A;  3FMC A;  4LFB Q;  2N88 A;  4DU9 A;  3ZYY X;  4OX9 Q;  2R93 G;  1GUG A;  1WTP A;  4A75 A;  2GVB A;  2PW7 A;  4DV3 L;  2BH2 A;  3F8T A;  1BO0 A;  3RMH A;  3D3R A;  4HTH A;  4J6H A;  4PZ8 A;  1ILP A;  5FLM G;  1HPC A;  4C3I G;  1FR3 A;  4LUV A;  3V96 A;  1D8L A;  2VNU D;  2PQA B;  2PNH A;  1G29 1;  1SYG A;  1TWG B;  4J15 A;  3GTP H;  5L37 A;  2KA7 A;  3HOU G;  3QB3 A;  1SLJ A;  2EXZ A;  3J81 E;  3S14 H;  3A8J E;  5E3F A;  4WJ4 A;  1R4Q B;  2CQA A;  2IY5 B;  5D3I B;  3F2U A;  5FK9 C;  1QG7 A;  4A3C G;  1QB5 D;  5LMU L;  2NN6 I;  1W6K A;  3EQL C;  1HNW L;  2Z4H A;  3P7J A;  5M3M H;  1K83 B;  1U4L A;  3WOE A;  3M3Y H;  1IHZ A;  4KI0 A;  4ID6 A;  4ODG A;  2PZU A;  3S2D H;  1N36 L;  2JSO A;  5M5X H;  3GDE A;  1JJ2 A;  4JI4 L;  2D2C C;  5C4X B;  1L0X B;  2XSC A;  3QJY A;  2K28 A;  1SE8 A;  3K8A A;  3H3V I;  3DEP A;  4A3J H;  3MA2 B;  2E74 C;  3T1H Q;  1WTO A;  1A3V A;  2N78 A;  4KHP L;  1HRJ A;  2R6G A;  3W2D A;  1HNZ L;  4GN5 A;  4B9X A;  4AIM A;  3BJU A;  2RKS A;  2Z6K C;  5KGU A;  5BR8 L;  4JCV E;  1V1P B;  3UDG A;  3U4Z A;  5K36 G;  4O2D A;  3BYY B;  4JI7 Q;  4HJA A;  4NP5 A;  3TZU A;  3FKI G;  2ZTE A;  4QMG A;  2IJ0 A;  1Y8P B;  3S1N H;  2HDM A;  1HTP A;  3M4P A;  2AWN A;  5D65 A;  1E3P A;  2NVY B;  4K0K Q;  1Y1V H;  4B3S L;  2HQE A;  3CMA A;  4KV6 A;  2MJ8 A;  1SJE D;  2PW5 A;  1IBM L;  4GOP A;  2JA5 H;  4RWS C;  1NR4 A;  4K5W A;  1U0L A;  1T5X D;  4NDX A;  2Q2U A;  1HTL D;  2NVT H;  2VQE L;  3ULP A;  5C3X A;  4LF7 Q;  1H9J A;  3OWE B;  1FNU A;  2MP1 A;  2AQ1 B;  3IKJ A;  1FJG L;  1VQN A;  3O13 A;  4Y52 H;  1EOV A;  1X9N A;  3AEV A;  1EUJ A;  2NZO A;  2AHO B;  3I4M H;  4JI0 Q;  1Z47 A;  4LF6 Q;  4JK1 C;  4RH6 A;  4A93 H;  2H1E A;  1X65 A;  1Q46 A;  1KTK A;  1CQV A;  3I7F A;  1TS4 A;  4EQ5 A;  4KKT A;  1PH8 A;  2E2J H;  3KLW A;  3MEH A;  1EYA A;  4DR4 Q;  5J3B A;  5I4D A;  3OSO A;  1RDP D;  4A3I H;  1JJG A;  2XWJ B;  5IYB G;  2LSS A;  1RD9 D;  4NXN Q;  5EBC A;  1WTW A;  5CBA E;  1S5E D;  2QDB A;  4R4I A;  3J7A 5;  4IUR A;  2KEC A;  1FGU A;  5ELN A;  1G2S A;  1W2B A;  1CKN B;  4A3M G;  4DFA A;  1D1I A;  4DAV A;  4POG A;  2Y0S B;  3NEN A;  4KN4 C;  3R2I A;  3GTQ H;  4GN4 B;  5KIX A;  3AMU A;  2D0P A;  2K7V A;  1DOL A;  2F0H A;  4LJZ C;  3PIP 3;  5IWA Q;  5E7N A;  1TVX A;  4A3K B;  1ENF A;  1SNC A;  4LNQ A;  1HZB A;  4XYO A;  2IHE A;  2OF1 A;  4IPD A;  1DYQ A;  1PA6 A;  3S2H H;  4MTK A;  2K1B A;  4DGZ A;  2R93 H;  1VDZ A;  1I50 H;  4BY7 H;  1MHW C;  3IRB A;  4CDD C;  3QOL A;  2UXB L;  3STB C;  1RTO A;  3I70 A;  1PRT F;  5HUR A;  2NVX B;  2SOB A;  2NVQ B;  4C3I H;  1STH A;  1BCP F;  1YEZ A;  4C1N I;  2F0E A;  3S16 B;  2L9H A;  4DV5 L;  1MBY A;  1F9S A;  2VQF Q;  1VQI A;  3W3A A;  1PH9 A;  2UU9 Q;  5JAV A;  2EYJ A;  3MWY W;  1J6Q A;  1E2Z A;  3SE0 A;  1PZI D;  4DV6 L;  4OIK A;  2Q2I A;  3HRZ C;  4B3T L;  2K5Q A;  1S5B D;  4DR7 L;  1P8L A;  2F0T A;  4LFA Q;  3A56 A;  5HGQ A;  1NJI C;  4RG1 A;  3TEH B;  2HCC A;  2K4K A;  1X3Q A;  1SJH D;  1UEA B;  1MGS A;  3HOU B;  4PV1 C;  3MXG A;  4X3S A;  1WYD A;  2RHS B;  3OIQ A;  5EBD A;  4YWK A;  3A55 A;  4JI3 L;  1TII D;  2A6E C;  4KY5 A;  1B70 B;  1EIF A;  5C3E H;  1PTO C;  4UHV A;  3KJP A;  2A69 D;  4X62 Q;  4UY8 C;  4IOA A;  1N32 L;  3CPW A;  1I6H H;  3BG3 A;  4JI1 L;  3SK5 A;  3S1R B;  3HS0 C;  1CZG A;  1WJJ A;  1HFN A;  1VQA A;  3D4R A;  3A8K E;  4BA2 I;  2ZXO A;  2QIL A;  2QEX A;  4CDC C;  2B2U A;  2OQK A;  1YHB A;  3TP6 A;  3AQQ A;  4L6T B;  4DR1 Q;  4B3M L;  3R3O A;  1JOQ A;  4G7O C;  4YY3 L;  3CCU A;  2EDG A;  5K36 H;  4FXG C;  3UE0 A;  2KEE A;  1IYV A;  3G48 A;  4JG2 A;  2OEO A;  2K5V A;  3FKI H;  1NR2 A;  5IP9 G;  2Z0S A;  5CV7 A;  2A5H A;  1J9O A;  1HZC A;  4A3G G;  3HG9 A;  4U67 3;  4OGQ C;  1KAA A;  4JV5 L;  1VQ7 A;  3N6R A;  1KXL A;  2XIW A;  1XMQ Q;  2XVS A;  2XTI A;  4P71 A;  1EIH A;  3ULL A;  1R9T B;  1OXS C;  1SEB D;  1G6Z A;  2YTY A;  3S17 B;  1VQ8 A;  4BWG B;  4J1M A;  5T1I A;  5KNB A;  3E0J A;  5KND A;  1CI3 M;  4QY7 A;  1L1O C;  4RMF A;  3BYT B;  4PMW A;  2F0Q A;  2MUY A;  5I2Y A;  2FMC A;  3F2B A;  4PNY A;  3D6W A;  3KBG A;  1GHJ A;  1UE7 A;  3NUC A;  4JYA Q;  1SYC A;  3BZC A;  4X66 L;  5I6W A;  1M90 C;  4BY1 B;  2IL8 A;  2WB1 G;  5E4W C;  1EY7 A;  1VMC A;  1LTI D;  4R8N A;  4KD3 A;  3S24 A;  5M9O A;  3RN2 A;  2KCC A;  4I65 A;  4XT1 B;  4DV1 L;  2V1C C;  1DCZ A;  2R7Z G;  2X6G A;  2AKW B;  1GUN A;  5FKA C;  1EQR A;  3WOF A;  5C0X G;  1LAC A;  3CRL C;  2B2T A;  1AZQ A;  3S1Q B;  2JA6 H;  4A3B B;  1HFG A;  5CV8 A;  2VS1 A;  2CH4 A;  1Q1B A;  5IYB H;  1AP0 A;  1CTM A;  3RZO B;  1KDB A;  2UUA L;  4JBW A;  4DAY A;  4HJ7 A;  2ZM6 Q;  1A6X A;  3CD6 A;  4OHJ A;  1A2U A;  1LTL A;  3M85 A;  5EJW A;  5K5P A;  4K8J A;  1VF7 A;  3GTG B;  2Z6B A;  1IL8 A;  1EIG A;  4TKO B;  1IZ6 A;  1XX8 A;  2A19 A;  3GQB A;  1O7Z A;  4A3M H;  2B63 B;  1K3B C;  2L1B A;  3UDX A;  2Z6K A;  1EY6 A;  5CR3 A;  5CV6 A;  3HOV G;  3J7A F;  3TP8 A;  3NQT A;  3JAM c;  1ZKO A;  1X3F A;  1BNZ A;  1U4P A;  4LF4 Q;  2V4D A;  3I91 A;  2F0M A;  2HUG A;  3PUW A;  3DWA A;  3MXN B;  4RHS A;  1F9Q A;  4DK1 A;  1CA5 A;  2PI2 A;  2G9H D;  5G3L F;  3T1Y L;  3K57 A;  4E6I A;  1MD2 D;  4JI2 L;  1PRT C;  1EEF D;  3HOZ H;  4YHH Q;  1OXU A;  2IT1 A;  3IFT A;  2WIN B;  3CP0 A;  3Q24 A;  1HA6 A;  1BCP C;  4Z9C B;  3I55 A;  3JAM E;  4X65 L;  3MC0 B;  4N8X 1;  1SNO A;  3TSS A;  1IYJ B;  2GN5 A;  4C2M H;  1VQB A;  3LGJ A;  1SYD A;  1GO3 E;  1EY0 A;  1TR5 A;  4DV0 Q;  3EFX D;  3GTM B;  2B2W C;  5LMN Q;  4UP7 A;  4XXE A;  3C46 A;  2O4X A;  5M5Y B;  4X64 Q;  2KVM A;  1RF2 D;  1D6E C;  3HZX A;  5M3F B;  2HT1 A;  1LT3 D;  3RUZ A;  1VQC A;  3CC7 A;  4DUZ L;  2F3I A;  4NKL A;  3V05 A;  3PCO B;  2F3W A;  1CKO A;  1Y8O B;  4DPG A;  1FNW A;  1A8V A;  1VQH A;  2AUJ D;  3I8Z A;  1PRT D;  4JC0 A;  5M5W H;  1IBL Q;  2HHH Q;  2F4V L;  1X55 A;  4A76 A;  2VUM B;  1FYC A;  4HN7 A;  4C3H H;  2WAQ E;  4DR2 L;  4NXM Q;  4DR6 L;  1BCP D;  1RCV D;  2CVR A;  4AH6 A;  4XYQ A;  3JC6 6;  3HKZ E;  2R7F A;  5HY6 A;  1GUT A;  4WOR A;  3DLL A;  5C4J H;  2F0D A;  3LWE A;  4ZUI A;  2JA7 B;  2A8V A;  3SK8 A;  4IUU A;  2BOS A;  1EWI A;  1ASY A;  5DEH A;  5JVG 3;  1TS3 A;  1STG A;  1MJC A;  1O78 A;  1VQK A;  3I4O A;  4M1U B;  4B3R Q;  5IP9 H;  1T5E A;  1BF4 A;  1VQP A;  4K6L A;  4A3G H;  2M00 A;  3KJO A;  4AYB E;  3S15 H;  5ISR A;  1KRT A;  2LXK A;  1Y14 B;  4RA8 A;  5COR A;  2EXD A;  4JOI A;  3TZD A;  3TN2 A;  1Y1V G;  1LT6 D;  3OHX C;  5C44 B;  1XPU A;  1VF5 C;  2ICE C;  3G6E A;  2EYP A;  1RTN A;  1GUS A;  2H5X A;  1FL0 A;  1S5D D;  5BN4 A;  3L7Z C;  4ZUJ A;  3PMF A;  2CKZ B;  4AQY L;  3DMU A;  1XNR L;  1U4R A;  1B3Q A;  3KFU A;  5LL6 S;  1C7Y A;  1VMP A;  1KRS A;  5BN5 A;  4HCS A;  4DV4 Q;  3SHL A;  4IJL A;  1IW7 C;  2EYL A;  2QA4 A;  1E1O A;  1WCM G;  2K33 A;  5J22 A;  3PIP A;  5C4Z A;  2ASB A;  2JN4 A;  1EYD A;  4A3D H;  4FYD A;  4LF5 L;  1ESR A;  3VR2 A;  1EYC A;  1S72 A;  4IPG A;  1JMC A;  3EA6 A;  2K6A A;  1J5E Q;  1HNX Q;  4RGN A;  2QGQ A;  4DV2 Q;  4JI6 L;  1SE4 A;  1OO9 B;  3CC2 A;  3OWF A;  2F4I A;  1SMY D;  4GOP B;  1JWS D;  2IPK D;  3RN5 A;  2WFW A;  1SSO A;  4A3I G;  1B44 D;  1VQE A;  4HJ8 A;  2DJF C;  2BDN A;  2WB1 B;  4G7H C;  3UE1 A;  3P20 A;  1HCZ A;  4G7Z C;  1TWF B;  1H95 A;  1K0S A;  4FF1 A;  2SNS A;  1JWU D;  4BA1 I;  1KD1 C;  3KDF A;  3MEF A;  4UPA A;  2JP1 A;  2R7Z B;  5CMD A;  3N52 A;  4ME5 A;  4Y7N H;  4DV3 Q;  1Y8N B;  4ZCK A;  1QUQ B;  1K8G A;  2A6H D;  4PG3 A;  2LFN A;  1FVI A;  1X3G A;  1S4Z A;  1PH6 A;  3PUZ A;  3QIA A;  3GTK H;  1Y1W G;  5CV9 A;  1YNJ D;  1YNX A;  1SND A;  3URY A;  2R61 A;  3UDI A;  1X3E A;  2CQO A;  1STN A;  1D7Q A;  1LTS D;  2L11 A;  4N8F A;  1LTB D;  3UDF A;  3K58 A;  1NCV A;  5LMU Q;  4EQN A;  5HGT A;  4BY7 G;  1HNW Q;  2NN6 H;  3TS0 A;  1U9R A;  4F7X A;  1NE3 A;  4A3E H;  2LXJ A;  4EVO A;  3Q23 A;  3HOV B;  2LY7 A;  2F0P A;  1HZA A;  4DXG A;  1N36 Q;  1IKL A;  2HIX A;  3EJI A;  4K6D A;  2NZ1 D;  5IGG A;  4JI4 Q;  1XJV A;  4ULL A;  2E2H H;  2EJG C;  4OEL B;  3EBE A;  3HOY H;  3Q22 A;  3SVM A;  4PMC A;  3MVV A;  3T4A C;  5FO9 B;  1JT8 A;  3H3V H;  5IOD A;  4DA2 A;  4HMJ A;  4OXP A;  1HNZ Q;  3L0O A;  4IN3 A;  2F3V A;  4IUN A;  3SR1 A;  2JA8 H;  4LUO A;  4GKK Q;  1VQ9 A;  4HSV A;  3H0G G;  1L2F A;  4OO1 I;  5BR8 Q;  4IPH A;  4GN3 B;  3GTP B;  2N55 A;  3JAM L;  5G3L D;  2R92 G;  1GHK A;  3S14 B;  5JJL A;  1SRU A;  4IFD I;  4O0A A;  1PTO F;  4ILW A;  2DY7 A;  5C3E G;  1WTX A;  2X69 A;  2F0W A;  5IGE A;  2IX0 A;  1BBU A;  4FXD A;  1K0R A;  2Z8L A;  4CJ0 B;  5EKI A;  5M3M B;  2MO1 A;  4P75 A;  1LTG D;  1L0Y B;  5EPL A;  4HR7 B;  4IZ8 A;  3M3Y B;  2CWP A;  3GV6 A;  3M7N A;  1YBY A;  3P1H A;  1IBM Q;  1E22 A;  2NTS A;  4RHR A;  3S2D B;  1HXY D;  2K14 A;  3RZD H;  5M5X B;  4H7B A;  2XN9 C;  3ND9 A;  1DON A;  3GTO H;  1R4P B;  2VQE Q;  4DF7 A;  3M4Y A;  4BBS H;  1UEB A;  3DWP A;  3MAQ A;  1AW7 A;  1V1Q A;  1DXM A;  1NTG A;  4A3J B;  1FJG Q;  1JC7 A;  3J80 L;  3HKS A;  3RLO A;  4FO2 A;  4BS9 A;  3K80 C;  1ET9 A;  3OTO L;  3R2T A;  3AFQ A;  4OWX B;  1Q3L A;  1EY9 A;  5FLX L;  3KF6 B;  4GLV B;  5JEA G;  1ZYR C;  4DKA C;  2D62 A;  4L63 B;  2RA4 A;  3S1N B;  1VQG A;  2E2I H;  3FDT A;  3NHH A;  1STB A;  2B2W A;  5FJ8 H;  1HHV A;  4FF3 A;  1DOK A;  1WCM H;  1F77 A;  1Y1V B;  3HEJ A;  4IPC A;  2MPM A;  3NP8 A;  4H02 A;  2UUC L;  2UXD L;  3IAY A;  3C2P A;  2KQ3 A;  4N9T A;  2DUD A;  3K0X A;  2N8N A;  2JA5 B;  1QVF A;  3GTJ H;  5DM6 3;  2NYZ D;  3H91 A;  4K2L A;  2VB2 X;  4R1J A;  1T9H A;  2JA6 G;  2NVT B;  4C3J G;  4ZKB B;  4WFN 3;  4ABN A;  1EQQ A;  2RVL A;  3K81 C;  1CZW A;  3W5O A;  3ITP A;  4KHV A;  2F03 A;  3VYU A;  1YHA A;  3I73 A;  1I3Q H;  4ZK9 B;  3X3M A;  4C56 C;  1TT2 A;  1CA6 A;  3I4M B;  3EVQ A;  5JJK A;  4A93 B;  3KLS X;  2UXB Q;  2E2J B;  1M8A A;  2EYF A;  3M4O H;  5IT9 L;  1TS2 A;  3MXP A;  1RKN A;  4CJ1 B;  1EU3 A;  4MTN A;  4DR5 L;  1Y1W H;  1SNP A;  1WOC A;  5DM7 3;  4A3I B;  2CH4 W;  2DNC A;  4DV5 Q;  1YZ6 A;  3K5M A;  1JB3 A;  2A68 C;  5LL6 X;  1EY4 A;  3D31 A;  2NBF A;  3FVQ A;  5GRO A;  4F87 A;  3FPU B;  1A63 A;  2EQS A;  2B2Y A;  2EYO A;  4QUF A;  2B3G A;  5LMN W;  3GP7 A;  4DAY B;  1IBK L;  4JI0 L;  2UXC Q;  4GZY C;  1STY A;  2WAQ G;  4R4C A;  4H0L C;  2AUK A;  2PQA A;  4DNT B;  3HOW G;  4B3T Q;  4DR7 Q;  3A5Z B;  4MHE A;  2P5Z X;  3NTH A;  3HOZ G;  1K8A C;  2G9D A;  1YJ9 A;  4RAU C;  3EN2 A;  3GTQ B;  2YU9 H;  4GKJ L;  3MXU A;  4XQJ A;  4NXN L;  1Z9F A;  2YTV A;  4JI3 Q;  5ELO A;  4ZYS A;  1XNQ L;  1N32 Q;  3W1G A;  1B3A A;  1YVC A;  5JEA J;  3S2H B;  4MNO A;  4JI1 Q;  2NB0 A;  3PO2 H;  1NUC A;  2R93 B;  3PIO 3;  1I50 B;  4BY7 B;  4FNF A;  1CM9 A;  1WTQ A;  3OMG A;  2DY8 A;  2Y0S E;  4KJO A;  4A3F G;  4X6A H;  4FF2 A;  3MFY A;  1QVC A;  3ERS X;  5CBE E;  4GNX C;  5IE8 A;  4C3I B;  4B3M Q;  1D2B A;  3H0G H;  2QF7 A;  1ENA A;  1H9M A;  2EPB A;  2R92 H;  1ILQ A;  2J7Z A;  3STB D;  1OXV A;  2Z4I A;  2KCT A;  1XMO L;  3IFD A;  4C3H G;  3NEM A;  4TRD A;  3RLN A;  4O1N A;  3HOX H;  2OTL A;  2J0T D;  2XRS D;  4JV5 Q;  1I4R A;  2WV6 D;  4DNR B;  2OWO A;  4ZLT F;  4LF9 L;  2IX3 A;  1G91 A;  1V1P A;  1V43 A;  3H0G B;  1PH2 A;  1LYL A;  2EYM A;  3PUY A;  1AZP A;  4QF4 A;  1RL2 A;  3J7Y W;  2NWG A;  2MO0 A;  4JBK A;  1F2M A;  3T53 B;  5TSS A;  1YI2 A;  2B39 A;  5C3E B;  5J1Z A;  2JK8 A;  1E2W A;  2RQX A;  1M1K C;  4RGO S;  3K5L A;  4DK6 C;  2BE5 C;  1HR0 L;  1I6H B;  4X66 Q;  2MNA A;  2CW0 C;  1EYG A;  1D5M C;  3K59 A;  1Q81 C;  1PFN A;  4DV1 Q;  2A6E D;  1NY4 A;  2DGY A;  4S3S A;  1PTO D;  2D0O A;  3CCQ A;  3H6M A;  4MIU A;  3E3X A;  4YIJ A;  2EY6 A;  2MHV A;  1GUO A;  1V8Q A;  1TWH H;  4KTA A;  5AFW A;  4DK3 C;  3OOC A;  3ONA B;  4L5T A;  2N3S A;  3JAM i;  5JEA H;  4WJW A;  3FKI B;  3QR8 A;  3SXH A;  4R4Q A;  3A74 A;  3M9B A;  4RGM A;  2F0L A;  2UUA Q;  3BDO A;  1B7Y B;  3G4S A;  3CCJ A;  4ZQ3 A;  1ASZ A;  1TY0 A;  3SEB A;  4RCO A;  4IJH A;  4JPB W;  4TVA B;  2ZJP A;  1STE A;  3TQY A;  4QUC A;  3G6J B;  1HQM C;  4HSP A;  1HJP A;  2I07 B;  4A3D G;  2XGT A;  1GKH A;  3DUZ A;  2B2V C;  5IYD G;  1YNN C;  1HQR D;  3RNU A;  1YIT A;  1V9P A;  2EY1 A;  4XTC S;  4C3J H;  5KYI A;  1TQO A;  2E2D C;  4GNX B;  4PQX A;  4QL5 A;  1IL2 A;  2YYZ A;  1NAP A;  3PO3 H;  4H13 C;  4R9W A;  2JYO A;  4QJF A;  3I4N G;  4DAM A;  1SXT A;  3M7G A;  3J80 i;  1CKN A;  3ND8 A;  1CT1 D;  1PTO H;  3FP9 A;  4J8Q A;  3F2C A;  2O2L D;  4OL7 A;  1F2L A;  1LO5 D;  2EOT A;  1S5F D;  2K03 A;  3T1Y Q;  4K5V A;  3CCS A;  3V2T A;  1AE3 A;  4JI2 Q;  1TU2 B;  3DHQ A;  1JR0 D;  2JA6 B;  1PZK D;  2IW3 A;  3CQZ H;  4X65 Q;  3ICE A;  4R4T A;  4KMU C;  2HIV A;  3IL8 A;  1Z6H A;  2IHF A;  1JCK B;  4RKL A;  1JWM D;  1I4Q A;  2D9U A;  5H1S E;  2VB3 X;  1PDQ A;  1NMG A;  1CSQ A;  4JI5 L;  2A1A A;  3ERO A;  3K5N A;  1RHP A;  2K32 A;  3CCE A;  1KNA A;  3CU7 A;  4P74 A;  1DZ1 A;  3HOW H;  4A3M B;  2NN6 G;  3CW2 C;  4IUQ A;  5CV4 A;  4DUZ Q;  1S40 A;  4A3E G;  2EYH A;  1A3T A;  1UE6 A;  3QO2 A;  5CV5 A;  5DNF A;  3NSW A;  1YHQ A;  1PH7 A;  1AFP A;  4KD4 A;  1GM5 A;  4L5S A;  2EE1 A;  3GO5 A;  1S5C D;  2F4V Q;  4IUP A;  1PH4 A;  1B1Z A;  3DWQ A;  1SDF A;  4DR2 Q;  3HOY G;  4DR6 Q;  1N34 L;  5KEE A;  4RFB A;  2Q2T A;  2FHT A;  4OON A;  3J80 c;  5IY0 A;  4A3F H;  1GUW A;  1LUZ A;  3HOZ B;  1HA5 A;  4JBJ A;  4GOP C;  3WDN A;  2DNE A;  3BZK A;  3MFG A;  4EGV A;  5C5M A;  2JA8 G;  4RCN A;  3QWN A;  5IYC G;  3CME A;  3TRZ A;  1WVL A;  5FLX c;  1LM0 A;  1PYW D;  4C2M B;  4G57 A;  1QZH A;  3A8I E;  1QNU A;  2G5D A;  2DJG C;  3VA5 A;  2IWH A;  2LS0 1;  2TSS A;  1OXX K;  1UE5 A;  3GTL H;  1MIU A;  2HCI A;  3J7Z C;  4A3L G;  1EL0 A;  2B8F A;  3J80 E;  1ESF A;  1KDC A;  1SYE A;  4OIJ A;  1EOT A;  5ELE A;  3R8B A;  2UUB Q;  4YCW A;  1PH5 A;  3BS1 A;  3VYT A;  2H4O A;  2K5D A;  2PZW A;  1G51 A;  4KHZ A;  5FLX E;  5KRU A;  3KF8 A;  1WFQ A;  2PQE A;  1KC8 C;  1C4Q A;  2JJQ A;  4DNI A;  2XRQ D;  3KK7 A;  4AQY Q;  1XNR Q;  1F2Z A;  1O7Y A;  5M5W B;  1SNQ A;  1Q86 C;  1JJC B;  3NXW A;  4C3H B;  4BBS G;  1YJN A;  1SFO H;  3EIV A;  4LF8 L;  1I94 L;  2RDG A;  1SYF A;  1A2T A;  4K5X A;  3P75 A;  4JW0 A;  1CHP D;  4M8A A;  3W1B A;  1IYU A;  1B9N A;  1GXD C;  5C4J B;  4WJ3 M;  4LF5 Q;  4N9P A;  1JE4 A;  5IGD A;  1OTC A;  1YIJ A;  4JI6 Q;  3LWU A;  4L5Q A;  5IT9 c;  4A4I A;  4HIM A;  3RR5 A;  5IOC A;  1XXG A;  1ICF B;  1TWA H;  2CHB D;  2I0Q A;  1LTR D;  4KKU A;  5C5L A;  1YJW A;  1K9M C;  4XIG S;  4NXM L;  4KN7 C;  4A3G B;  2BCO A;  2FJ2 A;  3I56 A;  4LFC L;  2F0I A;  1C48 A;  4CGY B;  3S15 B;  3S1M H;  1TY2 A;  1I4P A;  5A2Q L;  5AJ3 L;  1PVO A;  1HUN A;  5GAG C;  2KBN A;  5FJ8 G;  1DD2 A;  4KY7 A;  1DOM A;  2FMM A;  4IFD J;  1Q8I A;  3CHB D;  3HGB A;  4CBV A;  2RF4 A;  2PMZ B;  5IT9 E;  5IYD H;  4JBM A;  5F2D A;  5I9P A;  4TSS A;  1PV4 A;  1QVG A;  1QWY A;  4R4O A;  2ZJR A;  1BXT A;  1KNE A;  1N9W A;  1LT5 D;  4BBR H;  1U4M A;  3I4N H;  1TWC H;  2F0U A;  1KIX A;  1QCB D;  5C3W A;  3CXC A;  4DUY L;  4B08 A;  4QQB X;  1K28 A;  4A3D B;  2C35 B;  3G71 A;  4UP9 A;  1N33 L;  5EPK A;  4DXF A;  3CPF A;  2Y0S G;  3TP7 A;  3PIO A;  1IW7 D;  3E6Z X;  4FP5 D;  3U58 A;  1VQJ A;  2JA9 A;  4DR3 L;  2EVB A;  1HUM A;  2K04 A;  3VR3 A;  2BA1 A;  4A3K G;  1SN8 A;  5BN3 A;  3NWT A;  1B9M A;  2F0G A;  4OWW B;  4F8M A;  2QDL A;  3PV0 A;  5C0X I;  4LWC A;  4Y7N B;  2B2U C;  1BR9 A;  2F0K A;  4I7A A;  4PMB A;  1VQ5 A;  4ZKC B;  2E5L L;  2ID0 A;  2F0N A;  2KHJ A;  1XYI A;  3VDY A;  3GTK B;  3HP3 A;  1I4X A;  1L1O A;  4DV7 L;  2RDF A;  4FVM A;  1C8C A;  1HZ9 A;  1TWG H;  4OO1 H;  2C9O A;  4TQU S;  1QE6 A;  2RCN A;  2WB1 E;  3CKI B;  2E76 C;  1E7Z A;  3U50 C;  1O7I A;  4XQN A;  2LKV A;  1GOZ A;  1V1O A;  2F0V A;  4IFD H;  1MJE A;  5IGF A;  3DM3 A;  3PO2 G;  2F52 A;  3K7U C;  1Q7Y C;  4KHP Q;  1EWC A;  1SBB B;  2AMC B;  5A35 A;  3VA7 A;  3DXJ C;  4JI8 L;  4A3E B;  1K83 H;  1K8M A;  2B2V A;  3UI2 A;  1UNS A;  1WTR A;  4UP8 A;  5CGK A;  4QGU A;  5IYC H;  1PYB A;  1NBW A;  3GD7 A;  1X56 A;  5D3D A;  3PQI A;  3T56 B;  5C4X H;  2E2H B;  4MN3 A;  3OW2 A;  3HOY B;  3PF5 A;  1D1K A;  1ML0 D;  2ZXP A;  3E5S A;  2EY5 A;  4LFB L;  1BBW A;  1AE2 A;  2J4X A;  3TP5 A;  4OX9 L;  1QOH A;  4A3L H;  1MSG A;  3HOX G;  3C3L A;  4YCV A;  3PSI A;  2EJF C;  3K0Y A;  3NBH A;  3OTO Q;  4OEM B;  4B3S Q;  3VYR A;  2JA8 B;  3PGZ A;  4HJ9 A;  3H15 A;  2B2T C;  2SNM A;  2M2L A;  5FO7 B;  3SK6 A;  1NSN S;  2K75 A;  5NUC A;  3D6C A;  3TBI B;  4QCL A;  5C6A A;  4CKC A; 
#chains in the Genus database with same CATH homology
 2F0J A;  4I7Z C;  2BDO A;  4K14 A;  4R8I A;  2JEA I;  3D4D A;  2KED A;  3AB9 A;  4G4K A;  2K01 A;  4L8J A;  2O5I C;  4FF4 A;  2PYK A;  3I90 A;  1F9P A;  2K5W A;  3D4W A;  5ELB A;  1JQY D;  3VR6 A;  3X3N A;  1I4G A;  1KAB A;  1MI2 A;  2B8G A;  3RZD B;  1CQF A;  3LX0 A;  1LV9 A;  3GTO B;  2BA0 A;  3I3C A;  4BBS B;  3TME A;  2R3Z A;  1H9S A;  1B50 A;  2DN8 A;  4CKE A;  3BDC A;  1EY5 A;  3BDL A;  4CHT B;  3ERQ A;  5IGC A;  3U9O A;  2OXP A;  2IX1 A;  4WRD A;  5CYU A;  5EKL A;  4ZAI A;  5ELC A;  5IIF A;  1QNK A;  2PNR C;  2ICI A;  4XQQ A;  1EY8 A;  2E2I B;  4EQO A;  2VXW A;  4U68 A;  2XNA C;  3T16 A;  3DEO A;  1WCM B;  1BBX C;  1O80 A;  5FOB B;  2F1M A;  1ZYR D;  2F0F A;  3GTJ B;  4CKB A;  4KY6 A;  4Q5V A;  4RKB A;  3D8G A;  4IUT A;  5DAU A;  4LAA A;  5JPM C;  1B2T A;  4K8I A;  1SNM A;  1I3Q B;  5IGB A;  5EQ0 A;  2O5J C;  1UAP A;  1G8Z D;  1LTT D;  4XT3 B;  3SDZ A;  2Q8T A;  2X6L A;  3PUV A;  3KLS A;  3FRP B;  3M4O B;  3A54 A;  1Y1W B;  2PPB C;  3SK4 A;  1Y69 U;  3G7L A;  3OIP A;  4DN4 M;  3TDQ A;  5I2X A;  2KOL A;  1LAB A;  2A69 C;  4RGT A;  2KJX A;  2A68 D;  5CC4 A;  5EKK A;  2YU9 B;  1AN8 A;  1EQT A;  2F0O A;  2NUC A;  1FNV A;  2RSN A;  1FD7 D;  1EWH A;  2WKD A;  1JIC A;  1G2T A;  3MTS A;  3KLR A;  3PO2 B;  1PXU A;  2F0S A;  1BQQ T;  2JEB I;  2EJM A;  4O42 A;  4HMI A;  1LTA D;  1A3U A;  1XWE A;  1X32 A;  2QEJ C;  1B53 A;  4H44 C;  1K8O A;  3T13 A;  4QIW B;  2R92 B;  5JPN C;  2FFK B;  2NTT A;  3VR5 A;  2I46 A;  1RJT A;  3J81 L;  2JXM B;  4C1N K;  4IUV A;  3HOX B;  5A2Q E;  3DM1 A;  4EQP A;  1O7L A;  1XTC D;  5LHY 1;  1JOR A;  3NBI A;  3Q0A A;  5ELF A;  3BVG A;  5T1G A;  4HAE A;  4X3T A;  1ICW A;  5I9O A;  2WKC A;  2L5T A;  2RBM A;  1BDO A;  5JOB A;  4HED A;  2ENB A;  3RLF A;  2M9V A;  1EU4 A;  3K6O A;  2KCN A;  2KUM A;  1CK1 A;  2AQ3 B;  2AWO A;  2BE5 D;  1TWH B;  3L9A X;  1DJR D;  3PUX A;  1ET6 A;  2CW0 D;  5EPJ A;  2EZV A;  5ELD A;  1EEI D;  3A7L A;  5FO8 B;  3J7A V;  1KLU D;  1F9R A;  4KKS A;  4FXK C;  3Q6S A;  2D5D A;  2E75 C;  2SDF A;  2RDH A;  5D14 A;  4ZRZ A;  1QJO A;  1PLF A;  3NK9 A;  1I6V C;  3GV3 A;  2HDL A;  4K2K A;  3C1E A;  1JOK A;  4C3J B;  4HCE A;  2EY2 A;  1EZ8 A;  3QG1 A;  1TKW B;  5JVH 3;  3PO3 B;  1BOS A;  4DK0 A;  1SE3 A;  3MHB A;  3H94 A;  2TMP A;  1PTO B;  1YNN D;  3QOJ A;  5EGT A;  1GJX A;  3CRK C;  1WTV A;  2FIN B;  3VR4 A;  3MZ5 A;  1QIL A;  1IKM A;  1E2V A;  3CQZ B;  2C5C A;  2PO4 A;  3AU7 A;  4OO1 G;  3K7A B;  1SYB A;  2QCP X;  4IFD G;  2WAQ B;  1Z7T A;  1H9K A;  3HOW B;  1ONL A;  3HKZ B;  4KK7 A;  1PFM A;  2MGS A;  2Z1C A;  5I6Y A;  3NE5 B;  2GA4 B;  1F2Y A;  2A74 C;  1Q12 A;  2RSO A;  2WP8 J;  4LMQ D;  4UDU C;  1ENC A;  3VYS A;  4AYB B;  4A3F B;  2SEB D;  3L3O C;  3R93 A;  1MSH A;  5KYL A;  4V19 0;  2XWB B;  2K05 A;  3OPO A;  5C0X J;  1STA A;  1J8I A;  1A15 A;  1B4O A;  1D5X C;  3NWS A;  1E0B A;  1PFB A;  3T51 B;  1W6J A;  1LLR D;  3H09 A;  1Q1E A;  3GTL B;  3FPP A;  4CJ2 C;  2L0C A;  2WII B;  3RD4 A;  5KNC A;  1X3P A;  2Q8I B;  1ZEQ X;  4XDX A;  1D5Z C;  3NQI A;  4QB4 A;  2PCF B;  4V0B A;  3OMC A;  1FGB D;  4KJN A;  3KUP A;  4B9W A;  1EFI D;  3I72 A;  4X3U A;  4LK1 C;  2KHS A;  1SFO B;  1II3 A;  1BUV T;  2B2Y C;  1SMY C;  4P2C B;  1DM0 B;  3I4L A;  1OXT A;  3K5O A;  1UUP A;  1JOO A;  2Q8R E;  3BZD B;  1EQV A;  3S9W A;  1PRT B;  1PZJ D;  1TWA B;  1ROD A;  3FEW X;  1ZXT A;  2A6H C;  1BCP B;  2L12 A;  3H3V C;  1CHQ D;  4IAL A;  3S1M B;  1Q90 A;  1H9S B;  1YNJ C;  4DAP A;  2ZT9 C;  5C0X H;  4Q0F A;  4NMZ A;  2LMC B;  3LNN A;  1H9R A;  1M4V A;  4F88 A;  1SE2 A;  1WD0 A;  5J39 A;  3C1F A;  1EZ6 A;  1VCI A;  2ZXR A;  5E1F A;  4BBR B;  1LT4 D;  1PMR A;  3MXN A;  4NW2 A;  3I4N B;  3OW7 A;  1TWC B;  2PZT A;  5C4H A;  5COY A;  2L55 A;  3BVM A;  2QKI C;  4X3K A;  1TS5 A;  2OT2 A;  1WD1 A;  2WAC A;  1SAP A;  3KBX A;  4UAI A;  3BVZ A;  2AQ2 B;  2JE6 I;  1I4H A;  1AEX A;  3NPP A;  3NTI A;  2L4N A;  3NTK A;  1KDA A;  5JJZ A;  4IQZ A;  1CFM A;  3U9S A;  2A73 B;  3A7A B;  1KLG D;  5E4X A;  3FMC A;  2N88 A;  4DU9 A;  3ZYY X;  1GUG A;  1WTP A;  2PW7 A;  1BO0 A;  3RMH A;  3D3R A;  4HTH A;  4J6H A;  1ILP A;  1HPC A;  4C3I G;  1FR3 A;  3V96 A;  2VNU D;  1G29 1;  1SYG A;  1TWG B;  2KA7 A;  3QB3 A;  2EXZ A;  3J81 E;  3A8J E;  5E3F A;  1R4Q B;  2CQA A;  5D3I B;  3F2U A;  5FK9 C;  1QG7 A;  1QB5 D;  2NN6 I;  1W6K A;  3EQL C;  2Z4H A;  3P7J A;  1K83 B;  1U4L A;  3WOE A;  1IHZ A;  4KI0 A;  4ID6 A;  4ODG A;  2PZU A;  2JSO A;  2D2C C;  5C4X B;  1L0X B;  2XSC A;  3QJY A;  2K28 A;  3DEP A;  3MA2 B;  2E74 C;  1WTO A;  1A3V A;  1HRJ A;  2R6G A;  3W2D A;  4B9X A;  2RKS A;  5KGU A;  1V1P B;  5K36 G;  3BYY B;  4NP5 A;  3TZU A;  4QMG A;  2IJ0 A;  1Y8P B;  2HDM A;  1HTP A;  2AWN A;  5D65 A;  2NVY B;  2HQE A;  4KV6 A;  2MJ8 A;  1SJE D;  2PW5 A;  4RWS C;  1NR4 A;  4K5W A;  1T5X D;  4NDX A;  1HTL D;  5C3X A;  1H9J A;  3OWE B;  1FNU A;  2MP1 A;  2AQ1 B;  3IKJ A;  3O13 A;  1Z47 A;  4JK1 C;  4RH6 A;  2H1E A;  1KTK A;  1CQV A;  1TS4 A;  4KKT A;  3MEH A;  1EYA A;  5I4D A;  3OSO A;  1RDP D;  2XWJ B;  1RD9 D;  5EBC A;  1WTW A;  5CBA E;  1S5E D;  2QDB A;  4IUR A;  2KEC A;  1G2S A;  4DFA A;  1D1I A;  4DAV A;  2Y0S B;  4KN4 C;  3R2I A;  5KIX A;  3AMU A;  2K7V A;  1DOL A;  2F0H A;  4LJZ C;  3PIP 3;  1TVX A;  4A3K B;  1ENF A;  1SNC A;  4XYO A;  2OF1 A;  1DYQ A;  2K1B A;  4DGZ A;  1VDZ A;  3QOL A;  1RTO A;  3I70 A;  1PRT F;  5HUR A;  2NVX B;  2SOB A;  2NVQ B;  1STH A;  1BCP F;  4C1N I;  2F0E A;  3S16 B;  2L9H A;  1MBY A;  1F9S A;  3W3A A;  5JAV A;  2EYJ A;  3MWY W;  1E2Z A;  3SE0 A;  1PZI D;  4OIK A;  3HRZ C;  2K5Q A;  1S5B D;  2F0T A;  3A56 A;  2HCC A;  1X3Q A;  1SJH D;  1UEA B;  1MGS A;  3HOU B;  4PV1 C;  3MXG A;  4X3S A;  3OIQ A;  5EBD A;  3A55 A;  1TII D;  2A6E C;  4KY5 A;  1PTO C;  2A69 D;  3BG3 A;  3SK5 A;  3S1R B;  3HS0 C;  1CZG A;  1HFN A;  3D4R A;  3A8K E;  4BA2 I;  2ZXO A;  2QIL A;  2B2U A;  3TP6 A;  4L6T B;  3R3O A;  1JOQ A;  4G7O C;  2EDG A;  5K36 H;  4FXG C;  2KEE A;  1IYV A;  2OEO A;  1NR2 A;  5CV7 A;  2A5H A;  1J9O A;  3HG9 A;  4U67 3;  4OGQ C;  1KAA A;  3N6R A;  2XIW A;  2XVS A;  1EIH A;  1R9T B;  1OXS C;  1SEB D;  1G6Z A;  3S17 B;  4BWG B;  4J1M A;  5T1I A;  5KNB A;  3E0J A;  5KND A;  1CI3 M;  3BYT B;  4PMW A;  2F0Q A;  2MUY A;  5I2Y A;  2FMC A;  4PNY A;  3D6W A;  3KBG A;  1GHJ A;  3NUC A;  1SYC A;  5I6W A;  4BY1 B;  2IL8 A;  5E4W C;  1EY7 A;  1VMC A;  1LTI D;  4R8N A;  4KD3 A;  5M9O A;  2KCC A;  4I65 A;  4XT1 B;  1DCZ A;  2X6G A;  1GUN A;  5FKA C;  3WOF A;  5C0X G;  1LAC A;  3CRL C;  2B2T A;  1AZQ A;  3S1Q B;  4A3B B;  1HFG A;  5CV8 A;  1Q1B A;  1AP0 A;  1CTM A;  3RZO B;  1KDB A;  4JBW A;  4DAY A;  1A6X A;  4OHJ A;  1A2U A;  3M85 A;  5EJW A;  5K5P A;  4K8J A;  1VF7 A;  3GTG B;  1IL8 A;  1EIG A;  4TKO B;  1XX8 A;  3GQB A;  1O7Z A;  2B63 B;  2L1B A;  1EY6 A;  5CR3 A;  5CV6 A;  3J7A F;  3TP8 A;  3NQT A;  1ZKO A;  1BNZ A;  1U4P A;  2V4D A;  3I91 A;  2F0M A;  2HUG A;  3PUW A;  3DWA A;  4RHS A;  1F9Q A;  4DK1 A;  1CA5 A;  2G9H D;  5G3L F;  3K57 A;  4E6I A;  1MD2 D;  1PRT C;  1EEF D;  1OXU A;  2IT1 A;  3IFT A;  2WIN B;  3Q24 A;  1HA6 A;  1BCP C;  4Z9C B;  3JAM E;  3MC0 B;  1SNO A;  3TSS A;  1SYD A;  1EY0 A;  1TR5 A;  3EFX D;  3GTM B;  2B2W C;  4XXE A;  3C46 A;  2O4X A;  5M5Y B;  2KVM A;  1RF2 D;  1D6E C;  3HZX A;  5M3F B;  1LT3 D;  3RUZ A;  4NKL A;  3V05 A;  2F3W A;  1Y8O B;  1FNW A;  2AUJ D;  3I8Z A;  1PRT D;  2VUM B;  1FYC A;  4HN7 A;  1BCP D;  1RCV D;  2CVR A;  4XYQ A;  1GUT A;  4WOR A;  2F0D A;  3LWE A;  4ZUI A;  2JA7 B;  3SK8 A;  4IUU A;  2BOS A;  5DEH A;  5JVG 3;  1TS3 A;  1STG A;  1O78 A;  4M1U B;  1T5E A;  1BF4 A;  4K6L A;  2M00 A;  5ISR A;  4RA8 A;  5COR A;  3TZD A;  3TN2 A;  1LT6 D;  3OHX C;  5C44 B;  1VF5 C;  2ICE C;  2EYP A;  1RTN A;  1GUS A;  1S5D D;  5BN4 A;  3L7Z C;  4ZUJ A;  3PMF A;  3DMU A;  1U4R A;  5LL6 S;  1VMP A;  5BN5 A;  4HCS A;  3SHL A;  1IW7 C;  2EYL A;  2K33 A;  5J22 A;  5C4Z A;  1EYD A;  4FYD A;  1ESR A;  3VR2 A;  1EYC A;  3EA6 A;  2K6A A;  4RGN A;  1SE4 A;  1OO9 B;  3OWF A;  2F4I A;  1SMY D;  1JWS D;  2IPK D;  1SSO A;  1B44 D;  2BDN A;  2WB1 B;  4G7H C;  3P20 A;  1HCZ A;  4G7Z C;  1TWF B;  4FF1 A;  2SNS A;  1JWU D;  4BA1 I;  2JP1 A;  2R7Z B;  5CMD A;  3N52 A;  4ME5 A;  1Y8N B;  2A6H D;  2LFN A;  1S4Z A;  3PUZ A;  3QIA A;  5CV9 A;  1YNJ D;  1SND A;  3URY A;  2R61 A;  1STN A;  1LTS D;  2L11 A;  3K58 A;  1LTB D;  1NCV A;  4EQN A;  5HGT A;  2NN6 H;  1U9R A;  4F7X A;  4EVO A;  3Q23 A;  3HOV B;  2LY7 A;  2F0P A;  4DXG A;  1IKL A;  3EJI A;  4K6D A;  2NZ1 D;  5IGG A;  4ULL A;  2EJG C;  3Q22 A;  3SVM A;  4PMC A;  3MVV A;  3T4A C;  5FO9 B;  5IOD A;  4DA2 A;  4HMJ A;  4IN3 A;  2F3V A;  4IUN A;  3SR1 A;  4HSV A;  4OO1 I;  3GTP B;  2N55 A;  3JAM L;  5G3L D;  1GHK A;  3S14 B;  4IFD I;  1PTO F;  4ILW A;  2DY7 A;  1WTX A;  2X69 A;  2F0W A;  5IGE A;  2IX0 A;  4FXD A;  2Z8L A;  4CJ0 B;  5EKI A;  5M3M B;  1LTG D;  1L0Y B;  5EPL A;  4HR7 B;  4IZ8 A;  3M3Y B;  3GV6 A;  3M7N A;  3P1H A;  2NTS A;  4RHR A;  3S2D B;  1HXY D;  5M5X B;  4H7B A;  2XN9 C;  3ND9 A;  1DON A;  1R4P B;  4DF7 A;  3M4Y A;  3DWP A;  3MAQ A;  1AW7 A;  1DXM A;  4A3J B;  1JC7 A;  3J80 L;  4FO2 A;  4BS9 A;  1ET9 A;  3R2T A;  1Q3L A;  1EY9 A;  5FLX L;  5JEA G;  1ZYR C;  2D62 A;  4L63 B;  2RA4 A;  3S1N B;  3FDT A;  3NHH A;  1STB A;  2B2W A;  1HHV A;  4FF3 A;  1DOK A;  1F77 A;  1Y1V B;  3HEJ A;  2MPM A;  3NP8 A;  3IAY A;  3C2P A;  2KQ3 A;  4N9T A;  2JA5 B;  5DM6 3;  2NYZ D;  3H91 A;  4K2L A;  2VB2 X;  2NVT B;  4C3J G;  4ZKB B;  4WFN 3;  4ABN A;  2RVL A;  1CZW A;  3ITP A;  4KHV A;  2F03 A;  3VYU A;  3I73 A;  4ZK9 B;  3X3M A;  4C56 C;  1TT2 A;  1CA6 A;  3I4M B;  3EVQ A;  4A93 B;  3KLS X;  2E2J B;  1M8A A;  2EYF A;  5IT9 L;  1TS2 A;  3MXP A;  1RKN A;  4CJ1 B;  1EU3 A;  1SNP A;  5DM7 3;  4A3I B;  2DNC A;  3K5M A;  1JB3 A;  2A68 C;  5LL6 X;  1EY4 A;  3D31 A;  2NBF A;  3FVQ A;  4F87 A;  3FPU B;  2B2Y A;  4QUF A;  2EYO A;  3GP7 A;  4GZY C;  1STY A;  4H0L C;  2AUK A;  4DNT B;  4MHE A;  3NTH A;  2G9D A;  4RAU C;  3GTQ B;  3MXU A;  4XQJ A;  4ZYS A;  1B3A A;  5JEA J;  3S2H B;  2NB0 A;  2R93 B;  1NUC A;  3PIO 3;  1I50 B;  4BY7 B;  4FNF A;  1CM9 A;  1WTQ A;  3OMG A;  2DY8 A;  4KJO A;  4FF2 A;  3MFY A;  5CBE E;  4C3I B;  1D2B A;  2QF7 A;  1ENA A;  1H9M A;  2EPB A;  1ILQ A;  2J7Z A;  1OXV A;  2Z4I A;  3IFD A;  4C3H G;  4TRD A;  4O1N A;  2J0T D;  2XRS D;  1I4R A;  2WV6 D;  4DNR B;  4ZLT F;  2IX3 A;  1G91 A;  1V1P A;  1V43 A;  3H0G B;  1AZP A;  2EYM A;  3PUY A;  4QF4 A;  3J7Y W;  2NWG A;  1F2M A;  3T53 B;  5TSS A;  2B39 A;  5C3E B;  5J1Z A;  1E2W A;  2RQX A;  4RGO S;  3K5L A;  1I6H B;  2BE5 C;  2CW0 C;  1D5M C;  3K59 A;  1PFN A;  2A6E D;  4S3S A;  1PTO D;  3H6M A;  4MIU A;  4YIJ A;  2EY6 A;  2MHV A;  1GUO A;  1V8Q A;  4KTA A;  5AFW A;  3OOC A;  3ONA B;  5JEA H;  4WJW A;  3FKI B;  3SXH A;  4RGM A;  2F0L A;  3BDO A;  4ZQ3 A;  1TY0 A;  3SEB A;  4RCO A;  1STE A;  4QUC A;  3G6J B;  1HQM C;  4HSP A;  2I07 B;  3DUZ A;  2B2V C;  1YNN C;  1HQR D;  2EY1 A;  4XTC S;  5KYI A;  1TQO A;  2E2D C;  4PQX A;  2YYZ A;  1NAP A;  4H13 C;  4R9W A;  2JYO A;  1SXT A;  3M7G A;  3ND8 A;  1CT1 D;  1PTO H;  4J8Q A;  2O2L D;  4OL7 A;  1F2L A;  1LO5 D;  2EOT A;  1S5F D;  2K03 A;  4K5V A;  3V2T A;  1TU2 B;  3DHQ A;  1JR0 D;  2JA6 B;  1PZK D;  2IW3 A;  4KMU C;  3IL8 A;  1Z6H A;  1JCK B;  4RKL A;  1JWM D;  1I4Q A;  2D9U A;  2VB3 X;  1PDQ A;  3ERO A;  3K5N A;  1RHP A;  2K32 A;  1KNA A;  3CU7 A;  1DZ1 A;  4A3M B;  2NN6 G;  4IUQ A;  5CV4 A;  2EYH A;  1A3T A;  3QO2 A;  5CV5 A;  5DNF A;  3NSW A;  1AFP A;  4KD4 A;  2EE1 A;  3GO5 A;  1S5C D;  4IUP A;  1B1Z A;  3DWQ A;  1SDF A;  5KEE A;  4RFB A;  2FHT A;  1GUW A;  3HOZ B;  1HA5 A;  3WDN A;  2DNE A;  3MFG A;  4EGV A;  5C5M A;  4RCN A;  3QWN A;  1WVL A;  1PYW D;  4C2M B;  4G57 A;  3A8I E;  1QNU A;  3VA5 A;  2IWH A;  2LS0 1;  2TSS A;  1OXX K;  2HCI A;  1EL0 A;  2B8F A;  3J80 E;  1ESF A;  1KDC A;  1SYE A;  4OIJ A;  1EOT A;  5ELE A;  3R8B A;  3BS1 A;  3VYT A;  2H4O A;  2K5D A;  2PZW A;  4KHZ A;  5FLX E;  5KRU A;  3KF8 A;  2PQE A;  1C4Q A;  2XRQ D;  3KK7 A;  1F2Z A;  1O7Y A;  5M5W B;  1SNQ A;  3NXW A;  4C3H B;  2RDG A;  1SYF A;  1A2T A;  4K5X A;  3P75 A;  1CHP D;  4M8A A;  1IYU A;  1B9N A;  1GXD C;  5C4J B;  4N9P A;  1JE4 A;  5IGD A;  3LWU A;  5IOC A;  1XXG A;  2CHB D;  1LTR D;  4KKU A;  5C5L A;  4XIG S;  4KN7 C;  4A3G B;  2BCO A;  2FJ2 A;  2F0I A;  1C48 A;  4CGY B;  3S15 B;  1TY2 A;  1I4P A;  5A2Q L;  1HUN A;  1DD2 A;  4KY7 A;  1DOM A;  2FMM A;  4IFD J;  1Q8I A;  3CHB D;  3HGB A;  4CBV A;  2PMZ B;  5IT9 E;  5F2D A;  5I9P A;  4TSS A;  1QWY A;  1BXT A;  1KNE A;  1LT5 D;  1U4M A;  2F0U A;  1QCB D;  5C3W A;  4B08 A;  4A3D B;  5EPK A;  4DXF A;  3TP7 A;  1IW7 D;  3E6Z X;  4FP5 D;  2EVB A;  1HUM A;  2K04 A;  3VR3 A;  2BA1 A;  5BN3 A;  3NWT A;  1B9M A;  2F0G A;  4F8M A;  3PV0 A;  5C0X I;  4Y7N B;  2B2U C;  1BR9 A;  2F0K A;  4PMB A;  4ZKC B;  2ID0 A;  2F0N A;  1XYI A;  3GTK B;  3HP3 A;  1I4X A;  2RDF A;  4FVM A;  1C8C A;  4OO1 H;  2C9O A;  4TQU S;  1QE6 A;  3CKI B;  2E76 C;  4XQN A;  2LKV A;  1GOZ A;  1V1O A;  2F0V A;  4IFD H;  5IGF A;  1EWC A;  1SBB B;  5A35 A;  3VA7 A;  3DXJ C;  4A3E B;  1K8M A;  2B2V A;  3UI2 A;  1UNS A;  1WTR A;  5CGK A;  3GD7 A;  5D3D A;  3T56 B;  2E2H B;  4MN3 A;  3HOY B;  1D1K A;  1ML0 D;  2ZXP A;  3E5S A;  2EY5 A;  2J4X A;  3TP5 A;  1QOH A;  1MSG A;  3C3L A;  2EJF C;  3K0Y A;  3NBH A;  3VYR A;  2JA8 B;  2B2T C;  2SNM A;  2M2L A;  5FO7 B;  3SK6 A;  1NSN S;  5NUC A;  3D6C A;  3TBI B;  4QCL A;  5C6A A;  4CKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...