4CJ3A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 52
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cj3A00
3DLBA 1EETA 1RT1A 2YV0X 2KQ2A 4ELVA 5I42A 4KHWA 5DMRA 3DLKA 3RWUA 4OJRA 2E6LA 4CJQA 1R0AA 1UWBA 2E4LA 1CZBA 2RKIA 5HP1A 1CZ9A 1J54A 4OKEA 4E1MA 1RDCA 1RTJA 4CGFA 1RBUA 4MFBA 2BANA 4O4GA 3OYLA 1J5OA 3LANA 4DQRA 4DWIA 4TSXA 4I2QA 1CLQA 3AVHA 3ZT2A 3IG1A 1VSIA 3QEXA 1S1XA 2XY6A 4KREA 4FK2A 1JLEA 5SWMA 1LW2A 3NH2A 1JKHA 2GBZA 2G8WA 3C95A 1TKDA 4F2SA 4C8LA 3NAEA 1ZBIA 2RF2A 4CJRA 2Z1JA 5KRTA 2BDPA 1RTHA 3SUQA 4FLYA 1QTMA 2QK9A 3ZT0A 2JGUA 1VSEA 3K5MA 4CGGA 1DTTA 2WOMA 1NK9A 3WNFA 3VQ9A 4OVLA 3V1QA 4CEZA 2F96A 4I2PA 4IFVA 5JS2A 3ZCMA 3OYGA 3SQ2A 5HRRA 1D9DA 3IAYA 1RT3A 3S3OA 1TK8A 3OYNA 5CYQA 3LDSA 4I9QA 3BGRA 3LZJA 4CHQA 3TAMA 5KI6A 3AO1A 1QSSA 3DM2A 4ZTFA 3V81A 2Q3SA 2BGGA 3T3FA 1KVAA 2YHAA 4FJKA 4HHTA 4E89A 1TV6A 4BWMA 2FBVA 3TAFA 1S9EA 1LAWA 4KHNA 3O4NA 3AO5A 4AHCA 4FZXC 1O1WA 3LP0A 2OPPA 1HQEA 3M8PA 3L2RA 3ZSOA 4CGHA 1VSDA 2Y1JA 1IKWA 2HNYA 4CHYA 2KZMA 1RILA 3I0SA 4KFBA 4M3RA 1YTUA 3VA0A 2AJQA 1S6PA 4CK3A 4LSNA 3EZ5A 3SV3A 5HROA 3OYKA 4DTNA 4FJMA 3KLGA 3G10A 1T03A 4NCAA 1GOAA 4CIFA 4FM2A 1C6VA 3OYJA 4CJVA 4DU1A 3AA2A 4NYNA 1C1CA 1WLJA 1BI4A 1VSMA 3DI6A 4HTUA 3PO4A 3SZ2A 4FJ9A 2ATQA 4O0IA 3E01A 4W5TA 4M3TA 4Z4EA 1RDBA 3ZSWA 3B6PA 1N6QA 3RTVA 4CJ3A 4Z4GA 3PX0A 3AO3A 1WSJA 3M8SA 2D0AA 1BIZA 3SQ4A 3S9HA 1XHXA 1NK8A 3I8DA 1KRPA 4HCCA 3KK3A 4KTZA 2G8IA 3VQ4A 3P1GA 2HHQA 1RBSA 4FJ8A 4M3UA 3NF8A 4Q0BA 1S1UA 4GVMA 4BDZA 4PQUA 4F3TA 4E3SA 1A5WA 1JLAA 1SKWA 1NKBA 1WAFA 2FC0A 3KK1A 4HUEA 4EZ9A 3OS0A 1WSGA 3CM5A 4FK0A 4DTPA 1ZBUA 1IG9A 1TKZA 4CFAA 2DTUA 2HNDA 4CJPA 3NFAA 1RDDA 4E1NA 2DFEA 3LP3A 4F4KA 2ETJA 1D8YA 3CG7A 1T7PA 1D9FA 1KVCA 1NK7A 4M42A 1ASWA 3KD5E 3DLRA 4B8CA 1TL1A 5J2QA 4FJLA 1U4BA 1X1PA 1CXQA 1ZBFA 5HRPA 1RDAA 1REVA 4FJ5A 1YTAA 2HB5A 4EP5A 4W5OA 4BE0A 4J2DA 3I0RA 4FXDA 1C1BA 3KLIA 4RW8A 1ZBHA 2P5OA 3V1OA 3V9WA 4FVMA 2YKMA 3SPYA 4LH4A 4CCHA 2EHGA 1A5VA 3CM6A 1LAVA 3AVBA 4AH9A 3QEWA 3TAGA 4RW7A 4CK2A 3HP6A 4KHSA 2FBTA 1NKEA 1JLQA 2ITGA 4DFKA 2YNIA 1U45A 1LW0A 4CJKA 2OYQA 2EX3A 4OLAA 1KFDA 3OYAA 3A2FA 3F9KA 4NCGA 5C24A 4FLWA 1JL2A 1JLBA 4GW6A 3SI6A 3OVNA 4CESA 3D0PA 1G15A 4CIEA 4OKJA 3U3GA 3MEEA 4UQGA 4E7LA 4DU4A 4FJGA 1TVRA 1X9MA 1HJRA 1U48A 1S1WA 3AVAA 3LP1A 4B9SA 2IC3A 4CK1A 1Q8IA 1KSPA 2ZE2A 4FW1A 4Z4CA 3OYDA 3U6FA 1X9SA 3ZSZA 3ZSQA 1B9FA 2IGIA 2JLEA 1KCFA 1L3SA 2PYLA 4DQIA 5FROA 1RT6A 4LSLA 3CQ8A 4QAGA 3KD1E 4KHUA 1QS4A 3K5OA 2IS3A 3RMDA 3HVRA 3MXIA 4CEOA 1RT2A 2G8VA 2VWKA 4IBNA 3NH0A 2XHBA 2O4IA 3VQAA 5EU7A 4CEBA 4E19A 3L3UA 3O3GA 5C42A 1QSLA 1BCMA 2E6MA 2QKKA 2VG6A 4CJLA 2Y1IA 3VQ7A 3SYZA 4FJJA 4KI6A 1LWFA 3ZSRA 1VSKA 3AVGA 4DG1A 1UA1A 3ISNC 3TAQA 3TAPA 2IAJA 2D5RA 2QXFA 4DFPA 3O4QA 3ZT4A 4QOZB 1ASVA 3HM9A 5T7BA 5KTQA 4CJFA 2R7YA 4B9MA 3DRSA 1RNHA 3VQPA 4C8NA 3OYEA 3VA3A 1F21A 2I5JA 4DTUA 2G8FA 3AVNA 4CF8A 4FLTA 3ITHA 3PX6A 3K2PA 4FJIA 2G8KA 3IS9A 3VQQA 3QETA 4FLZA 3NBPA 3QINA 2HHUA 1Z25A 4B08A 4Q5VA 3U3YA 3NGZA 4M45A 4KO0A 3WNHA 3C94A 1FKOA 2YNHA 3T1AA 1XHZA 4FZYA 1WSHA 3L2WA 2X74A 4KTQA 1XI1A 4O5BA 5CZ2A 2OZSA 3VQ8A 3VQCA 1LWEA 3SJJA 3P5JA 3NE6A 3SCXA 3MXMA 1NK4A 3NF9A 4N76A 4CJEA 2RPIA 3QIPA 4FW2A 4ICLA 3LZIA 4DTRA 3HVTA 4DSJA 2OPQA 4LH5A 2XY7A 4OPKA 4CF1A 4CJSA 5HLFA 2XY5A 1N5YA 3AO4A 1TKXA 3VQ5A 1NK6A 5FRMA 1RBTA 5E41A 4KKOA 2P51A 3V1RA 3RMAA 4H4MA 1FK9A 5D3GA 1D5AA 2KZZA 4BE1A 1EXQA 1Z26A 3NH1A 1KLNA 2OPRA 2OPSA 1LV5A 4LY7A 1U49A 3OYFA 3V9XA 3O3FA 2GV9A 4J2AA 4M3XA 1S1TA 5J2MA 1BQNA 3DLGA 4I7FA 3P83D 4AHSA 3OYCA 2X6SA 2W42A 2HMIA 1XWLA 2RN2A 4CJ4A 1I3AA 3K58A 4H8KA 2XY8A 2ZQBA 4DMNA 4RW4A 4OKKA 4IG3A 5HRNA 1JXEA 5CY4A 5KRSA 4DS4A 3SNNA 4KHYA 3VQ6A 1IH7A 5JS1A 2LSNA 2O4GA 1QSYA 3H08A 2GUIA 2XRIA 4CF2A 1SUQA 4CHPA 4R5PA 4B9NA 3HP9A 3NCIA 1Q9YA 4CERA 1NKCA 4G1QA 4E7KA 1UA0A 3ZSXA 3TI0A 2P1JA 4JLHA 3KLFA 1S5JA 1W0HA 1WSFA 3EY1A 3QERA 3TR8A 3DMJA 4AHTA 4CFCA 2B4JA 3B6OA 3RRGA 1HPZA 3OY9A 1W9HA 2KFZA 3LAKA 2NUBA 3S3NA 4B9TA 4MQ3A 4W5RA 4FJNA 2HNZA 4CGJA 3L2QA 3QO9A 4CF0A 5KGXA 4FM0A 3HPGA 4BDPA 2KW4A 2HVHA 4Y1DA 3KKSA 4HUFA 3SV4A 4DSFA 1WNSA 3HJFA 4ELUA 3AV9A 2WONA 4AHUA 4DTJA 3PV8A 3THVA 3NGIA 4O0JA 1LWCA 1BGXT 1EKEA 3AVMA 1KTQA 4HCBA 4FJ7A 3L2UA 1NJYA 4IKFA 2DFHA 3TWHA 4FCYA 2YNFA 3LWMA 2F8SA 3KLEA 3V6DA 1C1AA 2Z1HA 3T19A 1JLFA 3HO1A 1UOCA 4E7HA 2B6AA 1U04A 3VQEA 1RT4A 3M8RA 3CFOA 1VSFA 4FYDA 2Z1IA 1UAXA 1DLOA 4I9LA 4CEQA 1A5XA 1RBVA 3CFRA 4JRPA 4B9LA 2VG7A 2G8HA 4Z4IA 2HHSA 1FXXA 1FKPA 5DK5A 4DTSA 3OYHA 1WSEA 3AVCA 3KTQA 1TAUA 4N41A 1VK0A 4YNQA 3OS1A 3AVJA 1KVBA 1BIUA 2A1RA 4N47A 2G8UA 1HRHA 3UIQA 4K8ZA 3LAMA 2X78A 3OYBA 5J1EA 1BL3A 1L3TA 2HHWA 3O3HA 1S1VA 3MAQA 4DTOA 5KGWA 5FRNA 1VRUA 1RTIA 2BE2A 3KIOA 4JS4A 1SL2A 1DTQA 2VG5A 3NF7A 2VWJA 4DQQA 3BDPA 3D45A 1SL0A 2PYJA 4FLXA 3ZT1A 5HRSA 1GOBA 4CJUA 3K57A 3DYAA 3ZSYA 4HVJA 4JS5A 4FM1A 4C8KA 5HBMA 3VN5A 2IDOA 3V4IA 3L3VA 1B9DA 1QQCA 1K6YA 1T05A 1Y97A 3SQ1A 1VRTA 2Z1GA 4CEFA 4CECA 4Z4FA 3ALYA 1TAQA 3HYFA 3JSMA 1NOYA 2ZD1A 4CEAA 4DS5A 4CEDA 3QESA 4C8OA 3TAEA 3TABA 3MECA 1BQMA 1TKTA 3SPZA 1RCHA 1U47A 4PUOA 2D0BA 4PWDA 1I39A 1NJWA 3HK2A 3C6TA 3AVKA 4H4OA 1JL1A 4IDKA 4IFYA 4CIGA 1L3VA 4KHQA 4KV8A 3DRRA 4B8AB 1VSJA 3KLHA 3KKRA 3LWLA 4FJHA 3DOKA 3OJSA 4OGCA 4KPYA 4F8RA 4KRFA 3MEGA 1RT7A 1NJZA 1TL3A 3LPUA 4OLBA 4EZ6A 3ZT3A 4AHVA 1VSLA 1B92A 1JLCA 3CFPA 4YFUA 4JRQA 4IG0A 4N5SA 3RMBA 3V9UA 3KJVA 4DU3A 3G0ZA 4M3ZA 4OPJA 4DSLA 1IO2A 3DLHA 1IKYA 5CZ1A 1TGOA 3HL8A 3QEIA 1TK0A 1HYZA 3LALA 4DLEA 3LP2A 1HNIA 4L8RB 3F73A 1SKSA 4FZZA 2KTQA 3MEDA 4WE1A 3M8QA 3OYMA 4DQSA 3TANA 1BI4B 1NJXA 3DOLA 4OGEA 4C8MA 4PA1A 4DQPA 4Y1CA 2YKNA 3AA5X 4CJWA 4FLVA 1HYSA 2HHTA 5J2PA 5J2NA 1ZYQA 4RW6A 3AVIA 1HQUA 3RRHA 3NHGA 1HYVA 1C0MA 3SQ0A 4E7JA 4B3OA 4DSEA 3QNOA 4DSIA 4BE2A 4F2RA 1MU2A 1BISA 1WAJA 1HMVA 1L3UA 2OZMA 3K5LA 4DF8A 4B9VA 2HHVA 4DSKA 3ZSVA 2PY5A 4M3WA 4KAZA 4BACA 1CXUA 1GOCA 5C25A 1EP4A 3CYMA 3OYIA 4CE9A 3QEVA 1SL1A 3PX4A 4CHOA 3L8BA 4W5QA 1C0TA 4CHZA 2YHBA 2F8TA 3HXMA 3S3MA 4Z0UA 4B9UA 4ZTJA 4CHNA 5CYMA 3K59A 4FLUA 2FBYA 4XIUA 4ID5A 2DFFA 3FFIA 1IKXA 1J9AA 1NK0A 1KFSA 3OJUA 4J2BA 4NCBA 4PY5A 4Z4HA 3HT3A 1IKVA 2D0CA 3AVFA 3VQBA 1NK5A 4DFMA 1XC9A 1SV5A 4J2EA 4QCLA 4HUGA 3KK2A 3HSTB 1TK5A 1WN7A 3JYTA 1JLGA 5I3UA 2HVIA 4EP4A 4DTXA 2KFNA 3DRPA 4K8XA 3SUPA 1JXBA 2FBXA 5SZTA 3RR8A 3C6UA 4E0DA 2OA8A 3RR7A 4RW9A 4GMJB 4CJTA 1ASUA 4DFJA 3OS2A 3PY8A 1KLMA 3EYZA 4DF4A 4KB1A 2HW3A 2QKBA 3NGYA 3IRXA 1SKRA 4M41A 3ULDA 4CF9A 5K14A 4LD0A 1WSIA 1VSHA 3WNGA 4NYFA 3V9SA 3VQDA 4M3YA 3QEPA 4AILC 1X9WA 4CFBA 4W5NA 3NDKA 4FJXA 1EX4A 3DLEA 4KTWA 2HHXA 3ASMA 1J53A 1S6QA 3PUFA 1HNVA 1BHLA 1S9GA 1YT3A 2B5JA 4F3OA 4AHRA 3SUNA 3K5NA 1Q9XA 2A1SA 1RT5A 4ZHRA 1ZBLA 1RBRA 4ID1A 4O44A 3PO5A 3AVLA 4FK4A 4KI4A 3V9ZA 3AA3A 3AA4A 3QNNA 1L5UA 3TARA 1QE1A 2IOCA 2P5GA 3QIOA 4BDYA 5FDLA 3NF6A 1BCOA 3L2VA 1T8EA 4RG8A 3SUOA 2YNGA 3WNEA 4CEEA 4O55A 1NOZA 4ELTA 1YVUA 1RTDA 2PZSA 1C0UA 3MXJA 3QLHA 4BWJA 2DY4A 1ITGA 4E7IA 3LPTA 4KB0A 4CGIA 4DLGA 4CFDA 4CJ5A 4N56A 3HPHA 4DTMA 3RMCA 2X6NA 1QHTA 3AO2A 3HPOA 4CGDA 2XO7A
chains in the Genus database with same CATH superfamily
4MDAA 3UKRA 1ZXOA 2YHXA 4KHWA 2P9NB 3RWUA 4OJRA 3E1YA 4GKJK 4DV1K 1UWBA 2AA4A 5HP1A 1CZ9A 4OKEA 4E1MA 1RFQA 4O4GA 3OYLA 3H1VX 3AVHA 5LY3A 3CJCA 3IG1A 2E2NA 4LF6K 1LW2A 2G8WA 4C8LA 4FL9A 2VWBA 1MDUB 5BREA 2WC9A 3NAEA 2Z1JA 1RTHA 2QK9A 4J8FA 4B1WB 2UU9K 2V52B 3VGLA 3K5MA 3V1QA 4H0TB 5AZIB 1RT3A 2GWKA 1TK8A 5CYQA 4I9QA 4CHQA 2NLXA 4JV5K 4FJKA 4BRMA 5JVGL 4O5FA 3TAFA 4KHNA 1E4GT 4BRGA 4O8KA 3LP0A 1HQEA 3M8PA 3O1BA 3ZSOA 4QS7A 4JI2K 1IKWA 5BRHA 2AJQA 4CK3A 3EZ5A 3WXIA 3KLGA 2KHOA 4DU1A 3QFUA 4NYNA 3KK7A 1BI4A 5C2FA 1J5EK 4FJ9A 1N6QA 4CJ3A 4Z4GA 4MO5A 3A0IX 5LJWA 3S9HA 4CZEA 3WXMB 4BRNA 5FPMA 4M63C 4FJ8A 1S1UA 4KH4A 4BDZA 4PQUA 4F3TA 5AQRA 4FWRA 1NKBA 2O8CB 3HOSA 1IG9A 5AQZA 5BPMA 4BC2A 1RDDA 4E1NA 4F4KA 5EX5A 1O13A 2O8DA 3CG7A 4AM6A 1D9FA 1NK7A 4BRDA 3SBTA 3KD5E 1X1PA 3J8AA 3R9PA 1ZBFA 5HRPA 4JYAK 1YTAA 5M1QA 4BE0A 4EP5A 4O8UA 1WOQA 1FW6A 3I0RA 4FXDA 3V1OA 3V9WA 4FVMA 3SPYA 2QM1A 3OHRA 1A5VA 1LAVA 3TAGA 1ZBSA 2FBTA 3EE9A 1JLQA 3GG4A 5C2DA 4CJKA 2EX3A 3OYAA 2E20A 3O9QA 4FLWA 4RCHA 5GIOA 4GW6A 4H5NA 3SI6A 1HNZK 1HNXK 4CIEA 4OKJA 2NRXA 4E7LA 1X9MA 1T3VA 3CIPA 3UKUB 3CCMN 3C6HA 4Z4CA 1B9FA 2IGIA 2JLEA 1KCFA 4LSLA 4BR7A 4QAGA 4AQYK 1QS4A 2V7ZA 4EHTA 3HOTA 3MXIA 3WEEA 5M1FA 3ZEUB 3NH0A 2O4IA 4CEBA 2Q1NA 3L3UA 1BCMA 2VG6A 4KI6A 4DR2K 2NNWA 3ZSRA 1UA1A 3R1XA 3S41A 3ZT4A 4DKWA 3KWGA 4ILJA 4DV5K 1RNHA 1JCGA 3MDQA 3AVNA 4FLTA 3K2PA 3VPZA 4DR1K 1QZ5A 4BRFA 3ID6A 4FLZA 2HHUA 1VQ4N 4WQ5C 2HF4A 4Q5VA 3OW2M 3WNHA 3C94A 1FKOA 2YNHA 3T1AA 1XQSC 4BRQA 2X74A 1XI1A 4O5BA 5CZ2A 2A40A 3VQ8A 3VQCA 1LWEA 4BG9A 3SCXA 4JI1K 1NK4A 3NF9A 4FWMA 4OPKA 4CJSA 5HLFA 5BRFA 2ASMA 1TKXA 2YJEA 1NK6A 4XH4A 1LCUA 5AZIA 2P51A 2P9KB 3VMFB 4H4MA 1FK9A 3AAPA 4A2BA 1D5AA 1WBBA 1EXQA 3VEYA 1KLNA 2OPSA 3K0SA 1LV5A 3BF3A 4IO8A 2HBKA 2GV9A 2QWRA 4LFBK 2X6SA 3GL1A 2RN2A 4CJ4A 2XY8A 3VF2A 4RW4A 4HTLA 4MDBA 4DS4A 1YVNA 3H08A 4H03B 3IKMA 1YJNN 3NCIA 3DXKA 4E7KA 1UA0A 2FSJA 3TI0A 2FXUA 4JLHA 3DMJA 4CFCA 1IJJA 1HPZA 2KFZA 1W9HA 2NUBA 3C0BA 4BDPA 1XMQK 3W0LA 1ILYA 2KW4A 3SV4A 4DSFA 5KPRA 1M1KO 4ELUA 2WONA 4V19S 3OBYA 4DTJA 2CGKA 3U9DA 5M1NA 4O0JA 1EKEA 3L2UA 1NJYA 4IKFA 2O8CA 3TWHA 2F8SA 5AQVA 1C1AA 1YI2N 4XH5A 1NGBA 3J7YP 1RT4A 3BP8A 4CEQA 4I9LA 1A5XA 2VG7A 2G8HA 3D2FB 4PKGA 1WSEA 4WFAL 3ULEB 3OS1A 1KVBA 4N47A 5KPZA 5F1XA 2X78A 4JD2B 1DKGD 5J1EA 3O3HA 2FF3B 3M1FA 1DTQA 1GLDG 3NF7A 1BG3A 3D45A 1SL0A 5JVHL 4C8KA 2KKZA 4JS5A 2H3GX 4BVPA 3L3VA 5AQWA 1TYQB 1OVYA 2ZM6K 1VRTA 4CEFA 3ALYA 1NBWA 4JHDA 3G4SN 1NOYA 4CEAA 2PBDA 2QWMA 1TKTA 1RCHA 3PIOL 3CC2N 1NJWA 3MN6A 1VQMN 4IFYA 3WT0A 4FJHA 3KKRA 1P90A 3DOKA 2FF6A 3ZEUA 3AGRA 4MLHA 4JRQA 3CFPA 3RMBA 4DU3A 3G0ZA 3ENBA 4M3ZA 3DLHA 2HHHK 3CCUN 3F73A 4FZZA 3MEDA 3OYMA 1C0GA 4B1XB 3TANA 1NJXA 1YAGA 4PA1A 1Q82O 3BF1A 4AF1A 4RW6A 4BROA 3FGUA 4B3OA 1WAJA 1HMVA 1L3UA 2OZMA 2F4VK 1T6CA 4FWLA 1HNWK 5AQLA 4BACA 1CXUA 1GOCA 3CYMA 3PX4A 4CZIA 3KVGA 2YHBA 3M6GA 3IMXA 4FVUA 4YOXA 4XIUA 2DFFA 1HR0K 1IKXA 5AZJB 4NCBA 4PY5A 4J2BA 1BU6O 3VQBA 4DFMA 4JI7K 4A59A 1NGAA 1JLGA 5I3UA 4EP4A 4K8XA 1HUXA 5BPNA 4E0DA 2OA8A 4A5AA 3D7EO 4GMJB 2YCHA 1D4XA 4DFJA 3OS2A 1K8AO 3O6WA 1ESVA 3FR0A 4LD0A 2W6KA 4NYFA 2ZGZA 4DR6K 4JKGB 3T7ZA 3PUFA 1HNVA 1Q9XA 2A1SA 4OPHA 3AVLA 3V9ZA 5LMNK 3AA4A 3QNNA 1L5UA 4JI0K 2IOCA 1T8EA 3MN7A 3EN9A 4ELTA 4DV2K 3QLHA 3ENOA 1IBLK 4DQ8A 4CJ5A 3HPHA 3KWIA 3IFRA 4JKBA 1QHTA 3QEIA 3LDQA 1YJWN 4U7BA 4JI6K 2YV0X 2QWLA 2KQ2A 3CERA 5I42A 5DMRA 3DLKA 2Q36A 2FSKA 3B8AX 2E6LA 3LDNA 4CJQA 2E4LA 1CZBA 1HKGA 3KZBA 1GLLO 3ENHA 2BANA 4DQRA 4DWIA 4TSXA 2GWJA 2XY6A 4JD2A 3NH2A 1JKHA 5AQMA 2GBZA 5KQ8A 3C95A 3ZLJA 2Q2RA 3VGMA 1YXQA 1ZBIA 4CJRA 2BDPA 1NGDA 2QWPA 1DTTA 4I6MA 4CEZA 1S72N 2NZTA 1TYQA 3ZCMA 1NMNA 4BC3A 5HRRA 3SQ2A 3R8EA 3S3OA 3LDSA 1RDUA 3AY9A 5KI6A 4BRIA 2W6LA 1KVAA 4HHTA 3I55N 1TV6A 4BWMA 2FBVA 4JNEA 1LAWA 4BQZA 3O8MA 1M90O 1VSDA 3PSIA 2Y1JA 2UXDK 3QICA 3VEOA 2KZMA 1RILA 4WQ4C 1NGGA 3O9UA 1S6PA 3SV3A 5HROA 4DTNA 5IT9O 3G10A 4NCAA 1GOAA 2OTJN 2UUBK 3AA2A 3FZKA 1C1CA 5C0YA 5AQPA 4HTUA 3PO4A 2ATQA 4M3TA 3OTOK 1RDBA 3ZSWA 3RTVA 4BREA 4OX9K 3PX0A 3M8SA 1BIZA 4BC4A 3SQ4A 5GADP 3Q7BA 1KRPA 2G8IA 3EL2A 2PFUA 4E3SA 1JLAA 4JI5K 4EZ9A 1WAFA 2FC0A 4JKCA 3KK1A 3OS0A 3CM5A 1ZBUA 2HNDA 3O9TA 5GAHP 2RHKA 4CJPA 5MLCQ 3NVKA 2DFEA 1WUAA 5JLFA 3H6EA 4LF9K 3LL3A 3UE5A 5AZJA 1V4TA 4JEPA 1ASWA 1TL1A 5J2QA 3CCSN 1RDAA 4NLCA 2HB5A 3LM9A 4W5OA 4J2DA 1C1BA 4RW8A 3FZFA 2ZJPL 3QEWA 3AVBA 5M1OA 1IBKK 2UYTA 3CC4N 2ITGA 4DFKA 1WB9A 3WUHA 1U45A 1LW0A 4OLAA 1KFDA 4IFEA 1JL2A 1IV0A 3LDOA 4CVNE 3F5TA 3SLCA 1TUUA 2J4RA 4DR3K 1G15A 3MEEA 5H1SQ 1N36K 1S1WA 1YHQN 4IJNA 3LP1A 4CJ7A 4B9SA 1Q8IA 4FW1A 1X9SA 1QQOA 3ZSZA 4LF8K 4KHUA 1RT6A 3CQ8A 3KD1E 2IS3A 4CZJA 3RMDA 3HVRA 2G8VA 1P8ZA 2CH5A 3J81O 4YOWA 3NMUA 1GLAG 5TKWA 2E6MA 2QKKA 4CJLA 3VQ7A 3SYZA 4FJJA 1VSKA 4RTFD 3VEWA 3ISNC 3ZX2A 3TAQA 3TAPA 4DV6K 3P38A 3CMEN 1ASVA 2R7YA 3BY5A 3OYEA 1N8RO 2ZJRL 1F21A 1DGKN 3IS9A 3I56N 3QINA 3U3YA 4YDUC 4KO0A 3OBWA 1YJ9N 1XHZA 2IIRA 1SQKA 4GV9A 3CF5L 3SJJA 3NE6A 3MXMA 2RPIA 2E88A 4DSJA 4ICLA 4LH5A 2XY5A 2OANA 3AO4A 4M7XA 5FRMA 1RBTA 3DXKB 1HX1A 3RMAA 5D3GA 4BE1A 3VEVA 1Z26A 4LY7A 4AM7A 3CETA 3O3FA 4C1NK 1BQNA 3DLGA 3BUZB 3P83D 4AHSA 3OYCA 3ID8A 1I3AA 3K58A 3BEXA 3GOIA 4CBXA 3E9LA 5HRNA 1JXEA 5FLXO 2QW9A 1IH7A 5AQKA 4B3MK 4A2AA 4B9NA 4FWOA 3HP9A 4QS9A 1Q9YA 4CERA 4R79A 1NKCA 1EWRA 4BRLA 1RGIA 3T1HK 1KAXA 1WSFA 3CMAN 3QERA 2O8EB 3B6OA 3S3NA 2Q31A 5AQXA 4ILGB 3G71N 3HM8A 1NGFA 3QO9A 3R6MA 5KGXA 3HPGA 2O8BB 3TSUA 2HVHA 3KKSA 4K43A 2IVPA 1X3NA 3HJFA 2YJFA 3THVA 4H5RA 1LWCA 1BGXT 5AQQA 4HCBA 4FJ7A 4FOIA 3R3LA 4FCYA 3LWMA 3KLEA 3V6DA 4BGAA 4GY2B 3T19A 5FPDA 1JLFA 3HO1A 1UOCA 1VQ8N 3M8RA 2P9LA 3QBWA 4JHDB 1UAXA 3WQUA 4Z4IA 3SAGA 1FKPA 1TAUA 2Q0RA 3HI0A 1BIUA 2A1RA 3UIQA 4K8ZA 5ADXH 5AQUA 2HHWA 1L3TA 1S1VA 4DTOA 5FRNA 1VRUA 1RTIA 2BE2A 3KIOA 1SL2A 2VG5A 2PYJA 3MMVA 5LMUK 3AAQA 1GOBA 4IOXA 4FM1A 3DYAA 3V4IA 4EHUA 3F2KA 1B9DA 3CJ7A 3SQ1A 1QZ6A 3QB0A 1GLFO 4LC9B 3CQYA 3CI5A 3JSMA 4DS5A 4CEDA 3QESA 4C8OA 1U47A 3SPZA 3GBTA 2D0BA 3HK2A 4H4OA 2AP1A 4IDKA 3O4WA 4H0VB 1L3VA 3DRRA 3LWLA 5AQHA 4BRPA 3OJSA 3DLLL 3CPWM 3MEGA 1RT7A 5GAEP 3LPUA 5AQSA 2YHYA 3I8BA 1JLCA 4N5SA 4CZFA 1IO2A 1TGOA 1S3XA 1TK0A 1HYZA 4DLEA 1S22A 3U9ZA 4EIAA 4L8RB 3ZYYX 1SKSA 3CD6N 4Y0WA 2A41A 4B1YB 4A62A 4H0XB 4FWSA 2V51B 3CJ9A 4IEIA 4DV4K 4FO0A 2GTDA 3C6AA 4DQPA 2QTDA 3MWTA 1I94K 2HHTA 5J2PA 1ZYQA 5M1PA 3AVIA 1HQUA 3RRHA 3SQ0A 4E7JA 2QI2A 4NLBA 4F2RA 4B1UB 4OPAA 2P9UA 3FLCO 3K5LA 3VTHA 4B9VA 1G99A 3WXLA 5C25A 1EP4A 3OYIA 1SL1A 2GEMA 3L8BA 4W5QA 1C0TA 4CHZA 2WUSA 4BY9C 2P9IA 1N33K 4Z0UA 4B9UA 2FBYA 4KBOA 3FFIA 1VQKN 4Z4HA 1IKVA 2D0CA 5EXWA 3AVFA 4IJAA 1SV5A 5BPLA 4HUGA 3HSTB 1TK5A 3JYTA 5C10A 2HVIA 1K8KB 2VQFK 3SUPA 2FBXA 4DCHA 4X64K 4X65K 2YI1A 4RW9A 3PY8A 1KLMA 3I33A 4KB1A 4DF4A 2HW3A 2QKBA 3NGYA 1QQNA 4CF9A 3WNGA 3V9SA 1X9WA 3T1YK 4FJXA 1VQLN 4CBUA 2HHXA 3EO3A 3J80O 3VENA 1S9GA 1YT3A 4AHRA 4JKHA 1HPMA 3K5NA 4ZHRA 1RT5A 1XNQK 4YORA 3PO5A 2O8EA 3G6EN 3SAFA 3AA3A 2Q97A 1QE1A 5FDLA 1BCOA 3L2VA 3CXCM 4CEEA 2O8BA 5KQDA 2DY4A 4IWVA 4KB0A 4CGIA 4Z94A 4N56A 1OKJA 3RMCA 1U2VA 1VQ5N 1NJIO 3C7NB 4A57A 4CZMA 1VQPN 4I6MB 3ZX0A 3DLBA 1EETA 4ELVA 5I9EB 1R0AA 1QHAA 1J54A 1RDCA 4CGFA 1RBUA 4MFBA 1J5OA 3LANA 4CZKA 3CJ1A 1CLQA 3ZT2A 3QEXA 2VGMA 1S1XA 4KREA 5JLHA 4FK2A 5SWMA 4G9ZA 3SAHA 4F2SA 3DXMA 3JXUA 2RF2A 1QTMA 5M1KA 4B3TK 4NXMK 1VSEA 4ILHA 4FOEA 2GUPA 4BC5A 4CGGA 4IO9L 1NK9A 3WNFA 3VQ9A 4OVLA 2F96A 4I2PA 3OYGA 1D9DA 3IAYA 4IZ9A 5LJVA 3MWPA 3P39A 5AQNA 3OYNA 3BGRA 3DWLA 1HLUA 3LZJA 4XEIA 2D0OA 3AO1A 1QSSA 3CHWA 1DT9A 3DM2A 4ZTFA 2Q3SA 2YHWA 2YHAA 4FWQA 4XH1A 3T3FA 4E89A 2BUPA 4DR5K 1S9EA 3SBGA 3AO5A 1OH7A 4FZXC 1NM1A 1O1WA 1VQ6N 4CGHA 1EQYA 3TSQA 2HNYA 4CHYA 3I0SA 4M3RA 5GAGP 3VA0A 1YTUA 1X3MA 3C65A 4K0KK 4HWIA 4FJMA 2CGJA 3OYJA 2FLOA 3K9KA 1WLJA 4DUZK 1GLJO 3SZ2A 5GIPA 4O0IA 3E01A 4Z4EA 3CCEN 3B6PA 2DPNA 1T44A 3AO3A 2I7NA 5AQJA 4WFBL 1XHXA 3I8DA 3E9OA 4HCCA 5BRDA 4KTZA 1J6ZA 3VQ4A 2HHQA 3IDHA 1RBSA 2IVNA 1SKWA 1OVQA 4DTPA 1TKZA 4CFAA 1QVFM 2DTUA 2CGLA 4CZLA 3NFAA 1GLEG 3LP3A 3MCAB 3TU5A 1T7PA 3WQTA 3CC7N 5CHIA 1KVCA 1VQNN 3THXA 4FJLA 4B8CA 1X9JA 1U4BA 1CXQA 1Z05A 1REVA 4FJ5A 3KLIA 1Q7YO 1ZBHA 2P5OA 1K8KA 3RVCA 3SJHA 4QS8A 4AH9A 4RW7A 3HP6A 4KHSA 3VESA 1NKEA 1HKCA 1KD1O 5LL6Z 4WQ5A 2OYQA 3A2FA 5IWAK 4NCGA 5C24A 3J7AP 1JLBA 4DHYA 2E2OA 4DU4A 1Q18A 3GE1A 1TVRA 4PL8A 1HJRA 1U48A 2IC3A 4CK1A 1KSPA 2ZE2A 3P4IA 2PYLA 4DQIA 5FROA 1H1VA 3EE8A 4CEOA 1RT2A 1YF5L 3H45C 1BOTO 2VWKA 4IBNA 4MLEA 3VQAA 4E19A 4BG8A 1MA9B 1NGEA 2ZJQL 2D0PA 5AR0A 3THYA 1E4FT 3MX2A 3LDLA 4BR5A 2ZF5O 4B1ZA 4DG1A 2IAJA 3C7NA 2QXFA 4DFPA 3O4QA 3A5NC 3HM9A 5T7BA 4CJFA 3CCJN 2FSNA 4C8NA 3VA3A 4DTUA 3A5OC 2G8FA 3PIPL 3PX6A 4FJIA 2G8KA 5AJ3K 3NBPA 5AQIA 4BRHA 4B08A 3CJBA 4DUYK 3NGZA 1HJOA 4FZYA 1WSHA 3L2WA 4X66K 1NMDA 4KTQA 2OZSA 5CR4A 3P5JA 4N76A 3QIPA 4FW2A 3LZIA 1SAZA 2OPQA 1N5YA 4YOTA 2P9PA 3VQ5A 5E41A 1CZAN 3RSEB 2A6AA 4JK8A 2KZZA 1MWKA 3E66A 3NH1A 2VGNA 1YITN 3V9XA 2VQEK 4M3XA 1S1TA 5J2MA 1YIJN 3IUCA 1BUPA 3VGKA 2W42A 1XWLA 4H8KA 2ZQBA 2ITMA 4IG3A 4KHYA 5CY4A 3SNNA 3VQ6A 5JS1A 4FWNA 2LSNA 2NRWA 2O4GA 2XRIA 3LDPA 4CHPA 4R5PA 3G25A 2P9LB 4BRCA 4FWKA 1MWMA 2P1JA 3KLFA 1S5JA 1W0HA 1E3MA 3TR8A 2F7TA 3LAKA 1VAZA 4BR4A 4C23A 2HNZA 3CCQN 4FPBA 4BR9A 4CGJA 5ADXA 3L2QA 1Q86O 4Y1DA 1KC8O 3SK3A 2ZGYA 3DAWA 2JWLA 1XC3A 3P31A 5AQGA 2DFHA 4CZGA 4WYBA 2HSTA 3H3NO 2Z1HA 4E7HA 1U04A 3VQEA 4FYDA 3CFOA 1VSFA 4BVOA 2Z1IA 1DLOA 4JRPA 4IXCA 1RBVA 4B9LA 2HHSA 5C12A 4DTSA 3OYHA 2YX6A 3AVCA 4N41A 1VK0A 4YNQA 1NLVA 4DV7K 1HRHA 3CCVN 2P9SA 3OYBA 5HL7L 3MAQA 3DJCA 4GKKK 4JS4A 1R59O 3L4IA 4FSVA 3ZT1A 4CJUA 3K57A 5E84A 3ZSYA 5HBMA 1EWQA 2IDOA 2VYPA 4JI4K 1QQCA 1K6YA 2ASPA 1Y97A 2QWNA 2V7YA 4CECA 4Z4FA 3TTCA 1TAQA 3HYFA 3TAEA 3TABA 4A5BA 3FZHA 1I39A 4PWDA 2UUCK 3C6TA 4EFHA 4CIGA 4KHQA 1VSJA 2A5XA 1TUYA 4F8RA 4CI6A 2P9UB 3ZETA 4OLBA 4EZ6A 3ZT3A 3ZX3A 1B92A 4YFUA 4IG0A 3V9UA 1SS6A 2I7PA 3HL8A 2P9IB 2BTFA 1XMOK 3M8QA 1Y64A 3EKUA 1ATRA 4GVEA 4OGEA 4C8MA 2YKNA 4CJWA 4H5WA 5J2NA 4KHPK 1KAYA 4K25A 1HYVA 4BGBA 3JAMO 3QNOA 4DSIA 4BE2A 1BISA 2O8FB 4UY8O 4DF8A 1QVGM 2HHVA 4DSKA 2PY5A 4KAZA 4H0PA 4CHOA 3VOVA 2F8TA 3ATUA 3S3MA 4ZTJA 4CHNA 2QEXN 5CYMA 3K59A 4FLUA 4KH6A 1BWFO 2OCEA 3HT3A 5FPNA 5AFUH 3VF4A 1XC9A 4J2EA 3D2EA 4QCLA 3RSEA 3QMLA 1WN7A 3VETA 4WF9L 4DTXA 5SZTA 4JKAA 3RR8A 3C6UA 2D4WA 1ASUA 3AARA 3EYZA 4M41A 3ULDA 2E1ZA 3O80A 1VSHA 1XNRK 4M3YA 2QXLA 3VQDA 3QEPA 1U2VB 1IG8A 4LF5K 4DV0K 4KTWA 3SUNA 4B3RK 1RBRA 4LFAK 2VCPA 4FK4A 3TARA 1VQ7N 2P5GA 4IEEA 3NF6A 1V4SA 4RG8A 3F9MA 2YNGA 2ZWHA 4O55A 1NOZA 1RTDA 2PZSA 1C0UA 3DXMB 4E7IA 3LPTA 3EZWA 5AQYA 2HBLA 5BN9A 3K9JA 4DTMA 4JI3K 3AO2A 3HPOA 1RT1A 4WQ4A 4EAHD 4OO1J 2RKIA 2F9TA 3O08A 1RTJA 1YUWA 4KH5A 4I2QA 1VSIA 3HSCA 3L0QA 1JLEA 4CZHA 1TKDA 3TPQA 2E1YA 5F0XA 4H0YB 5KRTA 3OA9A 1VHXA 3SUQA 4FLYA 3ZT0A 2JGUA 2WOMA 3VERA 2P9NA 4IFVA 5JS2A 1BO5O 4GV3A 3LM2A 4H0OA 2D1KA 3T69A 3TAMA 3THWB 3V81A 2BGGA 3O4NA 4AHCA 4GNIA 2OPPA 3HTVA 3L2RA 1N34K 5BR9A 2E2QA 2ASOA 5A2QO 4KFBA 4PKIA 4LSNA 3OYKA 1T03A 4CIFA 3VF6A 4CW7B 4FM2A 1C6VA 3FFKB 2QWOA 4CJVA 2HMPA 2WBNA 3Q7CA 3THXB 2E5LK 1ZC6A 1VSMA 3DI6A 4W5TA 3FZLA 3KHYA 3H1QA 1WSJA 2D0AA 2HOEA 1NK8A 4F9OA 2O8FA 3KK3A 3P1GA 4JK7A 4M3UA 4Q0BA 3NF8A 4GVMA 1A5WA 3M3ZA 1RDWX 4FK0A 4HUEA 1WSGA 1BA0A 3EEQA 2IVOA 3JS6A 4DB3A 4B1VA 3SMSA 5DM7L 1JJ2M 2ETJA 1D8YA 4B9QA 3O5BA 3NVMA 3HRGA 2NRVA 4M42A 3DLRA 3N4PA 4BQLA 2YKMA 1OH6A 5F2RA 4LH4A 4CCHA 2EHGA 3CM6A 4CK2A 4MO4A 2YNIA 3L4QA 1W7AA 4WFNL 4YDUA 3F9KA 3HZ6A 3THYB 1DEJA 3OVNA 4CESA 3D0PA 1NGCA 3U3GA 4UQGA 4B3SK 1NNEA 4ISGA 5DM6L 4FJGA 1ATNA 3QBXA 3AVAA 3OYDA 3U6FA 3ZSQA 3QFPA 4BRAA 3AGKA 1L3SA 5TKYA 3K5OA 1VQ9N 4C1NI 4E1JA 2XHBA 5EU7A 2NRRA 1IBMK 3O3GA 5C42A 1QSLA 5HOOA 4K42A 2Y1IA 1LWFA 3AVGA 5E26A 2D5RA 1JCFA 3TTDA 2P9PB 3CCRN 4QOZB 5EVZA 3UKUA 5KTQA 2NRTA 3A8YA 3DRSA 4B9MA 3VQPA 2I5JA 1QQMA 4CF8A 3ITHA 4DR4K 2A42A 3QETA 3VQQA 5BR8K 4ISEA 1Z25A 4M45A 2NRHA 3FE1A 1JCEA 5AQOA 4CJEA 4DTRA 3HVTA 2XY7A 4CF1A 1K9MO 3UB5A 2PAVA 4KKOA 1C0FA 3V1RA 1GLCG 2W40A 3THWA 3BZKA 2OPRA 1BDGA 1U49A 3OYFA 3GDQA 4J2AA 4I7FA 4JI8K 1LOTB 4BRKA 1WBDA 4L3QA 2HMIA 4H5VA 2UXCK 4DMNA 4OKKA 2Q0UA 5KRSA 4YOVA 4JKFA 1Q81O 1NGHA 1QSYA 2RE2A 4X62K 1NGIA 2GUIA 4CF2A 1SUQA 1OH8A 4G1QA 1T6DA 2P9KA 3ZSXA 1NWKA 5EOYA 3EY1A 4AHTA 2QA4N 2B4JA 3RRGA 1NGJA 3OY9A 4B9TA 3O1WA 4MQ3A 4W5RA 4FJNA 1VQON 1KAZA 4CF0A 2P9SB 4FM0A 2JWKA 4CD3A 3BZCA 4HUFA 2UXBK 1WNSA 3AV9A 4AHUA 1N32K 2HBJA 3PV8A 2UUAK 4DR7K 3NGIA 4M7YA 1FJGK 3AVMA 1KTQA 1EO1A 1KXPA 3UKRB 2YNFA 4NB4A 3W3DA 3A5LC 1NU0A 4JKDA 4K41A 2B6AA 4CD1A 3TSPA 3CFRA 2QWQA 1FXXA 1U6ZA 4PKHA 5DK5A 4WCEL 4JKEA 3KTQA 3AVJA 2G8UA 2OTLN 3LAMA 3PSFA 2E8AA 1BL3A 5KGWA 3MX5A 3ZETB 2VWJA 4DQQA 3D6RA 3H46O 3BDPA 2A3ZA 4FLXA 5HRSA 4HVJA 3H3OB 3VN5A 5B8HA 2GX9A 2E2PA 4RWTA 1T05A 4CBWA 4GV6A 2Z1GA 1NG9A 5BN8A 1W2BM 3E9PA 2ZD1A 4U67L 3MECA 1BQMA 4BR0A 4YOYA 4LF7K 4PUOA 3D2FA 4IOAL 3ULEA 3VEZA 3AVKA 1JL1A 2HBMA 3N4QA 3J7ZO 3FZMA 4KV8A 5ELZA 4B8AB 3KLHA 4OGCA 4KPYA 4KRFA 1NJZA 1TL3A 3EKSA 4ISFA 4DV3K 4AHVA 1VSLA 4PL7A 1BA1A 3KJVA 3MK6A 4OPJA 4DSLA 1SZ2A 2W41A 1IKYA 5CZ1A 3MN5A 4YY3K 3LALA 5JMVA 2CH6A 2NRZA 3LP2A 1HNIA 2GELA 2KTQA 4WE1A 4DQSA 3MN9A 1BI4B 5AFUA 3DOLA 3U4LA 4Y1CA 4H5TA 3AA5X 1HYSA 4FLVA 3D2EB 4JK9A 3TTFA 5AQTA 3MCPA 3NHGA 1C0MA 4JN4A 4DSEA 1HKBA 1MU2A 3ZSVA 3A5MC 2WTUA 4M3WA 3QEVA 1K73O 4CE9A 4LFCK 4LF4K 5KPTA 3HXMA 3O9RA 3PLAA 2KLAA 2O8DB 5AQFA 3QDKA 4ID5A 5EY4A 1J9AA 1NK0A 1KFSA 3OJUA 3M5RA 3HBTA 1NK5A 3KK2A 2EWSA 1OH5A 4A61A 2F9WA 5FPEA 5JICA 1XUPO 4YOUA 4PHTX 3DRPA 1KQSM 2KFNA 1JXBA 4YHHK 3CCLN 3RR7A 3CQXA 4CJTA 5GINA 3SMPA 4NXNK 3ATVA 4FPAA 2BH1A 3IRXA 1SKRA 5K14A 1WSIA 4AILC 3VTIA 4CFBA 5CE3A 4W5NA 3NDKA 1EX4A 3DLEA 3ASMA 1J53A 1S6QA 3WXJA 1BHLA 4JAXA 2B5JA 4F3OA 4BR2A 1ZBLA 4ID1A 4O44A 1GLBG 4IDHA 3U8XA 4KI4A 1W97L 4NO7A 3WEEB 3QIOA 4BDYA 3WXKA 4IOCL 3SUOA 3VEXA 3L6QA 2WFBA 3WNEA 5C15A 1YVUA 4BWJA 1Z6RA 3MXJA 4FWPA 1ITGA 4DLGA 4CFDA 1ATSA 3O9SA 3CJAA 3CPEA 2X6NA 2HF3A 4CGDA 2XO7A 4JKGA
chains in the Genus database with same CATH topology
3DLBA 1EETA 1RT1A 2YV0X 2KQ2A 4ELVA 5I42A 4KHWA 5DMRA 3DLKA 3RWUA 4OJRA 2E6LA 4CJQA 1R0AA 1UWBA 2E4LA 1CZBA 2RKIA 5HP1A 1CZ9A 1J54A 4OKEA 4E1MA 1RDCA 1RTJA 4CGFA 1RBUA 4MFBA 2BANA 4O4GA 3OYLA 1J5OA 3LANA 4DQRA 4DWIA 4TSXA 4I2QA 1CLQA 3AVHA 3ZT2A 3IG1A 1VSIA 3QEXA 1S1XA 2XY6A 4KREA 4FK2A 1JLEA 5SWMA 1LW2A 3NH2A 1JKHA 2GBZA 2G8WA 3C95A 1TKDA 4F2SA 4C8LA 3NAEA 1ZBIA 2RF2A 4CJRA 2Z1JA 5KRTA 2BDPA 1RTHA 3SUQA 4FLYA 1QTMA 2QK9A 3ZT0A 2JGUA 1VSEA 3K5MA 4CGGA 1DTTA 2WOMA 1NK9A 3WNFA 3VQ9A 4OVLA 3V1QA 4CEZA 2F96A 4I2PA 4IFVA 5JS2A 3ZCMA 3OYGA 3SQ2A 5HRRA 1D9DA 3IAYA 1RT3A 3S3OA 1TK8A 3OYNA 5CYQA 3LDSA 4I9QA 3BGRA 3LZJA 4CHQA 3TAMA 5KI6A 3AO1A 1QSSA 3DM2A 4ZTFA 3V81A 2Q3SA 2BGGA 3T3FA 1KVAA 2YHAA 4FJKA 4HHTA 4E89A 1TV6A 4BWMA 2FBVA 3TAFA 1S9EA 1LAWA 4KHNA 3O4NA 3AO5A 4AHCA 4FZXC 1O1WA 3LP0A 2OPPA 1HQEA 3M8PA 3L2RA 3ZSOA 4CGHA 1VSDA 2Y1JA 1IKWA 2HNYA 4CHYA 2KZMA 1RILA 3I0SA 4KFBA 4M3RA 1YTUA 3VA0A 2AJQA 1S6PA 4CK3A 4LSNA 3EZ5A 3SV3A 5HROA 3OYKA 4DTNA 4FJMA 3KLGA 3G10A 1T03A 4NCAA 1GOAA 4CIFA 4FM2A 1C6VA 3OYJA 4CJVA 4DU1A 3AA2A 4NYNA 1C1CA 1WLJA 1BI4A 1VSMA 3DI6A 4HTUA 3PO4A 3SZ2A 4FJ9A 2ATQA 4O0IA 3E01A 4W5TA 4M3TA 4Z4EA 1RDBA 3ZSWA 3B6PA 1N6QA 3RTVA 4CJ3A 4Z4GA 3PX0A 3AO3A 1WSJA 3M8SA 2D0AA 1BIZA 3SQ4A 3S9HA 1XHXA 1NK8A 3I8DA 1KRPA 4HCCA 3KK3A 4KTZA 2G8IA 3VQ4A 3P1GA 2HHQA 1RBSA 4FJ8A 4M3UA 3NF8A 4Q0BA 1S1UA 4GVMA 4BDZA 4PQUA 4F3TA 4E3SA 1A5WA 1JLAA 1SKWA 1NKBA 1WAFA 2FC0A 3KK1A 4HUEA 4EZ9A 3OS0A 1WSGA 3CM5A 4FK0A 4DTPA 1ZBUA 1IG9A 1TKZA 4CFAA 2DTUA 2HNDA 4CJPA 3NFAA 1RDDA 4E1NA 2DFEA 3LP3A 4F4KA 2ETJA 1D8YA 3CG7A 1T7PA 1D9FA 1KVCA 1NK7A 4M42A 1ASWA 3KD5E 3DLRA 4B8CA 1TL1A 5J2QA 4FJLA 1U4BA 1X1PA 1CXQA 1ZBFA 5HRPA 1RDAA 1REVA 4FJ5A 1YTAA 2HB5A 4EP5A 4W5OA 4BE0A 4J2DA 3I0RA 4FXDA 1C1BA 3KLIA 4RW8A 1ZBHA 2P5OA 3V1OA 3V9WA 4FVMA 2YKMA 3SPYA 4LH4A 4CCHA 2EHGA 1A5VA 3CM6A 1LAVA 3AVBA 4AH9A 3QEWA 3TAGA 4RW7A 4CK2A 3HP6A 4KHSA 2FBTA 1NKEA 1JLQA 2ITGA 4DFKA 2YNIA 1U45A 1LW0A 4CJKA 2OYQA 2EX3A 4OLAA 1KFDA 3OYAA 3A2FA 3F9KA 4NCGA 5C24A 4FLWA 1JL2A 1JLBA 4GW6A 3SI6A 3OVNA 4CESA 3D0PA 1G15A 4CIEA 4OKJA 3U3GA 3MEEA 4UQGA 4E7LA 4DU4A 4FJGA 1TVRA 1X9MA 1HJRA 1U48A 1S1WA 3AVAA 3LP1A 4B9SA 2IC3A 4CK1A 1Q8IA 1KSPA 2ZE2A 4FW1A 4Z4CA 3OYDA 3U6FA 1X9SA 3ZSZA 3ZSQA 1B9FA 2IGIA 2JLEA 1KCFA 1L3SA 2PYLA 4DQIA 5FROA 1RT6A 4LSLA 3CQ8A 4QAGA 3KD1E 4KHUA 1QS4A 3K5OA 2IS3A 3RMDA 3HVRA 3MXIA 4CEOA 1RT2A 2G8VA 2VWKA 4IBNA 3NH0A 2XHBA 2O4IA 3VQAA 5EU7A 4CEBA 4E19A 3L3UA 3O3GA 5C42A 1QSLA 1BCMA 2E6MA 2QKKA 2VG6A 4CJLA 2Y1IA 3VQ7A 3SYZA 4FJJA 4KI6A 1LWFA 3ZSRA 1VSKA 3AVGA 4DG1A 1UA1A 3ISNC 3TAQA 3TAPA 2IAJA 2D5RA 2QXFA 4DFPA 3O4QA 3ZT4A 4QOZB 1ASVA 3HM9A 5T7BA 5KTQA 4CJFA 2R7YA 4B9MA 3DRSA 1RNHA 3VQPA 4C8NA 3OYEA 3VA3A 1F21A 2I5JA 4DTUA 2G8FA 3AVNA 4CF8A 4FLTA 3ITHA 3PX6A 3K2PA 4FJIA 2G8KA 3IS9A 3VQQA 3QETA 4FLZA 3NBPA 3QINA 2HHUA 1Z25A 4B08A 4Q5VA 3U3YA 3NGZA 4M45A 4KO0A 3WNHA 3C94A 1FKOA 2YNHA 3T1AA 1XHZA 4FZYA 1WSHA 3L2WA 2X74A 4KTQA 1XI1A 4O5BA 5CZ2A 2OZSA 3VQ8A 3VQCA 1LWEA 3SJJA 3P5JA 3NE6A 3SCXA 3MXMA 1NK4A 3NF9A 4N76A 4CJEA 2RPIA 3QIPA 4FW2A 4ICLA 3LZIA 4DTRA 3HVTA 4DSJA 2OPQA 4LH5A 2XY7A 4OPKA 4CF1A 4CJSA 5HLFA 2XY5A 1N5YA 3AO4A 1TKXA 3VQ5A 1NK6A 5FRMA 1RBTA 5E41A 4KKOA 2P51A 3V1RA 3RMAA 4H4MA 1FK9A 5D3GA 1D5AA 2KZZA 4BE1A 1EXQA 1Z26A 3NH1A 1KLNA 2OPRA 2OPSA 1LV5A 4LY7A 1U49A 3OYFA 3V9XA 3O3FA 2GV9A 4J2AA 4M3XA 1S1TA 5J2MA 1BQNA 3DLGA 4I7FA 3P83D 4AHSA 3OYCA 2X6SA 2W42A 2HMIA 1XWLA 2RN2A 4CJ4A 1I3AA 3K58A 4H8KA 2XY8A 2ZQBA 4DMNA 4RW4A 4OKKA 4IG3A 5HRNA 1JXEA 5CY4A 5KRSA 4DS4A 3SNNA 4KHYA 3VQ6A 1IH7A 5JS1A 2LSNA 2O4GA 1QSYA 3H08A 2GUIA 2XRIA 4CF2A 1SUQA 4CHPA 4R5PA 4B9NA 3HP9A 3NCIA 1Q9YA 4CERA 1NKCA 4G1QA 4E7KA 1UA0A 3ZSXA 3TI0A 2P1JA 4JLHA 3KLFA 1S5JA 1W0HA 1WSFA 3EY1A 3QERA 3TR8A 3DMJA 4AHTA 4CFCA 2B4JA 3B6OA 3RRGA 1HPZA 3OY9A 1W9HA 2KFZA 3LAKA 2NUBA 3S3NA 4B9TA 4MQ3A 4W5RA 4FJNA 2HNZA 4CGJA 3L2QA 3QO9A 4CF0A 5KGXA 4FM0A 3HPGA 4BDPA 2KW4A 2HVHA 4Y1DA 3KKSA 4HUFA 3SV4A 4DSFA 1WNSA 3HJFA 4ELUA 3AV9A 2WONA 4AHUA 4DTJA 3PV8A 3THVA 3NGIA 4O0JA 1LWCA 1BGXT 1EKEA 3AVMA 1KTQA 4HCBA 4FJ7A 3L2UA 1NJYA 4IKFA 2DFHA 3TWHA 4FCYA 2YNFA 3LWMA 2F8SA 3KLEA 3V6DA 1C1AA 2Z1HA 3T19A 1JLFA 3HO1A 1UOCA 4E7HA 2B6AA 1U04A 3VQEA 1RT4A 3M8RA 3CFOA 1VSFA 4FYDA 2Z1IA 1UAXA 1DLOA 4I9LA 4CEQA 1A5XA 1RBVA 3CFRA 4JRPA 4B9LA 2VG7A 2G8HA 4Z4IA 2HHSA 1FXXA 1FKPA 5DK5A 4DTSA 3OYHA 1WSEA 3AVCA 3KTQA 1TAUA 4N41A 1VK0A 4YNQA 3OS1A 3AVJA 1KVBA 1BIUA 2A1RA 4N47A 2G8UA 1HRHA 3UIQA 4K8ZA 3LAMA 2X78A 3OYBA 5J1EA 1BL3A 1L3TA 2HHWA 3O3HA 1S1VA 3MAQA 4DTOA 5KGWA 5FRNA 1VRUA 1RTIA 2BE2A 3KIOA 4JS4A 1SL2A 1DTQA 2VG5A 3NF7A 2VWJA 4DQQA 3BDPA 3D45A 1SL0A 2PYJA 4FLXA 3ZT1A 5HRSA 1GOBA 4CJUA 3K57A 3DYAA 3ZSYA 4HVJA 4JS5A 4FM1A 4C8KA 5HBMA 3VN5A 2IDOA 3V4IA 3L3VA 1B9DA 1QQCA 1K6YA 1T05A 1Y97A 3SQ1A 1VRTA 2Z1GA 4CEFA 4CECA 4Z4FA 3ALYA 1TAQA 3HYFA 3JSMA 1NOYA 2ZD1A 4CEAA 4DS5A 4CEDA 3QESA 4C8OA 3TAEA 3TABA 3MECA 1BQMA 1TKTA 3SPZA 1RCHA 1U47A 4PUOA 2D0BA 4PWDA 1I39A 1NJWA 3HK2A 3C6TA 3AVKA 4H4OA 1JL1A 4IDKA 4IFYA 4CIGA 1L3VA 4KHQA 4KV8A 3DRRA 4B8AB 1VSJA 3KLHA 3KKRA 3LWLA 4FJHA 3DOKA 3OJSA 4OGCA 4KPYA 4F8RA 4KRFA 3MEGA 1RT7A 1NJZA 1TL3A 3LPUA 4OLBA 4EZ6A 3ZT3A 4AHVA 1VSLA 1B92A 1JLCA 3CFPA 4YFUA 4JRQA 4IG0A 4N5SA 3RMBA 3V9UA 3KJVA 4DU3A 3G0ZA 4M3ZA 4OPJA 4DSLA 1IO2A 3DLHA 1IKYA 5CZ1A 1TGOA 3HL8A 3QEIA 1TK0A 1HYZA 3LALA 4DLEA 3LP2A 1HNIA 4L8RB 3F73A 1SKSA 4FZZA 2KTQA 3MEDA 4WE1A 3M8QA 3OYMA 4DQSA 3TANA 1BI4B 1NJXA 3DOLA 4OGEA 4C8MA 4PA1A 4DQPA 4Y1CA 2YKNA 3AA5X 4CJWA 4FLVA 1HYSA 2HHTA 5J2PA 5J2NA 1ZYQA 4RW6A 3AVIA 1HQUA 3RRHA 3NHGA 1HYVA 1C0MA 3SQ0A 4E7JA 4B3OA 4DSEA 3QNOA 4DSIA 4BE2A 4F2RA 1MU2A 1BISA 1WAJA 1HMVA 1L3UA 2OZMA 3K5LA 4DF8A 4B9VA 2HHVA 4DSKA 3ZSVA 2PY5A 4M3WA 4KAZA 4BACA 1CXUA 1GOCA 5C25A 1EP4A 3CYMA 3OYIA 4CE9A 3QEVA 1SL1A 3PX4A 4CHOA 3L8BA 4W5QA 1C0TA 4CHZA 2YHBA 2F8TA 3HXMA 3S3MA 4Z0UA 4B9UA 4ZTJA 4CHNA 5CYMA 3K59A 4FLUA 2FBYA 4XIUA 4ID5A 2DFFA 3FFIA 1IKXA 1J9AA 1NK0A 1KFSA 3OJUA 4J2BA 4NCBA 4PY5A 4Z4HA 3HT3A 1IKVA 2D0CA 3AVFA 3VQBA 1NK5A 4DFMA 1XC9A 1SV5A 4J2EA 4QCLA 4HUGA 3KK2A 3HSTB 1TK5A 1WN7A 3JYTA 1JLGA 5I3UA 2HVIA 4EP4A 4DTXA 2KFNA 3DRPA 4K8XA 3SUPA 1JXBA 2FBXA 5SZTA 3RR8A 3C6UA 4E0DA 2OA8A 3RR7A 4RW9A 4GMJB 4CJTA 1ASUA 4DFJA 3OS2A 3PY8A 1KLMA 3EYZA 4DF4A 4KB1A 2HW3A 2QKBA 3NGYA 3IRXA 1SKRA 4M41A 3ULDA 4CF9A 5K14A 4LD0A 1WSIA 1VSHA 3WNGA 4NYFA 3V9SA 3VQDA 4M3YA 3QEPA 4AILC 1X9WA 4CFBA 4W5NA 3NDKA 4FJXA 1EX4A 3DLEA 4KTWA 2HHXA 3ASMA 1J53A 1S6QA 3PUFA 1HNVA 1BHLA 1S9GA 1YT3A 2B5JA 4F3OA 4AHRA 3SUNA 3K5NA 1Q9XA 2A1SA 1RT5A 4ZHRA 1ZBLA 1RBRA 4ID1A 4O44A 3PO5A 3AVLA 4FK4A 4KI4A 3V9ZA 3AA3A 3AA4A 3QNNA 1L5UA 3TARA 1QE1A 2IOCA 2P5GA 3QIOA 4BDYA 5FDLA 3NF6A 1BCOA 3L2VA 1T8EA 4RG8A 3SUOA 2YNGA 3WNEA 4CEEA 4O55A 1NOZA 4ELTA 1YVUA 1RTDA 2PZSA 1C0UA 3MXJA 3QLHA 4BWJA 2DY4A 1ITGA 4E7IA 3LPTA 4KB0A 4CGIA 4DLGA 4CFDA 4CJ5A 4N56A 3HPHA 4DTMA 3RMCA 2X6NA 1QHTA 3AO2A 3HPOA 4CGDA 2XO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLB A;  1EET A;  1RT1 A;  2YV0 X;  2KQ2 A;  4ELV A;  5I42 A;  4KHW A;  5DMR A;  3DLK A;  3RWU A;  4OJR A;  2E6L A;  4CJQ A;  1R0A A;  1UWB A;  2E4L A;  1CZB A;  2RKI A;  5HP1 A;  1CZ9 A;  1J54 A;  4OKE A;  4E1M A;  1RDC A;  1RTJ A;  4CGF A;  1RBU A;  4MFB A;  2BAN A;  4O4G A;  3OYL A;  1J5O A;  3LAN A;  4DQR A;  4DWI A;  4TSX A;  4I2Q A;  1CLQ A;  3AVH A;  3ZT2 A;  3IG1 A;  1VSI A;  3QEX A;  1S1X A;  2XY6 A;  4KRE A;  4FK2 A;  1JLE A;  5SWM A;  1LW2 A;  3NH2 A;  1JKH A;  2GBZ A;  2G8W A;  3C95 A;  1TKD A;  4F2S A;  4C8L A;  3NAE A;  1ZBI A;  2RF2 A;  4CJR A;  2Z1J A;  5KRT A;  2BDP A;  1RTH A;  3SUQ A;  4FLY A;  1QTM A;  2QK9 A;  3ZT0 A;  2JGU A;  1VSE A;  3K5M A;  4CGG A;  1DTT A;  2WOM A;  1NK9 A;  3WNF A;  3VQ9 A;  4OVL A;  3V1Q A;  4CEZ A;  2F96 A;  4I2P A;  4IFV A;  5JS2 A;  3ZCM A;  3OYG A;  3SQ2 A;  5HRR A;  1D9D A;  3IAY A;  1RT3 A;  3S3O A;  1TK8 A;  3OYN A;  5CYQ A;  3LDS A;  4I9Q A;  3BGR A;  3LZJ A;  4CHQ A;  3TAM A;  5KI6 A;  3AO1 A;  1QSS A;  3DM2 A;  4ZTF A;  3V81 A;  2Q3S A;  2BGG A;  3T3F A;  1KVA A;  2YHA A;  4FJK A;  4HHT A;  4E89 A;  1TV6 A;  4BWM A;  2FBV A;  3TAF A;  1S9E A;  1LAW A;  4KHN A;  3O4N A;  3AO5 A;  4AHC A;  4FZX C;  1O1W A;  3LP0 A;  2OPP A;  1HQE A;  3M8P A;  3L2R A;  3ZSO A;  4CGH A;  1VSD A;  2Y1J A;  1IKW A;  2HNY A;  4CHY A;  2KZM A;  1RIL A;  3I0S A;  4KFB A;  4M3R A;  1YTU A;  3VA0 A;  2AJQ A;  1S6P A;  4CK3 A;  4LSN A;  3EZ5 A;  3SV3 A;  5HRO A;  3OYK A;  4DTN A;  4FJM A;  3KLG A;  3G10 A;  1T03 A;  4NCA A;  1GOA A;  4CIF A;  4FM2 A;  1C6V A;  3OYJ A;  4CJV A;  4DU1 A;  3AA2 A;  4NYN A;  1C1C A;  1WLJ A;  1BI4 A;  1VSM A;  3DI6 A;  4HTU A;  3PO4 A;  3SZ2 A;  4FJ9 A;  2ATQ A;  4O0I A;  3E01 A;  4W5T A;  4M3T A;  4Z4E A;  1RDB A;  3ZSW A;  3B6P A;  1N6Q A;  3RTV A;  4CJ3 A;  4Z4G A;  3PX0 A;  3AO3 A;  1WSJ A;  3M8S A;  2D0A A;  1BIZ A;  3SQ4 A;  3S9H A;  1XHX A;  1NK8 A;  3I8D A;  1KRP A;  4HCC A;  3KK3 A;  4KTZ A;  2G8I A;  3VQ4 A;  3P1G A;  2HHQ A;  1RBS A;  4FJ8 A;  4M3U A;  3NF8 A;  4Q0B A;  1S1U A;  4GVM A;  4BDZ A;  4PQU A;  4F3T A;  4E3S A;  1A5W A;  1JLA A;  1SKW A;  1NKB A;  1WAF A;  2FC0 A;  3KK1 A;  4HUE A;  4EZ9 A;  3OS0 A;  1WSG A;  3CM5 A;  4FK0 A;  4DTP A;  1ZBU A;  1IG9 A;  1TKZ A;  4CFA A;  2DTU A;  2HND A;  4CJP A;  3NFA A;  1RDD A;  4E1N A;  2DFE A;  3LP3 A;  4F4K A;  2ETJ A;  1D8Y A;  3CG7 A;  1T7P A;  1D9F A;  1KVC A;  1NK7 A;  4M42 A;  1ASW A;  3KD5 E;  3DLR A;  4B8C A;  1TL1 A;  5J2Q A;  4FJL A;  1U4B A;  1X1P A;  1CXQ A;  1ZBF A;  5HRP A;  1RDA A;  1REV A;  4FJ5 A;  1YTA A;  2HB5 A;  4EP5 A;  4W5O A;  4BE0 A;  4J2D A;  3I0R A;  4FXD A;  1C1B A;  3KLI A;  4RW8 A;  1ZBH A;  2P5O A;  3V1O A;  3V9W A;  4FVM A;  2YKM A;  3SPY A;  4LH4 A;  4CCH A;  2EHG A;  1A5V A;  3CM6 A;  1LAV A;  3AVB A;  4AH9 A;  3QEW A;  3TAG A;  4RW7 A;  4CK2 A;  3HP6 A;  4KHS A;  2FBT A;  1NKE A;  1JLQ A;  2ITG A;  4DFK A;  2YNI A;  1U45 A;  1LW0 A;  4CJK A;  2OYQ A;  2EX3 A;  4OLA A;  1KFD A;  3OYA A;  3A2F A;  3F9K A;  4NCG A;  5C24 A;  4FLW A;  1JL2 A;  1JLB A;  4GW6 A;  3SI6 A;  3OVN A;  4CES A;  3D0P A;  1G15 A;  4CIE A;  4OKJ A;  3U3G A;  3MEE A;  4UQG A;  4E7L A;  4DU4 A;  4FJG A;  1TVR A;  1X9M A;  1HJR A;  1U48 A;  1S1W A;  3AVA A;  3LP1 A;  4B9S A;  2IC3 A;  4CK1 A;  1Q8I A;  1KSP A;  2ZE2 A;  4FW1 A;  4Z4C A;  3OYD A;  3U6F A;  1X9S A;  3ZSZ A;  3ZSQ A;  1B9F A;  2IGI A;  2JLE A;  1KCF A;  1L3S A;  2PYL A;  4DQI A;  5FRO A;  1RT6 A;  4LSL A;  3CQ8 A;  4QAG A;  3KD1 E;  4KHU A;  1QS4 A;  3K5O A;  2IS3 A;  3RMD A;  3HVR A;  3MXI A;  4CEO A;  1RT2 A;  2G8V A;  2VWK A;  4IBN A;  3NH0 A;  2XHB A;  2O4I A;  3VQA A;  5EU7 A;  4CEB A;  4E19 A;  3L3U A;  3O3G A;  5C42 A;  1QSL A;  1BCM A;  2E6M A;  2QKK A;  2VG6 A;  4CJL A;  2Y1I A;  3VQ7 A;  3SYZ A;  4FJJ A;  4KI6 A;  1LWF A;  3ZSR A;  1VSK A;  3AVG A;  4DG1 A;  1UA1 A;  3ISN C;  3TAQ A;  3TAP A;  2IAJ A;  2D5R A;  2QXF A;  4DFP A;  3O4Q A;  3ZT4 A;  4QOZ B;  1ASV A;  3HM9 A;  5T7B A;  5KTQ A;  4CJF A;  2R7Y A;  4B9M A;  3DRS A;  1RNH A;  3VQP A;  4C8N A;  3OYE A;  3VA3 A;  1F21 A;  2I5J A;  4DTU A;  2G8F A;  3AVN A;  4CF8 A;  4FLT A;  3ITH A;  3PX6 A;  3K2P A;  4FJI A;  2G8K A;  3IS9 A;  3VQQ A;  3QET A;  4FLZ A;  3NBP A;  3QIN A;  2HHU A;  1Z25 A;  4B08 A;  4Q5V A;  3U3Y A;  3NGZ A;  4M45 A;  4KO0 A;  3WNH A;  3C94 A;  1FKO A;  2YNH A;  3T1A A;  1XHZ A;  4FZY A;  1WSH A;  3L2W A;  2X74 A;  4KTQ A;  1XI1 A;  4O5B A;  5CZ2 A;  2OZS A;  3VQ8 A;  3VQC A;  1LWE A;  3SJJ A;  3P5J A;  3NE6 A;  3SCX A;  3MXM A;  1NK4 A;  3NF9 A;  4N76 A;  4CJE A;  2RPI A;  3QIP A;  4FW2 A;  4ICL A;  3LZI A;  4DTR A;  3HVT A;  4DSJ A;  2OPQ A;  4LH5 A;  2XY7 A;  4OPK A;  4CF1 A;  4CJS A;  5HLF A;  2XY5 A;  1N5Y A;  3AO4 A;  1TKX A;  3VQ5 A;  1NK6 A;  5FRM A;  1RBT A;  5E41 A;  4KKO A;  2P51 A;  3V1R A;  3RMA A;  4H4M A;  1FK9 A;  5D3G A;  1D5A A;  2KZZ A;  4BE1 A;  1EXQ A;  1Z26 A;  3NH1 A;  1KLN A;  2OPR A;  2OPS A;  1LV5 A;  4LY7 A;  1U49 A;  3OYF A;  3V9X A;  3O3F A;  2GV9 A;  4J2A A;  4M3X A;  1S1T A;  5J2M A;  1BQN A;  3DLG A;  4I7F A;  3P83 D;  4AHS A;  3OYC A;  2X6S A;  2W42 A;  2HMI A;  1XWL A;  2RN2 A;  4CJ4 A;  1I3A A;  3K58 A;  4H8K A;  2XY8 A;  2ZQB A;  4DMN A;  4RW4 A;  4OKK A;  4IG3 A;  5HRN A;  1JXE A;  5CY4 A;  5KRS A;  4DS4 A;  3SNN A;  4KHY A;  3VQ6 A;  1IH7 A;  5JS1 A;  2LSN A;  2O4G A;  1QSY A;  3H08 A;  2GUI A;  2XRI A;  4CF2 A;  1SUQ A;  4CHP A;  4R5P A;  4B9N A;  3HP9 A;  3NCI A;  1Q9Y A;  4CER A;  1NKC A;  4G1Q A;  4E7K A;  1UA0 A;  3ZSX A;  3TI0 A;  2P1J A;  4JLH A;  3KLF A;  1S5J A;  1W0H A;  1WSF A;  3EY1 A;  3QER A;  3TR8 A;  3DMJ A;  4AHT A;  4CFC A;  2B4J A;  3B6O A;  3RRG A;  1HPZ A;  3OY9 A;  1W9H A;  2KFZ A;  3LAK A;  2NUB A;  3S3N A;  4B9T A;  4MQ3 A;  4W5R A;  4FJN A;  2HNZ A;  4CGJ A;  3L2Q A;  3QO9 A;  4CF0 A;  5KGX A;  4FM0 A;  3HPG A;  4BDP A;  2KW4 A;  2HVH A;  4Y1D A;  3KKS A;  4HUF A;  3SV4 A;  4DSF A;  1WNS A;  3HJF A;  4ELU A;  3AV9 A;  2WON A;  4AHU A;  4DTJ A;  3PV8 A;  3THV A;  3NGI A;  4O0J A;  1LWC A;  1BGX T;  1EKE A;  3AVM A;  1KTQ A;  4HCB A;  4FJ7 A;  3L2U A;  1NJY A;  4IKF A;  2DFH A;  3TWH A;  4FCY A;  2YNF A;  3LWM A;  2F8S A;  3KLE A;  3V6D A;  1C1A A;  2Z1H A;  3T19 A;  1JLF A;  3HO1 A;  1UOC A;  4E7H A;  2B6A A;  1U04 A;  3VQE A;  1RT4 A;  3M8R A;  3CFO A;  1VSF A;  4FYD A;  2Z1I A;  1UAX A;  1DLO A;  4I9L A;  4CEQ A;  1A5X A;  1RBV A;  3CFR A;  4JRP A;  4B9L A;  2VG7 A;  2G8H A;  4Z4I A;  2HHS A;  1FXX A;  1FKP A;  5DK5 A;  4DTS A;  3OYH A;  1WSE A;  3AVC A;  3KTQ A;  1TAU A;  4N41 A;  1VK0 A;  4YNQ A;  3OS1 A;  3AVJ A;  1KVB A;  1BIU A;  2A1R A;  4N47 A;  2G8U A;  1HRH A;  3UIQ A;  4K8Z A;  3LAM A;  2X78 A;  3OYB A;  5J1E A;  1BL3 A;  1L3T A;  2HHW A;  3O3H A;  1S1V A;  3MAQ A;  4DTO A;  5KGW A;  5FRN A;  1VRU A;  1RTI A;  2BE2 A;  3KIO A;  4JS4 A;  1SL2 A;  1DTQ A;  2VG5 A;  3NF7 A;  2VWJ A;  4DQQ A;  3BDP A;  3D45 A;  1SL0 A;  2PYJ A;  4FLX A;  3ZT1 A;  5HRS A;  1GOB A;  4CJU A;  3K57 A;  3DYA A;  3ZSY A;  4HVJ A;  4JS5 A;  4FM1 A;  4C8K A;  5HBM A;  3VN5 A;  2IDO A;  3V4I A;  3L3V A;  1B9D A;  1QQC A;  1K6Y A;  1T05 A;  1Y97 A;  3SQ1 A;  1VRT A;  2Z1G A;  4CEF A;  4CEC A;  4Z4F A;  3ALY A;  1TAQ A;  3HYF A;  3JSM A;  1NOY A;  2ZD1 A;  4CEA A;  4DS5 A;  4CED A;  3QES A;  4C8O A;  3TAE A;  3TAB A;  3MEC A;  1BQM A;  1TKT A;  3SPZ A;  1RCH A;  1U47 A;  4PUO A;  2D0B A;  4PWD A;  1I39 A;  1NJW A;  3HK2 A;  3C6T A;  3AVK A;  4H4O A;  1JL1 A;  4IDK A;  4IFY A;  4CIG A;  1L3V A;  4KHQ A;  4KV8 A;  3DRR A;  4B8A B;  1VSJ A;  3KLH A;  3KKR A;  3LWL A;  4FJH A;  3DOK A;  3OJS A;  4OGC A;  4KPY A;  4F8R A;  4KRF A;  3MEG A;  1RT7 A;  1NJZ A;  1TL3 A;  3LPU A;  4OLB A;  4EZ6 A;  3ZT3 A;  4AHV A;  1VSL A;  1B92 A;  1JLC A;  3CFP A;  4YFU A;  4JRQ A;  4IG0 A;  4N5S A;  3RMB A;  3V9U A;  3KJV A;  4DU3 A;  3G0Z A;  4M3Z A;  4OPJ A;  4DSL A;  1IO2 A;  3DLH A;  1IKY A;  5CZ1 A;  1TGO A;  3HL8 A;  3QEI A;  1TK0 A;  1HYZ A;  3LAL A;  4DLE A;  3LP2 A;  1HNI A;  4L8R B;  3F73 A;  1SKS A;  4FZZ A;  2KTQ A;  3MED A;  4WE1 A;  3M8Q A;  3OYM A;  4DQS A;  3TAN A;  1BI4 B;  1NJX A;  3DOL A;  4OGE A;  4C8M A;  4PA1 A;  4DQP A;  4Y1C A;  2YKN A;  3AA5 X;  4CJW A;  4FLV A;  1HYS A;  2HHT A;  5J2P A;  5J2N A;  1ZYQ A;  4RW6 A;  3AVI A;  1HQU A;  3RRH A;  3NHG A;  1HYV A;  1C0M A;  3SQ0 A;  4E7J A;  4B3O A;  4DSE A;  3QNO A;  4DSI A;  4BE2 A;  4F2R A;  1MU2 A;  1BIS A;  1WAJ A;  1HMV A;  1L3U A;  2OZM A;  3K5L A;  4DF8 A;  4B9V A;  2HHV A;  4DSK A;  3ZSV A;  2PY5 A;  4M3W A;  4KAZ A;  4BAC A;  1CXU A;  1GOC A;  5C25 A;  1EP4 A;  3CYM A;  3OYI A;  4CE9 A;  3QEV A;  1SL1 A;  3PX4 A;  4CHO A;  3L8B A;  4W5Q A;  1C0T A;  4CHZ A;  2YHB A;  2F8T A;  3HXM A;  3S3M A;  4Z0U A;  4B9U A;  4ZTJ A;  4CHN A;  5CYM A;  3K59 A;  4FLU A;  2FBY A;  4XIU A;  4ID5 A;  2DFF A;  3FFI A;  1IKX A;  1J9A A;  1NK0 A;  1KFS A;  3OJU A;  4J2B A;  4NCB A;  4PY5 A;  4Z4H A;  3HT3 A;  1IKV A;  2D0C A;  3AVF A;  3VQB A;  1NK5 A;  4DFM A;  1XC9 A;  1SV5 A;  4J2E A;  4QCL A;  4HUG A;  3KK2 A;  3HST B;  1TK5 A;  1WN7 A;  3JYT A;  1JLG A;  5I3U A;  2HVI A;  4EP4 A;  4DTX A;  2KFN A;  3DRP A;  4K8X A;  3SUP A;  1JXB A;  2FBX A;  5SZT A;  3RR8 A;  3C6U A;  4E0D A;  2OA8 A;  3RR7 A;  4RW9 A;  4GMJ B;  4CJT A;  1ASU A;  4DFJ A;  3OS2 A;  3PY8 A;  1KLM A;  3EYZ A;  4DF4 A;  4KB1 A;  2HW3 A;  2QKB A;  3NGY A;  3IRX A;  1SKR A;  4M41 A;  3ULD A;  4CF9 A;  5K14 A;  4LD0 A;  1WSI A;  1VSH A;  3WNG A;  4NYF A;  3V9S A;  3VQD A;  4M3Y A;  3QEP A;  4AIL C;  1X9W A;  4CFB A;  4W5N A;  3NDK A;  4FJX A;  1EX4 A;  3DLE A;  4KTW A;  2HHX A;  3ASM A;  1J53 A;  1S6Q A;  3PUF A;  1HNV A;  1BHL A;  1S9G A;  1YT3 A;  2B5J A;  4F3O A;  4AHR A;  3SUN A;  3K5N A;  1Q9X A;  2A1S A;  1RT5 A;  4ZHR A;  1ZBL A;  1RBR A;  4ID1 A;  4O44 A;  3PO5 A;  3AVL A;  4FK4 A;  4KI4 A;  3V9Z A;  3AA3 A;  3AA4 A;  3QNN A;  1L5U A;  3TAR A;  1QE1 A;  2IOC A;  2P5G A;  3QIO A;  4BDY A;  5FDL A;  3NF6 A;  1BCO A;  3L2V A;  1T8E A;  4RG8 A;  3SUO A;  2YNG A;  3WNE A;  4CEE A;  4O55 A;  1NOZ A;  4ELT A;  1YVU A;  1RTD A;  2PZS A;  1C0U A;  3MXJ A;  3QLH A;  4BWJ A;  2DY4 A;  1ITG A;  4E7I A;  3LPT A;  4KB0 A;  4CGI A;  4DLG A;  4CFD A;  4CJ5 A;  4N56 A;  3HPH A;  4DTM A;  3RMC A;  2X6N A;  1QHT A;  3AO2 A;  3HPO A;  4CGD A;  2XO7 A; 
#chains in the Genus database with same CATH topology
 4MDA A;  3UKR A;  1ZXO A;  2YHX A;  4KHW A;  2P9N B;  3RWU A;  4OJR A;  3E1Y A;  4GKJ K;  4DV1 K;  1UWB A;  2AA4 A;  5HP1 A;  1CZ9 A;  4OKE A;  4E1M A;  1RFQ A;  4O4G A;  3OYL A;  3H1V X;  3AVH A;  5LY3 A;  3CJC A;  3IG1 A;  2E2N A;  4LF6 K;  1LW2 A;  2G8W A;  4C8L A;  4FL9 A;  2VWB A;  1MDU B;  5BRE A;  2WC9 A;  3NAE A;  2Z1J A;  1RTH A;  2QK9 A;  4J8F A;  4B1W B;  2UU9 K;  2V52 B;  3VGL A;  3K5M A;  3V1Q A;  4H0T B;  5AZI B;  1RT3 A;  2GWK A;  1TK8 A;  5CYQ A;  4I9Q A;  4CHQ A;  2NLX A;  4JV5 K;  4FJK A;  4BRM A;  5JVG L;  4O5F A;  3TAF A;  4KHN A;  1E4G T;  4BRG A;  4O8K A;  3LP0 A;  1HQE A;  3M8P A;  3O1B A;  3ZSO A;  4QS7 A;  4JI2 K;  1IKW A;  5BRH A;  2AJQ A;  4CK3 A;  3EZ5 A;  3WXI A;  3KLG A;  2KHO A;  4DU1 A;  3QFU A;  4NYN A;  3KK7 A;  1BI4 A;  5C2F A;  1J5E K;  4FJ9 A;  1N6Q A;  4CJ3 A;  4Z4G A;  4MO5 A;  3A0I X;  5LJW A;  3S9H A;  4CZE A;  3WXM B;  4BRN A;  5FPM A;  4M63 C;  4FJ8 A;  1S1U A;  4KH4 A;  4BDZ A;  4PQU A;  4F3T A;  5AQR A;  4FWR A;  1NKB A;  2O8C B;  3HOS A;  1IG9 A;  5AQZ A;  5BPM A;  4BC2 A;  1RDD A;  4E1N A;  4F4K A;  5EX5 A;  1O13 A;  2O8D A;  3CG7 A;  4AM6 A;  1D9F A;  1NK7 A;  4BRD A;  3SBT A;  3KD5 E;  1X1P A;  3J8A A;  3R9P A;  1ZBF A;  5HRP A;  4JYA K;  1YTA A;  5M1Q A;  4BE0 A;  4EP5 A;  4O8U A;  1WOQ A;  1FW6 A;  3I0R A;  4FXD A;  3V1O A;  3V9W A;  4FVM A;  3SPY A;  2QM1 A;  3OHR A;  1A5V A;  1LAV A;  3TAG A;  1ZBS A;  2FBT A;  3EE9 A;  1JLQ A;  3GG4 A;  5C2D A;  4CJK A;  2EX3 A;  3OYA A;  2E20 A;  3O9Q A;  4FLW A;  4RCH A;  5GIO A;  4GW6 A;  4H5N A;  3SI6 A;  1HNZ K;  1HNX K;  4CIE A;  4OKJ A;  2NRX A;  4E7L A;  1X9M A;  1T3V A;  3CIP A;  3UKU B;  3CCM N;  3C6H A;  4Z4C A;  1B9F A;  2IGI A;  2JLE A;  1KCF A;  4LSL A;  4BR7 A;  4QAG A;  4AQY K;  1QS4 A;  2V7Z A;  4EHT A;  3HOT A;  3MXI A;  3WEE A;  5M1F A;  3ZEU B;  3NH0 A;  2O4I A;  4CEB A;  2Q1N A;  3L3U A;  1BCM A;  2VG6 A;  4KI6 A;  4DR2 K;  2NNW A;  3ZSR A;  1UA1 A;  3R1X A;  3S41 A;  3ZT4 A;  4DKW A;  3KWG A;  4ILJ A;  4DV5 K;  1RNH A;  1JCG A;  3MDQ A;  3AVN A;  4FLT A;  3K2P A;  3VPZ A;  4DR1 K;  1QZ5 A;  4BRF A;  3ID6 A;  4FLZ A;  2HHU A;  1VQ4 N;  4WQ5 C;  2HF4 A;  4Q5V A;  3OW2 M;  3WNH A;  3C94 A;  1FKO A;  2YNH A;  3T1A A;  1XQS C;  4BRQ A;  2X74 A;  1XI1 A;  4O5B A;  5CZ2 A;  2A40 A;  3VQ8 A;  3VQC A;  1LWE A;  4BG9 A;  3SCX A;  4JI1 K;  1NK4 A;  3NF9 A;  4FWM A;  4OPK A;  4CJS A;  5HLF A;  5BRF A;  2ASM A;  1TKX A;  2YJE A;  1NK6 A;  4XH4 A;  1LCU A;  5AZI A;  2P51 A;  2P9K B;  3VMF B;  4H4M A;  1FK9 A;  3AAP A;  4A2B A;  1D5A A;  1WBB A;  1EXQ A;  3VEY A;  1KLN A;  2OPS A;  3K0S A;  1LV5 A;  3BF3 A;  4IO8 A;  2HBK A;  2GV9 A;  2QWR A;  4LFB K;  2X6S A;  3GL1 A;  2RN2 A;  4CJ4 A;  2XY8 A;  3VF2 A;  4RW4 A;  4HTL A;  4MDB A;  4DS4 A;  1YVN A;  3H08 A;  4H03 B;  3IKM A;  1YJN N;  3NCI A;  3DXK A;  4E7K A;  1UA0 A;  2FSJ A;  3TI0 A;  2FXU A;  4JLH A;  3DMJ A;  4CFC A;  1IJJ A;  1HPZ A;  2KFZ A;  1W9H A;  2NUB A;  3C0B A;  4BDP A;  1XMQ K;  3W0L A;  1ILY A;  2KW4 A;  3SV4 A;  4DSF A;  5KPR A;  1M1K O;  4ELU A;  2WON A;  4V19 S;  3OBY A;  4DTJ A;  2CGK A;  3U9D A;  5M1N A;  4O0J A;  1EKE A;  3L2U A;  1NJY A;  4IKF A;  2O8C A;  3TWH A;  2F8S A;  5AQV A;  1C1A A;  1YI2 N;  4XH5 A;  1NGB A;  3J7Y P;  1RT4 A;  3BP8 A;  4CEQ A;  4I9L A;  1A5X A;  2VG7 A;  2G8H A;  3D2F B;  4PKG A;  1WSE A;  4WFA L;  3ULE B;  3OS1 A;  1KVB A;  4N47 A;  5KPZ A;  5F1X A;  2X78 A;  4JD2 B;  1DKG D;  5J1E A;  3O3H A;  2FF3 B;  3M1F A;  1DTQ A;  1GLD G;  3NF7 A;  1BG3 A;  3D45 A;  1SL0 A;  5JVH L;  4C8K A;  2KKZ A;  4JS5 A;  2H3G X;  4BVP A;  3L3V A;  5AQW A;  1TYQ B;  1OVY A;  2ZM6 K;  1VRT A;  4CEF A;  3ALY A;  1NBW A;  4JHD A;  3G4S N;  1NOY A;  4CEA A;  2PBD A;  2QWM A;  1TKT A;  1RCH A;  3PIO L;  3CC2 N;  1NJW A;  3MN6 A;  1VQM N;  4IFY A;  3WT0 A;  4FJH A;  3KKR A;  1P90 A;  3DOK A;  2FF6 A;  3ZEU A;  3AGR A;  4MLH A;  4JRQ A;  3CFP A;  3RMB A;  4DU3 A;  3G0Z A;  3ENB A;  4M3Z A;  3DLH A;  2HHH K;  3CCU N;  3F73 A;  4FZZ A;  3MED A;  3OYM A;  1C0G A;  4B1X B;  3TAN A;  1NJX A;  1YAG A;  4PA1 A;  1Q82 O;  3BF1 A;  4AF1 A;  4RW6 A;  4BRO A;  3FGU A;  4B3O A;  1WAJ A;  1HMV A;  1L3U A;  2OZM A;  2F4V K;  1T6C A;  4FWL A;  1HNW K;  5AQL A;  4BAC A;  1CXU A;  1GOC A;  3CYM A;  3PX4 A;  4CZI A;  3KVG A;  2YHB A;  3M6G A;  3IMX A;  4FVU A;  4YOX A;  4XIU A;  2DFF A;  1HR0 K;  1IKX A;  5AZJ B;  4NCB A;  4PY5 A;  4J2B A;  1BU6 O;  3VQB A;  4DFM A;  4JI7 K;  4A59 A;  1NGA A;  1JLG A;  5I3U A;  4EP4 A;  4K8X A;  1HUX A;  5BPN A;  4E0D A;  2OA8 A;  4A5A A;  3D7E O;  4GMJ B;  2YCH A;  1D4X A;  4DFJ A;  3OS2 A;  1K8A O;  3O6W A;  1ESV A;  3FR0 A;  4LD0 A;  2W6K A;  4NYF A;  2ZGZ A;  4DR6 K;  4JKG B;  3T7Z A;  3PUF A;  1HNV A;  1Q9X A;  2A1S A;  4OPH A;  3AVL A;  3V9Z A;  5LMN K;  3AA4 A;  3QNN A;  1L5U A;  4JI0 K;  2IOC A;  1T8E A;  3MN7 A;  3EN9 A;  4ELT A;  4DV2 K;  3QLH A;  3ENO A;  1IBL K;  4DQ8 A;  4CJ5 A;  3HPH A;  3KWI A;  3IFR A;  4JKB A;  1QHT A;  3QEI A;  3LDQ A;  1YJW N;  4U7B A;  4JI6 K;  2YV0 X;  2QWL A;  2KQ2 A;  3CER A;  5I42 A;  5DMR A;  3DLK A;  2Q36 A;  2FSK A;  3B8A X;  2E6L A;  3LDN A;  4CJQ A;  2E4L A;  1CZB A;  1HKG A;  3KZB A;  1GLL O;  3ENH A;  2BAN A;  4DQR A;  4DWI A;  4TSX A;  2GWJ A;  2XY6 A;  4JD2 A;  3NH2 A;  1JKH A;  5AQM A;  2GBZ A;  5KQ8 A;  3C95 A;  3ZLJ A;  2Q2R A;  3VGM A;  1YXQ A;  1ZBI A;  4CJR A;  2BDP A;  1NGD A;  2QWP A;  1DTT A;  4I6M A;  4CEZ A;  1S72 N;  2NZT A;  1TYQ A;  3ZCM A;  1NMN A;  4BC3 A;  5HRR A;  3SQ2 A;  3R8E A;  3S3O A;  3LDS A;  1RDU A;  3AY9 A;  5KI6 A;  4BRI A;  2W6L A;  1KVA A;  4HHT A;  3I55 N;  1TV6 A;  4BWM A;  2FBV A;  4JNE A;  1LAW A;  4BQZ A;  3O8M A;  1M90 O;  1VSD A;  3PSI A;  2Y1J A;  2UXD K;  3QIC A;  3VEO A;  2KZM A;  1RIL A;  4WQ4 C;  1NGG A;  3O9U A;  1S6P A;  3SV3 A;  5HRO A;  4DTN A;  5IT9 O;  3G10 A;  4NCA A;  1GOA A;  2OTJ N;  2UUB K;  3AA2 A;  3FZK A;  1C1C A;  5C0Y A;  5AQP A;  4HTU A;  3PO4 A;  2ATQ A;  4M3T A;  3OTO K;  1RDB A;  3ZSW A;  3RTV A;  4BRE A;  4OX9 K;  3PX0 A;  3M8S A;  1BIZ A;  4BC4 A;  3SQ4 A;  5GAD P;  3Q7B A;  1KRP A;  2G8I A;  3EL2 A;  2PFU A;  4E3S A;  1JLA A;  4JI5 K;  4EZ9 A;  1WAF A;  2FC0 A;  4JKC A;  3KK1 A;  3OS0 A;  3CM5 A;  1ZBU A;  2HND A;  3O9T A;  5GAH P;  2RHK A;  4CJP A;  5MLC Q;  3NVK A;  2DFE A;  1WUA A;  5JLF A;  3H6E A;  4LF9 K;  3LL3 A;  3UE5 A;  5AZJ A;  1V4T A;  4JEP A;  1ASW A;  1TL1 A;  5J2Q A;  3CCS N;  1RDA A;  4NLC A;  2HB5 A;  3LM9 A;  4W5O A;  4J2D A;  1C1B A;  4RW8 A;  3FZF A;  2ZJP L;  3QEW A;  3AVB A;  5M1O A;  1IBK K;  2UYT A;  3CC4 N;  2ITG A;  4DFK A;  1WB9 A;  3WUH A;  1U45 A;  1LW0 A;  4OLA A;  1KFD A;  4IFE A;  1JL2 A;  1IV0 A;  3LDO A;  4CVN E;  3F5T A;  3SLC A;  1TUU A;  2J4R A;  4DR3 K;  1G15 A;  3MEE A;  5H1S Q;  1N36 K;  1S1W A;  1YHQ N;  4IJN A;  3LP1 A;  4CJ7 A;  4B9S A;  1Q8I A;  4FW1 A;  1X9S A;  1QQO A;  3ZSZ A;  4LF8 K;  4KHU A;  1RT6 A;  3CQ8 A;  3KD1 E;  2IS3 A;  4CZJ A;  3RMD A;  3HVR A;  2G8V A;  1P8Z A;  2CH5 A;  3J81 O;  4YOW A;  3NMU A;  1GLA G;  5TKW A;  2E6M A;  2QKK A;  4CJL A;  3VQ7 A;  3SYZ A;  4FJJ A;  1VSK A;  4RTF D;  3VEW A;  3ISN C;  3ZX2 A;  3TAQ A;  3TAP A;  4DV6 K;  3P38 A;  3CME N;  1ASV A;  2R7Y A;  3BY5 A;  3OYE A;  1N8R O;  2ZJR L;  1F21 A;  1DGK N;  3IS9 A;  3I56 N;  3QIN A;  3U3Y A;  4YDU C;  4KO0 A;  3OBW A;  1YJ9 N;  1XHZ A;  2IIR A;  1SQK A;  4GV9 A;  3CF5 L;  3SJJ A;  3NE6 A;  3MXM A;  2RPI A;  2E88 A;  4DSJ A;  4ICL A;  4LH5 A;  2XY5 A;  2OAN A;  3AO4 A;  4M7X A;  5FRM A;  1RBT A;  3DXK B;  1HX1 A;  3RMA A;  5D3G A;  4BE1 A;  3VEV A;  1Z26 A;  4LY7 A;  4AM7 A;  3CET A;  3O3F A;  4C1N K;  1BQN A;  3DLG A;  3BUZ B;  3P83 D;  4AHS A;  3OYC A;  3ID8 A;  1I3A A;  3K58 A;  3BEX A;  3GOI A;  4CBX A;  3E9L A;  5HRN A;  1JXE A;  5FLX O;  2QW9 A;  1IH7 A;  5AQK A;  4B3M K;  4A2A A;  4B9N A;  4FWO A;  3HP9 A;  4QS9 A;  1Q9Y A;  4CER A;  4R79 A;  1NKC A;  1EWR A;  4BRL A;  1RGI A;  3T1H K;  1KAX A;  1WSF A;  3CMA N;  3QER A;  2O8E B;  3B6O A;  3S3N A;  2Q31 A;  5AQX A;  4ILG B;  3G71 N;  3HM8 A;  1NGF A;  3QO9 A;  3R6M A;  5KGX A;  3HPG A;  2O8B B;  3TSU A;  2HVH A;  3KKS A;  4K43 A;  2IVP A;  1X3N A;  3HJF A;  2YJF A;  3THV A;  4H5R A;  1LWC A;  1BGX T;  5AQQ A;  4HCB A;  4FJ7 A;  4FOI A;  3R3L A;  4FCY A;  3LWM A;  3KLE A;  3V6D A;  4BGA A;  4GY2 B;  3T19 A;  5FPD A;  1JLF A;  3HO1 A;  1UOC A;  1VQ8 N;  3M8R A;  2P9L A;  3QBW A;  4JHD B;  1UAX A;  3WQU A;  4Z4I A;  3SAG A;  1FKP A;  1TAU A;  2Q0R A;  3HI0 A;  1BIU A;  2A1R A;  3UIQ A;  4K8Z A;  5ADX H;  5AQU A;  2HHW A;  1L3T A;  1S1V A;  4DTO A;  5FRN A;  1VRU A;  1RTI A;  2BE2 A;  3KIO A;  1SL2 A;  2VG5 A;  2PYJ A;  3MMV A;  5LMU K;  3AAQ A;  1GOB A;  4IOX A;  4FM1 A;  3DYA A;  3V4I A;  4EHU A;  3F2K A;  1B9D A;  3CJ7 A;  3SQ1 A;  1QZ6 A;  3QB0 A;  1GLF O;  4LC9 B;  3CQY A;  3CI5 A;  3JSM A;  4DS5 A;  4CED A;  3QES A;  4C8O A;  1U47 A;  3SPZ A;  3GBT A;  2D0B A;  3HK2 A;  4H4O A;  2AP1 A;  4IDK A;  3O4W A;  4H0V B;  1L3V A;  3DRR A;  3LWL A;  5AQH A;  4BRP A;  3OJS A;  3DLL L;  3CPW M;  3MEG A;  1RT7 A;  5GAE P;  3LPU A;  5AQS A;  2YHY A;  3I8B A;  1JLC A;  4N5S A;  4CZF A;  1IO2 A;  1TGO A;  1S3X A;  1TK0 A;  1HYZ A;  4DLE A;  1S22 A;  3U9Z A;  4EIA A;  4L8R B;  3ZYY X;  1SKS A;  3CD6 N;  4Y0W A;  2A41 A;  4B1Y B;  4A62 A;  4H0X B;  4FWS A;  2V51 B;  3CJ9 A;  4IEI A;  4DV4 K;  4FO0 A;  2GTD A;  3C6A A;  4DQP A;  2QTD A;  3MWT A;  1I94 K;  2HHT A;  5J2P A;  1ZYQ A;  5M1P A;  3AVI A;  1HQU A;  3RRH A;  3SQ0 A;  4E7J A;  2QI2 A;  4NLB A;  4F2R A;  4B1U B;  4OPA A;  2P9U A;  3FLC O;  3K5L A;  3VTH A;  4B9V A;  1G99 A;  3WXL A;  5C25 A;  1EP4 A;  3OYI A;  1SL1 A;  2GEM A;  3L8B A;  4W5Q A;  1C0T A;  4CHZ A;  2WUS A;  4BY9 C;  2P9I A;  1N33 K;  4Z0U A;  4B9U A;  2FBY A;  4KBO A;  3FFI A;  1VQK N;  4Z4H A;  1IKV A;  2D0C A;  5EXW A;  3AVF A;  4IJA A;  1SV5 A;  5BPL A;  4HUG A;  3HST B;  1TK5 A;  3JYT A;  5C10 A;  2HVI A;  1K8K B;  2VQF K;  3SUP A;  2FBX A;  4DCH A;  4X64 K;  4X65 K;  2YI1 A;  4RW9 A;  3PY8 A;  1KLM A;  3I33 A;  4KB1 A;  4DF4 A;  2HW3 A;  2QKB A;  3NGY A;  1QQN A;  4CF9 A;  3WNG A;  3V9S A;  1X9W A;  3T1Y K;  4FJX A;  1VQL N;  4CBU A;  2HHX A;  3EO3 A;  3J80 O;  3VEN A;  1S9G A;  1YT3 A;  4AHR A;  4JKH A;  1HPM A;  3K5N A;  4ZHR A;  1RT5 A;  1XNQ K;  4YOR A;  3PO5 A;  2O8E A;  3G6E N;  3SAF A;  3AA3 A;  2Q97 A;  1QE1 A;  5FDL A;  1BCO A;  3L2V A;  3CXC M;  4CEE A;  2O8B A;  5KQD A;  2DY4 A;  4IWV A;  4KB0 A;  4CGI A;  4Z94 A;  4N56 A;  1OKJ A;  3RMC A;  1U2V A;  1VQ5 N;  1NJI O;  3C7N B;  4A57 A;  4CZM A;  1VQP N;  4I6M B;  3ZX0 A;  3DLB A;  1EET A;  4ELV A;  5I9E B;  1R0A A;  1QHA A;  1J54 A;  1RDC A;  4CGF A;  1RBU A;  4MFB A;  1J5O A;  3LAN A;  4CZK A;  3CJ1 A;  1CLQ A;  3ZT2 A;  3QEX A;  2VGM A;  1S1X A;  4KRE A;  5JLH A;  4FK2 A;  5SWM A;  4G9Z A;  3SAH A;  4F2S A;  3DXM A;  3JXU A;  2RF2 A;  1QTM A;  5M1K A;  4B3T K;  4NXM K;  1VSE A;  4ILH A;  4FOE A;  2GUP A;  4BC5 A;  4CGG A;  4IO9 L;  1NK9 A;  3WNF A;  3VQ9 A;  4OVL A;  2F96 A;  4I2P A;  3OYG A;  1D9D A;  3IAY A;  4IZ9 A;  5LJV A;  3MWP A;  3P39 A;  5AQN A;  3OYN A;  3BGR A;  3DWL A;  1HLU A;  3LZJ A;  4XEI A;  2D0O A;  3AO1 A;  1QSS A;  3CHW A;  1DT9 A;  3DM2 A;  4ZTF A;  2Q3S A;  2YHW A;  2YHA A;  4FWQ A;  4XH1 A;  3T3F A;  4E89 A;  2BUP A;  4DR5 K;  1S9E A;  3SBG A;  3AO5 A;  1OH7 A;  4FZX C;  1NM1 A;  1O1W A;  1VQ6 N;  4CGH A;  1EQY A;  3TSQ A;  2HNY A;  4CHY A;  3I0S A;  4M3R A;  5GAG P;  3VA0 A;  1YTU A;  1X3M A;  3C65 A;  4K0K K;  4HWI A;  4FJM A;  2CGJ A;  3OYJ A;  2FLO A;  3K9K A;  1WLJ A;  4DUZ K;  1GLJ O;  3SZ2 A;  5GIP A;  4O0I A;  3E01 A;  4Z4E A;  3CCE N;  3B6P A;  2DPN A;  1T44 A;  3AO3 A;  2I7N A;  5AQJ A;  4WFB L;  1XHX A;  3I8D A;  3E9O A;  4HCC A;  5BRD A;  4KTZ A;  1J6Z A;  3VQ4 A;  2HHQ A;  3IDH A;  1RBS A;  2IVN A;  1SKW A;  1OVQ A;  4DTP A;  1TKZ A;  4CFA A;  1QVF M;  2DTU A;  2CGL A;  4CZL A;  3NFA A;  1GLE G;  3LP3 A;  3MCA B;  3TU5 A;  1T7P A;  3WQT A;  3CC7 N;  5CHI A;  1KVC A;  1VQN N;  3THX A;  4FJL A;  4B8C A;  1X9J A;  1U4B A;  1CXQ A;  1Z05 A;  1REV A;  4FJ5 A;  3KLI A;  1Q7Y O;  1ZBH A;  2P5O A;  1K8K A;  3RVC A;  3SJH A;  4QS8 A;  4AH9 A;  4RW7 A;  3HP6 A;  4KHS A;  3VES A;  1NKE A;  1HKC A;  1KD1 O;  5LL6 Z;  4WQ5 A;  2OYQ A;  3A2F A;  5IWA K;  4NCG A;  5C24 A;  3J7A P;  1JLB A;  4DHY A;  2E2O A;  4DU4 A;  1Q18 A;  3GE1 A;  1TVR A;  4PL8 A;  1HJR A;  1U48 A;  2IC3 A;  4CK1 A;  1KSP A;  2ZE2 A;  3P4I A;  2PYL A;  4DQI A;  5FRO A;  1H1V A;  3EE8 A;  4CEO A;  1RT2 A;  1YF5 L;  3H45 C;  1BOT O;  2VWK A;  4IBN A;  4MLE A;  3VQA A;  4E19 A;  4BG8 A;  1MA9 B;  1NGE A;  2ZJQ L;  2D0P A;  5AR0 A;  3THY A;  1E4F T;  3MX2 A;  3LDL A;  4BR5 A;  2ZF5 O;  4B1Z A;  4DG1 A;  2IAJ A;  3C7N A;  2QXF A;  4DFP A;  3O4Q A;  3A5N C;  3HM9 A;  5T7B A;  4CJF A;  3CCJ N;  2FSN A;  4C8N A;  3VA3 A;  4DTU A;  3A5O C;  2G8F A;  3PIP L;  3PX6 A;  4FJI A;  2G8K A;  5AJ3 K;  3NBP A;  5AQI A;  4BRH A;  4B08 A;  3CJB A;  4DUY K;  3NGZ A;  1HJO A;  4FZY A;  1WSH A;  3L2W A;  4X66 K;  1NMD A;  4KTQ A;  2OZS A;  5CR4 A;  3P5J A;  4N76 A;  3QIP A;  4FW2 A;  3LZI A;  1SAZ A;  2OPQ A;  1N5Y A;  4YOT A;  2P9P A;  3VQ5 A;  5E41 A;  1CZA N;  3RSE B;  2A6A A;  4JK8 A;  2KZZ A;  1MWK A;  3E66 A;  3NH1 A;  2VGN A;  1YIT N;  3V9X A;  2VQE K;  4M3X A;  1S1T A;  5J2M A;  1YIJ N;  3IUC A;  1BUP A;  3VGK A;  2W42 A;  1XWL A;  4H8K A;  2ZQB A;  2ITM A;  4IG3 A;  4KHY A;  5CY4 A;  3SNN A;  3VQ6 A;  5JS1 A;  4FWN A;  2LSN A;  2NRW A;  2O4G A;  2XRI A;  3LDP A;  4CHP A;  4R5P A;  3G25 A;  2P9L B;  4BRC A;  4FWK A;  1MWM A;  2P1J A;  3KLF A;  1S5J A;  1W0H A;  1E3M A;  3TR8 A;  2F7T A;  3LAK A;  1VAZ A;  4BR4 A;  4C23 A;  2HNZ A;  3CCQ N;  4FPB A;  4BR9 A;  4CGJ A;  5ADX A;  3L2Q A;  1Q86 O;  4Y1D A;  1KC8 O;  3SK3 A;  2ZGY A;  3DAW A;  2JWL A;  1XC3 A;  3P31 A;  5AQG A;  2DFH A;  4CZG A;  4WYB A;  2HST A;  3H3N O;  2Z1H A;  4E7H A;  1U04 A;  3VQE A;  4FYD A;  3CFO A;  1VSF A;  4BVO A;  2Z1I A;  1DLO A;  4JRP A;  4IXC A;  1RBV A;  4B9L A;  2HHS A;  5C12 A;  4DTS A;  3OYH A;  2YX6 A;  3AVC A;  4N41 A;  1VK0 A;  4YNQ A;  1NLV A;  4DV7 K;  1HRH A;  3CCV N;  2P9S A;  3OYB A;  5HL7 L;  3MAQ A;  3DJC A;  4GKK K;  4JS4 A;  1R59 O;  3L4I A;  4FSV A;  3ZT1 A;  4CJU A;  3K57 A;  5E84 A;  3ZSY A;  5HBM A;  1EWQ A;  2IDO A;  2VYP A;  4JI4 K;  1QQC A;  1K6Y A;  2ASP A;  1Y97 A;  2QWN A;  2V7Y A;  4CEC A;  4Z4F A;  3TTC A;  1TAQ A;  3HYF A;  3TAE A;  3TAB A;  4A5B A;  3FZH A;  1I39 A;  4PWD A;  2UUC K;  3C6T A;  4EFH A;  4CIG A;  4KHQ A;  1VSJ A;  2A5X A;  1TUY A;  4F8R A;  4CI6 A;  2P9U B;  3ZET A;  4OLB A;  4EZ6 A;  3ZT3 A;  3ZX3 A;  1B92 A;  4YFU A;  4IG0 A;  3V9U A;  1SS6 A;  2I7P A;  3HL8 A;  2P9I B;  2BTF A;  1XMO K;  3M8Q A;  1Y64 A;  3EKU A;  1ATR A;  4GVE A;  4OGE A;  4C8M A;  2YKN A;  4CJW A;  4H5W A;  5J2N A;  4KHP K;  1KAY A;  4K25 A;  1HYV A;  4BGB A;  3JAM O;  3QNO A;  4DSI A;  4BE2 A;  1BIS A;  2O8F B;  4UY8 O;  4DF8 A;  1QVG M;  2HHV A;  4DSK A;  2PY5 A;  4KAZ A;  4H0P A;  4CHO A;  3VOV A;  2F8T A;  3ATU A;  3S3M A;  4ZTJ A;  4CHN A;  2QEX N;  5CYM A;  3K59 A;  4FLU A;  4KH6 A;  1BWF O;  2OCE A;  3HT3 A;  5FPN A;  5AFU H;  3VF4 A;  1XC9 A;  4J2E A;  3D2E A;  4QCL A;  3RSE A;  3QML A;  1WN7 A;  3VET A;  4WF9 L;  4DTX A;  5SZT A;  4JKA A;  3RR8 A;  3C6U A;  2D4W A;  1ASU A;  3AAR A;  3EYZ A;  4M41 A;  3ULD A;  2E1Z A;  3O80 A;  1VSH A;  1XNR K;  4M3Y A;  2QXL A;  3VQD A;  3QEP A;  1U2V B;  1IG8 A;  4LF5 K;  4DV0 K;  4KTW A;  3SUN A;  4B3R K;  1RBR A;  4LFA K;  2VCP A;  4FK4 A;  3TAR A;  1VQ7 N;  2P5G A;  4IEE A;  3NF6 A;  1V4S A;  4RG8 A;  3F9M A;  2YNG A;  2ZWH A;  4O55 A;  1NOZ A;  1RTD A;  2PZS A;  1C0U A;  3DXM B;  4E7I A;  3LPT A;  3EZW A;  5AQY A;  2HBL A;  5BN9 A;  3K9J A;  4DTM A;  4JI3 K;  3AO2 A;  3HPO A;  1RT1 A;  4WQ4 A;  4EAH D;  4OO1 J;  2RKI A;  2F9T A;  3O08 A;  1RTJ A;  1YUW A;  4KH5 A;  4I2Q A;  1VSI A;  3HSC A;  3L0Q A;  1JLE A;  4CZH A;  1TKD A;  3TPQ A;  2E1Y A;  5F0X A;  4H0Y B;  5KRT A;  3OA9 A;  1VHX A;  3SUQ A;  4FLY A;  3ZT0 A;  2JGU A;  2WOM A;  3VER A;  2P9N A;  4IFV A;  5JS2 A;  1BO5 O;  4GV3 A;  3LM2 A;  4H0O A;  2D1K A;  3T69 A;  3TAM A;  3THW B;  3V81 A;  2BGG A;  3O4N A;  4AHC A;  4GNI A;  2OPP A;  3HTV A;  3L2R A;  1N34 K;  5BR9 A;  2E2Q A;  2ASO A;  5A2Q O;  4KFB A;  4PKI A;  4LSN A;  3OYK A;  1T03 A;  4CIF A;  3VF6 A;  4CW7 B;  4FM2 A;  1C6V A;  3FFK B;  2QWO A;  4CJV A;  2HMP A;  2WBN A;  3Q7C A;  3THX B;  2E5L K;  1ZC6 A;  1VSM A;  3DI6 A;  4W5T A;  3FZL A;  3KHY A;  3H1Q A;  1WSJ A;  2D0A A;  2HOE A;  1NK8 A;  4F9O A;  2O8F A;  3KK3 A;  3P1G A;  4JK7 A;  4M3U A;  4Q0B A;  3NF8 A;  4GVM A;  1A5W A;  3M3Z A;  1RDW X;  4FK0 A;  4HUE A;  1WSG A;  1BA0 A;  3EEQ A;  2IVO A;  3JS6 A;  4DB3 A;  4B1V A;  3SMS A;  5DM7 L;  1JJ2 M;  2ETJ A;  1D8Y A;  4B9Q A;  3O5B A;  3NVM A;  3HRG A;  2NRV A;  4M42 A;  3DLR A;  3N4P A;  4BQL A;  2YKM A;  1OH6 A;  5F2R A;  4LH4 A;  4CCH A;  2EHG A;  3CM6 A;  4CK2 A;  4MO4 A;  2YNI A;  3L4Q A;  1W7A A;  4WFN L;  4YDU A;  3F9K A;  3HZ6 A;  3THY B;  1DEJ A;  3OVN A;  4CES A;  3D0P A;  1NGC A;  3U3G A;  4UQG A;  4B3S K;  1NNE A;  4ISG A;  5DM6 L;  4FJG A;  1ATN A;  3QBX A;  3AVA A;  3OYD A;  3U6F A;  3ZSQ A;  3QFP A;  4BRA A;  3AGK A;  1L3S A;  5TKY A;  3K5O A;  1VQ9 N;  4C1N I;  4E1J A;  2XHB A;  5EU7 A;  2NRR A;  1IBM K;  3O3G A;  5C42 A;  1QSL A;  5HOO A;  4K42 A;  2Y1I A;  1LWF A;  3AVG A;  5E26 A;  2D5R A;  1JCF A;  3TTD A;  2P9P B;  3CCR N;  4QOZ B;  5EVZ A;  3UKU A;  5KTQ A;  2NRT A;  3A8Y A;  3DRS A;  4B9M A;  3VQP A;  2I5J A;  1QQM A;  4CF8 A;  3ITH A;  4DR4 K;  2A42 A;  3QET A;  3VQQ A;  5BR8 K;  4ISE A;  1Z25 A;  4M45 A;  2NRH A;  3FE1 A;  1JCE A;  5AQO A;  4CJE A;  4DTR A;  3HVT A;  2XY7 A;  4CF1 A;  1K9M O;  3UB5 A;  2PAV A;  4KKO A;  1C0F A;  3V1R A;  1GLC G;  2W40 A;  3THW A;  3BZK A;  2OPR A;  1BDG A;  1U49 A;  3OYF A;  3GDQ A;  4J2A A;  4I7F A;  4JI8 K;  1LOT B;  4BRK A;  1WBD A;  4L3Q A;  2HMI A;  4H5V A;  2UXC K;  4DMN A;  4OKK A;  2Q0U A;  5KRS A;  4YOV A;  4JKF A;  1Q81 O;  1NGH A;  1QSY A;  2RE2 A;  4X62 K;  1NGI A;  2GUI A;  4CF2 A;  1SUQ A;  1OH8 A;  4G1Q A;  1T6D A;  2P9K A;  3ZSX A;  1NWK A;  5EOY A;  3EY1 A;  4AHT A;  2QA4 N;  2B4J A;  3RRG A;  1NGJ A;  3OY9 A;  4B9T A;  3O1W A;  4MQ3 A;  4W5R A;  4FJN A;  1VQO N;  1KAZ A;  4CF0 A;  2P9S B;  4FM0 A;  2JWK A;  4CD3 A;  3BZC A;  4HUF A;  2UXB K;  1WNS A;  3AV9 A;  4AHU A;  1N32 K;  2HBJ A;  3PV8 A;  2UUA K;  4DR7 K;  3NGI A;  4M7Y A;  1FJG K;  3AVM A;  1KTQ A;  1EO1 A;  1KXP A;  3UKR B;  2YNF A;  4NB4 A;  3W3D A;  3A5L C;  1NU0 A;  4JKD A;  4K41 A;  2B6A A;  4CD1 A;  3TSP A;  3CFR A;  2QWQ A;  1FXX A;  1U6Z A;  4PKH A;  5DK5 A;  4WCE L;  4JKE A;  3KTQ A;  3AVJ A;  2G8U A;  2OTL N;  3LAM A;  3PSF A;  2E8A A;  1BL3 A;  5KGW A;  3MX5 A;  3ZET B;  2VWJ A;  4DQQ A;  3D6R A;  3H46 O;  3BDP A;  2A3Z A;  4FLX A;  5HRS A;  4HVJ A;  3H3O B;  3VN5 A;  5B8H A;  2GX9 A;  2E2P A;  4RWT A;  1T05 A;  4CBW A;  4GV6 A;  2Z1G A;  1NG9 A;  5BN8 A;  1W2B M;  3E9P A;  2ZD1 A;  4U67 L;  3MEC A;  1BQM A;  4BR0 A;  4YOY A;  4LF7 K;  4PUO A;  3D2F A;  4IOA L;  3ULE A;  3VEZ A;  3AVK A;  1JL1 A;  2HBM A;  3N4Q A;  3J7Z O;  3FZM A;  4KV8 A;  5ELZ A;  4B8A B;  3KLH A;  4OGC A;  4KPY A;  4KRF A;  1NJZ A;  1TL3 A;  3EKS A;  4ISF A;  4DV3 K;  4AHV A;  1VSL A;  4PL7 A;  1BA1 A;  3KJV A;  3MK6 A;  4OPJ A;  4DSL A;  1SZ2 A;  2W41 A;  1IKY A;  5CZ1 A;  3MN5 A;  4YY3 K;  3LAL A;  5JMV A;  2CH6 A;  2NRZ A;  3LP2 A;  1HNI A;  2GEL A;  2KTQ A;  4WE1 A;  4DQS A;  3MN9 A;  1BI4 B;  5AFU A;  3DOL A;  3U4L A;  4Y1C A;  4H5T A;  3AA5 X;  1HYS A;  4FLV A;  3D2E B;  4JK9 A;  3TTF A;  5AQT A;  3MCP A;  3NHG A;  1C0M A;  4JN4 A;  4DSE A;  1HKB A;  1MU2 A;  3ZSV A;  3A5M C;  2WTU A;  4M3W A;  3QEV A;  1K73 O;  4CE9 A;  4LFC K;  4LF4 K;  5KPT A;  3HXM A;  3O9R A;  3PLA A;  2KLA A;  2O8D B;  5AQF A;  3QDK A;  4ID5 A;  5EY4 A;  1J9A A;  1NK0 A;  1KFS A;  3OJU A;  3M5R A;  3HBT A;  1NK5 A;  3KK2 A;  2EWS A;  1OH5 A;  4A61 A;  2F9W A;  5FPE A;  5JIC A;  1XUP O;  4YOU A;  4PHT X;  3DRP A;  1KQS M;  2KFN A;  1JXB A;  4YHH K;  3CCL N;  3RR7 A;  3CQX A;  4CJT A;  5GIN A;  3SMP A;  4NXN K;  3ATV A;  4FPA A;  2BH1 A;  3IRX A;  1SKR A;  5K14 A;  1WSI A;  4AIL C;  3VTI A;  4CFB A;  5CE3 A;  4W5N A;  3NDK A;  1EX4 A;  3DLE A;  3ASM A;  1J53 A;  1S6Q A;  3WXJ A;  1BHL A;  4JAX A;  2B5J A;  4F3O A;  4BR2 A;  1ZBL A;  4ID1 A;  4O44 A;  1GLB G;  4IDH A;  3U8X A;  4KI4 A;  1W97 L;  4NO7 A;  3WEE B;  3QIO A;  4BDY A;  3WXK A;  4IOC L;  3SUO A;  3VEX A;  3L6Q A;  2WFB A;  3WNE A;  5C15 A;  1YVU A;  4BWJ A;  1Z6R A;  3MXJ A;  4FWP A;  1ITG A;  4DLG A;  4CFD A;  1ATS A;  3O9S A;  3CJA A;  3CPE A;  2X6N A;  2HF3 A;  4CGD A;  2XO7 A;  4JKG A; 
#chains in the Genus database with same CATH homology
 3DLB A;  1EET A;  1RT1 A;  2YV0 X;  2KQ2 A;  4ELV A;  5I42 A;  4KHW A;  5DMR A;  3DLK A;  3RWU A;  4OJR A;  2E6L A;  4CJQ A;  1R0A A;  1UWB A;  2E4L A;  1CZB A;  2RKI A;  5HP1 A;  1CZ9 A;  1J54 A;  4OKE A;  4E1M A;  1RDC A;  1RTJ A;  4CGF A;  1RBU A;  4MFB A;  2BAN A;  4O4G A;  3OYL A;  1J5O A;  3LAN A;  4DQR A;  4DWI A;  4TSX A;  4I2Q A;  1CLQ A;  3AVH A;  3ZT2 A;  3IG1 A;  1VSI A;  3QEX A;  1S1X A;  2XY6 A;  4KRE A;  4FK2 A;  1JLE A;  5SWM A;  1LW2 A;  3NH2 A;  1JKH A;  2GBZ A;  2G8W A;  3C95 A;  1TKD A;  4F2S A;  4C8L A;  3NAE A;  1ZBI A;  2RF2 A;  4CJR A;  2Z1J A;  5KRT A;  2BDP A;  1RTH A;  3SUQ A;  4FLY A;  1QTM A;  2QK9 A;  3ZT0 A;  2JGU A;  1VSE A;  3K5M A;  4CGG A;  1DTT A;  2WOM A;  1NK9 A;  3WNF A;  3VQ9 A;  4OVL A;  3V1Q A;  4CEZ A;  2F96 A;  4I2P A;  4IFV A;  5JS2 A;  3ZCM A;  3OYG A;  3SQ2 A;  5HRR A;  1D9D A;  3IAY A;  1RT3 A;  3S3O A;  1TK8 A;  3OYN A;  5CYQ A;  3LDS A;  4I9Q A;  3BGR A;  3LZJ A;  4CHQ A;  3TAM A;  5KI6 A;  3AO1 A;  1QSS A;  3DM2 A;  4ZTF A;  3V81 A;  2Q3S A;  2BGG A;  3T3F A;  1KVA A;  2YHA A;  4FJK A;  4HHT A;  4E89 A;  1TV6 A;  4BWM A;  2FBV A;  3TAF A;  1S9E A;  1LAW A;  4KHN A;  3O4N A;  3AO5 A;  4AHC A;  4FZX C;  1O1W A;  3LP0 A;  2OPP A;  1HQE A;  3M8P A;  3L2R A;  3ZSO A;  4CGH A;  1VSD A;  2Y1J A;  1IKW A;  2HNY A;  4CHY A;  2KZM A;  1RIL A;  3I0S A;  4KFB A;  4M3R A;  1YTU A;  3VA0 A;  2AJQ A;  1S6P A;  4CK3 A;  4LSN A;  3EZ5 A;  3SV3 A;  5HRO A;  3OYK A;  4DTN A;  4FJM A;  3KLG A;  3G10 A;  1T03 A;  4NCA A;  1GOA A;  4CIF A;  4FM2 A;  1C6V A;  3OYJ A;  4CJV A;  4DU1 A;  3AA2 A;  4NYN A;  1C1C A;  1WLJ A;  1BI4 A;  1VSM A;  3DI6 A;  4HTU A;  3PO4 A;  3SZ2 A;  4FJ9 A;  2ATQ A;  4O0I A;  3E01 A;  4W5T A;  4M3T A;  4Z4E A;  1RDB A;  3ZSW A;  3B6P A;  1N6Q A;  3RTV A;  4CJ3 A;  4Z4G A;  3PX0 A;  3AO3 A;  1WSJ A;  3M8S A;  2D0A A;  1BIZ A;  3SQ4 A;  3S9H A;  1XHX A;  1NK8 A;  3I8D A;  1KRP A;  4HCC A;  3KK3 A;  4KTZ A;  2G8I A;  3VQ4 A;  3P1G A;  2HHQ A;  1RBS A;  4FJ8 A;  4M3U A;  3NF8 A;  4Q0B A;  1S1U A;  4GVM A;  4BDZ A;  4PQU A;  4F3T A;  4E3S A;  1A5W A;  1JLA A;  1SKW A;  1NKB A;  1WAF A;  2FC0 A;  3KK1 A;  4HUE A;  4EZ9 A;  3OS0 A;  1WSG A;  3CM5 A;  4FK0 A;  4DTP A;  1ZBU A;  1IG9 A;  1TKZ A;  4CFA A;  2DTU A;  2HND A;  4CJP A;  3NFA A;  1RDD A;  4E1N A;  2DFE A;  3LP3 A;  4F4K A;  2ETJ A;  1D8Y A;  3CG7 A;  1T7P A;  1D9F A;  1KVC A;  1NK7 A;  4M42 A;  1ASW A;  3KD5 E;  3DLR A;  4B8C A;  1TL1 A;  5J2Q A;  4FJL A;  1U4B A;  1X1P A;  1CXQ A;  1ZBF A;  5HRP A;  1RDA A;  1REV A;  4FJ5 A;  1YTA A;  2HB5 A;  4EP5 A;  4W5O A;  4BE0 A;  4J2D A;  3I0R A;  4FXD A;  1C1B A;  3KLI A;  4RW8 A;  1ZBH A;  2P5O A;  3V1O A;  3V9W A;  4FVM A;  2YKM A;  3SPY A;  4LH4 A;  4CCH A;  2EHG A;  1A5V A;  3CM6 A;  1LAV A;  3AVB A;  4AH9 A;  3QEW A;  3TAG A;  4RW7 A;  4CK2 A;  3HP6 A;  4KHS A;  2FBT A;  1NKE A;  1JLQ A;  2ITG A;  4DFK A;  2YNI A;  1U45 A;  1LW0 A;  4CJK A;  2OYQ A;  2EX3 A;  4OLA A;  1KFD A;  3OYA A;  3A2F A;  3F9K A;  4NCG A;  5C24 A;  4FLW A;  1JL2 A;  1JLB A;  4GW6 A;  3SI6 A;  3OVN A;  4CES A;  3D0P A;  1G15 A;  4CIE A;  4OKJ A;  3U3G A;  3MEE A;  4UQG A;  4E7L A;  4DU4 A;  4FJG A;  1TVR A;  1X9M A;  1HJR A;  1U48 A;  1S1W A;  3AVA A;  3LP1 A;  4B9S A;  2IC3 A;  4CK1 A;  1Q8I A;  1KSP A;  2ZE2 A;  4FW1 A;  4Z4C A;  3OYD A;  3U6F A;  1X9S A;  3ZSZ A;  3ZSQ A;  1B9F A;  2IGI A;  2JLE A;  1KCF A;  1L3S A;  2PYL A;  4DQI A;  5FRO A;  1RT6 A;  4LSL A;  3CQ8 A;  4QAG A;  3KD1 E;  4KHU A;  1QS4 A;  3K5O A;  2IS3 A;  3RMD A;  3HVR A;  3MXI A;  4CEO A;  1RT2 A;  2G8V A;  2VWK A;  4IBN A;  3NH0 A;  2XHB A;  2O4I A;  3VQA A;  5EU7 A;  4CEB A;  4E19 A;  3L3U A;  3O3G A;  5C42 A;  1QSL A;  1BCM A;  2E6M A;  2QKK A;  2VG6 A;  4CJL A;  2Y1I A;  3VQ7 A;  3SYZ A;  4FJJ A;  4KI6 A;  1LWF A;  3ZSR A;  1VSK A;  3AVG A;  4DG1 A;  1UA1 A;  3ISN C;  3TAQ A;  3TAP A;  2IAJ A;  2D5R A;  2QXF A;  4DFP A;  3O4Q A;  3ZT4 A;  4QOZ B;  1ASV A;  3HM9 A;  5T7B A;  5KTQ A;  4CJF A;  2R7Y A;  4B9M A;  3DRS A;  1RNH A;  3VQP A;  4C8N A;  3OYE A;  3VA3 A;  1F21 A;  2I5J A;  4DTU A;  2G8F A;  3AVN A;  4CF8 A;  4FLT A;  3ITH A;  3PX6 A;  3K2P A;  4FJI A;  2G8K A;  3IS9 A;  3VQQ A;  3QET A;  4FLZ A;  3NBP A;  3QIN A;  2HHU A;  1Z25 A;  4B08 A;  4Q5V A;  3U3Y A;  3NGZ A;  4M45 A;  4KO0 A;  3WNH A;  3C94 A;  1FKO A;  2YNH A;  3T1A A;  1XHZ A;  4FZY A;  1WSH A;  3L2W A;  2X74 A;  4KTQ A;  1XI1 A;  4O5B A;  5CZ2 A;  2OZS A;  3VQ8 A;  3VQC A;  1LWE A;  3SJJ A;  3P5J A;  3NE6 A;  3SCX A;  3MXM A;  1NK4 A;  3NF9 A;  4N76 A;  4CJE A;  2RPI A;  3QIP A;  4FW2 A;  4ICL A;  3LZI A;  4DTR A;  3HVT A;  4DSJ A;  2OPQ A;  4LH5 A;  2XY7 A;  4OPK A;  4CF1 A;  4CJS A;  5HLF A;  2XY5 A;  1N5Y A;  3AO4 A;  1TKX A;  3VQ5 A;  1NK6 A;  5FRM A;  1RBT A;  5E41 A;  4KKO A;  2P51 A;  3V1R A;  3RMA A;  4H4M A;  1FK9 A;  5D3G A;  1D5A A;  2KZZ A;  4BE1 A;  1EXQ A;  1Z26 A;  3NH1 A;  1KLN A;  2OPR A;  2OPS A;  1LV5 A;  4LY7 A;  1U49 A;  3OYF A;  3V9X A;  3O3F A;  2GV9 A;  4J2A A;  4M3X A;  1S1T A;  5J2M A;  1BQN A;  3DLG A;  4I7F A;  3P83 D;  4AHS A;  3OYC A;  2X6S A;  2W42 A;  2HMI A;  1XWL A;  2RN2 A;  4CJ4 A;  1I3A A;  3K58 A;  4H8K A;  2XY8 A;  2ZQB A;  4DMN A;  4RW4 A;  4OKK A;  4IG3 A;  5HRN A;  1JXE A;  5CY4 A;  5KRS A;  4DS4 A;  3SNN A;  4KHY A;  3VQ6 A;  1IH7 A;  5JS1 A;  2LSN A;  2O4G A;  1QSY A;  3H08 A;  2GUI A;  2XRI A;  4CF2 A;  1SUQ A;  4CHP A;  4R5P A;  4B9N A;  3HP9 A;  3NCI A;  1Q9Y A;  4CER A;  1NKC A;  4G1Q A;  4E7K A;  1UA0 A;  3ZSX A;  3TI0 A;  2P1J A;  4JLH A;  3KLF A;  1S5J A;  1W0H A;  1WSF A;  3EY1 A;  3QER A;  3TR8 A;  3DMJ A;  4AHT A;  4CFC A;  2B4J A;  3B6O A;  3RRG A;  1HPZ A;  3OY9 A;  1W9H A;  2KFZ A;  3LAK A;  2NUB A;  3S3N A;  4B9T A;  4MQ3 A;  4W5R A;  4FJN A;  2HNZ A;  4CGJ A;  3L2Q A;  3QO9 A;  4CF0 A;  5KGX A;  4FM0 A;  3HPG A;  4BDP A;  2KW4 A;  2HVH A;  4Y1D A;  3KKS A;  4HUF A;  3SV4 A;  4DSF A;  1WNS A;  3HJF A;  4ELU A;  3AV9 A;  2WON A;  4AHU A;  4DTJ A;  3PV8 A;  3THV A;  3NGI A;  4O0J A;  1LWC A;  1BGX T;  1EKE A;  3AVM A;  1KTQ A;  4HCB A;  4FJ7 A;  3L2U A;  1NJY A;  4IKF A;  2DFH A;  3TWH A;  4FCY A;  2YNF A;  3LWM A;  2F8S A;  3KLE A;  3V6D A;  1C1A A;  2Z1H A;  3T19 A;  1JLF A;  3HO1 A;  1UOC A;  4E7H A;  2B6A A;  1U04 A;  3VQE A;  1RT4 A;  3M8R A;  3CFO A;  1VSF A;  4FYD A;  2Z1I A;  1UAX A;  1DLO A;  4I9L A;  4CEQ A;  1A5X A;  1RBV A;  3CFR A;  4JRP A;  4B9L A;  2VG7 A;  2G8H A;  4Z4I A;  2HHS A;  1FXX A;  1FKP A;  5DK5 A;  4DTS A;  3OYH A;  1WSE A;  3AVC A;  3KTQ A;  1TAU A;  4N41 A;  1VK0 A;  4YNQ A;  3OS1 A;  3AVJ A;  1KVB A;  1BIU A;  2A1R A;  4N47 A;  2G8U A;  1HRH A;  3UIQ A;  4K8Z A;  3LAM A;  2X78 A;  3OYB A;  5J1E A;  1BL3 A;  1L3T A;  2HHW A;  3O3H A;  1S1V A;  3MAQ A;  4DTO A;  5KGW A;  5FRN A;  1VRU A;  1RTI A;  2BE2 A;  3KIO A;  4JS4 A;  1SL2 A;  1DTQ A;  2VG5 A;  3NF7 A;  2VWJ A;  4DQQ A;  3BDP A;  3D45 A;  1SL0 A;  2PYJ A;  4FLX A;  3ZT1 A;  5HRS A;  1GOB A;  4CJU A;  3K57 A;  3DYA A;  3ZSY A;  4HVJ A;  4JS5 A;  4FM1 A;  4C8K A;  5HBM A;  3VN5 A;  2IDO A;  3V4I A;  3L3V A;  1B9D A;  1QQC A;  1K6Y A;  1T05 A;  1Y97 A;  3SQ1 A;  1VRT A;  2Z1G A;  4CEF A;  4CEC A;  4Z4F A;  3ALY A;  1TAQ A;  3HYF A;  3JSM A;  1NOY A;  2ZD1 A;  4CEA A;  4DS5 A;  4CED A;  3QES A;  4C8O A;  3TAE A;  3TAB A;  3MEC A;  1BQM A;  1TKT A;  3SPZ A;  1RCH A;  1U47 A;  4PUO A;  2D0B A;  4PWD A;  1I39 A;  1NJW A;  3HK2 A;  3C6T A;  3AVK A;  4H4O A;  1JL1 A;  4IDK A;  4IFY A;  4CIG A;  1L3V A;  4KHQ A;  4KV8 A;  3DRR A;  4B8A B;  1VSJ A;  3KLH A;  3KKR A;  3LWL A;  4FJH A;  3DOK A;  3OJS A;  4OGC A;  4KPY A;  4F8R A;  4KRF A;  3MEG A;  1RT7 A;  1NJZ A;  1TL3 A;  3LPU A;  4OLB A;  4EZ6 A;  3ZT3 A;  4AHV A;  1VSL A;  1B92 A;  1JLC A;  3CFP A;  4YFU A;  4JRQ A;  4IG0 A;  4N5S A;  3RMB A;  3V9U A;  3KJV A;  4DU3 A;  3G0Z A;  4M3Z A;  4OPJ A;  4DSL A;  1IO2 A;  3DLH A;  1IKY A;  5CZ1 A;  1TGO A;  3HL8 A;  3QEI A;  1TK0 A;  1HYZ A;  3LAL A;  4DLE A;  3LP2 A;  1HNI A;  4L8R B;  3F73 A;  1SKS A;  4FZZ A;  2KTQ A;  3MED A;  4WE1 A;  3M8Q A;  3OYM A;  4DQS A;  3TAN A;  1BI4 B;  1NJX A;  3DOL A;  4OGE A;  4C8M A;  4PA1 A;  4DQP A;  4Y1C A;  2YKN A;  3AA5 X;  4CJW A;  4FLV A;  1HYS A;  2HHT A;  5J2P A;  5J2N A;  1ZYQ A;  4RW6 A;  3AVI A;  1HQU A;  3RRH A;  3NHG A;  1HYV A;  1C0M A;  3SQ0 A;  4E7J A;  4B3O A;  4DSE A;  3QNO A;  4DSI A;  4BE2 A;  4F2R A;  1MU2 A;  1BIS A;  1WAJ A;  1HMV A;  1L3U A;  2OZM A;  3K5L A;  4DF8 A;  4B9V A;  2HHV A;  4DSK A;  3ZSV A;  2PY5 A;  4M3W A;  4KAZ A;  4BAC A;  1CXU A;  1GOC A;  5C25 A;  1EP4 A;  3CYM A;  3OYI A;  4CE9 A;  3QEV A;  1SL1 A;  3PX4 A;  4CHO A;  3L8B A;  4W5Q A;  1C0T A;  4CHZ A;  2YHB A;  2F8T A;  3HXM A;  3S3M A;  4Z0U A;  4B9U A;  4ZTJ A;  4CHN A;  5CYM A;  3K59 A;  4FLU A;  2FBY A;  4XIU A;  4ID5 A;  2DFF A;  3FFI A;  1IKX A;  1J9A A;  1NK0 A;  1KFS A;  3OJU A;  4J2B A;  4NCB A;  4PY5 A;  4Z4H A;  3HT3 A;  1IKV A;  2D0C A;  3AVF A;  3VQB A;  1NK5 A;  4DFM A;  1XC9 A;  1SV5 A;  4J2E A;  4QCL A;  4HUG A;  3KK2 A;  3HST B;  1TK5 A;  1WN7 A;  3JYT A;  1JLG A;  5I3U A;  2HVI A;  4EP4 A;  4DTX A;  2KFN A;  3DRP A;  4K8X A;  3SUP A;  1JXB A;  2FBX A;  5SZT A;  3RR8 A;  3C6U A;  4E0D A;  2OA8 A;  3RR7 A;  4RW9 A;  4GMJ B;  4CJT A;  1ASU A;  4DFJ A;  3OS2 A;  3PY8 A;  1KLM A;  3EYZ A;  4DF4 A;  4KB1 A;  2HW3 A;  2QKB A;  3NGY A;  3IRX A;  1SKR A;  4M41 A;  3ULD A;  4CF9 A;  5K14 A;  4LD0 A;  1WSI A;  1VSH A;  3WNG A;  4NYF A;  3V9S A;  3VQD A;  4M3Y A;  3QEP A;  4AIL C;  1X9W A;  4CFB A;  4W5N A;  3NDK A;  4FJX A;  1EX4 A;  3DLE A;  4KTW A;  2HHX A;  3ASM A;  1J53 A;  1S6Q A;  3PUF A;  1HNV A;  1BHL A;  1S9G A;  1YT3 A;  2B5J A;  4F3O A;  4AHR A;  3SUN A;  3K5N A;  1Q9X A;  2A1S A;  1RT5 A;  4ZHR A;  1ZBL A;  1RBR A;  4ID1 A;  4O44 A;  3PO5 A;  3AVL A;  4FK4 A;  4KI4 A;  3V9Z A;  3AA3 A;  3AA4 A;  3QNN A;  1L5U A;  3TAR A;  1QE1 A;  2IOC A;  2P5G A;  3QIO A;  4BDY A;  5FDL A;  3NF6 A;  1BCO A;  3L2V A;  1T8E A;  4RG8 A;  3SUO A;  2YNG A;  3WNE A;  4CEE A;  4O55 A;  1NOZ A;  4ELT A;  1YVU A;  1RTD A;  2PZS A;  1C0U A;  3MXJ A;  3QLH A;  4BWJ A;  2DY4 A;  1ITG A;  4E7I A;  3LPT A;  4KB0 A;  4CGI A;  4DLG A;  4CFD A;  4CJ5 A;  4N56 A;  3HPH A;  4DTM A;  3RMC A;  2X6N A;  1QHT A;  3AO2 A;  3HPO A;  4CGD A;  2XO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...