4CJ4A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV INTEGRASE
total genus 54
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cj4A00
3I0SA 1TKTA 1NJZA 4DSFA 1SKWA 3NCIA 3AV9A 3SPZA 3QO9A 1NK8A 4FZZA 3HT3A 2B5JA 3AVMA 3QEXA 2ZQBA 2RKIA 1S6PA 4HTUA 3AA2A 1D8YA 4G1QA 4RW7A 4N47A 3LALA 3ZSVA 5CZ1A 4I2QA 3RMAA 2QKKA 4EZ9A 3AVHA 4Q0BA 2HVIA 2NUBA 3NGYA 4JLHA 3RMCA 1KFSA 1CXUA 3ZT0A 3LP1A 3ZT1A 3HK2A 3CFPA 4DFPA 1QE1A 4TSXA 3QEIA 5J1EA 3T3FA 3NH1A 3QNNA 4CHOA 1TAQA 3QINA 4QAGA 5FDLA 4E7LA 4KHNA 4DTSA 4F8RA 3AO2A 3VQ4A 1NK5A 4N41A 2XO7A 1RILA 1U45A 3DMJA 4FW1A 3HL8A 3F73A 4J2EA 3TAGA 2P1JA 3P5JA 1RTJA 4IKFA 4ZHRA 3SYZA 3PV8A 4FM0A 1RTHA 2WONA 3ZT2A 2Y1IA 1U04A 4NYNA 1GOBA 1QSLA 2VWKA 3JYTA 4E7KA 4MFBA 3KLHA 3K58A 4N5SA 1K6YA 1LAVA 1LW0A 2OPSA 4H4OA 3KKRA 3C95A 5HP1A 4LD0A 3TAEA 3L2QA 4UQGA 2DTUA 3G10A 2Z1IA 4LH5A 3LP0A 4FLXA 4KFBA 3ZT3A 2HHQA 1YT3A 2LSNA 2O4GA 4RW8A 3TABA 4CHZA 3OYAA 2HB5A 2Z1HA 3LAKA 1G15A 4IG0A 3OYLA 3V9SA 1Y97A 3S3MA 1BQNA 1HNVA 3AA4A 4HCBA 3ISNC 4F4KA 1HPZA 1KSPA 4PY5A 2YNFA 4KKOA 4DF4A 1RTIA 4OGEA 4NCGA 4CJ5A 3QEVA 4C8NA 4CJLA 4HUFA 3LAMA 4LSLA 3BDPA 4KAZA 1IKXA 3ZSWA 1ASUA 1RDCA 1KFDA 4CF1A 3NGZA 3D0PA 3THVA 2HW3A 1HYZA 1QSYA 3FFIA 1EP4A 1WSFA 3O4QA 4IBNA 4RG8A 3L2VA 4DTUA 1JXEA 2WOMA 2D0AA 4DFMA 1ZBUA 4O44A 4BWMA 5D3GA 4FLTA 3CM6A 3ZSYA 1X9WA 3NFAA 1UA1A 3TARA 4IFYA 2KTQA 3AO4A 3NAEA 1UOCA 5CYQA 4CF9A 3ULDA 3PY8A 4FJ8A 3TI0A 4PA1A 3VQCA 2W42A 1KLMA 4EP4A 3QETA 2ITGA 4DSKA 1GOAA 3QESA 4B8CA 1VRUA 3RR7A 5J2MA 1BIZA 3HPGA 3V1OA 3ASMA 4E1NA 1JXBA 2RF2A 3U3GA 4E1MA 4DTRA 3AVCA 2QXFA 4GMJB 3M8PA 4CJPA 4E89A 3RRHA 3V1RA 2KFZA 3KJVA 1TL1A 1X1PA 3V4IA 4DG1A 1Q9YA 3AO1A 3AVAA 3WNGA 3RTVA 2Y1JA 3V9ZA 3SUPA 1NKBA 1QQCA 4LY7A 4FJ9A 4FLWA 3L2RA 1X9MA 4CE9A 1LWCA 3RMBA 4CJ4A 3AVNA 4DF8A 1CXQA 2X6SA 4CGIA 1BQMA 1REVA 1HQEA 5JS1A 3G0ZA 3TAPA 4FJIA 4CEBA 4NCAA 4FYDA 1IKVA 1NK7A 5HROA 5KI6A 2YV0X 4OLBA 1RBRA 4CJ3A 1JLFA 3HPOA 4DQSA 3JSMA 3K5OA 1C1BA 3MECA 4FJJA 4JS4A 4B08A 1C6VA 3MEEA 1WNSA 3KKSA 3KK1A 4FCYA 1ZBHA 2DFFA 2ATQA 2O4IA 1RBTA 4O4GA 4KHUA 4DSIA 4KHQA 2QKBA 3DOKA 5CZ2A 1VSEA 2OPPA 4AILC 4CFAA 3ITHA 4ICLA 4OVLA 4WE1A 3OS2A 4ELUA 1IH7A 4F3OA 3UIQA 4KTQA 1FK9A 1NOZA 1U49A 3KIOA 3MXJA 3QNOA 3PO4A 3S3NA 3L2UA 4KB0A 1VK0A 2B6AA 3SNNA 2KQ2A 3ZSOA 3TWHA 3KK2A 2AJQA 1TKXA 2IDOA 2GBZA 1IKYA 4E7JA 4W5OA 3NBPA 4ELVA 1D9FA 5FROA 3HO1A 4RW9A 1JL2A 4AHCA 1C1AA 3ZSQA 3LDSA 3LP3A 3IRXA 4KO0A 2G8VA 1JLEA 3WNHA 3ALYA 1S5JA 4CHPA 1S1XA 4FZXC 1A5XA 1TKDA 2VG5A 4DTJA 1S9GA 3V9WA 2ETJA 1U47A 3F9KA 4E3SA 4CIFA 5I3UA 3VQ7A 3VQAA 3QIOA 5KTQA 4Z4CA 3SUNA 3DLBA 3MXIA 3MXMA 1ZBIA 3ZSZA 4O0IA 4AHRA 1XI1A 2Z1JA 1RDDA 3HVRA 1MU2A 1ASVA 4CECA 1A5WA 4FJ5A 4I2PA 3ZT4A 3RMDA 4W5TA 2HVHA 3SJJA 4GVMA 1I39A 3V9UA 1A5VA 3OYEA 4QCLA 3HVTA 4CJKA 3VQQA 4DQPA 3OYFA 1IKWA 1S1TA 1SUQA 3CQ8A 2E6LA 4CERA 3LWMA 3S3OA 4KHSA 4FJKA 1C0UA 4FLUA 3U3YA 3EYZA 2XY6A 3AVKA 1KRPA 1IG9A 4O55A 1KVAA 1XWLA 2HNYA 2KW4A 5HRRA 3V81A 3OS1A 4BDZA 2F8SA 1JLBA 3OYCA 4OPKA 2HHSA 5EU7A 1SL1A 3HXMA 4LH4A 3O3HA 1YVUA 1TK0A 4M3TA 3VQ5A 4DFKA 4AH9A 4KREA 3BGRA 1NJYA 1QHTA 4DTNA 4F2SA 3LPTA 4CGGA 3MEGA 1NK9A 2IOCA 3SV3A 3OYDA 3M8SA 2Q3SA 1JL1A 1RT2A 1Z25A 2VG7A 4XIUA 4DTOA 3V6DA 1L3SA 2HNZA 3VQ6A 4CJWA 4BWJA 3SQ2A 2X6NA 4CHNA 3ZSXA 3AVBA 3HYFA 3OYGA 1TAUA 1BIUA 3T1AA 2KFNA 4FJHA 3DI6A 1KVBA 4AHSA 3KLGA 1HJRA 4CEZA 3B6OA 3M8QA 4DTMA 4FM2A 1WN7A 3HP9A 1YTAA 2IAJA 3QIPA 3V1QA 3K5NA 4IDKA 4ZTJA 3P83D 4DQRA 1RT4A 1C0TA 1VSKA 2B4JA 3QLHA 4KTWA 4CF2A 4DFJA 4FZYA 3NH0A 3K57A 2JLEA 2XY5A 4QOZB 1LWEA 3K5MA 1BISA 1C0MA 1WAJA 4Z4GA 3SCXA 2D5RA 5J2NA 4FM1A 1TVRA 1KVCA 3HJFA 3KLFA 2BGGA 3OYMA 3OYBA 3SUOA 3LANA 3NF6A 3SV4A 4DWIA 4FJMA 3T19A 1VSJA 4CF0A 4PUOA 4CEAA 4CJFA 1RTDA 4M3UA 2R7YA 4DSJA 4E7IA 1RBVA 3B6PA 3OY9A 4RW6A 3AVLA 1KCFA 1SKRA 2G8IA 5I42A 3HM9A 2X78A 4M3WA 1B92A 4Z4EA 1XHZA 2F8TA 1Q9XA 1C1CA 3L2WA 3V9XA 2BDPA 5KRSA 4DTXA 3SI6A 2G8FA 2G8WA 3NF7A 1EXQA 4DLEA 4M3ZA 3ZCMA 4DLGA 4B9NA 4F2RA 4KV8A 4FJ7A 1WSGA 3CM5A 4M3YA 2P5GA 2RN2A 1NKCA 3LPUA 4ID5A 3KD1E 2FBXA 1VSFA 3OYNA 4Z0UA 3TAQA 1RT7A 3IAYA 5SWMA 1RT6A 5KRTA 3KLEA 4BE2A 2OA8A 1TKZA 1RDAA 2YNHA 4CGJA 4JRQA 1U4BA 1LW2A 3WNEA 2XHBA 1YTUA 3OYHA 1J9AA 4KTZA 4FK2A 4ID1A 2FBYA 1SKSA 1QS4A 4CESA 4YNQA 4C8MA 1FXXA 3IG1A 1D5AA 4BDYA 1RT3A 5KGWA 4DU3A 4J2BA 1F21A 4M42A 1SL2A 3DLHA 3VQEA 5C24A 3DM2A 1L3VA 1ITGA 4GW6A 3P1GA 3VQ8A 4O0JA 4W5RA 3KD5E 2OZSA 5JS2A 2PY5A 3VQPA 2HHUA 5J2QA 1L5UA 4EZ6A 3WNFA 3AA5X 4CEDA 4CEQA 1IO2A 2BANA 2G8KA 1NOYA 4FLYA 4Q5VA 1UA0A 4M3RA 1L3UA 2PZSA 3CFOA 4H4MA 2ZE2A 4OKEA 4N56A 1NK4A 5KGXA 1BCOA 5C25A 1B9DA 1T7PA 2HHWA 3MEDA 4KI4A 4CFDA 1TK8A 1TV6A 1QSSA 1LV5A 4B9TA 1CZBA 3TR8A 3EZ5A 1LWFA 3TAMA 3DRSA 3KLIA 4CJSA 3ZSRA 2OPQA 2IC3A 3LWLA 4HVJA 1J53A 3VN5A 5HRNA 3O3FA 3QEWA 4HCCA 1U48A 3AVFA 3VQBA 1ZBLA 3TANA 4CK1A 2OYQA 5J2PA 1HQUA 1WAFA 3SZ2A 4CK2A 4I7FA 1HMVA 1R0AA 3VA3A 1W0HA 3EY1A 2DFEA 1X9SA 2D0CA 1RT5A 3L8BA 3AVIA 3DLKA 3PO5A 1UWBA 1BI4B 4ZTFA 4C8OA 3NH2A 4B9LA 4FVMA 4Z4IA 3NHGA 2XRIA 1N5YA 2F96A 1HNIA 1QTMA 4FJLA 4CF8A 1EETA 4NCBA 4AHVA 3DRRA 2OPRA 2I5JA 2XY8A 4DSLA 3C94A 4CFBA 4KI6A 4CJVA 2YHBA 2KZMA 2KZZA 1HYSA 2VWJA 1JLQA 1KLNA 4C8LA 3AO5A 4Z4FA 3O3GA 3NF9A 4DS5A 4M45A 1KTQA 3QEPA 1NK6A 3C6TA 4LSNA 4OKKA 3MAQA 5HLFA 4FK4A 2PYLA 1EX4A 4M3XA 3L3VA 4PWDA 4IFVA 5DMRA 1SV5A 3DYAA 1RDBA 1S6QA 3D45A 1RNHA 2E4LA 1DTTA 4Y1CA 1L3TA 4FJXA 4OGCA 3DLRA 3QERA 5FRMA 4OLAA 3KTQA 3DLEA 4J2DA 1I3AA 3IS9A 4FW2A 5CYMA 5K14A 4CEOA 4H8KA 1ZYQA 2HHTA 1Q8IA 3PX6A 2PYJA 1TGOA 3NE6A 4CEFA 4CIGA 1RCHA 3M8RA 4FLVA 1BHLA 3HPHA 2FC0A 3OYJA 4FLZA 1VSDA 3VA0A 4DSEA 4KHWA 2HHXA 1FKOA 1T8EA 1ZBFA 3K59A 3O4NA 1RBSA 4CFCA 2DFHA 1VSHA 2JGUA 4CJUA 2GUIA 3LZJA 3H08A 1B9FA 1GOCA 3C6UA 3K2PA 2YKNA 3VQ9A 4B8AB 4HUEA 2ZD1A 4BE1A 1N6QA 4RW4A 4CJRA 2G8HA 2HMIA 3TAFA 1WSIA 3RR8A 4CGDA 1VSIA 3L3UA 4FXDA 3PUFA 4E7HA 5HRPA 4ELTA 1VRTA 2XY7A 4OJRA 2RPIA 1T03A 1WSHA 4CIEA 4DU4A 3HSTB 4DMNA 1S1UA 2QK9A 2A1RA 2G8UA 1VSMA 1HYVA 3I0RA 1Z26A 1TK5A 5SZTA 1J5OA 4AHTA 4JRPA 1JLGA 3LP2A 2GV9A 3OS0A 4OKJA 4MQ3A 4KPYA 3NF8A 5HBMA 4R5PA 1TL3A 1BGXT 4DS4A 3AA3A 1JLCA 3OYIA 2BE2A 1J54A 4CJEA 3NGIA 1BL3A 1EKEA 4E19A 2HNDA 3SUQA 3RWUA 3E01A 3KK3A 4DTPA 4AHUA 4W5QA 4E0DA 3U6FA 5C42A 1VSLA 5DK5A 4Z4HA 2Z1GA 2D0BA 1S1VA 1RT1A 1WLJA 4HHTA 5E41A 4OPJA 4O5BA 3SQ1A 2IS3A 4F3TA 3VQDA 4JS5A 4HUGA 4C8KA 4K8ZA 1NKEA 3DRPA 3S9HA 2FBTA 4M41A 1T05A 1DTQA 1D9DA 5FRNA 4B9UA 4FJNA 1CLQA 2FBVA 4J2AA 2YNGA 3LZIA 1XHXA 3CG7A 3NDKA 2A1SA 4Y1DA 2YKMA 4B9SA 4B9MA 4N76A 4CHYA 4DQIA 3OJUA 3PX4A 4KHYA 4CCHA 3OVNA 4YFUA 1S9EA 1WSEA 1S1WA 3SPYA 2E6MA 4CGHA 4L8RB 2DY4A 1O1WA 4CGFA 5T7BA 3SQ0A 1FKPA 3A2FA 1JKHA 3OJSA 4DQQA 2EHGA 2YNIA 1NK0A 4KRFA 1BCMA 3AVJA 2OZMA 1HRHA 2IGIA 1NJXA 1W9HA 1RBUA 2YHAA 3CYMA 4DU1A 4FJGA 4KB1A 3AO3A 2VG6A 3DOLA 1LAWA 4IG3A 2P51A 4BACA 3I8DA 5HRSA 1ASWA 1JLAA 3SQ4A 1WSJA 1UAXA 3PX0A 3DLGA 4FK0A 4CK3A 4CJTA 1NJWA 4EP5A 1SL0A 2P5OA 4W5NA 4CHQA 5CY4A 1CZ9A 3RRGA 4B3OA 3OYKA 4BE0A 4BDPA 2X74A 3AVGA 1BI4A 4K8XA 3CFRA 1XC9A 4CJQA 3HP6A 4B9VA 1DLOA 4I9LA 4PQUA 2HHVA 4I9QA 4NYFA 3K5LA 2EX3A 4CEEA
chains in the Genus database with same CATH superfamily
1VQ6N 4KHPK 4DSFA 1SKWA 3QO9A 1NK8A 5AQKA 3LDQA 2B5JA 4CZMA 4DV3K 2V7YA 1S6PA 4HTUA 3AA2A 1D8YA 4DR5K 2V51B 4G1QA 3G71N 4N47A 4BR5A 3ZSVA 1HPMA 4I2QA 1T44A 2JWLA 3GL1A 1CXUA 3ZT1A 4BROA 1BUPA 3O9QA 3LM2A 3QBWA 5J1EA 1EWQA 4CHOA 1TAQA 4KHNA 1Y64A 2QM1A 1YAGA 4F8RA 1NK5A 4JN4A 4GKKK 4J2EA 4IKFA 1RTJA 5F0XA 1X3NA 4A5AA 4B9QA 2VWKA 3JYTA 4E7KA 1LW0A 3P38A 3MDQA 2OPSA 2CGLA 3C95A 3TTDA 4EIAA 3TAEA 4BRMA 3JAMO 2DTUA 3C7NB 3CCUN 3ZT3A 1YT3A 2LSNA 3EKUA 3ZETA 3IUCA 3LAKA 4B1YB 3HOSA 3AA4A 3ISNC 2HBMA 4NCGA 3OBYA 2VQEK 3L4QA 3LAMA 3ZSWA 1ASUA 1W7AA 3NGZA 1YITN 1HYZA 3J8AA 1EP4A 1WSFA 4E1JA 4O44A 3DXKA 3G25A 4BWMA 5D3GA 3ZSYA 2WTUA 4DV4K 3NFAA 1QQMA 4IFYA 3TARA 1RDWX 3I55N 3DWLA 3IDHA 3NAEA 1UOCA 2UU9K 4FJ8A 1KLMA 2ITGA 3EKSA 2VGNA 5J2MA 3V1OA 1NGGA 1X3MA 3K9KA 2CGJA 4GMJB 3M8PA 4CJPA 3THYB 2P9KB 1MWKA 3PIOL 3O9SA 3D2EA 3FZLA 3V9ZA 4LY7A 1HKBA 3RMBA 4IDHA 4DF8A 5FPMA 4CGIA 2NRZA 1CZAN 1HQEA 5JS1A 3G0ZA 3TAPA 4NXNK 2OCEA 5KI6A 4FOIA 5EOYA 4DQSA 1M90O 4LF7K 2BUPA 4FJJA 4JS4A 2NZTA 1XUPO 1WNSA 2ASOA 3KKSA 1SQKA 2WC9A 4KHUA 2FSNA 4A2BA 3D2EB 3THWA 4NLBA 4F3OA 1IH7A 2P9LA 4U7BA 1NOZA 3VEZA 2AJQA 3KK2A 2GBZA 4X62K 4W5OA 3NBPA 4ELVA 4DUYK 3HO1A 1C1AA 3ZSQA 4KO0A 3VEWA 2O8BA 2NRTA 4CHPA 3HRGA 1RGIA 4FZXC 1A5XA 1IG8A 2VG5A 2FSKA 1S9GA 3V9WA 5AR0A 3O80A 4JI5K 1YXQA 5KTQA 4Z4CA 4YORA 1ZBIA 1XI1A 1RDDA 2Q0RA 3HVRA 2O8DA 4DHYA 3NVMA 1VQ5N 1VHXA 3VEOA 4EAHD 3V9UA 3WXJA 4CJKA 3VQQA 1QHAA 4M7XA 1NG9A 3JS6A 2XY6A 1ESVA 3SAHA 5AZJA 1XWLA 4BRKA 3V81A 2F8SA 3OS1A 1JLBA 3KK7A 3HXMA 3AARA 2ZJQL 1Q81O 5JVGL 5AZJB 5LY3A 1I94K 5C2FA 1VQPN 1NJYA 4JI2K 1QHTA 4FWPA 4CGGA 3AGKA 3MEGA 1L3SA 2Q3SA 1TAUA 3L0QA 4CD3A 4CHNA 4WQ5C 1BO5O 3PSIA 4FJHA 1KVBA 1HJRA 4B3TK 3M8QA 4CBXA 2E20A 4DTMA 5A2QO 3HP9A 1Q86O 1YTAA 2IAJA 5AQZA 3TTFA 3K5NA 4IDKA 4DQRA 1ATNA 2UXDK 3HTVA 4CF2A 4BC2A 2XY5A 2FF3B 2JLEA 5IWAK 5MLCQ 1C0MA 3SCXA 1TVRA 4H0XB 1KVCA 3HJFA 2Q31A 3BEXA 3KLFA 3SV4A 5JICA 3T19A 1NJIO 5AQMA 1RTDA 5LL6Z 2R7YA 4DSJA 3M6GA 2PFUA 3B6PA 1RFQA 3CHWA 3AVLA 1KCFA 3M3ZA 3ZEUB 2G8IA 3CCVN 1B92A 4Z4EA 1C1CA 3L2WA 4DTXA 3NF7A 2JWKA 4JKCA 4M3ZA 3ZCMA 4BRFA 4BVPA 4M3YA 3R9PA 2E88A 3BZKA 3KD1E 2FBXA 3G6EN 3QBXA 3U9DA 4CGJA 4RWTA 2XHBA 4FK2A 2HHHK 2FBYA 4YNQA 3CETA 3IG1A 1D5AA 2YHXA 4JAXA 5AQQA 1F21A 3DLHA 3HI0A 3P1GA 4CBUA 4BC5A 2HHUA 2PY5A 3VQPA 1YF5L 1L5UA 4EZ6A 3WNFA 4CEDA 3BF3A 2BANA 1DGKN 5BRFA 4M3RA 1HR0K 3ULEB 2ZE2A 2QWOA 3KWGA 1B9DA 1T7PA 3RSEA 2O8CB 3MEDA 4KI4A 1TK8A 3TAMA 1GLEG 1N34K 4NLCA 3KLIA 4F9OA 4CJSA 3ZSRA 2OPQA 5AQSA 5ADXA 4YOVA 2ASMA 3LM9A 3VN5A 5EX5A 5HRNA 3O3FA 4HCCA 2E2OA 3TANA 1WAFA 5KPRA 2E5LK 1NBWA 1W97L 3DLKA 1HLUA 4JHDB 2P9LB 4B9LA 3NH2A 4WFNL 1OH8A 2F96A 2IVNA 4K42A 3IFRA 4NCBA 3DRRA 1Q82O 2I5JA 3C94A 1HNXK 1HYSA 3WXIA 4Z4FA 3O3GA 4M45A 1KTQA 1NK6A 4DCHA 1P90A 2A5XA 2QWRA 3SBTA 1NGFA 3CCQN 4PWDA 1S6QA 4FJXA 1RNHA 4OLAA 1I3AA 5K14A 1Q8IA 2PYJA 1TGOA 1KD1O 3MN7A 1BU6O 4RTFD 3M8RA 4NB4A 4FLVA 2FC0A 3WEEB 1RBSA 3H1VX 2DFHA 3CC4N 3J7AP 1GOCA 4BQLA 1QQOA 5AQIA 4M63C 4BG9A 4CJRA 3RR8A 1VSIA 3ZX0A 5HRPA 5AQPA 5AJ3K 4ELTA 5AQRA 4H0VB 1WSHA 4G9ZA 1S1UA 3T1YK 2G8UA 1VSMA 1HYVA 3QICA 1KAZA 1JLGA 3LP2A 4O8KA 3H6EA 4CZGA 4CZFA 4R5PA 4JI8K 1TL3A 2O8CA 1JLCA 3OYIA 2BE2A 1J54A 4CJEA 3NGIA 5AQXA 4FL9A 4H5WA 4B3SK 3VOVA 3KK3A 3CJCA 3U6FA 5GIPA 5C42A 1VSLA 4Z4HA 3R8EA 1R59O 1RT1A 4OPAA 4OPJA 1K73O 4F3TA 4K8ZA 4CI6A 3W0LA 1XMOK 1T05A 2FBTA 4J2AA 4N76A 4YOUA 3PX4A 4EHUA 3OA9A 4JK9A 1FKPA 3A2FA 4JD2A 4ISEA 2KLAA 2YNIA 4KRFA 1BCMA 3FFKB 1TUYA 1NJXA 1W9HA 3CQYA 1RBUA 3CYMA 3U9ZA 3NVKA 5LMNK 3DOLA 2P51A 3I8DA 4CD1A 1ASWA 1JLAA 3AAPA 4CK3A 5CY4A 3MX2A 3OYKA 4BDPA 3QMLA 2X74A 2O8EA 1XC9A 4CJQA 3HP6A 1HKGA 4JKHA 4BRCA 3K5LA 3HZ6A 4H4MA 2EX3A 4WYBA 5C2DA 1TKTA 3B8AX 3CI5A 3F9MA 3NCIA 3MN6A 3ZEUA 4FZZA 3HT3A 3AVMA 3GG4A 1LCUA 5GINA 5AQGA 4CZLA 4RW7A 1DT9A 5EY4A 2HVIA 4Q0BA 2NUBA 3VERA 3IMXA 1KFSA 5KPZA 2IIRA 4BRDA 2P9SB 3QINA 4QAGA 5AQLA 1IBLK 4YHHK 5BPLA 3F73A 4O5FA 2P1JA 4DQ8A 1RTHA 2WONA 3CMAN 1V4SA 4DR2K 1U04A 4NYNA 4DV1K 1GOBA 4MFBA 3KLHA 3H3NO 1K6YA 4XH1A 4H4OA 4UQGA 4H5RA 5FPEA 5BRHA 2HHQA 4RW8A 3EZWA 3OYAA 4IG0A 3FR0A 3V9SA 4X66K 3HM8A 1HPZA 1KSPA 4PY5A 4YY3K 5F1XA 4CJLA 1KFDA 2HOEA 4CF1A 3VPZA 3D0PA 3CD6N 5AQOA 1QSYA 3OHRA 5I9EB 3CJAA 4BGAA 3ATVA 3SAGA 4RG8A 2WOMA 4DFMA 4XEIA 4FLTA 5BRDA 4A5BA 2NRVA 1M1KO 4U67L 3AO4A 4CF9A 2VGMA 4PA1A 3VQCA 3QESA 3RSEB 4C1NK 1J5EK 1T6CA 3ASMA 1K8AO 3LDLA 4DTRA 2QXFA 4E89A 1ATSA 3ATUA 3V1RA 1TL1A 1X1PA 4DG1A 4A62A 1Q9YA 3AVAA 3WNGA 3RTVA 3H3OB 3WEEA 4BR7A 4FJ9A 3L2RA 4CZEA 3FZMA 1CXQA 2X6SA 1BQMA 1GLCG 1NNEA 4FWQA 4LFBK 5HROA 1RBRA 4CJ3A 1JLFA 1N8RO 4IZ9A 4R79A 3CPWM 1C1BA 1TYQB 1OH5A 4NO7A 5ADXH 4C23A 1C6VA 1XNRK 2E1ZA 1ZBHA 2ATQA 4YOXA 1RBTA 4KHQA 2QKBA 3DOKA 2OPPA 3ITHA 4WE1A 4OVLA 3OS2A 5FPNA 1JJ2M 2ZF5O 4KTQA 1FK9A 3W3DA 1U49A 1WOQA 3PO4A 3C65A 4KB0A 2KQ2A 3ZSOA 4WF9L 2BH1A 2BTFA 4KH4A 1JL2A 4YOTA 2E2QA 3IRXA 2G8VA 1JLEA 3ALYA 1S5JA 4DTJA 1U47A 3F9KA 3BF1A 4CIFA 3VQAA 3QIOA 2UXBK 4O0IA 3QFPA 1N32K 1ASVA 1XQSC 4IJNA 4FJ5A 4I2PA 3ZT4A 4GNIA 3SJJA 1I39A 3SLCA 3OYEA 5KPTA 4QCLA 3F2KA 4WQ4C 1SUQA 3CQ8A 2ZGZA 5BN8A 5GADP 3LWMA 4KHSA 3DXMB 1C0UA 4FLUA 3UKUB 3EYZA 3GOIA 1IG9A 1FW6A 4Y0WA 1KVAA 2HNYA 2P9UB 4FWRA 5HRRA 2QA4N 3LL3A 4OPKA 2HHSA 5EU7A 3M5RA 3O3HA 1VQ9N 3ZETB 3N4PA 4JKBA 1Q18A 4B3MK 3MCAB 4DFKA 4KREA 4K0KK 3CC2N 4LF9K 3MCPA 1NMDA 3SV3A 3M8SA 1RT2A 2ZJRL 2F7TA 3E9PA 3L4IA 3V6DA 4B3RK 3VQ6A 2X6NA 3AVBA 4ILHA 3T1AA 3IKMA 2KFNA 3DI6A 4AHSA 1NGBA 4FM2A 3QIPA 1VSKA 3QLHA 4DFJA 3K57A 2UYTA 4IEEA 3UKRB 1BISA 1WAJA 4FM1A 4I6MB 1ZC6A 4MDAA 2BGGA 1NGEA 5EVZA 3OYBA 3SUOA 4DR6K 4DWIA 4PUOA 1DKGD 4CEAA 4DV6K 3TPQA 3OY9A 3BP8A 2UUBK 4A2AA 3HM9A 2X78A 4M3WA 3QB0A 1VAZA 1XHZA 5KRSA 2G8FA 5M1OA 1EXQA 4DLEA 3AY9A 4DLGA 3O9RA 3TTCA 4FJ7A 3CM5A 1J6ZA 4B1XB 1NKCA 4B1UB 4ID5A 1MA9B 3J7ZO 1VSFA 3OYNA 1GLBG 3TAQA 1RT7A 3IAYA 5SWMA 4BE2A 4AM6A 4NXMK 2YNHA 4JRQA 2NNWA 5AQFA 3WNEA 4KTZA 4ID1A 3I8BA 4BDYA 5KGWA 5AFUH 4M42A 3VQEA 1L3VA 3UKUA 1ITGA 4W5RA 2VQFK 2KHOA 5JS2A 5J2QA 3EE8A 4BRNA 2G8KA 2P9KA 4Q5VA 1L3UA 1NGDA 4MO4A 3C6AA 1HKCA 2HHWA 4CFDA 4WQ4A 1TV6A 1LV5A 3L6QA 1CZBA 4B9TA 3EZ5A 1LWFA 1EQYA 5HL7L 4HVJA 1J53A 4FWLA 3QEWA 4B1ZA 1ZBLA 5J2PA 3SZ2A 4CK2A 4KBOA 4I7FA 2WUSA 4M7YA 3VTIA 1R0AA 2GTDA 1W0HA 3WXMB 3EY1A 1ILYA 2QI2A 2DFEA 1X9SA 1EO1A 1KAXA 5M1QA 1GLFO 1UWBA 4ZTFA 4CJ7A 4FVMA 4JK7A 5GAEP 2XRIA 1QTMA 2XY8A 2A6AA 4QS9A 2YHBA 2KZZA 4DR4K 1KLNA 4C8LA 3AGRA 4DS5A 4CZIA 4JD2B 3C6TA 3ZX3A 1IBMK 1EX4A 4M3XA 5DMRA 1SV5A 1RDBA 3DYAA 2E4LA 1DTTA 3QERA 5FRMA 5GAGP 2Q97A 3IS9A 2HHTA 4H8KA 4FSVA 2WFBA 3NE6A 1RCHA 2E2NA 3VTHA 1BHLA 3VA0A 4DSEA 2CGKA 2F4VK 1JCGA 1FKOA 1SZ2A 5CE3A 3THYA 1VSHA 4JI7K 3H08A 5M1NA 2E2PA 4RW4A 1WSIA 5KQ8A 3Q7BA 4E7HA 4PL8A 4YDUA 2XY7A 2RPIA 3EL2A 3HSTB 1Z26A 4PKIA 5SZTA 4JRPA 5CHIA 4DKWA 3OS0A 3ID6A 5HBMA 4LFAK 5TKYA 4DS4A 3E9OA 4JI6K 1QQNA 2YJEA 2HNDA 4IOAL 2Q36A 1VQKN 5C12A 4CZHA 2Z1GA 1WLJA 3SQ1A 4HHTA 5E41A 3C7NA 3VQDA 4BQZA 4JS5A 4FWNA 2P9NB 4JI3K 1DTQA 1D9DA 5FRNA 4CBWA 4B9UA 2GEMA 1CLQA 3LZIA 1XHXA 3NDKA 4B9MA 2YKMA 4DR3K 3OVNA 1XNQK 1WSEA 2E6MA 3GBTA 4L8RB 1O1WA 5T7BA 3K0SA 1YJNN 2YHWA 1NK0A 4MO5A 2IGIA 1KAYA 2YHAA 4IWVA 3VEVA 3CCLN 4DV2K 4BACA 3UE5A 3SQ4A 3P39A 3DXMA 1UAXA 4MLHA 1SL0A 4EP5A 4MLEA 1CZ9A 1OKJA 5LJWA 1HUXA 3T7ZA 1BI4A 4K8XA 4DV0K 3THXB 4B9VA 3PSFA 1VQ8N 2F9TA 4I9LA 4I9QA 3I0SA 3SPZA 2A40A 4LF5K 4BR2A 3QEXA 2ZQBA 2QWQA 3JXUA 4JKGA 2RHKA 4FWOA 3RMAA 2QKKA 3AVHA 3NGYA 4YDUC 3RMCA 4PL7A 1S3XA 3LP1A 3GDQA 3HK2A 3CFPA 3QEIA 1QE1A 2P9IB 3NH1A 4KH6A 3QNNA 4E7LA 4RCHA 5FDLA 4N41A 3AO2A 4GY2B 2XO7A 4FW1A 4BRQA 3HL8A 3EE9A 3TAGA 3P5JA 1D4XA 4ZHRA 3O9UA 3RVCA 3PV8A 4IO8A 3BUZB 2Y1IA 1C0GA 2YX6A 4AQYK 2GWKA 4PHTX 1Z6RA 2YHYA 2GWJA 4N5SA 3KKRA 5HP1A 3WXLA 1QZ6A 2OANA 1MWMA 3G10A 4LH5A 3LP0A 4KFBA 3TABA 3ID8A 3VEXA 2HB5A 2CH5A 3SMPA 1Y97A 3S3MA 4HCBA 3ENHA 4GV9A 3MWPA 4DF4A 3CCJN 4CJ5A 4C8NA 4HUFA 4KAZA 1IKXA 3THVA 3I33A 4ISFA 4DTUA 4IBNA 3O4QA 1YI2N 3L2VA 5M1PA 4CZJA 3CM6A 1X9WA 1ATRA 2KTQA 2A41A 5AZIA 3TI0A 3QETA 4EP4A 2QWNA 1GOAA 4B8CA 1VRUA 1BIZA 4E1NA 2RF2A 3U3GA 5ELZA 3RRHA 2KFZA 3KJVA 5JMVA 2UUAK 2E8AA 2Q2RA 3SUPA 1NKBA 2W6LA 4OO1J 4BG8A 4CE9A 1LWCA 1TUUA 5M1KA 3PLAA 1ZBSA 4K25A 1WBDA 4H0TB 4NCAA 1IKVA 2O8FB 2YV0X 2P9PA 2UUCK 4BR4A 3HPOA 3LDPA 3S41A 3MECA 1IJJA 2DFFA 4O4GA 4A59A 4DSIA 2DPNA 1NGIA 4OX9K 1VSEA 2D0PA 4ICLA 4ELUA 3CC7N 5AQWA 3TSUA 2IVPA 2HMPA 5AQVA 3MXJA 3QNOA 3U4LA 1VK0A 2B6AA 3SNNA 2UXCK 3TWHA 1WBBA 1TKXA 2IDOA 1IKYA 2QWMA 4L3QA 3FE1A 5FROA 1VQ4N 3H45C 4RW9A 4AHCA 3LDSA 3UKRA 4K43A 3WNHA 1S1XA 3ZYYX 3CF5L 3LDOA 2ETJA 1IV0A 3TU5A 5I3UA 3DLBA 3MXIA 3MXMA 4AHRA 3DJCA 2H3GX 4C1NI 4W5TA 4BC4A 2D0OA 1A5VA 3NMUA 1KXPA 3O8MA 3O5BA 3OYFA 4Z94A 4JKFA 4FJKA 2QWLA 1KRPA 3D2FB 2VCPA 4O55A 3AAQA 2KW4A 4BDZA 3SJHA 2YI1A 1O13A 1SL1A 1YVUA 1NM1A 4YOYA 1NU0A 3VQ5A 3BGRA 2AP1A 2HSTA 3CJ9A 4DTNA 3HBTA 5HOOA 1Z25A 2NRRA 5DM7L 4CJWA 3SQ2A 4B1WB 4PKHA 3B6OA 4OPHA 1WN7A 3V1QA 1K8KA 4ZTJA 1V4TA 1RT4A 1XMQK 1C0TA 2FF6A 2B4JA 1IBKK 4KTWA 4FZYA 4BREA 3WQUA 1LWEA 4JEPA 3K5MA 5J2NA 1YHQN 3OBWA 3TSPA 1YJWN 4CVNE 4FJMA 1VSJA 4H5VA 4WFAL 2O8EB 4DV7K 4H5NA 4RW6A 1SKRA 5I42A 1NMNA 1Q9XA 2F8TA 3SI6A 2G8WA 4B9NA 4F2RA 2RN2A 2P9PB 4DUZK 5KQDA 2I7PA 1KC8O 4Z0UA 2IVOA 4X64K 3EO3A 1RT6A 4ILGB 3KLEA 2OA8A 1NGJA 2FXUA 1G99A 1YTUA 3O9TA 4A57A 3PIPL 3OYHA 1XC3A 3H1QA 1QS4A 4C8MA 1X9JA 1RT3A 4DU3A 2I7NA 5C24A 3DM2A 5JVHL 3VQ8A 4O0JA 3R1XA 3SK3A 2W6KA 3R3LA 3AA5X 4FWMA 1NOYA 4FLYA 1OH7A 2Q1NA 4DR1K 4PKGA 3WUHA 2PZSA 5CR4A 1NK4A 4N56A 5KGXA 1BCOA 5C25A 2QTDA 5EXWA 2GUPA 2VYPA 4IJAA 2QXLA 4JKGB 3TR8A 3FLCO 4AF1A 5AQTA 3DRSA 3THXA 5GIOA 3AVFA 3DAWA 2OYQA 4CK1A 3O1WA 4HTLA 5JLHA 4JKDA 1S72N 4H0OA 5DM6L 3AVIA 1HNWK 4A61A 1BOTO 4Z4IA 3NHGA 2D1KA 1N5YA 1HNIA 4CF8A 4AHVA 3VF4A 2OPRA 2QEXN 4KI6A 2KZMA 1KQSM 4WQ5A 1GLAG 1JLQA 3KWIA 3SBGA 4LSNA 4HWIA 2ZM6K 3KZBA 3O4WA 5HLFA 4IEIA 3L3VA 1N36K 3D45A 3R6MA 5H1SQ 5CYMA 1YUWA 4FW2A 4CEOA 3G4SN 4LF6K 3PX6A 5F2RA 2QWPA 4DV5K 4CIGA 3OYJA 4FLZA 3OW2M 2HHXA 3T69A 1T8EA 2P9IA 3K59A 2JGUA 3A8YA 4CJUA 3LZJA 3ZLJA 1B9FA 3K2PA 3EEQA 2ZD1A 5BREA 4CGDA 3L3UA 2D4WA 4FXDA 5AFUA 1VRTA 4OJRA 3MX5A 5BPMA 3I0RA 1J5OA 3OTOK 4MQ3A 3NF8A 4J8FA 1NWKA 1LOTB 4CW7B 1BGXT 4B1VA 2AA4A 1EKEA 5BPNA 4E19A 3E01A 4DTPA 4E0DA 3VF6A 4LC9B 4BRIA 3Q7CA 1W2BM 4HUGA 4C8KA 3DRPA 2YNGA 3D7EO 3CG7A 4Y1DA 2QW9A 4KHYA 1S9EA 1S1WA 3SPYA 2A3ZA 4IOXA 2CH6A 1JKHA 3OJSA 3C6HA 2EHGA 1U6ZA 2ZJPL 1GLLO 4FPBA 2HBKA 3BZCA 1SAZA 3AO3A 2VG6A 4IG3A 1NLVA 5C15A 3PX0A 3DLGA 4FK0A 4CJTA 2PBDA 2P5OA 2NRWA 3H46O 4BE0A 3HOTA 5B8HA 2J4RA 2FSJA 3FGUA 4PQUA 4NYFA 3SMSA 4CEEA 1NJZA 1DEJA 3AV9A 1VQMN 4BY9C 2HBLA 2RKIA 5FLXO 3LALA 5CZ1A 4EZ9A 1VQLN 3F5TA 4JLHA 3ZT0A 2OTLN 4DFPA 4TSXA 1C0FA 4BRAA 3T3FA 1N33K 4DTSA 3VQ4A 1K8KB 1RILA 1U45A 3DMJA 4GV6A 1BDGA 1EWRA 2YJFA 3SYZA 4FM0A 3ZT2A 1U2VB 1QSLA 3MMVA 4LF8K 1FJGK 3K58A 1LAVA 4LD0A 3L2QA 1E4FT 3HSCA 4FLXA 1SS6A 2Z1IA 4JI4K 2O4GA 4CHZA 2Z1HA 1G15A 3OYLA 1BQNA 1HNVA 3VF2A 3QFUA 4F4KA 1WB9A 2YNFA 2PAVA 4KKOA 1RTIA 4JHDA 4OGEA 3QEVA 1OVQA 4LSLA 3BDPA 1RDCA 3N4QA 3J80O 2HW3A 4JI0K 3VGMA 3FFIA 5M1FA 4I6MA 1JXEA 3M1FA 4FO0A 2D0AA 1ZBUA 3J7YP 1UA1A 4ISGA 5CYQA 3ULDA 3PY8A 4XH5A 3CERA 2W42A 3P4IA 1NGCA 4DSKA 5BR8K 2W41A 1RDUA 3A0IX 3RR7A 3HPGA 4LF4K 1JXBA 4E1MA 1YJ9N 3AVCA 3V4IA 5BN9A 3AO1A 3O6WA 2Y1JA 1HNZK 5AQYA 1QQCA 2F9WA 4FLWA 1X9MA 4CJ4A 3AVNA 4H0YB 1GLJO 5BR9A 1REVA 5E84A 4FJIA 4CEBA 2E1YA 3TSQA 1HJOA 4FYDA 1NK7A 4OLBA 3JSMA 3K5OA 3D2FA 4FWSA 3ENBA 4BGBA 4B08A 3CCMN 2OTJN 3MEEA 3KK1A 3O1BA 4X65K 4FCYA 2O4IA 3MK6A 3E1YA 5CZ2A 4AILC 4CFAA 3WXKA 3UIQA 3KIOA 4MDBA 3S3NA 3L2UA 4WCEL 5LJVA 4E7JA 1D9FA 4BRPA 3LP3A 1NGAA 1TKDA 4XH4A 3WQTA 3EN9A 4E3SA 1S22A 3VQ7A 3SUNA 2V7ZA 3ZSZA 3T1HK 2Z1JA 1JCFA 3ULEA 1MU2A 2EWSA 3ZX2A 1A5WA 4CECA 3RMDA 2HVHA 3THWB 4GVMA 4H5TA 3HVTA 2NLXA 4JKEA 4DQPA 1IKWA 1S1TA 3S3OA 2E6LA 4CERA 4QS8A 3U3YA 3AVKA 3CCEN 1NGHA 2V52B 5IT9O 3OYCA 3P31A 3CJBA 4LH4A 1TK0A 4M3TA 2W40A 3MWTA 4AH9A 4BVOA 5GAHP 4DR7K 4F2SA 4JYAK 1GLDG 3FZKA 3LPTA 1NK9A 2IOCA 3OYDA 4QS7A 1JL1A 4DTOA 2VG7A 4XIUA 2O8FA 2HNZA 3CXCM 4BWJA 3OYGA 3ZSXA 3HYFA 1BIUA 3I56N 3KLGA 4CEZA 4FVUA 3P83D 2NRHA 3K9JA 4BR0A 3NH0A 4QOZB 3CJ7A 2O8BB 2FLOA 1H1VA 4Z4GA 4EFHA 2D5RA 3CCRN 3QDKA 3OYMA 1VQ7N 3LANA 3NF6A 4CF0A 5AZIB 4CJFA 4M3UA 4E7IA 1RBVA 2ZWHA 1MDUB 1BWFO 2KKZA 3V9XA 2BDPA 4FWKA 1E4GT 4KV8A 1WSGA 2P5GA 3VEYA 3LPUA 2ITMA 4V19S 1QZ5A 4JK8A 3D6RA 4H0PA 1P8ZA 5KRTA 3KVGA 1TKZA 1RDAA 1U4BA 4EHTA 1LW2A 1J9AA 1K9MO 1SKSA 4GVEA 4JI1K 4CESA 1FXXA 3CJ1A 4J2BA 1SL2A 4GW6A 4LFCK 2P9NA 3KD5E 2OZSA 5C0YA 2WBNA 1BG3A 5FPDA 4CEQA 4BR9A 1IO2A 1UA0A 1Z05A 3CFOA 2O8DB 4OKEA 4H03B 1QSSA 4UY8O 3A5OC 3LWLA 2IC3A 4BC3A 4FPAA 1U48A 3VGKA 3VQBA 1WUAA 4KH5A 1HQUA 1HMVA 3VA3A 3MN5A 4IFEA 1YIJN 3VESA 2D0CA 1RT5A 3L8BA 3PO5A 1BI4B 3MN9A 1OH6A 4C8OA 3E9LA 3VETA 4FJLA 5AQUA 1EETA 1U2VA 4DSLA 4CFBA 4CJVA 2VWJA 3AO5A 1TYQA 3NF9A 3QEPA 5TKWA 1VQON 4OKKA 3MAQA 4FK4A 2PYLA 2ZGYA 4IFVA 1JCEA 4Y1CA 1L3TA 2VWBA 4OGCA 3DLRA 3KTQA 3DLEA 4J2DA 1VQNN 1E3MA 1ZYQA 4GV3A 3SAFA 4CEFA 1ZXOA 4KHWA 3HPHA 1VSDA 5AQHA 5LMUK 4JKAA 1QVFM 1ZBFA 2HF3A 1Q7YO 5AQJA 3O4NA 4CFCA 1QVGM 2GUIA 4O8UA 3VENA 3VQ9A 3C6UA 4HUEA 4BE1A 2YKNA 4B8AB 4JV5K 1N6QA 2G8HA 2HMIA 2Q0UA 3TAFA 3WT0A 3VGLA 2NRXA 3PUFA 3VMFB 1T6DA 4JNEA 1T03A 4CIEA 4DU4A 4DMNA 2QK9A 3DXKB 2A1RA 5AQNA 3A5MC 4BRGA 1TK5A 4AHTA 2GV9A 4OKJA 2GX9A 4IXCA 4KPYA 3J81O 3A5NC 3AA3A 1BA0A 3BY5A 1BL3A 4BRLA 3SUQA 3RWUA 4AHUA 3ENOA 4W5QA 3CQXA 4IOCL 5DK5A 3LDNA 1YVNA 2D0BA 3U8XA 4FOEA 1S1VA 4O5BA 2IS3A 4DB3A 3CIPA 4WFBL 1NKEA 3S9HA 4M41A 3A5LC 4FJNA 2FBVA 5JLFA 4CZKA 2A1SA 4B9SA 3FZFA 4CHYA 3CCSN 4DQIA 3OJUA 2A42A 4CCHA 5E26A 2GELA 4YFUA 1OVYA 2DY4A 4CGHA 1BA1A 4CGFA 5C10A 3SQ0A 3UB5A 4DQQA 3C0BA 3AVJA 2ASPA 3O08A 2OZMA 4BRHA 1HRHA 3DLLL 1T3VA 4ILJA 2P9SA 4KB1A 4DU1A 4FJGA 3CMEN 2P9UA 3GE1A 1LAWA 5HRSA 4AM7A 4YOWA 1WSJA 2HBJA 1NJWA 4W5NA 1HX1A 4K41A 2YCHA 4CHQA 3RRGA 4B3OA 4GKJK 2RE2A 3AVGA 3E66A 3CFRA 3FZHA 1DLOA 4IO9L 3CPEA 2HF4A 2HHVA 3KHYA
chains in the Genus database with same CATH topology
3I0SA 1TKTA 1NJZA 4DSFA 1SKWA 3NCIA 3AV9A 3SPZA 3QO9A 1NK8A 4FZZA 3HT3A 2B5JA 3AVMA 3QEXA 2ZQBA 2RKIA 1S6PA 4HTUA 3AA2A 1D8YA 4G1QA 4RW7A 4N47A 3LALA 3ZSVA 5CZ1A 4I2QA 3RMAA 2QKKA 4EZ9A 3AVHA 4Q0BA 2HVIA 2NUBA 3NGYA 4JLHA 3RMCA 1KFSA 1CXUA 3ZT0A 3LP1A 3ZT1A 3HK2A 3CFPA 4DFPA 1QE1A 4TSXA 3QEIA 5J1EA 3T3FA 3NH1A 3QNNA 4CHOA 1TAQA 3QINA 4QAGA 5FDLA 4E7LA 4KHNA 4DTSA 4F8RA 3AO2A 3VQ4A 1NK5A 4N41A 2XO7A 1RILA 1U45A 3DMJA 4FW1A 3HL8A 3F73A 4J2EA 3TAGA 2P1JA 3P5JA 1RTJA 4IKFA 4ZHRA 3SYZA 3PV8A 4FM0A 1RTHA 2WONA 3ZT2A 2Y1IA 1U04A 4NYNA 1GOBA 1QSLA 2VWKA 3JYTA 4E7KA 4MFBA 3KLHA 3K58A 4N5SA 1K6YA 1LAVA 1LW0A 2OPSA 4H4OA 3KKRA 3C95A 5HP1A 4LD0A 3TAEA 3L2QA 4UQGA 2DTUA 3G10A 2Z1IA 4LH5A 3LP0A 4FLXA 4KFBA 3ZT3A 2HHQA 1YT3A 2LSNA 2O4GA 4RW8A 3TABA 4CHZA 3OYAA 2HB5A 2Z1HA 3LAKA 1G15A 4IG0A 3OYLA 3V9SA 1Y97A 3S3MA 1BQNA 1HNVA 3AA4A 4HCBA 3ISNC 4F4KA 1HPZA 1KSPA 4PY5A 2YNFA 4KKOA 4DF4A 1RTIA 4OGEA 4NCGA 4CJ5A 3QEVA 4C8NA 4CJLA 4HUFA 3LAMA 4LSLA 3BDPA 4KAZA 1IKXA 3ZSWA 1ASUA 1RDCA 1KFDA 4CF1A 3NGZA 3D0PA 3THVA 2HW3A 1HYZA 1QSYA 3FFIA 1EP4A 1WSFA 3O4QA 4IBNA 4RG8A 3L2VA 4DTUA 1JXEA 2WOMA 2D0AA 4DFMA 1ZBUA 4O44A 4BWMA 5D3GA 4FLTA 3CM6A 3ZSYA 1X9WA 3NFAA 1UA1A 3TARA 4IFYA 2KTQA 3AO4A 3NAEA 1UOCA 5CYQA 4CF9A 3ULDA 3PY8A 4FJ8A 3TI0A 4PA1A 3VQCA 2W42A 1KLMA 4EP4A 3QETA 2ITGA 4DSKA 1GOAA 3QESA 4B8CA 1VRUA 3RR7A 5J2MA 1BIZA 3HPGA 3V1OA 3ASMA 4E1NA 1JXBA 2RF2A 3U3GA 4E1MA 4DTRA 3AVCA 2QXFA 4GMJB 3M8PA 4CJPA 4E89A 3RRHA 3V1RA 2KFZA 3KJVA 1TL1A 1X1PA 3V4IA 4DG1A 1Q9YA 3AO1A 3AVAA 3WNGA 3RTVA 2Y1JA 3V9ZA 3SUPA 1NKBA 1QQCA 4LY7A 4FJ9A 4FLWA 3L2RA 1X9MA 4CE9A 1LWCA 3RMBA 4CJ4A 3AVNA 4DF8A 1CXQA 2X6SA 4CGIA 1BQMA 1REVA 1HQEA 5JS1A 3G0ZA 3TAPA 4FJIA 4CEBA 4NCAA 4FYDA 1IKVA 1NK7A 5HROA 5KI6A 2YV0X 4OLBA 1RBRA 4CJ3A 1JLFA 3HPOA 4DQSA 3JSMA 3K5OA 1C1BA 3MECA 4FJJA 4JS4A 4B08A 1C6VA 3MEEA 1WNSA 3KKSA 3KK1A 4FCYA 1ZBHA 2DFFA 2ATQA 2O4IA 1RBTA 4O4GA 4KHUA 4DSIA 4KHQA 2QKBA 3DOKA 5CZ2A 1VSEA 2OPPA 4AILC 4CFAA 3ITHA 4ICLA 4OVLA 4WE1A 3OS2A 4ELUA 1IH7A 4F3OA 3UIQA 4KTQA 1FK9A 1NOZA 1U49A 3KIOA 3MXJA 3QNOA 3PO4A 3S3NA 3L2UA 4KB0A 1VK0A 2B6AA 3SNNA 2KQ2A 3ZSOA 3TWHA 3KK2A 2AJQA 1TKXA 2IDOA 2GBZA 1IKYA 4E7JA 4W5OA 3NBPA 4ELVA 1D9FA 5FROA 3HO1A 4RW9A 1JL2A 4AHCA 1C1AA 3ZSQA 3LDSA 3LP3A 3IRXA 4KO0A 2G8VA 1JLEA 3WNHA 3ALYA 1S5JA 4CHPA 1S1XA 4FZXC 1A5XA 1TKDA 2VG5A 4DTJA 1S9GA 3V9WA 2ETJA 1U47A 3F9KA 4E3SA 4CIFA 5I3UA 3VQ7A 3VQAA 3QIOA 5KTQA 4Z4CA 3SUNA 3DLBA 3MXIA 3MXMA 1ZBIA 3ZSZA 4O0IA 4AHRA 1XI1A 2Z1JA 1RDDA 3HVRA 1MU2A 1ASVA 4CECA 1A5WA 4FJ5A 4I2PA 3ZT4A 3RMDA 4W5TA 2HVHA 3SJJA 4GVMA 1I39A 3V9UA 1A5VA 3OYEA 4QCLA 3HVTA 4CJKA 3VQQA 4DQPA 3OYFA 1IKWA 1S1TA 1SUQA 3CQ8A 2E6LA 4CERA 3LWMA 3S3OA 4KHSA 4FJKA 1C0UA 4FLUA 3U3YA 3EYZA 2XY6A 3AVKA 1KRPA 1IG9A 4O55A 1KVAA 1XWLA 2HNYA 2KW4A 5HRRA 3V81A 3OS1A 4BDZA 2F8SA 1JLBA 3OYCA 4OPKA 2HHSA 5EU7A 1SL1A 3HXMA 4LH4A 3O3HA 1YVUA 1TK0A 4M3TA 3VQ5A 4DFKA 4AH9A 4KREA 3BGRA 1NJYA 1QHTA 4DTNA 4F2SA 3LPTA 4CGGA 3MEGA 1NK9A 2IOCA 3SV3A 3OYDA 3M8SA 2Q3SA 1JL1A 1RT2A 1Z25A 2VG7A 4XIUA 4DTOA 3V6DA 1L3SA 2HNZA 3VQ6A 4CJWA 4BWJA 3SQ2A 2X6NA 4CHNA 3ZSXA 3AVBA 3HYFA 3OYGA 1TAUA 1BIUA 3T1AA 2KFNA 4FJHA 3DI6A 1KVBA 4AHSA 3KLGA 1HJRA 4CEZA 3B6OA 3M8QA 4DTMA 4FM2A 1WN7A 3HP9A 1YTAA 2IAJA 3QIPA 3V1QA 3K5NA 4IDKA 4ZTJA 3P83D 4DQRA 1RT4A 1C0TA 1VSKA 2B4JA 3QLHA 4KTWA 4CF2A 4DFJA 4FZYA 3NH0A 3K57A 2JLEA 2XY5A 4QOZB 1LWEA 3K5MA 1BISA 1C0MA 1WAJA 4Z4GA 3SCXA 2D5RA 5J2NA 4FM1A 1TVRA 1KVCA 3HJFA 3KLFA 2BGGA 3OYMA 3OYBA 3SUOA 3LANA 3NF6A 3SV4A 4DWIA 4FJMA 3T19A 1VSJA 4CF0A 4PUOA 4CEAA 4CJFA 1RTDA 4M3UA 2R7YA 4DSJA 4E7IA 1RBVA 3B6PA 3OY9A 4RW6A 3AVLA 1KCFA 1SKRA 2G8IA 5I42A 3HM9A 2X78A 4M3WA 1B92A 4Z4EA 1XHZA 2F8TA 1Q9XA 1C1CA 3L2WA 3V9XA 2BDPA 5KRSA 4DTXA 3SI6A 2G8FA 2G8WA 3NF7A 1EXQA 4DLEA 4M3ZA 3ZCMA 4DLGA 4B9NA 4F2RA 4KV8A 4FJ7A 1WSGA 3CM5A 4M3YA 2P5GA 2RN2A 1NKCA 3LPUA 4ID5A 3KD1E 2FBXA 1VSFA 3OYNA 4Z0UA 3TAQA 1RT7A 3IAYA 5SWMA 1RT6A 5KRTA 3KLEA 4BE2A 2OA8A 1TKZA 1RDAA 2YNHA 4CGJA 4JRQA 1U4BA 1LW2A 3WNEA 2XHBA 1YTUA 3OYHA 1J9AA 4KTZA 4FK2A 4ID1A 2FBYA 1SKSA 1QS4A 4CESA 4YNQA 4C8MA 1FXXA 3IG1A 1D5AA 4BDYA 1RT3A 5KGWA 4DU3A 4J2BA 1F21A 4M42A 1SL2A 3DLHA 3VQEA 5C24A 3DM2A 1L3VA 1ITGA 4GW6A 3P1GA 3VQ8A 4O0JA 4W5RA 3KD5E 2OZSA 5JS2A 2PY5A 3VQPA 2HHUA 5J2QA 1L5UA 4EZ6A 3WNFA 3AA5X 4CEDA 4CEQA 1IO2A 2BANA 2G8KA 1NOYA 4FLYA 4Q5VA 1UA0A 4M3RA 1L3UA 2PZSA 3CFOA 4H4MA 2ZE2A 4OKEA 4N56A 1NK4A 5KGXA 1BCOA 5C25A 1B9DA 1T7PA 2HHWA 3MEDA 4KI4A 4CFDA 1TK8A 1TV6A 1QSSA 1LV5A 4B9TA 1CZBA 3TR8A 3EZ5A 1LWFA 3TAMA 3DRSA 3KLIA 4CJSA 3ZSRA 2OPQA 2IC3A 3LWLA 4HVJA 1J53A 3VN5A 5HRNA 3O3FA 3QEWA 4HCCA 1U48A 3AVFA 3VQBA 1ZBLA 3TANA 4CK1A 2OYQA 5J2PA 1HQUA 1WAFA 3SZ2A 4CK2A 4I7FA 1HMVA 1R0AA 3VA3A 1W0HA 3EY1A 2DFEA 1X9SA 2D0CA 1RT5A 3L8BA 3AVIA 3DLKA 3PO5A 1UWBA 1BI4B 4ZTFA 4C8OA 3NH2A 4B9LA 4FVMA 4Z4IA 3NHGA 2XRIA 1N5YA 2F96A 1HNIA 1QTMA 4FJLA 4CF8A 1EETA 4NCBA 4AHVA 3DRRA 2OPRA 2I5JA 2XY8A 4DSLA 3C94A 4CFBA 4KI6A 4CJVA 2YHBA 2KZMA 2KZZA 1HYSA 2VWJA 1JLQA 1KLNA 4C8LA 3AO5A 4Z4FA 3O3GA 3NF9A 4DS5A 4M45A 1KTQA 3QEPA 1NK6A 3C6TA 4LSNA 4OKKA 3MAQA 5HLFA 4FK4A 2PYLA 1EX4A 4M3XA 3L3VA 4PWDA 4IFVA 5DMRA 1SV5A 3DYAA 1RDBA 1S6QA 3D45A 1RNHA 2E4LA 1DTTA 4Y1CA 1L3TA 4FJXA 4OGCA 3DLRA 3QERA 5FRMA 4OLAA 3KTQA 3DLEA 4J2DA 1I3AA 3IS9A 4FW2A 5CYMA 5K14A 4CEOA 4H8KA 1ZYQA 2HHTA 1Q8IA 3PX6A 2PYJA 1TGOA 3NE6A 4CEFA 4CIGA 1RCHA 3M8RA 4FLVA 1BHLA 3HPHA 2FC0A 3OYJA 4FLZA 1VSDA 3VA0A 4DSEA 4KHWA 2HHXA 1FKOA 1T8EA 1ZBFA 3K59A 3O4NA 1RBSA 4CFCA 2DFHA 1VSHA 2JGUA 4CJUA 2GUIA 3LZJA 3H08A 1B9FA 1GOCA 3C6UA 3K2PA 2YKNA 3VQ9A 4B8AB 4HUEA 2ZD1A 4BE1A 1N6QA 4RW4A 4CJRA 2G8HA 2HMIA 3TAFA 1WSIA 3RR8A 4CGDA 1VSIA 3L3UA 4FXDA 3PUFA 4E7HA 5HRPA 4ELTA 1VRTA 2XY7A 4OJRA 2RPIA 1T03A 1WSHA 4CIEA 4DU4A 3HSTB 4DMNA 1S1UA 2QK9A 2A1RA 2G8UA 1VSMA 1HYVA 3I0RA 1Z26A 1TK5A 5SZTA 1J5OA 4AHTA 4JRPA 1JLGA 3LP2A 2GV9A 3OS0A 4OKJA 4MQ3A 4KPYA 3NF8A 5HBMA 4R5PA 1TL3A 1BGXT 4DS4A 3AA3A 1JLCA 3OYIA 2BE2A 1J54A 4CJEA 3NGIA 1BL3A 1EKEA 4E19A 2HNDA 3SUQA 3RWUA 3E01A 3KK3A 4DTPA 4AHUA 4W5QA 4E0DA 3U6FA 5C42A 1VSLA 5DK5A 4Z4HA 2Z1GA 2D0BA 1S1VA 1RT1A 1WLJA 4HHTA 5E41A 4OPJA 4O5BA 3SQ1A 2IS3A 4F3TA 3VQDA 4JS5A 4HUGA 4C8KA 4K8ZA 1NKEA 3DRPA 3S9HA 2FBTA 4M41A 1T05A 1DTQA 1D9DA 5FRNA 4B9UA 4FJNA 1CLQA 2FBVA 4J2AA 2YNGA 3LZIA 1XHXA 3CG7A 3NDKA 2A1SA 4Y1DA 2YKMA 4B9SA 4B9MA 4N76A 4CHYA 4DQIA 3OJUA 3PX4A 4KHYA 4CCHA 3OVNA 4YFUA 1S9EA 1WSEA 1S1WA 3SPYA 2E6MA 4CGHA 4L8RB 2DY4A 1O1WA 4CGFA 5T7BA 3SQ0A 1FKPA 3A2FA 1JKHA 3OJSA 4DQQA 2EHGA 2YNIA 1NK0A 4KRFA 1BCMA 3AVJA 2OZMA 1HRHA 2IGIA 1NJXA 1W9HA 1RBUA 2YHAA 3CYMA 4DU1A 4FJGA 4KB1A 3AO3A 2VG6A 3DOLA 1LAWA 4IG3A 2P51A 4BACA 3I8DA 5HRSA 1ASWA 1JLAA 3SQ4A 1WSJA 1UAXA 3PX0A 3DLGA 4FK0A 4CK3A 4CJTA 1NJWA 4EP5A 1SL0A 2P5OA 4W5NA 4CHQA 5CY4A 1CZ9A 3RRGA 4B3OA 3OYKA 4BE0A 4BDPA 2X74A 3AVGA 1BI4A 4K8XA 3CFRA 1XC9A 4CJQA 3HP6A 4B9VA 1DLOA 4I9LA 4PQUA 2HHVA 4I9QA 4NYFA 3K5LA 2EX3A 4CEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I0S A;  1TKT A;  1NJZ A;  4DSF A;  1SKW A;  3NCI A;  3AV9 A;  3SPZ A;  3QO9 A;  1NK8 A;  4FZZ A;  3HT3 A;  2B5J A;  3AVM A;  3QEX A;  2ZQB A;  2RKI A;  1S6P A;  4HTU A;  3AA2 A;  1D8Y A;  4G1Q A;  4RW7 A;  4N47 A;  3LAL A;  3ZSV A;  5CZ1 A;  4I2Q A;  3RMA A;  2QKK A;  4EZ9 A;  3AVH A;  4Q0B A;  2HVI A;  2NUB A;  3NGY A;  4JLH A;  3RMC A;  1KFS A;  1CXU A;  3ZT0 A;  3LP1 A;  3ZT1 A;  3HK2 A;  3CFP A;  4DFP A;  1QE1 A;  4TSX A;  3QEI A;  5J1E A;  3T3F A;  3NH1 A;  3QNN A;  4CHO A;  1TAQ A;  3QIN A;  4QAG A;  5FDL A;  4E7L A;  4KHN A;  4DTS A;  4F8R A;  3AO2 A;  3VQ4 A;  1NK5 A;  4N41 A;  2XO7 A;  1RIL A;  1U45 A;  3DMJ A;  4FW1 A;  3HL8 A;  3F73 A;  4J2E A;  3TAG A;  2P1J A;  3P5J A;  1RTJ A;  4IKF A;  4ZHR A;  3SYZ A;  3PV8 A;  4FM0 A;  1RTH A;  2WON A;  3ZT2 A;  2Y1I A;  1U04 A;  4NYN A;  1GOB A;  1QSL A;  2VWK A;  3JYT A;  4E7K A;  4MFB A;  3KLH A;  3K58 A;  4N5S A;  1K6Y A;  1LAV A;  1LW0 A;  2OPS A;  4H4O A;  3KKR A;  3C95 A;  5HP1 A;  4LD0 A;  3TAE A;  3L2Q A;  4UQG A;  2DTU A;  3G10 A;  2Z1I A;  4LH5 A;  3LP0 A;  4FLX A;  4KFB A;  3ZT3 A;  2HHQ A;  1YT3 A;  2LSN A;  2O4G A;  4RW8 A;  3TAB A;  4CHZ A;  3OYA A;  2HB5 A;  2Z1H A;  3LAK A;  1G15 A;  4IG0 A;  3OYL A;  3V9S A;  1Y97 A;  3S3M A;  1BQN A;  1HNV A;  3AA4 A;  4HCB A;  3ISN C;  4F4K A;  1HPZ A;  1KSP A;  4PY5 A;  2YNF A;  4KKO A;  4DF4 A;  1RTI A;  4OGE A;  4NCG A;  4CJ5 A;  3QEV A;  4C8N A;  4CJL A;  4HUF A;  3LAM A;  4LSL A;  3BDP A;  4KAZ A;  1IKX A;  3ZSW A;  1ASU A;  1RDC A;  1KFD A;  4CF1 A;  3NGZ A;  3D0P A;  3THV A;  2HW3 A;  1HYZ A;  1QSY A;  3FFI A;  1EP4 A;  1WSF A;  3O4Q A;  4IBN A;  4RG8 A;  3L2V A;  4DTU A;  1JXE A;  2WOM A;  2D0A A;  4DFM A;  1ZBU A;  4O44 A;  4BWM A;  5D3G A;  4FLT A;  3CM6 A;  3ZSY A;  1X9W A;  3NFA A;  1UA1 A;  3TAR A;  4IFY A;  2KTQ A;  3AO4 A;  3NAE A;  1UOC A;  5CYQ A;  4CF9 A;  3ULD A;  3PY8 A;  4FJ8 A;  3TI0 A;  4PA1 A;  3VQC A;  2W42 A;  1KLM A;  4EP4 A;  3QET A;  2ITG A;  4DSK A;  1GOA A;  3QES A;  4B8C A;  1VRU A;  3RR7 A;  5J2M A;  1BIZ A;  3HPG A;  3V1O A;  3ASM A;  4E1N A;  1JXB A;  2RF2 A;  3U3G A;  4E1M A;  4DTR A;  3AVC A;  2QXF A;  4GMJ B;  3M8P A;  4CJP A;  4E89 A;  3RRH A;  3V1R A;  2KFZ A;  3KJV A;  1TL1 A;  1X1P A;  3V4I A;  4DG1 A;  1Q9Y A;  3AO1 A;  3AVA A;  3WNG A;  3RTV A;  2Y1J A;  3V9Z A;  3SUP A;  1NKB A;  1QQC A;  4LY7 A;  4FJ9 A;  4FLW A;  3L2R A;  1X9M A;  4CE9 A;  1LWC A;  3RMB A;  4CJ4 A;  3AVN A;  4DF8 A;  1CXQ A;  2X6S A;  4CGI A;  1BQM A;  1REV A;  1HQE A;  5JS1 A;  3G0Z A;  3TAP A;  4FJI A;  4CEB A;  4NCA A;  4FYD A;  1IKV A;  1NK7 A;  5HRO A;  5KI6 A;  2YV0 X;  4OLB A;  1RBR A;  4CJ3 A;  1JLF A;  3HPO A;  4DQS A;  3JSM A;  3K5O A;  1C1B A;  3MEC A;  4FJJ A;  4JS4 A;  4B08 A;  1C6V A;  3MEE A;  1WNS A;  3KKS A;  3KK1 A;  4FCY A;  1ZBH A;  2DFF A;  2ATQ A;  2O4I A;  1RBT A;  4O4G A;  4KHU A;  4DSI A;  4KHQ A;  2QKB A;  3DOK A;  5CZ2 A;  1VSE A;  2OPP A;  4AIL C;  4CFA A;  3ITH A;  4ICL A;  4OVL A;  4WE1 A;  3OS2 A;  4ELU A;  1IH7 A;  4F3O A;  3UIQ A;  4KTQ A;  1FK9 A;  1NOZ A;  1U49 A;  3KIO A;  3MXJ A;  3QNO A;  3PO4 A;  3S3N A;  3L2U A;  4KB0 A;  1VK0 A;  2B6A A;  3SNN A;  2KQ2 A;  3ZSO A;  3TWH A;  3KK2 A;  2AJQ A;  1TKX A;  2IDO A;  2GBZ A;  1IKY A;  4E7J A;  4W5O A;  3NBP A;  4ELV A;  1D9F A;  5FRO A;  3HO1 A;  4RW9 A;  1JL2 A;  4AHC A;  1C1A A;  3ZSQ A;  3LDS A;  3LP3 A;  3IRX A;  4KO0 A;  2G8V A;  1JLE A;  3WNH A;  3ALY A;  1S5J A;  4CHP A;  1S1X A;  4FZX C;  1A5X A;  1TKD A;  2VG5 A;  4DTJ A;  1S9G A;  3V9W A;  2ETJ A;  1U47 A;  3F9K A;  4E3S A;  4CIF A;  5I3U A;  3VQ7 A;  3VQA A;  3QIO A;  5KTQ A;  4Z4C A;  3SUN A;  3DLB A;  3MXI A;  3MXM A;  1ZBI A;  3ZSZ A;  4O0I A;  4AHR A;  1XI1 A;  2Z1J A;  1RDD A;  3HVR A;  1MU2 A;  1ASV A;  4CEC A;  1A5W A;  4FJ5 A;  4I2P A;  3ZT4 A;  3RMD A;  4W5T A;  2HVH A;  3SJJ A;  4GVM A;  1I39 A;  3V9U A;  1A5V A;  3OYE A;  4QCL A;  3HVT A;  4CJK A;  3VQQ A;  4DQP A;  3OYF A;  1IKW A;  1S1T A;  1SUQ A;  3CQ8 A;  2E6L A;  4CER A;  3LWM A;  3S3O A;  4KHS A;  4FJK A;  1C0U A;  4FLU A;  3U3Y A;  3EYZ A;  2XY6 A;  3AVK A;  1KRP A;  1IG9 A;  4O55 A;  1KVA A;  1XWL A;  2HNY A;  2KW4 A;  5HRR A;  3V81 A;  3OS1 A;  4BDZ A;  2F8S A;  1JLB A;  3OYC A;  4OPK A;  2HHS A;  5EU7 A;  1SL1 A;  3HXM A;  4LH4 A;  3O3H A;  1YVU A;  1TK0 A;  4M3T A;  3VQ5 A;  4DFK A;  4AH9 A;  4KRE A;  3BGR A;  1NJY A;  1QHT A;  4DTN A;  4F2S A;  3LPT A;  4CGG A;  3MEG A;  1NK9 A;  2IOC A;  3SV3 A;  3OYD A;  3M8S A;  2Q3S A;  1JL1 A;  1RT2 A;  1Z25 A;  2VG7 A;  4XIU A;  4DTO A;  3V6D A;  1L3S A;  2HNZ A;  3VQ6 A;  4CJW A;  4BWJ A;  3SQ2 A;  2X6N A;  4CHN A;  3ZSX A;  3AVB A;  3HYF A;  3OYG A;  1TAU A;  1BIU A;  3T1A A;  2KFN A;  4FJH A;  3DI6 A;  1KVB A;  4AHS A;  3KLG A;  1HJR A;  4CEZ A;  3B6O A;  3M8Q A;  4DTM A;  4FM2 A;  1WN7 A;  3HP9 A;  1YTA A;  2IAJ A;  3QIP A;  3V1Q A;  3K5N A;  4IDK A;  4ZTJ A;  3P83 D;  4DQR A;  1RT4 A;  1C0T A;  1VSK A;  2B4J A;  3QLH A;  4KTW A;  4CF2 A;  4DFJ A;  4FZY A;  3NH0 A;  3K57 A;  2JLE A;  2XY5 A;  4QOZ B;  1LWE A;  3K5M A;  1BIS A;  1C0M A;  1WAJ A;  4Z4G A;  3SCX A;  2D5R A;  5J2N A;  4FM1 A;  1TVR A;  1KVC A;  3HJF A;  3KLF A;  2BGG A;  3OYM A;  3OYB A;  3SUO A;  3LAN A;  3NF6 A;  3SV4 A;  4DWI A;  4FJM A;  3T19 A;  1VSJ A;  4CF0 A;  4PUO A;  4CEA A;  4CJF A;  1RTD A;  4M3U A;  2R7Y A;  4DSJ A;  4E7I A;  1RBV A;  3B6P A;  3OY9 A;  4RW6 A;  3AVL A;  1KCF A;  1SKR A;  2G8I A;  5I42 A;  3HM9 A;  2X78 A;  4M3W A;  1B92 A;  4Z4E A;  1XHZ A;  2F8T A;  1Q9X A;  1C1C A;  3L2W A;  3V9X A;  2BDP A;  5KRS A;  4DTX A;  3SI6 A;  2G8F A;  2G8W A;  3NF7 A;  1EXQ A;  4DLE A;  4M3Z A;  3ZCM A;  4DLG A;  4B9N A;  4F2R A;  4KV8 A;  4FJ7 A;  1WSG A;  3CM5 A;  4M3Y A;  2P5G A;  2RN2 A;  1NKC A;  3LPU A;  4ID5 A;  3KD1 E;  2FBX A;  1VSF A;  3OYN A;  4Z0U A;  3TAQ A;  1RT7 A;  3IAY A;  5SWM A;  1RT6 A;  5KRT A;  3KLE A;  4BE2 A;  2OA8 A;  1TKZ A;  1RDA A;  2YNH A;  4CGJ A;  4JRQ A;  1U4B A;  1LW2 A;  3WNE A;  2XHB A;  1YTU A;  3OYH A;  1J9A A;  4KTZ A;  4FK2 A;  4ID1 A;  2FBY A;  1SKS A;  1QS4 A;  4CES A;  4YNQ A;  4C8M A;  1FXX A;  3IG1 A;  1D5A A;  4BDY A;  1RT3 A;  5KGW A;  4DU3 A;  4J2B A;  1F21 A;  4M42 A;  1SL2 A;  3DLH A;  3VQE A;  5C24 A;  3DM2 A;  1L3V A;  1ITG A;  4GW6 A;  3P1G A;  3VQ8 A;  4O0J A;  4W5R A;  3KD5 E;  2OZS A;  5JS2 A;  2PY5 A;  3VQP A;  2HHU A;  5J2Q A;  1L5U A;  4EZ6 A;  3WNF A;  3AA5 X;  4CED A;  4CEQ A;  1IO2 A;  2BAN A;  2G8K A;  1NOY A;  4FLY A;  4Q5V A;  1UA0 A;  4M3R A;  1L3U A;  2PZS A;  3CFO A;  4H4M A;  2ZE2 A;  4OKE A;  4N56 A;  1NK4 A;  5KGX A;  1BCO A;  5C25 A;  1B9D A;  1T7P A;  2HHW A;  3MED A;  4KI4 A;  4CFD A;  1TK8 A;  1TV6 A;  1QSS A;  1LV5 A;  4B9T A;  1CZB A;  3TR8 A;  3EZ5 A;  1LWF A;  3TAM A;  3DRS A;  3KLI A;  4CJS A;  3ZSR A;  2OPQ A;  2IC3 A;  3LWL A;  4HVJ A;  1J53 A;  3VN5 A;  5HRN A;  3O3F A;  3QEW A;  4HCC A;  1U48 A;  3AVF A;  3VQB A;  1ZBL A;  3TAN A;  4CK1 A;  2OYQ A;  5J2P A;  1HQU A;  1WAF A;  3SZ2 A;  4CK2 A;  4I7F A;  1HMV A;  1R0A A;  3VA3 A;  1W0H A;  3EY1 A;  2DFE A;  1X9S A;  2D0C A;  1RT5 A;  3L8B A;  3AVI A;  3DLK A;  3PO5 A;  1UWB A;  1BI4 B;  4ZTF A;  4C8O A;  3NH2 A;  4B9L A;  4FVM A;  4Z4I A;  3NHG A;  2XRI A;  1N5Y A;  2F96 A;  1HNI A;  1QTM A;  4FJL A;  4CF8 A;  1EET A;  4NCB A;  4AHV A;  3DRR A;  2OPR A;  2I5J A;  2XY8 A;  4DSL A;  3C94 A;  4CFB A;  4KI6 A;  4CJV A;  2YHB A;  2KZM A;  2KZZ A;  1HYS A;  2VWJ A;  1JLQ A;  1KLN A;  4C8L A;  3AO5 A;  4Z4F A;  3O3G A;  3NF9 A;  4DS5 A;  4M45 A;  1KTQ A;  3QEP A;  1NK6 A;  3C6T A;  4LSN A;  4OKK A;  3MAQ A;  5HLF A;  4FK4 A;  2PYL A;  1EX4 A;  4M3X A;  3L3V A;  4PWD A;  4IFV A;  5DMR A;  1SV5 A;  3DYA A;  1RDB A;  1S6Q A;  3D45 A;  1RNH A;  2E4L A;  1DTT A;  4Y1C A;  1L3T A;  4FJX A;  4OGC A;  3DLR A;  3QER A;  5FRM A;  4OLA A;  3KTQ A;  3DLE A;  4J2D A;  1I3A A;  3IS9 A;  4FW2 A;  5CYM A;  5K14 A;  4CEO A;  4H8K A;  1ZYQ A;  2HHT A;  1Q8I A;  3PX6 A;  2PYJ A;  1TGO A;  3NE6 A;  4CEF A;  4CIG A;  1RCH A;  3M8R A;  4FLV A;  1BHL A;  3HPH A;  2FC0 A;  3OYJ A;  4FLZ A;  1VSD A;  3VA0 A;  4DSE A;  4KHW A;  2HHX A;  1FKO A;  1T8E A;  1ZBF A;  3K59 A;  3O4N A;  1RBS A;  4CFC A;  2DFH A;  1VSH A;  2JGU A;  4CJU A;  2GUI A;  3LZJ A;  3H08 A;  1B9F A;  1GOC A;  3C6U A;  3K2P A;  2YKN A;  3VQ9 A;  4B8A B;  4HUE A;  2ZD1 A;  4BE1 A;  1N6Q A;  4RW4 A;  4CJR A;  2G8H A;  2HMI A;  3TAF A;  1WSI A;  3RR8 A;  4CGD A;  1VSI A;  3L3U A;  4FXD A;  3PUF A;  4E7H A;  5HRP A;  4ELT A;  1VRT A;  2XY7 A;  4OJR A;  2RPI A;  1T03 A;  1WSH A;  4CIE A;  4DU4 A;  3HST B;  4DMN A;  1S1U A;  2QK9 A;  2A1R A;  2G8U A;  1VSM A;  1HYV A;  3I0R A;  1Z26 A;  1TK5 A;  5SZT A;  1J5O A;  4AHT A;  4JRP A;  1JLG A;  3LP2 A;  2GV9 A;  3OS0 A;  4OKJ A;  4MQ3 A;  4KPY A;  3NF8 A;  5HBM A;  4R5P A;  1TL3 A;  1BGX T;  4DS4 A;  3AA3 A;  1JLC A;  3OYI A;  2BE2 A;  1J54 A;  4CJE A;  3NGI A;  1BL3 A;  1EKE A;  4E19 A;  2HND A;  3SUQ A;  3RWU A;  3E01 A;  3KK3 A;  4DTP A;  4AHU A;  4W5Q A;  4E0D A;  3U6F A;  5C42 A;  1VSL A;  5DK5 A;  4Z4H A;  2Z1G A;  2D0B A;  1S1V A;  1RT1 A;  1WLJ A;  4HHT A;  5E41 A;  4OPJ A;  4O5B A;  3SQ1 A;  2IS3 A;  4F3T A;  3VQD A;  4JS5 A;  4HUG A;  4C8K A;  4K8Z A;  1NKE A;  3DRP A;  3S9H A;  2FBT A;  4M41 A;  1T05 A;  1DTQ A;  1D9D A;  5FRN A;  4B9U A;  4FJN A;  1CLQ A;  2FBV A;  4J2A A;  2YNG A;  3LZI A;  1XHX A;  3CG7 A;  3NDK A;  2A1S A;  4Y1D A;  2YKM A;  4B9S A;  4B9M A;  4N76 A;  4CHY A;  4DQI A;  3OJU A;  3PX4 A;  4KHY A;  4CCH A;  3OVN A;  4YFU A;  1S9E A;  1WSE A;  1S1W A;  3SPY A;  2E6M A;  4CGH A;  4L8R B;  2DY4 A;  1O1W A;  4CGF A;  5T7B A;  3SQ0 A;  1FKP A;  3A2F A;  1JKH A;  3OJS A;  4DQQ A;  2EHG A;  2YNI A;  1NK0 A;  4KRF A;  1BCM A;  3AVJ A;  2OZM A;  1HRH A;  2IGI A;  1NJX A;  1W9H A;  1RBU A;  2YHA A;  3CYM A;  4DU1 A;  4FJG A;  4KB1 A;  3AO3 A;  2VG6 A;  3DOL A;  1LAW A;  4IG3 A;  2P51 A;  4BAC A;  3I8D A;  5HRS A;  1ASW A;  1JLA A;  3SQ4 A;  1WSJ A;  1UAX A;  3PX0 A;  3DLG A;  4FK0 A;  4CK3 A;  4CJT A;  1NJW A;  4EP5 A;  1SL0 A;  2P5O A;  4W5N A;  4CHQ A;  5CY4 A;  1CZ9 A;  3RRG A;  4B3O A;  3OYK A;  4BE0 A;  4BDP A;  2X74 A;  3AVG A;  1BI4 A;  4K8X A;  3CFR A;  1XC9 A;  4CJQ A;  3HP6 A;  4B9V A;  1DLO A;  4I9L A;  4PQU A;  2HHV A;  4I9Q A;  4NYF A;  3K5L A;  2EX3 A;  4CEE A; 
#chains in the Genus database with same CATH topology
 1VQ6 N;  4KHP K;  4DSF A;  1SKW A;  3QO9 A;  1NK8 A;  5AQK A;  3LDQ A;  2B5J A;  4CZM A;  4DV3 K;  2V7Y A;  1S6P A;  4HTU A;  3AA2 A;  1D8Y A;  4DR5 K;  2V51 B;  4G1Q A;  3G71 N;  4N47 A;  4BR5 A;  3ZSV A;  1HPM A;  4I2Q A;  1T44 A;  2JWL A;  3GL1 A;  1CXU A;  3ZT1 A;  4BRO A;  1BUP A;  3O9Q A;  3LM2 A;  3QBW A;  5J1E A;  1EWQ A;  4CHO A;  1TAQ A;  4KHN A;  1Y64 A;  2QM1 A;  1YAG A;  4F8R A;  1NK5 A;  4JN4 A;  4GKK K;  4J2E A;  4IKF A;  1RTJ A;  5F0X A;  1X3N A;  4A5A A;  4B9Q A;  2VWK A;  3JYT A;  4E7K A;  1LW0 A;  3P38 A;  3MDQ A;  2OPS A;  2CGL A;  3C95 A;  3TTD A;  4EIA A;  3TAE A;  4BRM A;  3JAM O;  2DTU A;  3C7N B;  3CCU N;  3ZT3 A;  1YT3 A;  2LSN A;  3EKU A;  3ZET A;  3IUC A;  3LAK A;  4B1Y B;  3HOS A;  3AA4 A;  3ISN C;  2HBM A;  4NCG A;  3OBY A;  2VQE K;  3L4Q A;  3LAM A;  3ZSW A;  1ASU A;  1W7A A;  3NGZ A;  1YIT N;  1HYZ A;  3J8A A;  1EP4 A;  1WSF A;  4E1J A;  4O44 A;  3DXK A;  3G25 A;  4BWM A;  5D3G A;  3ZSY A;  2WTU A;  4DV4 K;  3NFA A;  1QQM A;  4IFY A;  3TAR A;  1RDW X;  3I55 N;  3DWL A;  3IDH A;  3NAE A;  1UOC A;  2UU9 K;  4FJ8 A;  1KLM A;  2ITG A;  3EKS A;  2VGN A;  5J2M A;  3V1O A;  1NGG A;  1X3M A;  3K9K A;  2CGJ A;  4GMJ B;  3M8P A;  4CJP A;  3THY B;  2P9K B;  1MWK A;  3PIO L;  3O9S A;  3D2E A;  3FZL A;  3V9Z A;  4LY7 A;  1HKB A;  3RMB A;  4IDH A;  4DF8 A;  5FPM A;  4CGI A;  2NRZ A;  1CZA N;  1HQE A;  5JS1 A;  3G0Z A;  3TAP A;  4NXN K;  2OCE A;  5KI6 A;  4FOI A;  5EOY A;  4DQS A;  1M90 O;  4LF7 K;  2BUP A;  4FJJ A;  4JS4 A;  2NZT A;  1XUP O;  1WNS A;  2ASO A;  3KKS A;  1SQK A;  2WC9 A;  4KHU A;  2FSN A;  4A2B A;  3D2E B;  3THW A;  4NLB A;  4F3O A;  1IH7 A;  2P9L A;  4U7B A;  1NOZ A;  3VEZ A;  2AJQ A;  3KK2 A;  2GBZ A;  4X62 K;  4W5O A;  3NBP A;  4ELV A;  4DUY K;  3HO1 A;  1C1A A;  3ZSQ A;  4KO0 A;  3VEW A;  2O8B A;  2NRT A;  4CHP A;  3HRG A;  1RGI A;  4FZX C;  1A5X A;  1IG8 A;  2VG5 A;  2FSK A;  1S9G A;  3V9W A;  5AR0 A;  3O80 A;  4JI5 K;  1YXQ A;  5KTQ A;  4Z4C A;  4YOR A;  1ZBI A;  1XI1 A;  1RDD A;  2Q0R A;  3HVR A;  2O8D A;  4DHY A;  3NVM A;  1VQ5 N;  1VHX A;  3VEO A;  4EAH D;  3V9U A;  3WXJ A;  4CJK A;  3VQQ A;  1QHA A;  4M7X A;  1NG9 A;  3JS6 A;  2XY6 A;  1ESV A;  3SAH A;  5AZJ A;  1XWL A;  4BRK A;  3V81 A;  2F8S A;  3OS1 A;  1JLB A;  3KK7 A;  3HXM A;  3AAR A;  2ZJQ L;  1Q81 O;  5JVG L;  5AZJ B;  5LY3 A;  1I94 K;  5C2F A;  1VQP N;  1NJY A;  4JI2 K;  1QHT A;  4FWP A;  4CGG A;  3AGK A;  3MEG A;  1L3S A;  2Q3S A;  1TAU A;  3L0Q A;  4CD3 A;  4CHN A;  4WQ5 C;  1BO5 O;  3PSI A;  4FJH A;  1KVB A;  1HJR A;  4B3T K;  3M8Q A;  4CBX A;  2E20 A;  4DTM A;  5A2Q O;  3HP9 A;  1Q86 O;  1YTA A;  2IAJ A;  5AQZ A;  3TTF A;  3K5N A;  4IDK A;  4DQR A;  1ATN A;  2UXD K;  3HTV A;  4CF2 A;  4BC2 A;  2XY5 A;  2FF3 B;  2JLE A;  5IWA K;  5MLC Q;  1C0M A;  3SCX A;  1TVR A;  4H0X B;  1KVC A;  3HJF A;  2Q31 A;  3BEX A;  3KLF A;  3SV4 A;  5JIC A;  3T19 A;  1NJI O;  5AQM A;  1RTD A;  5LL6 Z;  2R7Y A;  4DSJ A;  3M6G A;  2PFU A;  3B6P A;  1RFQ A;  3CHW A;  3AVL A;  1KCF A;  3M3Z A;  3ZEU B;  2G8I A;  3CCV N;  1B92 A;  4Z4E A;  1C1C A;  3L2W A;  4DTX A;  3NF7 A;  2JWK A;  4JKC A;  4M3Z A;  3ZCM A;  4BRF A;  4BVP A;  4M3Y A;  3R9P A;  2E88 A;  3BZK A;  3KD1 E;  2FBX A;  3G6E N;  3QBX A;  3U9D A;  4CGJ A;  4RWT A;  2XHB A;  4FK2 A;  2HHH K;  2FBY A;  4YNQ A;  3CET A;  3IG1 A;  1D5A A;  2YHX A;  4JAX A;  5AQQ A;  1F21 A;  3DLH A;  3HI0 A;  3P1G A;  4CBU A;  4BC5 A;  2HHU A;  2PY5 A;  3VQP A;  1YF5 L;  1L5U A;  4EZ6 A;  3WNF A;  4CED A;  3BF3 A;  2BAN A;  1DGK N;  5BRF A;  4M3R A;  1HR0 K;  3ULE B;  2ZE2 A;  2QWO A;  3KWG A;  1B9D A;  1T7P A;  3RSE A;  2O8C B;  3MED A;  4KI4 A;  1TK8 A;  3TAM A;  1GLE G;  1N34 K;  4NLC A;  3KLI A;  4F9O A;  4CJS A;  3ZSR A;  2OPQ A;  5AQS A;  5ADX A;  4YOV A;  2ASM A;  3LM9 A;  3VN5 A;  5EX5 A;  5HRN A;  3O3F A;  4HCC A;  2E2O A;  3TAN A;  1WAF A;  5KPR A;  2E5L K;  1NBW A;  1W97 L;  3DLK A;  1HLU A;  4JHD B;  2P9L B;  4B9L A;  3NH2 A;  4WFN L;  1OH8 A;  2F96 A;  2IVN A;  4K42 A;  3IFR A;  4NCB A;  3DRR A;  1Q82 O;  2I5J A;  3C94 A;  1HNX K;  1HYS A;  3WXI A;  4Z4F A;  3O3G A;  4M45 A;  1KTQ A;  1NK6 A;  4DCH A;  1P90 A;  2A5X A;  2QWR A;  3SBT A;  1NGF A;  3CCQ N;  4PWD A;  1S6Q A;  4FJX A;  1RNH A;  4OLA A;  1I3A A;  5K14 A;  1Q8I A;  2PYJ A;  1TGO A;  1KD1 O;  3MN7 A;  1BU6 O;  4RTF D;  3M8R A;  4NB4 A;  4FLV A;  2FC0 A;  3WEE B;  1RBS A;  3H1V X;  2DFH A;  3CC4 N;  3J7A P;  1GOC A;  4BQL A;  1QQO A;  5AQI A;  4M63 C;  4BG9 A;  4CJR A;  3RR8 A;  1VSI A;  3ZX0 A;  5HRP A;  5AQP A;  5AJ3 K;  4ELT A;  5AQR A;  4H0V B;  1WSH A;  4G9Z A;  1S1U A;  3T1Y K;  2G8U A;  1VSM A;  1HYV A;  3QIC A;  1KAZ A;  1JLG A;  3LP2 A;  4O8K A;  3H6E A;  4CZG A;  4CZF A;  4R5P A;  4JI8 K;  1TL3 A;  2O8C A;  1JLC A;  3OYI A;  2BE2 A;  1J54 A;  4CJE A;  3NGI A;  5AQX A;  4FL9 A;  4H5W A;  4B3S K;  3VOV A;  3KK3 A;  3CJC A;  3U6F A;  5GIP A;  5C42 A;  1VSL A;  4Z4H A;  3R8E A;  1R59 O;  1RT1 A;  4OPA A;  4OPJ A;  1K73 O;  4F3T A;  4K8Z A;  4CI6 A;  3W0L A;  1XMO K;  1T05 A;  2FBT A;  4J2A A;  4N76 A;  4YOU A;  3PX4 A;  4EHU A;  3OA9 A;  4JK9 A;  1FKP A;  3A2F A;  4JD2 A;  4ISE A;  2KLA A;  2YNI A;  4KRF A;  1BCM A;  3FFK B;  1TUY A;  1NJX A;  1W9H A;  3CQY A;  1RBU A;  3CYM A;  3U9Z A;  3NVK A;  5LMN K;  3DOL A;  2P51 A;  3I8D A;  4CD1 A;  1ASW A;  1JLA A;  3AAP A;  4CK3 A;  5CY4 A;  3MX2 A;  3OYK A;  4BDP A;  3QML A;  2X74 A;  2O8E A;  1XC9 A;  4CJQ A;  3HP6 A;  1HKG A;  4JKH A;  4BRC A;  3K5L A;  3HZ6 A;  4H4M A;  2EX3 A;  4WYB A;  5C2D A;  1TKT A;  3B8A X;  3CI5 A;  3F9M A;  3NCI A;  3MN6 A;  3ZEU A;  4FZZ A;  3HT3 A;  3AVM A;  3GG4 A;  1LCU A;  5GIN A;  5AQG A;  4CZL A;  4RW7 A;  1DT9 A;  5EY4 A;  2HVI A;  4Q0B A;  2NUB A;  3VER A;  3IMX A;  1KFS A;  5KPZ A;  2IIR A;  4BRD A;  2P9S B;  3QIN A;  4QAG A;  5AQL A;  1IBL K;  4YHH K;  5BPL A;  3F73 A;  4O5F A;  2P1J A;  4DQ8 A;  1RTH A;  2WON A;  3CMA N;  1V4S A;  4DR2 K;  1U04 A;  4NYN A;  4DV1 K;  1GOB A;  4MFB A;  3KLH A;  3H3N O;  1K6Y A;  4XH1 A;  4H4O A;  4UQG A;  4H5R A;  5FPE A;  5BRH A;  2HHQ A;  4RW8 A;  3EZW A;  3OYA A;  4IG0 A;  3FR0 A;  3V9S A;  4X66 K;  3HM8 A;  1HPZ A;  1KSP A;  4PY5 A;  4YY3 K;  5F1X A;  4CJL A;  1KFD A;  2HOE A;  4CF1 A;  3VPZ A;  3D0P A;  3CD6 N;  5AQO A;  1QSY A;  3OHR A;  5I9E B;  3CJA A;  4BGA A;  3ATV A;  3SAG A;  4RG8 A;  2WOM A;  4DFM A;  4XEI A;  4FLT A;  5BRD A;  4A5B A;  2NRV A;  1M1K O;  4U67 L;  3AO4 A;  4CF9 A;  2VGM A;  4PA1 A;  3VQC A;  3QES A;  3RSE B;  4C1N K;  1J5E K;  1T6C A;  3ASM A;  1K8A O;  3LDL A;  4DTR A;  2QXF A;  4E89 A;  1ATS A;  3ATU A;  3V1R A;  1TL1 A;  1X1P A;  4DG1 A;  4A62 A;  1Q9Y A;  3AVA A;  3WNG A;  3RTV A;  3H3O B;  3WEE A;  4BR7 A;  4FJ9 A;  3L2R A;  4CZE A;  3FZM A;  1CXQ A;  2X6S A;  1BQM A;  1GLC G;  1NNE A;  4FWQ A;  4LFB K;  5HRO A;  1RBR A;  4CJ3 A;  1JLF A;  1N8R O;  4IZ9 A;  4R79 A;  3CPW M;  1C1B A;  1TYQ B;  1OH5 A;  4NO7 A;  5ADX H;  4C23 A;  1C6V A;  1XNR K;  2E1Z A;  1ZBH A;  2ATQ A;  4YOX A;  1RBT A;  4KHQ A;  2QKB A;  3DOK A;  2OPP A;  3ITH A;  4WE1 A;  4OVL A;  3OS2 A;  5FPN A;  1JJ2 M;  2ZF5 O;  4KTQ A;  1FK9 A;  3W3D A;  1U49 A;  1WOQ A;  3PO4 A;  3C65 A;  4KB0 A;  2KQ2 A;  3ZSO A;  4WF9 L;  2BH1 A;  2BTF A;  4KH4 A;  1JL2 A;  4YOT A;  2E2Q A;  3IRX A;  2G8V A;  1JLE A;  3ALY A;  1S5J A;  4DTJ A;  1U47 A;  3F9K A;  3BF1 A;  4CIF A;  3VQA A;  3QIO A;  2UXB K;  4O0I A;  3QFP A;  1N32 K;  1ASV A;  1XQS C;  4IJN A;  4FJ5 A;  4I2P A;  3ZT4 A;  4GNI A;  3SJJ A;  1I39 A;  3SLC A;  3OYE A;  5KPT A;  4QCL A;  3F2K A;  4WQ4 C;  1SUQ A;  3CQ8 A;  2ZGZ A;  5BN8 A;  5GAD P;  3LWM A;  4KHS A;  3DXM B;  1C0U A;  4FLU A;  3UKU B;  3EYZ A;  3GOI A;  1IG9 A;  1FW6 A;  4Y0W A;  1KVA A;  2HNY A;  2P9U B;  4FWR A;  5HRR A;  2QA4 N;  3LL3 A;  4OPK A;  2HHS A;  5EU7 A;  3M5R A;  3O3H A;  1VQ9 N;  3ZET B;  3N4P A;  4JKB A;  1Q18 A;  4B3M K;  3MCA B;  4DFK A;  4KRE A;  4K0K K;  3CC2 N;  4LF9 K;  3MCP A;  1NMD A;  3SV3 A;  3M8S A;  1RT2 A;  2ZJR L;  2F7T A;  3E9P A;  3L4I A;  3V6D A;  4B3R K;  3VQ6 A;  2X6N A;  3AVB A;  4ILH A;  3T1A A;  3IKM A;  2KFN A;  3DI6 A;  4AHS A;  1NGB A;  4FM2 A;  3QIP A;  1VSK A;  3QLH A;  4DFJ A;  3K57 A;  2UYT A;  4IEE A;  3UKR B;  1BIS A;  1WAJ A;  4FM1 A;  4I6M B;  1ZC6 A;  4MDA A;  2BGG A;  1NGE A;  5EVZ A;  3OYB A;  3SUO A;  4DR6 K;  4DWI A;  4PUO A;  1DKG D;  4CEA A;  4DV6 K;  3TPQ A;  3OY9 A;  3BP8 A;  2UUB K;  4A2A A;  3HM9 A;  2X78 A;  4M3W A;  3QB0 A;  1VAZ A;  1XHZ A;  5KRS A;  2G8F A;  5M1O A;  1EXQ A;  4DLE A;  3AY9 A;  4DLG A;  3O9R A;  3TTC A;  4FJ7 A;  3CM5 A;  1J6Z A;  4B1X B;  1NKC A;  4B1U B;  4ID5 A;  1MA9 B;  3J7Z O;  1VSF A;  3OYN A;  1GLB G;  3TAQ A;  1RT7 A;  3IAY A;  5SWM A;  4BE2 A;  4AM6 A;  4NXM K;  2YNH A;  4JRQ A;  2NNW A;  5AQF A;  3WNE A;  4KTZ A;  4ID1 A;  3I8B A;  4BDY A;  5KGW A;  5AFU H;  4M42 A;  3VQE A;  1L3V A;  3UKU A;  1ITG A;  4W5R A;  2VQF K;  2KHO A;  5JS2 A;  5J2Q A;  3EE8 A;  4BRN A;  2G8K A;  2P9K A;  4Q5V A;  1L3U A;  1NGD A;  4MO4 A;  3C6A A;  1HKC A;  2HHW A;  4CFD A;  4WQ4 A;  1TV6 A;  1LV5 A;  3L6Q A;  1CZB A;  4B9T A;  3EZ5 A;  1LWF A;  1EQY A;  5HL7 L;  4HVJ A;  1J53 A;  4FWL A;  3QEW A;  4B1Z A;  1ZBL A;  5J2P A;  3SZ2 A;  4CK2 A;  4KBO A;  4I7F A;  2WUS A;  4M7Y A;  3VTI A;  1R0A A;  2GTD A;  1W0H A;  3WXM B;  3EY1 A;  1ILY A;  2QI2 A;  2DFE A;  1X9S A;  1EO1 A;  1KAX A;  5M1Q A;  1GLF O;  1UWB A;  4ZTF A;  4CJ7 A;  4FVM A;  4JK7 A;  5GAE P;  2XRI A;  1QTM A;  2XY8 A;  2A6A A;  4QS9 A;  2YHB A;  2KZZ A;  4DR4 K;  1KLN A;  4C8L A;  3AGR A;  4DS5 A;  4CZI A;  4JD2 B;  3C6T A;  3ZX3 A;  1IBM K;  1EX4 A;  4M3X A;  5DMR A;  1SV5 A;  1RDB A;  3DYA A;  2E4L A;  1DTT A;  3QER A;  5FRM A;  5GAG P;  2Q97 A;  3IS9 A;  2HHT A;  4H8K A;  4FSV A;  2WFB A;  3NE6 A;  1RCH A;  2E2N A;  3VTH A;  1BHL A;  3VA0 A;  4DSE A;  2CGK A;  2F4V K;  1JCG A;  1FKO A;  1SZ2 A;  5CE3 A;  3THY A;  1VSH A;  4JI7 K;  3H08 A;  5M1N A;  2E2P A;  4RW4 A;  1WSI A;  5KQ8 A;  3Q7B A;  4E7H A;  4PL8 A;  4YDU A;  2XY7 A;  2RPI A;  3EL2 A;  3HST B;  1Z26 A;  4PKI A;  5SZT A;  4JRP A;  5CHI A;  4DKW A;  3OS0 A;  3ID6 A;  5HBM A;  4LFA K;  5TKY A;  4DS4 A;  3E9O A;  4JI6 K;  1QQN A;  2YJE A;  2HND A;  4IOA L;  2Q36 A;  1VQK N;  5C12 A;  4CZH A;  2Z1G A;  1WLJ A;  3SQ1 A;  4HHT A;  5E41 A;  3C7N A;  3VQD A;  4BQZ A;  4JS5 A;  4FWN A;  2P9N B;  4JI3 K;  1DTQ A;  1D9D A;  5FRN A;  4CBW A;  4B9U A;  2GEM A;  1CLQ A;  3LZI A;  1XHX A;  3NDK A;  4B9M A;  2YKM A;  4DR3 K;  3OVN A;  1XNQ K;  1WSE A;  2E6M A;  3GBT A;  4L8R B;  1O1W A;  5T7B A;  3K0S A;  1YJN N;  2YHW A;  1NK0 A;  4MO5 A;  2IGI A;  1KAY A;  2YHA A;  4IWV A;  3VEV A;  3CCL N;  4DV2 K;  4BAC A;  3UE5 A;  3SQ4 A;  3P39 A;  3DXM A;  1UAX A;  4MLH A;  1SL0 A;  4EP5 A;  4MLE A;  1CZ9 A;  1OKJ A;  5LJW A;  1HUX A;  3T7Z A;  1BI4 A;  4K8X A;  4DV0 K;  3THX B;  4B9V A;  3PSF A;  1VQ8 N;  2F9T A;  4I9L A;  4I9Q A;  3I0S A;  3SPZ A;  2A40 A;  4LF5 K;  4BR2 A;  3QEX A;  2ZQB A;  2QWQ A;  3JXU A;  4JKG A;  2RHK A;  4FWO A;  3RMA A;  2QKK A;  3AVH A;  3NGY A;  4YDU C;  3RMC A;  4PL7 A;  1S3X A;  3LP1 A;  3GDQ A;  3HK2 A;  3CFP A;  3QEI A;  1QE1 A;  2P9I B;  3NH1 A;  4KH6 A;  3QNN A;  4E7L A;  4RCH A;  5FDL A;  4N41 A;  3AO2 A;  4GY2 B;  2XO7 A;  4FW1 A;  4BRQ A;  3HL8 A;  3EE9 A;  3TAG A;  3P5J A;  1D4X A;  4ZHR A;  3O9U A;  3RVC A;  3PV8 A;  4IO8 A;  3BUZ B;  2Y1I A;  1C0G A;  2YX6 A;  4AQY K;  2GWK A;  4PHT X;  1Z6R A;  2YHY A;  2GWJ A;  4N5S A;  3KKR A;  5HP1 A;  3WXL A;  1QZ6 A;  2OAN A;  1MWM A;  3G10 A;  4LH5 A;  3LP0 A;  4KFB A;  3TAB A;  3ID8 A;  3VEX A;  2HB5 A;  2CH5 A;  3SMP A;  1Y97 A;  3S3M A;  4HCB A;  3ENH A;  4GV9 A;  3MWP A;  4DF4 A;  3CCJ N;  4CJ5 A;  4C8N A;  4HUF A;  4KAZ A;  1IKX A;  3THV A;  3I33 A;  4ISF A;  4DTU A;  4IBN A;  3O4Q A;  1YI2 N;  3L2V A;  5M1P A;  4CZJ A;  3CM6 A;  1X9W A;  1ATR A;  2KTQ A;  2A41 A;  5AZI A;  3TI0 A;  3QET A;  4EP4 A;  2QWN A;  1GOA A;  4B8C A;  1VRU A;  1BIZ A;  4E1N A;  2RF2 A;  3U3G A;  5ELZ A;  3RRH A;  2KFZ A;  3KJV A;  5JMV A;  2UUA K;  2E8A A;  2Q2R A;  3SUP A;  1NKB A;  2W6L A;  4OO1 J;  4BG8 A;  4CE9 A;  1LWC A;  1TUU A;  5M1K A;  3PLA A;  1ZBS A;  4K25 A;  1WBD A;  4H0T B;  4NCA A;  1IKV A;  2O8F B;  2YV0 X;  2P9P A;  2UUC K;  4BR4 A;  3HPO A;  3LDP A;  3S41 A;  3MEC A;  1IJJ A;  2DFF A;  4O4G A;  4A59 A;  4DSI A;  2DPN A;  1NGI A;  4OX9 K;  1VSE A;  2D0P A;  4ICL A;  4ELU A;  3CC7 N;  5AQW A;  3TSU A;  2IVP A;  2HMP A;  5AQV A;  3MXJ A;  3QNO A;  3U4L A;  1VK0 A;  2B6A A;  3SNN A;  2UXC K;  3TWH A;  1WBB A;  1TKX A;  2IDO A;  1IKY A;  2QWM A;  4L3Q A;  3FE1 A;  5FRO A;  1VQ4 N;  3H45 C;  4RW9 A;  4AHC A;  3LDS A;  3UKR A;  4K43 A;  3WNH A;  1S1X A;  3ZYY X;  3CF5 L;  3LDO A;  2ETJ A;  1IV0 A;  3TU5 A;  5I3U A;  3DLB A;  3MXI A;  3MXM A;  4AHR A;  3DJC A;  2H3G X;  4C1N I;  4W5T A;  4BC4 A;  2D0O A;  1A5V A;  3NMU A;  1KXP A;  3O8M A;  3O5B A;  3OYF A;  4Z94 A;  4JKF A;  4FJK A;  2QWL A;  1KRP A;  3D2F B;  2VCP A;  4O55 A;  3AAQ A;  2KW4 A;  4BDZ A;  3SJH A;  2YI1 A;  1O13 A;  1SL1 A;  1YVU A;  1NM1 A;  4YOY A;  1NU0 A;  3VQ5 A;  3BGR A;  2AP1 A;  2HST A;  3CJ9 A;  4DTN A;  3HBT A;  5HOO A;  1Z25 A;  2NRR A;  5DM7 L;  4CJW A;  3SQ2 A;  4B1W B;  4PKH A;  3B6O A;  4OPH A;  1WN7 A;  3V1Q A;  1K8K A;  4ZTJ A;  1V4T A;  1RT4 A;  1XMQ K;  1C0T A;  2FF6 A;  2B4J A;  1IBK K;  4KTW A;  4FZY A;  4BRE A;  3WQU A;  1LWE A;  4JEP A;  3K5M A;  5J2N A;  1YHQ N;  3OBW A;  3TSP A;  1YJW N;  4CVN E;  4FJM A;  1VSJ A;  4H5V A;  4WFA L;  2O8E B;  4DV7 K;  4H5N A;  4RW6 A;  1SKR A;  5I42 A;  1NMN A;  1Q9X A;  2F8T A;  3SI6 A;  2G8W A;  4B9N A;  4F2R A;  2RN2 A;  2P9P B;  4DUZ K;  5KQD A;  2I7P A;  1KC8 O;  4Z0U A;  2IVO A;  4X64 K;  3EO3 A;  1RT6 A;  4ILG B;  3KLE A;  2OA8 A;  1NGJ A;  2FXU A;  1G99 A;  1YTU A;  3O9T A;  4A57 A;  3PIP L;  3OYH A;  1XC3 A;  3H1Q A;  1QS4 A;  4C8M A;  1X9J A;  1RT3 A;  4DU3 A;  2I7N A;  5C24 A;  3DM2 A;  5JVH L;  3VQ8 A;  4O0J A;  3R1X A;  3SK3 A;  2W6K A;  3R3L A;  3AA5 X;  4FWM A;  1NOY A;  4FLY A;  1OH7 A;  2Q1N A;  4DR1 K;  4PKG A;  3WUH A;  2PZS A;  5CR4 A;  1NK4 A;  4N56 A;  5KGX A;  1BCO A;  5C25 A;  2QTD A;  5EXW A;  2GUP A;  2VYP A;  4IJA A;  2QXL A;  4JKG B;  3TR8 A;  3FLC O;  4AF1 A;  5AQT A;  3DRS A;  3THX A;  5GIO A;  3AVF A;  3DAW A;  2OYQ A;  4CK1 A;  3O1W A;  4HTL A;  5JLH A;  4JKD A;  1S72 N;  4H0O A;  5DM6 L;  3AVI A;  1HNW K;  4A61 A;  1BOT O;  4Z4I A;  3NHG A;  2D1K A;  1N5Y A;  1HNI A;  4CF8 A;  4AHV A;  3VF4 A;  2OPR A;  2QEX N;  4KI6 A;  2KZM A;  1KQS M;  4WQ5 A;  1GLA G;  1JLQ A;  3KWI A;  3SBG A;  4LSN A;  4HWI A;  2ZM6 K;  3KZB A;  3O4W A;  5HLF A;  4IEI A;  3L3V A;  1N36 K;  3D45 A;  3R6M A;  5H1S Q;  5CYM A;  1YUW A;  4FW2 A;  4CEO A;  3G4S N;  4LF6 K;  3PX6 A;  5F2R A;  2QWP A;  4DV5 K;  4CIG A;  3OYJ A;  4FLZ A;  3OW2 M;  2HHX A;  3T69 A;  1T8E A;  2P9I A;  3K59 A;  2JGU A;  3A8Y A;  4CJU A;  3LZJ A;  3ZLJ A;  1B9F A;  3K2P A;  3EEQ A;  2ZD1 A;  5BRE A;  4CGD A;  3L3U A;  2D4W A;  4FXD A;  5AFU A;  1VRT A;  4OJR A;  3MX5 A;  5BPM A;  3I0R A;  1J5O A;  3OTO K;  4MQ3 A;  3NF8 A;  4J8F A;  1NWK A;  1LOT B;  4CW7 B;  1BGX T;  4B1V A;  2AA4 A;  1EKE A;  5BPN A;  4E19 A;  3E01 A;  4DTP A;  4E0D A;  3VF6 A;  4LC9 B;  4BRI A;  3Q7C A;  1W2B M;  4HUG A;  4C8K A;  3DRP A;  2YNG A;  3D7E O;  3CG7 A;  4Y1D A;  2QW9 A;  4KHY A;  1S9E A;  1S1W A;  3SPY A;  2A3Z A;  4IOX A;  2CH6 A;  1JKH A;  3OJS A;  3C6H A;  2EHG A;  1U6Z A;  2ZJP L;  1GLL O;  4FPB A;  2HBK A;  3BZC A;  1SAZ A;  3AO3 A;  2VG6 A;  4IG3 A;  1NLV A;  5C15 A;  3PX0 A;  3DLG A;  4FK0 A;  4CJT A;  2PBD A;  2P5O A;  2NRW A;  3H46 O;  4BE0 A;  3HOT A;  5B8H A;  2J4R A;  2FSJ A;  3FGU A;  4PQU A;  4NYF A;  3SMS A;  4CEE A;  1NJZ A;  1DEJ A;  3AV9 A;  1VQM N;  4BY9 C;  2HBL A;  2RKI A;  5FLX O;  3LAL A;  5CZ1 A;  4EZ9 A;  1VQL N;  3F5T A;  4JLH A;  3ZT0 A;  2OTL N;  4DFP A;  4TSX A;  1C0F A;  4BRA A;  3T3F A;  1N33 K;  4DTS A;  3VQ4 A;  1K8K B;  1RIL A;  1U45 A;  3DMJ A;  4GV6 A;  1BDG A;  1EWR A;  2YJF A;  3SYZ A;  4FM0 A;  3ZT2 A;  1U2V B;  1QSL A;  3MMV A;  4LF8 K;  1FJG K;  3K58 A;  1LAV A;  4LD0 A;  3L2Q A;  1E4F T;  3HSC A;  4FLX A;  1SS6 A;  2Z1I A;  4JI4 K;  2O4G A;  4CHZ A;  2Z1H A;  1G15 A;  3OYL A;  1BQN A;  1HNV A;  3VF2 A;  3QFU A;  4F4K A;  1WB9 A;  2YNF A;  2PAV A;  4KKO A;  1RTI A;  4JHD A;  4OGE A;  3QEV A;  1OVQ A;  4LSL A;  3BDP A;  1RDC A;  3N4Q A;  3J80 O;  2HW3 A;  4JI0 K;  3VGM A;  3FFI A;  5M1F A;  4I6M A;  1JXE A;  3M1F A;  4FO0 A;  2D0A A;  1ZBU A;  3J7Y P;  1UA1 A;  4ISG A;  5CYQ A;  3ULD A;  3PY8 A;  4XH5 A;  3CER A;  2W42 A;  3P4I A;  1NGC A;  4DSK A;  5BR8 K;  2W41 A;  1RDU A;  3A0I X;  3RR7 A;  3HPG A;  4LF4 K;  1JXB A;  4E1M A;  1YJ9 N;  3AVC A;  3V4I A;  5BN9 A;  3AO1 A;  3O6W A;  2Y1J A;  1HNZ K;  5AQY A;  1QQC A;  2F9W A;  4FLW A;  1X9M A;  4CJ4 A;  3AVN A;  4H0Y B;  1GLJ O;  5BR9 A;  1REV A;  5E84 A;  4FJI A;  4CEB A;  2E1Y A;  3TSQ A;  1HJO A;  4FYD A;  1NK7 A;  4OLB A;  3JSM A;  3K5O A;  3D2F A;  4FWS A;  3ENB A;  4BGB A;  4B08 A;  3CCM N;  2OTJ N;  3MEE A;  3KK1 A;  3O1B A;  4X65 K;  4FCY A;  2O4I A;  3MK6 A;  3E1Y A;  5CZ2 A;  4AIL C;  4CFA A;  3WXK A;  3UIQ A;  3KIO A;  4MDB A;  3S3N A;  3L2U A;  4WCE L;  5LJV A;  4E7J A;  1D9F A;  4BRP A;  3LP3 A;  1NGA A;  1TKD A;  4XH4 A;  3WQT A;  3EN9 A;  4E3S A;  1S22 A;  3VQ7 A;  3SUN A;  2V7Z A;  3ZSZ A;  3T1H K;  2Z1J A;  1JCF A;  3ULE A;  1MU2 A;  2EWS A;  3ZX2 A;  1A5W A;  4CEC A;  3RMD A;  2HVH A;  3THW B;  4GVM A;  4H5T A;  3HVT A;  2NLX A;  4JKE A;  4DQP A;  1IKW A;  1S1T A;  3S3O A;  2E6L A;  4CER A;  4QS8 A;  3U3Y A;  3AVK A;  3CCE N;  1NGH A;  2V52 B;  5IT9 O;  3OYC A;  3P31 A;  3CJB A;  4LH4 A;  1TK0 A;  4M3T A;  2W40 A;  3MWT A;  4AH9 A;  4BVO A;  5GAH P;  4DR7 K;  4F2S A;  4JYA K;  1GLD G;  3FZK A;  3LPT A;  1NK9 A;  2IOC A;  3OYD A;  4QS7 A;  1JL1 A;  4DTO A;  2VG7 A;  4XIU A;  2O8F A;  2HNZ A;  3CXC M;  4BWJ A;  3OYG A;  3ZSX A;  3HYF A;  1BIU A;  3I56 N;  3KLG A;  4CEZ A;  4FVU A;  3P83 D;  2NRH A;  3K9J A;  4BR0 A;  3NH0 A;  4QOZ B;  3CJ7 A;  2O8B B;  2FLO A;  1H1V A;  4Z4G A;  4EFH A;  2D5R A;  3CCR N;  3QDK A;  3OYM A;  1VQ7 N;  3LAN A;  3NF6 A;  4CF0 A;  5AZI B;  4CJF A;  4M3U A;  4E7I A;  1RBV A;  2ZWH A;  1MDU B;  1BWF O;  2KKZ A;  3V9X A;  2BDP A;  4FWK A;  1E4G T;  4KV8 A;  1WSG A;  2P5G A;  3VEY A;  3LPU A;  2ITM A;  4V19 S;  1QZ5 A;  4JK8 A;  3D6R A;  4H0P A;  1P8Z A;  5KRT A;  3KVG A;  1TKZ A;  1RDA A;  1U4B A;  4EHT A;  1LW2 A;  1J9A A;  1K9M O;  1SKS A;  4GVE A;  4JI1 K;  4CES A;  1FXX A;  3CJ1 A;  4J2B A;  1SL2 A;  4GW6 A;  4LFC K;  2P9N A;  3KD5 E;  2OZS A;  5C0Y A;  2WBN A;  1BG3 A;  5FPD A;  4CEQ A;  4BR9 A;  1IO2 A;  1UA0 A;  1Z05 A;  3CFO A;  2O8D B;  4OKE A;  4H03 B;  1QSS A;  4UY8 O;  3A5O C;  3LWL A;  2IC3 A;  4BC3 A;  4FPA A;  1U48 A;  3VGK A;  3VQB A;  1WUA A;  4KH5 A;  1HQU A;  1HMV A;  3VA3 A;  3MN5 A;  4IFE A;  1YIJ N;  3VES A;  2D0C A;  1RT5 A;  3L8B A;  3PO5 A;  1BI4 B;  3MN9 A;  1OH6 A;  4C8O A;  3E9L A;  3VET A;  4FJL A;  5AQU A;  1EET A;  1U2V A;  4DSL A;  4CFB A;  4CJV A;  2VWJ A;  3AO5 A;  1TYQ A;  3NF9 A;  3QEP A;  5TKW A;  1VQO N;  4OKK A;  3MAQ A;  4FK4 A;  2PYL A;  2ZGY A;  4IFV A;  1JCE A;  4Y1C A;  1L3T A;  2VWB A;  4OGC A;  3DLR A;  3KTQ A;  3DLE A;  4J2D A;  1VQN N;  1E3M A;  1ZYQ A;  4GV3 A;  3SAF A;  4CEF A;  1ZXO A;  4KHW A;  3HPH A;  1VSD A;  5AQH A;  5LMU K;  4JKA A;  1QVF M;  1ZBF A;  2HF3 A;  1Q7Y O;  5AQJ A;  3O4N A;  4CFC A;  1QVG M;  2GUI A;  4O8U A;  3VEN A;  3VQ9 A;  3C6U A;  4HUE A;  4BE1 A;  2YKN A;  4B8A B;  4JV5 K;  1N6Q A;  2G8H A;  2HMI A;  2Q0U A;  3TAF A;  3WT0 A;  3VGL A;  2NRX A;  3PUF A;  3VMF B;  1T6D A;  4JNE A;  1T03 A;  4CIE A;  4DU4 A;  4DMN A;  2QK9 A;  3DXK B;  2A1R A;  5AQN A;  3A5M C;  4BRG A;  1TK5 A;  4AHT A;  2GV9 A;  4OKJ A;  2GX9 A;  4IXC A;  4KPY A;  3J81 O;  3A5N C;  3AA3 A;  1BA0 A;  3BY5 A;  1BL3 A;  4BRL A;  3SUQ A;  3RWU A;  4AHU A;  3ENO A;  4W5Q A;  3CQX A;  4IOC L;  5DK5 A;  3LDN A;  1YVN A;  2D0B A;  3U8X A;  4FOE A;  1S1V A;  4O5B A;  2IS3 A;  4DB3 A;  3CIP A;  4WFB L;  1NKE A;  3S9H A;  4M41 A;  3A5L C;  4FJN A;  2FBV A;  5JLF A;  4CZK A;  2A1S A;  4B9S A;  3FZF A;  4CHY A;  3CCS N;  4DQI A;  3OJU A;  2A42 A;  4CCH A;  5E26 A;  2GEL A;  4YFU A;  1OVY A;  2DY4 A;  4CGH A;  1BA1 A;  4CGF A;  5C10 A;  3SQ0 A;  3UB5 A;  4DQQ A;  3C0B A;  3AVJ A;  2ASP A;  3O08 A;  2OZM A;  4BRH A;  1HRH A;  3DLL L;  1T3V A;  4ILJ A;  2P9S A;  4KB1 A;  4DU1 A;  4FJG A;  3CME N;  2P9U A;  3GE1 A;  1LAW A;  5HRS A;  4AM7 A;  4YOW A;  1WSJ A;  2HBJ A;  1NJW A;  4W5N A;  1HX1 A;  4K41 A;  2YCH A;  4CHQ A;  3RRG A;  4B3O A;  4GKJ K;  2RE2 A;  3AVG A;  3E66 A;  3CFR A;  3FZH A;  1DLO A;  4IO9 L;  3CPE A;  2HF4 A;  2HHV A;  3KHY A; 
#chains in the Genus database with same CATH homology
 3I0S A;  1TKT A;  1NJZ A;  4DSF A;  1SKW A;  3NCI A;  3AV9 A;  3SPZ A;  3QO9 A;  1NK8 A;  4FZZ A;  3HT3 A;  2B5J A;  3AVM A;  3QEX A;  2ZQB A;  2RKI A;  1S6P A;  4HTU A;  3AA2 A;  1D8Y A;  4G1Q A;  4RW7 A;  4N47 A;  3LAL A;  3ZSV A;  5CZ1 A;  4I2Q A;  3RMA A;  2QKK A;  4EZ9 A;  3AVH A;  4Q0B A;  2HVI A;  2NUB A;  3NGY A;  4JLH A;  3RMC A;  1KFS A;  1CXU A;  3ZT0 A;  3LP1 A;  3ZT1 A;  3HK2 A;  3CFP A;  4DFP A;  1QE1 A;  4TSX A;  3QEI A;  5J1E A;  3T3F A;  3NH1 A;  3QNN A;  4CHO A;  1TAQ A;  3QIN A;  4QAG A;  5FDL A;  4E7L A;  4KHN A;  4DTS A;  4F8R A;  3AO2 A;  3VQ4 A;  1NK5 A;  4N41 A;  2XO7 A;  1RIL A;  1U45 A;  3DMJ A;  4FW1 A;  3HL8 A;  3F73 A;  4J2E A;  3TAG A;  2P1J A;  3P5J A;  1RTJ A;  4IKF A;  4ZHR A;  3SYZ A;  3PV8 A;  4FM0 A;  1RTH A;  2WON A;  3ZT2 A;  2Y1I A;  1U04 A;  4NYN A;  1GOB A;  1QSL A;  2VWK A;  3JYT A;  4E7K A;  4MFB A;  3KLH A;  3K58 A;  4N5S A;  1K6Y A;  1LAV A;  1LW0 A;  2OPS A;  4H4O A;  3KKR A;  3C95 A;  5HP1 A;  4LD0 A;  3TAE A;  3L2Q A;  4UQG A;  2DTU A;  3G10 A;  2Z1I A;  4LH5 A;  3LP0 A;  4FLX A;  4KFB A;  3ZT3 A;  2HHQ A;  1YT3 A;  2LSN A;  2O4G A;  4RW8 A;  3TAB A;  4CHZ A;  3OYA A;  2HB5 A;  2Z1H A;  3LAK A;  1G15 A;  4IG0 A;  3OYL A;  3V9S A;  1Y97 A;  3S3M A;  1BQN A;  1HNV A;  3AA4 A;  4HCB A;  3ISN C;  4F4K A;  1HPZ A;  1KSP A;  4PY5 A;  2YNF A;  4KKO A;  4DF4 A;  1RTI A;  4OGE A;  4NCG A;  4CJ5 A;  3QEV A;  4C8N A;  4CJL A;  4HUF A;  3LAM A;  4LSL A;  3BDP A;  4KAZ A;  1IKX A;  3ZSW A;  1ASU A;  1RDC A;  1KFD A;  4CF1 A;  3NGZ A;  3D0P A;  3THV A;  2HW3 A;  1HYZ A;  1QSY A;  3FFI A;  1EP4 A;  1WSF A;  3O4Q A;  4IBN A;  4RG8 A;  3L2V A;  4DTU A;  1JXE A;  2WOM A;  2D0A A;  4DFM A;  1ZBU A;  4O44 A;  4BWM A;  5D3G A;  4FLT A;  3CM6 A;  3ZSY A;  1X9W A;  3NFA A;  1UA1 A;  3TAR A;  4IFY A;  2KTQ A;  3AO4 A;  3NAE A;  1UOC A;  5CYQ A;  4CF9 A;  3ULD A;  3PY8 A;  4FJ8 A;  3TI0 A;  4PA1 A;  3VQC A;  2W42 A;  1KLM A;  4EP4 A;  3QET A;  2ITG A;  4DSK A;  1GOA A;  3QES A;  4B8C A;  1VRU A;  3RR7 A;  5J2M A;  1BIZ A;  3HPG A;  3V1O A;  3ASM A;  4E1N A;  1JXB A;  2RF2 A;  3U3G A;  4E1M A;  4DTR A;  3AVC A;  2QXF A;  4GMJ B;  3M8P A;  4CJP A;  4E89 A;  3RRH A;  3V1R A;  2KFZ A;  3KJV A;  1TL1 A;  1X1P A;  3V4I A;  4DG1 A;  1Q9Y A;  3AO1 A;  3AVA A;  3WNG A;  3RTV A;  2Y1J A;  3V9Z A;  3SUP A;  1NKB A;  1QQC A;  4LY7 A;  4FJ9 A;  4FLW A;  3L2R A;  1X9M A;  4CE9 A;  1LWC A;  3RMB A;  4CJ4 A;  3AVN A;  4DF8 A;  1CXQ A;  2X6S A;  4CGI A;  1BQM A;  1REV A;  1HQE A;  5JS1 A;  3G0Z A;  3TAP A;  4FJI A;  4CEB A;  4NCA A;  4FYD A;  1IKV A;  1NK7 A;  5HRO A;  5KI6 A;  2YV0 X;  4OLB A;  1RBR A;  4CJ3 A;  1JLF A;  3HPO A;  4DQS A;  3JSM A;  3K5O A;  1C1B A;  3MEC A;  4FJJ A;  4JS4 A;  4B08 A;  1C6V A;  3MEE A;  1WNS A;  3KKS A;  3KK1 A;  4FCY A;  1ZBH A;  2DFF A;  2ATQ A;  2O4I A;  1RBT A;  4O4G A;  4KHU A;  4DSI A;  4KHQ A;  2QKB A;  3DOK A;  5CZ2 A;  1VSE A;  2OPP A;  4AIL C;  4CFA A;  3ITH A;  4ICL A;  4OVL A;  4WE1 A;  3OS2 A;  4ELU A;  1IH7 A;  4F3O A;  3UIQ A;  4KTQ A;  1FK9 A;  1NOZ A;  1U49 A;  3KIO A;  3MXJ A;  3QNO A;  3PO4 A;  3S3N A;  3L2U A;  4KB0 A;  1VK0 A;  2B6A A;  3SNN A;  2KQ2 A;  3ZSO A;  3TWH A;  3KK2 A;  2AJQ A;  1TKX A;  2IDO A;  2GBZ A;  1IKY A;  4E7J A;  4W5O A;  3NBP A;  4ELV A;  1D9F A;  5FRO A;  3HO1 A;  4RW9 A;  1JL2 A;  4AHC A;  1C1A A;  3ZSQ A;  3LDS A;  3LP3 A;  3IRX A;  4KO0 A;  2G8V A;  1JLE A;  3WNH A;  3ALY A;  1S5J A;  4CHP A;  1S1X A;  4FZX C;  1A5X A;  1TKD A;  2VG5 A;  4DTJ A;  1S9G A;  3V9W A;  2ETJ A;  1U47 A;  3F9K A;  4E3S A;  4CIF A;  5I3U A;  3VQ7 A;  3VQA A;  3QIO A;  5KTQ A;  4Z4C A;  3SUN A;  3DLB A;  3MXI A;  3MXM A;  1ZBI A;  3ZSZ A;  4O0I A;  4AHR A;  1XI1 A;  2Z1J A;  1RDD A;  3HVR A;  1MU2 A;  1ASV A;  4CEC A;  1A5W A;  4FJ5 A;  4I2P A;  3ZT4 A;  3RMD A;  4W5T A;  2HVH A;  3SJJ A;  4GVM A;  1I39 A;  3V9U A;  1A5V A;  3OYE A;  4QCL A;  3HVT A;  4CJK A;  3VQQ A;  4DQP A;  3OYF A;  1IKW A;  1S1T A;  1SUQ A;  3CQ8 A;  2E6L A;  4CER A;  3LWM A;  3S3O A;  4KHS A;  4FJK A;  1C0U A;  4FLU A;  3U3Y A;  3EYZ A;  2XY6 A;  3AVK A;  1KRP A;  1IG9 A;  4O55 A;  1KVA A;  1XWL A;  2HNY A;  2KW4 A;  5HRR A;  3V81 A;  3OS1 A;  4BDZ A;  2F8S A;  1JLB A;  3OYC A;  4OPK A;  2HHS A;  5EU7 A;  1SL1 A;  3HXM A;  4LH4 A;  3O3H A;  1YVU A;  1TK0 A;  4M3T A;  3VQ5 A;  4DFK A;  4AH9 A;  4KRE A;  3BGR A;  1NJY A;  1QHT A;  4DTN A;  4F2S A;  3LPT A;  4CGG A;  3MEG A;  1NK9 A;  2IOC A;  3SV3 A;  3OYD A;  3M8S A;  2Q3S A;  1JL1 A;  1RT2 A;  1Z25 A;  2VG7 A;  4XIU A;  4DTO A;  3V6D A;  1L3S A;  2HNZ A;  3VQ6 A;  4CJW A;  4BWJ A;  3SQ2 A;  2X6N A;  4CHN A;  3ZSX A;  3AVB A;  3HYF A;  3OYG A;  1TAU A;  1BIU A;  3T1A A;  2KFN A;  4FJH A;  3DI6 A;  1KVB A;  4AHS A;  3KLG A;  1HJR A;  4CEZ A;  3B6O A;  3M8Q A;  4DTM A;  4FM2 A;  1WN7 A;  3HP9 A;  1YTA A;  2IAJ A;  3QIP A;  3V1Q A;  3K5N A;  4IDK A;  4ZTJ A;  3P83 D;  4DQR A;  1RT4 A;  1C0T A;  1VSK A;  2B4J A;  3QLH A;  4KTW A;  4CF2 A;  4DFJ A;  4FZY A;  3NH0 A;  3K57 A;  2JLE A;  2XY5 A;  4QOZ B;  1LWE A;  3K5M A;  1BIS A;  1C0M A;  1WAJ A;  4Z4G A;  3SCX A;  2D5R A;  5J2N A;  4FM1 A;  1TVR A;  1KVC A;  3HJF A;  3KLF A;  2BGG A;  3OYM A;  3OYB A;  3SUO A;  3LAN A;  3NF6 A;  3SV4 A;  4DWI A;  4FJM A;  3T19 A;  1VSJ A;  4CF0 A;  4PUO A;  4CEA A;  4CJF A;  1RTD A;  4M3U A;  2R7Y A;  4DSJ A;  4E7I A;  1RBV A;  3B6P A;  3OY9 A;  4RW6 A;  3AVL A;  1KCF A;  1SKR A;  2G8I A;  5I42 A;  3HM9 A;  2X78 A;  4M3W A;  1B92 A;  4Z4E A;  1XHZ A;  2F8T A;  1Q9X A;  1C1C A;  3L2W A;  3V9X A;  2BDP A;  5KRS A;  4DTX A;  3SI6 A;  2G8F A;  2G8W A;  3NF7 A;  1EXQ A;  4DLE A;  4M3Z A;  3ZCM A;  4DLG A;  4B9N A;  4F2R A;  4KV8 A;  4FJ7 A;  1WSG A;  3CM5 A;  4M3Y A;  2P5G A;  2RN2 A;  1NKC A;  3LPU A;  4ID5 A;  3KD1 E;  2FBX A;  1VSF A;  3OYN A;  4Z0U A;  3TAQ A;  1RT7 A;  3IAY A;  5SWM A;  1RT6 A;  5KRT A;  3KLE A;  4BE2 A;  2OA8 A;  1TKZ A;  1RDA A;  2YNH A;  4CGJ A;  4JRQ A;  1U4B A;  1LW2 A;  3WNE A;  2XHB A;  1YTU A;  3OYH A;  1J9A A;  4KTZ A;  4FK2 A;  4ID1 A;  2FBY A;  1SKS A;  1QS4 A;  4CES A;  4YNQ A;  4C8M A;  1FXX A;  3IG1 A;  1D5A A;  4BDY A;  1RT3 A;  5KGW A;  4DU3 A;  4J2B A;  1F21 A;  4M42 A;  1SL2 A;  3DLH A;  3VQE A;  5C24 A;  3DM2 A;  1L3V A;  1ITG A;  4GW6 A;  3P1G A;  3VQ8 A;  4O0J A;  4W5R A;  3KD5 E;  2OZS A;  5JS2 A;  2PY5 A;  3VQP A;  2HHU A;  5J2Q A;  1L5U A;  4EZ6 A;  3WNF A;  3AA5 X;  4CED A;  4CEQ A;  1IO2 A;  2BAN A;  2G8K A;  1NOY A;  4FLY A;  4Q5V A;  1UA0 A;  4M3R A;  1L3U A;  2PZS A;  3CFO A;  4H4M A;  2ZE2 A;  4OKE A;  4N56 A;  1NK4 A;  5KGX A;  1BCO A;  5C25 A;  1B9D A;  1T7P A;  2HHW A;  3MED A;  4KI4 A;  4CFD A;  1TK8 A;  1TV6 A;  1QSS A;  1LV5 A;  4B9T A;  1CZB A;  3TR8 A;  3EZ5 A;  1LWF A;  3TAM A;  3DRS A;  3KLI A;  4CJS A;  3ZSR A;  2OPQ A;  2IC3 A;  3LWL A;  4HVJ A;  1J53 A;  3VN5 A;  5HRN A;  3O3F A;  3QEW A;  4HCC A;  1U48 A;  3AVF A;  3VQB A;  1ZBL A;  3TAN A;  4CK1 A;  2OYQ A;  5J2P A;  1HQU A;  1WAF A;  3SZ2 A;  4CK2 A;  4I7F A;  1HMV A;  1R0A A;  3VA3 A;  1W0H A;  3EY1 A;  2DFE A;  1X9S A;  2D0C A;  1RT5 A;  3L8B A;  3AVI A;  3DLK A;  3PO5 A;  1UWB A;  1BI4 B;  4ZTF A;  4C8O A;  3NH2 A;  4B9L A;  4FVM A;  4Z4I A;  3NHG A;  2XRI A;  1N5Y A;  2F96 A;  1HNI A;  1QTM A;  4FJL A;  4CF8 A;  1EET A;  4NCB A;  4AHV A;  3DRR A;  2OPR A;  2I5J A;  2XY8 A;  4DSL A;  3C94 A;  4CFB A;  4KI6 A;  4CJV A;  2YHB A;  2KZM A;  2KZZ A;  1HYS A;  2VWJ A;  1JLQ A;  1KLN A;  4C8L A;  3AO5 A;  4Z4F A;  3O3G A;  3NF9 A;  4DS5 A;  4M45 A;  1KTQ A;  3QEP A;  1NK6 A;  3C6T A;  4LSN A;  4OKK A;  3MAQ A;  5HLF A;  4FK4 A;  2PYL A;  1EX4 A;  4M3X A;  3L3V A;  4PWD A;  4IFV A;  5DMR A;  1SV5 A;  3DYA A;  1RDB A;  1S6Q A;  3D45 A;  1RNH A;  2E4L A;  1DTT A;  4Y1C A;  1L3T A;  4FJX A;  4OGC A;  3DLR A;  3QER A;  5FRM A;  4OLA A;  3KTQ A;  3DLE A;  4J2D A;  1I3A A;  3IS9 A;  4FW2 A;  5CYM A;  5K14 A;  4CEO A;  4H8K A;  1ZYQ A;  2HHT A;  1Q8I A;  3PX6 A;  2PYJ A;  1TGO A;  3NE6 A;  4CEF A;  4CIG A;  1RCH A;  3M8R A;  4FLV A;  1BHL A;  3HPH A;  2FC0 A;  3OYJ A;  4FLZ A;  1VSD A;  3VA0 A;  4DSE A;  4KHW A;  2HHX A;  1FKO A;  1T8E A;  1ZBF A;  3K59 A;  3O4N A;  1RBS A;  4CFC A;  2DFH A;  1VSH A;  2JGU A;  4CJU A;  2GUI A;  3LZJ A;  3H08 A;  1B9F A;  1GOC A;  3C6U A;  3K2P A;  2YKN A;  3VQ9 A;  4B8A B;  4HUE A;  2ZD1 A;  4BE1 A;  1N6Q A;  4RW4 A;  4CJR A;  2G8H A;  2HMI A;  3TAF A;  1WSI A;  3RR8 A;  4CGD A;  1VSI A;  3L3U A;  4FXD A;  3PUF A;  4E7H A;  5HRP A;  4ELT A;  1VRT A;  2XY7 A;  4OJR A;  2RPI A;  1T03 A;  1WSH A;  4CIE A;  4DU4 A;  3HST B;  4DMN A;  1S1U A;  2QK9 A;  2A1R A;  2G8U A;  1VSM A;  1HYV A;  3I0R A;  1Z26 A;  1TK5 A;  5SZT A;  1J5O A;  4AHT A;  4JRP A;  1JLG A;  3LP2 A;  2GV9 A;  3OS0 A;  4OKJ A;  4MQ3 A;  4KPY A;  3NF8 A;  5HBM A;  4R5P A;  1TL3 A;  1BGX T;  4DS4 A;  3AA3 A;  1JLC A;  3OYI A;  2BE2 A;  1J54 A;  4CJE A;  3NGI A;  1BL3 A;  1EKE A;  4E19 A;  2HND A;  3SUQ A;  3RWU A;  3E01 A;  3KK3 A;  4DTP A;  4AHU A;  4W5Q A;  4E0D A;  3U6F A;  5C42 A;  1VSL A;  5DK5 A;  4Z4H A;  2Z1G A;  2D0B A;  1S1V A;  1RT1 A;  1WLJ A;  4HHT A;  5E41 A;  4OPJ A;  4O5B A;  3SQ1 A;  2IS3 A;  4F3T A;  3VQD A;  4JS5 A;  4HUG A;  4C8K A;  4K8Z A;  1NKE A;  3DRP A;  3S9H A;  2FBT A;  4M41 A;  1T05 A;  1DTQ A;  1D9D A;  5FRN A;  4B9U A;  4FJN A;  1CLQ A;  2FBV A;  4J2A A;  2YNG A;  3LZI A;  1XHX A;  3CG7 A;  3NDK A;  2A1S A;  4Y1D A;  2YKM A;  4B9S A;  4B9M A;  4N76 A;  4CHY A;  4DQI A;  3OJU A;  3PX4 A;  4KHY A;  4CCH A;  3OVN A;  4YFU A;  1S9E A;  1WSE A;  1S1W A;  3SPY A;  2E6M A;  4CGH A;  4L8R B;  2DY4 A;  1O1W A;  4CGF A;  5T7B A;  3SQ0 A;  1FKP A;  3A2F A;  1JKH A;  3OJS A;  4DQQ A;  2EHG A;  2YNI A;  1NK0 A;  4KRF A;  1BCM A;  3AVJ A;  2OZM A;  1HRH A;  2IGI A;  1NJX A;  1W9H A;  1RBU A;  2YHA A;  3CYM A;  4DU1 A;  4FJG A;  4KB1 A;  3AO3 A;  2VG6 A;  3DOL A;  1LAW A;  4IG3 A;  2P51 A;  4BAC A;  3I8D A;  5HRS A;  1ASW A;  1JLA A;  3SQ4 A;  1WSJ A;  1UAX A;  3PX0 A;  3DLG A;  4FK0 A;  4CK3 A;  4CJT A;  1NJW A;  4EP5 A;  1SL0 A;  2P5O A;  4W5N A;  4CHQ A;  5CY4 A;  1CZ9 A;  3RRG A;  4B3O A;  3OYK A;  4BE0 A;  4BDP A;  2X74 A;  3AVG A;  1BI4 A;  4K8X A;  3CFR A;  1XC9 A;  4CJQ A;  3HP6 A;  4B9V A;  1DLO A;  4I9L A;  4PQU A;  2HHV A;  4I9Q A;  4NYF A;  3K5L A;  2EX3 A;  4CEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...