4CJ4A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV INTEGRASE
total genus 54
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cj4A00
2HHWA 3AVLA 4ID5A 3C94A 3LANA 4C8MA 1CXQA 3LAMA 3VN5A 3SV3A 3SCXA 3TI0A 3L3UA 1XHZA 4PUOA 4MFBA 3NCIA 3EY1A 2KFNA 3AO2A 4HCCA 1RTIA 5CYQA 4E0DA 1TV6A 4CJUA 1LWCA 1IKYA 3NAEA 1IG9A 1XWLA 3DLEA 2HHVA 3IG1A 4CK1A 1L3TA 2XY6A 1LW2A 4CJVA 3TR8A 3NF6A 4F3TA 3HYFA 1NK9A 2YHBA 5C42A 4FJJA 1ZBIA 1A5XA 1SL1A 4BE2A 3LAKA 3ZT4A 4DSFA 4DF4A 3OS2A 3HP6A 5HLFA 4FZXC 4DLGA 1U45A 3ISNC 1SKSA 2HB5A 2HHUA 4KPYA 3DI6A 1BI4A 2OPRA 4OVLA 1Z26A 1EP4A 1TK8A 1NKEA 1QHTA 4Z4CA 3NH1A 4FJMA 4KHNA 3G0ZA 4KKOA 4CJFA 2G8KA 1Y97A 3HO1A 3U3GA 3FFIA 3QIOA 4OLBA 3VQEA 3V9UA 2XO7A 4CIEA 4RW8A 4CGDA 4OKKA 1XHXA 3AVCA 2HVHA 1KVCA 3MAQA 4CFDA 3K5NA 1NK7A 4CCHA 1S1TA 4KHWA 4QCLA 3ZCMA 2PYJA 1IO2A 1SKWA 3VQ7A 4CFAA 3DLBA 2HNYA 3QERA 1SKRA 2OPPA 2O4GA 4AHCA 3V9ZA 4CIFA 3ITHA 2BGGA 4CGIA 2FC0A 2HNDA 1WLJA 2ZQBA 4E89A 3U6FA 2VG7A 1X9SA 3O4QA 3QLHA 3SQ0A 2ZD1A 4ELTA 3MEEA 2B5JA 4FM1A 1HYSA 3DMJA 4IG3A 1CZBA 1MU2A 4DFJA 3QESA 1NJWA 4ID1A 4CHYA 4YNQA 4KHUA 2X6SA 4CEOA 4KRFA 4J2EA 2KZZA 1D5AA 3VQ4A 3JYTA 1L3SA 5DK5A 3MXMA 3B6OA 4CF8A 4W5OA 4JS5A 2QKKA 2KW4A 3TABA 3C95A 4O5BA 4RW6A 5KI6A 3OYKA 3KTQA 1BCMA 1TAQA 1KVBA 3KK1A 2BDPA 2NUBA 1RBSA 1ZBLA 4KHYA 5HRPA 4QOZB 1KSPA 2ZE2A 4O4GA 4FJ5A 2D0BA 1C0UA 1LWEA 4FZZA 1U4BA 1NK6A 4FJ7A 3KD1E 1QTMA 4RW7A 2WONA 3MXJA 4FZYA 3PO4A 4B9UA 1CZ9A 3NH0A 2KFZA 4EP4A 4Y1CA 5K14A 3DOKA 3D45A 5JS1A 3L2WA 4DTUA 1NK0A 3SPYA 4CJ3A 3DLHA 3NF7A 2IGIA 1JLGA 4DSLA 1KRPA 1S1UA 3DYAA 4FM2A 1SL0A 3MECA 4FJNA 3AA2A 3AVJA 4ZHRA 3NHGA 4DTMA 4KTWA 1NJXA 4KTZA 4CEBA 1QSLA 3HP9A 4WE1A 5FRNA 2VWJA 1BISA 1WSGA 1LW0A 2B4JA 1QE1A 2VG5A 1WAJA 2XHBA 1SUQA 1KFSA 1RNHA 4IKFA 1WNSA 3RWUA 2KZMA 1C1AA 2JGUA 3LWMA 4M3XA 3RMDA 3ZSYA 3G10A 1U48A 1C6VA 4DMNA 3S3MA 1RDCA 3LPTA 1NK8A 1EETA 4KAZA 3HT3A 5FDLA 4DSEA 2FBYA 5SWMA 4DWIA 1U04A 1VSJA 4W5TA 1JXEA 4E7LA 3V4IA 1TVRA 4ZTJA 1SL2A 3S3NA 2IAJA 4LH5A 4E19A 1X9MA 4FK4A 1HQEA 3VQ9A 4DQPA 1S9EA 3VA0A 1Q9XA 4FYDA 3K57A 1F21A 3QO9A 4AILC 3SNNA 3U3YA 1RT7A 1CLQA 4FJIA 2Y1JA 4OKEA 5HROA 1WSEA 4NYFA 1C1CA 3F9KA 4IFVA 2DFFA 1NKBA 3RR7A 4LD0A 3P5JA 3TAGA 3OJSA 1LAWA 4FLVA 3PV8A 4DSIA 4FJGA 1FKOA 3SJJA 4RW9A 1VSHA 3WNGA 1VSKA 3DOLA 3OY9A 4KO0A 2F96A 2DTUA 1BIZA 3NDKA 3AO4A 4CJRA 1D9DA 3IAYA 4J2AA 3C6TA 1WAFA 4H4MA 3SQ2A 1YVUA 1RILA 1BGXT 4IDKA 1U47A 1YT3A 1I3AA 4CIGA 2HHXA 3M8PA 4DSKA 1ZBHA 1X9WA 1BHLA 3WNHA 5J2PA 5I3UA 1ASVA 4HUGA 4KB0A 1WSJA 4FW1A 4M3TA 1I39A 3ULDA 1T05A 3L3VA 3M8RA 4L8RB 3V81A 4M3RA 4FJLA 4E1NA 5E41A 4HCBA 2ATQA 2XY8A 3HPGA 4NCAA 1LAVA 3AVBA 2YV0X 1RTDA 3K5OA 4CJPA 2Q3SA 1GOAA 3CM6A 5KTQA 4Z4EA 2F8SA 3NGZA 3KK3A 1RT4A 4M42A 3NGYA 3VQ8A 2QK9A 4B08A 3DLRA 3TWHA 3EZ5A 3RMCA 1JLAA 4GMJB 1EX4A 4YFUA 4OJRA 3K5LA 3V1OA 3SPZA 4Z4IA 3VA3A 1TAUA 1T7PA 1BCOA 3QEVA 1D9FA 4M3YA 4BWMA 3AA5X 4CE9A 5J2MA 4DU1A 4AHTA 1C1BA 3OYAA 3THVA 1A5VA 2G8FA 4J2DA 4FJKA 3VQQA 1TKTA 2IDOA 4KFBA 4CECA 4B8AB 1N6QA 4G1QA 4Y1DA 5CY4A 3ALYA 4CHZA 4OPKA 1ZBFA 3AA3A 4CHNA 2PYLA 4BDZA 3SYZA 4JLHA 4F2RA 4B9VA 3LP2A 1KCFA 4JS4A 4F3OA 3RRHA 1GOCA 2DY4A 1NJZA 3HJFA 1BIUA 4FLWA 3AVMA 1L3VA 3I8DA 4CJWA 4PWDA 4I2QA 4KI4A 4KV8A 4O55A 1QS4A 4DTNA 1JL1A 3T19A 3LPUA 4FK2A 4TSXA 1ASUA 3L2RA 3L8BA 4K8XA 2I5JA 3OYNA 1C0TA 3OYHA 2Z1IA 4B9SA 3DLGA 3QIPA 4CGGA 1ZYQA 3ZT0A 4RW4A 4DLEA 3OYBA 4DFKA 4B9NA 2E4LA 4CEDA 3RMAA 3SUQA 3TAFA 2QKBA 1IKWA 4CJLA 1T8EA 1B9DA 3V1QA 1U49A 3NF9A 4M41A 3SV4A 4LY7A 4CEAA 2GBZA 1T03A 1VSLA 4CK2A 3O3GA 3VQCA 1RBTA 4E3SA 2BANA 5KGXA 2Z1GA 4M3WA 3HVTA 4I9LA 1TL1A 5HP1A 3A2FA 2G8HA 1KLMA 3AVKA 1O1WA 4KB1A 3LZJA 4LSLA 1RT5A 1EXQA 4HUFA 3SI6A 3SQ4A 2IS3A 1RT1A 2D0AA 2YKNA 1B92A 4OGCA 1HMVA 3ZSQA 3OYFA 3SQ1A 1HYVA 3L2VA 4DTOA 3PX0A 4EZ6A 4DFMA 3SUNA 4CESA 1S1WA 3T3FA 1RBRA 3LP1A 4O0JA 3ZSRA 3PX6A 4KHSA 1J53A 1ASWA 1HPZA 4K8ZA 3OVNA 2X6NA 3WNEA 5CZ2A 4DS4A 4O44A 1HRHA 3TAMA 1RTJA 3P1GA 4N56A 3OYMA 1LV5A 1L3UA 2G8WA 1KVAA 4FJXA 3M8QA 4IFYA 4CHOA 3V9XA 3ZT3A 1JLBA 3KLFA 4ZTFA 4CF0A 4C8OA 4PA1A 4CJKA 4R5PA 3CQ8A 3VQ6A 3RMBA 3TARA 4DTJA 4CGFA 4KHQA 2EHGA 2Z1JA 3CFPA 1K6YA 5CYMA 3OYIA 2XY7A 3I0RA 3ZSVA 3H08A 3QEWA 1D8YA 1HQUA 3F73A 3HK2A 4W5NA 2E6MA 2HNZA 4E7IA 3K5MA 3MEDA 4M45A 4N76A 4BWJA 1XI1A 1XC9A 1EKEA 3RTVA 3TAQA 5HRNA 4DU3A 4I9QA 1S6PA 3IRXA 3HPHA 2FBTA 3AVHA 4DG1A 4N5SA 4E7JA 1VSEA 4Z0UA 4NCGA 4BDYA 1KTQA 4DQRA 5HRSA 4DS5A 4Z4HA 4DTSA 2P5GA 4CFBA 3V9SA 2RPIA 3NE6A 4B8CA 1KFDA 3ZSOA 2JLEA 3NGIA 4E7HA 1FXXA 2RN2A 5SZTA 4Q5VA 4AHSA 3OYLA 3KJVA 4AHRA 4FLXA 3KLGA 2FBVA 1HJRA 3ZSXA 2YNFA 3KLHA 1TKXA 5J2QA 5KGWA 2LSNA 2G8UA 2P5OA 4B9LA 1FK9A 4B3OA 2F8TA 2HMIA 4CF9A 4C8LA 1IKXA 4OLAA 1C0MA 1L5UA 3AA4A 4DTPA 3QEPA 1VSFA 4CGJA 3AO5A 4Z4GA 5HBMA 4ICLA 5C25A 3SZ2A 1DLOA 3AO3A 3LDSA 4HTUA 4FLUA 4I7FA 2HW3A 4LH4A 3O3FA 4CERA 4N47A 2YHAA 3CYMA 4FVMA 1S1XA 3C6UA 3UIQA 1J5OA 4N41A 2XRIA 1TKZA 3KLIA 2OZSA 1BQMA 4CEEA 1Q9YA 3AVGA 4BE1A 1Q8IA 4DQQA 4E1MA 3TANA 4CJEA 3BDPA 1IH7A 4CHQA 3OS1A 4DQSA 2P1JA 1WN7A 3AVIA 3K58A 4FJHA 1G15A 4F4KA 4BDPA 2VWKA 1JL2A 4OPJA 3AVAA 4C8NA 1W0HA 1R0AA 1JKHA 1UAXA 4FLZA 4W5QA 4DU4A 4CEFA 2XY5A 4EP5A 2E6LA 3OS0A 3ZT1A 1JXBA 4B9TA 3E01A 3K59A 1UOCA 3MEGA 3TAPA 1JLCA 3RRGA 2IC3A 4M3ZA 2G8VA 1RBUA 1Z25A 3EYZA 2PZSA 3CFOA 1REVA 5HRRA 3PUFA 3HXMA 1RBVA 1GOBA 5D3GA 2KTQA 5C24A 3KLEA 2X78A 4CJ5A 3S9HA 2EX3A 3K2PA 1ZBUA 3AVFA 4IG0A 3OYEA 4NCBA 4JRQA 1S9GA 4JRPA 4AH9A 2IOCA 3V6DA 1TK5A 1W9HA 2RF2A 1JLEA 1X1PA 2YNGA 4BACA 5FRMA 4KREA 4CF1A 4DQIA 1QSSA 1IKVA 1LWFA 1TL3A 4DF8A 1B9FA 3L2UA 4CFCA 3AV9A 3LP0A 3HM9A 5I42A 4FW2A 5J2NA 2HHQA 2GUIA 4KI6A 1S6QA 1RT3A 2OA8A 1JLFA 5KRSA 1YTAA 3O3HA 3BGRA 5J1EA 3HL8A 1YTUA 2KQ2A 1VRUA 2X74A 4OKJA 4DFPA 2BE2A 4FM0A 3CG7A 4EZ9A 3ZSWA 1QQCA 3KKSA 4GVMA 1DTTA 4CHPA 1RT6A 3OJUA 4FLYA 3QETA 1NOYA 3DRSA 5T7BA 4M3UA 2D5RA 1RDBA 4HVJA 1S1VA 4CEQA 4CJTA 3KD5E 1BL3A 1DTQA 2DFHA 2B6AA 3O4NA 4CF2A 1UA1A 4ELVA 4Z4FA 2P51A 1J9AA 4DSJA 3KKRA 4MQ3A 3HPOA 3HSTB 1NK5A 1JLQA 4PY5A 4BE0A 3RR8A 1A5WA 3QNOA 1ITGA 3PO5A 2OPQA 3PX4A 2R7YA 2PY5A 4B9MA 1RCHA 3LZIA 2OZMA 3CFRA 2O4IA 3LP3A 1VSMA 3AVNA 1WSFA 4RG8A 1SV5A 3VQDA 3JSMA 5DMRA 1RDAA 1TK0A 1NOZA 4FJ9A 5EU7A 4CK3A 4QAGA 5FROA 3TAEA 5JS2A 4CJ4A 4CEZA 2ITGA 3OYJA 1NJYA 4H4OA 2GV9A 1QSYA 4DTXA 3ASMA 1VSIA 2D0CA 4NYNA 2ETJA 2RKIA 3OYDA 4DTRA 3DRRA 4OGEA 3KK2A 4FCYA 1VK0A 1TGOA 3NH2A 4E7KA 4J2BA 2W42A 3QEXA 2FBXA 2VG6A 3NF8A 3SUOA 3S3OA 4HUEA 1RTHA 2A1RA 4H8KA 1UA0A 4ELUA 3OYCA 3LWLA 3ZSZA 3IS9A 3HVRA 5CZ1A 1TKDA 2YKMA 4KTQA 3DLKA 1CXUA 3LALA 3VQAA 4XIUA 3OYGA 1BQNA 4FLTA 2OYQA 2HVIA 4Q0BA 2Y1IA 1KLNA 1RT2A 3T1AA 4UQGA 4PQUA 4HHTA 1HNVA 4F2SA 1HYZA 3ZT2A 4FK0A 2Z1HA 4I2PA 1J54A 2A1SA 4LSNA 4CJSA 2HHTA 5KRTA 3CM5A 1S5JA 3L2QA 2OPSA 3QINA 4CGHA 3VQPA 1NK4A 3SUPA 3QNNA 4IBNA 4W5RA 3D0PA 1VRTA 2AJQA 3VQBA 4AHVA 3NBPA 3V9WA 2DFEA 1HNIA 3I0SA 4FJ8A 2YNHA 2YNIA 3DRPA 4FXDA 3V1RA 4O0IA 2WOMA 3NFAA 1VSDA 4GW6A 1WSIA 3VQ5A 2G8IA 2HHSA 3DM2A 3M8SA 4C8KA 1FKPA 3MXIA 3PY8A 1BI4B 1WSHA 3B6PA 3KIOA 4CJQA 4F8RA 4AHUA 1N5YA 3P83D 1RDDA 1UWBA 2QXFA 3QEIA 1NKCA 3WNFA 3AO1A
chains in the Genus database with same CATH superfamily
1NU0A 3AVLA 1NGFA 3C94A 5BPMA 1CXQA 3TI0A 3EY1A 3E9PA 3AO2A 3THXA 3DLLL 4E0DA 4IOAL 3NAEA 1XWLA 3DLEA 3MN6A 2FSNA 3QMLA 1VQLN 3QFUA 1X3MA 3DXKA 3TR8A 3HYFA 1NK9A 5C42A 4FJJA 5EX5A 3LAKA 1NGHA 3C6HA 1U45A 5C2DA 1W2BM 4KPYA 4OVLA 1N36K 1NGAA 2W41A 1HUXA 1TK8A 1NKEA 4FJMA 3MX5A 4B1WB 4CI6A 3JAMO 3NVKA 1NG9A 4OLBA 2P9PA 3V9UA 3ZYYX 2Q1NA 3R9PA 1KVCA 3ZEUB 4CCHA 5BREA 1S1TA 2P9NA 4DV0K 4DV7K 4IZ9A 4XH5A 3TTCA 4AM6A 5AZIA 4CIFA 4CGIA 2FC0A 2NRVA 3VTIA 2VG7A 1X9SA 4CD3A 5MLCQ 2ZD1A 4FM1A 2B5JA 3I33A 2A3ZA 4KHPK 1NJWA 3WT0A 4JHDB 4KRFA 1D5AA 5DK5A 2NRZA 4JS5A 3C95A 4RW6A 5AFUA 3WQUA 3HOSA 1BCMA 3KK1A 4LF4K 2ZJPL 3DAWA 4BG8A 4FJ5A 5GAEP 3P4IA 2D0BA 1C0UA 1U4BA 5JVGL 4RW7A 3MXJA 1Q18A 3PO4A 4B9UA 3R8EA 4Y1CA 3DOKA 5I9EB 5JS1A 3M5RA 4CZLA 4DSLA 4I6MB 1VQKN 1S1UA 3VF4A 3AA2A 4ZHRA 3NHGA 4DTMA 4KTWA 4BRKA 4CEBA 4WE1A 1WSGA 5C2FA 1QE1A 2VG5A 2VGMA 4NXNK 1WNSA 1NNEA 5FPNA 3RMDA 3G10A 3U9ZA 3G71N 1NK8A 1EETA 5GAGP 4W5TA 4B9NA 1TVRA 4ZTJA 5ELZA 4NXMK 3VQ9A 4DQPA 4QS8A 1Q9XA 1F21A 1CLQA 4FJIA 3CQYA 1QVFM 1WSEA 4NYFA 3RR7A 4JKDA 3TSUA 3KVGA 4FLVA 3FR0A 5HL7L 3SJJA 3UKRA 1VSKA 3OY9A 2DTUA 4QS9A 4E1JA 1QQNA 3C6TA 3T69A 1YVUA 1BGXT 1YT3A 2HHXA 3M8PA 2A6AA 4DSKA 1X9WA 3WNHA 1ASVA 1TUYA 1WSJA 1GLBG 4JI6K 2O8EA 3VOVA 3ULDA 3M8RA 3C6AA 3C7NA 3MN7A 4M3RA 1V4TA 2OCEA 4JHDA 5LL6Z 4HCBA 3CC7N 3HPGA 4C1NK 4PL7A 1LAVA 3EKSA 1RTDA 1GOAA 2CGJA 3CM6A 5F2RA 5KTQA 2F8SA 2W40A 2QWNA 3PSIA 4B08A 4IO9L 5TKYA 3SAGA 3RMCA 1YJWN 1JLAA 4GMJB 4H03B 4OJRA 3AY9A 2Q0UA 3QEVA 3AA5X 1VQMN 3H46O 4FSVA 4DU1A 3O6WA 1ZC6A 3THVA 1TKTA 3PIOL 1WOQA 1N6QA 4LFAK 3ALYA 2P9KB 4JKBA 3SYZA 1KCFA 4JS4A 1QQOA 4BR5A 4F3OA 1BIUA 4FLWA 2WUSA 3UKUB 3O8MA 5BRHA 4O55A 4DTNA 3BZKA 3L2RA 3OYNA 3QICA 2OTLN 3E66A 4CZIA 3DLGA 1ZYQA 5B8HA 3ZT0A 2D0PA 4DLEA 4DFKA 3RMAA 3J7YP 3KWIA 4GV9A 5AQZA 2QKBA 1IKWA 3V1QA 1U49A 3NF9A 4A2AA 3VETA 3WXMB 2FF6A 1RBTA 4FWLA 4E3SA 4M3WA 3HVTA 4I9LA 1NMNA 3A2FA 1O1WA 1VQPN 4H5NA 5EXWA 2GTDA 5IT9O 3LZJA 2WFBA 3SI6A 1KAYA 2IS3A 4EAHD 3OYFA 3SQ4A 1BUPA 3L2VA 4DTOA 3H3OB 1MA9B 3SUNA 1ATSA 1RBRA 3ZSRA 3J81O 4U67L 4BRMA 1ASWA 3WNEA 4DS4A 2P9IB 4O44A 1RTJA 3OYMA 1LV5A 4YOYA 1JCFA 1NGBA 3F2KA 4FJXA 3HM8A 4J2EA 4ZTFA 1M1KO 4JKHA 4PA1A 4CJKA 1XC3A 1TUUA 4WQ5C 4JAXA 4QS7A 3Q7CA 2VCPA 2Z1JA 5CYMA 3T7ZA 3OYIA 3QEWA 1OKJA 1D8YA 4FWPA 3WXJA 4M45A 4JN4A 4DG1A 4U7BA 5LJWA 3WUHA 1VSEA 4BRFA 3GOIA 4I6MA 4DQRA 2RPIA 4BC5A 4M7XA 1NLVA 2F7TA 3KLGA 3KLHA 2G8UA 5KGWA 4A61A 1FK9A 3WEEA 4DV3K 4FPBA 2F8TA 4DR4K 4CF9A 4C8LA 5M1KA 1C0MA 4B3MK 3QEPA 4LC9B 5AZJB 5C25A 1K9MO 3EKUA 1DLOA 1NGCA 3BP8A 4I7FA 4CERA 1MWKA 4BQZA 2YHAA 1OH6A 3CETA 3C6UA 3UIQA 1KAXA 1J5OA 2AA4A 1TKZA 3KLIA 2OZSA 1BQMA 1NM1A 4BRCA 4H5TA 4Y0WA 4CJEA 3BDPA 3FZKA 3AVIA 2PBDA 4JK7A 4F4KA 3LL3A 2VWKA 3L4QA 2HBLA 2GELA 1R0AA 1JKHA 1UAXA 4DU4A 1HKGA 2UXDK 4EP5A 3ZT1A 1JXBA 3SK3A 4CZFA 1VQON 3E01A 1DKGD 1Q7YO 4M3ZA 2E8AA 3HSCA 1RBUA 4K0KK 4JYAK 1HKBA 3HXMA 5IWAK 1RBVA 1Z05A 1GOBA 5D3GA 5C24A 5GADP 4MO4A 2V7ZA 4CJ5A 4NCBA 4JRQA 3VESA 4JRPA 4BRHA 1W9HA 1X1PA 4H5WA 5AQLA 2QW9A 4CF1A 3N4QA 1EQYA 2O8BB 3HM9A 3CCRN 5I42A 2HHQA 5LJVA 1RT3A 5AFUH 4BGAA 3AAPA 4ILHA 4BROA 2Q0RA 3HL8A 1YTUA 4YDUC 4EZ9A 1QQCA 4FLYA 5FPDA 4CHPA 4DCHA 3DJCA 3OBYA 1RDBA 2YJEA 1BL3A 4CF2A 2B6AA 3VGLA 1UA1A 4DSJA 1NK5A 1JLQA 5C15A 2H3GX 3RR8A 3CCJN 3QNOA 3VEOA 4X65K 2PY5A 4B9MA 1OH7A 3LZIA 2OZMA 3MMVA 4OO1J 1RDAA 1YJ9N 3CERA 4FWQA 1VSIA 2D0CA 4LF6K 3CXCM 1GLJO 3DRRA 4H0VB 4FO0A 2W42A 2FBXA 4DKWA 1VQ5N 3KZBA 3SUOA 1GLLO 4HUEA 1UA0A 3ZSZA 5CZ1A 4C1NI 4DV5K 4KTQA 3DXKB 4B3RK 2HVIA 1IV0A 4Q0BA 4BRDA 1KLNA 4H5RA 3LDPA 3T1AA 4UQGA 4HHTA 5BR9A 1HYZA 3P39A 3ZT2A 2Z1HA 2O8DA 4I2PA 2A1SA 4LSNA 3CM5A 1S5JA 4GV3A 4CGHA 3QINA 3VQPA 3VEWA 3CQXA 4W5RA 2GWJA 3D0PA 1DT9A 3VQBA 3V9WA 3NBPA 1HNIA 4BR7A 2YNHA 3DRPA 4GW6A 3R3LA 3M8SA 4DUZK 3PY8A 1BI4B 1WSHA 2E20A 2NRHA 3B6PA 3KIOA 3CMAN 1U2VB 2QXFA 4LFCK 1NKCA 2QWPA 4LF9K 4ID5A 1XHZA 3VN5A 3SCXA 4PUOA 3L3UA 3NCIA 2KFNA 3VPZA 1IG9A 1JCGA 1VAZA 2HHVA 4BREA 1LW2A 3CCLN 4GNIA 2QWLA 4FOIA 2UXBK 1A5XA 1SL1A 4GVEA 4BR4A 3TPQA 3OS2A 2FSKA 4DF4A 4DLGA 4OPHA 1QHAA 1D4XA 1EP4A 4V19S 1QHTA 4Z4CA 1NWKA 3H1QA 1Y97A 1SAZA 3QIOA 3CJBA 4A5AA 3VQEA 2XO7A 4CIEA 4RW8A 4CGDA 4CFDA 3K5NA 1NK7A 4KHWA 3LDOA 2PYJA 5A2QO 4CW7B 2OPPA 2QM1A 3ITHA 2ZQBA 3SAFA 3U6FA 4XH4A 3O4QA 3SQ0A 3MEEA 2Q2RA 1MU2A 1ZBSA 3A5OC 3LDNA 3ATVA 5AQXA 2X6SA 2GWKA 4CEOA 2KZZA 4CF8A 3P38A 4BRAA 2UYTA 1TAQA 2NUBA 4BC3A 2ZE2A 4O4GA 1NK6A 3KD1E 1WUAA 4B3TK 1QTMA 3NMUA 4FZYA 1YAGA 1S3XA 2A5XA 3NH0A 4EP4A 3MWPA 4DV4K 4WCEL 5FLXO 5BR8K 2VWBA 1NK0A 3DLHA 3Q7BA 4CJ3A 1DGKN 3NF7A 4GV6A 3ZEUA 5AQOA 4FM2A 1SL0A 3AVJA 4FWMA 4KTZA 1QSLA 4C23A 3HP9A 4H0XB 1BISA 2B4JA 3H3NO 5M1NA 1WAJA 4EHUA 1BOTO 1RFQA 1KFSA 2JGUA 1XNQK 1U48A 1C6VA 3LPTA 3CHWA 3O9SA 3HT3A 5FDLA 4DWIA 4DUYK 3V4IA 4E7LA 2HF3A 1SL2A 4LH5A 1X9MA 4FK4A 4B1ZA 1GLCG 4M63C 2HHHK 5ADXA 4AILC 1O13A 4OKEA 4DR2K 5HROA 1C1CA 2PAVA 1HNWK 1YITN 2DFFA 4CZEA 1FKOA 1BWFO 3DOLA 4KO0A 2F96A 4YOXA 3IAYA 4J2AA 4CJRA 3P31A 3THXB 4H4MA 4CJ7A 3ENHA 1BHLA 3EE8A 5J2PA 2QI2A 4HUGA 4KB0A 1I39A 3CCQN 1T05A 4L8RB 4E1NA 5E41A 2Q36A 3K5OA 4CJPA 3CJ9A 3K0SA 2D1KA 1RT4A 4NO7A 2QK9A 5TKWA 3A0IX 3SPZA 4IOXA 3VA3A 1T7PA 1RDWX 2E2QA 4WFBL 3VEZA 4JI8K 3W3DA 4B8AB 4CECA 4Y1DA 5CY4A 4OPKA 3AA3A 2PYLA 4BDZA 4JLHA 4F2RA 4JI4K 3CCSN 1NJZA 3HJFA 3L4IA 4I2QA 4KV8A 1QS4A 4CBWA 4FK2A 1ASUA 4K8XA 5AQPA 3VGKA 3MCPA 3QIPA 2BUPA 3TAFA 3J7AP 2UXCK 4BRQA 1B9DA 4M41A 3SV4A 4CEAA 1VSLA 4MLEA 2E1ZA 1TL1A 5HP1A 4DR5K 1IG8A 4BVPA 1KLMA 4KB1A 5M1FA 4GKKK 4LSLA 2D0AA 2YKNA 4OGCA 1HMVA 5E26A 1HYVA 3PX0A 2QXLA 1S1WA 4O0JA 3PX6A 4WQ4A 4KHSA 3J80O 1HPZA 2F9TA 5LY3A 1HRHA 4PKGA 4N56A 1L3UA 5AQWA 3V9XA 4C8OA 1JLBA 4H0YB 3MCAB 3VQ6A 2WC9A 4FWKA 4CGFA 4K43A 2EHGA 4KHQA 3PIPL 3ZSVA 3H08A 3MN9A 1HQUA 3HK2A 4RTFD 4E7IA 3K5MA 1EKEA 3RTVA 3TAQA 1P8ZA 4IWVA 4RCHA 4ISGA 2FBTA 3O1WA 4E7JA 5KPZA 1NGJA 4BDYA 5HRSA 4DTSA 2P5GA 4CFBA 3V9SA 1C0GA 4B8CA 3DXMB 4E7HA 4FJGA 3KJVA 3OYLA 1LCUA 1E4GT 4A57A 1MWMA 1XUPO 2HMIA 4YORA 5M1PA 2I7NA 4DR6K 4OLAA 3AA4A 4DTPA 3D2EB 1BDGA 2CH6A 2KHOA 4ICLA 5HBMA 3S41A 3SZ2A 4Z4GA 3AO3A 3ATUA 3LDSA 4FLUA 4LH4A 4N47A 3CYMA 3CC2N 2HMPA 4CEEA 4WFNL 3AVGA 3TANA 3O08A 2A40A 4BR9A 5AQNA 4DQSA 4CHQA 1WN7A 3K58A 4DB3A 2P9LA 3AVAA 4C8NA 4W5QA 2XY5A 2E6LA 4BQLA 3TAPA 5AQTA 1Q86O 5BN8A 2G8VA 3SMPA 1REVA 3DXMA 2KTQA 1V4SA 2ASOA 3S9HA 2EX3A 5AQFA 4DHYA 1S9GA 4AH9A 3EN9A 3ID8A 2Q97A 2RF2A 4WQ5A 5FRMA 3R1XA 4KREA 2D0OA 4DF8A 3L2UA 3LP0A 2GUIA 4WYBA 1S6QA 2D4WA 4JI0K 2YCHA 3O3HA 1YJNN 3D7EO 3VEYA 1VRUA 4OKJA 2BE2A 3ZSWA 3KKSA 4GVMA 1DTTA 3DRSA 5T7BA 4M3UA 2D5RA 3RSEA 1S1VA 4CEQA 3KD5E 3O4NA 1WBBA 4Z4FA 3IUCA 2P51A 4JK9A 3KKRA 4PY5A 1K8AO 5AR0A 2CGKA 3PO5A 5GINA 3PX4A 2V52B 4G9ZA 1NBWA 2O4IA 3SMSA 3JSMA 3AVNA 5EVZA 4RG8A 1NOZA 3VF6A 5FROA 5JLFA 1JJ2M 4CEZA 4CJ4A 4BR0A 3D2FB 1NJYA 4H4OA 4NYNA 1T6CA 5C12A 2UUCK 4E7KA 4J2BA 3ZX2A 3M3ZA 3A5NC 3EL2A 3NF8A 1RTHA 2A1RA 4X66K 4H8KA 5AQGA 3VGMA 5DM7L 2NRTA 3FFKB 3OYCA 2P9UA 3LALA 2KLAA 2QTDA 2Y1IA 1RT2A 1Q82O 1EWRA 4PQUA 2OTJN 4CZHA 3THYA 2O8FA 4JKEA 2HHTA 4JKGB 5EY4A 4B1YB 3L2QA 2QWQA 4O8UA 5LMNK 3SUPA 3IDHA 1VRTA 2AJQA 5KQ8A 2P9LB 2WOMA 1NGEA 1VSDA 3NFAA 1WSIA 3O4WA 2HHSA 1FKPA 2BH1A 3MXIA 4IJAA 3QEIA 3RRHA 2BTFA 4XH1A 2HHWA 2UUBK 2QWOA 4B1XB 3SJHA 4C8MA 3HI0A 4MFBA 1RTIA 1TV6A 1LWCA 4IJNA 1N8RO 1MDUB 4A2BA 1X9JA 1ZXOA 1L3TA 2XY6A 1Y64A 1KXPA 1HR0K 3FZFA 3NF6A 2OANA 4F3TA 1ZBIA 3ZT4A 5HLFA 4FZXC 3VEVA 1SKSA 2HB5A 3IKMA 1T3VA 3DI6A 3WXIA 4NLCA 5AQSA 3O9RA 5BRDA 3NH1A 1P90A 4KKOA 2CH5A 4FVUA 2G8KA 3HO1A 3U3GA 4BRLA 4MDAA 5ADXH 4KBOA 1VQNN 3I8BA 4FOEA 3OA9A 4LFBK 4FWRA 4OKKA 2HVHA 3MAQA 4BGBA 4A5BA 4QCLA 2O8EB 3ZCMA 3VQ7A 2HNYA 3QERA 4AHCA 3O9QA 3V9ZA 4EHTA 2BGGA 3K9KA 2E2PA 5DM6L 4ELTA 2YJFA 4IG3A 1CZBA 3KWGA 4ILJA 4CBXA 4ID1A 4CHYA 3VQ4A 3JYTA 3FZLA 2HOEA 1LOTB 2KW4A 3EO3A 5KI6A 3OYKA 1CZAN 4JK8A 3CCMN 2BDPA 4J8FA 4KHYA 5HRPA 4QOZB 3U8XA 4CZKA 3AAQA 2QA4N 1T44A 2YHYA 5F0XA 4FJ7A 1TYQB 3MK6A 4CZGA 2KFZA 3CPWM 3LDLA 1KQSM 5K14A 3SPYA 2IGIA 1JLGA 3DYAA 3GL1A 4JKAA 1GLFO 2E5LK 1HNXK 5FRNA 4B1VA 2VWJA 3CPEA 1SUQA 3R6MA 1RNHA 4RWTA 3LWMA 3FE1A 3ZSYA 4PL8A 2DPNA 3S3MA 1RDCA 1WB9A 1U04A 1VSJA 1RGIA 2IAJA 4E19A 3ZETA 3O9UA 1ATRA 5AQRA 3VA0A 3K57A 3QO9A 3SNNA 3ENBA 1RT7A 2IVPA 4IFVA 1U2VA 4LD0A 3OJSA 3CJCA 4DSIA 3CI5A 4RW9A 1R59O 3WNGA 1T6DA 3NDKA 1D9DA 1WAFA 2KKZA 4IDKA 1U47A 1YVNA 1I3AA 4CIGA 2FLOA 3F9MA 5I3UA 4M3TA 1Z6RA 4KH5A 4K41A 1SQKA 3QDKA 3V81A 1E3MA 4FJLA 4DQ8A 2F9WA 4NCAA 3AVBA 3ID6A 4Z4EA 2Q3SA 4JV5K 3NGZA 4M42A 3I55N 3NGYA 4CBUA 4ISEA 4IEEA 3CIPA 4A62A 4YDUA 3EZ5A 3IFRA 4YFUA 4Z4IA 3V1OA 1TAUA 4BWMA 3GE1A 5J2MA 3L6QA 2G8FA 1A5VA 4J2DA 5F1XA 4FJKA 3VQQA 2IDOA 4KFBA 2E2NA 3HOTA 4G1QA 3D6RA 4CHZA 4CHNA 3THWA 1GOCA 1HX1A 4PKIA 4LF5K 2DY4A 4BRGA 1L3VA 3I8DA 3GG4A 3BY5A 5JICA 5JLHA 4GKJK 3T19A 3LPUA 3L8BA 2I5JA 1C0TA 3OYHA 3VERA 2ZJRL 1M90O 2Z1IA 3BUZB 4CGGA 4DR3K 4XEIA 4HWIA 4RW4A 2E4LA 4CEDA 4B3SK 2IVOA 5GAHP 4CJLA 1T8EA 4B9QA 3CJ7A 2GBZA 1N33K 4CK2A 4M7YA 1IBMK 2BANA 2P9KA 4FWOA 2PFUA 3M1FA 4DV2K 3G4SN 4FPAA 1EXQA 4HUFA 4JD2A 3ZSQA 2V7YA 4OPAA 4DFMA 4CESA 3T3FA 3SAHA 4K8ZA 3OVNA 2UUAK 3P1GA 4FL9A 3FZHA 1KVAA 1XMQK 1IBKK 4IFYA 3F5TA 4CHOA 4CF0A 3CQ8A 2O8FB 1YIJN 5E84A 4JNEA 4PHTX 4JI5K 3RMBA 5BPNA 3TARA 2WBNA 3H1VX 3LM2A 3G6EN 3CFPA 1K6YA 2XY7A 2ZGYA 3I0RA 3F73A 1OH5A 3DWLA 4BWJA 1XI1A 5HRNA 4I9QA 3HPHA 4BG9A 4H0TB 5LMUK 4Z0UA 3TU5A 3CF5L 1KTQA 1DEJA 5HOOA 4Z4HA 4YOTA 4H0PA 4JI1K 3ZSOA 3C0BA 5SZTA 4FLXA 4AHSA 1WBDA 1TKXA 3RSEB 4B9LA 2O8DB 3BEXA 3LDQA 2WTUA 3A5LC 4B3OA 3AGRA 2VQFK 3H6EA 4EIAA 1IKXA 3IMXA 3AO5A 1HLUA 4DR1K 3SBTA 2HW3A 3GDQA 4FVMA 1S1XA 3J7ZO 3K9JA 1HPMA 4BE1A 1Q8IA 4DQQA 4DV1K 2HBMA 1KC8O 4H5VA 2P1JA 4AF1A 4BDPA 4OPJA 1W0HA 4FLZA 1J6ZA 1W7AA 4JI7K 4B9TA 3MEGA 1JLCA 3O1BA 3RRGA 1EWQA 3O5BA 1K73O 3PUFA 1ATNA 3PLAA 1EO1A 3CJAA 4AQYK 4IG0A 3HRGA 1GLAG 1BA1A 2IOCA 3V6DA 1TK5A 1JLEA 2YNGA 1BA0A 1QSSA 1IKVA 1LWFA 1TL3A 1B9FA 1KD1O 3AV9A 4IXCA 4FW2A 4KI6A 5KRSA 1YTAA 3BGRA 2KQ2A 2X74A 4DFPA 3BZCA 4EFHA 1NOYA 4MDBA 4ELVA 4FXDA 3FZMA 4YHHK 3O80A 3HPOA 1ITGA 2OPQA 1HNZK 2R7YA 1RCHA 3D2EA 3UKUA 3QBXA 2W6LA 5JVHL 4BR2A 3CFRA 2NZTA 1WSFA 1SV5A 1NMDA 1TK0A 4FJ9A 5EU7A 3TAEA 3EEQA 5JS2A 3OYJA 2GV9A 1QSYA 3ASMA 2ETJA 5AQYA 1SS6A 1S72N 4OGEA 3KK2A 1TGOA 5M1OA 3NH2A 4OX9K 1VQ9N 3S3OA 1KAZA 3HVRA 2YHWA 3THWB 4CVNE 3J8AA 3C65A 4JKCA 1CXUA 3OYGA 4FLTA 2OYQA 1YXQA 1VQ8N 2E88A 4X62K 3WEEB 4FK0A 3MX2A 1J54A 5C0YA 3D2FA 4X64K 4IFEA 2A42A 2OPSA 2W6KA 4IBNA 3OHRA 4AHVA 4FJ8A 3I0SA 2QWRA 3W0LA 5KPRA 3V1RA 4O0IA 3RVCA 3VQ5A 4YOVA 4NB4A 3ZX0A 4C8KA 3ULEB 4KH4A 1OVYA 3ENOA 2FSJA 4CJQA 1S22A 3P83D 4WFAL 1RDDA 5CE3A 1G99A 2GX9A 2NRWA 5FPMA 2NRXA 3AO1A 2NLXA 2RE2A 2QWMA 3LANA 4M3XA 3LAMA 3SV3A 1Q81O 3M6GA 3ZLJA 4HCCA 5CYQA 2ITMA 4CJUA 1IKYA 1JCEA 1XQSC 3IG1A 4IOCL 4CK1A 4CJVA 3H45C 2P9IA 1YF5L 2YHBA 4BE2A 4DSFA 3HP6A 2YI1A 1FW6A 3PSFA 3ISNC 2HHUA 1BI4A 4K25A 2OPRA 1Z26A 5AZJA 3G0ZA 5H1SQ 2F4VK 2ZF5O 4CJFA 3FFIA 4IDHA 3WQTA 4WQ4C 3SBGA 1HKCA 1XHXA 3AVCA 3BF3A 1IO2A 1SKWA 4CFAA 3DLBA 1SKRA 2Q31A 2O4GA 4L3QA 1K8KB 2JWKA 2IIRA 4HTLA 2HNDA 1WLJA 3HTVA 4E89A 1GLDG 3AGKA 3QLHA 3O9TA 1HYSA 3DMJA 5BPLA 4DFJA 3QESA 3JS6A 4YNQA 4KHUA 2NNWA 1L3SA 3MXMA 3B6OA 4W5OA 2QKKA 3TABA 4O5BA 3KTQA 1KVBA 1X3NA 1RBSA 1ZBLA 2ZM6K 1KSPA 5KQDA 1BU6O 3HBTA 1LWEA 4FZZA 2P9SA 2WONA 4F9OA 1CZ9A 3TSPA 4B1UB 2A41A 2HF4A 3D45A 3MDQA 4MLHA 3L2WA 4DTUA 2I7PA 1KRPA 3MECA 4FJNA 1NJXA 3QFPA 1LW0A 1VHXA 2XHBA 4IKFA 3RWUA 2KZMA 1C1AA 4JKGA 4DMNA 4DSEA 2FBYA 5SWMA 3LM9A 4O8KA 1JXEA 3S3NA 1HQEA 1S9EA 4GY2B 1QVGM 4FYDA 3U3YA 3CC4N 2Y1JA 1H1VA 3F9KA 1NKBA 3P5JA 4UY8O 4PKHA 3TAGA 1LAWA 4BRNA 3PV8A 5AQVA 1VSHA 4LF7K 4FWSA 5AQIA 5GIOA 1BIZA 3AO4A 3VTHA 3TSQA 3SQ2A 2E1YA 1RILA 1ZBHA 4IO8A 4R79A 4FW1A 1BO5O 4BC4A 3HZ6A 4DR7K 3L3VA 4CZJA 5AQJA 1QQMA 2ATQA 3CCUN 2XY8A 3G25A 2YV0X 2VQEK 4WF9L 4FWNA 3UE5A 3KK3A 3VQ8A 5JMVA 3DLRA 3TWHA 4DV6K 1EX4A 3ZETB 3K5LA 3KHYA 1BCOA 1D9FA 4M3YA 4BRPA 4CE9A 2GUPA 4AHTA 1C1BA 3OYAA 2QEXN 2FF3B 3UB5A 5GIPA 1ZBFA 2CGLA 4B9VA 3LP2A 1IBLK 3I56N 1NJIO 3AVMA 3AARA 4CJWA 4PWDA 4KI4A 2VYPA 1JL1A 4TSXA 3OW2M 5KPTA 5AQKA 4LF8K 4B9SA 2VGNA 3OYBA 4BC2A 3SUQA 1QZ6A 3U4LA 2P9PB 4A59A 4LY7A 3WXLA 1T03A 2ZWHA 4NLBA 3EE9A 3O3GA 3VQCA 5KGXA 2Z1GA 5AQMA 3TTDA 2G8HA 3AVKA 1RT5A 1RT1A 3E9LA 1B92A 3T1HK 3SQ1A 1N34K 4EZ6A 3VF2A 3LP1A 1J53A 3VENA 2X6NA 5CZ2A 3TAMA 1ILYA 4YOUA 2G8WA 3N4PA 5AZIB 5M1QA 3M8QA 4KHNA 3ZT3A 2ASPA 3KLFA 1NGDA 4R5PA 2UU9K 4JKFA 2EWSA 4DTJA 4YY3K 1VQ7N 4W5NA 5AQQA 2E6MA 2HNZA 3MEDA 4N76A 1XC9A 5AJ3K 4DU3A 1S6PA 5FPEA 3IRXA 3AVHA 4H0OA 4N5SA 3MWTA 3L0QA 4NCGA 4ISFA 4DS5A 4YOWA 3NE6A 5AQUA 1KFDA 4Z94A 3A5MC 2JLEA 2HBJA 3NGIA 1FXXA 2RN2A 2HSTA 3MN5A 2E2OA 4Q5VA 4BY9C 4AHRA 4KAZA 2FBVA 1HJRA 3ZSXA 2YNFA 5J2QA 2P5OA 2LSNA 3GBTA 2AP1A 1YUWA 2NRRA 3FGUA 1L5UA 2YHXA 1VSFA 1N32K 4CGJA 1XMOK 4HTUA 2GEMA 3O3FA 2O8BA 1XNRK 3SLCA 1YI2N 5BRFA 1U6ZA 4N41A 2XRIA 2P9UB 1Q9YA 2P9SB 4E1MA 3UKRB 1IH7A 4CZMA 3OS1A 4FJHA 1G15A 3OBWA 3JXUA 1JL2A 5AQHA 5CHIA 3THYB 1K8KA 1NGGA 2RHKA 4CEFA 2V51B 3OS0A 4BRIA 3K59A 1UOCA 2IC3A 1ESVA 1Z25A 3EYZA 2PZSA 3CFOA 5HRRA 3VEXA 1YHQN 3WXKA 3KLEA 2X78A 3K2PA 1ZBUA 3AVFA 3CCVN 3OYEA 2IVNA 3C7NB 4BACA 5C10A 3A8YA 1FJGK 4DQIA 4CFCA 4AM7A 5J2NA 1QZ5A 1IJJA 1I94K 2OA8A 4KH6A 1JLFA 4BVOA 5J1EA 3QBWA 2ZJQL 4FM0A 1TYQA 3CG7A 3QETA 1RT6A 3OJUA 3QB0A 4HVJA 2ZGZA 4CJTA 3FLCO 1DTQA 2DFHA 3BF1A 4JI3K 1J9AA 4MQ3A 3HSTB 4O5FA 2O8CA 4BE0A 1E4FT 3VMFB 1A5WA 4ILGB 2YX6A 2O8CB 3U9DA 1HJOA 1BG3A 3E1YA 4IEIA 3LP3A 1VSMA 3VQDA 5EOYA 5DMRA 3ULEA 1W97L 1SZ2A 4CK3A 3B8AX 2ITGA 1VQ6N 4DTXA 1RDUA 2RKIA 3OYDA 4DTRA 4FCYA 1VK0A 3E9OA 1J5EK 4JI2K 1C0FA 4MO5A 1OVQA 3QEXA 2VG6A 4ELUA 3NVMA 5BN9A 3LWLA 3IS9A 2JWLA 1TKDA 2YKMA 1NGIA 3DLKA 3CCEN 3VQAA 4XIUA 2ASMA 1BQNA 5CR4A 4JD2B 1HNVA 4F2SA 4CD1A 2HBKA 3CMEN 2J4RA 4CJSA 5KRTA 1NK4A 3QNNA 3TTFA 3CJ1A 3OTOK 1OH8A 4JEPA 1GLEG 1VQ4N 3T1YK 2DFEA 2FXUA 2YNIA 3CD6N 4K42A 2G8IA 3EZWA 3DM2A 3ZX3A 3KK7A 4F8RA 4AHUA 1N5YA 1UWBA 3WNFA 2P9NB 4QAGA
chains in the Genus database with same CATH topology
2HHWA 3AVLA 4ID5A 3C94A 3LANA 4C8MA 1CXQA 3LAMA 3VN5A 3SV3A 3SCXA 3TI0A 3L3UA 1XHZA 4PUOA 4MFBA 3NCIA 3EY1A 2KFNA 3AO2A 4HCCA 1RTIA 5CYQA 4E0DA 1TV6A 4CJUA 1LWCA 1IKYA 3NAEA 1IG9A 1XWLA 3DLEA 2HHVA 3IG1A 4CK1A 1L3TA 2XY6A 1LW2A 4CJVA 3TR8A 3NF6A 4F3TA 3HYFA 1NK9A 2YHBA 5C42A 4FJJA 1ZBIA 1A5XA 1SL1A 4BE2A 3LAKA 3ZT4A 4DSFA 4DF4A 3OS2A 3HP6A 5HLFA 4FZXC 4DLGA 1U45A 3ISNC 1SKSA 2HB5A 2HHUA 4KPYA 3DI6A 1BI4A 2OPRA 4OVLA 1Z26A 1EP4A 1TK8A 1NKEA 1QHTA 4Z4CA 3NH1A 4FJMA 4KHNA 3G0ZA 4KKOA 4CJFA 2G8KA 1Y97A 3HO1A 3U3GA 3FFIA 3QIOA 4OLBA 3VQEA 3V9UA 2XO7A 4CIEA 4RW8A 4CGDA 4OKKA 1XHXA 3AVCA 2HVHA 1KVCA 3MAQA 4CFDA 3K5NA 1NK7A 4CCHA 1S1TA 4KHWA 4QCLA 3ZCMA 2PYJA 1IO2A 1SKWA 3VQ7A 4CFAA 3DLBA 2HNYA 3QERA 1SKRA 2OPPA 2O4GA 4AHCA 3V9ZA 4CIFA 3ITHA 2BGGA 4CGIA 2FC0A 2HNDA 1WLJA 2ZQBA 4E89A 3U6FA 2VG7A 1X9SA 3O4QA 3QLHA 3SQ0A 2ZD1A 4ELTA 3MEEA 2B5JA 4FM1A 1HYSA 3DMJA 4IG3A 1CZBA 1MU2A 4DFJA 3QESA 1NJWA 4ID1A 4CHYA 4YNQA 4KHUA 2X6SA 4CEOA 4KRFA 4J2EA 2KZZA 1D5AA 3VQ4A 3JYTA 1L3SA 5DK5A 3MXMA 3B6OA 4CF8A 4W5OA 4JS5A 2QKKA 2KW4A 3TABA 3C95A 4O5BA 4RW6A 5KI6A 3OYKA 3KTQA 1BCMA 1TAQA 1KVBA 3KK1A 2BDPA 2NUBA 1RBSA 1ZBLA 4KHYA 5HRPA 4QOZB 1KSPA 2ZE2A 4O4GA 4FJ5A 2D0BA 1C0UA 1LWEA 4FZZA 1U4BA 1NK6A 4FJ7A 3KD1E 1QTMA 4RW7A 2WONA 3MXJA 4FZYA 3PO4A 4B9UA 1CZ9A 3NH0A 2KFZA 4EP4A 4Y1CA 5K14A 3DOKA 3D45A 5JS1A 3L2WA 4DTUA 1NK0A 3SPYA 4CJ3A 3DLHA 3NF7A 2IGIA 1JLGA 4DSLA 1KRPA 1S1UA 3DYAA 4FM2A 1SL0A 3MECA 4FJNA 3AA2A 3AVJA 4ZHRA 3NHGA 4DTMA 4KTWA 1NJXA 4KTZA 4CEBA 1QSLA 3HP9A 4WE1A 5FRNA 2VWJA 1BISA 1WSGA 1LW0A 2B4JA 1QE1A 2VG5A 1WAJA 2XHBA 1SUQA 1KFSA 1RNHA 4IKFA 1WNSA 3RWUA 2KZMA 1C1AA 2JGUA 3LWMA 4M3XA 3RMDA 3ZSYA 3G10A 1U48A 1C6VA 4DMNA 3S3MA 1RDCA 3LPTA 1NK8A 1EETA 4KAZA 3HT3A 5FDLA 4DSEA 2FBYA 5SWMA 4DWIA 1U04A 1VSJA 4W5TA 1JXEA 4E7LA 3V4IA 1TVRA 4ZTJA 1SL2A 3S3NA 2IAJA 4LH5A 4E19A 1X9MA 4FK4A 1HQEA 3VQ9A 4DQPA 1S9EA 3VA0A 1Q9XA 4FYDA 3K57A 1F21A 3QO9A 4AILC 3SNNA 3U3YA 1RT7A 1CLQA 4FJIA 2Y1JA 4OKEA 5HROA 1WSEA 4NYFA 1C1CA 3F9KA 4IFVA 2DFFA 1NKBA 3RR7A 4LD0A 3P5JA 3TAGA 3OJSA 1LAWA 4FLVA 3PV8A 4DSIA 4FJGA 1FKOA 3SJJA 4RW9A 1VSHA 3WNGA 1VSKA 3DOLA 3OY9A 4KO0A 2F96A 2DTUA 1BIZA 3NDKA 3AO4A 4CJRA 1D9DA 3IAYA 4J2AA 3C6TA 1WAFA 4H4MA 3SQ2A 1YVUA 1RILA 1BGXT 4IDKA 1U47A 1YT3A 1I3AA 4CIGA 2HHXA 3M8PA 4DSKA 1ZBHA 1X9WA 1BHLA 3WNHA 5J2PA 5I3UA 1ASVA 4HUGA 4KB0A 1WSJA 4FW1A 4M3TA 1I39A 3ULDA 1T05A 3L3VA 3M8RA 4L8RB 3V81A 4M3RA 4FJLA 4E1NA 5E41A 4HCBA 2ATQA 2XY8A 3HPGA 4NCAA 1LAVA 3AVBA 2YV0X 1RTDA 3K5OA 4CJPA 2Q3SA 1GOAA 3CM6A 5KTQA 4Z4EA 2F8SA 3NGZA 3KK3A 1RT4A 4M42A 3NGYA 3VQ8A 2QK9A 4B08A 3DLRA 3TWHA 3EZ5A 3RMCA 1JLAA 4GMJB 1EX4A 4YFUA 4OJRA 3K5LA 3V1OA 3SPZA 4Z4IA 3VA3A 1TAUA 1T7PA 1BCOA 3QEVA 1D9FA 4M3YA 4BWMA 3AA5X 4CE9A 5J2MA 4DU1A 4AHTA 1C1BA 3OYAA 3THVA 1A5VA 2G8FA 4J2DA 4FJKA 3VQQA 1TKTA 2IDOA 4KFBA 4CECA 4B8AB 1N6QA 4G1QA 4Y1DA 5CY4A 3ALYA 4CHZA 4OPKA 1ZBFA 3AA3A 4CHNA 2PYLA 4BDZA 3SYZA 4JLHA 4F2RA 4B9VA 3LP2A 1KCFA 4JS4A 4F3OA 3RRHA 1GOCA 2DY4A 1NJZA 3HJFA 1BIUA 4FLWA 3AVMA 1L3VA 3I8DA 4CJWA 4PWDA 4I2QA 4KI4A 4KV8A 4O55A 1QS4A 4DTNA 1JL1A 3T19A 3LPUA 4FK2A 4TSXA 1ASUA 3L2RA 3L8BA 4K8XA 2I5JA 3OYNA 1C0TA 3OYHA 2Z1IA 4B9SA 3DLGA 3QIPA 4CGGA 1ZYQA 3ZT0A 4RW4A 4DLEA 3OYBA 4DFKA 4B9NA 2E4LA 4CEDA 3RMAA 3SUQA 3TAFA 2QKBA 1IKWA 4CJLA 1T8EA 1B9DA 3V1QA 1U49A 3NF9A 4M41A 3SV4A 4LY7A 4CEAA 2GBZA 1T03A 1VSLA 4CK2A 3O3GA 3VQCA 1RBTA 4E3SA 2BANA 5KGXA 2Z1GA 4M3WA 3HVTA 4I9LA 1TL1A 5HP1A 3A2FA 2G8HA 1KLMA 3AVKA 1O1WA 4KB1A 3LZJA 4LSLA 1RT5A 1EXQA 4HUFA 3SI6A 3SQ4A 2IS3A 1RT1A 2D0AA 2YKNA 1B92A 4OGCA 1HMVA 3ZSQA 3OYFA 3SQ1A 1HYVA 3L2VA 4DTOA 3PX0A 4EZ6A 4DFMA 3SUNA 4CESA 1S1WA 3T3FA 1RBRA 3LP1A 4O0JA 3ZSRA 3PX6A 4KHSA 1J53A 1ASWA 1HPZA 4K8ZA 3OVNA 2X6NA 3WNEA 5CZ2A 4DS4A 4O44A 1HRHA 3TAMA 1RTJA 3P1GA 4N56A 3OYMA 1LV5A 1L3UA 2G8WA 1KVAA 4FJXA 3M8QA 4IFYA 4CHOA 3V9XA 3ZT3A 1JLBA 3KLFA 4ZTFA 4CF0A 4C8OA 4PA1A 4CJKA 4R5PA 3CQ8A 3VQ6A 3RMBA 3TARA 4DTJA 4CGFA 4KHQA 2EHGA 2Z1JA 3CFPA 1K6YA 5CYMA 3OYIA 2XY7A 3I0RA 3ZSVA 3H08A 3QEWA 1D8YA 1HQUA 3F73A 3HK2A 4W5NA 2E6MA 2HNZA 4E7IA 3K5MA 3MEDA 4M45A 4N76A 4BWJA 1XI1A 1XC9A 1EKEA 3RTVA 3TAQA 5HRNA 4DU3A 4I9QA 1S6PA 3IRXA 3HPHA 2FBTA 3AVHA 4DG1A 4N5SA 4E7JA 1VSEA 4Z0UA 4NCGA 4BDYA 1KTQA 4DQRA 5HRSA 4DS5A 4Z4HA 4DTSA 2P5GA 4CFBA 3V9SA 2RPIA 3NE6A 4B8CA 1KFDA 3ZSOA 2JLEA 3NGIA 4E7HA 1FXXA 2RN2A 5SZTA 4Q5VA 4AHSA 3OYLA 3KJVA 4AHRA 4FLXA 3KLGA 2FBVA 1HJRA 3ZSXA 2YNFA 3KLHA 1TKXA 5J2QA 5KGWA 2LSNA 2G8UA 2P5OA 4B9LA 1FK9A 4B3OA 2F8TA 2HMIA 4CF9A 4C8LA 1IKXA 4OLAA 1C0MA 1L5UA 3AA4A 4DTPA 3QEPA 1VSFA 4CGJA 3AO5A 4Z4GA 5HBMA 4ICLA 5C25A 3SZ2A 1DLOA 3AO3A 3LDSA 4HTUA 4FLUA 4I7FA 2HW3A 4LH4A 3O3FA 4CERA 4N47A 2YHAA 3CYMA 4FVMA 1S1XA 3C6UA 3UIQA 1J5OA 4N41A 2XRIA 1TKZA 3KLIA 2OZSA 1BQMA 4CEEA 1Q9YA 3AVGA 4BE1A 1Q8IA 4DQQA 4E1MA 3TANA 4CJEA 3BDPA 1IH7A 4CHQA 3OS1A 4DQSA 2P1JA 1WN7A 3AVIA 3K58A 4FJHA 1G15A 4F4KA 4BDPA 2VWKA 1JL2A 4OPJA 3AVAA 4C8NA 1W0HA 1R0AA 1JKHA 1UAXA 4FLZA 4W5QA 4DU4A 4CEFA 2XY5A 4EP5A 2E6LA 3OS0A 3ZT1A 1JXBA 4B9TA 3E01A 3K59A 1UOCA 3MEGA 3TAPA 1JLCA 3RRGA 2IC3A 4M3ZA 2G8VA 1RBUA 1Z25A 3EYZA 2PZSA 3CFOA 1REVA 5HRRA 3PUFA 3HXMA 1RBVA 1GOBA 5D3GA 2KTQA 5C24A 3KLEA 2X78A 4CJ5A 3S9HA 2EX3A 3K2PA 1ZBUA 3AVFA 4IG0A 3OYEA 4NCBA 4JRQA 1S9GA 4JRPA 4AH9A 2IOCA 3V6DA 1TK5A 1W9HA 2RF2A 1JLEA 1X1PA 2YNGA 4BACA 5FRMA 4KREA 4CF1A 4DQIA 1QSSA 1IKVA 1LWFA 1TL3A 4DF8A 1B9FA 3L2UA 4CFCA 3AV9A 3LP0A 3HM9A 5I42A 4FW2A 5J2NA 2HHQA 2GUIA 4KI6A 1S6QA 1RT3A 2OA8A 1JLFA 5KRSA 1YTAA 3O3HA 3BGRA 5J1EA 3HL8A 1YTUA 2KQ2A 1VRUA 2X74A 4OKJA 4DFPA 2BE2A 4FM0A 3CG7A 4EZ9A 3ZSWA 1QQCA 3KKSA 4GVMA 1DTTA 4CHPA 1RT6A 3OJUA 4FLYA 3QETA 1NOYA 3DRSA 5T7BA 4M3UA 2D5RA 1RDBA 4HVJA 1S1VA 4CEQA 4CJTA 3KD5E 1BL3A 1DTQA 2DFHA 2B6AA 3O4NA 4CF2A 1UA1A 4ELVA 4Z4FA 2P51A 1J9AA 4DSJA 3KKRA 4MQ3A 3HPOA 3HSTB 1NK5A 1JLQA 4PY5A 4BE0A 3RR8A 1A5WA 3QNOA 1ITGA 3PO5A 2OPQA 3PX4A 2R7YA 2PY5A 4B9MA 1RCHA 3LZIA 2OZMA 3CFRA 2O4IA 3LP3A 1VSMA 3AVNA 1WSFA 4RG8A 1SV5A 3VQDA 3JSMA 5DMRA 1RDAA 1TK0A 1NOZA 4FJ9A 5EU7A 4CK3A 4QAGA 5FROA 3TAEA 5JS2A 4CJ4A 4CEZA 2ITGA 3OYJA 1NJYA 4H4OA 2GV9A 1QSYA 4DTXA 3ASMA 1VSIA 2D0CA 4NYNA 2ETJA 2RKIA 3OYDA 4DTRA 3DRRA 4OGEA 3KK2A 4FCYA 1VK0A 1TGOA 3NH2A 4E7KA 4J2BA 2W42A 3QEXA 2FBXA 2VG6A 3NF8A 3SUOA 3S3OA 4HUEA 1RTHA 2A1RA 4H8KA 1UA0A 4ELUA 3OYCA 3LWLA 3ZSZA 3IS9A 3HVRA 5CZ1A 1TKDA 2YKMA 4KTQA 3DLKA 1CXUA 3LALA 3VQAA 4XIUA 3OYGA 1BQNA 4FLTA 2OYQA 2HVIA 4Q0BA 2Y1IA 1KLNA 1RT2A 3T1AA 4UQGA 4PQUA 4HHTA 1HNVA 4F2SA 1HYZA 3ZT2A 4FK0A 2Z1HA 4I2PA 1J54A 2A1SA 4LSNA 4CJSA 2HHTA 5KRTA 3CM5A 1S5JA 3L2QA 2OPSA 3QINA 4CGHA 3VQPA 1NK4A 3SUPA 3QNNA 4IBNA 4W5RA 3D0PA 1VRTA 2AJQA 3VQBA 4AHVA 3NBPA 3V9WA 2DFEA 1HNIA 3I0SA 4FJ8A 2YNHA 2YNIA 3DRPA 4FXDA 3V1RA 4O0IA 2WOMA 3NFAA 1VSDA 4GW6A 1WSIA 3VQ5A 2G8IA 2HHSA 3DM2A 3M8SA 4C8KA 1FKPA 3MXIA 3PY8A 1BI4B 1WSHA 3B6PA 3KIOA 4CJQA 4F8RA 4AHUA 1N5YA 3P83D 1RDDA 1UWBA 2QXFA 3QEIA 1NKCA 3WNFA 3AO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHW A;  3AVL A;  4ID5 A;  3C94 A;  3LAN A;  4C8M A;  1CXQ A;  3LAM A;  3VN5 A;  3SV3 A;  3SCX A;  3TI0 A;  3L3U A;  1XHZ A;  4PUO A;  4MFB A;  3NCI A;  3EY1 A;  2KFN A;  3AO2 A;  4HCC A;  1RTI A;  5CYQ A;  4E0D A;  1TV6 A;  4CJU A;  1LWC A;  1IKY A;  3NAE A;  1IG9 A;  1XWL A;  3DLE A;  2HHV A;  3IG1 A;  4CK1 A;  1L3T A;  2XY6 A;  1LW2 A;  4CJV A;  3TR8 A;  3NF6 A;  4F3T A;  3HYF A;  1NK9 A;  2YHB A;  5C42 A;  4FJJ A;  1ZBI A;  1A5X A;  1SL1 A;  4BE2 A;  3LAK A;  3ZT4 A;  4DSF A;  4DF4 A;  3OS2 A;  3HP6 A;  5HLF A;  4FZX C;  4DLG A;  1U45 A;  3ISN C;  1SKS A;  2HB5 A;  2HHU A;  4KPY A;  3DI6 A;  1BI4 A;  2OPR A;  4OVL A;  1Z26 A;  1EP4 A;  1TK8 A;  1NKE A;  1QHT A;  4Z4C A;  3NH1 A;  4FJM A;  4KHN A;  3G0Z A;  4KKO A;  4CJF A;  2G8K A;  1Y97 A;  3HO1 A;  3U3G A;  3FFI A;  3QIO A;  4OLB A;  3VQE A;  3V9U A;  2XO7 A;  4CIE A;  4RW8 A;  4CGD A;  4OKK A;  1XHX A;  3AVC A;  2HVH A;  1KVC A;  3MAQ A;  4CFD A;  3K5N A;  1NK7 A;  4CCH A;  1S1T A;  4KHW A;  4QCL A;  3ZCM A;  2PYJ A;  1IO2 A;  1SKW A;  3VQ7 A;  4CFA A;  3DLB A;  2HNY A;  3QER A;  1SKR A;  2OPP A;  2O4G A;  4AHC A;  3V9Z A;  4CIF A;  3ITH A;  2BGG A;  4CGI A;  2FC0 A;  2HND A;  1WLJ A;  2ZQB A;  4E89 A;  3U6F A;  2VG7 A;  1X9S A;  3O4Q A;  3QLH A;  3SQ0 A;  2ZD1 A;  4ELT A;  3MEE A;  2B5J A;  4FM1 A;  1HYS A;  3DMJ A;  4IG3 A;  1CZB A;  1MU2 A;  4DFJ A;  3QES A;  1NJW A;  4ID1 A;  4CHY A;  4YNQ A;  4KHU A;  2X6S A;  4CEO A;  4KRF A;  4J2E A;  2KZZ A;  1D5A A;  3VQ4 A;  3JYT A;  1L3S A;  5DK5 A;  3MXM A;  3B6O A;  4CF8 A;  4W5O A;  4JS5 A;  2QKK A;  2KW4 A;  3TAB A;  3C95 A;  4O5B A;  4RW6 A;  5KI6 A;  3OYK A;  3KTQ A;  1BCM A;  1TAQ A;  1KVB A;  3KK1 A;  2BDP A;  2NUB A;  1RBS A;  1ZBL A;  4KHY A;  5HRP A;  4QOZ B;  1KSP A;  2ZE2 A;  4O4G A;  4FJ5 A;  2D0B A;  1C0U A;  1LWE A;  4FZZ A;  1U4B A;  1NK6 A;  4FJ7 A;  3KD1 E;  1QTM A;  4RW7 A;  2WON A;  3MXJ A;  4FZY A;  3PO4 A;  4B9U A;  1CZ9 A;  3NH0 A;  2KFZ A;  4EP4 A;  4Y1C A;  5K14 A;  3DOK A;  3D45 A;  5JS1 A;  3L2W A;  4DTU A;  1NK0 A;  3SPY A;  4CJ3 A;  3DLH A;  3NF7 A;  2IGI A;  1JLG A;  4DSL A;  1KRP A;  1S1U A;  3DYA A;  4FM2 A;  1SL0 A;  3MEC A;  4FJN A;  3AA2 A;  3AVJ A;  4ZHR A;  3NHG A;  4DTM A;  4KTW A;  1NJX A;  4KTZ A;  4CEB A;  1QSL A;  3HP9 A;  4WE1 A;  5FRN A;  2VWJ A;  1BIS A;  1WSG A;  1LW0 A;  2B4J A;  1QE1 A;  2VG5 A;  1WAJ A;  2XHB A;  1SUQ A;  1KFS A;  1RNH A;  4IKF A;  1WNS A;  3RWU A;  2KZM A;  1C1A A;  2JGU A;  3LWM A;  4M3X A;  3RMD A;  3ZSY A;  3G10 A;  1U48 A;  1C6V A;  4DMN A;  3S3M A;  1RDC A;  3LPT A;  1NK8 A;  1EET A;  4KAZ A;  3HT3 A;  5FDL A;  4DSE A;  2FBY A;  5SWM A;  4DWI A;  1U04 A;  1VSJ A;  4W5T A;  1JXE A;  4E7L A;  3V4I A;  1TVR A;  4ZTJ A;  1SL2 A;  3S3N A;  2IAJ A;  4LH5 A;  4E19 A;  1X9M A;  4FK4 A;  1HQE A;  3VQ9 A;  4DQP A;  1S9E A;  3VA0 A;  1Q9X A;  4FYD A;  3K57 A;  1F21 A;  3QO9 A;  4AIL C;  3SNN A;  3U3Y A;  1RT7 A;  1CLQ A;  4FJI A;  2Y1J A;  4OKE A;  5HRO A;  1WSE A;  4NYF A;  1C1C A;  3F9K A;  4IFV A;  2DFF A;  1NKB A;  3RR7 A;  4LD0 A;  3P5J A;  3TAG A;  3OJS A;  1LAW A;  4FLV A;  3PV8 A;  4DSI A;  4FJG A;  1FKO A;  3SJJ A;  4RW9 A;  1VSH A;  3WNG A;  1VSK A;  3DOL A;  3OY9 A;  4KO0 A;  2F96 A;  2DTU A;  1BIZ A;  3NDK A;  3AO4 A;  4CJR A;  1D9D A;  3IAY A;  4J2A A;  3C6T A;  1WAF A;  4H4M A;  3SQ2 A;  1YVU A;  1RIL A;  1BGX T;  4IDK A;  1U47 A;  1YT3 A;  1I3A A;  4CIG A;  2HHX A;  3M8P A;  4DSK A;  1ZBH A;  1X9W A;  1BHL A;  3WNH A;  5J2P A;  5I3U A;  1ASV A;  4HUG A;  4KB0 A;  1WSJ A;  4FW1 A;  4M3T A;  1I39 A;  3ULD A;  1T05 A;  3L3V A;  3M8R A;  4L8R B;  3V81 A;  4M3R A;  4FJL A;  4E1N A;  5E41 A;  4HCB A;  2ATQ A;  2XY8 A;  3HPG A;  4NCA A;  1LAV A;  3AVB A;  2YV0 X;  1RTD A;  3K5O A;  4CJP A;  2Q3S A;  1GOA A;  3CM6 A;  5KTQ A;  4Z4E A;  2F8S A;  3NGZ A;  3KK3 A;  1RT4 A;  4M42 A;  3NGY A;  3VQ8 A;  2QK9 A;  4B08 A;  3DLR A;  3TWH A;  3EZ5 A;  3RMC A;  1JLA A;  4GMJ B;  1EX4 A;  4YFU A;  4OJR A;  3K5L A;  3V1O A;  3SPZ A;  4Z4I A;  3VA3 A;  1TAU A;  1T7P A;  1BCO A;  3QEV A;  1D9F A;  4M3Y A;  4BWM A;  3AA5 X;  4CE9 A;  5J2M A;  4DU1 A;  4AHT A;  1C1B A;  3OYA A;  3THV A;  1A5V A;  2G8F A;  4J2D A;  4FJK A;  3VQQ A;  1TKT A;  2IDO A;  4KFB A;  4CEC A;  4B8A B;  1N6Q A;  4G1Q A;  4Y1D A;  5CY4 A;  3ALY A;  4CHZ A;  4OPK A;  1ZBF A;  3AA3 A;  4CHN A;  2PYL A;  4BDZ A;  3SYZ A;  4JLH A;  4F2R A;  4B9V A;  3LP2 A;  1KCF A;  4JS4 A;  4F3O A;  3RRH A;  1GOC A;  2DY4 A;  1NJZ A;  3HJF A;  1BIU A;  4FLW A;  3AVM A;  1L3V A;  3I8D A;  4CJW A;  4PWD A;  4I2Q A;  4KI4 A;  4KV8 A;  4O55 A;  1QS4 A;  4DTN A;  1JL1 A;  3T19 A;  3LPU A;  4FK2 A;  4TSX A;  1ASU A;  3L2R A;  3L8B A;  4K8X A;  2I5J A;  3OYN A;  1C0T A;  3OYH A;  2Z1I A;  4B9S A;  3DLG A;  3QIP A;  4CGG A;  1ZYQ A;  3ZT0 A;  4RW4 A;  4DLE A;  3OYB A;  4DFK A;  4B9N A;  2E4L A;  4CED A;  3RMA A;  3SUQ A;  3TAF A;  2QKB A;  1IKW A;  4CJL A;  1T8E A;  1B9D A;  3V1Q A;  1U49 A;  3NF9 A;  4M41 A;  3SV4 A;  4LY7 A;  4CEA A;  2GBZ A;  1T03 A;  1VSL A;  4CK2 A;  3O3G A;  3VQC A;  1RBT A;  4E3S A;  2BAN A;  5KGX A;  2Z1G A;  4M3W A;  3HVT A;  4I9L A;  1TL1 A;  5HP1 A;  3A2F A;  2G8H A;  1KLM A;  3AVK A;  1O1W A;  4KB1 A;  3LZJ A;  4LSL A;  1RT5 A;  1EXQ A;  4HUF A;  3SI6 A;  3SQ4 A;  2IS3 A;  1RT1 A;  2D0A A;  2YKN A;  1B92 A;  4OGC A;  1HMV A;  3ZSQ A;  3OYF A;  3SQ1 A;  1HYV A;  3L2V A;  4DTO A;  3PX0 A;  4EZ6 A;  4DFM A;  3SUN A;  4CES A;  1S1W A;  3T3F A;  1RBR A;  3LP1 A;  4O0J A;  3ZSR A;  3PX6 A;  4KHS A;  1J53 A;  1ASW A;  1HPZ A;  4K8Z A;  3OVN A;  2X6N A;  3WNE A;  5CZ2 A;  4DS4 A;  4O44 A;  1HRH A;  3TAM A;  1RTJ A;  3P1G A;  4N56 A;  3OYM A;  1LV5 A;  1L3U A;  2G8W A;  1KVA A;  4FJX A;  3M8Q A;  4IFY A;  4CHO A;  3V9X A;  3ZT3 A;  1JLB A;  3KLF A;  4ZTF A;  4CF0 A;  4C8O A;  4PA1 A;  4CJK A;  4R5P A;  3CQ8 A;  3VQ6 A;  3RMB A;  3TAR A;  4DTJ A;  4CGF A;  4KHQ A;  2EHG A;  2Z1J A;  3CFP A;  1K6Y A;  5CYM A;  3OYI A;  2XY7 A;  3I0R A;  3ZSV A;  3H08 A;  3QEW A;  1D8Y A;  1HQU A;  3F73 A;  3HK2 A;  4W5N A;  2E6M A;  2HNZ A;  4E7I A;  3K5M A;  3MED A;  4M45 A;  4N76 A;  4BWJ A;  1XI1 A;  1XC9 A;  1EKE A;  3RTV A;  3TAQ A;  5HRN A;  4DU3 A;  4I9Q A;  1S6P A;  3IRX A;  3HPH A;  2FBT A;  3AVH A;  4DG1 A;  4N5S A;  4E7J A;  1VSE A;  4Z0U A;  4NCG A;  4BDY A;  1KTQ A;  4DQR A;  5HRS A;  4DS5 A;  4Z4H A;  4DTS A;  2P5G A;  4CFB A;  3V9S A;  2RPI A;  3NE6 A;  4B8C A;  1KFD A;  3ZSO A;  2JLE A;  3NGI A;  4E7H A;  1FXX A;  2RN2 A;  5SZT A;  4Q5V A;  4AHS A;  3OYL A;  3KJV A;  4AHR A;  4FLX A;  3KLG A;  2FBV A;  1HJR A;  3ZSX A;  2YNF A;  3KLH A;  1TKX A;  5J2Q A;  5KGW A;  2LSN A;  2G8U A;  2P5O A;  4B9L A;  1FK9 A;  4B3O A;  2F8T A;  2HMI A;  4CF9 A;  4C8L A;  1IKX A;  4OLA A;  1C0M A;  1L5U A;  3AA4 A;  4DTP A;  3QEP A;  1VSF A;  4CGJ A;  3AO5 A;  4Z4G A;  5HBM A;  4ICL A;  5C25 A;  3SZ2 A;  1DLO A;  3AO3 A;  3LDS A;  4HTU A;  4FLU A;  4I7F A;  2HW3 A;  4LH4 A;  3O3F A;  4CER A;  4N47 A;  2YHA A;  3CYM A;  4FVM A;  1S1X A;  3C6U A;  3UIQ A;  1J5O A;  4N41 A;  2XRI A;  1TKZ A;  3KLI A;  2OZS A;  1BQM A;  4CEE A;  1Q9Y A;  3AVG A;  4BE1 A;  1Q8I A;  4DQQ A;  4E1M A;  3TAN A;  4CJE A;  3BDP A;  1IH7 A;  4CHQ A;  3OS1 A;  4DQS A;  2P1J A;  1WN7 A;  3AVI A;  3K58 A;  4FJH A;  1G15 A;  4F4K A;  4BDP A;  2VWK A;  1JL2 A;  4OPJ A;  3AVA A;  4C8N A;  1W0H A;  1R0A A;  1JKH A;  1UAX A;  4FLZ A;  4W5Q A;  4DU4 A;  4CEF A;  2XY5 A;  4EP5 A;  2E6L A;  3OS0 A;  3ZT1 A;  1JXB A;  4B9T A;  3E01 A;  3K59 A;  1UOC A;  3MEG A;  3TAP A;  1JLC A;  3RRG A;  2IC3 A;  4M3Z A;  2G8V A;  1RBU A;  1Z25 A;  3EYZ A;  2PZS A;  3CFO A;  1REV A;  5HRR A;  3PUF A;  3HXM A;  1RBV A;  1GOB A;  5D3G A;  2KTQ A;  5C24 A;  3KLE A;  2X78 A;  4CJ5 A;  3S9H A;  2EX3 A;  3K2P A;  1ZBU A;  3AVF A;  4IG0 A;  3OYE A;  4NCB A;  4JRQ A;  1S9G A;  4JRP A;  4AH9 A;  2IOC A;  3V6D A;  1TK5 A;  1W9H A;  2RF2 A;  1JLE A;  1X1P A;  2YNG A;  4BAC A;  5FRM A;  4KRE A;  4CF1 A;  4DQI A;  1QSS A;  1IKV A;  1LWF A;  1TL3 A;  4DF8 A;  1B9F A;  3L2U A;  4CFC A;  3AV9 A;  3LP0 A;  3HM9 A;  5I42 A;  4FW2 A;  5J2N A;  2HHQ A;  2GUI A;  4KI6 A;  1S6Q A;  1RT3 A;  2OA8 A;  1JLF A;  5KRS A;  1YTA A;  3O3H A;  3BGR A;  5J1E A;  3HL8 A;  1YTU A;  2KQ2 A;  1VRU A;  2X74 A;  4OKJ A;  4DFP A;  2BE2 A;  4FM0 A;  3CG7 A;  4EZ9 A;  3ZSW A;  1QQC A;  3KKS A;  4GVM A;  1DTT A;  4CHP A;  1RT6 A;  3OJU A;  4FLY A;  3QET A;  1NOY A;  3DRS A;  5T7B A;  4M3U A;  2D5R A;  1RDB A;  4HVJ A;  1S1V A;  4CEQ A;  4CJT A;  3KD5 E;  1BL3 A;  1DTQ A;  2DFH A;  2B6A A;  3O4N A;  4CF2 A;  1UA1 A;  4ELV A;  4Z4F A;  2P51 A;  1J9A A;  4DSJ A;  3KKR A;  4MQ3 A;  3HPO A;  3HST B;  1NK5 A;  1JLQ A;  4PY5 A;  4BE0 A;  3RR8 A;  1A5W A;  3QNO A;  1ITG A;  3PO5 A;  2OPQ A;  3PX4 A;  2R7Y A;  2PY5 A;  4B9M A;  1RCH A;  3LZI A;  2OZM A;  3CFR A;  2O4I A;  3LP3 A;  1VSM A;  3AVN A;  1WSF A;  4RG8 A;  1SV5 A;  3VQD A;  3JSM A;  5DMR A;  1RDA A;  1TK0 A;  1NOZ A;  4FJ9 A;  5EU7 A;  4CK3 A;  4QAG A;  5FRO A;  3TAE A;  5JS2 A;  4CJ4 A;  4CEZ A;  2ITG A;  3OYJ A;  1NJY A;  4H4O A;  2GV9 A;  1QSY A;  4DTX A;  3ASM A;  1VSI A;  2D0C A;  4NYN A;  2ETJ A;  2RKI A;  3OYD A;  4DTR A;  3DRR A;  4OGE A;  3KK2 A;  4FCY A;  1VK0 A;  1TGO A;  3NH2 A;  4E7K A;  4J2B A;  2W42 A;  3QEX A;  2FBX A;  2VG6 A;  3NF8 A;  3SUO A;  3S3O A;  4HUE A;  1RTH A;  2A1R A;  4H8K A;  1UA0 A;  4ELU A;  3OYC A;  3LWL A;  3ZSZ A;  3IS9 A;  3HVR A;  5CZ1 A;  1TKD A;  2YKM A;  4KTQ A;  3DLK A;  1CXU A;  3LAL A;  3VQA A;  4XIU A;  3OYG A;  1BQN A;  4FLT A;  2OYQ A;  2HVI A;  4Q0B A;  2Y1I A;  1KLN A;  1RT2 A;  3T1A A;  4UQG A;  4PQU A;  4HHT A;  1HNV A;  4F2S A;  1HYZ A;  3ZT2 A;  4FK0 A;  2Z1H A;  4I2P A;  1J54 A;  2A1S A;  4LSN A;  4CJS A;  2HHT A;  5KRT A;  3CM5 A;  1S5J A;  3L2Q A;  2OPS A;  3QIN A;  4CGH A;  3VQP A;  1NK4 A;  3SUP A;  3QNN A;  4IBN A;  4W5R A;  3D0P A;  1VRT A;  2AJQ A;  3VQB A;  4AHV A;  3NBP A;  3V9W A;  2DFE A;  1HNI A;  3I0S A;  4FJ8 A;  2YNH A;  2YNI A;  3DRP A;  4FXD A;  3V1R A;  4O0I A;  2WOM A;  3NFA A;  1VSD A;  4GW6 A;  1WSI A;  3VQ5 A;  2G8I A;  2HHS A;  3DM2 A;  3M8S A;  4C8K A;  1FKP A;  3MXI A;  3PY8 A;  1BI4 B;  1WSH A;  3B6P A;  3KIO A;  4CJQ A;  4F8R A;  4AHU A;  1N5Y A;  3P83 D;  1RDD A;  1UWB A;  2QXF A;  3QEI A;  1NKC A;  3WNF A;  3AO1 A; 
#chains in the Genus database with same CATH topology
 1NU0 A;  3AVL A;  1NGF A;  3C94 A;  5BPM A;  1CXQ A;  3TI0 A;  3EY1 A;  3E9P A;  3AO2 A;  3THX A;  3DLL L;  4E0D A;  4IOA L;  3NAE A;  1XWL A;  3DLE A;  3MN6 A;  2FSN A;  3QML A;  1VQL N;  3QFU A;  1X3M A;  3DXK A;  3TR8 A;  3HYF A;  1NK9 A;  5C42 A;  4FJJ A;  5EX5 A;  3LAK A;  1NGH A;  3C6H A;  1U45 A;  5C2D A;  1W2B M;  4KPY A;  4OVL A;  1N36 K;  1NGA A;  2W41 A;  1HUX A;  1TK8 A;  1NKE A;  4FJM A;  3MX5 A;  4B1W B;  4CI6 A;  3JAM O;  3NVK A;  1NG9 A;  4OLB A;  2P9P A;  3V9U A;  3ZYY X;  2Q1N A;  3R9P A;  1KVC A;  3ZEU B;  4CCH A;  5BRE A;  1S1T A;  2P9N A;  4DV0 K;  4DV7 K;  4IZ9 A;  4XH5 A;  3TTC A;  4AM6 A;  5AZI A;  4CIF A;  4CGI A;  2FC0 A;  2NRV A;  3VTI A;  2VG7 A;  1X9S A;  4CD3 A;  5MLC Q;  2ZD1 A;  4FM1 A;  2B5J A;  3I33 A;  2A3Z A;  4KHP K;  1NJW A;  3WT0 A;  4JHD B;  4KRF A;  1D5A A;  5DK5 A;  2NRZ A;  4JS5 A;  3C95 A;  4RW6 A;  5AFU A;  3WQU A;  3HOS A;  1BCM A;  3KK1 A;  4LF4 K;  2ZJP L;  3DAW A;  4BG8 A;  4FJ5 A;  5GAE P;  3P4I A;  2D0B A;  1C0U A;  1U4B A;  5JVG L;  4RW7 A;  3MXJ A;  1Q18 A;  3PO4 A;  4B9U A;  3R8E A;  4Y1C A;  3DOK A;  5I9E B;  5JS1 A;  3M5R A;  4CZL A;  4DSL A;  4I6M B;  1VQK N;  1S1U A;  3VF4 A;  3AA2 A;  4ZHR A;  3NHG A;  4DTM A;  4KTW A;  4BRK A;  4CEB A;  4WE1 A;  1WSG A;  5C2F A;  1QE1 A;  2VG5 A;  2VGM A;  4NXN K;  1WNS A;  1NNE A;  5FPN A;  3RMD A;  3G10 A;  3U9Z A;  3G71 N;  1NK8 A;  1EET A;  5GAG P;  4W5T A;  4B9N A;  1TVR A;  4ZTJ A;  5ELZ A;  4NXM K;  3VQ9 A;  4DQP A;  4QS8 A;  1Q9X A;  1F21 A;  1CLQ A;  4FJI A;  3CQY A;  1QVF M;  1WSE A;  4NYF A;  3RR7 A;  4JKD A;  3TSU A;  3KVG A;  4FLV A;  3FR0 A;  5HL7 L;  3SJJ A;  3UKR A;  1VSK A;  3OY9 A;  2DTU A;  4QS9 A;  4E1J A;  1QQN A;  3C6T A;  3T69 A;  1YVU A;  1BGX T;  1YT3 A;  2HHX A;  3M8P A;  2A6A A;  4DSK A;  1X9W A;  3WNH A;  1ASV A;  1TUY A;  1WSJ A;  1GLB G;  4JI6 K;  2O8E A;  3VOV A;  3ULD A;  3M8R A;  3C6A A;  3C7N A;  3MN7 A;  4M3R A;  1V4T A;  2OCE A;  4JHD A;  5LL6 Z;  4HCB A;  3CC7 N;  3HPG A;  4C1N K;  4PL7 A;  1LAV A;  3EKS A;  1RTD A;  1GOA A;  2CGJ A;  3CM6 A;  5F2R A;  5KTQ A;  2F8S A;  2W40 A;  2QWN A;  3PSI A;  4B08 A;  4IO9 L;  5TKY A;  3SAG A;  3RMC A;  1YJW N;  1JLA A;  4GMJ B;  4H03 B;  4OJR A;  3AY9 A;  2Q0U A;  3QEV A;  3AA5 X;  1VQM N;  3H46 O;  4FSV A;  4DU1 A;  3O6W A;  1ZC6 A;  3THV A;  1TKT A;  3PIO L;  1WOQ A;  1N6Q A;  4LFA K;  3ALY A;  2P9K B;  4JKB A;  3SYZ A;  1KCF A;  4JS4 A;  1QQO A;  4BR5 A;  4F3O A;  1BIU A;  4FLW A;  2WUS A;  3UKU B;  3O8M A;  5BRH A;  4O55 A;  4DTN A;  3BZK A;  3L2R A;  3OYN A;  3QIC A;  2OTL N;  3E66 A;  4CZI A;  3DLG A;  1ZYQ A;  5B8H A;  3ZT0 A;  2D0P A;  4DLE A;  4DFK A;  3RMA A;  3J7Y P;  3KWI A;  4GV9 A;  5AQZ A;  2QKB A;  1IKW A;  3V1Q A;  1U49 A;  3NF9 A;  4A2A A;  3VET A;  3WXM B;  2FF6 A;  1RBT A;  4FWL A;  4E3S A;  4M3W A;  3HVT A;  4I9L A;  1NMN A;  3A2F A;  1O1W A;  1VQP N;  4H5N A;  5EXW A;  2GTD A;  5IT9 O;  3LZJ A;  2WFB A;  3SI6 A;  1KAY A;  2IS3 A;  4EAH D;  3OYF A;  3SQ4 A;  1BUP A;  3L2V A;  4DTO A;  3H3O B;  1MA9 B;  3SUN A;  1ATS A;  1RBR A;  3ZSR A;  3J81 O;  4U67 L;  4BRM A;  1ASW A;  3WNE A;  4DS4 A;  2P9I B;  4O44 A;  1RTJ A;  3OYM A;  1LV5 A;  4YOY A;  1JCF A;  1NGB A;  3F2K A;  4FJX A;  3HM8 A;  4J2E A;  4ZTF A;  1M1K O;  4JKH A;  4PA1 A;  4CJK A;  1XC3 A;  1TUU A;  4WQ5 C;  4JAX A;  4QS7 A;  3Q7C A;  2VCP A;  2Z1J A;  5CYM A;  3T7Z A;  3OYI A;  3QEW A;  1OKJ A;  1D8Y A;  4FWP A;  3WXJ A;  4M45 A;  4JN4 A;  4DG1 A;  4U7B A;  5LJW A;  3WUH A;  1VSE A;  4BRF A;  3GOI A;  4I6M A;  4DQR A;  2RPI A;  4BC5 A;  4M7X A;  1NLV A;  2F7T A;  3KLG A;  3KLH A;  2G8U A;  5KGW A;  4A61 A;  1FK9 A;  3WEE A;  4DV3 K;  4FPB A;  2F8T A;  4DR4 K;  4CF9 A;  4C8L A;  5M1K A;  1C0M A;  4B3M K;  3QEP A;  4LC9 B;  5AZJ B;  5C25 A;  1K9M O;  3EKU A;  1DLO A;  1NGC A;  3BP8 A;  4I7F A;  4CER A;  1MWK A;  4BQZ A;  2YHA A;  1OH6 A;  3CET A;  3C6U A;  3UIQ A;  1KAX A;  1J5O A;  2AA4 A;  1TKZ A;  3KLI A;  2OZS A;  1BQM A;  1NM1 A;  4BRC A;  4H5T A;  4Y0W A;  4CJE A;  3BDP A;  3FZK A;  3AVI A;  2PBD A;  4JK7 A;  4F4K A;  3LL3 A;  2VWK A;  3L4Q A;  2HBL A;  2GEL A;  1R0A A;  1JKH A;  1UAX A;  4DU4 A;  1HKG A;  2UXD K;  4EP5 A;  3ZT1 A;  1JXB A;  3SK3 A;  4CZF A;  1VQO N;  3E01 A;  1DKG D;  1Q7Y O;  4M3Z A;  2E8A A;  3HSC A;  1RBU A;  4K0K K;  4JYA K;  1HKB A;  3HXM A;  5IWA K;  1RBV A;  1Z05 A;  1GOB A;  5D3G A;  5C24 A;  5GAD P;  4MO4 A;  2V7Z A;  4CJ5 A;  4NCB A;  4JRQ A;  3VES A;  4JRP A;  4BRH A;  1W9H A;  1X1P A;  4H5W A;  5AQL A;  2QW9 A;  4CF1 A;  3N4Q A;  1EQY A;  2O8B B;  3HM9 A;  3CCR N;  5I42 A;  2HHQ A;  5LJV A;  1RT3 A;  5AFU H;  4BGA A;  3AAP A;  4ILH A;  4BRO A;  2Q0R A;  3HL8 A;  1YTU A;  4YDU C;  4EZ9 A;  1QQC A;  4FLY A;  5FPD A;  4CHP A;  4DCH A;  3DJC A;  3OBY A;  1RDB A;  2YJE A;  1BL3 A;  4CF2 A;  2B6A A;  3VGL A;  1UA1 A;  4DSJ A;  1NK5 A;  1JLQ A;  5C15 A;  2H3G X;  3RR8 A;  3CCJ N;  3QNO A;  3VEO A;  4X65 K;  2PY5 A;  4B9M A;  1OH7 A;  3LZI A;  2OZM A;  3MMV A;  4OO1 J;  1RDA A;  1YJ9 N;  3CER A;  4FWQ A;  1VSI A;  2D0C A;  4LF6 K;  3CXC M;  1GLJ O;  3DRR A;  4H0V B;  4FO0 A;  2W42 A;  2FBX A;  4DKW A;  1VQ5 N;  3KZB A;  3SUO A;  1GLL O;  4HUE A;  1UA0 A;  3ZSZ A;  5CZ1 A;  4C1N I;  4DV5 K;  4KTQ A;  3DXK B;  4B3R K;  2HVI A;  1IV0 A;  4Q0B A;  4BRD A;  1KLN A;  4H5R A;  3LDP A;  3T1A A;  4UQG A;  4HHT A;  5BR9 A;  1HYZ A;  3P39 A;  3ZT2 A;  2Z1H A;  2O8D A;  4I2P A;  2A1S A;  4LSN A;  3CM5 A;  1S5J A;  4GV3 A;  4CGH A;  3QIN A;  3VQP A;  3VEW A;  3CQX A;  4W5R A;  2GWJ A;  3D0P A;  1DT9 A;  3VQB A;  3V9W A;  3NBP A;  1HNI A;  4BR7 A;  2YNH A;  3DRP A;  4GW6 A;  3R3L A;  3M8S A;  4DUZ K;  3PY8 A;  1BI4 B;  1WSH A;  2E20 A;  2NRH A;  3B6P A;  3KIO A;  3CMA N;  1U2V B;  2QXF A;  4LFC K;  1NKC A;  2QWP A;  4LF9 K;  4ID5 A;  1XHZ A;  3VN5 A;  3SCX A;  4PUO A;  3L3U A;  3NCI A;  2KFN A;  3VPZ A;  1IG9 A;  1JCG A;  1VAZ A;  2HHV A;  4BRE A;  1LW2 A;  3CCL N;  4GNI A;  2QWL A;  4FOI A;  2UXB K;  1A5X A;  1SL1 A;  4GVE A;  4BR4 A;  3TPQ A;  3OS2 A;  2FSK A;  4DF4 A;  4DLG A;  4OPH A;  1QHA A;  1D4X A;  1EP4 A;  4V19 S;  1QHT A;  4Z4C A;  1NWK A;  3H1Q A;  1Y97 A;  1SAZ A;  3QIO A;  3CJB A;  4A5A A;  3VQE A;  2XO7 A;  4CIE A;  4RW8 A;  4CGD A;  4CFD A;  3K5N A;  1NK7 A;  4KHW A;  3LDO A;  2PYJ A;  5A2Q O;  4CW7 B;  2OPP A;  2QM1 A;  3ITH A;  2ZQB A;  3SAF A;  3U6F A;  4XH4 A;  3O4Q A;  3SQ0 A;  3MEE A;  2Q2R A;  1MU2 A;  1ZBS A;  3A5O C;  3LDN A;  3ATV A;  5AQX A;  2X6S A;  2GWK A;  4CEO A;  2KZZ A;  4CF8 A;  3P38 A;  4BRA A;  2UYT A;  1TAQ A;  2NUB A;  4BC3 A;  2ZE2 A;  4O4G A;  1NK6 A;  3KD1 E;  1WUA A;  4B3T K;  1QTM A;  3NMU A;  4FZY A;  1YAG A;  1S3X A;  2A5X A;  3NH0 A;  4EP4 A;  3MWP A;  4DV4 K;  4WCE L;  5FLX O;  5BR8 K;  2VWB A;  1NK0 A;  3DLH A;  3Q7B A;  4CJ3 A;  1DGK N;  3NF7 A;  4GV6 A;  3ZEU A;  5AQO A;  4FM2 A;  1SL0 A;  3AVJ A;  4FWM A;  4KTZ A;  1QSL A;  4C23 A;  3HP9 A;  4H0X B;  1BIS A;  2B4J A;  3H3N O;  5M1N A;  1WAJ A;  4EHU A;  1BOT O;  1RFQ A;  1KFS A;  2JGU A;  1XNQ K;  1U48 A;  1C6V A;  3LPT A;  3CHW A;  3O9S A;  3HT3 A;  5FDL A;  4DWI A;  4DUY K;  3V4I A;  4E7L A;  2HF3 A;  1SL2 A;  4LH5 A;  1X9M A;  4FK4 A;  4B1Z A;  1GLC G;  4M63 C;  2HHH K;  5ADX A;  4AIL C;  1O13 A;  4OKE A;  4DR2 K;  5HRO A;  1C1C A;  2PAV A;  1HNW K;  1YIT N;  2DFF A;  4CZE A;  1FKO A;  1BWF O;  3DOL A;  4KO0 A;  2F96 A;  4YOX A;  3IAY A;  4J2A A;  4CJR A;  3P31 A;  3THX B;  4H4M A;  4CJ7 A;  3ENH A;  1BHL A;  3EE8 A;  5J2P A;  2QI2 A;  4HUG A;  4KB0 A;  1I39 A;  3CCQ N;  1T05 A;  4L8R B;  4E1N A;  5E41 A;  2Q36 A;  3K5O A;  4CJP A;  3CJ9 A;  3K0S A;  2D1K A;  1RT4 A;  4NO7 A;  2QK9 A;  5TKW A;  3A0I X;  3SPZ A;  4IOX A;  3VA3 A;  1T7P A;  1RDW X;  2E2Q A;  4WFB L;  3VEZ A;  4JI8 K;  3W3D A;  4B8A B;  4CEC A;  4Y1D A;  5CY4 A;  4OPK A;  3AA3 A;  2PYL A;  4BDZ A;  4JLH A;  4F2R A;  4JI4 K;  3CCS N;  1NJZ A;  3HJF A;  3L4I A;  4I2Q A;  4KV8 A;  1QS4 A;  4CBW A;  4FK2 A;  1ASU A;  4K8X A;  5AQP A;  3VGK A;  3MCP A;  3QIP A;  2BUP A;  3TAF A;  3J7A P;  2UXC K;  4BRQ A;  1B9D A;  4M41 A;  3SV4 A;  4CEA A;  1VSL A;  4MLE A;  2E1Z A;  1TL1 A;  5HP1 A;  4DR5 K;  1IG8 A;  4BVP A;  1KLM A;  4KB1 A;  5M1F A;  4GKK K;  4LSL A;  2D0A A;  2YKN A;  4OGC A;  1HMV A;  5E26 A;  1HYV A;  3PX0 A;  2QXL A;  1S1W A;  4O0J A;  3PX6 A;  4WQ4 A;  4KHS A;  3J80 O;  1HPZ A;  2F9T A;  5LY3 A;  1HRH A;  4PKG A;  4N56 A;  1L3U A;  5AQW A;  3V9X A;  4C8O A;  1JLB A;  4H0Y B;  3MCA B;  3VQ6 A;  2WC9 A;  4FWK A;  4CGF A;  4K43 A;  2EHG A;  4KHQ A;  3PIP L;  3ZSV A;  3H08 A;  3MN9 A;  1HQU A;  3HK2 A;  4RTF D;  4E7I A;  3K5M A;  1EKE A;  3RTV A;  3TAQ A;  1P8Z A;  4IWV A;  4RCH A;  4ISG A;  2FBT A;  3O1W A;  4E7J A;  5KPZ A;  1NGJ A;  4BDY A;  5HRS A;  4DTS A;  2P5G A;  4CFB A;  3V9S A;  1C0G A;  4B8C A;  3DXM B;  4E7H A;  4FJG A;  3KJV A;  3OYL A;  1LCU A;  1E4G T;  4A57 A;  1MWM A;  1XUP O;  2HMI A;  4YOR A;  5M1P A;  2I7N A;  4DR6 K;  4OLA A;  3AA4 A;  4DTP A;  3D2E B;  1BDG A;  2CH6 A;  2KHO A;  4ICL A;  5HBM A;  3S41 A;  3SZ2 A;  4Z4G A;  3AO3 A;  3ATU A;  3LDS A;  4FLU A;  4LH4 A;  4N47 A;  3CYM A;  3CC2 N;  2HMP A;  4CEE A;  4WFN L;  3AVG A;  3TAN A;  3O08 A;  2A40 A;  4BR9 A;  5AQN A;  4DQS A;  4CHQ A;  1WN7 A;  3K58 A;  4DB3 A;  2P9L A;  3AVA A;  4C8N A;  4W5Q A;  2XY5 A;  2E6L A;  4BQL A;  3TAP A;  5AQT A;  1Q86 O;  5BN8 A;  2G8V A;  3SMP A;  1REV A;  3DXM A;  2KTQ A;  1V4S A;  2ASO A;  3S9H A;  2EX3 A;  5AQF A;  4DHY A;  1S9G A;  4AH9 A;  3EN9 A;  3ID8 A;  2Q97 A;  2RF2 A;  4WQ5 A;  5FRM A;  3R1X A;  4KRE A;  2D0O A;  4DF8 A;  3L2U A;  3LP0 A;  2GUI A;  4WYB A;  1S6Q A;  2D4W A;  4JI0 K;  2YCH A;  3O3H A;  1YJN N;  3D7E O;  3VEY A;  1VRU A;  4OKJ A;  2BE2 A;  3ZSW A;  3KKS A;  4GVM A;  1DTT A;  3DRS A;  5T7B A;  4M3U A;  2D5R A;  3RSE A;  1S1V A;  4CEQ A;  3KD5 E;  3O4N A;  1WBB A;  4Z4F A;  3IUC A;  2P51 A;  4JK9 A;  3KKR A;  4PY5 A;  1K8A O;  5AR0 A;  2CGK A;  3PO5 A;  5GIN A;  3PX4 A;  2V52 B;  4G9Z A;  1NBW A;  2O4I A;  3SMS A;  3JSM A;  3AVN A;  5EVZ A;  4RG8 A;  1NOZ A;  3VF6 A;  5FRO A;  5JLF A;  1JJ2 M;  4CEZ A;  4CJ4 A;  4BR0 A;  3D2F B;  1NJY A;  4H4O A;  4NYN A;  1T6C A;  5C12 A;  2UUC K;  4E7K A;  4J2B A;  3ZX2 A;  3M3Z A;  3A5N C;  3EL2 A;  3NF8 A;  1RTH A;  2A1R A;  4X66 K;  4H8K A;  5AQG A;  3VGM A;  5DM7 L;  2NRT A;  3FFK B;  3OYC A;  2P9U A;  3LAL A;  2KLA A;  2QTD A;  2Y1I A;  1RT2 A;  1Q82 O;  1EWR A;  4PQU A;  2OTJ N;  4CZH A;  3THY A;  2O8F A;  4JKE A;  2HHT A;  4JKG B;  5EY4 A;  4B1Y B;  3L2Q A;  2QWQ A;  4O8U A;  5LMN K;  3SUP A;  3IDH A;  1VRT A;  2AJQ A;  5KQ8 A;  2P9L B;  2WOM A;  1NGE A;  1VSD A;  3NFA A;  1WSI A;  3O4W A;  2HHS A;  1FKP A;  2BH1 A;  3MXI A;  4IJA A;  3QEI A;  3RRH A;  2BTF A;  4XH1 A;  2HHW A;  2UUB K;  2QWO A;  4B1X B;  3SJH A;  4C8M A;  3HI0 A;  4MFB A;  1RTI A;  1TV6 A;  1LWC A;  4IJN A;  1N8R O;  1MDU B;  4A2B A;  1X9J A;  1ZXO A;  1L3T A;  2XY6 A;  1Y64 A;  1KXP A;  1HR0 K;  3FZF A;  3NF6 A;  2OAN A;  4F3T A;  1ZBI A;  3ZT4 A;  5HLF A;  4FZX C;  3VEV A;  1SKS A;  2HB5 A;  3IKM A;  1T3V A;  3DI6 A;  3WXI A;  4NLC A;  5AQS A;  3O9R A;  5BRD A;  3NH1 A;  1P90 A;  4KKO A;  2CH5 A;  4FVU A;  2G8K A;  3HO1 A;  3U3G A;  4BRL A;  4MDA A;  5ADX H;  4KBO A;  1VQN N;  3I8B A;  4FOE A;  3OA9 A;  4LFB K;  4FWR A;  4OKK A;  2HVH A;  3MAQ A;  4BGB A;  4A5B A;  4QCL A;  2O8E B;  3ZCM A;  3VQ7 A;  2HNY A;  3QER A;  4AHC A;  3O9Q A;  3V9Z A;  4EHT A;  2BGG A;  3K9K A;  2E2P A;  5DM6 L;  4ELT A;  2YJF A;  4IG3 A;  1CZB A;  3KWG A;  4ILJ A;  4CBX A;  4ID1 A;  4CHY A;  3VQ4 A;  3JYT A;  3FZL A;  2HOE A;  1LOT B;  2KW4 A;  3EO3 A;  5KI6 A;  3OYK A;  1CZA N;  4JK8 A;  3CCM N;  2BDP A;  4J8F A;  4KHY A;  5HRP A;  4QOZ B;  3U8X A;  4CZK A;  3AAQ A;  2QA4 N;  1T44 A;  2YHY A;  5F0X A;  4FJ7 A;  1TYQ B;  3MK6 A;  4CZG A;  2KFZ A;  3CPW M;  3LDL A;  1KQS M;  5K14 A;  3SPY A;  2IGI A;  1JLG A;  3DYA A;  3GL1 A;  4JKA A;  1GLF O;  2E5L K;  1HNX K;  5FRN A;  4B1V A;  2VWJ A;  3CPE A;  1SUQ A;  3R6M A;  1RNH A;  4RWT A;  3LWM A;  3FE1 A;  3ZSY A;  4PL8 A;  2DPN A;  3S3M A;  1RDC A;  1WB9 A;  1U04 A;  1VSJ A;  1RGI A;  2IAJ A;  4E19 A;  3ZET A;  3O9U A;  1ATR A;  5AQR A;  3VA0 A;  3K57 A;  3QO9 A;  3SNN A;  3ENB A;  1RT7 A;  2IVP A;  4IFV A;  1U2V A;  4LD0 A;  3OJS A;  3CJC A;  4DSI A;  3CI5 A;  4RW9 A;  1R59 O;  3WNG A;  1T6D A;  3NDK A;  1D9D A;  1WAF A;  2KKZ A;  4IDK A;  1U47 A;  1YVN A;  1I3A A;  4CIG A;  2FLO A;  3F9M A;  5I3U A;  4M3T A;  1Z6R A;  4KH5 A;  4K41 A;  1SQK A;  3QDK A;  3V81 A;  1E3M A;  4FJL A;  4DQ8 A;  2F9W A;  4NCA A;  3AVB A;  3ID6 A;  4Z4E A;  2Q3S A;  4JV5 K;  3NGZ A;  4M42 A;  3I55 N;  3NGY A;  4CBU A;  4ISE A;  4IEE A;  3CIP A;  4A62 A;  4YDU A;  3EZ5 A;  3IFR A;  4YFU A;  4Z4I A;  3V1O A;  1TAU A;  4BWM A;  3GE1 A;  5J2M A;  3L6Q A;  2G8F A;  1A5V A;  4J2D A;  5F1X A;  4FJK A;  3VQQ A;  2IDO A;  4KFB A;  2E2N A;  3HOT A;  4G1Q A;  3D6R A;  4CHZ A;  4CHN A;  3THW A;  1GOC A;  1HX1 A;  4PKI A;  4LF5 K;  2DY4 A;  4BRG A;  1L3V A;  3I8D A;  3GG4 A;  3BY5 A;  5JIC A;  5JLH A;  4GKJ K;  3T19 A;  3LPU A;  3L8B A;  2I5J A;  1C0T A;  3OYH A;  3VER A;  2ZJR L;  1M90 O;  2Z1I A;  3BUZ B;  4CGG A;  4DR3 K;  4XEI A;  4HWI A;  4RW4 A;  2E4L A;  4CED A;  4B3S K;  2IVO A;  5GAH P;  4CJL A;  1T8E A;  4B9Q A;  3CJ7 A;  2GBZ A;  1N33 K;  4CK2 A;  4M7Y A;  1IBM K;  2BAN A;  2P9K A;  4FWO A;  2PFU A;  3M1F A;  4DV2 K;  3G4S N;  4FPA A;  1EXQ A;  4HUF A;  4JD2 A;  3ZSQ A;  2V7Y A;  4OPA A;  4DFM A;  4CES A;  3T3F A;  3SAH A;  4K8Z A;  3OVN A;  2UUA K;  3P1G A;  4FL9 A;  3FZH A;  1KVA A;  1XMQ K;  1IBK K;  4IFY A;  3F5T A;  4CHO A;  4CF0 A;  3CQ8 A;  2O8F B;  1YIJ N;  5E84 A;  4JNE A;  4PHT X;  4JI5 K;  3RMB A;  5BPN A;  3TAR A;  2WBN A;  3H1V X;  3LM2 A;  3G6E N;  3CFP A;  1K6Y A;  2XY7 A;  2ZGY A;  3I0R A;  3F73 A;  1OH5 A;  3DWL A;  4BWJ A;  1XI1 A;  5HRN A;  4I9Q A;  3HPH A;  4BG9 A;  4H0T B;  5LMU K;  4Z0U A;  3TU5 A;  3CF5 L;  1KTQ A;  1DEJ A;  5HOO A;  4Z4H A;  4YOT A;  4H0P A;  4JI1 K;  3ZSO A;  3C0B A;  5SZT A;  4FLX A;  4AHS A;  1WBD A;  1TKX A;  3RSE B;  4B9L A;  2O8D B;  3BEX A;  3LDQ A;  2WTU A;  3A5L C;  4B3O A;  3AGR A;  2VQF K;  3H6E A;  4EIA A;  1IKX A;  3IMX A;  3AO5 A;  1HLU A;  4DR1 K;  3SBT A;  2HW3 A;  3GDQ A;  4FVM A;  1S1X A;  3J7Z O;  3K9J A;  1HPM A;  4BE1 A;  1Q8I A;  4DQQ A;  4DV1 K;  2HBM A;  1KC8 O;  4H5V A;  2P1J A;  4AF1 A;  4BDP A;  4OPJ A;  1W0H A;  4FLZ A;  1J6Z A;  1W7A A;  4JI7 K;  4B9T A;  3MEG A;  1JLC A;  3O1B A;  3RRG A;  1EWQ A;  3O5B A;  1K73 O;  3PUF A;  1ATN A;  3PLA A;  1EO1 A;  3CJA A;  4AQY K;  4IG0 A;  3HRG A;  1GLA G;  1BA1 A;  2IOC A;  3V6D A;  1TK5 A;  1JLE A;  2YNG A;  1BA0 A;  1QSS A;  1IKV A;  1LWF A;  1TL3 A;  1B9F A;  1KD1 O;  3AV9 A;  4IXC A;  4FW2 A;  4KI6 A;  5KRS A;  1YTA A;  3BGR A;  2KQ2 A;  2X74 A;  4DFP A;  3BZC A;  4EFH A;  1NOY A;  4MDB A;  4ELV A;  4FXD A;  3FZM A;  4YHH K;  3O80 A;  3HPO A;  1ITG A;  2OPQ A;  1HNZ K;  2R7Y A;  1RCH A;  3D2E A;  3UKU A;  3QBX A;  2W6L A;  5JVH L;  4BR2 A;  3CFR A;  2NZT A;  1WSF A;  1SV5 A;  1NMD A;  1TK0 A;  4FJ9 A;  5EU7 A;  3TAE A;  3EEQ A;  5JS2 A;  3OYJ A;  2GV9 A;  1QSY A;  3ASM A;  2ETJ A;  5AQY A;  1SS6 A;  1S72 N;  4OGE A;  3KK2 A;  1TGO A;  5M1O A;  3NH2 A;  4OX9 K;  1VQ9 N;  3S3O A;  1KAZ A;  3HVR A;  2YHW A;  3THW B;  4CVN E;  3J8A A;  3C65 A;  4JKC A;  1CXU A;  3OYG A;  4FLT A;  2OYQ A;  1YXQ A;  1VQ8 N;  2E88 A;  4X62 K;  3WEE B;  4FK0 A;  3MX2 A;  1J54 A;  5C0Y A;  3D2F A;  4X64 K;  4IFE A;  2A42 A;  2OPS A;  2W6K A;  4IBN A;  3OHR A;  4AHV A;  4FJ8 A;  3I0S A;  2QWR A;  3W0L A;  5KPR A;  3V1R A;  4O0I A;  3RVC A;  3VQ5 A;  4YOV A;  4NB4 A;  3ZX0 A;  4C8K A;  3ULE B;  4KH4 A;  1OVY A;  3ENO A;  2FSJ A;  4CJQ A;  1S22 A;  3P83 D;  4WFA L;  1RDD A;  5CE3 A;  1G99 A;  2GX9 A;  2NRW A;  5FPM A;  2NRX A;  3AO1 A;  2NLX A;  2RE2 A;  2QWM A;  3LAN A;  4M3X A;  3LAM A;  3SV3 A;  1Q81 O;  3M6G A;  3ZLJ A;  4HCC A;  5CYQ A;  2ITM A;  4CJU A;  1IKY A;  1JCE A;  1XQS C;  3IG1 A;  4IOC L;  4CK1 A;  4CJV A;  3H45 C;  2P9I A;  1YF5 L;  2YHB A;  4BE2 A;  4DSF A;  3HP6 A;  2YI1 A;  1FW6 A;  3PSF A;  3ISN C;  2HHU A;  1BI4 A;  4K25 A;  2OPR A;  1Z26 A;  5AZJ A;  3G0Z A;  5H1S Q;  2F4V K;  2ZF5 O;  4CJF A;  3FFI A;  4IDH A;  3WQT A;  4WQ4 C;  3SBG A;  1HKC A;  1XHX A;  3AVC A;  3BF3 A;  1IO2 A;  1SKW A;  4CFA A;  3DLB A;  1SKR A;  2Q31 A;  2O4G A;  4L3Q A;  1K8K B;  2JWK A;  2IIR A;  4HTL A;  2HND A;  1WLJ A;  3HTV A;  4E89 A;  1GLD G;  3AGK A;  3QLH A;  3O9T A;  1HYS A;  3DMJ A;  5BPL A;  4DFJ A;  3QES A;  3JS6 A;  4YNQ A;  4KHU A;  2NNW A;  1L3S A;  3MXM A;  3B6O A;  4W5O A;  2QKK A;  3TAB A;  4O5B A;  3KTQ A;  1KVB A;  1X3N A;  1RBS A;  1ZBL A;  2ZM6 K;  1KSP A;  5KQD A;  1BU6 O;  3HBT A;  1LWE A;  4FZZ A;  2P9S A;  2WON A;  4F9O A;  1CZ9 A;  3TSP A;  4B1U B;  2A41 A;  2HF4 A;  3D45 A;  3MDQ A;  4MLH A;  3L2W A;  4DTU A;  2I7P A;  1KRP A;  3MEC A;  4FJN A;  1NJX A;  3QFP A;  1LW0 A;  1VHX A;  2XHB A;  4IKF A;  3RWU A;  2KZM A;  1C1A A;  4JKG A;  4DMN A;  4DSE A;  2FBY A;  5SWM A;  3LM9 A;  4O8K A;  1JXE A;  3S3N A;  1HQE A;  1S9E A;  4GY2 B;  1QVG M;  4FYD A;  3U3Y A;  3CC4 N;  2Y1J A;  1H1V A;  3F9K A;  1NKB A;  3P5J A;  4UY8 O;  4PKH A;  3TAG A;  1LAW A;  4BRN A;  3PV8 A;  5AQV A;  1VSH A;  4LF7 K;  4FWS A;  5AQI A;  5GIO A;  1BIZ A;  3AO4 A;  3VTH A;  3TSQ A;  3SQ2 A;  2E1Y A;  1RIL A;  1ZBH A;  4IO8 A;  4R79 A;  4FW1 A;  1BO5 O;  4BC4 A;  3HZ6 A;  4DR7 K;  3L3V A;  4CZJ A;  5AQJ A;  1QQM A;  2ATQ A;  3CCU N;  2XY8 A;  3G25 A;  2YV0 X;  2VQE K;  4WF9 L;  4FWN A;  3UE5 A;  3KK3 A;  3VQ8 A;  5JMV A;  3DLR A;  3TWH A;  4DV6 K;  1EX4 A;  3ZET B;  3K5L A;  3KHY A;  1BCO A;  1D9F A;  4M3Y A;  4BRP A;  4CE9 A;  2GUP A;  4AHT A;  1C1B A;  3OYA A;  2QEX N;  2FF3 B;  3UB5 A;  5GIP A;  1ZBF A;  2CGL A;  4B9V A;  3LP2 A;  1IBL K;  3I56 N;  1NJI O;  3AVM A;  3AAR A;  4CJW A;  4PWD A;  4KI4 A;  2VYP A;  1JL1 A;  4TSX A;  3OW2 M;  5KPT A;  5AQK A;  4LF8 K;  4B9S A;  2VGN A;  3OYB A;  4BC2 A;  3SUQ A;  1QZ6 A;  3U4L A;  2P9P B;  4A59 A;  4LY7 A;  3WXL A;  1T03 A;  2ZWH A;  4NLB A;  3EE9 A;  3O3G A;  3VQC A;  5KGX A;  2Z1G A;  5AQM A;  3TTD A;  2G8H A;  3AVK A;  1RT5 A;  1RT1 A;  3E9L A;  1B92 A;  3T1H K;  3SQ1 A;  1N34 K;  4EZ6 A;  3VF2 A;  3LP1 A;  1J53 A;  3VEN A;  2X6N A;  5CZ2 A;  3TAM A;  1ILY A;  4YOU A;  2G8W A;  3N4P A;  5AZI B;  5M1Q A;  3M8Q A;  4KHN A;  3ZT3 A;  2ASP A;  3KLF A;  1NGD A;  4R5P A;  2UU9 K;  4JKF A;  2EWS A;  4DTJ A;  4YY3 K;  1VQ7 N;  4W5N A;  5AQQ A;  2E6M A;  2HNZ A;  3MED A;  4N76 A;  1XC9 A;  5AJ3 K;  4DU3 A;  1S6P A;  5FPE A;  3IRX A;  3AVH A;  4H0O A;  4N5S A;  3MWT A;  3L0Q A;  4NCG A;  4ISF A;  4DS5 A;  4YOW A;  3NE6 A;  5AQU A;  1KFD A;  4Z94 A;  3A5M C;  2JLE A;  2HBJ A;  3NGI A;  1FXX A;  2RN2 A;  2HST A;  3MN5 A;  2E2O A;  4Q5V A;  4BY9 C;  4AHR A;  4KAZ A;  2FBV A;  1HJR A;  3ZSX A;  2YNF A;  5J2Q A;  2P5O A;  2LSN A;  3GBT A;  2AP1 A;  1YUW A;  2NRR A;  3FGU A;  1L5U A;  2YHX A;  1VSF A;  1N32 K;  4CGJ A;  1XMO K;  4HTU A;  2GEM A;  3O3F A;  2O8B A;  1XNR K;  3SLC A;  1YI2 N;  5BRF A;  1U6Z A;  4N41 A;  2XRI A;  2P9U B;  1Q9Y A;  2P9S B;  4E1M A;  3UKR B;  1IH7 A;  4CZM A;  3OS1 A;  4FJH A;  1G15 A;  3OBW A;  3JXU A;  1JL2 A;  5AQH A;  5CHI A;  3THY B;  1K8K A;  1NGG A;  2RHK A;  4CEF A;  2V51 B;  3OS0 A;  4BRI A;  3K59 A;  1UOC A;  2IC3 A;  1ESV A;  1Z25 A;  3EYZ A;  2PZS A;  3CFO A;  5HRR A;  3VEX A;  1YHQ N;  3WXK A;  3KLE A;  2X78 A;  3K2P A;  1ZBU A;  3AVF A;  3CCV N;  3OYE A;  2IVN A;  3C7N B;  4BAC A;  5C10 A;  3A8Y A;  1FJG K;  4DQI A;  4CFC A;  4AM7 A;  5J2N A;  1QZ5 A;  1IJJ A;  1I94 K;  2OA8 A;  4KH6 A;  1JLF A;  4BVO A;  5J1E A;  3QBW A;  2ZJQ L;  4FM0 A;  1TYQ A;  3CG7 A;  3QET A;  1RT6 A;  3OJU A;  3QB0 A;  4HVJ A;  2ZGZ A;  4CJT A;  3FLC O;  1DTQ A;  2DFH A;  3BF1 A;  4JI3 K;  1J9A A;  4MQ3 A;  3HST B;  4O5F A;  2O8C A;  4BE0 A;  1E4F T;  3VMF B;  1A5W A;  4ILG B;  2YX6 A;  2O8C B;  3U9D A;  1HJO A;  1BG3 A;  3E1Y A;  4IEI A;  3LP3 A;  1VSM A;  3VQD A;  5EOY A;  5DMR A;  3ULE A;  1W97 L;  1SZ2 A;  4CK3 A;  3B8A X;  2ITG A;  1VQ6 N;  4DTX A;  1RDU A;  2RKI A;  3OYD A;  4DTR A;  4FCY A;  1VK0 A;  3E9O A;  1J5E K;  4JI2 K;  1C0F A;  4MO5 A;  1OVQ A;  3QEX A;  2VG6 A;  4ELU A;  3NVM A;  5BN9 A;  3LWL A;  3IS9 A;  2JWL A;  1TKD A;  2YKM A;  1NGI A;  3DLK A;  3CCE N;  3VQA A;  4XIU A;  2ASM A;  1BQN A;  5CR4 A;  4JD2 B;  1HNV A;  4F2S A;  4CD1 A;  2HBK A;  3CME N;  2J4R A;  4CJS A;  5KRT A;  1NK4 A;  3QNN A;  3TTF A;  3CJ1 A;  3OTO K;  1OH8 A;  4JEP A;  1GLE G;  1VQ4 N;  3T1Y K;  2DFE A;  2FXU A;  2YNI A;  3CD6 N;  4K42 A;  2G8I A;  3EZW A;  3DM2 A;  3ZX3 A;  3KK7 A;  4F8R A;  4AHU A;  1N5Y A;  1UWB A;  3WNF A;  2P9N B;  4QAG A; 
#chains in the Genus database with same CATH homology
 2HHW A;  3AVL A;  4ID5 A;  3C94 A;  3LAN A;  4C8M A;  1CXQ A;  3LAM A;  3VN5 A;  3SV3 A;  3SCX A;  3TI0 A;  3L3U A;  1XHZ A;  4PUO A;  4MFB A;  3NCI A;  3EY1 A;  2KFN A;  3AO2 A;  4HCC A;  1RTI A;  5CYQ A;  4E0D A;  1TV6 A;  4CJU A;  1LWC A;  1IKY A;  3NAE A;  1IG9 A;  1XWL A;  3DLE A;  2HHV A;  3IG1 A;  4CK1 A;  1L3T A;  2XY6 A;  1LW2 A;  4CJV A;  3TR8 A;  3NF6 A;  4F3T A;  3HYF A;  1NK9 A;  2YHB A;  5C42 A;  4FJJ A;  1ZBI A;  1A5X A;  1SL1 A;  4BE2 A;  3LAK A;  3ZT4 A;  4DSF A;  4DF4 A;  3OS2 A;  3HP6 A;  5HLF A;  4FZX C;  4DLG A;  1U45 A;  3ISN C;  1SKS A;  2HB5 A;  2HHU A;  4KPY A;  3DI6 A;  1BI4 A;  2OPR A;  4OVL A;  1Z26 A;  1EP4 A;  1TK8 A;  1NKE A;  1QHT A;  4Z4C A;  3NH1 A;  4FJM A;  4KHN A;  3G0Z A;  4KKO A;  4CJF A;  2G8K A;  1Y97 A;  3HO1 A;  3U3G A;  3FFI A;  3QIO A;  4OLB A;  3VQE A;  3V9U A;  2XO7 A;  4CIE A;  4RW8 A;  4CGD A;  4OKK A;  1XHX A;  3AVC A;  2HVH A;  1KVC A;  3MAQ A;  4CFD A;  3K5N A;  1NK7 A;  4CCH A;  1S1T A;  4KHW A;  4QCL A;  3ZCM A;  2PYJ A;  1IO2 A;  1SKW A;  3VQ7 A;  4CFA A;  3DLB A;  2HNY A;  3QER A;  1SKR A;  2OPP A;  2O4G A;  4AHC A;  3V9Z A;  4CIF A;  3ITH A;  2BGG A;  4CGI A;  2FC0 A;  2HND A;  1WLJ A;  2ZQB A;  4E89 A;  3U6F A;  2VG7 A;  1X9S A;  3O4Q A;  3QLH A;  3SQ0 A;  2ZD1 A;  4ELT A;  3MEE A;  2B5J A;  4FM1 A;  1HYS A;  3DMJ A;  4IG3 A;  1CZB A;  1MU2 A;  4DFJ A;  3QES A;  1NJW A;  4ID1 A;  4CHY A;  4YNQ A;  4KHU A;  2X6S A;  4CEO A;  4KRF A;  4J2E A;  2KZZ A;  1D5A A;  3VQ4 A;  3JYT A;  1L3S A;  5DK5 A;  3MXM A;  3B6O A;  4CF8 A;  4W5O A;  4JS5 A;  2QKK A;  2KW4 A;  3TAB A;  3C95 A;  4O5B A;  4RW6 A;  5KI6 A;  3OYK A;  3KTQ A;  1BCM A;  1TAQ A;  1KVB A;  3KK1 A;  2BDP A;  2NUB A;  1RBS A;  1ZBL A;  4KHY A;  5HRP A;  4QOZ B;  1KSP A;  2ZE2 A;  4O4G A;  4FJ5 A;  2D0B A;  1C0U A;  1LWE A;  4FZZ A;  1U4B A;  1NK6 A;  4FJ7 A;  3KD1 E;  1QTM A;  4RW7 A;  2WON A;  3MXJ A;  4FZY A;  3PO4 A;  4B9U A;  1CZ9 A;  3NH0 A;  2KFZ A;  4EP4 A;  4Y1C A;  5K14 A;  3DOK A;  3D45 A;  5JS1 A;  3L2W A;  4DTU A;  1NK0 A;  3SPY A;  4CJ3 A;  3DLH A;  3NF7 A;  2IGI A;  1JLG A;  4DSL A;  1KRP A;  1S1U A;  3DYA A;  4FM2 A;  1SL0 A;  3MEC A;  4FJN A;  3AA2 A;  3AVJ A;  4ZHR A;  3NHG A;  4DTM A;  4KTW A;  1NJX A;  4KTZ A;  4CEB A;  1QSL A;  3HP9 A;  4WE1 A;  5FRN A;  2VWJ A;  1BIS A;  1WSG A;  1LW0 A;  2B4J A;  1QE1 A;  2VG5 A;  1WAJ A;  2XHB A;  1SUQ A;  1KFS A;  1RNH A;  4IKF A;  1WNS A;  3RWU A;  2KZM A;  1C1A A;  2JGU A;  3LWM A;  4M3X A;  3RMD A;  3ZSY A;  3G10 A;  1U48 A;  1C6V A;  4DMN A;  3S3M A;  1RDC A;  3LPT A;  1NK8 A;  1EET A;  4KAZ A;  3HT3 A;  5FDL A;  4DSE A;  2FBY A;  5SWM A;  4DWI A;  1U04 A;  1VSJ A;  4W5T A;  1JXE A;  4E7L A;  3V4I A;  1TVR A;  4ZTJ A;  1SL2 A;  3S3N A;  2IAJ A;  4LH5 A;  4E19 A;  1X9M A;  4FK4 A;  1HQE A;  3VQ9 A;  4DQP A;  1S9E A;  3VA0 A;  1Q9X A;  4FYD A;  3K57 A;  1F21 A;  3QO9 A;  4AIL C;  3SNN A;  3U3Y A;  1RT7 A;  1CLQ A;  4FJI A;  2Y1J A;  4OKE A;  5HRO A;  1WSE A;  4NYF A;  1C1C A;  3F9K A;  4IFV A;  2DFF A;  1NKB A;  3RR7 A;  4LD0 A;  3P5J A;  3TAG A;  3OJS A;  1LAW A;  4FLV A;  3PV8 A;  4DSI A;  4FJG A;  1FKO A;  3SJJ A;  4RW9 A;  1VSH A;  3WNG A;  1VSK A;  3DOL A;  3OY9 A;  4KO0 A;  2F96 A;  2DTU A;  1BIZ A;  3NDK A;  3AO4 A;  4CJR A;  1D9D A;  3IAY A;  4J2A A;  3C6T A;  1WAF A;  4H4M A;  3SQ2 A;  1YVU A;  1RIL A;  1BGX T;  4IDK A;  1U47 A;  1YT3 A;  1I3A A;  4CIG A;  2HHX A;  3M8P A;  4DSK A;  1ZBH A;  1X9W A;  1BHL A;  3WNH A;  5J2P A;  5I3U A;  1ASV A;  4HUG A;  4KB0 A;  1WSJ A;  4FW1 A;  4M3T A;  1I39 A;  3ULD A;  1T05 A;  3L3V A;  3M8R A;  4L8R B;  3V81 A;  4M3R A;  4FJL A;  4E1N A;  5E41 A;  4HCB A;  2ATQ A;  2XY8 A;  3HPG A;  4NCA A;  1LAV A;  3AVB A;  2YV0 X;  1RTD A;  3K5O A;  4CJP A;  2Q3S A;  1GOA A;  3CM6 A;  5KTQ A;  4Z4E A;  2F8S A;  3NGZ A;  3KK3 A;  1RT4 A;  4M42 A;  3NGY A;  3VQ8 A;  2QK9 A;  4B08 A;  3DLR A;  3TWH A;  3EZ5 A;  3RMC A;  1JLA A;  4GMJ B;  1EX4 A;  4YFU A;  4OJR A;  3K5L A;  3V1O A;  3SPZ A;  4Z4I A;  3VA3 A;  1TAU A;  1T7P A;  1BCO A;  3QEV A;  1D9F A;  4M3Y A;  4BWM A;  3AA5 X;  4CE9 A;  5J2M A;  4DU1 A;  4AHT A;  1C1B A;  3OYA A;  3THV A;  1A5V A;  2G8F A;  4J2D A;  4FJK A;  3VQQ A;  1TKT A;  2IDO A;  4KFB A;  4CEC A;  4B8A B;  1N6Q A;  4G1Q A;  4Y1D A;  5CY4 A;  3ALY A;  4CHZ A;  4OPK A;  1ZBF A;  3AA3 A;  4CHN A;  2PYL A;  4BDZ A;  3SYZ A;  4JLH A;  4F2R A;  4B9V A;  3LP2 A;  1KCF A;  4JS4 A;  4F3O A;  3RRH A;  1GOC A;  2DY4 A;  1NJZ A;  3HJF A;  1BIU A;  4FLW A;  3AVM A;  1L3V A;  3I8D A;  4CJW A;  4PWD A;  4I2Q A;  4KI4 A;  4KV8 A;  4O55 A;  1QS4 A;  4DTN A;  1JL1 A;  3T19 A;  3LPU A;  4FK2 A;  4TSX A;  1ASU A;  3L2R A;  3L8B A;  4K8X A;  2I5J A;  3OYN A;  1C0T A;  3OYH A;  2Z1I A;  4B9S A;  3DLG A;  3QIP A;  4CGG A;  1ZYQ A;  3ZT0 A;  4RW4 A;  4DLE A;  3OYB A;  4DFK A;  4B9N A;  2E4L A;  4CED A;  3RMA A;  3SUQ A;  3TAF A;  2QKB A;  1IKW A;  4CJL A;  1T8E A;  1B9D A;  3V1Q A;  1U49 A;  3NF9 A;  4M41 A;  3SV4 A;  4LY7 A;  4CEA A;  2GBZ A;  1T03 A;  1VSL A;  4CK2 A;  3O3G A;  3VQC A;  1RBT A;  4E3S A;  2BAN A;  5KGX A;  2Z1G A;  4M3W A;  3HVT A;  4I9L A;  1TL1 A;  5HP1 A;  3A2F A;  2G8H A;  1KLM A;  3AVK A;  1O1W A;  4KB1 A;  3LZJ A;  4LSL A;  1RT5 A;  1EXQ A;  4HUF A;  3SI6 A;  3SQ4 A;  2IS3 A;  1RT1 A;  2D0A A;  2YKN A;  1B92 A;  4OGC A;  1HMV A;  3ZSQ A;  3OYF A;  3SQ1 A;  1HYV A;  3L2V A;  4DTO A;  3PX0 A;  4EZ6 A;  4DFM A;  3SUN A;  4CES A;  1S1W A;  3T3F A;  1RBR A;  3LP1 A;  4O0J A;  3ZSR A;  3PX6 A;  4KHS A;  1J53 A;  1ASW A;  1HPZ A;  4K8Z A;  3OVN A;  2X6N A;  3WNE A;  5CZ2 A;  4DS4 A;  4O44 A;  1HRH A;  3TAM A;  1RTJ A;  3P1G A;  4N56 A;  3OYM A;  1LV5 A;  1L3U A;  2G8W A;  1KVA A;  4FJX A;  3M8Q A;  4IFY A;  4CHO A;  3V9X A;  3ZT3 A;  1JLB A;  3KLF A;  4ZTF A;  4CF0 A;  4C8O A;  4PA1 A;  4CJK A;  4R5P A;  3CQ8 A;  3VQ6 A;  3RMB A;  3TAR A;  4DTJ A;  4CGF A;  4KHQ A;  2EHG A;  2Z1J A;  3CFP A;  1K6Y A;  5CYM A;  3OYI A;  2XY7 A;  3I0R A;  3ZSV A;  3H08 A;  3QEW A;  1D8Y A;  1HQU A;  3F73 A;  3HK2 A;  4W5N A;  2E6M A;  2HNZ A;  4E7I A;  3K5M A;  3MED A;  4M45 A;  4N76 A;  4BWJ A;  1XI1 A;  1XC9 A;  1EKE A;  3RTV A;  3TAQ A;  5HRN A;  4DU3 A;  4I9Q A;  1S6P A;  3IRX A;  3HPH A;  2FBT A;  3AVH A;  4DG1 A;  4N5S A;  4E7J A;  1VSE A;  4Z0U A;  4NCG A;  4BDY A;  1KTQ A;  4DQR A;  5HRS A;  4DS5 A;  4Z4H A;  4DTS A;  2P5G A;  4CFB A;  3V9S A;  2RPI A;  3NE6 A;  4B8C A;  1KFD A;  3ZSO A;  2JLE A;  3NGI A;  4E7H A;  1FXX A;  2RN2 A;  5SZT A;  4Q5V A;  4AHS A;  3OYL A;  3KJV A;  4AHR A;  4FLX A;  3KLG A;  2FBV A;  1HJR A;  3ZSX A;  2YNF A;  3KLH A;  1TKX A;  5J2Q A;  5KGW A;  2LSN A;  2G8U A;  2P5O A;  4B9L A;  1FK9 A;  4B3O A;  2F8T A;  2HMI A;  4CF9 A;  4C8L A;  1IKX A;  4OLA A;  1C0M A;  1L5U A;  3AA4 A;  4DTP A;  3QEP A;  1VSF A;  4CGJ A;  3AO5 A;  4Z4G A;  5HBM A;  4ICL A;  5C25 A;  3SZ2 A;  1DLO A;  3AO3 A;  3LDS A;  4HTU A;  4FLU A;  4I7F A;  2HW3 A;  4LH4 A;  3O3F A;  4CER A;  4N47 A;  2YHA A;  3CYM A;  4FVM A;  1S1X A;  3C6U A;  3UIQ A;  1J5O A;  4N41 A;  2XRI A;  1TKZ A;  3KLI A;  2OZS A;  1BQM A;  4CEE A;  1Q9Y A;  3AVG A;  4BE1 A;  1Q8I A;  4DQQ A;  4E1M A;  3TAN A;  4CJE A;  3BDP A;  1IH7 A;  4CHQ A;  3OS1 A;  4DQS A;  2P1J A;  1WN7 A;  3AVI A;  3K58 A;  4FJH A;  1G15 A;  4F4K A;  4BDP A;  2VWK A;  1JL2 A;  4OPJ A;  3AVA A;  4C8N A;  1W0H A;  1R0A A;  1JKH A;  1UAX A;  4FLZ A;  4W5Q A;  4DU4 A;  4CEF A;  2XY5 A;  4EP5 A;  2E6L A;  3OS0 A;  3ZT1 A;  1JXB A;  4B9T A;  3E01 A;  3K59 A;  1UOC A;  3MEG A;  3TAP A;  1JLC A;  3RRG A;  2IC3 A;  4M3Z A;  2G8V A;  1RBU A;  1Z25 A;  3EYZ A;  2PZS A;  3CFO A;  1REV A;  5HRR A;  3PUF A;  3HXM A;  1RBV A;  1GOB A;  5D3G A;  2KTQ A;  5C24 A;  3KLE A;  2X78 A;  4CJ5 A;  3S9H A;  2EX3 A;  3K2P A;  1ZBU A;  3AVF A;  4IG0 A;  3OYE A;  4NCB A;  4JRQ A;  1S9G A;  4JRP A;  4AH9 A;  2IOC A;  3V6D A;  1TK5 A;  1W9H A;  2RF2 A;  1JLE A;  1X1P A;  2YNG A;  4BAC A;  5FRM A;  4KRE A;  4CF1 A;  4DQI A;  1QSS A;  1IKV A;  1LWF A;  1TL3 A;  4DF8 A;  1B9F A;  3L2U A;  4CFC A;  3AV9 A;  3LP0 A;  3HM9 A;  5I42 A;  4FW2 A;  5J2N A;  2HHQ A;  2GUI A;  4KI6 A;  1S6Q A;  1RT3 A;  2OA8 A;  1JLF A;  5KRS A;  1YTA A;  3O3H A;  3BGR A;  5J1E A;  3HL8 A;  1YTU A;  2KQ2 A;  1VRU A;  2X74 A;  4OKJ A;  4DFP A;  2BE2 A;  4FM0 A;  3CG7 A;  4EZ9 A;  3ZSW A;  1QQC A;  3KKS A;  4GVM A;  1DTT A;  4CHP A;  1RT6 A;  3OJU A;  4FLY A;  3QET A;  1NOY A;  3DRS A;  5T7B A;  4M3U A;  2D5R A;  1RDB A;  4HVJ A;  1S1V A;  4CEQ A;  4CJT A;  3KD5 E;  1BL3 A;  1DTQ A;  2DFH A;  2B6A A;  3O4N A;  4CF2 A;  1UA1 A;  4ELV A;  4Z4F A;  2P51 A;  1J9A A;  4DSJ A;  3KKR A;  4MQ3 A;  3HPO A;  3HST B;  1NK5 A;  1JLQ A;  4PY5 A;  4BE0 A;  3RR8 A;  1A5W A;  3QNO A;  1ITG A;  3PO5 A;  2OPQ A;  3PX4 A;  2R7Y A;  2PY5 A;  4B9M A;  1RCH A;  3LZI A;  2OZM A;  3CFR A;  2O4I A;  3LP3 A;  1VSM A;  3AVN A;  1WSF A;  4RG8 A;  1SV5 A;  3VQD A;  3JSM A;  5DMR A;  1RDA A;  1TK0 A;  1NOZ A;  4FJ9 A;  5EU7 A;  4CK3 A;  4QAG A;  5FRO A;  3TAE A;  5JS2 A;  4CJ4 A;  4CEZ A;  2ITG A;  3OYJ A;  1NJY A;  4H4O A;  2GV9 A;  1QSY A;  4DTX A;  3ASM A;  1VSI A;  2D0C A;  4NYN A;  2ETJ A;  2RKI A;  3OYD A;  4DTR A;  3DRR A;  4OGE A;  3KK2 A;  4FCY A;  1VK0 A;  1TGO A;  3NH2 A;  4E7K A;  4J2B A;  2W42 A;  3QEX A;  2FBX A;  2VG6 A;  3NF8 A;  3SUO A;  3S3O A;  4HUE A;  1RTH A;  2A1R A;  4H8K A;  1UA0 A;  4ELU A;  3OYC A;  3LWL A;  3ZSZ A;  3IS9 A;  3HVR A;  5CZ1 A;  1TKD A;  2YKM A;  4KTQ A;  3DLK A;  1CXU A;  3LAL A;  3VQA A;  4XIU A;  3OYG A;  1BQN A;  4FLT A;  2OYQ A;  2HVI A;  4Q0B A;  2Y1I A;  1KLN A;  1RT2 A;  3T1A A;  4UQG A;  4PQU A;  4HHT A;  1HNV A;  4F2S A;  1HYZ A;  3ZT2 A;  4FK0 A;  2Z1H A;  4I2P A;  1J54 A;  2A1S A;  4LSN A;  4CJS A;  2HHT A;  5KRT A;  3CM5 A;  1S5J A;  3L2Q A;  2OPS A;  3QIN A;  4CGH A;  3VQP A;  1NK4 A;  3SUP A;  3QNN A;  4IBN A;  4W5R A;  3D0P A;  1VRT A;  2AJQ A;  3VQB A;  4AHV A;  3NBP A;  3V9W A;  2DFE A;  1HNI A;  3I0S A;  4FJ8 A;  2YNH A;  2YNI A;  3DRP A;  4FXD A;  3V1R A;  4O0I A;  2WOM A;  3NFA A;  1VSD A;  4GW6 A;  1WSI A;  3VQ5 A;  2G8I A;  2HHS A;  3DM2 A;  3M8S A;  4C8K A;  1FKP A;  3MXI A;  3PY8 A;  1BI4 B;  1WSH A;  3B6P A;  3KIO A;  4CJQ A;  4F8R A;  4AHU A;  1N5Y A;  3P83 D;  1RDD A;  1UWB A;  2QXF A;  3QEI A;  1NKC A;  3WNF A;  3AO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...