4CJ4A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cj4A00
4CF0A 1QQCA 1Q9XA 3SUQA 4KI6A 1SL1A 2G8FA 1JKHA 3T1AA 1RBRA 1U48A 4E1NA 1C0UA 1J9AA 1TK8A 3I8DA 1I39A 1TKZA 3LPUA 2KZZA 3OYCA 3OS2A 2YNHA 3QIPA 4DQIA 2XRIA 1EXQA 4FJ7A 1QSLA 1IO2A 2OPSA 4Z4EA 1YVUA 1BIUA 1C1CA 2D0BA 4KHQA 4M3XA 3KTQA 4AHTA 4FCYA 1RDAA 2G8KA 5SZTA 4B9UA 3QESA 5KI6A 3MECA 2D5RA 4LSLA 4Z4CA 1QTMA 1BCMA 4F8RA 4RW8A 2XY6A 3TABA 4AH9A 4CHPA 4E3SA 1X1PA 4CEZA 3TR8A 4LY7A 3SQ1A 4N56A 3HPOA 2Y1JA 3JSMA 2B6AA 1R0AA 1DTTA 3QEIA 4O0IA 1GOCA 5CYMA 4CF9A 5KRTA 4BE0A 4OKEA 1JLFA 2HNZA 4CJ3A 4CESA 3OYEA 5FROA 4EP4A 2IOCA 3HSTB 1N5YA 4DSIA 2BANA 3G0ZA 3EYZA 4JRQA 1A5XA 3LALA 4KB1A 1KVAA 4DTJA 3DM2A 2DTUA 5KTQA 3VA0A 5D3GA 4N5SA 3S3MA 3AVJA 4KKOA 2FBTA 4KB0A 4CJ4A 3E01A 3KLFA 3AVIA 1WSFA 3DYAA 4CGGA 1YTAA 3OS1A 1TKTA 3O3FA 4FW1A 1XI1A 2GBZA 1WAFA 4CEDA 4OLBA 2O4GA 4O44A 4H4OA 1HJRA 1VK0A 1IH7A 3KLEA 3OYIA 2IDOA 2Z1JA 3M8RA 1DLOA 3AO2A 4OGCA 4FJMA 4C8LA 2HHTA 3OYDA 1WSJA 3PO4A 5KRSA 1QS4A 4ID5A 3ZSWA 4AHSA 4J2EA 4I9QA 4M3RA 3LWLA 3P1GA 3KK3A 1U04A 1W0HA 2VG5A 4KO0A 3CFRA 4C8OA 3AVFA 1C0MA 1RDBA 1WNSA 3ZT3A 2G8UA 3H08A 4PUOA 1VSDA 3LP3A 2W42A 3AVKA 1YTUA 3DI6A 4CJPA 3LP0A 4KTWA 4DTMA 4KHUA 4M3ZA 4PWDA 4BDZA 3L2RA 3AVMA 1T7PA 3AVLA 1NOZA 1LWCA 1FKPA 1Y97A 3DMJA 3DRPA 4K8XA 3O3GA 1D5AA 4EP5A 4W5TA 3SUOA 4FJ5A 4DTXA 4FJLA 2HVIA 3KIOA 3CM6A 1SUQA 2R7YA 4ELTA 4KI4A 2F8TA 3BGRA 1S5JA 3MEDA 3ZSZA 1BQNA 4OJRA 5C42A 2P51A 2OPQA 4F2RA 2NUBA 4F3TA 1RT1A 5HBMA 1HYZA 1LAWA 4LSNA 4W5QA 4OKJA 1GOAA 4E7KA 5HROA 1WAJA 3DLEA 3P5JA 1EP4A 1TL3A 3MXMA 3RR7A 4FK4A 1C6VA 1WN7A 4R5PA 2FBYA 1T8EA 1ZBFA 1TV6A 4ICLA 1JLCA 4CK2A 2G8IA 3KLHA 4DWIA 4NCGA 4CJWA 4WE1A 3TAPA 1UA1A 5HLFA 4KFBA 4B08A 1NK8A 1SKWA 1D8YA 2G8WA 2QKKA 4BE2A 2XHBA 4CJUA 2IAJA 4DTUA 4C8KA 3HK2A 5FDLA 3EY1A 5E41A 2XO7A 1CXQA 1ASVA 5FRNA 3VQAA 3RRGA 1BQMA 4FYDA 4FLWA 3CFPA 4FM1A 1LV5A 2PYJA 1IKXA 3WNFA 4RG8A 3CFOA 4F4KA 1LWEA 1VSIA 4FZXC 3VQ8A 1QE1A 1TKXA 2OPPA 2X6NA 4HCCA 4W5RA 1U4BA 3AVHA 3KKRA 3NDKA 2HHWA 3DLKA 3IRXA 5CZ2A 4B9LA 3ZT1A 2Y1IA 2YNGA 3NBPA 3PX4A 2OZSA 4DTOA 4Q0BA 3MEGA 4FZYA 3TAEA 2P5GA 3LZIA 4KTZA 3KLGA 4DS4A 3QEPA 1SL2A 1A5VA 3M8SA 1DTQA 1NJWA 1ZYQA 2BDPA 1QHTA 2D0CA 3U3GA 3OJUA 3HP6A 4I2PA 5JS1A 3V9ZA 4CFAA 1GOBA 5EU7A 1UWBA 4KHYA 1NJZA 4GW6A 3OS0A 3K59A 4CJRA 4NCAA 1KLNA 4CHYA 3TWHA 3QO9A 2RPIA 2YKMA 4Z4IA 2Z1GA 4CIEA 3WNGA 4CJKA 3EZ5A 1LW0A 1WSGA 2HHQA 1YT3A 3K5MA 1F21A 4CHOA 3NH0A 1VSHA 1ZBLA 4KRFA 4M3YA 2HHUA 1BI4A 1BGXT 4KREA 1S1TA 3U3YA 3VQ4A 2KQ2A 3AA5X 3CYMA 3OYBA 2KFZA 4BACA 1HNIA 1VSJA 1J5OA 1S1UA 3RMBA 3LPTA 4J2BA 3HPHA 1JXBA 1RBVA 1VSFA 4AHCA 3K5NA 3CG7A 5HRNA 3QEVA 4IKFA 2XY5A 3RMCA 2G8VA 4O4GA 1LAVA 4NYFA 1IG9A 1K6YA 4CJFA 1G15A 3D45A 1HNVA 1TAUA 2ATQA 3HVTA 1X9MA 4F2SA 4OLAA 4FJ8A 1TVRA 5I3UA 3PO5A 3V9WA 4AHRA 5I42A 1HYSA 2FBXA 1RTHA 4CFCA 4DSEA 3UIQA 1KVBA 1U45A 3I0SA 1VRUA 4F3OA 5HRSA 4Y1DA 1RT3A 3AO5A 4DS5A 1S9GA 1Z26A 2WONA 3WNHA 4OVLA 4DU1A 1NK7A 4FJKA 3VQCA 5C25A 1KTQA 2KZMA 2VG6A 3VN5A 3THVA 4Q5VA 3SI6A 4W5NA 1HPZA 2Z1IA 4IBNA 2HHXA 4E1MA 3HYFA 3F73A 3SPZA 5CYQA 4H4MA 3SYZA 3PV8A 3NHGA 5DK5A 3OYNA 1RNHA 4NCBA 4FXDA 4TSXA 4YFUA 4M42A 4B9TA 2RF2A 4CEFA 3NCIA 4FJNA 3AVCA 4FM2A 1U47A 4PQUA 2BE2A 4ZTFA 3HJFA 3DOLA 4FJGA 4EZ6A 5KGXA 3B6OA 4ID1A 2XY7A 3AO3A 4CHZA 1SKRA 1IKYA 3V1QA 4HUFA 4B9VA 1B92A 4GVMA 4J2AA 3AVAA 3I0RA 5KGWA 3ASMA 4FLUA 3A2FA 4DF8A 3M8PA 2RKIA 3AV9A 3P83D 3LDSA 4DTPA 3VQ6A 3V81A 1QSYA 4HUGA 1J54A 2G8HA 3AO1A 4M3UA 4HUEA 3C6TA 3NGIA 3HL8A 3ZSOA 3SPYA 4M3WA 1REVA 3TAGA 4O55A 4CF1A 3SUNA 3U6FA 1FXXA 3ZSXA 1JLEA 3SQ0A 3KKSA 4FW2A 3ZCMA 2IS3A 4O5BA 1Q9YA 2YHAA 2PY5A 1NK4A 1JLQA 2BGGA 3OYGA 4DF4A 3TANA 2IC3A 1KFDA 3IAYA 2RN2A 1JXEA 3G10A 4J2DA 1FKOA 1HYVA 5CZ1A 4UQGA 3OYMA 4CFDA 4DQQA 4K8ZA 1ZBHA 4Z4GA 4MQ3A 3V1OA 4E19A 4CF2A 4DSKA 4RW9A 3AVBA 5T7BA 4E0DA 4I9LA 4B9SA 5J1EA 2DFFA 3L8BA 4DTSA 4JRPA 4CGHA 5J2PA 3QNNA 3V6DA 1WSEA 3V1RA 3NAEA 4CJEA 3HO1A 4DFJA 3NF9A 3WNEA 4L8RB 1ZBUA 2QKBA 4HHTA 3TARA 3LAKA 3VQPA 4CJQA 3S9HA 4E7IA 2D0AA 1VSMA 1SL0A 3C95A 4CEEA 4CIFA 1RT5A 1RILA 3DLGA 3SJJA 3ISNC 3K2PA 4DU3A 1TAQA 2OYQA 2B4JA 2KFNA 3DOKA 4HVJA 3OY9A 3SCXA 4CIGA 4FJHA 4FZZA 3O4NA 1T03A 3ZT4A 4M3TA 3DRSA 1U49A 2VWJA 4OGEA 2QXFA 1XHZA 4CEBA 1IKVA 1CZ9A 3AA4A 3OYFA 3NF8A 4PA1A 1S6QA 1ASUA 3TAQA 2E6LA 2KW4A 4RW6A 2F8SA 4QCLA 4BE1A 3OYHA 4BDYA 1TK0A 1BI4B 4LH5A 1QSSA 4E89A 2P5OA 1N6QA 4CFBA 1KRPA 3O3HA 3LP2A 2JLEA 4B8AB 1MU2A 4HTUA 1IKWA 4N47A 4Z4FA 1RDDA 3V9SA 4CJ5A 3RRHA 1NK6A 1XHXA 4IDKA 3VQ9A 4CJVA 1ITGA 3L2QA 3RWUA 3C6UA 3L3VA 3NE6A 5J2QA 4B8CA 4N41A 1SV5A 5K14A 2EHGA 3OYLA 4FVMA 1EKEA 4DSJA 1VSEA 2I5JA 1Z25A 2B5JA 1I3AA 3CM5A 3FFIA 1RBSA 4I2QA 2VWKA 2HNYA 3QINA 1RT7A 4LD0A 3ZSRA 1RTDA 1D9FA 1RBUA 1BHLA 2HNDA 4CJTA 3OJSA 3LAMA 4IFYA 4MFBA 3L3UA 3L2WA 1D9DA 4FJXA 2HW3A 3NGZA 3V4IA 4C8NA 1WSHA 4LH4A 4BWMA 2IGIA 1L3VA 2OA8A 1BCOA 4ELUA 3QLHA 3QETA 3K57A 3SUPA 3KK1A 2ZD1A 4DSLA 1BISA 3K5OA 3OYKA 2YKNA 4CK3A 2YNIA 4PY5A 4QOZB 4CERA 1NKCA 1L3SA 4C8MA 1A5WA 4KAZA 4AHVA 4BWJA 1J53A 2X78A 4FJ9A 3VQ5A 1L5UA 1NK5A 1L3TA 5JS2A 1C1BA 4IFVA 4QAGA 1O1WA 3VQQA 1WLJA 3S3NA 1NK0A 4ZHRA 3NH1A 2X6SA 4FJJA 4CEQA 4OKKA 1XC9A 2DFHA 3PY8A 4DMNA 4B3OA 3ZSYA 4BDPA 4E7LA 2A1RA 1JLGA 4FLXA 2QK9A 1W9HA 1WSIA 1HQEA 3ZT2A 3RR8A 2LSNA 3KD1E 4HCBA 2HHVA 1KCFA 4B9MA 1B9DA 3HPGA 3HXMA 1ZBIA 1RTIA 3HP9A 2GV9A 4IG3A 1JL2A 5C24A 3KK2A 4DFKA 3PX6A 3QERA 4FK0A 1T05A 2FBVA 2JGUA 5J2MA 4CE9A 3MXIA 2KTQA 3ZSVA 1NKBA 3HM9A 4YNQA 3V9UA 2PZSA 1CLQA 3K58A 2E4LA 1JL1A 4ELVA 5CY4A 1X9SA 1VSLA 3QEXA 1RDCA 1NJXA 2DFEA 2ETJA 3SV3A 2HMIA 3ZSQA 4AHUA 4KPYA 1XWLA 3MXJA 4CJSA 3LWMA 1RT6A 3KJVA 1RT4A 2XY8A 3SV4A 1NKEA 1UOCA 2YNFA 3IG1A 1NOYA 3VA3A 3SNNA 4CGJA 3VQEA 1UA0A 1B9FA 4XIUA 3DRRA 1TL1A 3DLBA 4JLHA 3L2UA 3B6PA 4DFPA 3NFAA 2HVHA 3IS9A 4CECA 1KFSA 4B9NA 3VQBA 5HRRA 4CF8A 3HT3A 3T3FA 1C1AA 3F9KA 3CQ8A 3AVGA 2AJQA 3OVNA 3SQ4A 1Q8IA 1ASWA 4DLGA 4FJIA 3OYJA 1C0TA 3M8QA 2PYLA 3DLHA 1LW2A 2YV0X 4N76A 4JS5A 1S6PA 2DY4A 4DQRA 1KSPA 3KLIA 3OYAA 2EX3A 3NF7A 4M45A 4CGIA 3PX0A 4E7HA 1L3UA 3ULDA 3DLRA 1TKDA 2GUIA 4RW4A 4DQSA 3QIOA 4CHNA 1HQUA 2YHBA 3KD5E 4OPJA 2X74A 5HRPA 5SWMA 1CZBA 4FM0A 3AO4A 3QEWA 3S3OA 4ZTJA 4EZ9A 4KHWA 1S1VA 2HB5A 1S1WA 4O0JA 4H8KA 1RBTA 1BL3A 4OPKA 5FRMA 1X9WA 1UAXA 4W5OA 3T19A 3LZJA 3ALYA 2HHSA 1RT2A 4GMJB 1FK9A 4CCHA 3QNOA 1HRHA 4CGFA 4FLZA 3VQ7A 4FLTA 1BIZA 4DQPA 1JLBA 3AA3A 5J2NA 2O4IA 2ITGA 3D0PA 2FC0A 3RMAA 4IG0A 3TAMA 3NF6A 4KHNA 3HVRA 3BDPA 3MEEA 3V9XA 1NJYA 3MAQA 4FK2A 3JYTA 4KHSA 3SQ2A 2A1SA 4CEAA 4JS4A 4CJLA 4DFMA 2F96A 4FLYA 2OZMA 2P1JA 5DMRA 1S1XA 3AVNA 1TGOA 4NYNA 1EX4A 1VSKA 3L2VA 4DG1A 1LWFA 4CK1A 3K5LA 1SKSA 1EETA 2OPRA 4CGDA 3AA2A 3SZ2A 1NK9A 4RW7A 2E6MA 4E7JA 3RMDA 4DU4A 4DTRA 2Z1HA 1RCHA 4DTNA 2VG7A 3ITHA 3LP1A 1VRTA 1HMVA 1KVCA 3LANA 3TI0A 2ZQBA 3PUFA 4DSFA 1RTJA 4AILC 3NGYA 2Q3SA 3C94A 1S9EA 4Y1CA 3O4QA 4KV8A 2WOMA 4Z0UA 1KLMA 4Z4HA 3NH2A 3VQDA 4DLEA 4KTQA 1CXUA 3TAFA 4CHQA 4CEOA 1TK5A 4G1QA 4FLVA 4M41A 1JLAA 3RTVA 5HP1A 3ZT0A 4I7FA 2ZE2A
chains in the Genus database with same CATH superfamily
1Q9XA 3VERA 1SL1A 3T1AA 1J9AA 4LC9B 1I39A 1TKZA 2ZJPL 1KXPA 3VOVA 4DQIA 3N4QA 3F2KA 4Z4EA 2WC9A 1YVUA 4DHYA 1K8KA 1BIUA 2D0BA 5FLXO 4KHQA 4FCYA 1RDAA 5SZTA 3UKUA 2D5RA 4CW7B 1QTMA 4RW8A 2Q31A 2XY6A 4LY7A 1NMDA 3HPOA 2B6AA 4JD2A 1R0AA 2AA4A 1JCGA 4JHDB 4O0IA 2P9LB 4BE0A 5KRTA 1JLFA 4CESA 4EP4A 2DPNA 4DSIA 3HSTB 5AQMA 3G0ZA 1Z6RA 4KB1A 4FWLA 4FVUA 5KTQA 5D3GA 3S3MA 5BR9A 3AVJA 4KKOA 2FBTA 4X65K 3CD6N 3L4IA 3AVIA 1NGAA 4BRQA 3J7ZO 3DYAA 1YTAA 1TKTA 1XI1A 4O44A 4H4OA 1HJRA 3THYB 3OYIA 4DV5K 2QWNA 4B1ZA 4C8LA 1I94K 2HHTA 5KRSA 1QS4A 3P1GA 5KPZA 3KK3A 3CFRA 4C8OA 5AQSA 1ZBSA 3B8AX 1GLJO 4BR7A 1M90O 1HKGA 2NRXA 3D2FB 3LP3A 3VGMA 4H5TA 4WFBL 4KHUA 4BDZA 3ZX3A 3TSUA 2Q0RA 3AVMA 2RHKA 1FKPA 3DMJA 3O3GA 1Q86O 4EP5A 4JKAA 2HVIA 2QEXN 1SUQA 4ELTA 3BGRA 1S5JA 1BQNA 2QWQA 2BTFA 1K9MO 4W5QA 4JI8K 4E7KA 3RR7A 3DLEA 3E9LA 1EP4A 3P5JA 4FK4A 4R5PA 5I9EB 1TV6A 1JLCA 2D0OA 4DWIA 1VQ8N 1DT9A 4ISEA 1D8YA 2QKKA 1OH7A 2WUSA 4NLBA 3SBGA 4BY9C 5FDLA 3EY1A 5E41A 1EO1A 4O8UA 3N4PA 4KH6A 4FYDA 3DLLL 5E26A 1IKXA 3P38A 3CFOA 3NMUA 4FZXC 5AQWA 4W5RA 1U4BA 3CERA 1YITN 2HHWA 4B9LA 5KQDA 2Y1IA 2YNGA 3NBPA 3PX4A 4DTOA 4Q0BA 3MEGA 4WQ4A 4DS4A 3DXKA 1A5VA 5AQKA 2D0CA 3OJUA 3WXLA 1WB9A 5JS1A 4CFAA 1E3MA 3KWGA 1FJGK 4CJRA 2O8EB 4JK7A 2A3ZA 3QO9A 1ATRA 2NRWA 3BY5A 4B3RK 3WNGA 4B1UB 4BRKA 1WSGA 1YT3A 4KRFA 3CCUN 2D1KA 4U7BA 4BACA 4NLCA 3LPTA 1VSFA 2UYTA 4GY2B 5HRNA 3QEVA 1RGIA 3O5BA 4IKFA 3RMCA 2G8VA 4O4GA 2E1ZA 1K6YA 4CJFA 1G15A 3D45A 4RTFD 3EO3A 4ISGA 1HJOA 3HVTA 4ILGB 1X9MA 1HYSA 3V9WA 4DSEA 5M1PA 2NNWA 1RT3A 1Z26A 1NK7A 4OVLA 3CQXA 3CCLN 2Z1IA 4IBNA 4LF5K 3F73A 3LDOA 3SYZA 3PV8A 2ZJRL 3OYNA 3VGLA 4I6MA 4YFUA 3CXCM 4GV9A 1S22A 3P4IA 2YHWA 3HJFA 1BA1A 4X64K 4EZ6A 2E88A 1ZXOA 2E1YA 4LF7K 3VGKA 5MLCQ 4ID1A 4BRDA 2XY7A 5HL7L 3WEEB 2WFBA 1XC3A 3A2FA 3VPZA 4BR2A 4DF8A 3AV9A 3LDSA 4HUGA 3OHRA 3ZSOA 3OW2M 3KHYA 4M63C 3TAGA 4O55A 1HKBA 2NRRA 3U6FA 4LF8K 3ZSXA 1SS6A 4YOYA 1Q9YA 4H5RA 4BC3A 4BRLA 2IC3A 1MA9B 3IAYA 4J2DA 2E2NA 4K8ZA 1ZBHA 4E19A 4CF2A 5T7BA 3AVBA 4M7XA 4JK9A 1X3MA 4DTSA 4IO8A 5H1SQ 4YORA 3V1RA 3WNEA 3NVMA 2D0AA 5GAGP 3C95A 4CEEA 4BRPA 3DLGA 1P90A 4DU3A 3WQUA 3THXA 4YOUA 5AQIA 1T03A 3ZT4A 4OGEA 3OYFA 4PA1A 1JCEA 2KW4A 4RW6A 5EY4A 1O13A 5JVHL 4BE1A 3OYHA 1BI4B 4E89A 2O8CA 3O3HA 1K8KB 2QXLA 2YJEA 4B8AB 3QMLA 1MU2A 5GAHP 1VQ5N 4DCHA 2V52B 3VQ9A 3RWUA 1VQKN 5J2QA 4YOXA 3O08A 4JD2B 2EHGA 5BPLA 3VENA 4DSJA 2I5JA 1RBSA 1RBUA 5LJWA 3EE9A 2IGIA 1BCOA 4HTLA 3JXUA 3PIOL 2ZD1A 3OYKA 3ZYYX 4X62K 4CK3A 5EVZA 2YNIA 3K0SA 2W6LA 5AFUH 4KAZA 4IOXA 4BWJA 1L5UA 1GLBG 3KWIA 4IFVA 3S3NA 3Q7CA 1WLJA 1NK0A 1KC8O 3NH1A 4DMNA 3U4LA 2E2PA 2A1RA 3K9JA 4FLXA 1HQEA 3KD1E 2LSNA 1MDUB 4B9MA 1VAZA 1B9DA 2Q2RA 1RTIA 1JL2A 5AQQA 4FWSA 4M7YA 3MXIA 4BQLA 4YNQA 2UU9K 2PZSA 3A5LC 3CF5L 1RDCA 1NJXA 4AHUA 4KPYA 1XWLA 3ULEA 3LWMA 1RT6A 3SV4A 3IG1A 2YNFA 3O8MA 3VA3A 3SNNA 4CGJA 3VQEA 3CJ1A 1G99A 3DRRA 3L2UA 3B6PA 1KFSA 4CECA 3MN9A 4O8KA 4CZJA 3DWLA 2GWJA 2GTDA 3AVGA 5GIOA 1GLDG 1C0TA 2YV0X 4K43A 4DR3K 2YX6A 3NF7A 3EKSA 4RW4A 3QIOA 1HQUA 2X74A 3VEYA 4KHWA 3AO4A 4ZTJA 2BH1A 1S1VA 4J8FA 3VEXA 1S1WA 4H8KA 4CD1A 1BL3A 4KH4A 3CCRN 4PKHA 3VTIA 4CGFA 4FLZA 1BIZA 2O4IA 3DXKB 3R9PA 5M1FA 3RMAA 1D4XA 1HNXK 3HVRA 3V9XA 3MAQA 4IOAL 2ASPA 3L2VA 1LWFA 2OPRA 3KVGA 4E7JA 3ITHA 1VRTA 4AF1A 2RE2A 3EL2A 5AQHA 4B9QA 1OH8A 3O9UA 3HBTA 5GAEP 5AR0A 4Z4HA 1Q82O 2WOMA 2ZWHA 4DLEA 4KTQA 3NH2A 4CHQA 4CEOA 3CCJN 3O4WA 3W3DA 4M41A 1JLAA 3RTVA 3CI5A 4I7FA 4ISFA 4FL9A 4CF0A 3SMPA 2WBNA 1U48A 2HSTA 3I8DA 3OS2A 1EXQA 5C2FA 4FJ7A 4MLEA 4JKCA 4CD3A 1BUPA 1ESVA 4B9UA 3MECA 3CPEA 3O80A 1BCMA 4CHPA 1X1PA 3SQ1A 4N56A 4I6MB 4PL7A 3CCQN 1DTTA 1GLEG 1GOCA 3ZX0A 4OKEA 2HNZA 4CJ3A 4BG9A 5FROA 1N5YA 2BANA 3EYZA 4JRQA 3U9DA 1ATNA 3LALA 4DTJA 2P9PA 4BGBA 3ATVA 4AM6A 5AQOA 4N5SA 5LMUK 3CJCA 5F1XA 4LFCK 4CZMA 2UXDK 2GBZA 4CEDA 4MO5A 3MN7A 1VK0A 1IH7A 4OGCA 5TKYA 2FF3B 4DR4K 4DV0K 3LWLA 1U04A 1W0HA 2VG5A 3VTHA 1HX1A 3J7YP 3QBWA 4YHHK 1WNSA 3H08A 4JI5K 2W42A 4BRNA 1YTUA 2D4WA 4KTWA 3E9PA 4DTMA 3L2RA 1T7PA 1NOZA 1LWCA 1Y97A 2QA4N 1FW6A 4FOIA 3SUOA 3FFKB 5AQXA 3BF3A 4OJRA 3TU5A 2NUBA 5GADP 1HYZA 1LAWA 3THXB 5HROA 1GOAA 4M3WA 1C6VA 1ZBFA 4CK2A 2G8IA 4WQ5A 1XQSC 4NCGA 4GV6A 3WQTA 4WE1A 5HLFA 4KFBA 4CBXA 3HK2A 2O8CB 5CE3A 4KHPK 2IVNA 5KQ8A 2QWRA 4FO0A 1BQMA 4FLWA 2PYJA 4NXMK 3WNFA 4F4KA 4RG8A 3HZ6A 2OPPA 1TKXA 2YHYA 4HCCA 3T1HK 3DLKA 3IRXA 3ZT1A 5FPEA 3PIPL 4H0YB 3LZIA 4KTZA 3QEPA 4H0PA 4BR4A 4CZGA 2EWSA 4YOVA 1VHXA 3HP6A 3V9ZA 5EU7A 1UWBA 4H5VA 3QFUA 1NJZA 3K59A 4NCAA 4CHYA 3TWHA 5FPNA 2O8FA 2RPIA 2YKMA 2Z1GA 4JI1K 3CCEN 2HHQA 4JEPA 1ZBLA 4CVNE 3PSIA 3NH0A 4IXCA 1BI4A 1BGXT 3LDPA 4DV2K 1S1TA 3U3YA 3QB0A 3FE1A 2KFZA 1HNIA 1VSJA 1J5OA 1S1UA 4BRAA 4J2BA 4BR0A 3HPHA 3VESA 1JXBA 1RBVA 1BU6O 1VQMN 4AHCA 3K5NA 3J80O 1C0FA 4NYFA 1IG9A 1T6CA 1LCUA 2HOEA 1HNVA 2IIRA 1TAUA 2ATQA 5AQYA 2QM1A 4F2SA 2HBLA 4FJ8A 3PO5A 4OLAA 4NXNK 5I42A 3UIQA 1KVBA 3AO5A 3WNHA 2WONA 1R59O 2V51B 4BRCA 2O8DA 5C25A 1KTQA 2BUPA 3WUHA 5EOYA 4FOEA 4LFAK 2HHXA 2E2QA 3ULEB 3HYFA 5IWAK 3A8YA 1U2VA 4NCBA 1GLFO 4FXDA 2CGLA 2P9UA 4B9TA 1HNWK 1YI2N 1YHQN 4CI6A 3AVCA 4FM2A 2NZTA 5KGXA 2ASMA 3B6OA 2ZGZA 2UXBK 1IKYA 3VF4A 1B92A 1W7AA 1NGCA 1Y64A 3EN9A 3M8PA 3P83D 4DTPA 1YF5L 1WOQA 3V81A 1N34K 3A5NC 2G8HA 3AO1A 4EHTA 4HUEA 4JI7K 3MCPA 3SPYA 3SQ0A 4BR5A 1JLQA 4L3QA 2BGGA 3OYGA 3QFPA 1JXEA 4CJ7A 3OYMA 5CZ1A 4UQGA 4CFDA 4DQQA 2PBDA 3V1OA 1QQOA 3OBWA 4I9LA 3ID6A 3CC2N 4JRPA 3NAEA 4DUZK 4CJEA 4FPAA 3HO1A 3NF9A 2QKBA 4CJQA 1SL0A 3LM2A 1VQON 1RT5A 1RILA 2OTJN 1IBKK 3ISNC 2F9TA 1TAQA 2OYQA 3VEZA 1T3VA 4FZZA 4FJHA 3FGUA 2OCEA 2VWJA 2QXFA 1CZ9A 4B3TK 1S6QA 1ASUA 4BRHA 1TK0A 1QSSA 4H0XB 2P5OA 4JI3K 4CFBA 1KRPA 3FLCO 2A41A 1XHXA 3H3NO 3D7EO 4CJVA 1ITGA 4MLHA 4IO9L 3WXJA 3EEQA 3JS6A 3LDNA 4I2QA 1I3AA 4OX9K 2HNYA 3QINA 3RSEA 1YIJN 3MN6A 3ZX2A 1N8RO 4MFBA 3L3UA 4FJXA 3ENHA 3NGZA 4C8NA 3CMEN 2P9PB 2OA8A 1L3VA 4ELUA 3K57A 3KK1A 4DSLA 3K5OA 3EE8A 4PY5A 4QOZB 1NGGA 1NKCA 1A5WA 4IEIA 1J53A 4FJ9A 4H0VB 4EFHA 5JLHA 2X6SA 4IDHA 4OKKA 2DFHA 1VQ9N 3HOTA 4B3OA 3ZSYA 2UXCK 1W9HA 3A5OC 2KLAA 2IVOA 3GE1A 2HHVA 1ZBIA 3UE5A 2GV9A 4IG3A 5C24A 2UUAK 3PX6A 4FK0A 1T05A 2PAVA 4K25A 3ZSVA 1NKBA 3HM9A 4DQ8A 1CLQA 3K58A 2E4LA 1JL1A 3HM8A 1X9SA 2HBKA 2DFEA 2ETJA 4E1JA 2HMIA 3FZFA 3ENBA 3O6WA 4CJSA 1YXQA 2XY8A 1VQ4N 2CGKA 1TL1A 3CETA 5AQVA 4YDUA 3UB5A 5HRRA 4CF8A 3T3FA 2NRHA 1C1AA 3F9KA 2AJQA 2FSNA 3CCSN 4DLGA 3NVKA 3OYJA 3AGRA 3DLHA 2VYPA 4JS5A 4WFAL 2DY4A 1KSPA 1M1KO 2EX3A 4CGIA 4M45A 1L3UA 3IUCA 3ULDA 3VMFB 1GLCG 1VQ7N 2KHOA 2JWLA 3H1VX 1BG3A 1HPMA 2HB5A 2HF3A 2QW9A 4W5OA 3LZJA 3ALYA 2HHSA 4GMJB 4IEEA 3QNOA 3HOSA 3OA9A 1NGDA 4FLTA 2QWOA 1JLBA 4JV5K 4IG0A 3TAMA 4KHNA 4H5NA 2GX9A 1NJYA 2I7NA 4FK2A 3BP8A 4KHSA 2F4VK 4CJLA 4AQYK 4LF6K 2OZMA 2P1JA 5DMRA 3VEWA 4A2AA 3AVNA 2O8FB 4NYNA 4BG8A 4CK1A 3SZ2A 1NK9A 1N32K 4DU4A 4DTRA 2Z1HA 4DTNA 1NWKA 4DV1K 3PUFA 4BQZA 3NGYA 2Q3SA 5EX5A 1CXUA 2V7YA 3MX2A 3M3ZA 3L4QA 4G1QA 1J6ZA 3MK6A 3WXIA 3SUQA 3LM9A 2KZZA 5JMVA 3UKRA 4BREA 3R6MA 3AY9A 5LMNK 1NG9A 1QSLA 2O8DB 1OH5A 4M3XA 1C1CA 3KTQA 5C10A 2G8KA 1QVGM 1NGIA 4LSLA 2E8AA 1YAGA 3TABA 4AH9A 1U2VB 3O9TA 4CEZA 2Y1JA 3JSMA 2P9UB 3QEIA 3CJ7A 5CR4A 4CF9A 1HNZK 3MN5A 3OYEA 3L0QA 2IOCA 4WCEL 5AQGA 2QTDA 2JWKA 3DM2A 2IVPA 3U9ZA 3VA0A 3FZMA 4KB0A 4CJ4A 3E01A 3H1QA 2O8BA 2YHXA 4CGGA 3OS1A 2GELA 3O9RA 3CJBA 3SAHA 1WAFA 4B1XB 3ZLJA 4R79A 3PSFA 1HR0K 3OYDA 3ZSWA 4AHSA 4J2EA 2V7ZA 1VQNN 2HBMA 4XEIA 1C0MA 3ZT3A 2KKZA 1XNQK 4PUOA 5KPTA 4FWMA 3AVKA 5KPRA 3CHWA 4M3ZA 4PWDA 4K8XA 1D5AA 2VWBA 3M6GA 2F8TA 1IBLK 3ZSZA 4JKHA 3W0LA 5C42A 4F3TA 4BVPA 1RT1A 5HBMA 4LSNA 2W40A 1TL3A 4JI6K 1KD1O 4QS9A 2FBYA 4EAHD 1T8EA 4CJWA 4K0KK 3TAPA 1UA1A 2VQEK 4CJUA 2WTUA 1XNRK 1SQKA 1VQPN 4C8KA 4BROA 3VQAA 3CFPA 2CH6A 1LWEA 1VSIA 3VQ8A 2X6NA 3KKRA 2OZSA 3TTFA 3TAEA 3KLGA 1SL2A 1C0GA 3A5MC 1DTQA 3T7ZA 3M8SA 1ZYQA 5LJVA 3GOIA 3RSEB 5ADXH 4GW6A 4XH5A 1LW0A 1E4FT 3IDHA 3K5MA 4CHOA 2HHUA 2A40A 5BREA 3TPQA 4M3YA 2P9IA 4Y0WA 1QHAA 2KQ2A 3AA5X 3CYMA 4KBOA 2HBJA 1VQLN 1QZ5A 3RMBA 3HSCA 3SLCA 2XY5A 1YJ9N 5IT9O 1LAVA 4O5FA 5AZIA 5I3UA 3IFRA 4AHRA 2FBXA 1RTHA 3LL3A 3E66A 4BRGA 5DM6L 3VQCA 3VN5A 2FXUA 4Q5VA 4W5NA 4E1MA 4LF9K 3NHGA 5DK5A 1RNHA 4JK8A 5FPMA 4DB3A 2NLXA 4FJNA 4KH5A 2BE2A 4ZTFA 4FJGA 4CZEA 1WBDA 1QQNA 4PKGA 3AO3A 2OANA 4CHZA 2CGJA 1BWFO 3SAFA 3V1QA 4HUFA 3M5RA 4GVMA 4J2AA 3KZBA 5KGWA 2GEMA 3ASMA 2YCHA 4FLUA 1J54A 2P9NA 3IKMA 5A2QO 4CF1A 3SUNA 1S72N 1FXXA 5AQFA 1RFQA 4FW2A 1E4GT 2IS3A 3AARA 3ZCMA 3Q7BA 4BGAA 1NK4A 5GIPA 4DF4A 3TANA 1HLUA 2RN2A 2UUCK 1FKOA 1HYVA 1Q18A 4GVEA 3MDQA 5AQRA 2F7TA 4Z4GA 4MQ3A 4B3MK 1DEJA 5JICA 4DSKA 4RW9A 4E0DA 5J1EA 2DFFA 3L8BA 4CGHA 5J2PA 3QNNA 1WSEA 4BC2A 4DFJA 4F9OA 4NO7A 4HHTA 1NBWA 3TARA 3S9HA 4PHTX 4H03B 2A5XA 1VSMA 4CIFA 4JI2K 3K2PA 1RDWX 3ATUA 4JKEA 2KFNA 3DOKA 3OY9A 3SCXA 4M3TA 4CZIA 1U49A 1YVNA 1XHZA 3GDQA 3AA4A 3CPWM 4JYAK 3TAQA 2F8SA 3UKRB 4OPHA 4YOTA 5BR8K 4BDYA 3OBYA 3DXMA 4LH5A 1N6QA 3LP2A 2JLEA 4H0OA 4HTUA 1IKWA 3P39A 1RDDA 3V9SA 4CJ5A 3RRHA 5C0YA 3CMAN 4DV6K 4B8CA 5AQPA 2FSKA 4N41A 1SV5A 4CBWA 4X66K 3OYLA 1XMQK 4FVMA 1EKEA 4C1NK 4DS5A 3WXMB 1Z25A 2B5JA 3VQ6A 3C6AA 3CM5A 3FFIA 3ZSRA 2VWKA 1RTDA 5BRFA 1D9FA 1EWRA 3E1YA 1XMOK 1BHLA 4CJTA 1NGHA 2HW3A 2QWPA 3V4IA 4BWMA 3CC4N 3QETA 1QZ6A 3SUPA 3TSPA 3P31A 2O8BB 1BISA 1RDUA 3O1WA 1L3SA 1S3XA 4C8MA 1T6DA 5C12A 2P9KA 4AHVA 4JAXA 3F5TA 3VQ5A 1SAZA 1NK5A 1L3TA 5JS2A 5AQJA 1C1BA 2PFUA 3VQQA 3I33A 4DR1K 1HKCA 2HF4A 4ZHRA 2I7PA 1XC9A 2FSJA 3PY8A 1NJIO 1DGKN 1IG8A 3C7NA 4BDPA 2FF6A 1ATSA 4HCBA 3RR8A 1KCFA 3HXMA 3O1BA 4JKGA 1ILYA 5AZJA 2FBVA 2YJFA 3E9OA 4CE9A 2NRVA 3M1FA 5HOOA 1BA0A 1BOTO 4EIAA 4ELVA 1V4SA 1IV0A 3HRGA 1YJNN 1RT4A 1UOCA 1NOYA 1HUXA 1UA0A 4XIUA 4JLHA 2HVHA 3IS9A 3HT3A 3K9KA 3OVNA 3SQ4A 1ASWA 4FJIA 3G71N 1H1VA 4XH1A 4OO1J 4H0TB 1ZC6A 3PX0A 1XUPO 4E7HA 2FLOA 4FWKA 1NGJA 1QQMA 4DQSA 2J4RA 4A5BA 4CHNA 2YHBA 4OPJA 1NM1A 5SWMA 4EZ9A 3S3OA 1LOTB 5FRMA 2OTLN 1UAXA 4K42A 1RT2A 1FK9A 4CCHA 1HRHA 4B1YB 4CZFA 3VQ7A 2W41A 4OPAA 3AA3A 2ITGA 4WFNL 2FC0A 3BUZB 3NF6A 3RVCA 2E20A 3BDPA 5AQNA 5AJ3K 4CZLA 3MEEA 2A1SA 4CEAA 4JS4A 4DFMA 4FLYA 1NLVA 1S1XA 1EX4A 3I8BA 1SKSA 4IJAA 4CGDA 3AA2A 4RW7A 3RMDA 1KQSM 4B1VA 2VG7A 2P9IB 4AM7A 1GLAG 3LANA 3TI0A 2ZQBA 5M1NA 1KAZA 3MWTA 3C94A 4Y1CA 1S9EA 5BRHA 2A42A 3O4QA 4KV8A 4Z0UA 1KLMA 4B9NA 3VQDA 2E2OA 5LL6Z 5FPDA 3MWPA 3HTVA 3OTOK 4MO4A 4FLVA 4B1WB 5AZIB 5LY3A 3WXKA 3AGKA 5HP1A 2ZE2A 1YUWA 1QQCA 4KI6A 1TUYA 4CZKA 2G8FA 1JCFA 1JKHA 1RBRA 4XH4A 3JAMO 4WQ4C 4E1NA 1C0UA 1TK8A 3CJ9A 3LPUA 3OYCA 1WUAA 4LF4K 3C6HA 2YNHA 3QIPA 4WYBA 2XRIA 1K8AO 1IO2A 2OPSA 5M1OA 1TYQA 1KAYA 4AHTA 4JI0K 2UUBK 2D0PA 3QESA 5KI6A 3QBXA 4Z4CA 4F8RA 3S41A 4E3SA 1P8ZA 3TR8A 3CIPA 1W97L 4FWNA 2Q0UA 4H5WA 1VQ6N 5CYMA 2ZGYA 3EKUA 1A5XA 1KVAA 2DTUA 3IMXA 5BRDA 5M1QA 3H45C 3KLFA 4A57A 2YI1A 3F9MA 2Q97A 1WSFA 3O3FA 1U6ZA 3THWA 4FW1A 4WF9L 3BEXA 3BZKA 3SJHA 5B8HA 1OH6A 4OLBA 2O4GA 2Q1NA 3KLEA 2IDOA 2Z1JA 3FZLA 3M8RA 1DLOA 3AO2A 2P9NB 4FJMA 1OVQA 4DV3K 4RCHA 1WSJA 3PO4A 3LDLA 4ID5A 4GV3A 2P9SA 4I9QA 4M3RA 4EHUA 4KO0A 3HI0A 3AVFA 1RDBA 2G8UA 1EQYA 1VSDA 2H3GX 2GWKA 3DI6A 4CJPA 3LP0A 4U67L 4FWRA 4BR9A 4YOWA 3AVLA 1SZ2A 3DRPA 4W5TA 4FJ5A 4DR5K 4DTXA 4FJLA 4B3SK 3KIOA 3CM6A 3SBTA 2R7YA 4KI4A 4RWTA 2VGMA 5AQUA 3MEDA 4DUYK 2P51A 4BC4A 2OPQA 4F2RA 3D2EA 4OKJA 3MXMA 1WAJA 2CH5A 3ZEUA 1WN7A 4HWIA 1NU0A 4ICLA 4YDUC 3J81O 3KLHA 1NK8A 1SKWA 4B08A 2G8WA 4JKFA 5AQZA 4BE2A 1NGEA 2XHBA 2IAJA 3DXMB 4DTUA 1NNEA 5M1KA 3KK7A 2XO7A 1CXQA 1ASVA 3R8EA 3ENOA 3RRGA 5FRNA 4FM1A 1LV5A 2HMPA 4UY8O 4JI4K 1QE1A 3AVHA 3NDKA 4DV4K 5CZ2A 2GUPA 3O9QA 5C2DA 4A2BA 3A0IX 4FZYA 3VEVA 4GKJK 2P5GA 3G6EN 3ZETA 1MWKA 1NJWA 2BDPA 1QHTA 3U3GA 3MCAB 4I2PA 1GOBA 3EZWA 4KHYA 3OS0A 3PLAA 1GLLO 1KLNA 4G9ZA 4IOCL 4Z4IA 3VEOA 4CIEA 3AAQA 4BRIA 4CJKA 3EZ5A 1F21A 1VSHA 4CZHA 3H3OB 1TUUA 4JNEA 4KREA 1NMNA 3DJCA 3UKUB 2P9KB 3VQ4A 3OYBA 1T44A 2NRTA 4DR2K 2ZF5O 3CG7A 4MDAA 1CZAN 3C7NB 2QWLA 5F2RA 1J5EK 1OVYA 3WT0A 1V4TA 4C1NI 4JKGB 1TVRA 4BRMA 4LFBK 4CFCA 5AZJB 1U45A 3I0SA 3QDKA 1VRUA 4F3OA 5HRSA 4Y1DA 5GINA 1S9GA 1N36K 3SAGA 4DU1A 4FJKA 2KZMA 3BZCA 2VG6A 3THVA 3SI6A 1HPZA 5EXWA 3SPZA 5CYQA 4H4MA 4FPBA 2VCPA 4QS7A 4IFEA 4A5AA 4TSXA 5BPMA 2QI2A 4M42A 4JHDA 2RF2A 4CEFA 3NCIA 2P9LA 1U47A 4PQUA 3TTDA 3DOLA 3I55N 3SMSA 1SKRA 4B9VA 3TSQA 3BF1A 3AVAA 3I0RA 2ZJQL 3CJAA 2VQFK 2VGNA 2RKIA 3T1YK 3THYA 1QSYA 3T69A 4M3UA 3C6TA 3NGIA 4IWVA 3HL8A 1NGFA 1REVA 5C15A 4FSVA 5AFUA 1JLEA 3KKSA 4O5BA 2YHAA 2PY5A 1NGBA 1KFDA 3G10A 3GBTA 4GKKK 3I56N 5ELZA 3LDQA 3R1XA 3D2FA 3VF2A 3GG4A 3J7AP 4B9SA 2A6AA 5E84A 1K73O 2ZM6K 3V6DA 4Z94A 1Z05A 4L8RB 1ZBUA 3LAKA 3VQPA 4GNIA 4E7IA 3ID8A 5AQLA 3D6RA 3SJJA 4ILHA 4IJNA 1W2BM 2B4JA 4HVJA 4CIGA 3O4NA 3DRSA 1X3NA 4CEBA 1IKVA 3C65A 5BN9A 3NF8A 4JKBA 1IBMK 2E6LA 4QCLA 4DR6K 4A62A 3FR0A 5AQTA 3SK3A 1TYQB 3G4SN 4N47A 4Z4FA 1Q81O 4V19S 1NK6A 4IDKA 2NRZA 3L2QA 3C0BA 3C6UA 3L3VA 3NE6A 5K14A 2Q36A 3VETA 2ITMA 2E5LK 1VSEA 5DM7L 1RT7A 4PL8A 4LD0A 4FWOA 1KAXA 2HNDA 2F9WA 3LAMA 1OKJA 4YY3K 3OJSA 4DV7K 4IFYA 3L2WA 4A59A 1D9DA 3G25A 1WSHA 2O8EA 4LH4A 3QLHA 3GL1A 2YKNA 4C23A 4ILJA 3R3LA 4CERA 4BRFA 1WBBA 3THWB 1X9JA 2X78A 4DR7K 1IJJA 5JVGL 1JJ2M 3DAWA 4QAGA 1O1WA 4FJJA 4CEQA 2P9SB 5BPNA 4DKWA 4E7LA 1JLGA 2QK9A 1WSIA 3ZT2A 4CBUA 4BVOA 3HPGA 3HP9A 4DFKA 3KK2A 2AP1A 3QERA 2HHHK 4BC5A 2JGUA 5J2MA 2KTQA 5ADXA 3V9UA 3H46O 5CY4A 1VSLA 4FWQA 3QEXA 4IZ9A 4A61A 3SV3A 3MX5A 3ZSQA 3CC7N 3MXJA 1N33K 3KJVA 1NKEA 4JN4A 1B9FA 3VF6A 3DLBA 4DFPA 1DKGD 3NFAA 3D2EB 3VQBA 3ZEUB 3CQ8A 3O9SA 3CQYA 1Q8IA 3L6QA 4N76A 3M8QA 3U8XA 2PYLA 1LW2A 3CCMN 1EWQA 2W6KA 1S6PA 1Q7YO 4DQRA 1QVFM 3H6EA 3KLIA 3OYAA 2ASOA 1YJWN 3DLRA 1TKDA 2GUIA 4NB4A 3WEEA 5JLFA 1BDGA 4PKIA 3KD5E 5HRPA 3QEWA 1CZBA 4FM0A 4O0JA 1RBTA 4OPKA 1X9WA 3T19A 3FZKA 5CHIA 3AAPA 5TKWA 4DQPA 5J2NA 3ZETB 3D0PA 1BO5O 5F0XA 3JYTA 3CCVN 3SQ2A 3MMVA 3TTCA 1MWMA 2F96A 1TGOA 3FZHA 1VSKA 4DG1A 3J8AA 3K5LA 1EETA 2E6MA 4JKDA 4WQ5C 1RCHA 5BN8A 3LP1A 1HMVA 1KVCA 4QS8A 4FWPA 4DSFA 1RTJA 4AILC 4MDBA 2QWMA 3TAFA 3QICA 1TK5A 4K41A 3ZT0A
chains in the Genus database with same CATH topology
4CF0A 1QQCA 1Q9XA 3SUQA 4KI6A 1SL1A 2G8FA 1JKHA 3T1AA 1RBRA 1U48A 4E1NA 1C0UA 1J9AA 1TK8A 3I8DA 1I39A 1TKZA 3LPUA 2KZZA 3OYCA 3OS2A 2YNHA 3QIPA 4DQIA 2XRIA 1EXQA 4FJ7A 1QSLA 1IO2A 2OPSA 4Z4EA 1YVUA 1BIUA 1C1CA 2D0BA 4KHQA 4M3XA 3KTQA 4AHTA 4FCYA 1RDAA 2G8KA 5SZTA 4B9UA 3QESA 5KI6A 3MECA 2D5RA 4LSLA 4Z4CA 1QTMA 1BCMA 4F8RA 4RW8A 2XY6A 3TABA 4AH9A 4CHPA 4E3SA 1X1PA 4CEZA 3TR8A 4LY7A 3SQ1A 4N56A 3HPOA 2Y1JA 3JSMA 2B6AA 1R0AA 1DTTA 3QEIA 4O0IA 1GOCA 5CYMA 4CF9A 5KRTA 4BE0A 4OKEA 1JLFA 2HNZA 4CJ3A 4CESA 3OYEA 5FROA 4EP4A 2IOCA 3HSTB 1N5YA 4DSIA 2BANA 3G0ZA 3EYZA 4JRQA 1A5XA 3LALA 4KB1A 1KVAA 4DTJA 3DM2A 2DTUA 5KTQA 3VA0A 5D3GA 4N5SA 3S3MA 3AVJA 4KKOA 2FBTA 4KB0A 4CJ4A 3E01A 3KLFA 3AVIA 1WSFA 3DYAA 4CGGA 1YTAA 3OS1A 1TKTA 3O3FA 4FW1A 1XI1A 2GBZA 1WAFA 4CEDA 4OLBA 2O4GA 4O44A 4H4OA 1HJRA 1VK0A 1IH7A 3KLEA 3OYIA 2IDOA 2Z1JA 3M8RA 1DLOA 3AO2A 4OGCA 4FJMA 4C8LA 2HHTA 3OYDA 1WSJA 3PO4A 5KRSA 1QS4A 4ID5A 3ZSWA 4AHSA 4J2EA 4I9QA 4M3RA 3LWLA 3P1GA 3KK3A 1U04A 1W0HA 2VG5A 4KO0A 3CFRA 4C8OA 3AVFA 1C0MA 1RDBA 1WNSA 3ZT3A 2G8UA 3H08A 4PUOA 1VSDA 3LP3A 2W42A 3AVKA 1YTUA 3DI6A 4CJPA 3LP0A 4KTWA 4DTMA 4KHUA 4M3ZA 4PWDA 4BDZA 3L2RA 3AVMA 1T7PA 3AVLA 1NOZA 1LWCA 1FKPA 1Y97A 3DMJA 3DRPA 4K8XA 3O3GA 1D5AA 4EP5A 4W5TA 3SUOA 4FJ5A 4DTXA 4FJLA 2HVIA 3KIOA 3CM6A 1SUQA 2R7YA 4ELTA 4KI4A 2F8TA 3BGRA 1S5JA 3MEDA 3ZSZA 1BQNA 4OJRA 5C42A 2P51A 2OPQA 4F2RA 2NUBA 4F3TA 1RT1A 5HBMA 1HYZA 1LAWA 4LSNA 4W5QA 4OKJA 1GOAA 4E7KA 5HROA 1WAJA 3DLEA 3P5JA 1EP4A 1TL3A 3MXMA 3RR7A 4FK4A 1C6VA 1WN7A 4R5PA 2FBYA 1T8EA 1ZBFA 1TV6A 4ICLA 1JLCA 4CK2A 2G8IA 3KLHA 4DWIA 4NCGA 4CJWA 4WE1A 3TAPA 1UA1A 5HLFA 4KFBA 4B08A 1NK8A 1SKWA 1D8YA 2G8WA 2QKKA 4BE2A 2XHBA 4CJUA 2IAJA 4DTUA 4C8KA 3HK2A 5FDLA 3EY1A 5E41A 2XO7A 1CXQA 1ASVA 5FRNA 3VQAA 3RRGA 1BQMA 4FYDA 4FLWA 3CFPA 4FM1A 1LV5A 2PYJA 1IKXA 3WNFA 4RG8A 3CFOA 4F4KA 1LWEA 1VSIA 4FZXC 3VQ8A 1QE1A 1TKXA 2OPPA 2X6NA 4HCCA 4W5RA 1U4BA 3AVHA 3KKRA 3NDKA 2HHWA 3DLKA 3IRXA 5CZ2A 4B9LA 3ZT1A 2Y1IA 2YNGA 3NBPA 3PX4A 2OZSA 4DTOA 4Q0BA 3MEGA 4FZYA 3TAEA 2P5GA 3LZIA 4KTZA 3KLGA 4DS4A 3QEPA 1SL2A 1A5VA 3M8SA 1DTQA 1NJWA 1ZYQA 2BDPA 1QHTA 2D0CA 3U3GA 3OJUA 3HP6A 4I2PA 5JS1A 3V9ZA 4CFAA 1GOBA 5EU7A 1UWBA 4KHYA 1NJZA 4GW6A 3OS0A 3K59A 4CJRA 4NCAA 1KLNA 4CHYA 3TWHA 3QO9A 2RPIA 2YKMA 4Z4IA 2Z1GA 4CIEA 3WNGA 4CJKA 3EZ5A 1LW0A 1WSGA 2HHQA 1YT3A 3K5MA 1F21A 4CHOA 3NH0A 1VSHA 1ZBLA 4KRFA 4M3YA 2HHUA 1BI4A 1BGXT 4KREA 1S1TA 3U3YA 3VQ4A 2KQ2A 3AA5X 3CYMA 3OYBA 2KFZA 4BACA 1HNIA 1VSJA 1J5OA 1S1UA 3RMBA 3LPTA 4J2BA 3HPHA 1JXBA 1RBVA 1VSFA 4AHCA 3K5NA 3CG7A 5HRNA 3QEVA 4IKFA 2XY5A 3RMCA 2G8VA 4O4GA 1LAVA 4NYFA 1IG9A 1K6YA 4CJFA 1G15A 3D45A 1HNVA 1TAUA 2ATQA 3HVTA 1X9MA 4F2SA 4OLAA 4FJ8A 1TVRA 5I3UA 3PO5A 3V9WA 4AHRA 5I42A 1HYSA 2FBXA 1RTHA 4CFCA 4DSEA 3UIQA 1KVBA 1U45A 3I0SA 1VRUA 4F3OA 5HRSA 4Y1DA 1RT3A 3AO5A 4DS5A 1S9GA 1Z26A 2WONA 3WNHA 4OVLA 4DU1A 1NK7A 4FJKA 3VQCA 5C25A 1KTQA 2KZMA 2VG6A 3VN5A 3THVA 4Q5VA 3SI6A 4W5NA 1HPZA 2Z1IA 4IBNA 2HHXA 4E1MA 3HYFA 3F73A 3SPZA 5CYQA 4H4MA 3SYZA 3PV8A 3NHGA 5DK5A 3OYNA 1RNHA 4NCBA 4FXDA 4TSXA 4YFUA 4M42A 4B9TA 2RF2A 4CEFA 3NCIA 4FJNA 3AVCA 4FM2A 1U47A 4PQUA 2BE2A 4ZTFA 3HJFA 3DOLA 4FJGA 4EZ6A 5KGXA 3B6OA 4ID1A 2XY7A 3AO3A 4CHZA 1SKRA 1IKYA 3V1QA 4HUFA 4B9VA 1B92A 4GVMA 4J2AA 3AVAA 3I0RA 5KGWA 3ASMA 4FLUA 3A2FA 4DF8A 3M8PA 2RKIA 3AV9A 3P83D 3LDSA 4DTPA 3VQ6A 3V81A 1QSYA 4HUGA 1J54A 2G8HA 3AO1A 4M3UA 4HUEA 3C6TA 3NGIA 3HL8A 3ZSOA 3SPYA 4M3WA 1REVA 3TAGA 4O55A 4CF1A 3SUNA 3U6FA 1FXXA 3ZSXA 1JLEA 3SQ0A 3KKSA 4FW2A 3ZCMA 2IS3A 4O5BA 1Q9YA 2YHAA 2PY5A 1NK4A 1JLQA 2BGGA 3OYGA 4DF4A 3TANA 2IC3A 1KFDA 3IAYA 2RN2A 1JXEA 3G10A 4J2DA 1FKOA 1HYVA 5CZ1A 4UQGA 3OYMA 4CFDA 4DQQA 4K8ZA 1ZBHA 4Z4GA 4MQ3A 3V1OA 4E19A 4CF2A 4DSKA 4RW9A 3AVBA 5T7BA 4E0DA 4I9LA 4B9SA 5J1EA 2DFFA 3L8BA 4DTSA 4JRPA 4CGHA 5J2PA 3QNNA 3V6DA 1WSEA 3V1RA 3NAEA 4CJEA 3HO1A 4DFJA 3NF9A 3WNEA 4L8RB 1ZBUA 2QKBA 4HHTA 3TARA 3LAKA 3VQPA 4CJQA 3S9HA 4E7IA 2D0AA 1VSMA 1SL0A 3C95A 4CEEA 4CIFA 1RT5A 1RILA 3DLGA 3SJJA 3ISNC 3K2PA 4DU3A 1TAQA 2OYQA 2B4JA 2KFNA 3DOKA 4HVJA 3OY9A 3SCXA 4CIGA 4FJHA 4FZZA 3O4NA 1T03A 3ZT4A 4M3TA 3DRSA 1U49A 2VWJA 4OGEA 2QXFA 1XHZA 4CEBA 1IKVA 1CZ9A 3AA4A 3OYFA 3NF8A 4PA1A 1S6QA 1ASUA 3TAQA 2E6LA 2KW4A 4RW6A 2F8SA 4QCLA 4BE1A 3OYHA 4BDYA 1TK0A 1BI4B 4LH5A 1QSSA 4E89A 2P5OA 1N6QA 4CFBA 1KRPA 3O3HA 3LP2A 2JLEA 4B8AB 1MU2A 4HTUA 1IKWA 4N47A 4Z4FA 1RDDA 3V9SA 4CJ5A 3RRHA 1NK6A 1XHXA 4IDKA 3VQ9A 4CJVA 1ITGA 3L2QA 3RWUA 3C6UA 3L3VA 3NE6A 5J2QA 4B8CA 4N41A 1SV5A 5K14A 2EHGA 3OYLA 4FVMA 1EKEA 4DSJA 1VSEA 2I5JA 1Z25A 2B5JA 1I3AA 3CM5A 3FFIA 1RBSA 4I2QA 2VWKA 2HNYA 3QINA 1RT7A 4LD0A 3ZSRA 1RTDA 1D9FA 1RBUA 1BHLA 2HNDA 4CJTA 3OJSA 3LAMA 4IFYA 4MFBA 3L3UA 3L2WA 1D9DA 4FJXA 2HW3A 3NGZA 3V4IA 4C8NA 1WSHA 4LH4A 4BWMA 2IGIA 1L3VA 2OA8A 1BCOA 4ELUA 3QLHA 3QETA 3K57A 3SUPA 3KK1A 2ZD1A 4DSLA 1BISA 3K5OA 3OYKA 2YKNA 4CK3A 2YNIA 4PY5A 4QOZB 4CERA 1NKCA 1L3SA 4C8MA 1A5WA 4KAZA 4AHVA 4BWJA 1J53A 2X78A 4FJ9A 3VQ5A 1L5UA 1NK5A 1L3TA 5JS2A 1C1BA 4IFVA 4QAGA 1O1WA 3VQQA 1WLJA 3S3NA 1NK0A 4ZHRA 3NH1A 2X6SA 4FJJA 4CEQA 4OKKA 1XC9A 2DFHA 3PY8A 4DMNA 4B3OA 3ZSYA 4BDPA 4E7LA 2A1RA 1JLGA 4FLXA 2QK9A 1W9HA 1WSIA 1HQEA 3ZT2A 3RR8A 2LSNA 3KD1E 4HCBA 2HHVA 1KCFA 4B9MA 1B9DA 3HPGA 3HXMA 1ZBIA 1RTIA 3HP9A 2GV9A 4IG3A 1JL2A 5C24A 3KK2A 4DFKA 3PX6A 3QERA 4FK0A 1T05A 2FBVA 2JGUA 5J2MA 4CE9A 3MXIA 2KTQA 3ZSVA 1NKBA 3HM9A 4YNQA 3V9UA 2PZSA 1CLQA 3K58A 2E4LA 1JL1A 4ELVA 5CY4A 1X9SA 1VSLA 3QEXA 1RDCA 1NJXA 2DFEA 2ETJA 3SV3A 2HMIA 3ZSQA 4AHUA 4KPYA 1XWLA 3MXJA 4CJSA 3LWMA 1RT6A 3KJVA 1RT4A 2XY8A 3SV4A 1NKEA 1UOCA 2YNFA 3IG1A 1NOYA 3VA3A 3SNNA 4CGJA 3VQEA 1UA0A 1B9FA 4XIUA 3DRRA 1TL1A 3DLBA 4JLHA 3L2UA 3B6PA 4DFPA 3NFAA 2HVHA 3IS9A 4CECA 1KFSA 4B9NA 3VQBA 5HRRA 4CF8A 3HT3A 3T3FA 1C1AA 3F9KA 3CQ8A 3AVGA 2AJQA 3OVNA 3SQ4A 1Q8IA 1ASWA 4DLGA 4FJIA 3OYJA 1C0TA 3M8QA 2PYLA 3DLHA 1LW2A 2YV0X 4N76A 4JS5A 1S6PA 2DY4A 4DQRA 1KSPA 3KLIA 3OYAA 2EX3A 3NF7A 4M45A 4CGIA 3PX0A 4E7HA 1L3UA 3ULDA 3DLRA 1TKDA 2GUIA 4RW4A 4DQSA 3QIOA 4CHNA 1HQUA 2YHBA 3KD5E 4OPJA 2X74A 5HRPA 5SWMA 1CZBA 4FM0A 3AO4A 3QEWA 3S3OA 4ZTJA 4EZ9A 4KHWA 1S1VA 2HB5A 1S1WA 4O0JA 4H8KA 1RBTA 1BL3A 4OPKA 5FRMA 1X9WA 1UAXA 4W5OA 3T19A 3LZJA 3ALYA 2HHSA 1RT2A 4GMJB 1FK9A 4CCHA 3QNOA 1HRHA 4CGFA 4FLZA 3VQ7A 4FLTA 1BIZA 4DQPA 1JLBA 3AA3A 5J2NA 2O4IA 2ITGA 3D0PA 2FC0A 3RMAA 4IG0A 3TAMA 3NF6A 4KHNA 3HVRA 3BDPA 3MEEA 3V9XA 1NJYA 3MAQA 4FK2A 3JYTA 4KHSA 3SQ2A 2A1SA 4CEAA 4JS4A 4CJLA 4DFMA 2F96A 4FLYA 2OZMA 2P1JA 5DMRA 1S1XA 3AVNA 1TGOA 4NYNA 1EX4A 1VSKA 3L2VA 4DG1A 1LWFA 4CK1A 3K5LA 1SKSA 1EETA 2OPRA 4CGDA 3AA2A 3SZ2A 1NK9A 4RW7A 2E6MA 4E7JA 3RMDA 4DU4A 4DTRA 2Z1HA 1RCHA 4DTNA 2VG7A 3ITHA 3LP1A 1VRTA 1HMVA 1KVCA 3LANA 3TI0A 2ZQBA 3PUFA 4DSFA 1RTJA 4AILC 3NGYA 2Q3SA 3C94A 1S9EA 4Y1CA 3O4QA 4KV8A 2WOMA 4Z0UA 1KLMA 4Z4HA 3NH2A 3VQDA 4DLEA 4KTQA 1CXUA 3TAFA 4CHQA 4CEOA 1TK5A 4G1QA 4FLVA 4M41A 1JLAA 3RTVA 5HP1A 3ZT0A 4I7FA 2ZE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CF0 A;  1QQC A;  1Q9X A;  3SUQ A;  4KI6 A;  1SL1 A;  2G8F A;  1JKH A;  3T1A A;  1RBR A;  1U48 A;  4E1N A;  1C0U A;  1J9A A;  1TK8 A;  3I8D A;  1I39 A;  1TKZ A;  3LPU A;  2KZZ A;  3OYC A;  3OS2 A;  2YNH A;  3QIP A;  4DQI A;  2XRI A;  1EXQ A;  4FJ7 A;  1QSL A;  1IO2 A;  2OPS A;  4Z4E A;  1YVU A;  1BIU A;  1C1C A;  2D0B A;  4KHQ A;  4M3X A;  3KTQ A;  4AHT A;  4FCY A;  1RDA A;  2G8K A;  5SZT A;  4B9U A;  3QES A;  5KI6 A;  3MEC A;  2D5R A;  4LSL A;  4Z4C A;  1QTM A;  1BCM A;  4F8R A;  4RW8 A;  2XY6 A;  3TAB A;  4AH9 A;  4CHP A;  4E3S A;  1X1P A;  4CEZ A;  3TR8 A;  4LY7 A;  3SQ1 A;  4N56 A;  3HPO A;  2Y1J A;  3JSM A;  2B6A A;  1R0A A;  1DTT A;  3QEI A;  4O0I A;  1GOC A;  5CYM A;  4CF9 A;  5KRT A;  4BE0 A;  4OKE A;  1JLF A;  2HNZ A;  4CJ3 A;  4CES A;  3OYE A;  5FRO A;  4EP4 A;  2IOC A;  3HST B;  1N5Y A;  4DSI A;  2BAN A;  3G0Z A;  3EYZ A;  4JRQ A;  1A5X A;  3LAL A;  4KB1 A;  1KVA A;  4DTJ A;  3DM2 A;  2DTU A;  5KTQ A;  3VA0 A;  5D3G A;  4N5S A;  3S3M A;  3AVJ A;  4KKO A;  2FBT A;  4KB0 A;  4CJ4 A;  3E01 A;  3KLF A;  3AVI A;  1WSF A;  3DYA A;  4CGG A;  1YTA A;  3OS1 A;  1TKT A;  3O3F A;  4FW1 A;  1XI1 A;  2GBZ A;  1WAF A;  4CED A;  4OLB A;  2O4G A;  4O44 A;  4H4O A;  1HJR A;  1VK0 A;  1IH7 A;  3KLE A;  3OYI A;  2IDO A;  2Z1J A;  3M8R A;  1DLO A;  3AO2 A;  4OGC A;  4FJM A;  4C8L A;  2HHT A;  3OYD A;  1WSJ A;  3PO4 A;  5KRS A;  1QS4 A;  4ID5 A;  3ZSW A;  4AHS A;  4J2E A;  4I9Q A;  4M3R A;  3LWL A;  3P1G A;  3KK3 A;  1U04 A;  1W0H A;  2VG5 A;  4KO0 A;  3CFR A;  4C8O A;  3AVF A;  1C0M A;  1RDB A;  1WNS A;  3ZT3 A;  2G8U A;  3H08 A;  4PUO A;  1VSD A;  3LP3 A;  2W42 A;  3AVK A;  1YTU A;  3DI6 A;  4CJP A;  3LP0 A;  4KTW A;  4DTM A;  4KHU A;  4M3Z A;  4PWD A;  4BDZ A;  3L2R A;  3AVM A;  1T7P A;  3AVL A;  1NOZ A;  1LWC A;  1FKP A;  1Y97 A;  3DMJ A;  3DRP A;  4K8X A;  3O3G A;  1D5A A;  4EP5 A;  4W5T A;  3SUO A;  4FJ5 A;  4DTX A;  4FJL A;  2HVI A;  3KIO A;  3CM6 A;  1SUQ A;  2R7Y A;  4ELT A;  4KI4 A;  2F8T A;  3BGR A;  1S5J A;  3MED A;  3ZSZ A;  1BQN A;  4OJR A;  5C42 A;  2P51 A;  2OPQ A;  4F2R A;  2NUB A;  4F3T A;  1RT1 A;  5HBM A;  1HYZ A;  1LAW A;  4LSN A;  4W5Q A;  4OKJ A;  1GOA A;  4E7K A;  5HRO A;  1WAJ A;  3DLE A;  3P5J A;  1EP4 A;  1TL3 A;  3MXM A;  3RR7 A;  4FK4 A;  1C6V A;  1WN7 A;  4R5P A;  2FBY A;  1T8E A;  1ZBF A;  1TV6 A;  4ICL A;  1JLC A;  4CK2 A;  2G8I A;  3KLH A;  4DWI A;  4NCG A;  4CJW A;  4WE1 A;  3TAP A;  1UA1 A;  5HLF A;  4KFB A;  4B08 A;  1NK8 A;  1SKW A;  1D8Y A;  2G8W A;  2QKK A;  4BE2 A;  2XHB A;  4CJU A;  2IAJ A;  4DTU A;  4C8K A;  3HK2 A;  5FDL A;  3EY1 A;  5E41 A;  2XO7 A;  1CXQ A;  1ASV A;  5FRN A;  3VQA A;  3RRG A;  1BQM A;  4FYD A;  4FLW A;  3CFP A;  4FM1 A;  1LV5 A;  2PYJ A;  1IKX A;  3WNF A;  4RG8 A;  3CFO A;  4F4K A;  1LWE A;  1VSI A;  4FZX C;  3VQ8 A;  1QE1 A;  1TKX A;  2OPP A;  2X6N A;  4HCC A;  4W5R A;  1U4B A;  3AVH A;  3KKR A;  3NDK A;  2HHW A;  3DLK A;  3IRX A;  5CZ2 A;  4B9L A;  3ZT1 A;  2Y1I A;  2YNG A;  3NBP A;  3PX4 A;  2OZS A;  4DTO A;  4Q0B A;  3MEG A;  4FZY A;  3TAE A;  2P5G A;  3LZI A;  4KTZ A;  3KLG A;  4DS4 A;  3QEP A;  1SL2 A;  1A5V A;  3M8S A;  1DTQ A;  1NJW A;  1ZYQ A;  2BDP A;  1QHT A;  2D0C A;  3U3G A;  3OJU A;  3HP6 A;  4I2P A;  5JS1 A;  3V9Z A;  4CFA A;  1GOB A;  5EU7 A;  1UWB A;  4KHY A;  1NJZ A;  4GW6 A;  3OS0 A;  3K59 A;  4CJR A;  4NCA A;  1KLN A;  4CHY A;  3TWH A;  3QO9 A;  2RPI A;  2YKM A;  4Z4I A;  2Z1G A;  4CIE A;  3WNG A;  4CJK A;  3EZ5 A;  1LW0 A;  1WSG A;  2HHQ A;  1YT3 A;  3K5M A;  1F21 A;  4CHO A;  3NH0 A;  1VSH A;  1ZBL A;  4KRF A;  4M3Y A;  2HHU A;  1BI4 A;  1BGX T;  4KRE A;  1S1T A;  3U3Y A;  3VQ4 A;  2KQ2 A;  3AA5 X;  3CYM A;  3OYB A;  2KFZ A;  4BAC A;  1HNI A;  1VSJ A;  1J5O A;  1S1U A;  3RMB A;  3LPT A;  4J2B A;  3HPH A;  1JXB A;  1RBV A;  1VSF A;  4AHC A;  3K5N A;  3CG7 A;  5HRN A;  3QEV A;  4IKF A;  2XY5 A;  3RMC A;  2G8V A;  4O4G A;  1LAV A;  4NYF A;  1IG9 A;  1K6Y A;  4CJF A;  1G15 A;  3D45 A;  1HNV A;  1TAU A;  2ATQ A;  3HVT A;  1X9M A;  4F2S A;  4OLA A;  4FJ8 A;  1TVR A;  5I3U A;  3PO5 A;  3V9W A;  4AHR A;  5I42 A;  1HYS A;  2FBX A;  1RTH A;  4CFC A;  4DSE A;  3UIQ A;  1KVB A;  1U45 A;  3I0S A;  1VRU A;  4F3O A;  5HRS A;  4Y1D A;  1RT3 A;  3AO5 A;  4DS5 A;  1S9G A;  1Z26 A;  2WON A;  3WNH A;  4OVL A;  4DU1 A;  1NK7 A;  4FJK A;  3VQC A;  5C25 A;  1KTQ A;  2KZM A;  2VG6 A;  3VN5 A;  3THV A;  4Q5V A;  3SI6 A;  4W5N A;  1HPZ A;  2Z1I A;  4IBN A;  2HHX A;  4E1M A;  3HYF A;  3F73 A;  3SPZ A;  5CYQ A;  4H4M A;  3SYZ A;  3PV8 A;  3NHG A;  5DK5 A;  3OYN A;  1RNH A;  4NCB A;  4FXD A;  4TSX A;  4YFU A;  4M42 A;  4B9T A;  2RF2 A;  4CEF A;  3NCI A;  4FJN A;  3AVC A;  4FM2 A;  1U47 A;  4PQU A;  2BE2 A;  4ZTF A;  3HJF A;  3DOL A;  4FJG A;  4EZ6 A;  5KGX A;  3B6O A;  4ID1 A;  2XY7 A;  3AO3 A;  4CHZ A;  1SKR A;  1IKY A;  3V1Q A;  4HUF A;  4B9V A;  1B92 A;  4GVM A;  4J2A A;  3AVA A;  3I0R A;  5KGW A;  3ASM A;  4FLU A;  3A2F A;  4DF8 A;  3M8P A;  2RKI A;  3AV9 A;  3P83 D;  3LDS A;  4DTP A;  3VQ6 A;  3V81 A;  1QSY A;  4HUG A;  1J54 A;  2G8H A;  3AO1 A;  4M3U A;  4HUE A;  3C6T A;  3NGI A;  3HL8 A;  3ZSO A;  3SPY A;  4M3W A;  1REV A;  3TAG A;  4O55 A;  4CF1 A;  3SUN A;  3U6F A;  1FXX A;  3ZSX A;  1JLE A;  3SQ0 A;  3KKS A;  4FW2 A;  3ZCM A;  2IS3 A;  4O5B A;  1Q9Y A;  2YHA A;  2PY5 A;  1NK4 A;  1JLQ A;  2BGG A;  3OYG A;  4DF4 A;  3TAN A;  2IC3 A;  1KFD A;  3IAY A;  2RN2 A;  1JXE A;  3G10 A;  4J2D A;  1FKO A;  1HYV A;  5CZ1 A;  4UQG A;  3OYM A;  4CFD A;  4DQQ A;  4K8Z A;  1ZBH A;  4Z4G A;  4MQ3 A;  3V1O A;  4E19 A;  4CF2 A;  4DSK A;  4RW9 A;  3AVB A;  5T7B A;  4E0D A;  4I9L A;  4B9S A;  5J1E A;  2DFF A;  3L8B A;  4DTS A;  4JRP A;  4CGH A;  5J2P A;  3QNN A;  3V6D A;  1WSE A;  3V1R A;  3NAE A;  4CJE A;  3HO1 A;  4DFJ A;  3NF9 A;  3WNE A;  4L8R B;  1ZBU A;  2QKB A;  4HHT A;  3TAR A;  3LAK A;  3VQP A;  4CJQ A;  3S9H A;  4E7I A;  2D0A A;  1VSM A;  1SL0 A;  3C95 A;  4CEE A;  4CIF A;  1RT5 A;  1RIL A;  3DLG A;  3SJJ A;  3ISN C;  3K2P A;  4DU3 A;  1TAQ A;  2OYQ A;  2B4J A;  2KFN A;  3DOK A;  4HVJ A;  3OY9 A;  3SCX A;  4CIG A;  4FJH A;  4FZZ A;  3O4N A;  1T03 A;  3ZT4 A;  4M3T A;  3DRS A;  1U49 A;  2VWJ A;  4OGE A;  2QXF A;  1XHZ A;  4CEB A;  1IKV A;  1CZ9 A;  3AA4 A;  3OYF A;  3NF8 A;  4PA1 A;  1S6Q A;  1ASU A;  3TAQ A;  2E6L A;  2KW4 A;  4RW6 A;  2F8S A;  4QCL A;  4BE1 A;  3OYH A;  4BDY A;  1TK0 A;  1BI4 B;  4LH5 A;  1QSS A;  4E89 A;  2P5O A;  1N6Q A;  4CFB A;  1KRP A;  3O3H A;  3LP2 A;  2JLE A;  4B8A B;  1MU2 A;  4HTU A;  1IKW A;  4N47 A;  4Z4F A;  1RDD A;  3V9S A;  4CJ5 A;  3RRH A;  1NK6 A;  1XHX A;  4IDK A;  3VQ9 A;  4CJV A;  1ITG A;  3L2Q A;  3RWU A;  3C6U A;  3L3V A;  3NE6 A;  5J2Q A;  4B8C A;  4N41 A;  1SV5 A;  5K14 A;  2EHG A;  3OYL A;  4FVM A;  1EKE A;  4DSJ A;  1VSE A;  2I5J A;  1Z25 A;  2B5J A;  1I3A A;  3CM5 A;  3FFI A;  1RBS A;  4I2Q A;  2VWK A;  2HNY A;  3QIN A;  1RT7 A;  4LD0 A;  3ZSR A;  1RTD A;  1D9F A;  1RBU A;  1BHL A;  2HND A;  4CJT A;  3OJS A;  3LAM A;  4IFY A;  4MFB A;  3L3U A;  3L2W A;  1D9D A;  4FJX A;  2HW3 A;  3NGZ A;  3V4I A;  4C8N A;  1WSH A;  4LH4 A;  4BWM A;  2IGI A;  1L3V A;  2OA8 A;  1BCO A;  4ELU A;  3QLH A;  3QET A;  3K57 A;  3SUP A;  3KK1 A;  2ZD1 A;  4DSL A;  1BIS A;  3K5O A;  3OYK A;  2YKN A;  4CK3 A;  2YNI A;  4PY5 A;  4QOZ B;  4CER A;  1NKC A;  1L3S A;  4C8M A;  1A5W A;  4KAZ A;  4AHV A;  4BWJ A;  1J53 A;  2X78 A;  4FJ9 A;  3VQ5 A;  1L5U A;  1NK5 A;  1L3T A;  5JS2 A;  1C1B A;  4IFV A;  4QAG A;  1O1W A;  3VQQ A;  1WLJ A;  3S3N A;  1NK0 A;  4ZHR A;  3NH1 A;  2X6S A;  4FJJ A;  4CEQ A;  4OKK A;  1XC9 A;  2DFH A;  3PY8 A;  4DMN A;  4B3O A;  3ZSY A;  4BDP A;  4E7L A;  2A1R A;  1JLG A;  4FLX A;  2QK9 A;  1W9H A;  1WSI A;  1HQE A;  3ZT2 A;  3RR8 A;  2LSN A;  3KD1 E;  4HCB A;  2HHV A;  1KCF A;  4B9M A;  1B9D A;  3HPG A;  3HXM A;  1ZBI A;  1RTI A;  3HP9 A;  2GV9 A;  4IG3 A;  1JL2 A;  5C24 A;  3KK2 A;  4DFK A;  3PX6 A;  3QER A;  4FK0 A;  1T05 A;  2FBV A;  2JGU A;  5J2M A;  4CE9 A;  3MXI A;  2KTQ A;  3ZSV A;  1NKB A;  3HM9 A;  4YNQ A;  3V9U A;  2PZS A;  1CLQ A;  3K58 A;  2E4L A;  1JL1 A;  4ELV A;  5CY4 A;  1X9S A;  1VSL A;  3QEX A;  1RDC A;  1NJX A;  2DFE A;  2ETJ A;  3SV3 A;  2HMI A;  3ZSQ A;  4AHU A;  4KPY A;  1XWL A;  3MXJ A;  4CJS A;  3LWM A;  1RT6 A;  3KJV A;  1RT4 A;  2XY8 A;  3SV4 A;  1NKE A;  1UOC A;  2YNF A;  3IG1 A;  1NOY A;  3VA3 A;  3SNN A;  4CGJ A;  3VQE A;  1UA0 A;  1B9F A;  4XIU A;  3DRR A;  1TL1 A;  3DLB A;  4JLH A;  3L2U A;  3B6P A;  4DFP A;  3NFA A;  2HVH A;  3IS9 A;  4CEC A;  1KFS A;  4B9N A;  3VQB A;  5HRR A;  4CF8 A;  3HT3 A;  3T3F A;  1C1A A;  3F9K A;  3CQ8 A;  3AVG A;  2AJQ A;  3OVN A;  3SQ4 A;  1Q8I A;  1ASW A;  4DLG A;  4FJI A;  3OYJ A;  1C0T A;  3M8Q A;  2PYL A;  3DLH A;  1LW2 A;  2YV0 X;  4N76 A;  4JS5 A;  1S6P A;  2DY4 A;  4DQR A;  1KSP A;  3KLI A;  3OYA A;  2EX3 A;  3NF7 A;  4M45 A;  4CGI A;  3PX0 A;  4E7H A;  1L3U A;  3ULD A;  3DLR A;  1TKD A;  2GUI A;  4RW4 A;  4DQS A;  3QIO A;  4CHN A;  1HQU A;  2YHB A;  3KD5 E;  4OPJ A;  2X74 A;  5HRP A;  5SWM A;  1CZB A;  4FM0 A;  3AO4 A;  3QEW A;  3S3O A;  4ZTJ A;  4EZ9 A;  4KHW A;  1S1V A;  2HB5 A;  1S1W A;  4O0J A;  4H8K A;  1RBT A;  1BL3 A;  4OPK A;  5FRM A;  1X9W A;  1UAX A;  4W5O A;  3T19 A;  3LZJ A;  3ALY A;  2HHS A;  1RT2 A;  4GMJ B;  1FK9 A;  4CCH A;  3QNO A;  1HRH A;  4CGF A;  4FLZ A;  3VQ7 A;  4FLT A;  1BIZ A;  4DQP A;  1JLB A;  3AA3 A;  5J2N A;  2O4I A;  2ITG A;  3D0P A;  2FC0 A;  3RMA A;  4IG0 A;  3TAM A;  3NF6 A;  4KHN A;  3HVR A;  3BDP A;  3MEE A;  3V9X A;  1NJY A;  3MAQ A;  4FK2 A;  3JYT A;  4KHS A;  3SQ2 A;  2A1S A;  4CEA A;  4JS4 A;  4CJL A;  4DFM A;  2F96 A;  4FLY A;  2OZM A;  2P1J A;  5DMR A;  1S1X A;  3AVN A;  1TGO A;  4NYN A;  1EX4 A;  1VSK A;  3L2V A;  4DG1 A;  1LWF A;  4CK1 A;  3K5L A;  1SKS A;  1EET A;  2OPR A;  4CGD A;  3AA2 A;  3SZ2 A;  1NK9 A;  4RW7 A;  2E6M A;  4E7J A;  3RMD A;  4DU4 A;  4DTR A;  2Z1H A;  1RCH A;  4DTN A;  2VG7 A;  3ITH A;  3LP1 A;  1VRT A;  1HMV A;  1KVC A;  3LAN A;  3TI0 A;  2ZQB A;  3PUF A;  4DSF A;  1RTJ A;  4AIL C;  3NGY A;  2Q3S A;  3C94 A;  1S9E A;  4Y1C A;  3O4Q A;  4KV8 A;  2WOM A;  4Z0U A;  1KLM A;  4Z4H A;  3NH2 A;  3VQD A;  4DLE A;  4KTQ A;  1CXU A;  3TAF A;  4CHQ A;  4CEO A;  1TK5 A;  4G1Q A;  4FLV A;  4M41 A;  1JLA A;  3RTV A;  5HP1 A;  3ZT0 A;  4I7F A;  2ZE2 A; 
#chains in the Genus database with same CATH topology
 1Q9X A;  3VER A;  1SL1 A;  3T1A A;  1J9A A;  4LC9 B;  1I39 A;  1TKZ A;  2ZJP L;  1KXP A;  3VOV A;  4DQI A;  3N4Q A;  3F2K A;  4Z4E A;  2WC9 A;  1YVU A;  4DHY A;  1K8K A;  1BIU A;  2D0B A;  5FLX O;  4KHQ A;  4FCY A;  1RDA A;  5SZT A;  3UKU A;  2D5R A;  4CW7 B;  1QTM A;  4RW8 A;  2Q31 A;  2XY6 A;  4LY7 A;  1NMD A;  3HPO A;  2B6A A;  4JD2 A;  1R0A A;  2AA4 A;  1JCG A;  4JHD B;  4O0I A;  2P9L B;  4BE0 A;  5KRT A;  1JLF A;  4CES A;  4EP4 A;  2DPN A;  4DSI A;  3HST B;  5AQM A;  3G0Z A;  1Z6R A;  4KB1 A;  4FWL A;  4FVU A;  5KTQ A;  5D3G A;  3S3M A;  5BR9 A;  3AVJ A;  4KKO A;  2FBT A;  4X65 K;  3CD6 N;  3L4I A;  3AVI A;  1NGA A;  4BRQ A;  3J7Z O;  3DYA A;  1YTA A;  1TKT A;  1XI1 A;  4O44 A;  4H4O A;  1HJR A;  3THY B;  3OYI A;  4DV5 K;  2QWN A;  4B1Z A;  4C8L A;  1I94 K;  2HHT A;  5KRS A;  1QS4 A;  3P1G A;  5KPZ A;  3KK3 A;  3CFR A;  4C8O A;  5AQS A;  1ZBS A;  3B8A X;  1GLJ O;  4BR7 A;  1M90 O;  1HKG A;  2NRX A;  3D2F B;  3LP3 A;  3VGM A;  4H5T A;  4WFB L;  4KHU A;  4BDZ A;  3ZX3 A;  3TSU A;  2Q0R A;  3AVM A;  2RHK A;  1FKP A;  3DMJ A;  3O3G A;  1Q86 O;  4EP5 A;  4JKA A;  2HVI A;  2QEX N;  1SUQ A;  4ELT A;  3BGR A;  1S5J A;  1BQN A;  2QWQ A;  2BTF A;  1K9M O;  4W5Q A;  4JI8 K;  4E7K A;  3RR7 A;  3DLE A;  3E9L A;  1EP4 A;  3P5J A;  4FK4 A;  4R5P A;  5I9E B;  1TV6 A;  1JLC A;  2D0O A;  4DWI A;  1VQ8 N;  1DT9 A;  4ISE A;  1D8Y A;  2QKK A;  1OH7 A;  2WUS A;  4NLB A;  3SBG A;  4BY9 C;  5FDL A;  3EY1 A;  5E41 A;  1EO1 A;  4O8U A;  3N4P A;  4KH6 A;  4FYD A;  3DLL L;  5E26 A;  1IKX A;  3P38 A;  3CFO A;  3NMU A;  4FZX C;  5AQW A;  4W5R A;  1U4B A;  3CER A;  1YIT N;  2HHW A;  4B9L A;  5KQD A;  2Y1I A;  2YNG A;  3NBP A;  3PX4 A;  4DTO A;  4Q0B A;  3MEG A;  4WQ4 A;  4DS4 A;  3DXK A;  1A5V A;  5AQK A;  2D0C A;  3OJU A;  3WXL A;  1WB9 A;  5JS1 A;  4CFA A;  1E3M A;  3KWG A;  1FJG K;  4CJR A;  2O8E B;  4JK7 A;  2A3Z A;  3QO9 A;  1ATR A;  2NRW A;  3BY5 A;  4B3R K;  3WNG A;  4B1U B;  4BRK A;  1WSG A;  1YT3 A;  4KRF A;  3CCU N;  2D1K A;  4U7B A;  4BAC A;  4NLC A;  3LPT A;  1VSF A;  2UYT A;  4GY2 B;  5HRN A;  3QEV A;  1RGI A;  3O5B A;  4IKF A;  3RMC A;  2G8V A;  4O4G A;  2E1Z A;  1K6Y A;  4CJF A;  1G15 A;  3D45 A;  4RTF D;  3EO3 A;  4ISG A;  1HJO A;  3HVT A;  4ILG B;  1X9M A;  1HYS A;  3V9W A;  4DSE A;  5M1P A;  2NNW A;  1RT3 A;  1Z26 A;  1NK7 A;  4OVL A;  3CQX A;  3CCL N;  2Z1I A;  4IBN A;  4LF5 K;  3F73 A;  3LDO A;  3SYZ A;  3PV8 A;  2ZJR L;  3OYN A;  3VGL A;  4I6M A;  4YFU A;  3CXC M;  4GV9 A;  1S22 A;  3P4I A;  2YHW A;  3HJF A;  1BA1 A;  4X64 K;  4EZ6 A;  2E88 A;  1ZXO A;  2E1Y A;  4LF7 K;  3VGK A;  5MLC Q;  4ID1 A;  4BRD A;  2XY7 A;  5HL7 L;  3WEE B;  2WFB A;  1XC3 A;  3A2F A;  3VPZ A;  4BR2 A;  4DF8 A;  3AV9 A;  3LDS A;  4HUG A;  3OHR A;  3ZSO A;  3OW2 M;  3KHY A;  4M63 C;  3TAG A;  4O55 A;  1HKB A;  2NRR A;  3U6F A;  4LF8 K;  3ZSX A;  1SS6 A;  4YOY A;  1Q9Y A;  4H5R A;  4BC3 A;  4BRL A;  2IC3 A;  1MA9 B;  3IAY A;  4J2D A;  2E2N A;  4K8Z A;  1ZBH A;  4E19 A;  4CF2 A;  5T7B A;  3AVB A;  4M7X A;  4JK9 A;  1X3M A;  4DTS A;  4IO8 A;  5H1S Q;  4YOR A;  3V1R A;  3WNE A;  3NVM A;  2D0A A;  5GAG P;  3C95 A;  4CEE A;  4BRP A;  3DLG A;  1P90 A;  4DU3 A;  3WQU A;  3THX A;  4YOU A;  5AQI A;  1T03 A;  3ZT4 A;  4OGE A;  3OYF A;  4PA1 A;  1JCE A;  2KW4 A;  4RW6 A;  5EY4 A;  1O13 A;  5JVH L;  4BE1 A;  3OYH A;  1BI4 B;  4E89 A;  2O8C A;  3O3H A;  1K8K B;  2QXL A;  2YJE A;  4B8A B;  3QML A;  1MU2 A;  5GAH P;  1VQ5 N;  4DCH A;  2V52 B;  3VQ9 A;  3RWU A;  1VQK N;  5J2Q A;  4YOX A;  3O08 A;  4JD2 B;  2EHG A;  5BPL A;  3VEN A;  4DSJ A;  2I5J A;  1RBS A;  1RBU A;  5LJW A;  3EE9 A;  2IGI A;  1BCO A;  4HTL A;  3JXU A;  3PIO L;  2ZD1 A;  3OYK A;  3ZYY X;  4X62 K;  4CK3 A;  5EVZ A;  2YNI A;  3K0S A;  2W6L A;  5AFU H;  4KAZ A;  4IOX A;  4BWJ A;  1L5U A;  1GLB G;  3KWI A;  4IFV A;  3S3N A;  3Q7C A;  1WLJ A;  1NK0 A;  1KC8 O;  3NH1 A;  4DMN A;  3U4L A;  2E2P A;  2A1R A;  3K9J A;  4FLX A;  1HQE A;  3KD1 E;  2LSN A;  1MDU B;  4B9M A;  1VAZ A;  1B9D A;  2Q2R A;  1RTI A;  1JL2 A;  5AQQ A;  4FWS A;  4M7Y A;  3MXI A;  4BQL A;  4YNQ A;  2UU9 K;  2PZS A;  3A5L C;  3CF5 L;  1RDC A;  1NJX A;  4AHU A;  4KPY A;  1XWL A;  3ULE A;  3LWM A;  1RT6 A;  3SV4 A;  3IG1 A;  2YNF A;  3O8M A;  3VA3 A;  3SNN A;  4CGJ A;  3VQE A;  3CJ1 A;  1G99 A;  3DRR A;  3L2U A;  3B6P A;  1KFS A;  4CEC A;  3MN9 A;  4O8K A;  4CZJ A;  3DWL A;  2GWJ A;  2GTD A;  3AVG A;  5GIO A;  1GLD G;  1C0T A;  2YV0 X;  4K43 A;  4DR3 K;  2YX6 A;  3NF7 A;  3EKS A;  4RW4 A;  3QIO A;  1HQU A;  2X74 A;  3VEY A;  4KHW A;  3AO4 A;  4ZTJ A;  2BH1 A;  1S1V A;  4J8F A;  3VEX A;  1S1W A;  4H8K A;  4CD1 A;  1BL3 A;  4KH4 A;  3CCR N;  4PKH A;  3VTI A;  4CGF A;  4FLZ A;  1BIZ A;  2O4I A;  3DXK B;  3R9P A;  5M1F A;  3RMA A;  1D4X A;  1HNX K;  3HVR A;  3V9X A;  3MAQ A;  4IOA L;  2ASP A;  3L2V A;  1LWF A;  2OPR A;  3KVG A;  4E7J A;  3ITH A;  1VRT A;  4AF1 A;  2RE2 A;  3EL2 A;  5AQH A;  4B9Q A;  1OH8 A;  3O9U A;  3HBT A;  5GAE P;  5AR0 A;  4Z4H A;  1Q82 O;  2WOM A;  2ZWH A;  4DLE A;  4KTQ A;  3NH2 A;  4CHQ A;  4CEO A;  3CCJ N;  3O4W A;  3W3D A;  4M41 A;  1JLA A;  3RTV A;  3CI5 A;  4I7F A;  4ISF A;  4FL9 A;  4CF0 A;  3SMP A;  2WBN A;  1U48 A;  2HST A;  3I8D A;  3OS2 A;  1EXQ A;  5C2F A;  4FJ7 A;  4MLE A;  4JKC A;  4CD3 A;  1BUP A;  1ESV A;  4B9U A;  3MEC A;  3CPE A;  3O80 A;  1BCM A;  4CHP A;  1X1P A;  3SQ1 A;  4N56 A;  4I6M B;  4PL7 A;  3CCQ N;  1DTT A;  1GLE G;  1GOC A;  3ZX0 A;  4OKE A;  2HNZ A;  4CJ3 A;  4BG9 A;  5FRO A;  1N5Y A;  2BAN A;  3EYZ A;  4JRQ A;  3U9D A;  1ATN A;  3LAL A;  4DTJ A;  2P9P A;  4BGB A;  3ATV A;  4AM6 A;  5AQO A;  4N5S A;  5LMU K;  3CJC A;  5F1X A;  4LFC K;  4CZM A;  2UXD K;  2GBZ A;  4CED A;  4MO5 A;  3MN7 A;  1VK0 A;  1IH7 A;  4OGC A;  5TKY A;  2FF3 B;  4DR4 K;  4DV0 K;  3LWL A;  1U04 A;  1W0H A;  2VG5 A;  3VTH A;  1HX1 A;  3J7Y P;  3QBW A;  4YHH K;  1WNS A;  3H08 A;  4JI5 K;  2W42 A;  4BRN A;  1YTU A;  2D4W A;  4KTW A;  3E9P A;  4DTM A;  3L2R A;  1T7P A;  1NOZ A;  1LWC A;  1Y97 A;  2QA4 N;  1FW6 A;  4FOI A;  3SUO A;  3FFK B;  5AQX A;  3BF3 A;  4OJR A;  3TU5 A;  2NUB A;  5GAD P;  1HYZ A;  1LAW A;  3THX B;  5HRO A;  1GOA A;  4M3W A;  1C6V A;  1ZBF A;  4CK2 A;  2G8I A;  4WQ5 A;  1XQS C;  4NCG A;  4GV6 A;  3WQT A;  4WE1 A;  5HLF A;  4KFB A;  4CBX A;  3HK2 A;  2O8C B;  5CE3 A;  4KHP K;  2IVN A;  5KQ8 A;  2QWR A;  4FO0 A;  1BQM A;  4FLW A;  2PYJ A;  4NXM K;  3WNF A;  4F4K A;  4RG8 A;  3HZ6 A;  2OPP A;  1TKX A;  2YHY A;  4HCC A;  3T1H K;  3DLK A;  3IRX A;  3ZT1 A;  5FPE A;  3PIP L;  4H0Y B;  3LZI A;  4KTZ A;  3QEP A;  4H0P A;  4BR4 A;  4CZG A;  2EWS A;  4YOV A;  1VHX A;  3HP6 A;  3V9Z A;  5EU7 A;  1UWB A;  4H5V A;  3QFU A;  1NJZ A;  3K59 A;  4NCA A;  4CHY A;  3TWH A;  5FPN A;  2O8F A;  2RPI A;  2YKM A;  2Z1G A;  4JI1 K;  3CCE N;  2HHQ A;  4JEP A;  1ZBL A;  4CVN E;  3PSI A;  3NH0 A;  4IXC A;  1BI4 A;  1BGX T;  3LDP A;  4DV2 K;  1S1T A;  3U3Y A;  3QB0 A;  3FE1 A;  2KFZ A;  1HNI A;  1VSJ A;  1J5O A;  1S1U A;  4BRA A;  4J2B A;  4BR0 A;  3HPH A;  3VES A;  1JXB A;  1RBV A;  1BU6 O;  1VQM N;  4AHC A;  3K5N A;  3J80 O;  1C0F A;  4NYF A;  1IG9 A;  1T6C A;  1LCU A;  2HOE A;  1HNV A;  2IIR A;  1TAU A;  2ATQ A;  5AQY A;  2QM1 A;  4F2S A;  2HBL A;  4FJ8 A;  3PO5 A;  4OLA A;  4NXN K;  5I42 A;  3UIQ A;  1KVB A;  3AO5 A;  3WNH A;  2WON A;  1R59 O;  2V51 B;  4BRC A;  2O8D A;  5C25 A;  1KTQ A;  2BUP A;  3WUH A;  5EOY A;  4FOE A;  4LFA K;  2HHX A;  2E2Q A;  3ULE B;  3HYF A;  5IWA K;  3A8Y A;  1U2V A;  4NCB A;  1GLF O;  4FXD A;  2CGL A;  2P9U A;  4B9T A;  1HNW K;  1YI2 N;  1YHQ N;  4CI6 A;  3AVC A;  4FM2 A;  2NZT A;  5KGX A;  2ASM A;  3B6O A;  2ZGZ A;  2UXB K;  1IKY A;  3VF4 A;  1B92 A;  1W7A A;  1NGC A;  1Y64 A;  3EN9 A;  3M8P A;  3P83 D;  4DTP A;  1YF5 L;  1WOQ A;  3V81 A;  1N34 K;  3A5N C;  2G8H A;  3AO1 A;  4EHT A;  4HUE A;  4JI7 K;  3MCP A;  3SPY A;  3SQ0 A;  4BR5 A;  1JLQ A;  4L3Q A;  2BGG A;  3OYG A;  3QFP A;  1JXE A;  4CJ7 A;  3OYM A;  5CZ1 A;  4UQG A;  4CFD A;  4DQQ A;  2PBD A;  3V1O A;  1QQO A;  3OBW A;  4I9L A;  3ID6 A;  3CC2 N;  4JRP A;  3NAE A;  4DUZ K;  4CJE A;  4FPA A;  3HO1 A;  3NF9 A;  2QKB A;  4CJQ A;  1SL0 A;  3LM2 A;  1VQO N;  1RT5 A;  1RIL A;  2OTJ N;  1IBK K;  3ISN C;  2F9T A;  1TAQ A;  2OYQ A;  3VEZ A;  1T3V A;  4FZZ A;  4FJH A;  3FGU A;  2OCE A;  2VWJ A;  2QXF A;  1CZ9 A;  4B3T K;  1S6Q A;  1ASU A;  4BRH A;  1TK0 A;  1QSS A;  4H0X B;  2P5O A;  4JI3 K;  4CFB A;  1KRP A;  3FLC O;  2A41 A;  1XHX A;  3H3N O;  3D7E O;  4CJV A;  1ITG A;  4MLH A;  4IO9 L;  3WXJ A;  3EEQ A;  3JS6 A;  3LDN A;  4I2Q A;  1I3A A;  4OX9 K;  2HNY A;  3QIN A;  3RSE A;  1YIJ N;  3MN6 A;  3ZX2 A;  1N8R O;  4MFB A;  3L3U A;  4FJX A;  3ENH A;  3NGZ A;  4C8N A;  3CME N;  2P9P B;  2OA8 A;  1L3V A;  4ELU A;  3K57 A;  3KK1 A;  4DSL A;  3K5O A;  3EE8 A;  4PY5 A;  4QOZ B;  1NGG A;  1NKC A;  1A5W A;  4IEI A;  1J53 A;  4FJ9 A;  4H0V B;  4EFH A;  5JLH A;  2X6S A;  4IDH A;  4OKK A;  2DFH A;  1VQ9 N;  3HOT A;  4B3O A;  3ZSY A;  2UXC K;  1W9H A;  3A5O C;  2KLA A;  2IVO A;  3GE1 A;  2HHV A;  1ZBI A;  3UE5 A;  2GV9 A;  4IG3 A;  5C24 A;  2UUA K;  3PX6 A;  4FK0 A;  1T05 A;  2PAV A;  4K25 A;  3ZSV A;  1NKB A;  3HM9 A;  4DQ8 A;  1CLQ A;  3K58 A;  2E4L A;  1JL1 A;  3HM8 A;  1X9S A;  2HBK A;  2DFE A;  2ETJ A;  4E1J A;  2HMI A;  3FZF A;  3ENB A;  3O6W A;  4CJS A;  1YXQ A;  2XY8 A;  1VQ4 N;  2CGK A;  1TL1 A;  3CET A;  5AQV A;  4YDU A;  3UB5 A;  5HRR A;  4CF8 A;  3T3F A;  2NRH A;  1C1A A;  3F9K A;  2AJQ A;  2FSN A;  3CCS N;  4DLG A;  3NVK A;  3OYJ A;  3AGR A;  3DLH A;  2VYP A;  4JS5 A;  4WFA L;  2DY4 A;  1KSP A;  1M1K O;  2EX3 A;  4CGI A;  4M45 A;  1L3U A;  3IUC A;  3ULD A;  3VMF B;  1GLC G;  1VQ7 N;  2KHO A;  2JWL A;  3H1V X;  1BG3 A;  1HPM A;  2HB5 A;  2HF3 A;  2QW9 A;  4W5O A;  3LZJ A;  3ALY A;  2HHS A;  4GMJ B;  4IEE A;  3QNO A;  3HOS A;  3OA9 A;  1NGD A;  4FLT A;  2QWO A;  1JLB A;  4JV5 K;  4IG0 A;  3TAM A;  4KHN A;  4H5N A;  2GX9 A;  1NJY A;  2I7N A;  4FK2 A;  3BP8 A;  4KHS A;  2F4V K;  4CJL A;  4AQY K;  4LF6 K;  2OZM A;  2P1J A;  5DMR A;  3VEW A;  4A2A A;  3AVN A;  2O8F B;  4NYN A;  4BG8 A;  4CK1 A;  3SZ2 A;  1NK9 A;  1N32 K;  4DU4 A;  4DTR A;  2Z1H A;  4DTN A;  1NWK A;  4DV1 K;  3PUF A;  4BQZ A;  3NGY A;  2Q3S A;  5EX5 A;  1CXU A;  2V7Y A;  3MX2 A;  3M3Z A;  3L4Q A;  4G1Q A;  1J6Z A;  3MK6 A;  3WXI A;  3SUQ A;  3LM9 A;  2KZZ A;  5JMV A;  3UKR A;  4BRE A;  3R6M A;  3AY9 A;  5LMN K;  1NG9 A;  1QSL A;  2O8D B;  1OH5 A;  4M3X A;  1C1C A;  3KTQ A;  5C10 A;  2G8K A;  1QVG M;  1NGI A;  4LSL A;  2E8A A;  1YAG A;  3TAB A;  4AH9 A;  1U2V B;  3O9T A;  4CEZ A;  2Y1J A;  3JSM A;  2P9U B;  3QEI A;  3CJ7 A;  5CR4 A;  4CF9 A;  1HNZ K;  3MN5 A;  3OYE A;  3L0Q A;  2IOC A;  4WCE L;  5AQG A;  2QTD A;  2JWK A;  3DM2 A;  2IVP A;  3U9Z A;  3VA0 A;  3FZM A;  4KB0 A;  4CJ4 A;  3E01 A;  3H1Q A;  2O8B A;  2YHX A;  4CGG A;  3OS1 A;  2GEL A;  3O9R A;  3CJB A;  3SAH A;  1WAF A;  4B1X B;  3ZLJ A;  4R79 A;  3PSF A;  1HR0 K;  3OYD A;  3ZSW A;  4AHS A;  4J2E A;  2V7Z A;  1VQN N;  2HBM A;  4XEI A;  1C0M A;  3ZT3 A;  2KKZ A;  1XNQ K;  4PUO A;  5KPT A;  4FWM A;  3AVK A;  5KPR A;  3CHW A;  4M3Z A;  4PWD A;  4K8X A;  1D5A A;  2VWB A;  3M6G A;  2F8T A;  1IBL K;  3ZSZ A;  4JKH A;  3W0L A;  5C42 A;  4F3T A;  4BVP A;  1RT1 A;  5HBM A;  4LSN A;  2W40 A;  1TL3 A;  4JI6 K;  1KD1 O;  4QS9 A;  2FBY A;  4EAH D;  1T8E A;  4CJW A;  4K0K K;  3TAP A;  1UA1 A;  2VQE K;  4CJU A;  2WTU A;  1XNR K;  1SQK A;  1VQP N;  4C8K A;  4BRO A;  3VQA A;  3CFP A;  2CH6 A;  1LWE A;  1VSI A;  3VQ8 A;  2X6N A;  3KKR A;  2OZS A;  3TTF A;  3TAE A;  3KLG A;  1SL2 A;  1C0G A;  3A5M C;  1DTQ A;  3T7Z A;  3M8S A;  1ZYQ A;  5LJV A;  3GOI A;  3RSE B;  5ADX H;  4GW6 A;  4XH5 A;  1LW0 A;  1E4F T;  3IDH A;  3K5M A;  4CHO A;  2HHU A;  2A40 A;  5BRE A;  3TPQ A;  4M3Y A;  2P9I A;  4Y0W A;  1QHA A;  2KQ2 A;  3AA5 X;  3CYM A;  4KBO A;  2HBJ A;  1VQL N;  1QZ5 A;  3RMB A;  3HSC A;  3SLC A;  2XY5 A;  1YJ9 N;  5IT9 O;  1LAV A;  4O5F A;  5AZI A;  5I3U A;  3IFR A;  4AHR A;  2FBX A;  1RTH A;  3LL3 A;  3E66 A;  4BRG A;  5DM6 L;  3VQC A;  3VN5 A;  2FXU A;  4Q5V A;  4W5N A;  4E1M A;  4LF9 K;  3NHG A;  5DK5 A;  1RNH A;  4JK8 A;  5FPM A;  4DB3 A;  2NLX A;  4FJN A;  4KH5 A;  2BE2 A;  4ZTF A;  4FJG A;  4CZE A;  1WBD A;  1QQN A;  4PKG A;  3AO3 A;  2OAN A;  4CHZ A;  2CGJ A;  1BWF O;  3SAF A;  3V1Q A;  4HUF A;  3M5R A;  4GVM A;  4J2A A;  3KZB A;  5KGW A;  2GEM A;  3ASM A;  2YCH A;  4FLU A;  1J54 A;  2P9N A;  3IKM A;  5A2Q O;  4CF1 A;  3SUN A;  1S72 N;  1FXX A;  5AQF A;  1RFQ A;  4FW2 A;  1E4G T;  2IS3 A;  3AAR A;  3ZCM A;  3Q7B A;  4BGA A;  1NK4 A;  5GIP A;  4DF4 A;  3TAN A;  1HLU A;  2RN2 A;  2UUC K;  1FKO A;  1HYV A;  1Q18 A;  4GVE A;  3MDQ A;  5AQR A;  2F7T A;  4Z4G A;  4MQ3 A;  4B3M K;  1DEJ A;  5JIC A;  4DSK A;  4RW9 A;  4E0D A;  5J1E A;  2DFF A;  3L8B A;  4CGH A;  5J2P A;  3QNN A;  1WSE A;  4BC2 A;  4DFJ A;  4F9O A;  4NO7 A;  4HHT A;  1NBW A;  3TAR A;  3S9H A;  4PHT X;  4H03 B;  2A5X A;  1VSM A;  4CIF A;  4JI2 K;  3K2P A;  1RDW X;  3ATU A;  4JKE A;  2KFN A;  3DOK A;  3OY9 A;  3SCX A;  4M3T A;  4CZI A;  1U49 A;  1YVN A;  1XHZ A;  3GDQ A;  3AA4 A;  3CPW M;  4JYA K;  3TAQ A;  2F8S A;  3UKR B;  4OPH A;  4YOT A;  5BR8 K;  4BDY A;  3OBY A;  3DXM A;  4LH5 A;  1N6Q A;  3LP2 A;  2JLE A;  4H0O A;  4HTU A;  1IKW A;  3P39 A;  1RDD A;  3V9S A;  4CJ5 A;  3RRH A;  5C0Y A;  3CMA N;  4DV6 K;  4B8C A;  5AQP A;  2FSK A;  4N41 A;  1SV5 A;  4CBW A;  4X66 K;  3OYL A;  1XMQ K;  4FVM A;  1EKE A;  4C1N K;  4DS5 A;  3WXM B;  1Z25 A;  2B5J A;  3VQ6 A;  3C6A A;  3CM5 A;  3FFI A;  3ZSR A;  2VWK A;  1RTD A;  5BRF A;  1D9F A;  1EWR A;  3E1Y A;  1XMO K;  1BHL A;  4CJT A;  1NGH A;  2HW3 A;  2QWP A;  3V4I A;  4BWM A;  3CC4 N;  3QET A;  1QZ6 A;  3SUP A;  3TSP A;  3P31 A;  2O8B B;  1BIS A;  1RDU A;  3O1W A;  1L3S A;  1S3X A;  4C8M A;  1T6D A;  5C12 A;  2P9K A;  4AHV A;  4JAX A;  3F5T A;  3VQ5 A;  1SAZ A;  1NK5 A;  1L3T A;  5JS2 A;  5AQJ A;  1C1B A;  2PFU A;  3VQQ A;  3I33 A;  4DR1 K;  1HKC A;  2HF4 A;  4ZHR A;  2I7P A;  1XC9 A;  2FSJ A;  3PY8 A;  1NJI O;  1DGK N;  1IG8 A;  3C7N A;  4BDP A;  2FF6 A;  1ATS A;  4HCB A;  3RR8 A;  1KCF A;  3HXM A;  3O1B A;  4JKG A;  1ILY A;  5AZJ A;  2FBV A;  2YJF A;  3E9O A;  4CE9 A;  2NRV A;  3M1F A;  5HOO A;  1BA0 A;  1BOT O;  4EIA A;  4ELV A;  1V4S A;  1IV0 A;  3HRG A;  1YJN N;  1RT4 A;  1UOC A;  1NOY A;  1HUX A;  1UA0 A;  4XIU A;  4JLH A;  2HVH A;  3IS9 A;  3HT3 A;  3K9K A;  3OVN A;  3SQ4 A;  1ASW A;  4FJI A;  3G71 N;  1H1V A;  4XH1 A;  4OO1 J;  4H0T B;  1ZC6 A;  3PX0 A;  1XUP O;  4E7H A;  2FLO A;  4FWK A;  1NGJ A;  1QQM A;  4DQS A;  2J4R A;  4A5B A;  4CHN A;  2YHB A;  4OPJ A;  1NM1 A;  5SWM A;  4EZ9 A;  3S3O A;  1LOT B;  5FRM A;  2OTL N;  1UAX A;  4K42 A;  1RT2 A;  1FK9 A;  4CCH A;  1HRH A;  4B1Y B;  4CZF A;  3VQ7 A;  2W41 A;  4OPA A;  3AA3 A;  2ITG A;  4WFN L;  2FC0 A;  3BUZ B;  3NF6 A;  3RVC A;  2E20 A;  3BDP A;  5AQN A;  5AJ3 K;  4CZL A;  3MEE A;  2A1S A;  4CEA A;  4JS4 A;  4DFM A;  4FLY A;  1NLV A;  1S1X A;  1EX4 A;  3I8B A;  1SKS A;  4IJA A;  4CGD A;  3AA2 A;  4RW7 A;  3RMD A;  1KQS M;  4B1V A;  2VG7 A;  2P9I B;  4AM7 A;  1GLA G;  3LAN A;  3TI0 A;  2ZQB A;  5M1N A;  1KAZ A;  3MWT A;  3C94 A;  4Y1C A;  1S9E A;  5BRH A;  2A42 A;  3O4Q A;  4KV8 A;  4Z0U A;  1KLM A;  4B9N A;  3VQD A;  2E2O A;  5LL6 Z;  5FPD A;  3MWP A;  3HTV A;  3OTO K;  4MO4 A;  4FLV A;  4B1W B;  5AZI B;  5LY3 A;  3WXK A;  3AGK A;  5HP1 A;  2ZE2 A;  1YUW A;  1QQC A;  4KI6 A;  1TUY A;  4CZK A;  2G8F A;  1JCF A;  1JKH A;  1RBR A;  4XH4 A;  3JAM O;  4WQ4 C;  4E1N A;  1C0U A;  1TK8 A;  3CJ9 A;  3LPU A;  3OYC A;  1WUA A;  4LF4 K;  3C6H A;  2YNH A;  3QIP A;  4WYB A;  2XRI A;  1K8A O;  1IO2 A;  2OPS A;  5M1O A;  1TYQ A;  1KAY A;  4AHT A;  4JI0 K;  2UUB K;  2D0P A;  3QES A;  5KI6 A;  3QBX A;  4Z4C A;  4F8R A;  3S41 A;  4E3S A;  1P8Z A;  3TR8 A;  3CIP A;  1W97 L;  4FWN A;  2Q0U A;  4H5W A;  1VQ6 N;  5CYM A;  2ZGY A;  3EKU A;  1A5X A;  1KVA A;  2DTU A;  3IMX A;  5BRD A;  5M1Q A;  3H45 C;  3KLF A;  4A57 A;  2YI1 A;  3F9M A;  2Q97 A;  1WSF A;  3O3F A;  1U6Z A;  3THW A;  4FW1 A;  4WF9 L;  3BEX A;  3BZK A;  3SJH A;  5B8H A;  1OH6 A;  4OLB A;  2O4G A;  2Q1N A;  3KLE A;  2IDO A;  2Z1J A;  3FZL A;  3M8R A;  1DLO A;  3AO2 A;  2P9N B;  4FJM A;  1OVQ A;  4DV3 K;  4RCH A;  1WSJ A;  3PO4 A;  3LDL A;  4ID5 A;  4GV3 A;  2P9S A;  4I9Q A;  4M3R A;  4EHU A;  4KO0 A;  3HI0 A;  3AVF A;  1RDB A;  2G8U A;  1EQY A;  1VSD A;  2H3G X;  2GWK A;  3DI6 A;  4CJP A;  3LP0 A;  4U67 L;  4FWR A;  4BR9 A;  4YOW A;  3AVL A;  1SZ2 A;  3DRP A;  4W5T A;  4FJ5 A;  4DR5 K;  4DTX A;  4FJL A;  4B3S K;  3KIO A;  3CM6 A;  3SBT A;  2R7Y A;  4KI4 A;  4RWT A;  2VGM A;  5AQU A;  3MED A;  4DUY K;  2P51 A;  4BC4 A;  2OPQ A;  4F2R A;  3D2E A;  4OKJ A;  3MXM A;  1WAJ A;  2CH5 A;  3ZEU A;  1WN7 A;  4HWI A;  1NU0 A;  4ICL A;  4YDU C;  3J81 O;  3KLH A;  1NK8 A;  1SKW A;  4B08 A;  2G8W A;  4JKF A;  5AQZ A;  4BE2 A;  1NGE A;  2XHB A;  2IAJ A;  3DXM B;  4DTU A;  1NNE A;  5M1K A;  3KK7 A;  2XO7 A;  1CXQ A;  1ASV A;  3R8E A;  3ENO A;  3RRG A;  5FRN A;  4FM1 A;  1LV5 A;  2HMP A;  4UY8 O;  4JI4 K;  1QE1 A;  3AVH A;  3NDK A;  4DV4 K;  5CZ2 A;  2GUP A;  3O9Q A;  5C2D A;  4A2B A;  3A0I X;  4FZY A;  3VEV A;  4GKJ K;  2P5G A;  3G6E N;  3ZET A;  1MWK A;  1NJW A;  2BDP A;  1QHT A;  3U3G A;  3MCA B;  4I2P A;  1GOB A;  3EZW A;  4KHY A;  3OS0 A;  3PLA A;  1GLL O;  1KLN A;  4G9Z A;  4IOC L;  4Z4I A;  3VEO A;  4CIE A;  3AAQ A;  4BRI A;  4CJK A;  3EZ5 A;  1F21 A;  1VSH A;  4CZH A;  3H3O B;  1TUU A;  4JNE A;  4KRE A;  1NMN A;  3DJC A;  3UKU B;  2P9K B;  3VQ4 A;  3OYB A;  1T44 A;  2NRT A;  4DR2 K;  2ZF5 O;  3CG7 A;  4MDA A;  1CZA N;  3C7N B;  2QWL A;  5F2R A;  1J5E K;  1OVY A;  3WT0 A;  1V4T A;  4C1N I;  4JKG B;  1TVR A;  4BRM A;  4LFB K;  4CFC A;  5AZJ B;  1U45 A;  3I0S A;  3QDK A;  1VRU A;  4F3O A;  5HRS A;  4Y1D A;  5GIN A;  1S9G A;  1N36 K;  3SAG A;  4DU1 A;  4FJK A;  2KZM A;  3BZC A;  2VG6 A;  3THV A;  3SI6 A;  1HPZ A;  5EXW A;  3SPZ A;  5CYQ A;  4H4M A;  4FPB A;  2VCP A;  4QS7 A;  4IFE A;  4A5A A;  4TSX A;  5BPM A;  2QI2 A;  4M42 A;  4JHD A;  2RF2 A;  4CEF A;  3NCI A;  2P9L A;  1U47 A;  4PQU A;  3TTD A;  3DOL A;  3I55 N;  3SMS A;  1SKR A;  4B9V A;  3TSQ A;  3BF1 A;  3AVA A;  3I0R A;  2ZJQ L;  3CJA A;  2VQF K;  2VGN A;  2RKI A;  3T1Y K;  3THY A;  1QSY A;  3T69 A;  4M3U A;  3C6T A;  3NGI A;  4IWV A;  3HL8 A;  1NGF A;  1REV A;  5C15 A;  4FSV A;  5AFU A;  1JLE A;  3KKS A;  4O5B A;  2YHA A;  2PY5 A;  1NGB A;  1KFD A;  3G10 A;  3GBT A;  4GKK K;  3I56 N;  5ELZ A;  3LDQ A;  3R1X A;  3D2F A;  3VF2 A;  3GG4 A;  3J7A P;  4B9S A;  2A6A A;  5E84 A;  1K73 O;  2ZM6 K;  3V6D A;  4Z94 A;  1Z05 A;  4L8R B;  1ZBU A;  3LAK A;  3VQP A;  4GNI A;  4E7I A;  3ID8 A;  5AQL A;  3D6R A;  3SJJ A;  4ILH A;  4IJN A;  1W2B M;  2B4J A;  4HVJ A;  4CIG A;  3O4N A;  3DRS A;  1X3N A;  4CEB A;  1IKV A;  3C65 A;  5BN9 A;  3NF8 A;  4JKB A;  1IBM K;  2E6L A;  4QCL A;  4DR6 K;  4A62 A;  3FR0 A;  5AQT A;  3SK3 A;  1TYQ B;  3G4S N;  4N47 A;  4Z4F A;  1Q81 O;  4V19 S;  1NK6 A;  4IDK A;  2NRZ A;  3L2Q A;  3C0B A;  3C6U A;  3L3V A;  3NE6 A;  5K14 A;  2Q36 A;  3VET A;  2ITM A;  2E5L K;  1VSE A;  5DM7 L;  1RT7 A;  4PL8 A;  4LD0 A;  4FWO A;  1KAX A;  2HND A;  2F9W A;  3LAM A;  1OKJ A;  4YY3 K;  3OJS A;  4DV7 K;  4IFY A;  3L2W A;  4A59 A;  1D9D A;  3G25 A;  1WSH A;  2O8E A;  4LH4 A;  3QLH A;  3GL1 A;  2YKN A;  4C23 A;  4ILJ A;  3R3L A;  4CER A;  4BRF A;  1WBB A;  3THW B;  1X9J A;  2X78 A;  4DR7 K;  1IJJ A;  5JVG L;  1JJ2 M;  3DAW A;  4QAG A;  1O1W A;  4FJJ A;  4CEQ A;  2P9S B;  5BPN A;  4DKW A;  4E7L A;  1JLG A;  2QK9 A;  1WSI A;  3ZT2 A;  4CBU A;  4BVO A;  3HPG A;  3HP9 A;  4DFK A;  3KK2 A;  2AP1 A;  3QER A;  2HHH K;  4BC5 A;  2JGU A;  5J2M A;  2KTQ A;  5ADX A;  3V9U A;  3H46 O;  5CY4 A;  1VSL A;  4FWQ A;  3QEX A;  4IZ9 A;  4A61 A;  3SV3 A;  3MX5 A;  3ZSQ A;  3CC7 N;  3MXJ A;  1N33 K;  3KJV A;  1NKE A;  4JN4 A;  1B9F A;  3VF6 A;  3DLB A;  4DFP A;  1DKG D;  3NFA A;  3D2E B;  3VQB A;  3ZEU B;  3CQ8 A;  3O9S A;  3CQY A;  1Q8I A;  3L6Q A;  4N76 A;  3M8Q A;  3U8X A;  2PYL A;  1LW2 A;  3CCM N;  1EWQ A;  2W6K A;  1S6P A;  1Q7Y O;  4DQR A;  1QVF M;  3H6E A;  3KLI A;  3OYA A;  2ASO A;  1YJW N;  3DLR A;  1TKD A;  2GUI A;  4NB4 A;  3WEE A;  5JLF A;  1BDG A;  4PKI A;  3KD5 E;  5HRP A;  3QEW A;  1CZB A;  4FM0 A;  4O0J A;  1RBT A;  4OPK A;  1X9W A;  3T19 A;  3FZK A;  5CHI A;  3AAP A;  5TKW A;  4DQP A;  5J2N A;  3ZET B;  3D0P A;  1BO5 O;  5F0X A;  3JYT A;  3CCV N;  3SQ2 A;  3MMV A;  3TTC A;  1MWM A;  2F96 A;  1TGO A;  3FZH A;  1VSK A;  4DG1 A;  3J8A A;  3K5L A;  1EET A;  2E6M A;  4JKD A;  4WQ5 C;  1RCH A;  5BN8 A;  3LP1 A;  1HMV A;  1KVC A;  4QS8 A;  4FWP A;  4DSF A;  1RTJ A;  4AIL C;  4MDB A;  2QWM A;  3TAF A;  3QIC A;  1TK5 A;  4K41 A;  3ZT0 A; 
#chains in the Genus database with same CATH homology
 4CF0 A;  1QQC A;  1Q9X A;  3SUQ A;  4KI6 A;  1SL1 A;  2G8F A;  1JKH A;  3T1A A;  1RBR A;  1U48 A;  4E1N A;  1C0U A;  1J9A A;  1TK8 A;  3I8D A;  1I39 A;  1TKZ A;  3LPU A;  2KZZ A;  3OYC A;  3OS2 A;  2YNH A;  3QIP A;  4DQI A;  2XRI A;  1EXQ A;  4FJ7 A;  1QSL A;  1IO2 A;  2OPS A;  4Z4E A;  1YVU A;  1BIU A;  1C1C A;  2D0B A;  4KHQ A;  4M3X A;  3KTQ A;  4AHT A;  4FCY A;  1RDA A;  2G8K A;  5SZT A;  4B9U A;  3QES A;  5KI6 A;  3MEC A;  2D5R A;  4LSL A;  4Z4C A;  1QTM A;  1BCM A;  4F8R A;  4RW8 A;  2XY6 A;  3TAB A;  4AH9 A;  4CHP A;  4E3S A;  1X1P A;  4CEZ A;  3TR8 A;  4LY7 A;  3SQ1 A;  4N56 A;  3HPO A;  2Y1J A;  3JSM A;  2B6A A;  1R0A A;  1DTT A;  3QEI A;  4O0I A;  1GOC A;  5CYM A;  4CF9 A;  5KRT A;  4BE0 A;  4OKE A;  1JLF A;  2HNZ A;  4CJ3 A;  4CES A;  3OYE A;  5FRO A;  4EP4 A;  2IOC A;  3HST B;  1N5Y A;  4DSI A;  2BAN A;  3G0Z A;  3EYZ A;  4JRQ A;  1A5X A;  3LAL A;  4KB1 A;  1KVA A;  4DTJ A;  3DM2 A;  2DTU A;  5KTQ A;  3VA0 A;  5D3G A;  4N5S A;  3S3M A;  3AVJ A;  4KKO A;  2FBT A;  4KB0 A;  4CJ4 A;  3E01 A;  3KLF A;  3AVI A;  1WSF A;  3DYA A;  4CGG A;  1YTA A;  3OS1 A;  1TKT A;  3O3F A;  4FW1 A;  1XI1 A;  2GBZ A;  1WAF A;  4CED A;  4OLB A;  2O4G A;  4O44 A;  4H4O A;  1HJR A;  1VK0 A;  1IH7 A;  3KLE A;  3OYI A;  2IDO A;  2Z1J A;  3M8R A;  1DLO A;  3AO2 A;  4OGC A;  4FJM A;  4C8L A;  2HHT A;  3OYD A;  1WSJ A;  3PO4 A;  5KRS A;  1QS4 A;  4ID5 A;  3ZSW A;  4AHS A;  4J2E A;  4I9Q A;  4M3R A;  3LWL A;  3P1G A;  3KK3 A;  1U04 A;  1W0H A;  2VG5 A;  4KO0 A;  3CFR A;  4C8O A;  3AVF A;  1C0M A;  1RDB A;  1WNS A;  3ZT3 A;  2G8U A;  3H08 A;  4PUO A;  1VSD A;  3LP3 A;  2W42 A;  3AVK A;  1YTU A;  3DI6 A;  4CJP A;  3LP0 A;  4KTW A;  4DTM A;  4KHU A;  4M3Z A;  4PWD A;  4BDZ A;  3L2R A;  3AVM A;  1T7P A;  3AVL A;  1NOZ A;  1LWC A;  1FKP A;  1Y97 A;  3DMJ A;  3DRP A;  4K8X A;  3O3G A;  1D5A A;  4EP5 A;  4W5T A;  3SUO A;  4FJ5 A;  4DTX A;  4FJL A;  2HVI A;  3KIO A;  3CM6 A;  1SUQ A;  2R7Y A;  4ELT A;  4KI4 A;  2F8T A;  3BGR A;  1S5J A;  3MED A;  3ZSZ A;  1BQN A;  4OJR A;  5C42 A;  2P51 A;  2OPQ A;  4F2R A;  2NUB A;  4F3T A;  1RT1 A;  5HBM A;  1HYZ A;  1LAW A;  4LSN A;  4W5Q A;  4OKJ A;  1GOA A;  4E7K A;  5HRO A;  1WAJ A;  3DLE A;  3P5J A;  1EP4 A;  1TL3 A;  3MXM A;  3RR7 A;  4FK4 A;  1C6V A;  1WN7 A;  4R5P A;  2FBY A;  1T8E A;  1ZBF A;  1TV6 A;  4ICL A;  1JLC A;  4CK2 A;  2G8I A;  3KLH A;  4DWI A;  4NCG A;  4CJW A;  4WE1 A;  3TAP A;  1UA1 A;  5HLF A;  4KFB A;  4B08 A;  1NK8 A;  1SKW A;  1D8Y A;  2G8W A;  2QKK A;  4BE2 A;  2XHB A;  4CJU A;  2IAJ A;  4DTU A;  4C8K A;  3HK2 A;  5FDL A;  3EY1 A;  5E41 A;  2XO7 A;  1CXQ A;  1ASV A;  5FRN A;  3VQA A;  3RRG A;  1BQM A;  4FYD A;  4FLW A;  3CFP A;  4FM1 A;  1LV5 A;  2PYJ A;  1IKX A;  3WNF A;  4RG8 A;  3CFO A;  4F4K A;  1LWE A;  1VSI A;  4FZX C;  3VQ8 A;  1QE1 A;  1TKX A;  2OPP A;  2X6N A;  4HCC A;  4W5R A;  1U4B A;  3AVH A;  3KKR A;  3NDK A;  2HHW A;  3DLK A;  3IRX A;  5CZ2 A;  4B9L A;  3ZT1 A;  2Y1I A;  2YNG A;  3NBP A;  3PX4 A;  2OZS A;  4DTO A;  4Q0B A;  3MEG A;  4FZY A;  3TAE A;  2P5G A;  3LZI A;  4KTZ A;  3KLG A;  4DS4 A;  3QEP A;  1SL2 A;  1A5V A;  3M8S A;  1DTQ A;  1NJW A;  1ZYQ A;  2BDP A;  1QHT A;  2D0C A;  3U3G A;  3OJU A;  3HP6 A;  4I2P A;  5JS1 A;  3V9Z A;  4CFA A;  1GOB A;  5EU7 A;  1UWB A;  4KHY A;  1NJZ A;  4GW6 A;  3OS0 A;  3K59 A;  4CJR A;  4NCA A;  1KLN A;  4CHY A;  3TWH A;  3QO9 A;  2RPI A;  2YKM A;  4Z4I A;  2Z1G A;  4CIE A;  3WNG A;  4CJK A;  3EZ5 A;  1LW0 A;  1WSG A;  2HHQ A;  1YT3 A;  3K5M A;  1F21 A;  4CHO A;  3NH0 A;  1VSH A;  1ZBL A;  4KRF A;  4M3Y A;  2HHU A;  1BI4 A;  1BGX T;  4KRE A;  1S1T A;  3U3Y A;  3VQ4 A;  2KQ2 A;  3AA5 X;  3CYM A;  3OYB A;  2KFZ A;  4BAC A;  1HNI A;  1VSJ A;  1J5O A;  1S1U A;  3RMB A;  3LPT A;  4J2B A;  3HPH A;  1JXB A;  1RBV A;  1VSF A;  4AHC A;  3K5N A;  3CG7 A;  5HRN A;  3QEV A;  4IKF A;  2XY5 A;  3RMC A;  2G8V A;  4O4G A;  1LAV A;  4NYF A;  1IG9 A;  1K6Y A;  4CJF A;  1G15 A;  3D45 A;  1HNV A;  1TAU A;  2ATQ A;  3HVT A;  1X9M A;  4F2S A;  4OLA A;  4FJ8 A;  1TVR A;  5I3U A;  3PO5 A;  3V9W A;  4AHR A;  5I42 A;  1HYS A;  2FBX A;  1RTH A;  4CFC A;  4DSE A;  3UIQ A;  1KVB A;  1U45 A;  3I0S A;  1VRU A;  4F3O A;  5HRS A;  4Y1D A;  1RT3 A;  3AO5 A;  4DS5 A;  1S9G A;  1Z26 A;  2WON A;  3WNH A;  4OVL A;  4DU1 A;  1NK7 A;  4FJK A;  3VQC A;  5C25 A;  1KTQ A;  2KZM A;  2VG6 A;  3VN5 A;  3THV A;  4Q5V A;  3SI6 A;  4W5N A;  1HPZ A;  2Z1I A;  4IBN A;  2HHX A;  4E1M A;  3HYF A;  3F73 A;  3SPZ A;  5CYQ A;  4H4M A;  3SYZ A;  3PV8 A;  3NHG A;  5DK5 A;  3OYN A;  1RNH A;  4NCB A;  4FXD A;  4TSX A;  4YFU A;  4M42 A;  4B9T A;  2RF2 A;  4CEF A;  3NCI A;  4FJN A;  3AVC A;  4FM2 A;  1U47 A;  4PQU A;  2BE2 A;  4ZTF A;  3HJF A;  3DOL A;  4FJG A;  4EZ6 A;  5KGX A;  3B6O A;  4ID1 A;  2XY7 A;  3AO3 A;  4CHZ A;  1SKR A;  1IKY A;  3V1Q A;  4HUF A;  4B9V A;  1B92 A;  4GVM A;  4J2A A;  3AVA A;  3I0R A;  5KGW A;  3ASM A;  4FLU A;  3A2F A;  4DF8 A;  3M8P A;  2RKI A;  3AV9 A;  3P83 D;  3LDS A;  4DTP A;  3VQ6 A;  3V81 A;  1QSY A;  4HUG A;  1J54 A;  2G8H A;  3AO1 A;  4M3U A;  4HUE A;  3C6T A;  3NGI A;  3HL8 A;  3ZSO A;  3SPY A;  4M3W A;  1REV A;  3TAG A;  4O55 A;  4CF1 A;  3SUN A;  3U6F A;  1FXX A;  3ZSX A;  1JLE A;  3SQ0 A;  3KKS A;  4FW2 A;  3ZCM A;  2IS3 A;  4O5B A;  1Q9Y A;  2YHA A;  2PY5 A;  1NK4 A;  1JLQ A;  2BGG A;  3OYG A;  4DF4 A;  3TAN A;  2IC3 A;  1KFD A;  3IAY A;  2RN2 A;  1JXE A;  3G10 A;  4J2D A;  1FKO A;  1HYV A;  5CZ1 A;  4UQG A;  3OYM A;  4CFD A;  4DQQ A;  4K8Z A;  1ZBH A;  4Z4G A;  4MQ3 A;  3V1O A;  4E19 A;  4CF2 A;  4DSK A;  4RW9 A;  3AVB A;  5T7B A;  4E0D A;  4I9L A;  4B9S A;  5J1E A;  2DFF A;  3L8B A;  4DTS A;  4JRP A;  4CGH A;  5J2P A;  3QNN A;  3V6D A;  1WSE A;  3V1R A;  3NAE A;  4CJE A;  3HO1 A;  4DFJ A;  3NF9 A;  3WNE A;  4L8R B;  1ZBU A;  2QKB A;  4HHT A;  3TAR A;  3LAK A;  3VQP A;  4CJQ A;  3S9H A;  4E7I A;  2D0A A;  1VSM A;  1SL0 A;  3C95 A;  4CEE A;  4CIF A;  1RT5 A;  1RIL A;  3DLG A;  3SJJ A;  3ISN C;  3K2P A;  4DU3 A;  1TAQ A;  2OYQ A;  2B4J A;  2KFN A;  3DOK A;  4HVJ A;  3OY9 A;  3SCX A;  4CIG A;  4FJH A;  4FZZ A;  3O4N A;  1T03 A;  3ZT4 A;  4M3T A;  3DRS A;  1U49 A;  2VWJ A;  4OGE A;  2QXF A;  1XHZ A;  4CEB A;  1IKV A;  1CZ9 A;  3AA4 A;  3OYF A;  3NF8 A;  4PA1 A;  1S6Q A;  1ASU A;  3TAQ A;  2E6L A;  2KW4 A;  4RW6 A;  2F8S A;  4QCL A;  4BE1 A;  3OYH A;  4BDY A;  1TK0 A;  1BI4 B;  4LH5 A;  1QSS A;  4E89 A;  2P5O A;  1N6Q A;  4CFB A;  1KRP A;  3O3H A;  3LP2 A;  2JLE A;  4B8A B;  1MU2 A;  4HTU A;  1IKW A;  4N47 A;  4Z4F A;  1RDD A;  3V9S A;  4CJ5 A;  3RRH A;  1NK6 A;  1XHX A;  4IDK A;  3VQ9 A;  4CJV A;  1ITG A;  3L2Q A;  3RWU A;  3C6U A;  3L3V A;  3NE6 A;  5J2Q A;  4B8C A;  4N41 A;  1SV5 A;  5K14 A;  2EHG A;  3OYL A;  4FVM A;  1EKE A;  4DSJ A;  1VSE A;  2I5J A;  1Z25 A;  2B5J A;  1I3A A;  3CM5 A;  3FFI A;  1RBS A;  4I2Q A;  2VWK A;  2HNY A;  3QIN A;  1RT7 A;  4LD0 A;  3ZSR A;  1RTD A;  1D9F A;  1RBU A;  1BHL A;  2HND A;  4CJT A;  3OJS A;  3LAM A;  4IFY A;  4MFB A;  3L3U A;  3L2W A;  1D9D A;  4FJX A;  2HW3 A;  3NGZ A;  3V4I A;  4C8N A;  1WSH A;  4LH4 A;  4BWM A;  2IGI A;  1L3V A;  2OA8 A;  1BCO A;  4ELU A;  3QLH A;  3QET A;  3K57 A;  3SUP A;  3KK1 A;  2ZD1 A;  4DSL A;  1BIS A;  3K5O A;  3OYK A;  2YKN A;  4CK3 A;  2YNI A;  4PY5 A;  4QOZ B;  4CER A;  1NKC A;  1L3S A;  4C8M A;  1A5W A;  4KAZ A;  4AHV A;  4BWJ A;  1J53 A;  2X78 A;  4FJ9 A;  3VQ5 A;  1L5U A;  1NK5 A;  1L3T A;  5JS2 A;  1C1B A;  4IFV A;  4QAG A;  1O1W A;  3VQQ A;  1WLJ A;  3S3N A;  1NK0 A;  4ZHR A;  3NH1 A;  2X6S A;  4FJJ A;  4CEQ A;  4OKK A;  1XC9 A;  2DFH A;  3PY8 A;  4DMN A;  4B3O A;  3ZSY A;  4BDP A;  4E7L A;  2A1R A;  1JLG A;  4FLX A;  2QK9 A;  1W9H A;  1WSI A;  1HQE A;  3ZT2 A;  3RR8 A;  2LSN A;  3KD1 E;  4HCB A;  2HHV A;  1KCF A;  4B9M A;  1B9D A;  3HPG A;  3HXM A;  1ZBI A;  1RTI A;  3HP9 A;  2GV9 A;  4IG3 A;  1JL2 A;  5C24 A;  3KK2 A;  4DFK A;  3PX6 A;  3QER A;  4FK0 A;  1T05 A;  2FBV A;  2JGU A;  5J2M A;  4CE9 A;  3MXI A;  2KTQ A;  3ZSV A;  1NKB A;  3HM9 A;  4YNQ A;  3V9U A;  2PZS A;  1CLQ A;  3K58 A;  2E4L A;  1JL1 A;  4ELV A;  5CY4 A;  1X9S A;  1VSL A;  3QEX A;  1RDC A;  1NJX A;  2DFE A;  2ETJ A;  3SV3 A;  2HMI A;  3ZSQ A;  4AHU A;  4KPY A;  1XWL A;  3MXJ A;  4CJS A;  3LWM A;  1RT6 A;  3KJV A;  1RT4 A;  2XY8 A;  3SV4 A;  1NKE A;  1UOC A;  2YNF A;  3IG1 A;  1NOY A;  3VA3 A;  3SNN A;  4CGJ A;  3VQE A;  1UA0 A;  1B9F A;  4XIU A;  3DRR A;  1TL1 A;  3DLB A;  4JLH A;  3L2U A;  3B6P A;  4DFP A;  3NFA A;  2HVH A;  3IS9 A;  4CEC A;  1KFS A;  4B9N A;  3VQB A;  5HRR A;  4CF8 A;  3HT3 A;  3T3F A;  1C1A A;  3F9K A;  3CQ8 A;  3AVG A;  2AJQ A;  3OVN A;  3SQ4 A;  1Q8I A;  1ASW A;  4DLG A;  4FJI A;  3OYJ A;  1C0T A;  3M8Q A;  2PYL A;  3DLH A;  1LW2 A;  2YV0 X;  4N76 A;  4JS5 A;  1S6P A;  2DY4 A;  4DQR A;  1KSP A;  3KLI A;  3OYA A;  2EX3 A;  3NF7 A;  4M45 A;  4CGI A;  3PX0 A;  4E7H A;  1L3U A;  3ULD A;  3DLR A;  1TKD A;  2GUI A;  4RW4 A;  4DQS A;  3QIO A;  4CHN A;  1HQU A;  2YHB A;  3KD5 E;  4OPJ A;  2X74 A;  5HRP A;  5SWM A;  1CZB A;  4FM0 A;  3AO4 A;  3QEW A;  3S3O A;  4ZTJ A;  4EZ9 A;  4KHW A;  1S1V A;  2HB5 A;  1S1W A;  4O0J A;  4H8K A;  1RBT A;  1BL3 A;  4OPK A;  5FRM A;  1X9W A;  1UAX A;  4W5O A;  3T19 A;  3LZJ A;  3ALY A;  2HHS A;  1RT2 A;  4GMJ B;  1FK9 A;  4CCH A;  3QNO A;  1HRH A;  4CGF A;  4FLZ A;  3VQ7 A;  4FLT A;  1BIZ A;  4DQP A;  1JLB A;  3AA3 A;  5J2N A;  2O4I A;  2ITG A;  3D0P A;  2FC0 A;  3RMA A;  4IG0 A;  3TAM A;  3NF6 A;  4KHN A;  3HVR A;  3BDP A;  3MEE A;  3V9X A;  1NJY A;  3MAQ A;  4FK2 A;  3JYT A;  4KHS A;  3SQ2 A;  2A1S A;  4CEA A;  4JS4 A;  4CJL A;  4DFM A;  2F96 A;  4FLY A;  2OZM A;  2P1J A;  5DMR A;  1S1X A;  3AVN A;  1TGO A;  4NYN A;  1EX4 A;  1VSK A;  3L2V A;  4DG1 A;  1LWF A;  4CK1 A;  3K5L A;  1SKS A;  1EET A;  2OPR A;  4CGD A;  3AA2 A;  3SZ2 A;  1NK9 A;  4RW7 A;  2E6M A;  4E7J A;  3RMD A;  4DU4 A;  4DTR A;  2Z1H A;  1RCH A;  4DTN A;  2VG7 A;  3ITH A;  3LP1 A;  1VRT A;  1HMV A;  1KVC A;  3LAN A;  3TI0 A;  2ZQB A;  3PUF A;  4DSF A;  1RTJ A;  4AIL C;  3NGY A;  2Q3S A;  3C94 A;  1S9E A;  4Y1C A;  3O4Q A;  4KV8 A;  2WOM A;  4Z0U A;  1KLM A;  4Z4H A;  3NH2 A;  3VQD A;  4DLE A;  4KTQ A;  1CXU A;  3TAF A;  4CHQ A;  4CEO A;  1TK5 A;  4G1Q A;  4FLV A;  4M41 A;  1JLA A;  3RTV A;  5HP1 A;  3ZT0 A;  4I7F A;  2ZE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...