4CJ6A

Crystal structure of the complex of the cellular retinal binding protein mutant r234w with 9-cis-retinal
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
250
structure length
250
Chain Sequence
ETREEAVRELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFIRARKFNVGRAYELLRGYVNFRLQYPELFDSLSPEAVRCTIEAGYPGVLSSRDKYGRVVMLFNIENWQSQEITFDEILQAYCFILEKLLENEETQINGFCIIENFKGFTMQQAASLRTSDLRKMVDMLQDSFPAWFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSDFGGTLPKYDGKAVAEQLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RETINALDEHYDE-BINDING PROTEIN 1
publication title Human Cellular Retinaldehyde-Binding Protein Has Secondary Thermal 9-Cis-Retinal Isomerase Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 98
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00650 CRAL_TRIO CRAL/TRIO domain
A PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.20 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 N-terminal domain of phosphatidylinositol transfer protein sec14p 4cj6A01
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 4cj6A02
4M8ZA 1AUAA 3W67A 4J7QA 4UYBA 3HY5A 1OIPA 4OMJA 3W68A 2E2XA 4OMKA 1OLMA 4FMMA 1O6UA 3P7ZA 4J7PA 3B7NA 3PG7A 3B7QA 3Q8GA 1OLME 3B7ZA 1R5LA 3HX3A 2D4QA 4CJ6A 4TLGA 1OIZA 4CIZA 3PEGA 3B74A
chains in the Genus database with same CATH superfamily
3W67A 3J27B 4Z6YA 3NWLA 4KLNA 4I8OA 4F1IA 2D7EA 2DAIA 4PT5A 3SAUA 1TDZA 4JV5M 5FTNA 5KPTA 1XC8A 2ERCA 1MU5A 2JY8A 3FTCA 4UN2B 2JY5A 2DAMA 4DUZM 1NVMA 1PM5A 1V34A 3FTFA 4DR1M 1Z6TA 1IXSB 3U5ZA 1MN3A 2R4EA 2QPAA 2W82A 4IIWA 3VDPA 5BPVA 5GKNA 3GPUA 3GLIB 1ZAEA 4DV5M 1EFUB 2CRUA 2JUJA 1OAOC 2WSEF 2LHGA 2JXNA 2XSZD 4G3OA 1IN4A 1TH4A 2BJVA 1YE9A 2M5ZA 5JI3E 2D7GA 2C9OA 4Q7JA 1KYIA 4EIWA 1N75A 1IBLM 3HHYA 2A5YB 2HKJA 4D80A 2DWZB 3C3DA 3SATA 3PEGA 1YLAA 3U61A 2OO9A 3SC3A 4DR4M 4LZJA 1E9RA 1NV8A 1TGUA 2DWMA 2F5QA 1Q3BA 2R6FA 4DR3M 3U60A 4REZA 1UM8A 2LH0A 1IM2A 3W68A 3QWLA 2VDBB 3GPPA 4XBOA 3GPYA 2CV1A 1Z59A 5FSWA 2VQEM 1HNXM 4GKKM 1QAOA 3C3EA 1GLNA 2EKFA 1F4IA 4MGYE 3R9XB 3B7NA 4I4LA 1IN7A 3KFUG 1OLME 2DAGA 2Y21A 2XSZA 4LF9M 2ZANA 2ZAMA 3SFZA 2CV0A 1OQYA 5KPRA 1RU3A 3T6PA 1Z5AA 4GHAA 1VG5A 1JR3E 4GIPA 2HL7A 4M0WA 2QSFX 2C5RA 5JI2E 1SXJD 3TPZA 4I5SA 3FTDA 5KQDA 2LNHC 4D82A 4LF7M 1IXZA 2L7IA 1SXJB 3VKGA 5KO3A 1J7KA 3W0FA 3HGIA 1Z5CA 2HAKA 2LVAA 2DZOB 3KOXE 1GO5A 4OU7A 4W5WA 3GLGE 3GRVA 4P16A 2LVQD 2ZAOA 1O6UA 1DGHB 2X49A 3VDUA 1TH3A 1XXHE 1JR3D 2R65A 4IJFA 1YUBA 4FD2A 2KRKA 4GITA 2QNJA 3U6MA 3M7GA 2VIIA 2LHCA 5FTJA 1PJJA 2JZ0A 4FWGA 2Z4RA 2MROB 2K0BX 4M9XA 3EIHA 3T1HM 3GLHA 4LRSA 3GLFA 1QYRA 4DR7M 2D7HA 1WR1B 4DBGB 2ZM6M 4DR6M 2Y20A 2DHRA 2HWJA 1QZMA 4QHTA 1IN6A 4S12A 4JI4M 4QHSA 1G59A 4GMQA 2LXEA 3CF2A 1OFHA 4MGKE 3DOAA 1SXJA 3HU3A 2DVWB 4B3SM 3CTWB 3EIEA 4FCWA 3SAVA 1QUSA 2YQZA 8CATA 3FUTA 3I4VA 2L4FA 1OLMA 1IBMM 4HLQA 4DV2M 1N77A 1DGGA 1DGHA 2RRUA 2LVOC 2CFOA 3KS4A 1C1KA 3MMPA 2LTUA 2KHHA 4AZFA 3L28A 3QYEA 5H37D 2F4VM 3B7ZA 3K9OA 4FWDA 4NSRA 3HX3A 1JR3A 3D8LA 1HNWM 2V6ZM 4PDGA 3SARA 4L8RC 1XHBA 4DV1M 2KDLA 4RF1A 2C9CA 1G3IA 1D0LA 4II7A 4MGIE 2Y0QA 4FW9A 2L6OA 1IN8A 2ZBKB 2JWSA 4DV4M 4LJ5A 1SG9A 2XF3A 3AOGA 1OJLA 3AOEC 4Z8XA 3VFDA 4JI2M 1FNNA 2EA0A 4X65M 1XNQM 4IJEA 3K2LA 4LZZA 3RFWA 4DR2M 1K3WA 4OX9M 3IECA 4G4RA 5ITYA 1PJTA 3PXGA 4NSOB 3V76A 3PG7A 1GABA 1ZMUA 2CV2A 3ZQJA 4LJ8A 3KDSE 2D4QA 1MX0A 1D0MA 3MJ5A 2V1UA 1PGYA 5FTMA 3GLIE 1L2CA 1QVRA 1G71A 1TTEA 2CE7A 3I01M 2BWBA 3AJIB 1NJFA 3LW5F 5EXTA 3GPXA 1L2BA 4PCZA 1ZQ9A 1K82A 3GRYA 2L7HA 3E4RA 3R8FA 4NRVA 1LTMA 5EP2A 2QP9X 1VEJA 1V33A 3BBZA 3CGWA 4LJ7A 3A98B 3F92A 2OPFA 3E9SA 3HKPA 1G41A 3ILKA 2R46A 2QBYA 2C99A 2UXDM 2KA6B 2MR9A 4IBIA 4OVZB 2Z8YM 1X37A 4HL4A 3SHGB 3T15A 1OTRA 4P17A 3FUVA 4B08A 3U6EA 2DI0A 1IY1A 5KQ8A 1GVNA 3A42A 2JP7A 2CEAA 4R7GA 5IWAM 3NBIA 2UUBM 3KOYE 2Y0TA 3M0EA 2RKOA 2XH9A 3FD9A 1HNZM 5EJCA 4DUYM 1GL7A 3SHFA 5FLXS 3B74A 1VEKA 4L4UA 4AG6A 4QNRA 3ZC7B 3FRIA 3J2PB 2R44A 3L2AA 2I7NA 5EP4A 2CWBA 3GLHE 3FUWA 3HHXA 2CUZA 2K6BA 1IQPA 3LQQA 2FOIC 3PVSA 1Y8GA 1HJPA 3QYBA 2G3QA 4LY6A 3SMPA 1L1TA 4GHLA 1KSFX 3KXEC 3GRUA 1UFZA 4BLCA 1CUKA 4OMKA 1NHWC 3C9PA 4NXNM 2EKKA 1D0KA 1IXSA 1GKIA 2KXEA 3GLIA 1SXJE 1HQYE 4IBEA 4IBGA 2P5TA 2FFJA 3L27A 1ZV1A 2Z3XA 4JI7M 4JI1M 1PJQA 3SAWA 4GH9A 3A46A 1P3QQ 4CGYB 2RGHA 4QNMA 4WURA 4ANRA 3DFZA 1N78A 1D2NA 2VF7A 4HEOA 1NNUC 2K9DA 3T38A 3JAMS 2UXBM 4G4OA 3LMMA 4MB7A 4OMJA 4GRIA 4IBCA 1BVSA 1WIVA 3FTEA 2I7PA 5A2QS 2DAEA 3FE3A 4KHPM 1XB2B 2MGWA 1H6UA 3J7BA 3GQ5A 4NC6A 2QCUA 3FUUA 1QAMA 1GL6A 3I04M 1GJSA 1XNRM 1QUTA 4LCBA 1WXQA 1IY2A 2Z4SA 4RNAA 1OKSA 3GO8A 4M9ZA 4BBAA 3U6OA 2UUAM 5IT9S 2X8AA 4ZPXA 2XZFA 4DV7M 2BNKA 3SBJA 3SASA 4AKIA 4LF4M 4LF6M 4JI6M 4G4QA 1IFYA 4J7QA 5LMUM 1J09A 2KNAA 2DAKA 4F2LA 3DZDA 2R0IA 1YSYA 2R62A 3KW6A 2DWNA 2UU9M 2DKLA 2LWXA 1ORYB 3I4YA 1R2YA 3B9PA 3C58A 2BJWA 1PRBA 3L25A 2DXIA 2N35A 2H1RA 4R71A 3HZJA 2E5LM 7CATA 4JI5M 3M6AA 4LJ4A 1PJIA 4TUWA 4X64M 4LF5M 3FKEA 2XZUA 5FTLA 2GNOA 3TWLA 4GKJM 1A5TA 1R5LA 4KT0F 3I51A 1IXRC 2RGOA 1NY5A 1LV7A 1W5SA 3FYDA 3HU2A 4A3VB 2F5NA 3GRRA 2C98A 3VK7A 2XFTA 2KEBA 1DO2A 4KODA 3IG8A 5ITQA 1T6OA 1WJ7A 1XXHB 1NSFA 5EQTA 3GP1A 1J5EM 4IBBA 1ZMVA 1QZEA 5DYIA 2KNVA 3FUXA 3DA1A 3TE6A 3B89A 3U6LA 3MK6A 4R3DA 4GEWA 4JI8M 4LF8M 4AI6A 3RGSA 3VKHA 2F5OA 4LJ9A 3U6SA 4NOOB 4RF0A 2H5XA 2CHQA 5E26A 5E6JA 1N32M 4J7PA 3E46A 3U6QA 4IBJA 4PDIA 1WGNA 1QANA 2DZNB 3HHZA 4L16A 1QDTA 3VK8A 1AIPC 3OTOM 1DGFA 2MJ5B 3AL0C 1VEGA 3GQ4A 3KOZE 3KS8A 1WHCA 3UGJA 1AUAA 1IN5A 4DV3M 2UUCM 4M8ZA 3L26A 4AKHA 2DWLA 3THGA 5EP3A 1C7YA 1R4GA 2LVNC 3U6CA 3U5ZB 2O01F 2B3TA 3KOWE 4DV0M 1E9SA 4ITQA 4GC5A 4LRTA 1XMOM 1E94E 1VDDA 1DO0A 2VF8A 5ITUA 2JZ1A 3SYKA 4D81A 3AV0A 3SYLA 4LGMA 2X4AA 3T1YM 1T43A 2WZJA 4CJ6A 3K1JA 3CF0A 1GJTA 2J7NA 1N34M 4DV6M 2DHYA 1OIZA 3UK6A 3U61B 2WSCF 4OW0A 4LFAM 3RGPA 4CIZA 4YHHM 1NNJA 1TR8A 3U60B 2QQ8A 3FRHA 1N33M 3TWKA 4I81A 2G8LA 5BR8M 1Q3CA 4LG2A 3TWMA 3KSXA 3K8ZA 3LCUA 4M9SA 3HJ8A 4OVZA 4WP2A 2C96A 5EXXA 1SXJC 5ITXE 3P7ZA 3A45A 4B3RM 2KZUA 3LVWA 4WW0A 3K9PA 3H4JA 1VQ1A 2YR0A 3FYCA 1R6BX 4X62M 3W0LB 2CHVA 2FNAA 2KW0A 3AOEA 2UXCM 1DGBA 1JB0F 2WSFF 4UYBA 3IG5A 1S3SA 4QOSA 1G8PA 1OIPA 2AHMA 3LVVA 3MHVC 4DR5M 1IBKM 1XWIA 1I4WA 4Y28F 1G4AE 5EXSA 2DENA 1ZMWA 5LMNM 4JI0M 2XGNA 1PJSA 2JNHA 4LJ6A 1NHGC 4IBDA 3JR5A 4B3TM 4LFCM 2YNMD 1HQCA 1IY0A 1QAQA 2OOAA 3BOSA 2QENA 4JI3M 4AG5A 5C1BA 2HCBA 1E32A 1OAIA 3HWSA 1K3XA 1N36M 1NO1A 4JXJA 2R45A 5IZ7D 4FVMA 4XGIA 4QOZC 2Z7JA 4M0DA 3GLHB 3GLFB 4CHTB 3K92A 1Q39A 4IBFA 4LFBM 5EP1A 3TQSA 3U6DA 5ITRA 1I94M 2QHOB 2O25A 3D8BA 5DYGA 4MGHA 4B3MM 2EUCA 4IBKA 4JYAM 2EO2A 1KFVA 2J5YA 3J80S 5ITXA 1EE8A 3PNVA 2K47A 3SMSA 3KP1E 4MH0E 1HR0M 3L29A 2E2XA 1R2ZA 2CHGA 1HT2E 5F3WA 3AFHA 2KZSA 3Q8XA 1Z5BA 4MM3B 3BXWA 5L8RF 4X66M 4B7GA 3JR4A 3ZH9B 3WHLA 2XFSA 3KSJA 4FCVA 3GLFE 1W5TA 4YY3M 2ZTCA 1WGLA 2FH0A 4AQYM 1NY6A 1OFIA 3TL4X 2DZLA 3CF6E 3GQ3A 4NL4H 2KRUA 3H4MA 2OOBA 1QDRA 2R4JA 3HHWA 3PFIA 4L15A 3RE8A 4B7FA 3HY5A 3GLGB 1L1ZA 2CP8A 5C18A 2R18A 2APLA 3VLFB 1R7RA 2QZ4A 3U6PA 4NXMM 1FJGM 1TH2A 4XK8F 5DNYA 2KNZA 3HJQA 1L8QA 2LBCA 2L4EA 1QQWA 2VQFM 2GQFA 2J7OA 2Q2EB 2XLJA 1EIJA 2YFQA 3PNYA 1T3TA 2F5SA 3HU1A 2BWEA 3B7QA 1MJGM 2M60A 1Q02A 1VDLA 4KO8A 3UJNA 1XMQM 2FS1A 2OQ4A 1L2DA 4L78A 3E21A 2MH8A 4LJAA 2L2DA 4RKUF 4PD2A 3LQRA 4AKGA 4AW4A 4BB9A 2LVPC 3AKZA 2JY6B 5KPZA 1V92A 3J81S 4K0KM 2EJSA 1HT1E 2FE8A 3GLGA 2QBYB 3QAUA 4NRWA 3WHKA 4CISA 4LGYA 2O5RA 2L09A 1XXHA 3LCVB 2NQ8C 3NBXX 1NJGA 2JY7A 4GC9A 4FWHA 1NV9A 1TDHA 2V1CA 4L6V6 4JN6A 5DFLA 1DV0A 4FMMA 4MGZE 5ITTA 4G6ZA 5IREB 2HHHM 2G5GX 5EXPA 4G4NA 3J7AS 3Q8GA 2JA2A 2DNAA 4FCTA 4B7HA 3IHPA 3KP0E 3HJSA 2XEPA 3KVWA 2F5PA 4TLGA 3UZUA 5FTKA 3ZCBB 3UMMA 1TF0B 1JQJC 2ZTDA
chains in the Genus database with same CATH topology
4M8ZA 1AUAA 3W67A 4J7QA 4UYBA 3HY5A 1OIPA 4OMJA 3W68A 2E2XA 4OMKA 1OLMA 4FMMA 1O6UA 3P7ZA 4J7PA 3B7NA 3PG7A 3B7QA 3Q8GA 1OLME 3B7ZA 1R5LA 3HX3A 2D4QA 4CJ6A 4TLGA 1OIZA 4CIZA 3PEGA 3B74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M8Z A;  1AUA A;  3W67 A;  4J7Q A;  4UYB A;  3HY5 A;  1OIP A;  4OMJ A;  3W68 A;  2E2X A;  4OMK A;  1OLM A;  4FMM A;  1O6U A;  3P7Z A;  4J7P A;  3B7N A;  3PG7 A;  3B7Q A;  3Q8G A;  1OLM E;  3B7Z A;  1R5L A;  3HX3 A;  2D4Q A;  4CJ6 A;  4TLG A;  1OIZ A;  4CIZ A;  3PEG A;  3B74 A; 
#chains in the Genus database with same CATH topology
 3W67 A;  3J27 B;  4Z6Y A;  3NWL A;  4KLN A;  4I8O A;  4F1I A;  2D7E A;  2DAI A;  4PT5 A;  3SAU A;  1TDZ A;  4JV5 M;  5FTN A;  5KPT A;  1XC8 A;  2ERC A;  1MU5 A;  2JY8 A;  3FTC A;  4UN2 B;  2JY5 A;  2DAM A;  4DUZ M;  1NVM A;  1PM5 A;  1V34 A;  3FTF A;  4DR1 M;  1Z6T A;  1IXS B;  3U5Z A;  1MN3 A;  2R4E A;  2QPA A;  2W82 A;  4IIW A;  3VDP A;  5BPV A;  5GKN A;  3GPU A;  3GLI B;  1ZAE A;  4DV5 M;  1EFU B;  2CRU A;  2JUJ A;  1OAO C;  2WSE F;  2LHG A;  2JXN A;  2XSZ D;  4G3O A;  1IN4 A;  1TH4 A;  2BJV A;  1YE9 A;  2M5Z A;  5JI3 E;  2D7G A;  2C9O A;  4Q7J A;  1KYI A;  4EIW A;  1N75 A;  1IBL M;  3HHY A;  2A5Y B;  2HKJ A;  4D80 A;  2DWZ B;  3C3D A;  3SAT A;  3PEG A;  1YLA A;  3U61 A;  2OO9 A;  3SC3 A;  4DR4 M;  4LZJ A;  1E9R A;  1NV8 A;  1TGU A;  2DWM A;  2F5Q A;  1Q3B A;  2R6F A;  4DR3 M;  3U60 A;  4REZ A;  1UM8 A;  2LH0 A;  1IM2 A;  3W68 A;  3QWL A;  2VDB B;  3GPP A;  4XBO A;  3GPY A;  2CV1 A;  1Z59 A;  5FSW A;  2VQE M;  1HNX M;  4GKK M;  1QAO A;  3C3E A;  1GLN A;  2EKF A;  1F4I A;  4MGY E;  3R9X B;  3B7N A;  4I4L A;  1IN7 A;  3KFU G;  1OLM E;  2DAG A;  2Y21 A;  2XSZ A;  4LF9 M;  2ZAN A;  2ZAM A;  3SFZ A;  2CV0 A;  1OQY A;  5KPR A;  1RU3 A;  3T6P A;  1Z5A A;  4GHA A;  1VG5 A;  1JR3 E;  4GIP A;  2HL7 A;  4M0W A;  2QSF X;  2C5R A;  5JI2 E;  1SXJ D;  3TPZ A;  4I5S A;  3FTD A;  5KQD A;  2LNH C;  4D82 A;  4LF7 M;  1IXZ A;  2L7I A;  1SXJ B;  3VKG A;  5KO3 A;  1J7K A;  3W0F A;  3HGI A;  1Z5C A;  2HAK A;  2LVA A;  2DZO B;  3KOX E;  1GO5 A;  4OU7 A;  4W5W A;  3GLG E;  3GRV A;  4P16 A;  2LVQ D;  2ZAO A;  1O6U A;  1DGH B;  2X49 A;  3VDU A;  1TH3 A;  1XXH E;  1JR3 D;  2R65 A;  4IJF A;  1YUB A;  4FD2 A;  2KRK A;  4GIT A;  2QNJ A;  3U6M A;  3M7G A;  2VII A;  2LHC A;  5FTJ A;  1PJJ A;  2JZ0 A;  4FWG A;  2Z4R A;  2MRO B;  2K0B X;  4M9X A;  3EIH A;  3T1H M;  3GLH A;  4LRS A;  3GLF A;  1QYR A;  4DR7 M;  2D7H A;  1WR1 B;  4DBG B;  2ZM6 M;  4DR6 M;  2Y20 A;  2DHR A;  2HWJ A;  1QZM A;  4QHT A;  1IN6 A;  4S12 A;  4JI4 M;  4QHS A;  1G59 A;  4GMQ A;  2LXE A;  3CF2 A;  1OFH A;  4MGK E;  3DOA A;  1SXJ A;  3HU3 A;  2DVW B;  4B3S M;  3CTW B;  3EIE A;  4FCW A;  3SAV A;  1QUS A;  2YQZ A;  8CAT A;  3FUT A;  3I4V A;  2L4F A;  1OLM A;  1IBM M;  4HLQ A;  4DV2 M;  1N77 A;  1DGG A;  1DGH A;  2RRU A;  2LVO C;  2CFO A;  3KS4 A;  1C1K A;  3MMP A;  2LTU A;  2KHH A;  4AZF A;  3L28 A;  3QYE A;  5H37 D;  2F4V M;  3B7Z A;  3K9O A;  4FWD A;  4NSR A;  3HX3 A;  1JR3 A;  3D8L A;  1HNW M;  2V6Z M;  4PDG A;  3SAR A;  4L8R C;  1XHB A;  4DV1 M;  2KDL A;  4RF1 A;  2C9C A;  1G3I A;  1D0L A;  4II7 A;  4MGI E;  2Y0Q A;  4FW9 A;  2L6O A;  1IN8 A;  2ZBK B;  2JWS A;  4DV4 M;  4LJ5 A;  1SG9 A;  2XF3 A;  3AOG A;  1OJL A;  3AOE C;  4Z8X A;  3VFD A;  4JI2 M;  1FNN A;  2EA0 A;  4X65 M;  1XNQ M;  4IJE A;  3K2L A;  4LZZ A;  3RFW A;  4DR2 M;  1K3W A;  4OX9 M;  3IEC A;  4G4R A;  5ITY A;  1PJT A;  3PXG A;  4NSO B;  3V76 A;  3PG7 A;  1GAB A;  1ZMU A;  2CV2 A;  3ZQJ A;  4LJ8 A;  3KDS E;  2D4Q A;  1MX0 A;  1D0M A;  3MJ5 A;  2V1U A;  1PGY A;  5FTM A;  3GLI E;  1L2C A;  1QVR A;  1G71 A;  1TTE A;  2CE7 A;  3I01 M;  2BWB A;  3AJI B;  1NJF A;  3LW5 F;  5EXT A;  3GPX A;  1L2B A;  4PCZ A;  1ZQ9 A;  1K82 A;  3GRY A;  2L7H A;  3E4R A;  3R8F A;  4NRV A;  1LTM A;  5EP2 A;  2QP9 X;  1VEJ A;  1V33 A;  3BBZ A;  3CGW A;  4LJ7 A;  3A98 B;  3F92 A;  2OPF A;  3E9S A;  3HKP A;  1G41 A;  3ILK A;  2R46 A;  2QBY A;  2C99 A;  2UXD M;  2KA6 B;  2MR9 A;  4IBI A;  4OVZ B;  2Z8Y M;  1X37 A;  4HL4 A;  3SHG B;  3T15 A;  1OTR A;  4P17 A;  3FUV A;  4B08 A;  3U6E A;  2DI0 A;  1IY1 A;  5KQ8 A;  1GVN A;  3A42 A;  2JP7 A;  2CEA A;  4R7G A;  5IWA M;  3NBI A;  2UUB M;  3KOY E;  2Y0T A;  3M0E A;  2RKO A;  2XH9 A;  3FD9 A;  1HNZ M;  5EJC A;  4DUY M;  1GL7 A;  3SHF A;  5FLX S;  3B74 A;  1VEK A;  4L4U A;  4AG6 A;  4QNR A;  3ZC7 B;  3FRI A;  3J2P B;  2R44 A;  3L2A A;  2I7N A;  5EP4 A;  2CWB A;  3GLH E;  3FUW A;  3HHX A;  2CUZ A;  2K6B A;  1IQP A;  3LQQ A;  2FOI C;  3PVS A;  1Y8G A;  1HJP A;  3QYB A;  2G3Q A;  4LY6 A;  3SMP A;  1L1T A;  4GHL A;  1KSF X;  3KXE C;  3GRU A;  1UFZ A;  4BLC A;  1CUK A;  4OMK A;  1NHW C;  3C9P A;  4NXN M;  2EKK A;  1D0K A;  1IXS A;  1GKI A;  2KXE A;  3GLI A;  1SXJ E;  1HQY E;  4IBE A;  4IBG A;  2P5T A;  2FFJ A;  3L27 A;  1ZV1 A;  2Z3X A;  4JI7 M;  4JI1 M;  1PJQ A;  3SAW A;  4GH9 A;  3A46 A;  1P3Q Q;  4CGY B;  2RGH A;  4QNM A;  4WUR A;  4ANR A;  3DFZ A;  1N78 A;  1D2N A;  2VF7 A;  4HEO A;  1NNU C;  2K9D A;  3T38 A;  3JAM S;  2UXB M;  4G4O A;  3LMM A;  4MB7 A;  4OMJ A;  4GRI A;  4IBC A;  1BVS A;  1WIV A;  3FTE A;  2I7P A;  5A2Q S;  2DAE A;  3FE3 A;  4KHP M;  1XB2 B;  2MGW A;  1H6U A;  3J7B A;  3GQ5 A;  4NC6 A;  2QCU A;  3FUU A;  1QAM A;  1GL6 A;  3I04 M;  1GJS A;  1XNR M;  1QUT A;  4LCB A;  1WXQ A;  1IY2 A;  2Z4S A;  4RNA A;  1OKS A;  3GO8 A;  4M9Z A;  4BBA A;  3U6O A;  2UUA M;  5IT9 S;  2X8A A;  4ZPX A;  2XZF A;  4DV7 M;  2BNK A;  3SBJ A;  3SAS A;  4AKI A;  4LF4 M;  4LF6 M;  4JI6 M;  4G4Q A;  1IFY A;  4J7Q A;  5LMU M;  1J09 A;  2KNA A;  2DAK A;  4F2L A;  3DZD A;  2R0I A;  1YSY A;  2R62 A;  3KW6 A;  2DWN A;  2UU9 M;  2DKL A;  2LWX A;  1ORY B;  3I4Y A;  1R2Y A;  3B9P A;  3C58 A;  2BJW A;  1PRB A;  3L25 A;  2DXI A;  2N35 A;  2H1R A;  4R71 A;  3HZJ A;  2E5L M;  7CAT A;  4JI5 M;  3M6A A;  4LJ4 A;  1PJI A;  4TUW A;  4X64 M;  4LF5 M;  3FKE A;  2XZU A;  5FTL A;  2GNO A;  3TWL A;  4GKJ M;  1A5T A;  1R5L A;  4KT0 F;  3I51 A;  1IXR C;  2RGO A;  1NY5 A;  1LV7 A;  1W5S A;  3FYD A;  3HU2 A;  4A3V B;  2F5N A;  3GRR A;  2C98 A;  3VK7 A;  2XFT A;  2KEB A;  1DO2 A;  4KOD A;  3IG8 A;  5ITQ A;  1T6O A;  1WJ7 A;  1XXH B;  1NSF A;  5EQT A;  3GP1 A;  1J5E M;  4IBB A;  1ZMV A;  1QZE A;  5DYI A;  2KNV A;  3FUX A;  3DA1 A;  3TE6 A;  3B89 A;  3U6L A;  3MK6 A;  4R3D A;  4GEW A;  4JI8 M;  4LF8 M;  4AI6 A;  3RGS A;  3VKH A;  2F5O A;  4LJ9 A;  3U6S A;  4NOO B;  4RF0 A;  2H5X A;  2CHQ A;  5E26 A;  5E6J A;  1N32 M;  4J7P A;  3E46 A;  3U6Q A;  4IBJ A;  4PDI A;  1WGN A;  1QAN A;  2DZN B;  3HHZ A;  4L16 A;  1QDT A;  3VK8 A;  1AIP C;  3OTO M;  1DGF A;  2MJ5 B;  3AL0 C;  1VEG A;  3GQ4 A;  3KOZ E;  3KS8 A;  1WHC A;  3UGJ A;  1AUA A;  1IN5 A;  4DV3 M;  2UUC M;  4M8Z A;  3L26 A;  4AKH A;  2DWL A;  3THG A;  5EP3 A;  1C7Y A;  1R4G A;  2LVN C;  3U6C A;  3U5Z B;  2O01 F;  2B3T A;  3KOW E;  4DV0 M;  1E9S A;  4ITQ A;  4GC5 A;  4LRT A;  1XMO M;  1E94 E;  1VDD A;  1DO0 A;  2VF8 A;  5ITU A;  2JZ1 A;  3SYK A;  4D81 A;  3AV0 A;  3SYL A;  4LGM A;  2X4A A;  3T1Y M;  1T43 A;  2WZJ A;  4CJ6 A;  3K1J A;  3CF0 A;  1GJT A;  2J7N A;  1N34 M;  4DV6 M;  2DHY A;  1OIZ A;  3UK6 A;  3U61 B;  2WSC F;  4OW0 A;  4LFA M;  3RGP A;  4CIZ A;  4YHH M;  1NNJ A;  1TR8 A;  3U60 B;  2QQ8 A;  3FRH A;  1N33 M;  3TWK A;  4I81 A;  2G8L A;  5BR8 M;  1Q3C A;  4LG2 A;  3TWM A;  3KSX A;  3K8Z A;  3LCU A;  4M9S A;  3HJ8 A;  4OVZ A;  4WP2 A;  2C96 A;  5EXX A;  1SXJ C;  5ITX E;  3P7Z A;  3A45 A;  4B3R M;  2KZU A;  3LVW A;  4WW0 A;  3K9P A;  3H4J A;  1VQ1 A;  2YR0 A;  3FYC A;  1R6B X;  4X62 M;  3W0L B;  2CHV A;  2FNA A;  2KW0 A;  3AOE A;  2UXC M;  1DGB A;  1JB0 F;  2WSF F;  4UYB A;  3IG5 A;  1S3S A;  4QOS A;  1G8P A;  1OIP A;  2AHM A;  3LVV A;  3MHV C;  4DR5 M;  1IBK M;  1XWI A;  1I4W A;  4Y28 F;  1G4A E;  5EXS A;  2DEN A;  1ZMW A;  5LMN M;  4JI0 M;  2XGN A;  1PJS A;  2JNH A;  4LJ6 A;  1NHG C;  4IBD A;  3JR5 A;  4B3T M;  4LFC M;  2YNM D;  1HQC A;  1IY0 A;  1QAQ A;  2OOA A;  3BOS A;  2QEN A;  4JI3 M;  4AG5 A;  5C1B A;  2HCB A;  1E32 A;  1OAI A;  3HWS A;  1K3X A;  1N36 M;  1NO1 A;  4JXJ A;  2R45 A;  5IZ7 D;  4FVM A;  4XGI A;  4QOZ C;  2Z7J A;  4M0D A;  3GLH B;  3GLF B;  4CHT B;  3K92 A;  1Q39 A;  4IBF A;  4LFB M;  5EP1 A;  3TQS A;  3U6D A;  5ITR A;  1I94 M;  2QHO B;  2O25 A;  3D8B A;  5DYG A;  4MGH A;  4B3M M;  2EUC A;  4IBK A;  4JYA M;  2EO2 A;  1KFV A;  2J5Y A;  3J80 S;  5ITX A;  1EE8 A;  3PNV A;  2K47 A;  3SMS A;  3KP1 E;  4MH0 E;  1HR0 M;  3L29 A;  2E2X A;  1R2Z A;  2CHG A;  1HT2 E;  5F3W A;  3AFH A;  2KZS A;  3Q8X A;  1Z5B A;  4MM3 B;  3BXW A;  5L8R F;  4X66 M;  4B7G A;  3JR4 A;  3ZH9 B;  3WHL A;  2XFS A;  3KSJ A;  4FCV A;  3GLF E;  1W5T A;  4YY3 M;  2ZTC A;  1WGL A;  2FH0 A;  4AQY M;  1NY6 A;  1OFI A;  3TL4 X;  2DZL A;  3CF6 E;  3GQ3 A;  4NL4 H;  2KRU A;  3H4M A;  2OOB A;  1QDR A;  2R4J A;  3HHW A;  3PFI A;  4L15 A;  3RE8 A;  4B7F A;  3HY5 A;  3GLG B;  1L1Z A;  2CP8 A;  5C18 A;  2R18 A;  2APL A;  3VLF B;  1R7R A;  2QZ4 A;  3U6P A;  4NXM M;  1FJG M;  1TH2 A;  4XK8 F;  5DNY A;  2KNZ A;  3HJQ A;  1L8Q A;  2LBC A;  2L4E A;  1QQW A;  2VQF M;  2GQF A;  2J7O A;  2Q2E B;  2XLJ A;  1EIJ A;  2YFQ A;  3PNY A;  1T3T A;  2F5S A;  3HU1 A;  2BWE A;  3B7Q A;  1MJG M;  2M60 A;  1Q02 A;  1VDL A;  4KO8 A;  3UJN A;  1XMQ M;  2FS1 A;  2OQ4 A;  1L2D A;  4L78 A;  3E21 A;  2MH8 A;  4LJA A;  2L2D A;  4RKU F;  4PD2 A;  3LQR A;  4AKG A;  4AW4 A;  4BB9 A;  2LVP C;  3AKZ A;  2JY6 B;  5KPZ A;  1V92 A;  3J81 S;  4K0K M;  2EJS A;  1HT1 E;  2FE8 A;  3GLG A;  2QBY B;  3QAU A;  4NRW A;  3WHK A;  4CIS A;  4LGY A;  2O5R A;  2L09 A;  1XXH A;  3LCV B;  2NQ8 C;  3NBX X;  1NJG A;  2JY7 A;  4GC9 A;  4FWH A;  1NV9 A;  1TDH A;  2V1C A;  4L6V 6;  4JN6 A;  5DFL A;  1DV0 A;  4FMM A;  4MGZ E;  5ITT A;  4G6Z A;  5IRE B;  2HHH M;  2G5G X;  5EXP A;  4G4N A;  3J7A S;  3Q8G A;  2JA2 A;  2DNA A;  4FCT A;  4B7H A;  3IHP A;  3KP0 E;  3HJS A;  2XEP A;  3KVW A;  2F5P A;  4TLG A;  3UZU A;  5FTK A;  3ZCB B;  3UMM A;  1TF0 B;  1JQJ C;  2ZTD A; 
#chains in the Genus database with same CATH homology
 4M8Z A;  1AUA A;  3W67 A;  4J7Q A;  4UYB A;  3HY5 A;  1OIP A;  4OMJ A;  3W68 A;  2E2X A;  4OMK A;  1OLM A;  4FMM A;  1O6U A;  3P7Z A;  4J7P A;  3B7N A;  3PG7 A;  3B7Q A;  3Q8G A;  1OLM E;  3B7Z A;  1R5L A;  3HX3 A;  2D4Q A;  4CJ6 A;  4TLG A;  1OIZ A;  4CIZ A;  3PEG A;  3B74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...