4CJ6A

Crystal structure of the complex of the cellular retinal binding protein mutant r234w with 9-cis-retinal
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
250
structure length
250
Chain Sequence
ETREEAVRELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFIRARKFNVGRAYELLRGYVNFRLQYPELFDSLSPEAVRCTIEAGYPGVLSSRDKYGRVVMLFNIENWQSQEITFDEILQAYCFILEKLLENEETQINGFCIIENFKGFTMQQAASLRTSDLRKMVDMLQDSFPAWFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSDFGGTLPKYDGKAVAEQLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human Cellular Retinaldehyde-Binding Protein Has Secondary Thermal 9-Cis-Retinal Isomerase Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords RETINALDEHYDE-BINDING PROTEIN 1
total genus 98
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00650 CRAL_TRIO CRAL/TRIO domain
A PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.20 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 N-terminal domain of phosphatidylinositol transfer protein sec14p 4cj6A01
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 4cj6A02
3B7ZA 4OMJA 4M8ZA 1OLME 4UYBA 4CIZA 1AUAA 4CJ6A 1OIZA 4FMMA 4OMKA 1OLMA 3P7ZA 2D4QA 3B7QA 3PG7A 3HX3A 3HY5A 4J7PA 3B74A 3Q8GA 3W68A 1R5LA 1O6UA 1OIPA 3W67A 3PEGA 3B7NA 4TLGA 2E2XA 4J7QA
chains in the Genus database with same CATH superfamily
2LXEA 2UU9M 4GC9A 2C99A 3KXEC 4DBGB 1PGYA 4LJ5A 3TQSA 2JZ0A 2DAEA 4LF9M 2JP7A 4QOSA 2YFQA 1HNWM 2KW0A 1WR1B 1YSYA 2F5QA 5FTKA 3U6DA 2V1CA 2QSFX 4QHTA 2C98A 3QYEA 4IBJA 2XF3A 1XXHE 4KO8A 2Q2EB 3HX3A 2JY6B 1HNXM 4KLNA 1T3TA 2K0BX 4MGYE 3TWLA 2AHMA 4BB9A 1XWIA 2CHQA 1R6BX 2CP8A 3LQRA 3CF0A 2I7NA 3KW6A 3LVWA 3ZQJA 2JY5A 4AKGA 2VQFM 3GQ3A 2UXBM 3UK6A 5KPTA 1MN3A 2KRUA 2OO9A 2BNKA 2DAKA 1R2YA 5EP4A 2Y0QA 3BXWA 3U60A 4S12A 2ZTCA 2JY8A 4XBOA 4D81A 4X65M 3VKHA 2QENA 2CHGA 3M0EA 2CV1A 3JR4A 3P7ZA 2Z4RA 4IBGA 1OAOC 3MK6A 2OOAA 3HY5A 5JI2E 2F5SA 4B7GA 1SXJC 3K2LA 3I01M 2NQ8C 3TPZA 5ITQA 1L1TA 3B74A 1SXJA 2KNZA 2G3QA 2WSCF 4IJEA 4L4UA 3DA1A 1OIPA 1Q3BA 4JN6A 1QUTA 1O6UA 1PJTA 3W0FA 5H37D 1F4IA 4NXNM 1K3XA 4DUYM 1IM2A 3EIEA 2L7HA 1TH3A 1UM8A 1VG5A 2Y20A 1IY2A 4JI3M 1TH2A 4Z8XA 1J7KA 2XSZA 1HNZM 3FTEA 2KHHA 1YE9A 4P17A 2UXDM 2DHRA 4Q7JA 3GPUA 4DR2M 1W5SA 2C5RA 4JXJA 4OMKA 1QDTA 4MGHA 3AL0C 3R8FA 2EJSA 1HT2E 1WXQA 1OFIA 3PG7A 3GLHE 2HWJA 2JXNA 4ANRA 4GRIA 2RGHA 2R18A 1ZMVA 4NSRA 3FUXA 4LJ6A 1OJLA 3Q8GA 4ITQA 2R4JA 1NVMA 4X64M 3KOZE 4KT0F 2KZSA 4LFBM 4GMQA 3U6MA 2KDLA 1Z5CA 2ZANA 3KSJA 3L26A 3AV0A 2FNAA 2HL7A 3PVSA 2MJ5B 3KP1E 2VF8A 3KP0E 3GRRA 1Z59A 3U6PA 3FUTA 1G71A 1XNRM 2FS1A 2XZFA 1HT1E 3VLFB 2DENA 1RU3A 5LMUM 3SARA 4B3RM 4IIWA 2H1RA 2K6BA 1JR3E 4F2LA 1L1ZA 1Q39A 1ZQ9A 3HHZA 4GC5A 2JY7A 4IBCA 2R6FA 3ZH9B 4EIWA 2BWEA 3NBXX 4IBIA 4L15A 1WGLA 2EKFA 4PCZA 5EP2A 4HEOA 1Q02A 2C9OA 4NOOB 4QNMA 4UN2B 3GLIB 3L28A 4DV5M 1PRBA 4FCWA 5F3WA 3AFHA 5BPVA 2DZLA 4IJFA 2M60A 1OTRA 2ZAMA 2LBCA 2R62A 3VK7A 1OFHA 4LRTA 1TDZA 3TE6A 3GLHB 3I4VA 1XXHB 2Y21A 1GJTA 2F5NA 4M0WA 1VDLA 2QZ4A 1R7RA 2LNHC 3DFZA 3FYDA 3GLHA 4WP2A 3T15A 4LGYA 4OVZA 1KFVA 2CEAA 2DAMA 1E32A 3DZDA 2RGOA 3B9PA 1GABA 2XFSA 3I04M 1TR8A 1Z5AA 3HU1A 3J2PB 3FYCA 3TL4X 2CFOA 4I4LA 1D0LA 1NSFA 3C3EA 3HGIA 3A42A 1CUKA 4P16A 1ZV1A 3IG8A 4LG2A 2J5YA 5A2QS 5IT9S 4YHHM 3GLIE 3T6PA 3MJ5A 1VQ1A 4JV5M 1IN8A 4Z6YA 5FTLA 3GO8A 1FJGM 3FUWA 5FTMA 3FUUA 1GL6A 4FWDA 4FCVA 1DGFA 2Z8YM 3AOEA 4TUWA 4DV2M 4UYBA 3GLGE 3Q8XA 4A3VB 1L2BA 3U5ZA 3U6LA 3HU3A 4L16A 2DZNB 1OKSA 5EXTA 1P3QQ 1I4WA 2FE8A 1IQPA 2XLJA 4B3SM 2ERCA 3PFIA 1K3WA 5L8RF 2CV0A 4KODA 1QUSA 2WSFF 1EE8A 1NO1A 4CGYB 3E21A 3JAMS 5EXPA 2CUZA 4MGIE 1GJSA 1QVRA 3GRUA 1S3SA 1N34M 4FWHA 3IG5A 2KNAA 3M6AA 4I5SA 2C9CA 4FVMA 5E26A 1G8PA 4B08A 5EP1A 5C18A 1Q3CA 1N77A 4JI2M 3ZCBB 1GLNA 1QDRA 4G4RA 1C7YA 3VK8A 5EJCA 2XZUA 4LF5M 4M8ZA 4LF7M 2B3TA 1VEJA 4PD2A 2DAIA 4CJ6A 1OIZA 2MH8A 1UFZA 3IECA 2FH0A 1OAIA 2HKJA 4FMMA 4R71A 4QHSA 2R65A 4RF1A 3AKZA 4JI7M 1JR3D 3U6CA 4G3OA 3HJQA 5KQ8A 1OLMA 2CHVA 1V33A 3SYLA 2MR9A 3GLFA 3B7QA 3B89A 1YLAA 1DGGA 4DR3M 1A5TA 2YR0A 5BR8M 4JI5M 3RE8A 2DKLA 3GLFB 2UUBM 5FTNA 4IBKA 4AQYM 3QWLA 2UUAM 4FD2A 3U6SA 2CE7A 3IHPA 3T1YM 4AKHA 4MB7A 5C1BA 3RGSA 4G4NA 3W67A 4DR7M 2OOBA 1G3IA 4R7GA 3VDPA 3BOSA 4JI6M 4GKKM 1DGBA 3KFUG 3PNVA 4BBAA 1GO5A 1G59A 1IY0A 2L09A 2LVNC 4HLQA 1NHGC 4LCBA 5DYGA 4OVZB 3C58A 4IBFA 1JR3A 2XH9A 3GQ4A 2LVQD 3HKPA 3K1JA 3D8LA 1E9RA 4LF6M 3FTDA 3FUVA 1N36M 4KHPM 2DWMA 5KO3A 1JQJC 2D7EA 4GHAA 4FWGA 2G8LA 3U61A 5ITYA 3SMSA 3W68A 4AKIA 2LHGA 3CTWB 1XC8A 2L7IA 4L78A 1NNUC 1NNJA 4G4OA 1VEGA 4OW0A 2E5LM 3TWMA 5EXXA 2VDBB 3UZUA 3J81S 2EKKA 7CATA 4ZPXA 3VFDA 2GNOA 2QP9X 2FOIC 4DR4M 4X66M 3GLFE 1IN5A 2W82A 3H4JA 4Y28F 1L2DA 4QOZC 1QYRA 3NWLA 1WGNA 4WW0A 3T1HM 2V1UA 2J7OA 3SC3A 2OPFA 3WHLA 3RFWA 4LFAM 2CRUA 3H4MA 1R2ZA 1IXSA 2MROB 2L4FA 2YNMD 3SFZA 4DR5M 1R4GA 2KA6B 4DR6M 4MGZE 4GEWA 1IBLM 3SYKA 2UXCM 1ZMUA 2QBYA 1VDDA 1WJ7A 2ZAOA 1C1KA 1BVSA 3PNYA 4RNAA 2DWNA 1LTMA 2QBYB 2WZJA 3B7NA 2Z4SA 3KS4A 3L2AA 4DV1M 1DO2A 3HWSA 1TDHA 3V76A 5IWAM 4XGIA 4K0KM 2WSEF 3CGWA 3K9OA 4JI8M 3VKGA 1JB0F 2HAKA 1GVNA 3C3DA 1L2CA 2CV2A 2LHCA 1IN6A 2XSZD 4LGMA 1E94E 5FTJA 4LFCM 2F4VM 2ZBKB 3GRVA 4I81A 1D0MA 5ITUA 4I8OA 2D7GA 3HHWA 2LH0A 1TGUA 1MU5A 2K9DA 5ITRA 1VEKA 3GQ5A 5IZ7D 1WHCA 3GLGB 1V92A 2RKOA 2DHYA 5EXSA 1PJIA 3W0LB 5GKNA 4LY6A 4OU7A 1MJGM 2L2DA 2Z3XA 3SHFA 4AI6A 3LQQA 4LJ9A 1HQCA 1EIJA 3A45A 3B7ZA 1NV8A 3I4YA 2H5XA 3GPPA 3U6EA 2ZM6M 1SG9A 2CWBA 2MGWA 2JWSA 4HL4A 3J27B 2A5YB 3NBIA 2M5ZA 3FTCA 1ZMWA 3KOWE 1H6UA 4L6V6 2DWZB 1KSFX 4D80A 4X62M 2DAGA 1QAQA 3MMPA 2JUJA 1SXJB 3E4RA 2XEPA 1EFUB 1AIPC 3FRHA 3KVWA 4DV3M 2R44A 2F5PA 1T6OA 3A98B 3LCUA 4GH9A 4M9ZA 5FSWA 1J5EM 1R5LA 1PM5A 4NRVA 2HCBA 2ZTDA 3HZJA 3GLIA 2F5OA 2LTUA 3WHKA 1X37A 3U6OA 3KOYE 1PJQA 4J7QA 2KZUA 2GQFA 3E9SA 3KSXA 4IBBA 4DV7M 2DWLA 5ITTA 3FE3A 1NY5A 5E6JA 2FFJA 2YQZA 4PDGA 1N75A 3C9PA 1AUAA 1XXHA 2QCUA 2X4AA 2Y0TA 3K92A 1HQYE 3HHXA 1GL7A 3SHGB 3UGJA 3F92A 3ILKA 3FKEA 3L27A 4XK8F 3JR5A 2QHOB 2Z7JA 1KYIA 2D4QA 1XB2B 1IBKM 5KPZA 3LCVB 2EO2A 1HJPA 2C96A 2O25A 2QQ8A 3D8BA 4YY3M 3GPXA 2LVOC 4J7PA 3HJSA 3THGA 3M7GA 3HHYA 3GLGA 2G5GX 1ZAEA 2JA2A 2LVPC 3AOGA 2L6OA 1YUBA 2X49A 3HJ8A 4REZA 1N32M 2KNVA 2K47A 1V34A 4JI1M 1ORYB 4NL4H 4CIZA 1DO0A 3SMPA 3RGPA 1I94M 1NY6A 3KDSE 1IBMM 2DVWB 3AJIB 2DI0A 4II7A 4M9XA 3SAUA 3KS8A 3MHVC 1QAOA 3LMMA 4B3MM 1QZEA 1QQWA 5DYIA 1K82A 1G4AE 3CF2A 2BJVA 2KXEA 4JYAM 5FLXS 4LJ4A 2D7HA 3OTOM 3GPYA 3SATA 1Z6TA 3L29A 2XFTA 1PJJA 3SASA 3GP1A 3TWKA 1IXZA 3SAVA 4LJ7A 2P5TA 4MH0E 1PJSA 3GRYA 4B7HA 4DV4M 1IY1A 2DNAA 4LF8M 4LRSA 1D0KA 2VQEM 3FRIA 1N78A 1DV0A 3FD9A 2BWBA 4OMJA 3CF6E 4FCTA 3A46A 3J7BA 4DV6M 1Z5BA 4DV0M 2R0IA 3UMMA 1G41A 1QANA 4NC6A 5ITXE 2DXIA 4B7FA 2V6ZM 1SXJD 3LW5F 1D2NA 4GKJM 4M0DA 4NSOB 1TF0B 5ITXA 5KPRA 2R4EA 4FW9A 1WIVA 3VDUA 3EIHA 4AZFA 8CATA 1IXSB 2EA0A 4PDIA 1TH4A 4B3TM 2DZOB 1W5TA 2KRKA 5DNYA 2QNJA 2HHHM 4DR1M 4GIPA 4LJAA 3AOEC 2RRUA 4JI0M 4AW4A 2O01F 2X8AA 1SXJE 1NHWC 2XGNA 4IBEA 1HR0M 2E2XA 3T38A 3K8ZA 4M9SA 3U5ZB 1OLME 4GHLA 3U6QA 3PXGA 3I51A 5EP3A 3U60B 2VF7A 2UUCM 1IFYA 2OQ4A 2L4EA 4NXMM 4NRWA 5KQDA 4W5WA 1LV7A 1N33M 4DUZM 4D82A 4MGKE 2VIIA 4L8RC 4JI4M 2KEBA 3SBJA 2LWXA 1NJFA 3L25A 4BLCA 1IN4A 5LMNM 2QPAA 3J7AS 2LVAA 2EUCA 4G4QA 3DOAA 4GITA 1DGHA 4PT5A 2JNHA 1E9SA 3BBZA 4G6ZA 4R3DA 5EQTA 4AG6A 1XNQM 2R46A 1QZMA 1T43A 5DFLA 3FTFA 2J7NA 3QYBA 5IREB 4AG5A 2N35A 3UJNA 2APLA 4IBDA 2BJWA 4F1IA 1TTEA 4QNRA 3E46A 3HU2A 3QAUA 2R45A 1XMQM 1MX0A 2JZ1A 4LF4M 3J80S 1NJGA 3K9PA 1IXRC 4LJ8A 4WURA 3R9XB 1XHBA 1J09A 2I7PA 4LZJA 3SAWA 4CISA 4LZZA 1FNNA 1L8QA 1OQYA 1QAMA 4MM3B 3ZC7B 3KOXE 1IN7A 2O5RA 1NV9A 4RKUF 1XMOM 4RF0A 5JI3E 1DGHB 4CHTB 3U61B 3PEGA 1Y8GA 1GKIA 3LVVA 4OX9M 4TLGA
chains in the Genus database with same CATH topology
3B7ZA 4OMJA 4M8ZA 1OLME 4UYBA 4CIZA 1AUAA 4CJ6A 1OIZA 4FMMA 4OMKA 1OLMA 3P7ZA 2D4QA 3B7QA 3PG7A 3HX3A 3HY5A 4J7PA 3B74A 3Q8GA 3W68A 1R5LA 1O6UA 1OIPA 3W67A 3PEGA 3B7NA 4TLGA 2E2XA 4J7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B7Z A;  4OMJ A;  4M8Z A;  1OLM E;  4UYB A;  4CIZ A;  1AUA A;  4CJ6 A;  1OIZ A;  4FMM A;  4OMK A;  1OLM A;  3P7Z A;  2D4Q A;  3B7Q A;  3PG7 A;  3HX3 A;  3HY5 A;  4J7P A;  3B74 A;  3Q8G A;  3W68 A;  1R5L A;  1O6U A;  1OIP A;  3W67 A;  3PEG A;  3B7N A;  4TLG A;  2E2X A;  4J7Q A; 
#chains in the Genus database with same CATH topology
 2LXE A;  2UU9 M;  4GC9 A;  2C99 A;  3KXE C;  4DBG B;  1PGY A;  4LJ5 A;  3TQS A;  2JZ0 A;  2DAE A;  4LF9 M;  2JP7 A;  4QOS A;  2YFQ A;  1HNW M;  2KW0 A;  1WR1 B;  1YSY A;  2F5Q A;  5FTK A;  3U6D A;  2V1C A;  2QSF X;  4QHT A;  2C98 A;  3QYE A;  4IBJ A;  2XF3 A;  1XXH E;  4KO8 A;  2Q2E B;  3HX3 A;  2JY6 B;  1HNX M;  4KLN A;  1T3T A;  2K0B X;  4MGY E;  3TWL A;  2AHM A;  4BB9 A;  1XWI A;  2CHQ A;  1R6B X;  2CP8 A;  3LQR A;  3CF0 A;  2I7N A;  3KW6 A;  3LVW A;  3ZQJ A;  2JY5 A;  4AKG A;  2VQF M;  3GQ3 A;  2UXB M;  3UK6 A;  5KPT A;  1MN3 A;  2KRU A;  2OO9 A;  2BNK A;  2DAK A;  1R2Y A;  5EP4 A;  2Y0Q A;  3BXW A;  3U60 A;  4S12 A;  2ZTC A;  2JY8 A;  4XBO A;  4D81 A;  4X65 M;  3VKH A;  2QEN A;  2CHG A;  3M0E A;  2CV1 A;  3JR4 A;  3P7Z A;  2Z4R A;  4IBG A;  1OAO C;  3MK6 A;  2OOA A;  3HY5 A;  5JI2 E;  2F5S A;  4B7G A;  1SXJ C;  3K2L A;  3I01 M;  2NQ8 C;  3TPZ A;  5ITQ A;  1L1T A;  3B74 A;  1SXJ A;  2KNZ A;  2G3Q A;  2WSC F;  4IJE A;  4L4U A;  3DA1 A;  1OIP A;  1Q3B A;  4JN6 A;  1QUT A;  1O6U A;  1PJT A;  3W0F A;  5H37 D;  1F4I A;  4NXN M;  1K3X A;  4DUY M;  1IM2 A;  3EIE A;  2L7H A;  1TH3 A;  1UM8 A;  1VG5 A;  2Y20 A;  1IY2 A;  4JI3 M;  1TH2 A;  4Z8X A;  1J7K A;  2XSZ A;  1HNZ M;  3FTE A;  2KHH A;  1YE9 A;  4P17 A;  2UXD M;  2DHR A;  4Q7J A;  3GPU A;  4DR2 M;  1W5S A;  2C5R A;  4JXJ A;  4OMK A;  1QDT A;  4MGH A;  3AL0 C;  3R8F A;  2EJS A;  1HT2 E;  1WXQ A;  1OFI A;  3PG7 A;  3GLH E;  2HWJ A;  2JXN A;  4ANR A;  4GRI A;  2RGH A;  2R18 A;  1ZMV A;  4NSR A;  3FUX A;  4LJ6 A;  1OJL A;  3Q8G A;  4ITQ A;  2R4J A;  1NVM A;  4X64 M;  3KOZ E;  4KT0 F;  2KZS A;  4LFB M;  4GMQ A;  3U6M A;  2KDL A;  1Z5C A;  2ZAN A;  3KSJ A;  3L26 A;  3AV0 A;  2FNA A;  2HL7 A;  3PVS A;  2MJ5 B;  3KP1 E;  2VF8 A;  3KP0 E;  3GRR A;  1Z59 A;  3U6P A;  3FUT A;  1G71 A;  1XNR M;  2FS1 A;  2XZF A;  1HT1 E;  3VLF B;  2DEN A;  1RU3 A;  5LMU M;  3SAR A;  4B3R M;  4IIW A;  2H1R A;  2K6B A;  1JR3 E;  4F2L A;  1L1Z A;  1Q39 A;  1ZQ9 A;  3HHZ A;  4GC5 A;  2JY7 A;  4IBC A;  2R6F A;  3ZH9 B;  4EIW A;  2BWE A;  3NBX X;  4IBI A;  4L15 A;  1WGL A;  2EKF A;  4PCZ A;  5EP2 A;  4HEO A;  1Q02 A;  2C9O A;  4NOO B;  4QNM A;  4UN2 B;  3GLI B;  3L28 A;  4DV5 M;  1PRB A;  4FCW A;  5F3W A;  3AFH A;  5BPV A;  2DZL A;  4IJF A;  2M60 A;  1OTR A;  2ZAM A;  2LBC A;  2R62 A;  3VK7 A;  1OFH A;  4LRT A;  1TDZ A;  3TE6 A;  3GLH B;  3I4V A;  1XXH B;  2Y21 A;  1GJT A;  2F5N A;  4M0W A;  1VDL A;  2QZ4 A;  1R7R A;  2LNH C;  3DFZ A;  3FYD A;  3GLH A;  4WP2 A;  3T15 A;  4LGY A;  4OVZ A;  1KFV A;  2CEA A;  2DAM A;  1E32 A;  3DZD A;  2RGO A;  3B9P A;  1GAB A;  2XFS A;  3I04 M;  1TR8 A;  1Z5A A;  3HU1 A;  3J2P B;  3FYC A;  3TL4 X;  2CFO A;  4I4L A;  1D0L A;  1NSF A;  3C3E A;  3HGI A;  3A42 A;  1CUK A;  4P16 A;  1ZV1 A;  3IG8 A;  4LG2 A;  2J5Y A;  5A2Q S;  5IT9 S;  4YHH M;  3GLI E;  3T6P A;  3MJ5 A;  1VQ1 A;  4JV5 M;  1IN8 A;  4Z6Y A;  5FTL A;  3GO8 A;  1FJG M;  3FUW A;  5FTM A;  3FUU A;  1GL6 A;  4FWD A;  4FCV A;  1DGF A;  2Z8Y M;  3AOE A;  4TUW A;  4DV2 M;  4UYB A;  3GLG E;  3Q8X A;  4A3V B;  1L2B A;  3U5Z A;  3U6L A;  3HU3 A;  4L16 A;  2DZN B;  1OKS A;  5EXT A;  1P3Q Q;  1I4W A;  2FE8 A;  1IQP A;  2XLJ A;  4B3S M;  2ERC A;  3PFI A;  1K3W A;  5L8R F;  2CV0 A;  4KOD A;  1QUS A;  2WSF F;  1EE8 A;  1NO1 A;  4CGY B;  3E21 A;  3JAM S;  5EXP A;  2CUZ A;  4MGI E;  1GJS A;  1QVR A;  3GRU A;  1S3S A;  1N34 M;  4FWH A;  3IG5 A;  2KNA A;  3M6A A;  4I5S A;  2C9C A;  4FVM A;  5E26 A;  1G8P A;  4B08 A;  5EP1 A;  5C18 A;  1Q3C A;  1N77 A;  4JI2 M;  3ZCB B;  1GLN A;  1QDR A;  4G4R A;  1C7Y A;  3VK8 A;  5EJC A;  2XZU A;  4LF5 M;  4M8Z A;  4LF7 M;  2B3T A;  1VEJ A;  4PD2 A;  2DAI A;  4CJ6 A;  1OIZ A;  2MH8 A;  1UFZ A;  3IEC A;  2FH0 A;  1OAI A;  2HKJ A;  4FMM A;  4R71 A;  4QHS A;  2R65 A;  4RF1 A;  3AKZ A;  4JI7 M;  1JR3 D;  3U6C A;  4G3O A;  3HJQ A;  5KQ8 A;  1OLM A;  2CHV A;  1V33 A;  3SYL A;  2MR9 A;  3GLF A;  3B7Q A;  3B89 A;  1YLA A;  1DGG A;  4DR3 M;  1A5T A;  2YR0 A;  5BR8 M;  4JI5 M;  3RE8 A;  2DKL A;  3GLF B;  2UUB M;  5FTN A;  4IBK A;  4AQY M;  3QWL A;  2UUA M;  4FD2 A;  3U6S A;  2CE7 A;  3IHP A;  3T1Y M;  4AKH A;  4MB7 A;  5C1B A;  3RGS A;  4G4N A;  3W67 A;  4DR7 M;  2OOB A;  1G3I A;  4R7G A;  3VDP A;  3BOS A;  4JI6 M;  4GKK M;  1DGB A;  3KFU G;  3PNV A;  4BBA A;  1GO5 A;  1G59 A;  1IY0 A;  2L09 A;  2LVN C;  4HLQ A;  1NHG C;  4LCB A;  5DYG A;  4OVZ B;  3C58 A;  4IBF A;  1JR3 A;  2XH9 A;  3GQ4 A;  2LVQ D;  3HKP A;  3K1J A;  3D8L A;  1E9R A;  4LF6 M;  3FTD A;  3FUV A;  1N36 M;  4KHP M;  2DWM A;  5KO3 A;  1JQJ C;  2D7E A;  4GHA A;  4FWG A;  2G8L A;  3U61 A;  5ITY A;  3SMS A;  3W68 A;  4AKI A;  2LHG A;  3CTW B;  1XC8 A;  2L7I A;  4L78 A;  1NNU C;  1NNJ A;  4G4O A;  1VEG A;  4OW0 A;  2E5L M;  3TWM A;  5EXX A;  2VDB B;  3UZU A;  3J81 S;  2EKK A;  7CAT A;  4ZPX A;  3VFD A;  2GNO A;  2QP9 X;  2FOI C;  4DR4 M;  4X66 M;  3GLF E;  1IN5 A;  2W82 A;  3H4J A;  4Y28 F;  1L2D A;  4QOZ C;  1QYR A;  3NWL A;  1WGN A;  4WW0 A;  3T1H M;  2V1U A;  2J7O A;  3SC3 A;  2OPF A;  3WHL A;  3RFW A;  4LFA M;  2CRU A;  3H4M A;  1R2Z A;  1IXS A;  2MRO B;  2L4F A;  2YNM D;  3SFZ A;  4DR5 M;  1R4G A;  2KA6 B;  4DR6 M;  4MGZ E;  4GEW A;  1IBL M;  3SYK A;  2UXC M;  1ZMU A;  2QBY A;  1VDD A;  1WJ7 A;  2ZAO A;  1C1K A;  1BVS A;  3PNY A;  4RNA A;  2DWN A;  1LTM A;  2QBY B;  2WZJ A;  3B7N A;  2Z4S A;  3KS4 A;  3L2A A;  4DV1 M;  1DO2 A;  3HWS A;  1TDH A;  3V76 A;  5IWA M;  4XGI A;  4K0K M;  2WSE F;  3CGW A;  3K9O A;  4JI8 M;  3VKG A;  1JB0 F;  2HAK A;  1GVN A;  3C3D A;  1L2C A;  2CV2 A;  2LHC A;  1IN6 A;  2XSZ D;  4LGM A;  1E94 E;  5FTJ A;  4LFC M;  2F4V M;  2ZBK B;  3GRV A;  4I81 A;  1D0M A;  5ITU A;  4I8O A;  2D7G A;  3HHW A;  2LH0 A;  1TGU A;  1MU5 A;  2K9D A;  5ITR A;  1VEK A;  3GQ5 A;  5IZ7 D;  1WHC A;  3GLG B;  1V92 A;  2RKO A;  2DHY A;  5EXS A;  1PJI A;  3W0L B;  5GKN A;  4LY6 A;  4OU7 A;  1MJG M;  2L2D A;  2Z3X A;  3SHF A;  4AI6 A;  3LQQ A;  4LJ9 A;  1HQC A;  1EIJ A;  3A45 A;  3B7Z A;  1NV8 A;  3I4Y A;  2H5X A;  3GPP A;  3U6E A;  2ZM6 M;  1SG9 A;  2CWB A;  2MGW A;  2JWS A;  4HL4 A;  3J27 B;  2A5Y B;  3NBI A;  2M5Z A;  3FTC A;  1ZMW A;  3KOW E;  1H6U A;  4L6V 6;  2DWZ B;  1KSF X;  4D80 A;  4X62 M;  2DAG A;  1QAQ A;  3MMP A;  2JUJ A;  1SXJ B;  3E4R A;  2XEP A;  1EFU B;  1AIP C;  3FRH A;  3KVW A;  4DV3 M;  2R44 A;  2F5P A;  1T6O A;  3A98 B;  3LCU A;  4GH9 A;  4M9Z A;  5FSW A;  1J5E M;  1R5L A;  1PM5 A;  4NRV A;  2HCB A;  2ZTD A;  3HZJ A;  3GLI A;  2F5O A;  2LTU A;  3WHK A;  1X37 A;  3U6O A;  3KOY E;  1PJQ A;  4J7Q A;  2KZU A;  2GQF A;  3E9S A;  3KSX A;  4IBB A;  4DV7 M;  2DWL A;  5ITT A;  3FE3 A;  1NY5 A;  5E6J A;  2FFJ A;  2YQZ A;  4PDG A;  1N75 A;  3C9P A;  1AUA A;  1XXH A;  2QCU A;  2X4A A;  2Y0T A;  3K92 A;  1HQY E;  3HHX A;  1GL7 A;  3SHG B;  3UGJ A;  3F92 A;  3ILK A;  3FKE A;  3L27 A;  4XK8 F;  3JR5 A;  2QHO B;  2Z7J A;  1KYI A;  2D4Q A;  1XB2 B;  1IBK M;  5KPZ A;  3LCV B;  2EO2 A;  1HJP A;  2C96 A;  2O25 A;  2QQ8 A;  3D8B A;  4YY3 M;  3GPX A;  2LVO C;  4J7P A;  3HJS A;  3THG A;  3M7G A;  3HHY A;  3GLG A;  2G5G X;  1ZAE A;  2JA2 A;  2LVP C;  3AOG A;  2L6O A;  1YUB A;  2X49 A;  3HJ8 A;  4REZ A;  1N32 M;  2KNV A;  2K47 A;  1V34 A;  4JI1 M;  1ORY B;  4NL4 H;  4CIZ A;  1DO0 A;  3SMP A;  3RGP A;  1I94 M;  1NY6 A;  3KDS E;  1IBM M;  2DVW B;  3AJI B;  2DI0 A;  4II7 A;  4M9X A;  3SAU A;  3KS8 A;  3MHV C;  1QAO A;  3LMM A;  4B3M M;  1QZE A;  1QQW A;  5DYI A;  1K82 A;  1G4A E;  3CF2 A;  2BJV A;  2KXE A;  4JYA M;  5FLX S;  4LJ4 A;  2D7H A;  3OTO M;  3GPY A;  3SAT A;  1Z6T A;  3L29 A;  2XFT A;  1PJJ A;  3SAS A;  3GP1 A;  3TWK A;  1IXZ A;  3SAV A;  4LJ7 A;  2P5T A;  4MH0 E;  1PJS A;  3GRY A;  4B7H A;  4DV4 M;  1IY1 A;  2DNA A;  4LF8 M;  4LRS A;  1D0K A;  2VQE M;  3FRI A;  1N78 A;  1DV0 A;  3FD9 A;  2BWB A;  4OMJ A;  3CF6 E;  4FCT A;  3A46 A;  3J7B A;  4DV6 M;  1Z5B A;  4DV0 M;  2R0I A;  3UMM A;  1G41 A;  1QAN A;  4NC6 A;  5ITX E;  2DXI A;  4B7F A;  2V6Z M;  1SXJ D;  3LW5 F;  1D2N A;  4GKJ M;  4M0D A;  4NSO B;  1TF0 B;  5ITX A;  5KPR A;  2R4E A;  4FW9 A;  1WIV A;  3VDU A;  3EIH A;  4AZF A;  8CAT A;  1IXS B;  2EA0 A;  4PDI A;  1TH4 A;  4B3T M;  2DZO B;  1W5T A;  2KRK A;  5DNY A;  2QNJ A;  2HHH M;  4DR1 M;  4GIP A;  4LJA A;  3AOE C;  2RRU A;  4JI0 M;  4AW4 A;  2O01 F;  2X8A A;  1SXJ E;  1NHW C;  2XGN A;  4IBE A;  1HR0 M;  2E2X A;  3T38 A;  3K8Z A;  4M9S A;  3U5Z B;  1OLM E;  4GHL A;  3U6Q A;  3PXG A;  3I51 A;  5EP3 A;  3U60 B;  2VF7 A;  2UUC M;  1IFY A;  2OQ4 A;  2L4E A;  4NXM M;  4NRW A;  5KQD A;  4W5W A;  1LV7 A;  1N33 M;  4DUZ M;  4D82 A;  4MGK E;  2VII A;  4L8R C;  4JI4 M;  2KEB A;  3SBJ A;  2LWX A;  1NJF A;  3L25 A;  4BLC A;  1IN4 A;  5LMN M;  2QPA A;  3J7A S;  2LVA A;  2EUC A;  4G4Q A;  3DOA A;  4GIT A;  1DGH A;  4PT5 A;  2JNH A;  1E9S A;  3BBZ A;  4G6Z A;  4R3D A;  5EQT A;  4AG6 A;  1XNQ M;  2R46 A;  1QZM A;  1T43 A;  5DFL A;  3FTF A;  2J7N A;  3QYB A;  5IRE B;  4AG5 A;  2N35 A;  3UJN A;  2APL A;  4IBD A;  2BJW A;  4F1I A;  1TTE A;  4QNR A;  3E46 A;  3HU2 A;  3QAU A;  2R45 A;  1XMQ M;  1MX0 A;  2JZ1 A;  4LF4 M;  3J80 S;  1NJG A;  3K9P A;  1IXR C;  4LJ8 A;  4WUR A;  3R9X B;  1XHB A;  1J09 A;  2I7P A;  4LZJ A;  3SAW A;  4CIS A;  4LZZ A;  1FNN A;  1L8Q A;  1OQY A;  1QAM A;  4MM3 B;  3ZC7 B;  3KOX E;  1IN7 A;  2O5R A;  1NV9 A;  4RKU F;  1XMO M;  4RF0 A;  5JI3 E;  1DGH B;  4CHT B;  3U61 B;  3PEG A;  1Y8G A;  1GKI A;  3LVV A;  4OX9 M;  4TLG A; 
#chains in the Genus database with same CATH homology
 3B7Z A;  4OMJ A;  4M8Z A;  1OLM E;  4UYB A;  4CIZ A;  1AUA A;  4CJ6 A;  1OIZ A;  4FMM A;  4OMK A;  1OLM A;  3P7Z A;  2D4Q A;  3B7Q A;  3PG7 A;  3HX3 A;  3HY5 A;  4J7P A;  3B74 A;  3Q8G A;  3W68 A;  1R5L A;  1O6U A;  1OIP A;  3W67 A;  3PEG A;  3B7N A;  4TLG A;  2E2X A;  4J7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...