4CJ6A

Crystal structure of the complex of the cellular retinal binding protein mutant r234w with 9-cis-retinal
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
250
structure length
250
Chain Sequence
b'ETREEAVRELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFIRARKFNVGRAYELLRGYVNFRLQYPELFDSLSPEAVRCTIEAGYPGVLSSRDKYGRVVMLFNIENWQSQEITFDEILQAYCFILEKLLENEETQINGFCIIENFKGFTMQQAASLRTSDLRKMVDMLQDSFPAWFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSDFGGTLPKYDGKAVAEQLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RETINALDEHYDE-BINDING PROTEIN 1
molecule tags Isomerase
source organism Homo sapiens
publication title Human Cellular Retinaldehyde-Binding Protein Has Secondary Thermal 9-Cis-Retinal Isomerase Activity.
pubmed doi rcsb
total genus 98
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00650 CRAL_TRIO CRAL/TRIO domain
A PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.20 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 N-terminal domain of phosphatidylinositol transfer protein sec14p 4cj6A01
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 4cj6A02
3B7NA 4FMMA 4CJ6A 1R5LA 3Q8GA 3B7ZA 3B7QA 3P7ZA 4OMJA 1O6UA 3W67A 3HY5A 4TLGA 2E2XA 4M8ZA 1AUAA 4CIZA 1OIPA 1OLMA 1OLME 4OMKA 4UYBA 3PG7A 3HX3A 4J7PA 2D4QA 3PEGA 4J7QA 3B74A 3W68A 1OIZA
chains in the Genus database with same CATH superfamily
3VK8A 1NY6A 1TGUA 2B3TA 2H5XA 4NXNM 3BXWA 4BLCA 1OJLA 1XMQM 1IBKM 3W0FA 3P7ZA 2HL7A 2JA2A 3AOEC 3NWLA 4ITQA 1FNNA 1HT1E 4AI6A 5EXSA 2YQZA 2QBYB 1TH2A 1L8QA 2I7NA 3GP1A 3AOGA 4WURA 4L6V6 1GJTA 3HY5A 2HHHM 1T6OA 1K82A 4JV5M 2UU9M 4EIWA 3GLHE 2HCBA 2LVQD 5EP4A 4LF8M 1OIPA 3AL0C 2L09A 3KOYE 5FSWA 2YFQA 4OMKA 3DA1A 2R4JA 1XXHB 4RKUF 1CUKA 4FCTA 3GLFB 4LF9M 2GQFA 2QPAA 5H37D 3T1HM 1C7YA 1TH3A 2APLA 1GL6A 3AV0A 4PT5A 4UN2B 3R8FA 4B3SM 1N36M 3HJ8A 3W68A 4M0DA 4PD2A 3K9OA 4GHAA 4D82A 2F5NA 4JI0M 3B7ZA 5A2QS 4A3VB 4D80A 2JZ1A 3AFHA 1QAQA 4NSRA 2JUJA 1WIVA 4FWHA 4NXMM 4NOOB 1JR3D 1NNUC 3RE8A 1G59A 2M60A 2V1UA 4KLNA 3SHGB 2LH0A 2R46A 1GO5A 1SXJD 1ZQ9A 2RGOA 4IBFA 4M9ZA 1TF0B 4S12A 1QUTA 2LTUA 3MK6A 2Z4RA 2R0IA 2WSEF 2MROB 4IBCA 3SAWA 2CP8A 2BNKA 3H4JA 3QAUA 4PDIA 3LQRA 4IBEA 1NJFA 1ZV1A 1QYRA 2Z7JA 3Q8GA 3HHZA 2EA0A 2D7HA 2M5ZA 1HJPA 3GLGA 2R18A 1PJTA 1MX0A 2UUCM 1XC8A 3WHKA 4R7GA 2LNHC 1OFHA 2LHCA 4LY6A 2JY6B 4TLGA 3FD9A 2DZLA 1HR0M 4M8ZA 1IN4A 3E9SA 4QHTA 5EQTA 2FNAA 1NJGA 2VF8A 4NRVA 4GEWA 1NHWC 2ZM6M 1NVMA 2C99A 1PJSA 2XSZA 4IBKA 4Z6YA 3U61B 4JI8M 1DO0A 3T6PA 3L25A 1QAOA 5KPZA 2O25A 2DAGA 3B74A 3J2PB 3M6AA 4KODA 3GLGB 4YHHM 1L1ZA 4AKIA 1N78A 1GJSA 4DUZM 3DOAA 3PVSA 1NV8A 2BJWA 8CATA 2VF7A 3T38A 4KT0F 4G6ZA 2VDBB 3B7QA 4OMJA 1VDLA 3EIHA 2L4FA 2CV1A 4LF4M 3FTFA 4M9XA 1IBLM 4B3MM 2EKFA 2OO9A 4IBGA 3C3DA 2DVWB 5ITQA 1YE9A 2KZUA 1OFIA 4JI5M 2JY7A 2MR9A 4IBDA 4HLQA 3VFDA 1GABA 2ZANA 1PGYA 5ITRA 4GRIA 1T43A 2Y20A 3AJIB 2J7OA 2G8LA 5EP1A 2KDLA 2LXEA 2Q2EB 2OPFA 5BR8M 3E21A 2JP7A 3FUTA 5FLXS 3KP0E 4OU7A 3A46A 3K8ZA 4DR7M 1TH4A 1WGNA 3GLIE 2KXEA 4Y28F 4Z8XA 3SARA 1S3SA 3FE3A 3SFZA 3UMMA 4X65M 5IZ7D 3GLFE 1RU3A 3KOXE 2OOAA 2C96A 3IHPA 4GH9A 2LVAA 3C3EA 3GLHB 4YY3M 4W5WA 2CHGA 4I8OA 4QHSA 2KNAA 4NL4H 4RF1A 5EXXA 1R7RA 3SYKA 3GO8A 4P17A 1PM5A 5LMNM 3ZC7B 3B9PA 2UXDM 1QQWA 2KNZA 1J09A 3RGPA 1SXJC 3PEGA 3HWSA 4FW9A 3L28A 4GKJM 4FCVA 3JR4A 4DR3M 5FTNA 4RNAA 1MJGM 2WSCF 2XSZD 2KW0A 1OQYA 1IY0A 2JZ0A 4LGYA 4LFAM 4MH0E 3VDUA 3U6SA 3HHYA 2L4EA 4DV3M 2R44A 1QDRA 3SASA 4IBBA 1IXSA 2NQ8C 1IY2A 3Q8XA 2FH0A 4WP2A 1N33M 3GPXA 3M0EA 1HT2E 1OTRA 2C5RA 1NY5A 4R71A 2DWLA 1QUSA 1C1KA 5LMUM 4LF6M 2F4VM 4JI6M 1ZMVA 3UZUA 1YUBA 5DNYA 4MGKE 2WSFF 4ZPXA 1XHBA 1TTEA 4P16A 3FTDA 5C18A 5EP3A 3GQ3A 1XXHE 3TL4X 1HQCA 2DHYA 2I7PA 4AZFA 2MJ5B 1K3WA 4HL4A 3BOSA 4G4RA 3PNYA 1SG9A 1XWIA 2R4EA 1XNRM 2C98A 3U6CA 3J80S 5KO3A 1VQ1A 3PNVA 2JY8A 3LMMA 4AW4A 2ZTCA 1TDZA 1EIJA 3IECA 3K2LA 2F5SA 4GITA 3SC3A 3U6LA 2D7GA 3R9XB 2XH9A 1NV9A 1IN7A 4OVZA 3FUVA 2V1CA 4B7HA 2CWBA 4LZZA 3B89A 4NSOB 5FTJA 2CHQA 5EP2A 4GC9A 1Q39A 3VKHA 3LW5F 2Z4SA 1D0LA 1QZEA 1YSYA 2KZSA 3L26A 2HKJA 1Q02A 2MGWA 3GLIB 3TWLA 1R5LA 4LCBA 1DGFA 2LVPC 1PJJA 1IY1A 1G3IA 2EUCA 1LV7A 1QAMA 1E9RA 1WHCA 2QSFX 3I4VA 4DR1M 3U60B 4FCWA 4AG6A 3DZDA 2DXIA 1HNWM 3SMSA 2F5QA 2Y21A 4L78A 4IBJA 1ZAEA 1PJIA 4DV4M 4DV0M 3J7AS 1TR8A 2R62A 2VIIA 1NHGC 4XBOA 2QZ4A 1V92A 2ZAMA 2L2DA 7CATA 1GKIA 1R2ZA 3KS8A 5FTKA 3U6PA 1L2DA 1DGHA 4HEOA 3CF2A 4Q7JA 1VG5A 2CHVA 2DNAA 3SMPA 2ZAOA 1GLNA 4LRTA 3MHVC 1OKSA 5ITXA 1IBMM 3KFUG 2K6BA 2WZJA 3FUWA 4GIPA 4NRWA 1QANA 2XFTA 3RFWA 4DBGB 3KOZE 2J5YA 4DR5M 3DFZA 3MMPA 3GLGE 2F5PA 4L15A 1DGHB 1PRBA 5E26A 1OAIA 3J81S 1JB0F 3K9PA 3VK7A 1G41A 1XB2B 1NNJA 1KYIA 1N34M 3U5ZA 3LCUA 4RF0A 1HNZM 3HU1A 1SXJA 2CEAA 5ITTA 4GHLA 1V33A 4L8RC 3K1JA 4TUWA 2UUBM 1G4AE 2XF3A 3K92A 1JQJC 1R4GA 4FWDA 3KSXA 4XGIA 4PCZA 1F4IA 3U6OA 3U60A 3A42A 3CTWB 4FWGA 1R2YA 1VEKA 1IQPA 3B7NA 3CF0A 4IJEA 4R3DA 1PJQA 1ZMUA 3GLIA 3D8LA 2CUZA 4KO8A 4DR6M 1L1TA 4LFCM 1NO1A 4DV6M 3SAUA 1R6BX 4ANRA 3THGA 1Z6TA 2CRUA 3L2AA 3U6EA 4CIZA 2Z3XA 4OVZB 4QNRA 3SHFA 4JI4M 2XZUA 2V6ZM 1OLMA 1AIPC 2G5GX 1LTMA 3C9PA 2C9CA 3GRRA 3NBXX 1XNQM 4B3TM 4QOSA 3FUXA 1WGLA 2K47A 4LJ6A 3AOEA 2OOBA 3KS4A 4J7QA 3LQQA 2XFSA 3HKPA 3GPYA 4AG5A 3KSJA 1E9SA 2DAMA 5ITUA 1QDTA 2R45A 2FE8A 3A45A 3IG8A 2XZFA 5IREB 2K9DA 2KA6B 3U6QA 4F1IA 3RGSA 3OTOM 2R65A 3GPUA 4DV2M 5FTLA 4PDGA 4JN6A 3I4YA 3L27A 4AKHA 2ERCA 3W67A 2LBCA 2LWXA 3KOWE 1D0MA 1N75A 4BB9A 1A5TA 4F2LA 2K0BX 3H4MA 3TE6A 3D8BA 1VDDA 1MU5A 1H6UA 1W5SA 3ZH9B 2DZOB 5EXTA 1YLAA 2KHHA 4DUYM 3ZQJA 4G4QA 1X37A 4J7PA 2D4QA 2EKKA 4LGMA 4MM3B 1K3XA 4LG2A 1I4WA 3QYBA 2QCUA 3QWLA 4AQYM 4IJFA 4BBAA 5EXPA 1HQYE 1TDHA 1IN5A 1Z5CA 2KEBA 3TPZA 4B7FA 2CFOA 2DENA 2Y0QA 1HNXM 2BWBA 1J7KA 4DV1M 3HHXA 1DO2A 3HHWA 2VQEM 4G4NA 2DZNB 1Y8GA 1ZMWA 3KVWA 1L2BA 4M0WA 2L7HA 1UM8A 2QBYA 4G3OA 5BPVA 5DFLA 2YNMD 3I04M 4UYBA 3PG7A 2FS1A 3GLHA 3HX3A 1DGGA 2EJSA 3KP1E 1EFUB 3CF6E 3L29A 2QNJA 3U6MA 4OX9M 5GKNA 4LJ8A 3TWKA 2DAEA 4B3RM 3SAVA 1GVNA 3NBIA 4FD2A 4MGYE 3T1YM 2L7IA 4CJ6A 2GNOA 2ZBKB 2FFJA 5EJCA 3BBZA 2CV2A 4MB7A 2HAKA 2DAKA 4I81A 4CGYB 3ILKA 2D7EA 2VQFM 3FRHA 1UFZA 1SXJB 2X8AA 3J7BA 4JI2M 1G8PA 2O5RA 3U5ZB 3GRUA 2DAIA 3GQ5A 2E2XA 2Y0TA 2JY5A 4II7A 5F3WA 1NSFA 5KQ8A 2Z8YM 2G3QA 3HU3A 2O01F 5FTMA 3M7GA 3SBJA 4WW0A 5ITXE 1DV0A 2R6FA 3U6DA 1QVRA 3VKGA 1P3QQ 5KPRA 1J5EM 3KDSE 4DV5M 1OIZA 4CISA 4JI1M 4K0KM 4X64M 1OAOC 4FMMA 4MGHA 4LF5M 4LRSA 1WXQA 3FYDA 2HWJA 5KQDA 2XEPA 3LVVA 3TQSA 1EE8A 3VLFB 3PFIA 4B08A 2DWMA 2YR0A 3I01M 5L8RF 4DV7M 1O6UA 2QENA 1WJ7A 4L16A 4LJ4A 1N77A 3U61A 1Z5AA 2X49A 1BVSA 3FRIA 3F92A 2P5TA 4GMQA 3SATA 4JI7M 4LF7M 4XK8F 2UXBM 3MJ5A 1FJGM 3TWMA 2DWNA 5DYIA 3GRYA 3IG5A 1T3TA 2EO2A 3JAMS 3HU2A 3PXGA 4LFBM 2KRUA 2RRUA 1W5TA 2RKOA 2UXCM 4KHPM 4G4OA 5JI2E 4LJ9A 2QP9X 1Q3CA 1IXRC 2N35A 2DKLA 4LJAA 1Z59A 2W82A 4JI3M 4I5SA 1IN6A 1E94E 1MN3A 2JWSA 2RGHA 1G71A 4OW0A 3UJNA 3FTEA 5DYGA 2DI0A 2X4AA 2CE7A 1VEJA 1JR3E 2DWZB 3WHLA 1GL7A 1Q3BA 1KFVA 2LHGA 5C1BA 3HJQA 3CGWA 4JYAM 1AUAA 1JR3A 2AHMA 4CHTB 4QOZC 2XLJA 4LJ5A 4REZA 1OLME 3JR5A 2LVNC 2QHOB 3ZCBB 1IXZA 1IFYA 3FUUA 1KSFX 1SXJE 4GC5A 4JXJA 3FYCA 3E4RA 1DGBA 3FKEA 1WR1B 2L6OA 4QNMA 1L2CA 2JNHA 1VEGA 2J7NA 2QQ8A 3HJSA 4MGIE 3KXEC 2A5YB 1Z5BA 4NC6A 3T15A 5KPTA 1I94M 4M9SA 1D0KA 3W0LB 2JXNA 5E6JA 2F5OA 1N32M 2DHRA 5ITYA 4AKGA 2KNVA 3QYEA 4D81A 5IWAM 3GRVA 1XMOM 3V76A 2LVOC 1ORYB 2C9OA 3EIEA 3UK6A 2CV0A 2H1RA 1IM2A 3E46A 3LCVB 3J27B 3GLFA 5JI3E 3C58A 1XXHA 3LVWA 4L4UA 4DR4M 3GPPA 1E32A 4LZJA 1V34A 2FOIC 4IIWA 4LJ7A 4GKKM 2OQ4A 2E5LM 4IBIA 1D2NA 2ZTDA 3HZJA 4FVMA 4MGZE 4DR2M 2BJVA 3HGIA 2XGNA 3VDPA 3AKZA 2MH8A 3A98B 3GQ4A 1IN8A 2BWEA 1IXSB 3I51A 3KW6A 4I4LA 4B7GA 3FTCA 3SYLA 3UGJA 2UUAM 1QZMA 4X66M 5IT9S 2KRKA 4X62M
chains in the Genus database with same CATH topology
3B7NA 4FMMA 4CJ6A 1R5LA 3Q8GA 3B7ZA 3B7QA 3P7ZA 4OMJA 1O6UA 3W67A 3HY5A 4TLGA 2E2XA 4M8ZA 1AUAA 4CIZA 1OIPA 1OLMA 1OLME 4OMKA 4UYBA 3PG7A 3HX3A 4J7PA 2D4QA 3PEGA 4J7QA 3B74A 3W68A 1OIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B7N A;  4FMM A;  4CJ6 A;  1R5L A;  3Q8G A;  3B7Z A;  3B7Q A;  3P7Z A;  4OMJ A;  1O6U A;  3W67 A;  3HY5 A;  4TLG A;  2E2X A;  4M8Z A;  1AUA A;  4CIZ A;  1OIP A;  1OLM A;  1OLM E;  4OMK A;  4UYB A;  3PG7 A;  3HX3 A;  4J7P A;  2D4Q A;  3PEG A;  4J7Q A;  3B74 A;  3W68 A;  1OIZ A; 
#chains in the Genus database with same CATH topology
 3VK8 A;  1NY6 A;  1TGU A;  2B3T A;  2H5X A;  4NXN M;  3BXW A;  4BLC A;  1OJL A;  1XMQ M;  1IBK M;  3W0F A;  3P7Z A;  2HL7 A;  2JA2 A;  3AOE C;  3NWL A;  4ITQ A;  1FNN A;  1HT1 E;  4AI6 A;  5EXS A;  2YQZ A;  2QBY B;  1TH2 A;  1L8Q A;  2I7N A;  3GP1 A;  3AOG A;  4WUR A;  4L6V 6;  1GJT A;  3HY5 A;  2HHH M;  1T6O A;  1K82 A;  4JV5 M;  2UU9 M;  4EIW A;  3GLH E;  2HCB A;  2LVQ D;  5EP4 A;  4LF8 M;  1OIP A;  3AL0 C;  2L09 A;  3KOY E;  5FSW A;  2YFQ A;  4OMK A;  3DA1 A;  2R4J A;  1XXH B;  4RKU F;  1CUK A;  4FCT A;  3GLF B;  4LF9 M;  2GQF A;  2QPA A;  5H37 D;  3T1H M;  1C7Y A;  1TH3 A;  2APL A;  1GL6 A;  3AV0 A;  4PT5 A;  4UN2 B;  3R8F A;  4B3S M;  1N36 M;  3HJ8 A;  3W68 A;  4M0D A;  4PD2 A;  3K9O A;  4GHA A;  4D82 A;  2F5N A;  4JI0 M;  3B7Z A;  5A2Q S;  4A3V B;  4D80 A;  2JZ1 A;  3AFH A;  1QAQ A;  4NSR A;  2JUJ A;  1WIV A;  4FWH A;  4NXM M;  4NOO B;  1JR3 D;  1NNU C;  3RE8 A;  1G59 A;  2M60 A;  2V1U A;  4KLN A;  3SHG B;  2LH0 A;  2R46 A;  1GO5 A;  1SXJ D;  1ZQ9 A;  2RGO A;  4IBF A;  4M9Z A;  1TF0 B;  4S12 A;  1QUT A;  2LTU A;  3MK6 A;  2Z4R A;  2R0I A;  2WSE F;  2MRO B;  4IBC A;  3SAW A;  2CP8 A;  2BNK A;  3H4J A;  3QAU A;  4PDI A;  3LQR A;  4IBE A;  1NJF A;  1ZV1 A;  1QYR A;  2Z7J A;  3Q8G A;  3HHZ A;  2EA0 A;  2D7H A;  2M5Z A;  1HJP A;  3GLG A;  2R18 A;  1PJT A;  1MX0 A;  2UUC M;  1XC8 A;  3WHK A;  4R7G A;  2LNH C;  1OFH A;  2LHC A;  4LY6 A;  2JY6 B;  4TLG A;  3FD9 A;  2DZL A;  1HR0 M;  4M8Z A;  1IN4 A;  3E9S A;  4QHT A;  5EQT A;  2FNA A;  1NJG A;  2VF8 A;  4NRV A;  4GEW A;  1NHW C;  2ZM6 M;  1NVM A;  2C99 A;  1PJS A;  2XSZ A;  4IBK A;  4Z6Y A;  3U61 B;  4JI8 M;  1DO0 A;  3T6P A;  3L25 A;  1QAO A;  5KPZ A;  2O25 A;  2DAG A;  3B74 A;  3J2P B;  3M6A A;  4KOD A;  3GLG B;  4YHH M;  1L1Z A;  4AKI A;  1N78 A;  1GJS A;  4DUZ M;  3DOA A;  3PVS A;  1NV8 A;  2BJW A;  8CAT A;  2VF7 A;  3T38 A;  4KT0 F;  4G6Z A;  2VDB B;  3B7Q A;  4OMJ A;  1VDL A;  3EIH A;  2L4F A;  2CV1 A;  4LF4 M;  3FTF A;  4M9X A;  1IBL M;  4B3M M;  2EKF A;  2OO9 A;  4IBG A;  3C3D A;  2DVW B;  5ITQ A;  1YE9 A;  2KZU A;  1OFI A;  4JI5 M;  2JY7 A;  2MR9 A;  4IBD A;  4HLQ A;  3VFD A;  1GAB A;  2ZAN A;  1PGY A;  5ITR A;  4GRI A;  1T43 A;  2Y20 A;  3AJI B;  2J7O A;  2G8L A;  5EP1 A;  2KDL A;  2LXE A;  2Q2E B;  2OPF A;  5BR8 M;  3E21 A;  2JP7 A;  3FUT A;  5FLX S;  3KP0 E;  4OU7 A;  3A46 A;  3K8Z A;  4DR7 M;  1TH4 A;  1WGN A;  3GLI E;  2KXE A;  4Y28 F;  4Z8X A;  3SAR A;  1S3S A;  3FE3 A;  3SFZ A;  3UMM A;  4X65 M;  5IZ7 D;  3GLF E;  1RU3 A;  3KOX E;  2OOA A;  2C96 A;  3IHP A;  4GH9 A;  2LVA A;  3C3E A;  3GLH B;  4YY3 M;  4W5W A;  2CHG A;  4I8O A;  4QHS A;  2KNA A;  4NL4 H;  4RF1 A;  5EXX A;  1R7R A;  3SYK A;  3GO8 A;  4P17 A;  1PM5 A;  5LMN M;  3ZC7 B;  3B9P A;  2UXD M;  1QQW A;  2KNZ A;  1J09 A;  3RGP A;  1SXJ C;  3PEG A;  3HWS A;  4FW9 A;  3L28 A;  4GKJ M;  4FCV A;  3JR4 A;  4DR3 M;  5FTN A;  4RNA A;  1MJG M;  2WSC F;  2XSZ D;  2KW0 A;  1OQY A;  1IY0 A;  2JZ0 A;  4LGY A;  4LFA M;  4MH0 E;  3VDU A;  3U6S A;  3HHY A;  2L4E A;  4DV3 M;  2R44 A;  1QDR A;  3SAS A;  4IBB A;  1IXS A;  2NQ8 C;  1IY2 A;  3Q8X A;  2FH0 A;  4WP2 A;  1N33 M;  3GPX A;  3M0E A;  1HT2 E;  1OTR A;  2C5R A;  1NY5 A;  4R71 A;  2DWL A;  1QUS A;  1C1K A;  5LMU M;  4LF6 M;  2F4V M;  4JI6 M;  1ZMV A;  3UZU A;  1YUB A;  5DNY A;  4MGK E;  2WSF F;  4ZPX A;  1XHB A;  1TTE A;  4P16 A;  3FTD A;  5C18 A;  5EP3 A;  3GQ3 A;  1XXH E;  3TL4 X;  1HQC A;  2DHY A;  2I7P A;  4AZF A;  2MJ5 B;  1K3W A;  4HL4 A;  3BOS A;  4G4R A;  3PNY A;  1SG9 A;  1XWI A;  2R4E A;  1XNR M;  2C98 A;  3U6C A;  3J80 S;  5KO3 A;  1VQ1 A;  3PNV A;  2JY8 A;  3LMM A;  4AW4 A;  2ZTC A;  1TDZ A;  1EIJ A;  3IEC A;  3K2L A;  2F5S A;  4GIT A;  3SC3 A;  3U6L A;  2D7G A;  3R9X B;  2XH9 A;  1NV9 A;  1IN7 A;  4OVZ A;  3FUV A;  2V1C A;  4B7H A;  2CWB A;  4LZZ A;  3B89 A;  4NSO B;  5FTJ A;  2CHQ A;  5EP2 A;  4GC9 A;  1Q39 A;  3VKH A;  3LW5 F;  2Z4S A;  1D0L A;  1QZE A;  1YSY A;  2KZS A;  3L26 A;  2HKJ A;  1Q02 A;  2MGW A;  3GLI B;  3TWL A;  1R5L A;  4LCB A;  1DGF A;  2LVP C;  1PJJ A;  1IY1 A;  1G3I A;  2EUC A;  1LV7 A;  1QAM A;  1E9R A;  1WHC A;  2QSF X;  3I4V A;  4DR1 M;  3U60 B;  4FCW A;  4AG6 A;  3DZD A;  2DXI A;  1HNW M;  3SMS A;  2F5Q A;  2Y21 A;  4L78 A;  4IBJ A;  1ZAE A;  1PJI A;  4DV4 M;  4DV0 M;  3J7A S;  1TR8 A;  2R62 A;  2VII A;  1NHG C;  4XBO A;  2QZ4 A;  1V92 A;  2ZAM A;  2L2D A;  7CAT A;  1GKI A;  1R2Z A;  3KS8 A;  5FTK A;  3U6P A;  1L2D A;  1DGH A;  4HEO A;  3CF2 A;  4Q7J A;  1VG5 A;  2CHV A;  2DNA A;  3SMP A;  2ZAO A;  1GLN A;  4LRT A;  3MHV C;  1OKS A;  5ITX A;  1IBM M;  3KFU G;  2K6B A;  2WZJ A;  3FUW A;  4GIP A;  4NRW A;  1QAN A;  2XFT A;  3RFW A;  4DBG B;  3KOZ E;  2J5Y A;  4DR5 M;  3DFZ A;  3MMP A;  3GLG E;  2F5P A;  4L15 A;  1DGH B;  1PRB A;  5E26 A;  1OAI A;  3J81 S;  1JB0 F;  3K9P A;  3VK7 A;  1G41 A;  1XB2 B;  1NNJ A;  1KYI A;  1N34 M;  3U5Z A;  3LCU A;  4RF0 A;  1HNZ M;  3HU1 A;  1SXJ A;  2CEA A;  5ITT A;  4GHL A;  1V33 A;  4L8R C;  3K1J A;  4TUW A;  2UUB M;  1G4A E;  2XF3 A;  3K92 A;  1JQJ C;  1R4G A;  4FWD A;  3KSX A;  4XGI A;  4PCZ A;  1F4I A;  3U6O A;  3U60 A;  3A42 A;  3CTW B;  4FWG A;  1R2Y A;  1VEK A;  1IQP A;  3B7N A;  3CF0 A;  4IJE A;  4R3D A;  1PJQ A;  1ZMU A;  3GLI A;  3D8L A;  2CUZ A;  4KO8 A;  4DR6 M;  1L1T A;  4LFC M;  1NO1 A;  4DV6 M;  3SAU A;  1R6B X;  4ANR A;  3THG A;  1Z6T A;  2CRU A;  3L2A A;  3U6E A;  4CIZ A;  2Z3X A;  4OVZ B;  4QNR A;  3SHF A;  4JI4 M;  2XZU A;  2V6Z M;  1OLM A;  1AIP C;  2G5G X;  1LTM A;  3C9P A;  2C9C A;  3GRR A;  3NBX X;  1XNQ M;  4B3T M;  4QOS A;  3FUX A;  1WGL A;  2K47 A;  4LJ6 A;  3AOE A;  2OOB A;  3KS4 A;  4J7Q A;  3LQQ A;  2XFS A;  3HKP A;  3GPY A;  4AG5 A;  3KSJ A;  1E9S A;  2DAM A;  5ITU A;  1QDT A;  2R45 A;  2FE8 A;  3A45 A;  3IG8 A;  2XZF A;  5IRE B;  2K9D A;  2KA6 B;  3U6Q A;  4F1I A;  3RGS A;  3OTO M;  2R65 A;  3GPU A;  4DV2 M;  5FTL A;  4PDG A;  4JN6 A;  3I4Y A;  3L27 A;  4AKH A;  2ERC A;  3W67 A;  2LBC A;  2LWX A;  3KOW E;  1D0M A;  1N75 A;  4BB9 A;  1A5T A;  4F2L A;  2K0B X;  3H4M A;  3TE6 A;  3D8B A;  1VDD A;  1MU5 A;  1H6U A;  1W5S A;  3ZH9 B;  2DZO B;  5EXT A;  1YLA A;  2KHH A;  4DUY M;  3ZQJ A;  4G4Q A;  1X37 A;  4J7P A;  2D4Q A;  2EKK A;  4LGM A;  4MM3 B;  1K3X A;  4LG2 A;  1I4W A;  3QYB A;  2QCU A;  3QWL A;  4AQY M;  4IJF A;  4BBA A;  5EXP A;  1HQY E;  1TDH A;  1IN5 A;  1Z5C A;  2KEB A;  3TPZ A;  4B7F A;  2CFO A;  2DEN A;  2Y0Q A;  1HNX M;  2BWB A;  1J7K A;  4DV1 M;  3HHX A;  1DO2 A;  3HHW A;  2VQE M;  4G4N A;  2DZN B;  1Y8G A;  1ZMW A;  3KVW A;  1L2B A;  4M0W A;  2L7H A;  1UM8 A;  2QBY A;  4G3O A;  5BPV A;  5DFL A;  2YNM D;  3I04 M;  4UYB A;  3PG7 A;  2FS1 A;  3GLH A;  3HX3 A;  1DGG A;  2EJS A;  3KP1 E;  1EFU B;  3CF6 E;  3L29 A;  2QNJ A;  3U6M A;  4OX9 M;  5GKN A;  4LJ8 A;  3TWK A;  2DAE A;  4B3R M;  3SAV A;  1GVN A;  3NBI A;  4FD2 A;  4MGY E;  3T1Y M;  2L7I A;  4CJ6 A;  2GNO A;  2ZBK B;  2FFJ A;  5EJC A;  3BBZ A;  2CV2 A;  4MB7 A;  2HAK A;  2DAK A;  4I81 A;  4CGY B;  3ILK A;  2D7E A;  2VQF M;  3FRH A;  1UFZ A;  1SXJ B;  2X8A A;  3J7B A;  4JI2 M;  1G8P A;  2O5R A;  3U5Z B;  3GRU A;  2DAI A;  3GQ5 A;  2E2X A;  2Y0T A;  2JY5 A;  4II7 A;  5F3W A;  1NSF A;  5KQ8 A;  2Z8Y M;  2G3Q A;  3HU3 A;  2O01 F;  5FTM A;  3M7G A;  3SBJ A;  4WW0 A;  5ITX E;  1DV0 A;  2R6F A;  3U6D A;  1QVR A;  3VKG A;  1P3Q Q;  5KPR A;  1J5E M;  3KDS E;  4DV5 M;  1OIZ A;  4CIS A;  4JI1 M;  4K0K M;  4X64 M;  1OAO C;  4FMM A;  4MGH A;  4LF5 M;  4LRS A;  1WXQ A;  3FYD A;  2HWJ A;  5KQD A;  2XEP A;  3LVV A;  3TQS A;  1EE8 A;  3VLF B;  3PFI A;  4B08 A;  2DWM A;  2YR0 A;  3I01 M;  5L8R F;  4DV7 M;  1O6U A;  2QEN A;  1WJ7 A;  4L16 A;  4LJ4 A;  1N77 A;  3U61 A;  1Z5A A;  2X49 A;  1BVS A;  3FRI A;  3F92 A;  2P5T A;  4GMQ A;  3SAT A;  4JI7 M;  4LF7 M;  4XK8 F;  2UXB M;  3MJ5 A;  1FJG M;  3TWM A;  2DWN A;  5DYI A;  3GRY A;  3IG5 A;  1T3T A;  2EO2 A;  3JAM S;  3HU2 A;  3PXG A;  4LFB M;  2KRU A;  2RRU A;  1W5T A;  2RKO A;  2UXC M;  4KHP M;  4G4O A;  5JI2 E;  4LJ9 A;  2QP9 X;  1Q3C A;  1IXR C;  2N35 A;  2DKL A;  4LJA A;  1Z59 A;  2W82 A;  4JI3 M;  4I5S A;  1IN6 A;  1E94 E;  1MN3 A;  2JWS A;  2RGH A;  1G71 A;  4OW0 A;  3UJN A;  3FTE A;  5DYG A;  2DI0 A;  2X4A A;  2CE7 A;  1VEJ A;  1JR3 E;  2DWZ B;  3WHL A;  1GL7 A;  1Q3B A;  1KFV A;  2LHG A;  5C1B A;  3HJQ A;  3CGW A;  4JYA M;  1AUA A;  1JR3 A;  2AHM A;  4CHT B;  4QOZ C;  2XLJ A;  4LJ5 A;  4REZ A;  1OLM E;  3JR5 A;  2LVN C;  2QHO B;  3ZCB B;  1IXZ A;  1IFY A;  3FUU A;  1KSF X;  1SXJ E;  4GC5 A;  4JXJ A;  3FYC A;  3E4R A;  1DGB A;  3FKE A;  1WR1 B;  2L6O A;  4QNM A;  1L2C A;  2JNH A;  1VEG A;  2J7N A;  2QQ8 A;  3HJS A;  4MGI E;  3KXE C;  2A5Y B;  1Z5B A;  4NC6 A;  3T15 A;  5KPT A;  1I94 M;  4M9S A;  1D0K A;  3W0L B;  2JXN A;  5E6J A;  2F5O A;  1N32 M;  2DHR A;  5ITY A;  4AKG A;  2KNV A;  3QYE A;  4D81 A;  5IWA M;  3GRV A;  1XMO M;  3V76 A;  2LVO C;  1ORY B;  2C9O A;  3EIE A;  3UK6 A;  2CV0 A;  2H1R A;  1IM2 A;  3E46 A;  3LCV B;  3J27 B;  3GLF A;  5JI3 E;  3C58 A;  1XXH A;  3LVW A;  4L4U A;  4DR4 M;  3GPP A;  1E32 A;  4LZJ A;  1V34 A;  2FOI C;  4IIW A;  4LJ7 A;  4GKK M;  2OQ4 A;  2E5L M;  4IBI A;  1D2N A;  2ZTD A;  3HZJ A;  4FVM A;  4MGZ E;  4DR2 M;  2BJV A;  3HGI A;  2XGN A;  3VDP A;  3AKZ A;  2MH8 A;  3A98 B;  3GQ4 A;  1IN8 A;  2BWE A;  1IXS B;  3I51 A;  3KW6 A;  4I4L A;  4B7G A;  3FTC A;  3SYL A;  3UGJ A;  2UUA M;  1QZM A;  4X66 M;  5IT9 S;  2KRK A;  4X62 M; 
#chains in the Genus database with same CATH homology
 3B7N A;  4FMM A;  4CJ6 A;  1R5L A;  3Q8G A;  3B7Z A;  3B7Q A;  3P7Z A;  4OMJ A;  1O6U A;  3W67 A;  3HY5 A;  4TLG A;  2E2X A;  4M8Z A;  1AUA A;  4CIZ A;  1OIP A;  1OLM A;  1OLM E;  4OMK A;  4UYB A;  3PG7 A;  3HX3 A;  4J7P A;  2D4Q A;  3PEG A;  4J7Q A;  3B74 A;  3W68 A;  1OIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...