4CJ6A

Crystal structure of the complex of the cellular retinal binding protein mutant r234w with 9-cis-retinal
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
250
structure length
250
Chain Sequence
ETREEAVRELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFIRARKFNVGRAYELLRGYVNFRLQYPELFDSLSPEAVRCTIEAGYPGVLSSRDKYGRVVMLFNIENWQSQEITFDEILQAYCFILEKLLENEETQINGFCIIENFKGFTMQQAASLRTSDLRKMVDMLQDSFPAWFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSDFGGTLPKYDGKAVAEQLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RETINALDEHYDE-BINDING PROTEIN 1
publication title Human Cellular Retinaldehyde-Binding Protein Has Secondary Thermal 9-Cis-Retinal Isomerase Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 98
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00650 CRAL_TRIO CRAL/TRIO domain
A PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.20 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 N-terminal domain of phosphatidylinositol transfer protein sec14p 4cj6A01
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 4cj6A02
3P7ZA 1OIPA 4FMMA 4J7QA 3B74A 4M8ZA 3HX3A 4UYBA 3W68A 1OIZA 4CIZA 3B7NA 1R5LA 4OMJA 2E2XA 3PG7A 4TLGA 3W67A 3PEGA 1O6UA 4OMKA 1OLME 3B7QA 4J7PA 2D4QA 1OLMA 3HY5A 3B7ZA 3Q8GA 4CJ6A 1AUAA
chains in the Genus database with same CATH superfamily
2H5XA 3CF2A 2DZNB 3GLGB 2KXEA 1N33M 1YLAA 2C98A 4AQYM 2DHYA 4FMMA 2XFTA 3R9XB 1N36M 1XNQM 1T3TA 1E94E 1NSFA 3VKHA 2JNHA 4LF9M 4IBDA 2D7GA 2X4AA 2XLJA 1ZAEA 2C5RA 2V1UA 3BXWA 1BVSA 4I4LA 1HNZM 4P16A 2CV0A 3AOEC 1EIJA 3HHWA 1IBLM 2DWNA 4MGHA 1DGHB 1SXJA 2LVAA 1SXJC 1ZMVA 2L4EA 2Y20A 2G8LA 3KW6A 1QAOA 4XBOA 3J7AS 1TH2A 2I7PA 5DYIA 1SG9A 2DKLA 1N77A 2DAKA 4GKKM 4LRTA 1G8PA 1D0MA 3C3DA 1DV0A 2ZAMA 4LJ6A 2R45A 2CE7A 1ZMUA 1XMOM 4OU7A 4JI7M 2Z8YM 1QDRA 2WZJA 2RGHA 2C99A 3FTDA 4NSOB 1QANA 2F5SA 3F92A 1QUTA 5EP3A 2ZTDA 3TWKA 2CUZA 2QBYB 1YUBA 4I81A 2MJ5B 1OQYA 3J7BA 1SXJE 1IN8A 1WIVA 3TPZA 3I4VA 4R71A 1NJGA 5ITUA 5DNYA 1UM8A 3T1HM 4LF7M 2UU9M 3NWLA 2KZUA 1N32M 3THGA 3PVSA 2P5TA 2RRUA 1J7KA 3AJIB 2F4VM 3WHKA 2OPFA 3NBIA 2DWLA 1QQWA 3GQ4A 1CUKA 1HR0M 4CJ6A 4UYBA 5EXPA 2CRUA 1C7YA 1T6OA 4PT5A 2KNZA 1PJIA 2V6ZM 2LWXA 2Y0TA 1RU3A 3TQSA 1NO1A 2G3QA 2LVQD 1L2CA 1N75A 3SYLA 3FUVA 3CGWA 5FTLA 4FD2A 4DV5M 1WGLA 2QZ4A 3PFIA 3D8LA 4HLQA 1VG5A 4LJ7A 4QHTA 4L6V6 3KXEC 3A46A 3UJNA 1IN6A 1QAQA 3PXGA 1JR3D 4L15A 3U5ZB 2KZSA 1EFUB 1TDHA 3IG5A 3B7ZA 3FYDA 3HU2A 1QZMA 4L4UA 1FJGM 2FE8A 4FVMA 4LF4M 4DR2M 1IXSA 2APLA 2JUJA 2J7OA 2H1RA 2Z4SA 4QNMA 5FSWA 4AZFA 3GPXA 2MR9A 4GEWA 4A3VB 4OVZB 2L7IA 1HT1E 5ITRA 2KRUA 3D8BA 2FNAA 3W68A 1IM2A 4FWDA 3U6QA 4JI4M 5H37D 2LNHC 2AHMA 4GHLA 1DGFA 2OOAA 1D2NA 4JI1M 4LZZA 1G71A 2QENA 2ERCA 4JI3M 4GC9A 3ZH9B 1PJSA 4QHSA 4DV7M 4GITA 1NVMA 2K9DA 2XSZA 3E46A 1N78A 3BOSA 3DA1A 5IWAM 4D81A 2DZOB 1C1KA 2DVWB 1X37A 2OO9A 3CF0A 4FWHA 3HHZA 3DFZA 3WHLA 2DHRA 4IJFA 3BBZA 2KNAA 1HNWM 4J7QA 1E32A 3GLHA 2RGOA 3KDSE 4LF8M 4X62M 2UUBM 4GC5A 1IN4A 2JXNA 3RE8A 4FCWA 3RGPA 3U6OA 2DWZB 4WW0A 3SYKA 2KNVA 1KSFX 4L8RC 2Z4RA 4DR5M 4ANRA 2LXEA 3LVVA 2BNKA 3UZUA 3K92A 1I94M 3AKZA 4AG6A 2D7HA 4GMQA 3RGSA 3U61B 1IBKM 5EP1A 2UXCM 1IXSB 3U6EA 1EE8A 2XZFA 5BR8M 1ZMWA 1AIPC 4IBGA 2UUAM 3A45A 3L26A 4ITQA 1WHCA 1NY5A 3GLHE 3IHPA 3GPYA 2LHGA 1G3IA 2QHOB 2R6FA 4LFBM 4LF6M 4IBCA 4IBKA 2CV1A 3QYEA 2YR0A 4LCBA 1WGNA 3E21A 2DNAA 2R0IA 3HHYA 4NXNM 3M0EA 2WSCF 3ZCBB 1TF0B 3B9PA 4BLCA 5BPVA 2DI0A 4LF5M 3ILKA 3EIEA 3AOEA 4B7FA 4QOZC 4OMKA 5KPRA 4DR6M 1NHGC 2HAKA 2QNJA 3HHXA 1NY6A 3HU1A 4GIPA 2ZM6M 1PJJA 2MGWA 2FH0A 5E26A 1OFIA 3RFWA 4W5WA 4XGIA 1TH3A 5KQDA 4IBFA 3VLFB 2CFOA 3J81S 4X65M 5IT9S 1OLME 4G6ZA 4HL4A 1PJTA 4B3RM 3SHFA 4KO8A 3HGIA 3MJ5A 3GLHB 3T38A 2VIIA 3FRHA 3GRRA 3GQ3A 1YE9A 2R4EA 4M8ZA 1DGGA 1TGUA 1XXHA 3KS4A 3SARA 4JI2M 1OIZA 1IXRC 2KDLA 4G4QA 4JI8M 2L6OA 3GO8A 1L1ZA 3L25A 3LCVB 2KW0A 2HWJA 4DV0M 4GHAA 1Z6TA 2QP9X 1OAIA 1MJGM 3FYCA 4MGYE 4B08A 1OFHA 2UXDM 2V1CA 2YNMD 5C18A 1L8QA 5JI2E 2F5OA 1HT2E 2ZANA 3DZDA 4B3TM 4LFCM 1XNRM 1DGBA 2QPAA 2CHVA 4NOOB 3HJQA 2L4FA 4LZJA 3M6AA 2K47A 3I4YA 5DFLA 5GKNA 2F5PA 3MMPA 1OTRA 2DAMA 4JI5M 3SFZA 1L1TA 4DV4M 4JI6M 1OAOC 2VF7A 1XB2B 3KP1E 3LQQA 3SBJA 1XXHE 3W0LB 2G5GX 2DAGA 2C9OA 3GLIA 3T6PA 2F5QA 4JYAM 1LV7A 2Q2EB 1OJLA 2B3TA 3FUWA 3PG7A 2HHHM 1V92A 3FTCA 3J80S 1IBMM 2YQZA 3U6PA 1IXZA 1Y8GA 2LVNC 2CV2A 3SATA 4KHPM 3U60A 1SXJB 2X49A 3FTEA 3L29A 1R6BX 3VK8A 4JI0M 1O6UA 4WP2A 3UK6A 1Z5BA 3LCUA 1R2YA 1G41A 1VEGA 5C1BA 2UXBM 5FLXS 2XGNA 2X8AA 5EP4A 5IZ7D 4L16A 3GP1A 3HU3A 1AUAA 5EXSA 1PM5A 5ITQA 4CGYB 4R3DA 5KQ8A 5LMUM 3ZC7B 4RNAA 3TE6A 3C9PA 1XXHB 1PGYA 2LVPC 4MB7A 5ITXA 3GLIE 2O5RA 1G59A 3HJSA 1KYIA 3HWSA 4BB9A 2HKJA 4YY3M 1J5EM 4NSRA 2Y0QA 4L78A 3TL4X 1E9SA 3C58A 4MGKE 4Z8XA 4DUZM 2DZLA 2KHHA 3W67A 1ZQ9A 4RF0A 4YHHM 4X66M 2EKFA 3M7GA 3LMMA 3A98B 1GVNA 2CHQA 4LY6A 2R46A 2LTUA 2C96A 1DO2A 3KOZE 4LGYA 5ITTA 3B89A 3T1YM 3PNYA 3MK6A 2D7EA 2C9CA 4LJ5A 4P17A 3UGJA 3SC3A 1HJPA 2I7NA 1OIPA 2DXIA 3CF6E 3CTWB 3GLGA 2VQEM 3VKGA 5ITXE 1XWIA 4FW9A 1NV8A 1ORYB 2WSFF 4G3OA 3VDUA 3GLIB 2MROB 3HX3A 1K82A 2J5YA 2XH9A 3I01M 3KOXE 4IIWA 2GNOA 3V76A 1WR1B 4CIZA 2QSFX 1XHBA 3J27B 4AW4A 3AL0C 4DV1M 3FUUA 1Q3CA 4B7HA 1F4IA 2KEBA 2ZBKB 4IBIA 4G4OA 1G4AE 2FS1A 4II7A 3AFHA 1Q39A 4CISA 2JZ1A 3B7QA 3TWMA 2D4QA 3L2AA 1VDLA 2XFSA 5A2QS 4BBAA 4DV2M 2RKOA 3FKEA 4F1IA 1IN7A 3KS8A 2KRKA 3GLGE 3QWLA 1XC8A 2BJVA 1TDZA 2WSEF 2Z3XA 1QVRA 3KVWA 3U6MA 1SXJD 4B7GA 4GRIA 7CATA 4QNRA 4JN6A 2OOBA 4F2LA 1A5TA 3B7NA 3I04M 2BJWA 4M9SA 1DO0A 4M0DA 1D0LA 2R62A 1KFVA 2QBYA 4DR3M 4FWGA 3K9PA 4UN2B 1HQYE 2EUCA 3GPUA 1GO5A 4Z6YA 4TUWA 1JQJC 1Z5AA 3QAUA 1WJ7A 2HCBA 3KOWE 1GJSA 3U6LA 1IY0A 3L28A 3VFDA 1OLMA 2EA0A 4DV3M 1R7RA 4TLGA 2QQ8A 2L7HA 1VEKA 3UMMA 3H4JA 2K0BX 3KSJA 1Z5CA 4NRVA 4LG2A 3R8FA 4ZPXA 1L2DA 4LFAM 5JI3E 2CHGA 1V34A 4KT0F 8CATA 1W5SA 2HL7A 5FTKA 2XF3A 1HQCA 4FCTA 1QAMA 2LH0A 3GRVA 5KO3A 3GQ5A 4OMJA 2Y21A 3KOYE 3QYBA 4LGMA 3JR5A 2A5YB 2XZUA 4GH9A 5EQTA 4AKIA 2R18A 3EIHA 4LJ9A 4M9ZA 2JZ0A 4RKUF 3GLFA 4IBJA 4XK8F 2JY7A 2R44A 1NNJA 2J7NA 4MH0E 4G4RA 4HEOA 3U5ZA 1J09A 3ZQJA 1N34M 2BWEA 2LHCA 4NXMM 3AOGA 4Y28F 1IQPA 1D0KA 4NL4H 4IBBA 3PNVA 4DR4M 1QUSA 4M0WA 1Q3BA 2JWSA 2ZAOA 5IREB 2JY6B 3K8ZA 2M5ZA 4MGIE 2FFJA 4GKJM 4I5SA 1WXQA 3B74A 2XEPA 4OVZA 3SHGB 4AKHA 2JA2A 1NHWC 3SMPA 4D82A 3VK7A 1LTMA 1PRBA 4QOSA 4FCVA 1P3QQ 2LBCA 3DOAA 2JY5A 3GLFE 3FTFA 4KODA 2DENA 2VDBB 3LQRA 4IBEA 3E9SA 3C3EA 2F5NA 4DR7M 3GPPA 1GL6A 1T43A 5FTMA 1L2BA 4J7PA 2QCUA 2BWBA 3K1JA 5EXXA 2YFQA 1HNXM 5KPTA 3NBXX 2FOIC 5F3WA 5FTNA 1GABA 1IFYA 3P7ZA 1TH4A 2EJSA 3SAUA 3OTOM 1TTEA 3IG8A 3SASA 2XSZD 2LVOC 1MN3A 1PJQA 2DWMA 1VDDA 2CP8A 3U6SA 3E4RA 1UFZA 2N35A 1OKSA 4DUYM 4JV5M 1Q02A 4PDIA 4B3MM 2DAIA 1W5TA 4CHTB 4PCZA 4DV6M 3GLFB 4JXJA 2JP7A 1QZEA 5EXTA 3KFUG 1V33A 4S12A 5E6JA 3JAMS 3FD9A 3AV0A 4REZA 5EP2A 5LMNM 2O25A 2K6BA 2L2DA 3U6DA 3U61A 3HY5A 2KA6B 1QDTA 3HJ8A 1GKIA 5DYGA 3LW5F 5KPZA 1NV9A 5L8RF 2W82A 3LVWA 4LJ8A 3GRUA 2CEAA 2ZTCA 3SAWA 3A42A 1Z59A 3JR4A 1GL7A 1I4WA 2JY8A 3GRYA 1VQ1A 1GLNA 1JR3A 2E5LM 3FUTA 4NRWA 4LJ4A 2R65A 1QYRA 2L09A 4AG5A 1R5LA 1IN5A 4MM3B 4PD2A 2UUCM 2E2XA 1MX0A 2DAEA 4WURA 2VF8A 3KSXA 4KLNA 1FNNA 1VEJA 2MH8A 3J2PB 1NJFA 1TR8A 3K2LA 4MGZE 3U60B 3I51A 3VDPA 3H4MA 4EIWA 3U6CA 4K0KM 4R7GA 2EKKA 1R2ZA 3FRIA 3TWLA 3PEGA 3FE3A 1ZV1A 1JB0F 4DR1M 3SMSA 1DGHA 4NC6A 1GJTA 3IECA 4LRSA 2GQFA 3T15A 3FUXA 2M60A 1YSYA 3MHVC 1R4GA 1IY2A 2EO2A 4I8OA 4AKGA 3K9OA 4PDGA 4IJEA 4G4NA 4B3SM 3W0FA 4D80A 4AI6A 1JR3E 1E9RA 4Q7JA 2NQ8C 5FTJA 4X64M 1IY1A 3HKPA 4OW0A 5ITYA 2OQ4A 2O01F 2CWBA 4DBGB 3HZJA 2R4JA 4M9XA 5EJCA 1S3SA 4LJAA 3KP0E 1MU5A 2Z7JA 3L27A 1K3WA 1XMQM 4RF1A 1H6UA 3Q8XA 3Q8GA 3SAVA 1K3XA 1NNUC 2VQFM 4OX9M
chains in the Genus database with same CATH topology
3P7ZA 1OIPA 4FMMA 4J7QA 3B74A 4M8ZA 3HX3A 4UYBA 3W68A 1OIZA 4CIZA 3B7NA 1R5LA 4OMJA 2E2XA 3PG7A 4TLGA 3W67A 3PEGA 1O6UA 4OMKA 1OLME 3B7QA 4J7PA 2D4QA 1OLMA 3HY5A 3B7ZA 3Q8GA 4CJ6A 1AUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P7Z A;  1OIP A;  4FMM A;  4J7Q A;  3B74 A;  4M8Z A;  3HX3 A;  4UYB A;  3W68 A;  1OIZ A;  4CIZ A;  3B7N A;  1R5L A;  4OMJ A;  2E2X A;  3PG7 A;  4TLG A;  3W67 A;  3PEG A;  1O6U A;  4OMK A;  1OLM E;  3B7Q A;  4J7P A;  2D4Q A;  1OLM A;  3HY5 A;  3B7Z A;  3Q8G A;  4CJ6 A;  1AUA A; 
#chains in the Genus database with same CATH topology
 2H5X A;  3CF2 A;  2DZN B;  3GLG B;  2KXE A;  1N33 M;  1YLA A;  2C98 A;  4AQY M;  2DHY A;  4FMM A;  2XFT A;  3R9X B;  1N36 M;  1XNQ M;  1T3T A;  1E94 E;  1NSF A;  3VKH A;  2JNH A;  4LF9 M;  4IBD A;  2D7G A;  2X4A A;  2XLJ A;  1ZAE A;  2C5R A;  2V1U A;  3BXW A;  1BVS A;  4I4L A;  1HNZ M;  4P16 A;  2CV0 A;  3AOE C;  1EIJ A;  3HHW A;  1IBL M;  2DWN A;  4MGH A;  1DGH B;  1SXJ A;  2LVA A;  1SXJ C;  1ZMV A;  2L4E A;  2Y20 A;  2G8L A;  3KW6 A;  1QAO A;  4XBO A;  3J7A S;  1TH2 A;  2I7P A;  5DYI A;  1SG9 A;  2DKL A;  1N77 A;  2DAK A;  4GKK M;  4LRT A;  1G8P A;  1D0M A;  3C3D A;  1DV0 A;  2ZAM A;  4LJ6 A;  2R45 A;  2CE7 A;  1ZMU A;  1XMO M;  4OU7 A;  4JI7 M;  2Z8Y M;  1QDR A;  2WZJ A;  2RGH A;  2C99 A;  3FTD A;  4NSO B;  1QAN A;  2F5S A;  3F92 A;  1QUT A;  5EP3 A;  2ZTD A;  3TWK A;  2CUZ A;  2QBY B;  1YUB A;  4I81 A;  2MJ5 B;  1OQY A;  3J7B A;  1SXJ E;  1IN8 A;  1WIV A;  3TPZ A;  3I4V A;  4R71 A;  1NJG A;  5ITU A;  5DNY A;  1UM8 A;  3T1H M;  4LF7 M;  2UU9 M;  3NWL A;  2KZU A;  1N32 M;  3THG A;  3PVS A;  2P5T A;  2RRU A;  1J7K A;  3AJI B;  2F4V M;  3WHK A;  2OPF A;  3NBI A;  2DWL A;  1QQW A;  3GQ4 A;  1CUK A;  1HR0 M;  4CJ6 A;  4UYB A;  5EXP A;  2CRU A;  1C7Y A;  1T6O A;  4PT5 A;  2KNZ A;  1PJI A;  2V6Z M;  2LWX A;  2Y0T A;  1RU3 A;  3TQS A;  1NO1 A;  2G3Q A;  2LVQ D;  1L2C A;  1N75 A;  3SYL A;  3FUV A;  3CGW A;  5FTL A;  4FD2 A;  4DV5 M;  1WGL A;  2QZ4 A;  3PFI A;  3D8L A;  4HLQ A;  1VG5 A;  4LJ7 A;  4QHT A;  4L6V 6;  3KXE C;  3A46 A;  3UJN A;  1IN6 A;  1QAQ A;  3PXG A;  1JR3 D;  4L15 A;  3U5Z B;  2KZS A;  1EFU B;  1TDH A;  3IG5 A;  3B7Z A;  3FYD A;  3HU2 A;  1QZM A;  4L4U A;  1FJG M;  2FE8 A;  4FVM A;  4LF4 M;  4DR2 M;  1IXS A;  2APL A;  2JUJ A;  2J7O A;  2H1R A;  2Z4S A;  4QNM A;  5FSW A;  4AZF A;  3GPX A;  2MR9 A;  4GEW A;  4A3V B;  4OVZ B;  2L7I A;  1HT1 E;  5ITR A;  2KRU A;  3D8B A;  2FNA A;  3W68 A;  1IM2 A;  4FWD A;  3U6Q A;  4JI4 M;  5H37 D;  2LNH C;  2AHM A;  4GHL A;  1DGF A;  2OOA A;  1D2N A;  4JI1 M;  4LZZ A;  1G71 A;  2QEN A;  2ERC A;  4JI3 M;  4GC9 A;  3ZH9 B;  1PJS A;  4QHS A;  4DV7 M;  4GIT A;  1NVM A;  2K9D A;  2XSZ A;  3E46 A;  1N78 A;  3BOS A;  3DA1 A;  5IWA M;  4D81 A;  2DZO B;  1C1K A;  2DVW B;  1X37 A;  2OO9 A;  3CF0 A;  4FWH A;  3HHZ A;  3DFZ A;  3WHL A;  2DHR A;  4IJF A;  3BBZ A;  2KNA A;  1HNW M;  4J7Q A;  1E32 A;  3GLH A;  2RGO A;  3KDS E;  4LF8 M;  4X62 M;  2UUB M;  4GC5 A;  1IN4 A;  2JXN A;  3RE8 A;  4FCW A;  3RGP A;  3U6O A;  2DWZ B;  4WW0 A;  3SYK A;  2KNV A;  1KSF X;  4L8R C;  2Z4R A;  4DR5 M;  4ANR A;  2LXE A;  3LVV A;  2BNK A;  3UZU A;  3K92 A;  1I94 M;  3AKZ A;  4AG6 A;  2D7H A;  4GMQ A;  3RGS A;  3U61 B;  1IBK M;  5EP1 A;  2UXC M;  1IXS B;  3U6E A;  1EE8 A;  2XZF A;  5BR8 M;  1ZMW A;  1AIP C;  4IBG A;  2UUA M;  3A45 A;  3L26 A;  4ITQ A;  1WHC A;  1NY5 A;  3GLH E;  3IHP A;  3GPY A;  2LHG A;  1G3I A;  2QHO B;  2R6F A;  4LFB M;  4LF6 M;  4IBC A;  4IBK A;  2CV1 A;  3QYE A;  2YR0 A;  4LCB A;  1WGN A;  3E21 A;  2DNA A;  2R0I A;  3HHY A;  4NXN M;  3M0E A;  2WSC F;  3ZCB B;  1TF0 B;  3B9P A;  4BLC A;  5BPV A;  2DI0 A;  4LF5 M;  3ILK A;  3EIE A;  3AOE A;  4B7F A;  4QOZ C;  4OMK A;  5KPR A;  4DR6 M;  1NHG C;  2HAK A;  2QNJ A;  3HHX A;  1NY6 A;  3HU1 A;  4GIP A;  2ZM6 M;  1PJJ A;  2MGW A;  2FH0 A;  5E26 A;  1OFI A;  3RFW A;  4W5W A;  4XGI A;  1TH3 A;  5KQD A;  4IBF A;  3VLF B;  2CFO A;  3J81 S;  4X65 M;  5IT9 S;  1OLM E;  4G6Z A;  4HL4 A;  1PJT A;  4B3R M;  3SHF A;  4KO8 A;  3HGI A;  3MJ5 A;  3GLH B;  3T38 A;  2VII A;  3FRH A;  3GRR A;  3GQ3 A;  1YE9 A;  2R4E A;  4M8Z A;  1DGG A;  1TGU A;  1XXH A;  3KS4 A;  3SAR A;  4JI2 M;  1OIZ A;  1IXR C;  2KDL A;  4G4Q A;  4JI8 M;  2L6O A;  3GO8 A;  1L1Z A;  3L25 A;  3LCV B;  2KW0 A;  2HWJ A;  4DV0 M;  4GHA A;  1Z6T A;  2QP9 X;  1OAI A;  1MJG M;  3FYC A;  4MGY E;  4B08 A;  1OFH A;  2UXD M;  2V1C A;  2YNM D;  5C18 A;  1L8Q A;  5JI2 E;  2F5O A;  1HT2 E;  2ZAN A;  3DZD A;  4B3T M;  4LFC M;  1XNR M;  1DGB A;  2QPA A;  2CHV A;  4NOO B;  3HJQ A;  2L4F A;  4LZJ A;  3M6A A;  2K47 A;  3I4Y A;  5DFL A;  5GKN A;  2F5P A;  3MMP A;  1OTR A;  2DAM A;  4JI5 M;  3SFZ A;  1L1T A;  4DV4 M;  4JI6 M;  1OAO C;  2VF7 A;  1XB2 B;  3KP1 E;  3LQQ A;  3SBJ A;  1XXH E;  3W0L B;  2G5G X;  2DAG A;  2C9O A;  3GLI A;  3T6P A;  2F5Q A;  4JYA M;  1LV7 A;  2Q2E B;  1OJL A;  2B3T A;  3FUW A;  3PG7 A;  2HHH M;  1V92 A;  3FTC A;  3J80 S;  1IBM M;  2YQZ A;  3U6P A;  1IXZ A;  1Y8G A;  2LVN C;  2CV2 A;  3SAT A;  4KHP M;  3U60 A;  1SXJ B;  2X49 A;  3FTE A;  3L29 A;  1R6B X;  3VK8 A;  4JI0 M;  1O6U A;  4WP2 A;  3UK6 A;  1Z5B A;  3LCU A;  1R2Y A;  1G41 A;  1VEG A;  5C1B A;  2UXB M;  5FLX S;  2XGN A;  2X8A A;  5EP4 A;  5IZ7 D;  4L16 A;  3GP1 A;  3HU3 A;  1AUA A;  5EXS A;  1PM5 A;  5ITQ A;  4CGY B;  4R3D A;  5KQ8 A;  5LMU M;  3ZC7 B;  4RNA A;  3TE6 A;  3C9P A;  1XXH B;  1PGY A;  2LVP C;  4MB7 A;  5ITX A;  3GLI E;  2O5R A;  1G59 A;  3HJS A;  1KYI A;  3HWS A;  4BB9 A;  2HKJ A;  4YY3 M;  1J5E M;  4NSR A;  2Y0Q A;  4L78 A;  3TL4 X;  1E9S A;  3C58 A;  4MGK E;  4Z8X A;  4DUZ M;  2DZL A;  2KHH A;  3W67 A;  1ZQ9 A;  4RF0 A;  4YHH M;  4X66 M;  2EKF A;  3M7G A;  3LMM A;  3A98 B;  1GVN A;  2CHQ A;  4LY6 A;  2R46 A;  2LTU A;  2C96 A;  1DO2 A;  3KOZ E;  4LGY A;  5ITT A;  3B89 A;  3T1Y M;  3PNY A;  3MK6 A;  2D7E A;  2C9C A;  4LJ5 A;  4P17 A;  3UGJ A;  3SC3 A;  1HJP A;  2I7N A;  1OIP A;  2DXI A;  3CF6 E;  3CTW B;  3GLG A;  2VQE M;  3VKG A;  5ITX E;  1XWI A;  4FW9 A;  1NV8 A;  1ORY B;  2WSF F;  4G3O A;  3VDU A;  3GLI B;  2MRO B;  3HX3 A;  1K82 A;  2J5Y A;  2XH9 A;  3I01 M;  3KOX E;  4IIW A;  2GNO A;  3V76 A;  1WR1 B;  4CIZ A;  2QSF X;  1XHB A;  3J27 B;  4AW4 A;  3AL0 C;  4DV1 M;  3FUU A;  1Q3C A;  4B7H A;  1F4I A;  2KEB A;  2ZBK B;  4IBI A;  4G4O A;  1G4A E;  2FS1 A;  4II7 A;  3AFH A;  1Q39 A;  4CIS A;  2JZ1 A;  3B7Q A;  3TWM A;  2D4Q A;  3L2A A;  1VDL A;  2XFS A;  5A2Q S;  4BBA A;  4DV2 M;  2RKO A;  3FKE A;  4F1I A;  1IN7 A;  3KS8 A;  2KRK A;  3GLG E;  3QWL A;  1XC8 A;  2BJV A;  1TDZ A;  2WSE F;  2Z3X A;  1QVR A;  3KVW A;  3U6M A;  1SXJ D;  4B7G A;  4GRI A;  7CAT A;  4QNR A;  4JN6 A;  2OOB A;  4F2L A;  1A5T A;  3B7N A;  3I04 M;  2BJW A;  4M9S A;  1DO0 A;  4M0D A;  1D0L A;  2R62 A;  1KFV A;  2QBY A;  4DR3 M;  4FWG A;  3K9P A;  4UN2 B;  1HQY E;  2EUC A;  3GPU A;  1GO5 A;  4Z6Y A;  4TUW A;  1JQJ C;  1Z5A A;  3QAU A;  1WJ7 A;  2HCB A;  3KOW E;  1GJS A;  3U6L A;  1IY0 A;  3L28 A;  3VFD A;  1OLM A;  2EA0 A;  4DV3 M;  1R7R A;  4TLG A;  2QQ8 A;  2L7H A;  1VEK A;  3UMM A;  3H4J A;  2K0B X;  3KSJ A;  1Z5C A;  4NRV A;  4LG2 A;  3R8F A;  4ZPX A;  1L2D A;  4LFA M;  5JI3 E;  2CHG A;  1V34 A;  4KT0 F;  8CAT A;  1W5S A;  2HL7 A;  5FTK A;  2XF3 A;  1HQC A;  4FCT A;  1QAM A;  2LH0 A;  3GRV A;  5KO3 A;  3GQ5 A;  4OMJ A;  2Y21 A;  3KOY E;  3QYB A;  4LGM A;  3JR5 A;  2A5Y B;  2XZU A;  4GH9 A;  5EQT A;  4AKI A;  2R18 A;  3EIH A;  4LJ9 A;  4M9Z A;  2JZ0 A;  4RKU F;  3GLF A;  4IBJ A;  4XK8 F;  2JY7 A;  2R44 A;  1NNJ A;  2J7N A;  4MH0 E;  4G4R A;  4HEO A;  3U5Z A;  1J09 A;  3ZQJ A;  1N34 M;  2BWE A;  2LHC A;  4NXM M;  3AOG A;  4Y28 F;  1IQP A;  1D0K A;  4NL4 H;  4IBB A;  3PNV A;  4DR4 M;  1QUS A;  4M0W A;  1Q3B A;  2JWS A;  2ZAO A;  5IRE B;  2JY6 B;  3K8Z A;  2M5Z A;  4MGI E;  2FFJ A;  4GKJ M;  4I5S A;  1WXQ A;  3B74 A;  2XEP A;  4OVZ A;  3SHG B;  4AKH A;  2JA2 A;  1NHW C;  3SMP A;  4D82 A;  3VK7 A;  1LTM A;  1PRB A;  4QOS A;  4FCV A;  1P3Q Q;  2LBC A;  3DOA A;  2JY5 A;  3GLF E;  3FTF A;  4KOD A;  2DEN A;  2VDB B;  3LQR A;  4IBE A;  3E9S A;  3C3E A;  2F5N A;  4DR7 M;  3GPP A;  1GL6 A;  1T43 A;  5FTM A;  1L2B A;  4J7P A;  2QCU A;  2BWB A;  3K1J A;  5EXX A;  2YFQ A;  1HNX M;  5KPT A;  3NBX X;  2FOI C;  5F3W A;  5FTN A;  1GAB A;  1IFY A;  3P7Z A;  1TH4 A;  2EJS A;  3SAU A;  3OTO M;  1TTE A;  3IG8 A;  3SAS A;  2XSZ D;  2LVO C;  1MN3 A;  1PJQ A;  2DWM A;  1VDD A;  2CP8 A;  3U6S A;  3E4R A;  1UFZ A;  2N35 A;  1OKS A;  4DUY M;  4JV5 M;  1Q02 A;  4PDI A;  4B3M M;  2DAI A;  1W5T A;  4CHT B;  4PCZ A;  4DV6 M;  3GLF B;  4JXJ A;  2JP7 A;  1QZE A;  5EXT A;  3KFU G;  1V33 A;  4S12 A;  5E6J A;  3JAM S;  3FD9 A;  3AV0 A;  4REZ A;  5EP2 A;  5LMN M;  2O25 A;  2K6B A;  2L2D A;  3U6D A;  3U61 A;  3HY5 A;  2KA6 B;  1QDT A;  3HJ8 A;  1GKI A;  5DYG A;  3LW5 F;  5KPZ A;  1NV9 A;  5L8R F;  2W82 A;  3LVW A;  4LJ8 A;  3GRU A;  2CEA A;  2ZTC A;  3SAW A;  3A42 A;  1Z59 A;  3JR4 A;  1GL7 A;  1I4W A;  2JY8 A;  3GRY A;  1VQ1 A;  1GLN A;  1JR3 A;  2E5L M;  3FUT A;  4NRW A;  4LJ4 A;  2R65 A;  1QYR A;  2L09 A;  4AG5 A;  1R5L A;  1IN5 A;  4MM3 B;  4PD2 A;  2UUC M;  2E2X A;  1MX0 A;  2DAE A;  4WUR A;  2VF8 A;  3KSX A;  4KLN A;  1FNN A;  1VEJ A;  2MH8 A;  3J2P B;  1NJF A;  1TR8 A;  3K2L A;  4MGZ E;  3U60 B;  3I51 A;  3VDP A;  3H4M A;  4EIW A;  3U6C A;  4K0K M;  4R7G A;  2EKK A;  1R2Z A;  3FRI A;  3TWL A;  3PEG A;  3FE3 A;  1ZV1 A;  1JB0 F;  4DR1 M;  3SMS A;  1DGH A;  4NC6 A;  1GJT A;  3IEC A;  4LRS A;  2GQF A;  3T15 A;  3FUX A;  2M60 A;  1YSY A;  3MHV C;  1R4G A;  1IY2 A;  2EO2 A;  4I8O A;  4AKG A;  3K9O A;  4PDG A;  4IJE A;  4G4N A;  4B3S M;  3W0F A;  4D80 A;  4AI6 A;  1JR3 E;  1E9R A;  4Q7J A;  2NQ8 C;  5FTJ A;  4X64 M;  1IY1 A;  3HKP A;  4OW0 A;  5ITY A;  2OQ4 A;  2O01 F;  2CWB A;  4DBG B;  3HZJ A;  2R4J A;  4M9X A;  5EJC A;  1S3S A;  4LJA A;  3KP0 E;  1MU5 A;  2Z7J A;  3L27 A;  1K3W A;  1XMQ M;  4RF1 A;  1H6U A;  3Q8X A;  3Q8G A;  3SAV A;  1K3X A;  1NNU C;  2VQF M;  4OX9 M; 
#chains in the Genus database with same CATH homology
 3P7Z A;  1OIP A;  4FMM A;  4J7Q A;  3B74 A;  4M8Z A;  3HX3 A;  4UYB A;  3W68 A;  1OIZ A;  4CIZ A;  3B7N A;  1R5L A;  4OMJ A;  2E2X A;  3PG7 A;  4TLG A;  3W67 A;  3PEG A;  1O6U A;  4OMK A;  1OLM E;  3B7Q A;  4J7P A;  2D4Q A;  1OLM A;  3HY5 A;  3B7Z A;  3Q8G A;  4CJ6 A;  1AUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...