4CJBA

Orthorhombic crystal form of bogt6a e192q in complex with galnac
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
236
structure length
236
Chain Sequence
MRIGILYICTGKYDIFWKDFYLSAERYFMQDQSFIIEYYVFTDSPKLYDEENNKHIHRIKQKNLGWPDNTLKRFHIFLRIKEQLERETDYLFFFNANLLFTSPIGKEILPPSDSNGLLGTMHPGFYNKPNSEFTYERRDASTAYIPEGEGRYYYAGGLSGGCTKAYLKLCTTICSWVDRDATNHIIPIWHDQSLINKYFLDNPPAITLSPAYLYPEGWLLPFEPIILIRDKNKPQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSYLTRANSFERASE FAMILY 6
publication title Structures of Complexes of a Metal-Independent Glycosyltransferase Gt6 from Bacteroides Ovatus with Udp-Galnac and its Hydrolysis Products.
pubmed doi rcsb
source organism Bacteroides ovatus
molecule tags Transferase
total genus 69
structure length 236
sequence length 236
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.40: Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03414 Glyco_transf_6 Glycosyltransferase family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4cjbA00
3IOHA 3ST8A 4KC1A 1G8OA 2WE9A 5EJZA 5JQQA 1ZCUA 2AESA 2XWLA 1H7TA 2Y4MA 3OH3A 1PZYB 1R82A 3OH4A 1O7OA 3D5NA 2OI7A 3NGWA 3F1YA 2Y6PA 1YP4A 3T7OA 2E8BA 3USQA 4UEGA 3SX3A 4LW6A 2ZU7A 1OMXA 3F1CA 4Y7VA 4KPXA 1R7YA 3I0IX 4CVHA 1VGZA 2VS3A 2Z86A 2GGQA 1R7VA 2VS4A 1FR8A 5AJNA 1ZJOA 5FV9A 5C4FA 4Y7GA 4CJ8A 1OMZA 3V0MA 1H3MA 5C4DA 1FGGA 3DUVA 3I0DA 4CJCA 4KC2A 3U2XA 3FWWA 2RJ1A 5CQNX 5C4EA 4FRMA 3V0PA 2XWMA 1YP3A 4KRVA 1FWYA 4Y7UA 5FU0A 2FYDB 4AAWA 5FU8A 1VH3A 5EIYA 2JCOA 2VXMA 3U2WA 3CKQA 3ZGFA 1FOAA 4EEMA 1XHBA 1OQMB 3OC9A 2E3DA 4HG6A 3E26A 3SXCA 4DECA 2VSIA 2APCA 5IFYA 1H7EA 3I0KA 1S4OA 4Y62A 3POLA 4EE4A 2RJ4A 2WGZA 1ZDGA 4KNRA 4Y64A 2JCJA 4B5BA 2YQHA 3SX8A 4D0TA 2YQCA 2YC3A 3I0FA 1H7QA 2AM3A 1JVDA 1ZCYA 2AE7A 2VD4A 2RJ9A 5IDTA 1ZCTA 5AJPA 1FO9A 1HV9A 1IIMA 1WT1A 4FRQA 5C36A 4R7PA 4E1KA 3I0CA 4FCUA 1QGSA 2Y7AA 1QG8A 1ZJ1A 3T7MA 3CKOA 5FTSA 5AJOA 5FYEA 1YROB 1VGUA 1ZJ3A 1MP3A 1E5KA 3SXBA 1W77A 4EE5A 1HM8A 1VZUA 4P00A 1VZTA 1SS9A 4D11A 2V0LA 2BO8A 2XMHA 4M28A 2YQJA 1WT2A 2VSHA 4FQWA 1H7LA 2I7BA 2RJ5A 1LL0A 1G23A 4HO0A 4Y9XA 4HO8A 2RJ8A 1TVYA 2AM4A 1GQCA 3OH0A 1QWJA 4Y6NA 2AM5A 4ARWA 1G97A 1H7HA 3OAMA 1MP5A 4G3QA 1GA8A 5C1LA 5C3BA 1ZIZA 1G95A 2Z87A 3OH2A 2OI6A 4M4KA 4M2AA 4NALA 2QKXA 1ZI1A 1INIA 1ZI4A 1VGTA 2V0JA 4KNXA 1VICA 1O23B 1S4NA 5EJ1A 5C4CA 2AECA 3TZTA 3Q7UA 2OEGA 3T7NA 2NXVA 1EYRA 1GQ9A 4Y63A 3TQDA 2Q4JA 2X5SA 5C8RA 2YESA 4ECMA 2WVLA 2RIXA 2PGYA 3SX5A 5C48A 3K8DA 3SXAA 2VS5A 1QGQA 3Q80A 1FXJA 2RJ6A 4HO9A 4D11C 1R7TA 4EVWA 4B2XA 3DJ4A 5IDSA 2D7IA 1H7FA 4KXOA 2OEFA 4IRPA 3SXEA 4HO2A 1Z90A 5C38A 3PNNA 4KQLA 4B4GA 1G3LA 3GUEA 1LZJA 5CMJA 1NWGB 4FCEA 5C1HA 3SXGA 4B4MA 5DDVA 3QVBA 1TW1A 3SX7A 4BMAA 2GGOA 1O0RA 3ZF8A 5C49A 3CGXA 2V0HA 1ZDFA 4P02A 4G87A 3D8VA 2VFZA 4Y7TA 1FZWA 1H4EA 4FRHA 1LVWA 2AH9A 1I52A 3IOJA 2W0WA 2D7RA 1FXOA 4YS8A 3U2TA 4JISA 3RMWA 1H4DA 2YCMA 5C47A 3U0YA 1H5RA 5L6SA 3D98A 2OI5A 3HL3A 5FUHA 4K6RA 1ZI3A 2XWNA 1G9RA 1INJA 4ASJA 4JD0A 3ZLKA 1VPAA 2FY7A 2BO6A 2FYAA 4AYJA 3V8ZA 3LW6A 1H5SA 1WVCA 5C1GA 2X65A 4MYBA 1ZCVA 1V82A 2A8UA 1JV1A 1H7GA 2D0JA 2VXLA 3CKVA 4HO6A 3U2UA 3CKNA 2RJ7A 4EE3A 3I0EA 3U2VA 3V90A 1HM0A 1V83A 5CQLX 4G3SA 3EE5A 2CU2A 1LL3A 3R2WA 5CMGX 1V84A 1ZJPA 1NKHB 3DK5A 3N9WA 2BO7A 2DPWA 2Y4KA 4EEAA 1JYKA 2PA4A 4L41C 1LZ0A 3USRA 1H5TA 4FRPA 2RIYA 2BO4A 3I0JA 1GX0A 1VM8A 4FREA 1VZXA 5I1FA 2P6WA 2ZU8A 3OGZA 1JYLA 4DE7A 1JVGA 5CQPA 1GWVA 3OKRA 1LZ7A 1G93A 2Y4LA 3U0XA 4CJBA 4HO4A 5CMHA 1TW5A 2WAWA 1FGXA 3V0LA 1R81A 4Y6UA 1H5RB 5C4BA 2O1FA 1NF5B 5L6VA 2FFUA 1GX4A 2PGVA 1MC3A 2WEEA 1H5SB 3PKQA 1H5SC 2X60A 2MZBA 1FR9A 1WSZA 3I0GA 3JTJA 5C3DA 3RMVA 5CMIA 3I0LA 1G1LA 3R3IA 4AC3A 3BRKX 1S4PA 1ZJ0A 4FRAA 2RITA 2FFVA 4GBPA 1FRWA 4B42A 1WT3A 2AGDA 1O7QA 3JUJA 3V8YA 1YP2A 1R80A 1VGWA 2Y4JA 2XMEA 3K8EA 4FRBA 4KPZA 2JCKA 2YC5A 1ON8A 4LW3A 4KT7A 1KWSA 4MNDA 1G2VA 1NHEB 1FG5N 1H5TB 2PX7A 4FRDA 1LL2A 3V0NA 5FTVA 3RSBA 3E25A 2I5EA 3CKJA 4HCQA 3BCVA 3ZLLA 4B2WA 3I0HA 4NANA 1WT0A 1FO8A 1HJLA 5C3AA 1H4CA 3JUKA 1W55A 4HO5A 1ON6A 2WVMA 2A8WA 4IRQA 1NQIB 4FROA 1ZHJA 4XWIA 2X5ZA 3FOQA 1HM9A 2QGIA 2V0KA 5DDTA 5CQMX 1NMMB 1ZI5A 1VH1A 5CQOA 2FYCB 2ICYA 1ZJ2A 5J49A 3CU0A 3V91A 2I5KA 2P73A 1R7XA 2RJ0A 2O1GA 2WVKA 1MP4A 4Y7FA 4AYLA 3PKPA 5HS2A 3Q4SA 3ZGGA 1H5SD 3V0QA 2RIZA 1W57A 1TZFA 3V0OA 1PZTA 4NAIA 5BXCA 4J18A 1XZ6A 4HOCA 4HO3A 4D48A 4NAKA 2FYBA 4C2SA 4FRLA 2YQSA 4D0ZA 2ZU9A 2JCLA 1G0RA 1HJJA 4ASYA 1R7UA 4EEGA 4BQHA 4EEOA 1K4VA 3IOIA 1GWWA 2ICXA 3KIAA 1LZIA 2V0IA 1JV3A 3O3PA 2P72A 3SPTA 2UX8A 4KC4A 2O1HA 3OH1A 1IINA 4B3UA 4DDZA 1EZIA 5CMFX 4B4BA 4ZDQA 2QH5A 4M2BA 4G3PA 2W0VA 3SXDA
chains in the Genus database with same CATH superfamily
3IOHA 3ST8A 4KC1A 1G8OA 2WE9A 5EJZA 5JQQA 1ZCUA 2AESA 2XWLA 1H7TA 2Y4MA 3OH3A 1PZYB 1R82A 3OH4A 1O7OA 3D5NA 2OI7A 3NGWA 3F1YA 2Y6PA 1YP4A 3T7OA 2E8BA 3USQA 4UEGA 3SX3A 4LW6A 2ZU7A 1OMXA 3F1CA 4Y7VA 4KPXA 1R7YA 3I0IX 4CVHA 1VGZA 2VS3A 2Z86A 2GGQA 1R7VA 2VS4A 1FR8A 5AJNA 1ZJOA 5FV9A 5C4FA 4Y7GA 4CJ8A 1OMZA 3V0MA 1H3MA 5C4DA 1FGGA 3DUVA 3I0DA 4CJCA 4KC2A 3U2XA 3FWWA 2RJ1A 5CQNX 5C4EA 4FRMA 3V0PA 2XWMA 1YP3A 4KRVA 1FWYA 4Y7UA 5FU0A 2FYDB 4AAWA 5FU8A 1VH3A 5EIYA 2JCOA 2VXMA 3U2WA 3CKQA 3ZGFA 1FOAA 4EEMA 1XHBA 1OQMB 3OC9A 2E3DA 4HG6A 3E26A 3SXCA 4DECA 2VSIA 2APCA 5IFYA 5D92A 1H7EA 3I0KA 1S4OA 4Y62A 3POLA 4EE4A 2RJ4A 2WGZA 1ZDGA 4KNRA 2VK9A 4Y64A 2JCJA 4B5BA 2YQHA 3SX8A 4D0TA 2YQCA 2YC3A 3I0FA 1H7QA 2AM3A 1JVDA 1ZCYA 2AE7A 2VD4A 2RJ9A 5IDTA 1ZCTA 5AJPA 1FO9A 1HV9A 1IIMA 1WT1A 4FRQA 5C36A 4R7PA 4E1KA 4O6MA 3I0CA 4FCUA 4FIYA 1QGSA 2Y7AA 1QG8A 1ZJ1A 3T7MA 3CKOA 5FTSA 5AJOA 5FYEA 1YROB 1VGUA 1ZJ3A 1MP3A 1E5KA 3SXBA 1W77A 4EE5A 1HM8A 1VZUA 4P00A 1VZTA 1SS9A 4D11A 2V0LA 2BO8A 2XMHA 4M28A 2YQJA 1WT2A 2VSHA 4FQWA 1H7LA 2I7BA 2RJ5A 1LL0A 1G23A 4HO0A 4Y9XA 4HO8A 2RJ8A 1TVYA 2AM4A 1GQCA 3OH0A 1QWJA 4Y6NA 2AM5A 4ARWA 1G97A 1H7HA 3OAMA 1MP5A 4G3QA 1GA8A 5C1LA 5C3BA 1ZIZA 1G95A 2Z87A 3OH2A 2OI6A 4M4KA 4M2AA 4NALA 2QKXA 1ZI1A 1INIA 1ZI4A 1VGTA 2V0JA 4KNXA 1VICA 1O23B 1S4NA 5EJ1A 5C4CA 2AECA 3TZTA 3Q7UA 2OEGA 3T7NA 2NXVA 1EYRA 1GQ9A 4Y63A 3TQDA 2Q4JA 2X5SA 5C8RA 2YESA 4ECMA 2WVLA 2RIXA 2PGYA 3SX5A 5C48A 3K8DA 3SXAA 2VS5A 1QGQA 3Q80A 1FXJA 2RJ6A 4O6NA 4HO9A 4Q7CA 4D11C 5D91A 1R7TA 4EVWA 4B2XA 3DJ4A 5IDSA 2D7IA 1H7FA 4KXOA 2OEFA 4IRPA 3SXEA 4HO2A 1Z90A 5C38A 3PNNA 4KQLA 4B4GA 1G3LA 3GUEA 1LZJA 5CMJA 1NWGB 4FCEA 5C1HA 3SXGA 4B4MA 5DDVA 3QVBA 1TW1A 3SX7A 4BMAA 2GGOA 1O0RA 3ZF8A 5C49A 3CGXA 2V0HA 1ZDFA 4P02A 4G87A 3D8VA 2VFZA 4Y7TA 1FZWA 1H4EA 4FRHA 1LVWA 2AH9A 1I52A 3IOJA 2W0WA 2D7RA 1FXOA 4YS8A 3U2TA 4JISA 3RMWA 1H4DA 2YCMA 5C47A 3U0YA 1H5RA 5L6SA 3D98A 2OI5A 3HL3A 5FUHA 4FIXA 4K6RA 1ZI3A 2XWNA 1G9RA 1INJA 4ASJA 4JD0A 3ZLKA 1VPAA 2FY7A 2BO6A 2FYAA 4AYJA 3V8ZA 3LW6A 1H5SA 1WVCA 5C1GA 2X65A 4MYBA 1ZCVA 1V82A 2A8UA 1JV1A 1H7GA 2D0JA 2VXLA 3CKVA 4HO6A 3U2UA 3CKNA 2RJ7A 4EE3A 3I0EA 3U2VA 3V90A 1HM0A 1V83A 5CQLX 4G3SA 3EE5A 2CU2A 1LL3A 3R2WA 5CMGX 1V84A 1ZJPA 1NKHB 3DK5A 3N9WA 2BO7A 2DPWA 2Y4KA 4EEAA 1JYKA 2PA4A 4L41C 1LZ0A 3USRA 1H5TA 4FRPA 2RIYA 2BO4A 3I0JA 1GX0A 1VM8A 4FREA 1VZXA 5I1FA 2P6WA 2ZU8A 3OGZA 1JYLA 4DE7A 1JVGA 5CQPA 1GWVA 3OKRA 1LZ7A 1G93A 2Y4LA 3U0XA 4CJBA 4HO4A 5CMHA 1TW5A 2WAWA 1FGXA 3V0LA 1R81A 4Y6UA 1H5RB 5C4BA 2O1FA 1NF5B 5L6VA 2FFUA 1GX4A 2PGVA 1MC3A 2WEEA 1H5SB 3PKQA 1H5SC 2X60A 2J0BA 2MZBA 1FR9A 1WSZA 3I0GA 3JTJA 5C3DA 3RMVA 5CMIA 3I0LA 1G1LA 3R3IA 4AC3A 3BRKX 1S4PA 1ZJ0A 4FRAA 2RITA 2FFVA 4GBPA 1FRWA 4B42A 1WT3A 2AGDA 1O7QA 3JUJA 3V8YA 1YP2A 1R80A 1VGWA 2Y4JA 2XMEA 3K8EA 4FRBA 4KPZA 2JCKA 2YC5A 2J0AA 1ON8A 4LW3A 4KT7A 1KWSA 4MNDA 1G2VA 1NHEB 1FG5N 1H5TB 2PX7A 4FRDA 1LL2A 3V0NA 5FTVA 3RSBA 3E25A 2I5EA 3CKJA 4HCQA 3BCVA 3ZLLA 4B2WA 3I0HA 4NANA 1WT0A 1FO8A 1HJLA 5C3AA 1H4CA 3JUKA 1W55A 4HO5A 1ON6A 2WVMA 2A8WA 4IRQA 1NQIB 4FROA 1ZHJA 4XWIA 2X5ZA 3FOQA 1HM9A 2QGIA 2V0KA 5DDTA 5CQMX 1NMMB 1ZI5A 1VH1A 2C0NA 5CQOA 2FYCB 2ICYA 1ZJ2A 5J49A 3CU0A 3V91A 2I5KA 2P73A 1R7XA 2RJ0A 2O1GA 2WVKA 1MP4A 4Y7FA 4AYLA 3PKPA 5HS2A 3Q4SA 3ZGGA 1H5SD 3V0QA 2RIZA 1W57A 1TZFA 3V0OA 1PZTA 4NAIA 5BXCA 4J18A 1XZ6A 4HOCA 4HO3A 4MIXA 4D48A 4NAKA 2FYBA 4C2SA 4FRLA 2YQSA 4D0ZA 2ZU9A 2JCLA 1G0RA 1HJJA 4ASYA 1R7UA 4EEGA 4BQHA 4EEOA 1K4VA 3IOIA 1GWWA 2ICXA 3KIAA 1LZIA 2V0IA 1JV3A 3O3PA 2P72A 3SPTA 2UX8A 4KC4A 2O1HA 3OH1A 1IINA 4B3UA 4DDZA 1EZIA 5CMFX 4B4BA 4ZDQA 2QH5A 4M2BA 4G3PA 2W0VA 3SXDA
chains in the Genus database with same CATH topology
3IOHA 3ST8A 4KC1A 1G8OA 2WE9A 5EJZA 5JQQA 1ZCUA 2AESA 2XWLA 1H7TA 2Y4MA 3OH3A 1PZYB 1R82A 3OH4A 1O7OA 3D5NA 2OI7A 3NGWA 3F1YA 2Y6PA 1YP4A 3T7OA 2E8BA 3USQA 4UEGA 3SX3A 4LW6A 2ZU7A 1OMXA 3F1CA 4Y7VA 4KPXA 1R7YA 3I0IX 4CVHA 1VGZA 2VS3A 2Z86A 2GGQA 1R7VA 2VS4A 1FR8A 5AJNA 1ZJOA 5FV9A 5C4FA 4Y7GA 4CJ8A 1OMZA 3V0MA 1H3MA 5C4DA 1FGGA 3DUVA 3I0DA 4CJCA 4KC2A 3U2XA 3FWWA 2RJ1A 5CQNX 5C4EA 4FRMA 3V0PA 2XWMA 1YP3A 4KRVA 1FWYA 4Y7UA 5FU0A 2FYDB 4AAWA 5FU8A 1VH3A 5EIYA 2JCOA 2VXMA 3U2WA 3CKQA 3ZGFA 1FOAA 4EEMA 1XHBA 1OQMB 3OC9A 2E3DA 4HG6A 3E26A 3SXCA 4DECA 2VSIA 2APCA 5IFYA 5D92A 1H7EA 3I0KA 1S4OA 4Y62A 3POLA 4EE4A 2RJ4A 2WGZA 1ZDGA 4KNRA 2VK9A 4Y64A 2JCJA 4B5BA 2YQHA 3SX8A 4D0TA 2YQCA 2YC3A 3I0FA 1H7QA 2AM3A 1JVDA 1ZCYA 2AE7A 2VD4A 2RJ9A 5IDTA 1ZCTA 5AJPA 1FO9A 1HV9A 1IIMA 1WT1A 4FRQA 5C36A 4R7PA 4E1KA 4O6MA 3I0CA 4FCUA 4FIYA 1QGSA 2Y7AA 1QG8A 1ZJ1A 3T7MA 3CKOA 5FTSA 5AJOA 5FYEA 1YROB 1VGUA 1ZJ3A 1MP3A 1E5KA 3SXBA 1W77A 4EE5A 1HM8A 1VZUA 4P00A 1VZTA 1SS9A 4D11A 2V0LA 2BO8A 2XMHA 4M28A 2YQJA 1WT2A 2VSHA 4FQWA 1H7LA 2I7BA 2RJ5A 1LL0A 1G23A 4HO0A 4Y9XA 4HO8A 2RJ8A 1TVYA 2AM4A 1GQCA 3OH0A 1QWJA 4Y6NA 2AM5A 4ARWA 1G97A 1H7HA 3OAMA 1MP5A 4G3QA 1GA8A 5C1LA 5C3BA 1ZIZA 1G95A 2Z87A 3OH2A 2OI6A 4M4KA 4M2AA 4NALA 2QKXA 1ZI1A 1INIA 1ZI4A 1VGTA 2V0JA 4KNXA 1VICA 1O23B 1S4NA 5EJ1A 5C4CA 2AECA 3TZTA 3Q7UA 2OEGA 3T7NA 2NXVA 1EYRA 1GQ9A 4Y63A 3TQDA 2Q4JA 2X5SA 5C8RA 2YESA 4ECMA 2WVLA 2RIXA 2PGYA 3SX5A 5C48A 3K8DA 3SXAA 2VS5A 1QGQA 3Q80A 1FXJA 2RJ6A 4O6NA 4HO9A 4Q7CA 4D11C 5D91A 1R7TA 4EVWA 4B2XA 3DJ4A 5IDSA 2D7IA 1H7FA 4KXOA 2OEFA 4IRPA 3SXEA 4HO2A 1Z90A 5C38A 3PNNA 4KQLA 4B4GA 1G3LA 3GUEA 1LZJA 5CMJA 1NWGB 4FCEA 5C1HA 3SXGA 4B4MA 5DDVA 3QVBA 1TW1A 3SX7A 4BMAA 2GGOA 1O0RA 3ZF8A 5C49A 3CGXA 2V0HA 1ZDFA 4P02A 4G87A 3D8VA 2VFZA 4Y7TA 1FZWA 1H4EA 4FRHA 1LVWA 2AH9A 1I52A 3IOJA 2W0WA 2D7RA 1FXOA 4YS8A 3U2TA 4JISA 3RMWA 1H4DA 2YCMA 5C47A 3U0YA 1H5RA 5L6SA 3D98A 2OI5A 3HL3A 5FUHA 4FIXA 4K6RA 1ZI3A 2XWNA 1G9RA 1INJA 4ASJA 4JD0A 3ZLKA 1VPAA 2FY7A 2BO6A 2FYAA 4AYJA 3V8ZA 3LW6A 1H5SA 1WVCA 5C1GA 2X65A 4MYBA 1ZCVA 1V82A 2A8UA 1JV1A 1H7GA 2D0JA 2VXLA 3CKVA 4HO6A 3U2UA 3CKNA 2RJ7A 4EE3A 3I0EA 3U2VA 3V90A 1HM0A 1V83A 5CQLX 4G3SA 3EE5A 2CU2A 1LL3A 3R2WA 5CMGX 1V84A 1ZJPA 1NKHB 3DK5A 3N9WA 2BO7A 2DPWA 2Y4KA 4EEAA 1JYKA 2PA4A 4L41C 1LZ0A 3USRA 1H5TA 4FRPA 2RIYA 2BO4A 3I0JA 1GX0A 1VM8A 4FREA 1VZXA 5I1FA 2P6WA 2ZU8A 3OGZA 1JYLA 4DE7A 1JVGA 5CQPA 1GWVA 3OKRA 1LZ7A 1G93A 2Y4LA 3U0XA 4CJBA 4HO4A 5CMHA 1TW5A 2WAWA 1FGXA 3V0LA 1R81A 4Y6UA 1H5RB 5C4BA 2O1FA 1NF5B 5L6VA 2FFUA 1GX4A 2PGVA 1MC3A 2WEEA 1H5SB 3PKQA 1H5SC 2X60A 2J0BA 2MZBA 1FR9A 1WSZA 3I0GA 3JTJA 5C3DA 3RMVA 5CMIA 3I0LA 1G1LA 3R3IA 4AC3A 3BRKX 1S4PA 1ZJ0A 4FRAA 2RITA 2FFVA 4GBPA 1FRWA 4B42A 1WT3A 2AGDA 1O7QA 3JUJA 3V8YA 1YP2A 1R80A 1VGWA 2Y4JA 2XMEA 3K8EA 4FRBA 4KPZA 2JCKA 2YC5A 2J0AA 1ON8A 4LW3A 4KT7A 1KWSA 4MNDA 1G2VA 1NHEB 1FG5N 1H5TB 2PX7A 4FRDA 1LL2A 3V0NA 5FTVA 3RSBA 3E25A 2I5EA 3CKJA 4HCQA 3BCVA 3ZLLA 4B2WA 3I0HA 4NANA 1WT0A 1FO8A 1HJLA 5C3AA 1H4CA 3JUKA 1W55A 4HO5A 1ON6A 2WVMA 2A8WA 4IRQA 1NQIB 4FROA 1ZHJA 4XWIA 2X5ZA 3FOQA 1HM9A 2QGIA 2V0KA 5DDTA 5CQMX 1NMMB 1ZI5A 1VH1A 2C0NA 5CQOA 2FYCB 2ICYA 1ZJ2A 5J49A 3CU0A 3V91A 2I5KA 2P73A 1R7XA 2RJ0A 2O1GA 2WVKA 1MP4A 4Y7FA 4AYLA 3PKPA 5HS2A 3Q4SA 3ZGGA 1H5SD 3V0QA 2RIZA 1W57A 1TZFA 3V0OA 1PZTA 4NAIA 5BXCA 4J18A 1XZ6A 4HOCA 4HO3A 4MIXA 4D48A 4NAKA 2FYBA 4C2SA 4FRLA 2YQSA 4D0ZA 2ZU9A 2JCLA 1G0RA 1HJJA 4ASYA 1R7UA 4EEGA 4BQHA 4EEOA 1K4VA 3IOIA 1GWWA 2ICXA 3KIAA 1LZIA 2V0IA 1JV3A 3O3PA 2P72A 3SPTA 2UX8A 4KC4A 2O1HA 3OH1A 1IINA 4B3UA 4DDZA 1EZIA 5CMFX 4B4BA 4ZDQA 2QH5A 4M2BA 4G3PA 2W0VA 3SXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IOH A;  3ST8 A;  4KC1 A;  1G8O A;  2WE9 A;  5EJZ A;  5JQQ A;  1ZCU A;  2AES A;  2XWL A;  1H7T A;  2Y4M A;  3OH3 A;  1PZY B;  1R82 A;  3OH4 A;  1O7O A;  3D5N A;  2OI7 A;  3NGW A;  3F1Y A;  2Y6P A;  1YP4 A;  3T7O A;  2E8B A;  3USQ A;  4UEG A;  3SX3 A;  4LW6 A;  2ZU7 A;  1OMX A;  3F1C A;  4Y7V A;  4KPX A;  1R7Y A;  3I0I X;  4CVH A;  1VGZ A;  2VS3 A;  2Z86 A;  2GGQ A;  1R7V A;  2VS4 A;  1FR8 A;  5AJN A;  1ZJO A;  5FV9 A;  5C4F A;  4Y7G A;  4CJ8 A;  1OMZ A;  3V0M A;  1H3M A;  5C4D A;  1FGG A;  3DUV A;  3I0D A;  4CJC A;  4KC2 A;  3U2X A;  3FWW A;  2RJ1 A;  5CQN X;  5C4E A;  4FRM A;  3V0P A;  2XWM A;  1YP3 A;  4KRV A;  1FWY A;  4Y7U A;  5FU0 A;  2FYD B;  4AAW A;  5FU8 A;  1VH3 A;  5EIY A;  2JCO A;  2VXM A;  3U2W A;  3CKQ A;  3ZGF A;  1FOA A;  4EEM A;  1XHB A;  1OQM B;  3OC9 A;  2E3D A;  4HG6 A;  3E26 A;  3SXC A;  4DEC A;  2VSI A;  2APC A;  5IFY A;  1H7E A;  3I0K A;  1S4O A;  4Y62 A;  3POL A;  4EE4 A;  2RJ4 A;  2WGZ A;  1ZDG A;  4KNR A;  4Y64 A;  2JCJ A;  4B5B A;  2YQH A;  3SX8 A;  4D0T A;  2YQC A;  2YC3 A;  3I0F A;  1H7Q A;  2AM3 A;  1JVD A;  1ZCY A;  2AE7 A;  2VD4 A;  2RJ9 A;  5IDT A;  1ZCT A;  5AJP A;  1FO9 A;  1HV9 A;  1IIM A;  1WT1 A;  4FRQ A;  5C36 A;  4R7P A;  4E1K A;  3I0C A;  4FCU A;  1QGS A;  2Y7A A;  1QG8 A;  1ZJ1 A;  3T7M A;  3CKO A;  5FTS A;  5AJO A;  5FYE A;  1YRO B;  1VGU A;  1ZJ3 A;  1MP3 A;  1E5K A;  3SXB A;  1W77 A;  4EE5 A;  1HM8 A;  1VZU A;  4P00 A;  1VZT A;  1SS9 A;  4D11 A;  2V0L A;  2BO8 A;  2XMH A;  4M28 A;  2YQJ A;  1WT2 A;  2VSH A;  4FQW A;  1H7L A;  2I7B A;  2RJ5 A;  1LL0 A;  1G23 A;  4HO0 A;  4Y9X A;  4HO8 A;  2RJ8 A;  1TVY A;  2AM4 A;  1GQC A;  3OH0 A;  1QWJ A;  4Y6N A;  2AM5 A;  4ARW A;  1G97 A;  1H7H A;  3OAM A;  1MP5 A;  4G3Q A;  1GA8 A;  5C1L A;  5C3B A;  1ZIZ A;  1G95 A;  2Z87 A;  3OH2 A;  2OI6 A;  4M4K A;  4M2A A;  4NAL A;  2QKX A;  1ZI1 A;  1INI A;  1ZI4 A;  1VGT A;  2V0J A;  4KNX A;  1VIC A;  1O23 B;  1S4N A;  5EJ1 A;  5C4C A;  2AEC A;  3TZT A;  3Q7U A;  2OEG A;  3T7N A;  2NXV A;  1EYR A;  1GQ9 A;  4Y63 A;  3TQD A;  2Q4J A;  2X5S A;  5C8R A;  2YES A;  4ECM A;  2WVL A;  2RIX A;  2PGY A;  3SX5 A;  5C48 A;  3K8D A;  3SXA A;  2VS5 A;  1QGQ A;  3Q80 A;  1FXJ A;  2RJ6 A;  4HO9 A;  4D11 C;  1R7T A;  4EVW A;  4B2X A;  3DJ4 A;  5IDS A;  2D7I A;  1H7F A;  4KXO A;  2OEF A;  4IRP A;  3SXE A;  4HO2 A;  1Z90 A;  5C38 A;  3PNN A;  4KQL A;  4B4G A;  1G3L A;  3GUE A;  1LZJ A;  5CMJ A;  1NWG B;  4FCE A;  5C1H A;  3SXG A;  4B4M A;  5DDV A;  3QVB A;  1TW1 A;  3SX7 A;  4BMA A;  2GGO A;  1O0R A;  3ZF8 A;  5C49 A;  3CGX A;  2V0H A;  1ZDF A;  4P02 A;  4G87 A;  3D8V A;  2VFZ A;  4Y7T A;  1FZW A;  1H4E A;  4FRH A;  1LVW A;  2AH9 A;  1I52 A;  3IOJ A;  2W0W A;  2D7R A;  1FXO A;  4YS8 A;  3U2T A;  4JIS A;  3RMW A;  1H4D A;  2YCM A;  5C47 A;  3U0Y A;  1H5R A;  5L6S A;  3D98 A;  2OI5 A;  3HL3 A;  5FUH A;  4K6R A;  1ZI3 A;  2XWN A;  1G9R A;  1INJ A;  4ASJ A;  4JD0 A;  3ZLK A;  1VPA A;  2FY7 A;  2BO6 A;  2FYA A;  4AYJ A;  3V8Z A;  3LW6 A;  1H5S A;  1WVC A;  5C1G A;  2X65 A;  4MYB A;  1ZCV A;  1V82 A;  2A8U A;  1JV1 A;  1H7G A;  2D0J A;  2VXL A;  3CKV A;  4HO6 A;  3U2U A;  3CKN A;  2RJ7 A;  4EE3 A;  3I0E A;  3U2V A;  3V90 A;  1HM0 A;  1V83 A;  5CQL X;  4G3S A;  3EE5 A;  2CU2 A;  1LL3 A;  3R2W A;  5CMG X;  1V84 A;  1ZJP A;  1NKH B;  3DK5 A;  3N9W A;  2BO7 A;  2DPW A;  2Y4K A;  4EEA A;  1JYK A;  2PA4 A;  4L41 C;  1LZ0 A;  3USR A;  1H5T A;  4FRP A;  2RIY A;  2BO4 A;  3I0J A;  1GX0 A;  1VM8 A;  4FRE A;  1VZX A;  5I1F A;  2P6W A;  2ZU8 A;  3OGZ A;  1JYL A;  4DE7 A;  1JVG A;  5CQP A;  1GWV A;  3OKR A;  1LZ7 A;  1G93 A;  2Y4L A;  3U0X A;  4CJB A;  4HO4 A;  5CMH A;  1TW5 A;  2WAW A;  1FGX A;  3V0L A;  1R81 A;  4Y6U A;  1H5R B;  5C4B A;  2O1F A;  1NF5 B;  5L6V A;  2FFU A;  1GX4 A;  2PGV A;  1MC3 A;  2WEE A;  1H5S B;  3PKQ A;  1H5S C;  2X60 A;  2MZB A;  1FR9 A;  1WSZ A;  3I0G A;  3JTJ A;  5C3D A;  3RMV A;  5CMI A;  3I0L A;  1G1L A;  3R3I A;  4AC3 A;  3BRK X;  1S4P A;  1ZJ0 A;  4FRA A;  2RIT A;  2FFV A;  4GBP A;  1FRW A;  4B42 A;  1WT3 A;  2AGD A;  1O7Q A;  3JUJ A;  3V8Y A;  1YP2 A;  1R80 A;  1VGW A;  2Y4J A;  2XME A;  3K8E A;  4FRB A;  4KPZ A;  2JCK A;  2YC5 A;  1ON8 A;  4LW3 A;  4KT7 A;  1KWS A;  4MND A;  1G2V A;  1NHE B;  1FG5 N;  1H5T B;  2PX7 A;  4FRD A;  1LL2 A;  3V0N A;  5FTV A;  3RSB A;  3E25 A;  2I5E A;  3CKJ A;  4HCQ A;  3BCV A;  3ZLL A;  4B2W A;  3I0H A;  4NAN A;  1WT0 A;  1FO8 A;  1HJL A;  5C3A A;  1H4C A;  3JUK A;  1W55 A;  4HO5 A;  1ON6 A;  2WVM A;  2A8W A;  4IRQ A;  1NQI B;  4FRO A;  1ZHJ A;  4XWI A;  2X5Z A;  3FOQ A;  1HM9 A;  2QGI A;  2V0K A;  5DDT A;  5CQM X;  1NMM B;  1ZI5 A;  1VH1 A;  5CQO A;  2FYC B;  2ICY A;  1ZJ2 A;  5J49 A;  3CU0 A;  3V91 A;  2I5K A;  2P73 A;  1R7X A;  2RJ0 A;  2O1G A;  2WVK A;  1MP4 A;  4Y7F A;  4AYL A;  3PKP A;  5HS2 A;  3Q4S A;  3ZGG A;  1H5S D;  3V0Q A;  2RIZ A;  1W57 A;  1TZF A;  3V0O A;  1PZT A;  4NAI A;  5BXC A;  4J18 A;  1XZ6 A;  4HOC A;  4HO3 A;  4D48 A;  4NAK A;  2FYB A;  4C2S A;  4FRL A;  2YQS A;  4D0Z A;  2ZU9 A;  2JCL A;  1G0R A;  1HJJ A;  4ASY A;  1R7U A;  4EEG A;  4BQH A;  4EEO A;  1K4V A;  3IOI A;  1GWW A;  2ICX A;  3KIA A;  1LZI A;  2V0I A;  1JV3 A;  3O3P A;  2P72 A;  3SPT A;  2UX8 A;  4KC4 A;  2O1H A;  3OH1 A;  1IIN A;  4B3U A;  4DDZ A;  1EZI A;  5CMF X;  4B4B A;  4ZDQ A;  2QH5 A;  4M2B A;  4G3P A;  2W0V A;  3SXD A; 
#chains in the Genus database with same CATH topology
 3IOH A;  3ST8 A;  4KC1 A;  1G8O A;  2WE9 A;  5EJZ A;  5JQQ A;  1ZCU A;  2AES A;  2XWL A;  1H7T A;  2Y4M A;  3OH3 A;  1PZY B;  1R82 A;  3OH4 A;  1O7O A;  3D5N A;  2OI7 A;  3NGW A;  3F1Y A;  2Y6P A;  1YP4 A;  3T7O A;  2E8B A;  3USQ A;  4UEG A;  3SX3 A;  4LW6 A;  2ZU7 A;  1OMX A;  3F1C A;  4Y7V A;  4KPX A;  1R7Y A;  3I0I X;  4CVH A;  1VGZ A;  2VS3 A;  2Z86 A;  2GGQ A;  1R7V A;  2VS4 A;  1FR8 A;  5AJN A;  1ZJO A;  5FV9 A;  5C4F A;  4Y7G A;  4CJ8 A;  1OMZ A;  3V0M A;  1H3M A;  5C4D A;  1FGG A;  3DUV A;  3I0D A;  4CJC A;  4KC2 A;  3U2X A;  3FWW A;  2RJ1 A;  5CQN X;  5C4E A;  4FRM A;  3V0P A;  2XWM A;  1YP3 A;  4KRV A;  1FWY A;  4Y7U A;  5FU0 A;  2FYD B;  4AAW A;  5FU8 A;  1VH3 A;  5EIY A;  2JCO A;  2VXM A;  3U2W A;  3CKQ A;  3ZGF A;  1FOA A;  4EEM A;  1XHB A;  1OQM B;  3OC9 A;  2E3D A;  4HG6 A;  3E26 A;  3SXC A;  4DEC A;  2VSI A;  2APC A;  5IFY A;  5D92 A;  1H7E A;  3I0K A;  1S4O A;  4Y62 A;  3POL A;  4EE4 A;  2RJ4 A;  2WGZ A;  1ZDG A;  4KNR A;  2VK9 A;  4Y64 A;  2JCJ A;  4B5B A;  2YQH A;  3SX8 A;  4D0T A;  2YQC A;  2YC3 A;  3I0F A;  1H7Q A;  2AM3 A;  1JVD A;  1ZCY A;  2AE7 A;  2VD4 A;  2RJ9 A;  5IDT A;  1ZCT A;  5AJP A;  1FO9 A;  1HV9 A;  1IIM A;  1WT1 A;  4FRQ A;  5C36 A;  4R7P A;  4E1K A;  4O6M A;  3I0C A;  4FCU A;  4FIY A;  1QGS A;  2Y7A A;  1QG8 A;  1ZJ1 A;  3T7M A;  3CKO A;  5FTS A;  5AJO A;  5FYE A;  1YRO B;  1VGU A;  1ZJ3 A;  1MP3 A;  1E5K A;  3SXB A;  1W77 A;  4EE5 A;  1HM8 A;  1VZU A;  4P00 A;  1VZT A;  1SS9 A;  4D11 A;  2V0L A;  2BO8 A;  2XMH A;  4M28 A;  2YQJ A;  1WT2 A;  2VSH A;  4FQW A;  1H7L A;  2I7B A;  2RJ5 A;  1LL0 A;  1G23 A;  4HO0 A;  4Y9X A;  4HO8 A;  2RJ8 A;  1TVY A;  2AM4 A;  1GQC A;  3OH0 A;  1QWJ A;  4Y6N A;  2AM5 A;  4ARW A;  1G97 A;  1H7H A;  3OAM A;  1MP5 A;  4G3Q A;  1GA8 A;  5C1L A;  5C3B A;  1ZIZ A;  1G95 A;  2Z87 A;  3OH2 A;  2OI6 A;  4M4K A;  4M2A A;  4NAL A;  2QKX A;  1ZI1 A;  1INI A;  1ZI4 A;  1VGT A;  2V0J A;  4KNX A;  1VIC A;  1O23 B;  1S4N A;  5EJ1 A;  5C4C A;  2AEC A;  3TZT A;  3Q7U A;  2OEG A;  3T7N A;  2NXV A;  1EYR A;  1GQ9 A;  4Y63 A;  3TQD A;  2Q4J A;  2X5S A;  5C8R A;  2YES A;  4ECM A;  2WVL A;  2RIX A;  2PGY A;  3SX5 A;  5C48 A;  3K8D A;  3SXA A;  2VS5 A;  1QGQ A;  3Q80 A;  1FXJ A;  2RJ6 A;  4O6N A;  4HO9 A;  4Q7C A;  4D11 C;  5D91 A;  1R7T A;  4EVW A;  4B2X A;  3DJ4 A;  5IDS A;  2D7I A;  1H7F A;  4KXO A;  2OEF A;  4IRP A;  3SXE A;  4HO2 A;  1Z90 A;  5C38 A;  3PNN A;  4KQL A;  4B4G A;  1G3L A;  3GUE A;  1LZJ A;  5CMJ A;  1NWG B;  4FCE A;  5C1H A;  3SXG A;  4B4M A;  5DDV A;  3QVB A;  1TW1 A;  3SX7 A;  4BMA A;  2GGO A;  1O0R A;  3ZF8 A;  5C49 A;  3CGX A;  2V0H A;  1ZDF A;  4P02 A;  4G87 A;  3D8V A;  2VFZ A;  4Y7T A;  1FZW A;  1H4E A;  4FRH A;  1LVW A;  2AH9 A;  1I52 A;  3IOJ A;  2W0W A;  2D7R A;  1FXO A;  4YS8 A;  3U2T A;  4JIS A;  3RMW A;  1H4D A;  2YCM A;  5C47 A;  3U0Y A;  1H5R A;  5L6S A;  3D98 A;  2OI5 A;  3HL3 A;  5FUH A;  4FIX A;  4K6R A;  1ZI3 A;  2XWN A;  1G9R A;  1INJ A;  4ASJ A;  4JD0 A;  3ZLK A;  1VPA A;  2FY7 A;  2BO6 A;  2FYA A;  4AYJ A;  3V8Z A;  3LW6 A;  1H5S A;  1WVC A;  5C1G A;  2X65 A;  4MYB A;  1ZCV A;  1V82 A;  2A8U A;  1JV1 A;  1H7G A;  2D0J A;  2VXL A;  3CKV A;  4HO6 A;  3U2U A;  3CKN A;  2RJ7 A;  4EE3 A;  3I0E A;  3U2V A;  3V90 A;  1HM0 A;  1V83 A;  5CQL X;  4G3S A;  3EE5 A;  2CU2 A;  1LL3 A;  3R2W A;  5CMG X;  1V84 A;  1ZJP A;  1NKH B;  3DK5 A;  3N9W A;  2BO7 A;  2DPW A;  2Y4K A;  4EEA A;  1JYK A;  2PA4 A;  4L41 C;  1LZ0 A;  3USR A;  1H5T A;  4FRP A;  2RIY A;  2BO4 A;  3I0J A;  1GX0 A;  1VM8 A;  4FRE A;  1VZX A;  5I1F A;  2P6W A;  2ZU8 A;  3OGZ A;  1JYL A;  4DE7 A;  1JVG A;  5CQP A;  1GWV A;  3OKR A;  1LZ7 A;  1G93 A;  2Y4L A;  3U0X A;  4CJB A;  4HO4 A;  5CMH A;  1TW5 A;  2WAW A;  1FGX A;  3V0L A;  1R81 A;  4Y6U A;  1H5R B;  5C4B A;  2O1F A;  1NF5 B;  5L6V A;  2FFU A;  1GX4 A;  2PGV A;  1MC3 A;  2WEE A;  1H5S B;  3PKQ A;  1H5S C;  2X60 A;  2J0B A;  2MZB A;  1FR9 A;  1WSZ A;  3I0G A;  3JTJ A;  5C3D A;  3RMV A;  5CMI A;  3I0L A;  1G1L A;  3R3I A;  4AC3 A;  3BRK X;  1S4P A;  1ZJ0 A;  4FRA A;  2RIT A;  2FFV A;  4GBP A;  1FRW A;  4B42 A;  1WT3 A;  2AGD A;  1O7Q A;  3JUJ A;  3V8Y A;  1YP2 A;  1R80 A;  1VGW A;  2Y4J A;  2XME A;  3K8E A;  4FRB A;  4KPZ A;  2JCK A;  2YC5 A;  2J0A A;  1ON8 A;  4LW3 A;  4KT7 A;  1KWS A;  4MND A;  1G2V A;  1NHE B;  1FG5 N;  1H5T B;  2PX7 A;  4FRD A;  1LL2 A;  3V0N A;  5FTV A;  3RSB A;  3E25 A;  2I5E A;  3CKJ A;  4HCQ A;  3BCV A;  3ZLL A;  4B2W A;  3I0H A;  4NAN A;  1WT0 A;  1FO8 A;  1HJL A;  5C3A A;  1H4C A;  3JUK A;  1W55 A;  4HO5 A;  1ON6 A;  2WVM A;  2A8W A;  4IRQ A;  1NQI B;  4FRO A;  1ZHJ A;  4XWI A;  2X5Z A;  3FOQ A;  1HM9 A;  2QGI A;  2V0K A;  5DDT A;  5CQM X;  1NMM B;  1ZI5 A;  1VH1 A;  2C0N A;  5CQO A;  2FYC B;  2ICY A;  1ZJ2 A;  5J49 A;  3CU0 A;  3V91 A;  2I5K A;  2P73 A;  1R7X A;  2RJ0 A;  2O1G A;  2WVK A;  1MP4 A;  4Y7F A;  4AYL A;  3PKP A;  5HS2 A;  3Q4S A;  3ZGG A;  1H5S D;  3V0Q A;  2RIZ A;  1W57 A;  1TZF A;  3V0O A;  1PZT A;  4NAI A;  5BXC A;  4J18 A;  1XZ6 A;  4HOC A;  4HO3 A;  4MIX A;  4D48 A;  4NAK A;  2FYB A;  4C2S A;  4FRL A;  2YQS A;  4D0Z A;  2ZU9 A;  2JCL A;  1G0R A;  1HJJ A;  4ASY A;  1R7U A;  4EEG A;  4BQH A;  4EEO A;  1K4V A;  3IOI A;  1GWW A;  2ICX A;  3KIA A;  1LZI A;  2V0I A;  1JV3 A;  3O3P A;  2P72 A;  3SPT A;  2UX8 A;  4KC4 A;  2O1H A;  3OH1 A;  1IIN A;  4B3U A;  4DDZ A;  1EZI A;  5CMF X;  4B4B A;  4ZDQ A;  2QH5 A;  4M2B A;  4G3P A;  2W0V A;  3SXD A; 
#chains in the Genus database with same CATH homology
 3IOH A;  3ST8 A;  4KC1 A;  1G8O A;  2WE9 A;  5EJZ A;  5JQQ A;  1ZCU A;  2AES A;  2XWL A;  1H7T A;  2Y4M A;  3OH3 A;  1PZY B;  1R82 A;  3OH4 A;  1O7O A;  3D5N A;  2OI7 A;  3NGW A;  3F1Y A;  2Y6P A;  1YP4 A;  3T7O A;  2E8B A;  3USQ A;  4UEG A;  3SX3 A;  4LW6 A;  2ZU7 A;  1OMX A;  3F1C A;  4Y7V A;  4KPX A;  1R7Y A;  3I0I X;  4CVH A;  1VGZ A;  2VS3 A;  2Z86 A;  2GGQ A;  1R7V A;  2VS4 A;  1FR8 A;  5AJN A;  1ZJO A;  5FV9 A;  5C4F A;  4Y7G A;  4CJ8 A;  1OMZ A;  3V0M A;  1H3M A;  5C4D A;  1FGG A;  3DUV A;  3I0D A;  4CJC A;  4KC2 A;  3U2X A;  3FWW A;  2RJ1 A;  5CQN X;  5C4E A;  4FRM A;  3V0P A;  2XWM A;  1YP3 A;  4KRV A;  1FWY A;  4Y7U A;  5FU0 A;  2FYD B;  4AAW A;  5FU8 A;  1VH3 A;  5EIY A;  2JCO A;  2VXM A;  3U2W A;  3CKQ A;  3ZGF A;  1FOA A;  4EEM A;  1XHB A;  1OQM B;  3OC9 A;  2E3D A;  4HG6 A;  3E26 A;  3SXC A;  4DEC A;  2VSI A;  2APC A;  5IFY A;  5D92 A;  1H7E A;  3I0K A;  1S4O A;  4Y62 A;  3POL A;  4EE4 A;  2RJ4 A;  2WGZ A;  1ZDG A;  4KNR A;  2VK9 A;  4Y64 A;  2JCJ A;  4B5B A;  2YQH A;  3SX8 A;  4D0T A;  2YQC A;  2YC3 A;  3I0F A;  1H7Q A;  2AM3 A;  1JVD A;  1ZCY A;  2AE7 A;  2VD4 A;  2RJ9 A;  5IDT A;  1ZCT A;  5AJP A;  1FO9 A;  1HV9 A;  1IIM A;  1WT1 A;  4FRQ A;  5C36 A;  4R7P A;  4E1K A;  4O6M A;  3I0C A;  4FCU A;  4FIY A;  1QGS A;  2Y7A A;  1QG8 A;  1ZJ1 A;  3T7M A;  3CKO A;  5FTS A;  5AJO A;  5FYE A;  1YRO B;  1VGU A;  1ZJ3 A;  1MP3 A;  1E5K A;  3SXB A;  1W77 A;  4EE5 A;  1HM8 A;  1VZU A;  4P00 A;  1VZT A;  1SS9 A;  4D11 A;  2V0L A;  2BO8 A;  2XMH A;  4M28 A;  2YQJ A;  1WT2 A;  2VSH A;  4FQW A;  1H7L A;  2I7B A;  2RJ5 A;  1LL0 A;  1G23 A;  4HO0 A;  4Y9X A;  4HO8 A;  2RJ8 A;  1TVY A;  2AM4 A;  1GQC A;  3OH0 A;  1QWJ A;  4Y6N A;  2AM5 A;  4ARW A;  1G97 A;  1H7H A;  3OAM A;  1MP5 A;  4G3Q A;  1GA8 A;  5C1L A;  5C3B A;  1ZIZ A;  1G95 A;  2Z87 A;  3OH2 A;  2OI6 A;  4M4K A;  4M2A A;  4NAL A;  2QKX A;  1ZI1 A;  1INI A;  1ZI4 A;  1VGT A;  2V0J A;  4KNX A;  1VIC A;  1O23 B;  1S4N A;  5EJ1 A;  5C4C A;  2AEC A;  3TZT A;  3Q7U A;  2OEG A;  3T7N A;  2NXV A;  1EYR A;  1GQ9 A;  4Y63 A;  3TQD A;  2Q4J A;  2X5S A;  5C8R A;  2YES A;  4ECM A;  2WVL A;  2RIX A;  2PGY A;  3SX5 A;  5C48 A;  3K8D A;  3SXA A;  2VS5 A;  1QGQ A;  3Q80 A;  1FXJ A;  2RJ6 A;  4O6N A;  4HO9 A;  4Q7C A;  4D11 C;  5D91 A;  1R7T A;  4EVW A;  4B2X A;  3DJ4 A;  5IDS A;  2D7I A;  1H7F A;  4KXO A;  2OEF A;  4IRP A;  3SXE A;  4HO2 A;  1Z90 A;  5C38 A;  3PNN A;  4KQL A;  4B4G A;  1G3L A;  3GUE A;  1LZJ A;  5CMJ A;  1NWG B;  4FCE A;  5C1H A;  3SXG A;  4B4M A;  5DDV A;  3QVB A;  1TW1 A;  3SX7 A;  4BMA A;  2GGO A;  1O0R A;  3ZF8 A;  5C49 A;  3CGX A;  2V0H A;  1ZDF A;  4P02 A;  4G87 A;  3D8V A;  2VFZ A;  4Y7T A;  1FZW A;  1H4E A;  4FRH A;  1LVW A;  2AH9 A;  1I52 A;  3IOJ A;  2W0W A;  2D7R A;  1FXO A;  4YS8 A;  3U2T A;  4JIS A;  3RMW A;  1H4D A;  2YCM A;  5C47 A;  3U0Y A;  1H5R A;  5L6S A;  3D98 A;  2OI5 A;  3HL3 A;  5FUH A;  4FIX A;  4K6R A;  1ZI3 A;  2XWN A;  1G9R A;  1INJ A;  4ASJ A;  4JD0 A;  3ZLK A;  1VPA A;  2FY7 A;  2BO6 A;  2FYA A;  4AYJ A;  3V8Z A;  3LW6 A;  1H5S A;  1WVC A;  5C1G A;  2X65 A;  4MYB A;  1ZCV A;  1V82 A;  2A8U A;  1JV1 A;  1H7G A;  2D0J A;  2VXL A;  3CKV A;  4HO6 A;  3U2U A;  3CKN A;  2RJ7 A;  4EE3 A;  3I0E A;  3U2V A;  3V90 A;  1HM0 A;  1V83 A;  5CQL X;  4G3S A;  3EE5 A;  2CU2 A;  1LL3 A;  3R2W A;  5CMG X;  1V84 A;  1ZJP A;  1NKH B;  3DK5 A;  3N9W A;  2BO7 A;  2DPW A;  2Y4K A;  4EEA A;  1JYK A;  2PA4 A;  4L41 C;  1LZ0 A;  3USR A;  1H5T A;  4FRP A;  2RIY A;  2BO4 A;  3I0J A;  1GX0 A;  1VM8 A;  4FRE A;  1VZX A;  5I1F A;  2P6W A;  2ZU8 A;  3OGZ A;  1JYL A;  4DE7 A;  1JVG A;  5CQP A;  1GWV A;  3OKR A;  1LZ7 A;  1G93 A;  2Y4L A;  3U0X A;  4CJB A;  4HO4 A;  5CMH A;  1TW5 A;  2WAW A;  1FGX A;  3V0L A;  1R81 A;  4Y6U A;  1H5R B;  5C4B A;  2O1F A;  1NF5 B;  5L6V A;  2FFU A;  1GX4 A;  2PGV A;  1MC3 A;  2WEE A;  1H5S B;  3PKQ A;  1H5S C;  2X60 A;  2J0B A;  2MZB A;  1FR9 A;  1WSZ A;  3I0G A;  3JTJ A;  5C3D A;  3RMV A;  5CMI A;  3I0L A;  1G1L A;  3R3I A;  4AC3 A;  3BRK X;  1S4P A;  1ZJ0 A;  4FRA A;  2RIT A;  2FFV A;  4GBP A;  1FRW A;  4B42 A;  1WT3 A;  2AGD A;  1O7Q A;  3JUJ A;  3V8Y A;  1YP2 A;  1R80 A;  1VGW A;  2Y4J A;  2XME A;  3K8E A;  4FRB A;  4KPZ A;  2JCK A;  2YC5 A;  2J0A A;  1ON8 A;  4LW3 A;  4KT7 A;  1KWS A;  4MND A;  1G2V A;  1NHE B;  1FG5 N;  1H5T B;  2PX7 A;  4FRD A;  1LL2 A;  3V0N A;  5FTV A;  3RSB A;  3E25 A;  2I5E A;  3CKJ A;  4HCQ A;  3BCV A;  3ZLL A;  4B2W A;  3I0H A;  4NAN A;  1WT0 A;  1FO8 A;  1HJL A;  5C3A A;  1H4C A;  3JUK A;  1W55 A;  4HO5 A;  1ON6 A;  2WVM A;  2A8W A;  4IRQ A;  1NQI B;  4FRO A;  1ZHJ A;  4XWI A;  2X5Z A;  3FOQ A;  1HM9 A;  2QGI A;  2V0K A;  5DDT A;  5CQM X;  1NMM B;  1ZI5 A;  1VH1 A;  2C0N A;  5CQO A;  2FYC B;  2ICY A;  1ZJ2 A;  5J49 A;  3CU0 A;  3V91 A;  2I5K A;  2P73 A;  1R7X A;  2RJ0 A;  2O1G A;  2WVK A;  1MP4 A;  4Y7F A;  4AYL A;  3PKP A;  5HS2 A;  3Q4S A;  3ZGG A;  1H5S D;  3V0Q A;  2RIZ A;  1W57 A;  1TZF A;  3V0O A;  1PZT A;  4NAI A;  5BXC A;  4J18 A;  1XZ6 A;  4HOC A;  4HO3 A;  4MIX A;  4D48 A;  4NAK A;  2FYB A;  4C2S A;  4FRL A;  2YQS A;  4D0Z A;  2ZU9 A;  2JCL A;  1G0R A;  1HJJ A;  4ASY A;  1R7U A;  4EEG A;  4BQH A;  4EEO A;  1K4V A;  3IOI A;  1GWW A;  2ICX A;  3KIA A;  1LZI A;  2V0I A;  1JV3 A;  3O3P A;  2P72 A;  3SPT A;  2UX8 A;  4KC4 A;  2O1H A;  3OH1 A;  1IIN A;  4B3U A;  4DDZ A;  1EZI A;  5CMF X;  4B4B A;  4ZDQ A;  2QH5 A;  4M2B A;  4G3P A;  2W0V A;  3SXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...