4CJEA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 53
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjeA00
4J2AA 4CEEA 1LAVA 1ZBHA 3VQPA 3AVMA 1VRTA 4CJSA 1TV6A 1JLAA 4B9MA 2OPPA 4BACA 4FLXA 1BHLA 2G8FA 5KI6A 4CFCA 4Z4EA 2AJQA 4DFMA 4AHSA 3HO1A 3TWHA 3SI6A 3D0PA 3QEVA 3LAMA 4DQRA 1CZ9A 1C0UA 2QK9A 3HJFA 1BISA 4LY7A 1KCFA 3DYAA 3EYZA 4RW9A 4DTOA 4DMNA 3SJJA 2FC0A 4CGDA 1U47A 3VQQA 5KRTA 3HP6A 1C1AA 3PX0A 1A5WA 5CYMA 3C95A 4CIEA 1LWEA 4O0JA 1VSMA 3HPOA 3PX4A 4ZTJA 3NGZA 3KTQA 4DSJA 1NJXA 4RW7A 1L3VA 4BDYA 2OA8A 2HNDA 3ALYA 4CHYA 3AVLA 4C8LA 1S6PA 2YHAA 3AVAA 3HPHA 3NH2A 1TAUA 2HMIA 1JXEA 1GOAA 3V1QA 3A2FA 3QO9A 4CGFA 3V1RA 1LWFA 1TKXA 3AO4A 1IKXA 3HVRA 4OLAA 4PY5A 4CESA 1WSHA 3AVJA 5K14A 3H08A 1WSIA 4DU1A 1YT3A 4DTJA 3NGIA 4AILC 4N47A 3ZT0A 3PUFA 3SNNA 1FKOA 1LAWA 1TGOA 4EP5A 1TL1A 4AHTA 1HNIA 4ZHRA 2XY5A 1QE1A 1JL1A 1QHTA 1RDDA 2GBZA 4ICLA 3AO3A 4IG0A 1RDCA 4CERA 1C0MA 1NK6A 4B9NA 4CEQA 3O4NA 2HNYA 1C1CA 1VSEA 3DM2A 4BDPA 4F8RA 1U4BA 3TABA 4FVMA 4FJGA 2F8SA 4IBNA 1NK0A 4ELTA 2Z1JA 3O3FA 4Y1DA 3OYMA 3NE6A 4LD0A 2ZE2A 1HMVA 1JKHA 4CEDA 4CF8A 3OYLA 1NK5A 4RW4A 1MU2A 4CFDA 3MEDA 1TL3A 2YNGA 3NF8A 2KFNA 1KVBA 5J2NA 1BCMA 1ITGA 3P83D 1WSEA 1KFDA 4DWIA 4CGHA 3DLEA 5J1EA 3AA5X 1JLQA 1ASUA 5HRRA 5E41A 4CF9A 4E1MA 2XO7A 3KD1E 3AVIA 3RRHA 4FLWA 3OYFA 3V9ZA 4FJLA 2G8UA 2KZMA 2B5JA 4UQGA 3PV8A 3NHGA 2KQ2A 3ZSWA 1L5UA 4FJ7A 3F73A 3OYCA 3JSMA 3L2QA 3QEPA 4JRPA 4KTQA 3QIPA 1RT3A 1RTIA 4OVLA 5CYQA 3OYNA 1UA0A 3DLKA 4KTZA 2YHBA 5C42A 3EY1A 1IKWA 4H4OA 3TAFA 3TI0A 4FJ5A 4W5QA 4J2BA 3CFRA 4Z4FA 4DFPA 1S9EA 1S1UA 1RNHA 2R7YA 3UIQA 3DOKA 3QNOA 4HCBA 2Y1IA 1B92A 1ZBFA 3VQ5A 3SPYA 4NYFA 1YTUA 2X6NA 3RMDA 5CZ2A 1JL2A 3T3FA 5DMRA 1T7PA 3AO1A 3P5JA 5HLFA 3VQ7A 1TK0A 4FM1A 4EP4A 2VWJA 1RBUA 5J2PA 3CG7A 1B9DA 4G1QA 1S1VA 1BQMA 2X6SA 4O5BA 3MECA 3CM6A 1U45A 4BDZA 2PY5A 3L2UA 2B4JA 3KIOA 3AVKA 1RT4A 3HXMA 1NK9A 3IAYA 3DRPA 4LH4A 4L8RB 1WSGA 3PX6A 4KAZA 3C6TA 1SL1A 4GMJB 4FK2A 1J53A 1REVA 1UWBA 3AVNA 3AO5A 3CM5A 3LPUA 4IG3A 4FLTA 4B9UA 4E7KA 2OZSA 1W0HA 5HRSA 4ELVA 3K5MA 4NCAA 1HYSA 1NJYA 3SPZA 2VG6A 3I0SA 4N56A 3RMCA 1NK8A 4RW6A 4DQIA 3LWMA 3OYJA 4B9TA 1C6VA 3V9SA 1RT6A 1XI1A 2PYJA 1S1WA 4M3XA 4CJEA 3OJUA 5J2MA 2RN2A 3LP0A 5I42A 1ASWA 2FBTA 1J54A 3TR8A 4KB1A 1S6QA 2BGGA 2KZZA 4DG1A 2VWKA 2FBYA 1ASVA 3K57A 4CF0A 1Q8IA 5SWMA 3HYFA 2HNZA 3VA3A 2IC3A 3QESA 3S3MA 3AVHA 1TK8A 3RR7A 2D0BA 1BQNA 2OPRA 4DTXA 4CJPA 4KV8A 4CJFA 3QEWA 1RTDA 1UAXA 1T03A 3O3GA 2IGIA 1VSLA 3ASMA 4QCLA 4KHWA 3G0ZA 3WNHA 4YFUA 1VSKA 3M8PA 1L3TA 3LZIA 5FRNA 3NH1A 1JLBA 3LANA 4CE9A 4DTRA 1HNVA 4J2DA 3DLBA 3AA4A 1IG9A 3O3HA 4CJKA 1D8YA 5JS1A 3KLEA 1TKZA 4CJQA 3KK3A 4E3SA 3NDKA 4Q0BA 2OPQA 3AA2A 4LH5A 3L3VA 3DOLA 2G8KA 1X9WA 3PO5A 4DQPA 3DI6A 3VQ8A 4E1NA 2A1SA 3D45A 3IRXA 4CK3A 4CCHA 2HHWA 2YKMA 1JLEA 4KHSA 4O4GA 4BE0A 3ZT4A 4CHOA 3S3OA 4BE1A 1S9GA 3ZSOA 3B6PA 2YNIA 4FZXC 3L2RA 3M8RA 3KKRA 1JLGA 4I9LA 1RBTA 4DLEA 1ZYQA 3O4QA 3HVTA 3RR8A 2HHXA 1T8EA 3MXMA 1TKDA 3LALA 3S9HA 1C0TA 1I39A 4MQ3A 1U48A 4HVJA 3TAMA 2XY7A 3FFIA 3LP1A 3VQAA 4E7LA 4NCBA 3AVFA 4I2QA 1QSLA 3VQ6A 3KKSA 4CJ3A 1TK5A 2D0CA 4M3UA 2Z1HA 3JYTA 2F8TA 4IFYA 3WNFA 3LDSA 1JLCA 3V9XA 3DLHA 1SKRA 3F9KA 1WLJA 4C8NA 4JRQA 4DS4A 4Z0UA 4CJUA 3SQ2A 4CJ4A 2HHTA 1DTQA 2E6LA 4FW1A 2KW4A 4Q5VA 4H8KA 3NFAA 4B8AB 3HM9A 2ITGA 3U3YA 3AVBA 1A5VA 1HQUA 1XHXA 1S5JA 4PQUA 3T19A 4IFVA 1X9MA 4OLBA 2DFHA 3K5LA 3OVNA 1F21A 2ATQA 3QNNA 4FLUA 2HVHA 2RKIA 3NBPA 4DTMA 1N6QA 1RBRA 4ID5A 5CZ1A 1LW0A 4B9LA 4W5OA 3RWUA 3ITHA 3VQEA 1WAJA 1VSDA 1NOZA 1NKBA 3QIOA 3OY9A 3KLHA 3SQ0A 1A5XA 4CEOA 3SYZA 3RTVA 3K5OA 1JXBA 3NF7A 3OYGA 1O1WA 3MAQA 3NF9A 4CFAA 4KREA 3HPGA 4CHZA 1SKWA 1SL2A 2G8VA 3VN5A 3S3NA 2D0AA 1DLOA 3ISNC 4N41A 4W5RA 3BGRA 3AVCA 1SV5A 2ETJA 3MEGA 3K5NA 4KFBA 4J2EA 4FJXA 4KHYA 3C6UA 4KPYA 4FJKA 3QINA 5JS2A 4M45A 3L8BA 1BI4A 2OPSA 4PWDA 4LSNA 1NKCA 4E7HA 4K8ZA 4KI4A 4B9VA 3PY8A 1HYVA 2ZD1A 4CJRA 4BE2A 3KLGA 3RMBA 2RPIA 3ZCMA 4R5PA 1XHZA 4FCYA 1NKEA 2XY6A 1X9SA 3AV9A 3I8DA 2BDPA 3HK2A 1NK4A 5C24A 1JLFA 2X74A 5SZTA 4FK0A 3OS1A 3SV4A 3TARA 2I5JA 3LP2A 1CLQA 2IAJA 4KHNA 4DFJA 1UA1A 4KKOA 1EETA 1BIZA 5KTQA 1ZBUA 4DU3A 3TAEA 1RDBA 3E01A 4IDKA 5HP1A 3OS0A 4F2RA 4C8MA 3ZSXA 4CHNA 3V6DA 4H4MA 1KRPA 4F4KA 4BWMA 4CHPA 2KFZA 4FZZA 1YVUA 4XIUA 2E6MA 3AVGA 5KRSA 3VQCA 1TKTA 4DQSA 1VSFA 2O4GA 1NK7A 4DF8A 2GV9A 3TAQA 1Q9YA 4CFBA 2HHQA 2X78A 4FJIA 4O55A 3ULDA 2VG7A 3MXJA 4DSIA 2BE2A 1D9FA 3QERA 1RDAA 4CK2A 4TSXA 5EU7A 3CFPA 3PO4A 4FK4A 2YNFA 4M3YA 1BGXT 1S1XA 1CZBA 2JGUA 4PA1A 5HBMA 4AHRA 3V9WA 4KRFA 3T1AA 2HHVA 4FJMA 4QOZB 1IKVA 1RBVA 3ZT2A 3OJSA 5J2QA 2G8IA 3OYEA 4KB0A 4F3OA 3K59A 3V9UA 3VQDA 1RTHA 2IS3A 4OJRA 3ZSVA 4CIGA 3L2WA 1NJZA 4CJ5A 4OPKA 4I7FA 1IO2A 4CJWA 4DTPA 1U49A 4FJNA 3DLGA 1KVAA 2EX3A 4KHQA 3OYDA 4I9QA 1Z25A 4RW8A 1S1TA 3NH0A 3V4IA 1FK9A 3QEIA 4M3ZA 3NAEA 1RT5A 3B6OA 1WSFA 2O4IA 4M41A 1FKPA 3OYKA 4DSFA 3VQ9A 4FLVA 3I0RA 1BI4B 1HJRA 3SZ2A 4M3TA 4DLGA 2QKKA 4Z4GA 1R0AA 1WN7A 2PYLA 4N76A 1RBSA 4HUFA 4CF1A 2P5GA 1BL3A 3L2VA 3KD5E 2HVIA 4IKFA 1EX4A 4GVMA 4CJTA 2Z1GA 2KTQA 4CEFA 2DTUA 1U04A 4ID1A 3KLFA 5D3GA 4AHCA 1J9AA 1EP4A 3RMAA 1SKSA 2P51A 3SUNA 2DFEA 2NUBA 1HRHA 1Y97A 4DTNA 1RT7A 4CEAA 3NGYA 4JLHA 1EKEA 2E4LA 1Z26A 2OZMA 2D5RA 3OYBA 3SUQA 3KLIA 5KGXA 4DTUA 3TAGA 4AHUA 5T7BA 3DRSA 4HCCA 1EXQA 1NOYA 4KO0A 3G10A 2DY4A 3LPTA 4OKJA 3M8SA 3CFOA 4OKKA 4E89A 4HHTA 1SL0A 1L3SA 3ZSQA 5FROA 4OKEA 4FXDA 1LWCA 4W5TA 4NCGA 4EZ9A 1BCOA 1B9FA 3TANA 3U3GA 3EZ5A 2QKBA 2YKNA 2JLEA 3M8QA 3OS2A 2G8HA 1QS4A 3ZSZA 4DS5A 3SUPA 1VSIA 4DSLA 4CGGA 4KI6A 1TAQA 4NYNA 1HYZA 1J5OA 4KHUA 1TVRA 1FXXA 1G15A 4MFBA 3DMJA 1IH7A 1VSHA 4QAGA 1D5AA 1DTTA 4CJVA 1T05A 1QSYA 4CHQA 3MEEA 2P1JA 3KJVA 2BANA 2EHGA 1WNSA 3LP3A 4Y1CA 3OYAA 3WNEA 4CGJA 4DSKA 2XY8A 1YTAA 4B8CA 1QQCA 2WOMA 1RTJA 4DTSA 3QEXA 2XHBA 3SV3A 4GW6A 4JS4A 1XC9A 3AA3A 4CECA 1SUQA 4DSEA 1IKYA 2DFFA 2ZQBA 2RF2A 3LZJA 3LAKA 3VQ4A 3ZSYA 3SUOA 4E0DA 3DRRA 2HHSA 2Q3SA 3WNGA 2A1RA 1ZBIA 5CY4A 3AO2A 1HPZA 1C1BA 1X1PA 1LW2A 3L3UA 2LSNA 3ZT3A 4AH9A 4OPJA 3HT3A 3V1OA 2F96A 4DF4A 4EZ6A 4FJ9A 4B3OA 3SQ1A 2IDOA 4LSLA 4YNQA 1VSJA 4CK1A 4C8OA 3HP9A 4FLYA 1WSJA 3CYMA 4AHVA 4E7IA 2G8WA 3QETA 1LV5A 4KTWA 4O44A 5FDLA 4HUEA 4F3TA 2W42A 2Z1IA 4Z4CA 2VG5A 2HW3A 4FJ8A 3CQ8A 2YV0X 2OYQA 4FYDA 3P1GA 2QXFA 1KFSA 4B08A 1NJWA 4FJJA 4HUGA 3K58A 3ZT1A 3U6FA 3BDPA 5HRNA 3VA0A 4B9SA 4ELUA 1KSPA 4F2SA 1W9HA 1KTQA 3SQ4A 1UOCA 2IOCA 5HRPA 4FM2A 5HROA 1I3AA 3TAPA 5I3UA 1QTMA 1CXUA 3K2PA 4FW2A 4FJHA 2Y1JA 1RT1A 1WAFA 5DK5A 1RCHA 3IS9A 1L3UA 1VRUA 4CEZA 2FBVA 1QSSA 4CIFA 4E19A 4CGIA 4I2PA 3V81A 4CF2A 4FM0A 1BIUA 4OGEA 4N5SA 4O0IA 3LWLA 4CJLA 4M42A 2B6AA 4DFKA 1KLMA 3ZSRA 1Q9XA 3HSTB 5C25A 1GOBA 3SCXA 2GUIA 2XRIA 4HTUA 1K6YA 3IG1A 3MXIA 4DU4A 1KLNA 1KVCA 3OYHA 2FBXA 2WONA 4BWJA 1D9DA 2PZSA 3QLHA 4C8KA 1HQEA 1RILA 4JS5A 4Z4IA 1GOCA 3NF6A 4WE1A 4CEBA 4DQQA 5FRMA 3VQBA 3OYIA 4FZYA 1N5YA 3KK2A 2HHUA 1XWLA 3DLRA 4ZTFA 3NCIA 4Z4HA 3KK1A 4FLZA 2HB5A 4PUOA 3THVA 4W5NA 2YNHA 3C94A 1ZBLA 4M3WA 4K8XA 1RT2A 3RRGA 4E7JA 2P5OA 5KGWA 4OGCA 3HL8A 1CXQA 4M3RA 4RG8A 1VK0A
chains in the Genus database with same CATH superfamily
4CEEA 4DV6K 3VQPA 4A57A 3CCSN 1JLAA 1NGAA 2OPPA 5AQFA 1BDGA 3SMPA 5KI6A 4CFCA 3LDPA 3M5RA 2AJQA 3TWHA 4BR0A 3CMAN 2V51B 4LY7A 1KCFA 3DYAA 4FWPA 4DR6K 2VYPA 4CZJA 3U8XA 3VQQA 3EEQA 3C95A 4CIEA 1LWEA 4O0JA 1VSMA 3PX4A 2OA8A 4BDYA 3AVLA 1DKGD 3AVAA 1GOAA 3LDQA 3QO9A 4MDBA 3PIPL 1LWFA 1JJ2M 3R9PA 3WUHA 1YT3A 4DTJA 4XH1A 5F1XA 2D4WA 4YDUA 4RWTA 2GWKA 1FKOA 4PKGA 1TGOA 3VMFB 1HNIA 3IKMA 3O9SA 4ZHRA 4DV4K 3AO3A 1RDCA 4B9NA 4DV2K 1NGEA 1C1CA 1VSEA 1U4BA 4FJGA 4FVMA 4OPHA 1NK0A 2YJFA 5AQOA 3OYMA 1YF5L 3CC7N 4LD0A 4CEDA 3MEDA 3IUCA 1WSEA 1KFDA 2P9LB 3NVMA 4PL7A 3AA5X 1JLQA 4JKGA 1ASUA 3AVIA 3OYFA 2G8UA 3JSMA 4KTQA 4JRPA 3QIPA 3OYNA 4CZMA 3THYB 4WQ4A 1IKWA 3CHWA 4H4OA 3QB0A 3H46O 4ILJA 4Z4FA 4DFPA 1H1VA 3UIQA 3MWPA 3VGLA 3SPYA 4NYFA 2X6NA 2A3ZA 5CZ2A 3P5JA 1TK0A 4JAXA 4EP4A 2A5XA 5J2PA 2O8DB 2X6SA 4O5BA 3BZKA 4BDZA 4X66K 3L2UA 5BPMA 1Q18A 1NK9A 2V7ZA 2Q36A 3ATVA 3AVKA 4BRFA 3DRPA 3IAYA 4JEPA 5KPRA 2FLOA 3LPUA 2ZF5O 4E7KA 5HRSA 3K5MA 1SAZA 5EX5A 4H5NA 3RMCA 1WBDA 3CC2N 4DQIA 3V9SA 2PYJA 1XI1A 1J6ZA 4A61A 5C2FA 1YJWN 2FBTA 1S6QA 2VWKA 3K57A 4DCHA 2HNZA 2D0BA 2CGJA 4J8FA 5AZJB 5DM6L 3QEWA 5ADXH 5BRHA 2YHYA 1RTDA 4BGAA 4DUZK 2PFUA 4BRMA 3LZIA 3LANA 4JI4K 4CE9A 4J2DA 4H0YB 4WQ5C 3AA4A 3O3HA 4CJKA 1D8YA 2Q0UA 5AQKA 3KLEA 1TKZA 4Q0BA 4BC3A 3AA2A 4H0TB 3W0LA 4DQPA 3DI6A 3VQ8A 4E1NA 4CCHA 3KZBA 1JLEA 1XQSC 3MWTA 4X64K 4KHSA 4CHOA 1S9GA 2A41A 4JKHA 3L2RA 1NMNA 3KKRA 1JLGA 4FWOA 1RBTA 4DLEA 5GIOA 3W3DA 3MXMA 3PSIA 4BC2A 4DKWA 3J81O 3VGKA 2NZTA 3LP1A 5HOOA 3AVFA 4I2QA 1QSLA 1T6CA 4CJ3A 4OO1J 3HTVA 2Z1HA 4BRLA 2F8TA 3WNFA 3F9KA 4C8NA 4PKIA 4CJUA 2HHTA 2HBKA 3TTCA 2E6LA 3BZCA 4FW1A 3T7ZA 2KW4A 3I56N 2F4VK 4DV0K 3ZX2A 4B8AB 2QI2A 4A5AA 1HQUA 2O8BB 1XHXA 4PQUA 2UXDK 1X9MA 3K5LA 3OVNA 4B9LA 3VQEA 1WAJA 1VSDA 1NOZA 2W41A 2HSTA 2HF3A 4YOVA 2O8CB 1R59O 1A5XA 1BO5O 3NF7A 1O1WA 1M1KO 3VERA 4CFAA 1SKWA 2G8VA 3VN5A 1ZXOA 1DLOA 2P9UB 1TYQA 3AVCA 1SV5A 4KHYA 3C6UA 4FJKA 3QINA 5JS2A 3D2FB 4KI4A 4CJRA 3U9ZA 3A5MC 1X9SA 2YCHA 3I8DA 3O9UA 3D2EA 1NK4A 2X74A 4KH5A 4FK0A 3T1HK 2IAJA 3FZFA 3MN7A 3L6QA 3A5NC 3ZSXA 4H4MA 4LFAK 3VETA 2KFZA 1BU6O 3WXIA 1TYQB 1RFQA 1NK7A 1Q9YA 4FWKA 2X78A 3O08A 4FJIA 4O55A 3MXJA 1P90A 2BE2A 5AQWA 3FZHA 1BGXT 1S1XA 3P39A 4AHRA 4DR7K 4KRFA 4FJMA 3ZT2A 5J2QA 3WXMB 3UKUA 3V9UA 2IS3A 4OJRA 4FWMA 1NWKA 1IO2A 4CJWA 1U49A 4FJNA 1VQ4N 3DLGA 2ZJPL 4MLEA 2GUPA 2ASOA 3QEIA 3NAEA 4M41A 1FKPA 1LOTB 4M3TA 1NNEA 4DLGA 4H5TA 1X9JA 4Z4GA 4EAHD 2QWNA 2KHOA 3L2VA 3KD5E 1HLUA 2Z1GA 4B3SK 1NGGA 4ID1A 3WEEB 5D3GA 1J9AA 3RMAA 3R8EA 1VQ7N 4IO9L 2CH6A 1K8KB 1GLCG 3DWLA 4JLHA 1EKEA 2OZMA 1GLLO 1HX1A 4M7YA 4IJNA 4B3RK 2ZJRL 3CFOA 2O8FA 4FXDA 4CW7B 4NCGA 4BVOA 2OTJN 1BCOA 1KXPA 4CVNE 3U3GA 2QKBA 3U9DA 4CD3A 3SUPA 2P9IB 4CGGA 1HYZA 2GEMA 5BR8K 4CJVA 3CJ1A 1QSYA 4CHQA 3ZYYX 3KJVA 3TTDA 2E2PA 3OYAA 4B1WB 1YTAA 2F7TA 4XH4A 2XHBA 3SV3A 4GW6A 3CC4N 4JS4A 4IZ9A 1SUQA 4DSEA 4JN4A 1IKYA 2ZQBA 3DRRA 2Q3SA 5KQ8A 2H3GX 4IEIA 1ZC6A 1LW2A 1VQLN 4YOTA 3ZT3A 3FFKB 4EZ6A 4WFBL 2IDOA 5GIPA 1C0FA 4C8OA 2I7NA 4E7IA 3CYMA 4M3XA 4KTWA 4O44A 2PAVA 2VG5A 4FJ8A 4EHUA 3CQ8A 1V4SA 4FJJA 2Q31A 4JI1K 3U6FA 4GKJK 1UOCA 4FM2A 3TAPA 1CXUA 4FJHA 5DK5A 1BG3A 3QBXA 5FPNA 2GELA 1J5EK 4E19A 3CCMN 3N4QA 2FSJA 4O0IA 2B6AA 2GUIA 1W7AA 2ZGZA 3IG1A 1S22A 2CGLA 4DV1K 4JS5A 4Z4IA 2O8FB 1GOCA 1QQOA 3DXMB 2QA4N 1QZ5A 1NJIO 4LF5K 2P5OA 4OGCA 5C2DA 3M3ZA 1CXQA 3CPWM 3K9KA 2CH5A 4EHTA 2A6AA 3AVMA 1TV6A 4B9MA 4JKCA 5GAHP 3M1FA 3E66A 1QQNA 4Z4EA 1SZ2A 4DFMA 4AHSA 4O5FA 3SI6A 4GVEA 1S72N 3D0PA 1CZ9A 4O8UA 1BOTO 1BISA 3CCUN 3EYZA 4EFHA 3TTFA 5KRTA 3TSUA 1A5WA 4HTLA 3KWIA 1KD1O 1IBKK 4GNIA 3SK3A 3O1WA 5E84A 2YJEA 3JS6A 3NGZA 4RW7A 4GV3A 3AY9A 4A59A 4YOWA 2HMIA 3A2FA 3P38A 1WSHA 5AR0A 4CZIA 4CZHA 1WSIA 1NM1A 3ZT0A 3PUFA 3OW2M 1DT9A 4A2AA 1HJOA 2WTUA 3CCVN 4BRGA 2GBZA 4IG0A 2IVNA 2GTDA 4A2BA 4AM7A 2F8SA 4IBNA 5GAEP 3VEVA 2ZE2A 3IFRA 1NK5A 2UUBK 3TSPA 2FSNA 3UKRA 4CFDA 2HBMA 4U67L 2YNGA 3NF8A 2KFNA 2DPNA 3D7EO 4CGHA 5HRRA 5AQXA 5E41A 4JHDB 4E1MA 3I55N 1VQON 2P9KB 4BRNA 3PV8A 1XUPO 1L5UA 1T44A 3L2QA 4OVLA 3DLKA 3CXCM 2YHBA 5BREA 4W5QA 4J2BA 1S9EA 4KH6A 1RNHA 2R7YA 4CJ7A 3JAMO 3VGMA 3QNOA 3SAHA 1VAZA 1T7PA 4GV9A 3GOIA 5HLFA 5M1OA 4FM1A 5C12A 1RBUA 2UYTA 3CG7A 4FJXA 1BQMA 3CM6A 5GAGP 3LM9A 4BG8A 4KHPK 1HNZK 4NLBA 1RT4A 1NGDA 1WSGA 1YXQA 1SL1A 1UWBA 4NB4A 3AO5A 4LFBK 4FLTA 5JLHA 4NCAA 3ZETA 2A40A 2WFBA 3CCRN 5ELZA 4N56A 1NK8A 5AQUA 3LWMA 3OYJA 1C6VA 1ESVA 1RT6A 4CJEA 5J2MA 2KZZA 3F9MA 4CZFA 2FBYA 3DJCA 5BPNA 3FGUA 4K0KK 3RR7A 2IC3A 2VCPA 4FWSA 1EO1A 5KPTA 1UAXA 1T03A 3O3GA 1VSKA 3E9PA 3M8PA 3KHYA 3AAQA 1JLBA 4K43A 4H0PA 4DTRA 3SBGA 1HNVA 3DLBA 3O9QA 1IG9A 4YDUC 3ZX0A 3KK3A 4E3SA 1K8AO 4LH5A 4F9OA 3DOLA 1YIJN 1X9WA 3BF3A 2A1SA 3D45A 3IRXA 1VQ8N 3R1XA 4FOEA 3CF5L 5JVGL 1Q86O 1GLBG 5AQGA 3HVTA 5LY3A 1Q7YO 4MQ3A 4FOIA 1E4GT 1U48A 3FFIA 1OH8A 4NCBA 3THXB 3KKSA 1XNRK 1OVQA 2Q2RA 5AQYA 1VQ5N 1KC8O 3H3OB 3N4PA 3V9XA 1JLCA 2Q1NA 4JRQA 1IBLK 3SQ2A 4CJ4A 5M1NA 4BY9C 3GDQA 4H8KA 3HM9A 3QMLA 3AVBA 1A5VA 2NNWA 5EOYA 1S5JA 3P31A 3THXA 4IFVA 5EVZA 4OLBA 5C10A 1QQMA 3WXLA 4DTMA 1N6QA 2VWBA 1RBRA 4A62A 4PHTX 5DM7L 4W5OA 5AQMA 1NKBA 1TUYA 3VF4A 3CQYA 2D0OA 3OY9A 3C0BA 4CEOA 3RTVA 1JXBA 3DAWA 2P9IA 3J8AA 4FWRA 3EE8A 3NF9A 4LF4K 4KREA 3FZKA 4CHZA 2VQFK 3K0SA 3VPZA 3S3NA 2D0AA 4N41A 4W5RA 1Q81O 2OCEA 3MEGA 4FPBA 4KPYA 1BI4A 4DB3A 4B9VA 2ZD1A 4JHDA 3IMXA 2O8EA 3ZCMA 3THYA 3KK7A 1XHZA 1NKEA 1Z6RA 2BDPA 3HK2A 3C6HA 3E9OA 3G4SN 4M7XA 2P9PA 3F5TA 5SZTA 3NVKA 2I5JA 3LP2A 4DFJA 1UA1A 4KKOA 1EETA 1ZBUA 4DU3A 1VQNN 1RDBA 5C0YA 1YHQN 2GWJA 4F4KA 1KRPA 4CHPA 4FZZA 1EWQA 2E6MA 3AVGA 3EKSA 1GLDG 4DQSA 1VSFA 3F2KA 4DF8A 2GV9A 4CFBA 4JI7K 2UUAK 2VG7A 4MO5A 3BF1A 4CK2A 4U7BA 5HBMA 3O5BA 3T1AA 2QTDA 4QOZB 4IJAA 3HOTA 3ID8A 1QVGM 4F3OA 3K59A 3VQDA 5IT9O 5TKWA 4CIGA 3OTOK 4OPKA 2ZM6K 5C15A 3QICA 4NXMK 1Z25A 4RW8A 1FK9A 1RT5A 5GINA 3VQ9A 4FLVA 2QW9A 1R0AA 5M1QA 1RBSA 4IKFA 4CJTA 4BQZA 1CZAN 3DXKB 4XEIA 4AHCA 1EP4A 2P51A 4DTNA 1MA9B 4MDAA 4H5WA 1LCUA 3P4IA 3SUQA 3H45C 5T7BA 4HCCA 1EXQA 1NOYA 4KO0A 4HHTA 4E89A 2FXUA 3ZSQA 4W5TA 4IOXA 5BRDA 3EZ5A 4OX9K 4CZGA 3OS2A 1QS4A 3CJBA 4UY8O 2NLXA 4BR7A 1HPMA 4KHUA 1FXXA 2ASPA 2FF6A 4MFBA 1IH7A 4QAGA 5AZIB 1DTTA 4YOYA 1VHXA 2P1JA 2EHGA 2HBLA 4IDHA 4DSKA 4YHHK 1QQCA 3L4IA 3KVGA 5EY4A 1IJJA 1XC9A 3AA3A 4CECA 2RF2A 4E0DA 3LAKA 3VQ4A 1VQ9N 1T6DA 2HHSA 1HPZA 3L3UA 1X1PA 4AH9A 4OPJA 4IXCA 5IWAK 4B3OA 3RVCA 4LSLA 4DR3K 3LM2A 4JI0K 2J4RA 1HKBA 3EN9A 3ZEUB 4B1UB 3MN9A 3ENOA 2GX9A 2O8DA 1K9MO 5KPZA 3P1GA 2QWOA 3WXJA 1NMDA 3K58A 3WT0A 3VA0A 4PKHA 3KWGA 1W9HA 1KTQA 1I3AA 5I3UA 5AQIA 3K2PA 1K8KA 2P9KA 4BRPA 1NGHA 3CCLN 2F9WA 1WAFA 1IV0A 4JKGB 3IS9A 3WQUA 1L3UA 2FBVA 2QXLA 3SBTA 3V81A 3I33A 1T3VA 3EO3A 3LWLA 4CJLA 4M42A 4JI5K 4B3MK 4DFKA 1KLMA 3ZSRA 4B1YB 3SCXA 4DU4A 4ILHA 3LDNA 2FBXA 2WONA 4BWJA 3QLHA 1HQEA 3ZETB 1ILYA 1P8ZA 2NRHA 3VQBA 3SAFA 3OYIA 1N5YA 4FZYA 1I94K 3KK2A 1XWLA 4RTFD 3NCIA 3SJHA 4W5NA 3C94A 1ZBLA 4K8XA 1RT2A 5KGWA 3HL8A 3EL2A 4BRHA 4JD2A 3G25A 4J2AA 1E3MA 4BACA 4FLXA 5CR4A 2QWMA 2ITMA 2G8FA 3HO1A 3QEVA 4DQRA 4BRDA 4JI2K 3HJFA 2IIRA 2RE2A 4DTOA 3H1QA 3SJJA 2FC0A 4CGDA 3Q7BA 4Y0WA 3THWB 3HP6A 3VENA 3PX0A 3BY5A 3DXKA 4XH5A 2PBDA 3KTQA 3HPOA 4DSJA 1NJXA 1L3VA 3J7YP 3EZWA 2HNDA 3ALYA 5AQTA 4CHYA 2YHAA 3NH2A 1TAUA 1MWKA 3HVRA 4OLAA 3AO4A 4NLCA 4PY5A 3AVJA 3GL1A 3H08A 4WF9L 1W2BM 2KLAA 4N47A 4YOUA 2P9UA 4KH4A 4C1NK 4QS8A 4ILGB 4BR4A 3CI5A 4AHTA 4AM6A 2XY5A 1QE1A 1JL1A 1RDDA 4ICLA 4CERA 1NK6A 3HOSA 3O4NA 2BUPA 2HNYA 3PSFA 4JI6K 2QWPA 4BDPA 2O8CA 3TABA 4ELTA 1RDWX 2Z1JA 3O3FA 3NE6A 2VGNA 4E1JA 4JK7A 4CF8A 2E1ZA 2HBJA 4K25A 4MLHA 3L4QA 1TL3A 1KVBA 5J2NA 1ITGA 3P83D 1YUWA 5J1EA 1Q82O 3RRHA 3V9ZA 4FJLA 4UQGA 3NHGA 3UE5A 3F73A 2O8BA 3OYCA 4JKDA 1RT3A 3CQXA 1UA0A 3EY1A 5C42A 3TAFA 1NGCA 4M63C 3CFRA 2E5LK 1S1UA 4LF8K 3DOKA 3UKUB 1B92A 1G99A 1JL2A 5DMRA 3AO1A 4JD2B 4BGBA 5HL7L 4LC9B 1B9DA 1S1VA 2PY5A 3ULEA 2YHXA 3KIOA 4B9QA 4KAZA 4H0OA 3PX6A 4FK2A 4GMJB 3CM5A 4IG3A 5LMNK 2OZSA 4ELVA 1XNQK 1HYSA 1NJYA 3SPZA 3I0SA 4BRKA 2BH1A 4B9TA 2IVOA 1HKCA 5LMUK 2RN2A 3LP0A 1ASWA 2BGGA 4DV5K 4DG1A 4CF0A 5SWMA 4G9ZA 3S3MA 3A0IX 3CD6N 2NRVA 3AVHA 1TK8A 4DTXA 4CJPA 2NRWA 1D4XA 2IGIA 4QCLA 3WNHA 4YFUA 3ULEB 5I9EB 1L3TA 5FRNA 3VOVA 3MDQA 4H5RA 1WUAA 4CJQA 1XMQK 3NDKA 2OPQA 5BR9A 4WQ5A 3PO5A 3CCJN 4L3QA 4O4GA 4BE1A 5TKYA 4K42A 3ZSOA 2YNIA 4FZXC 4I9LA 1ZYQA 4JK9A 3WXKA 2HHXA 1T8EA 1U2VA 1JCEA 4HVJA 2XY7A 2UXBK 4JKEA 3VQ6A 3A8YA 5JMVA 1TK5A 1OKJA 2BTFA 2D0CA 2QWRA 4M3UA 3JYTA 3DLHA 1WLJA 1DEJA 1DTQA 1S3XA 1Z05A 3U3YA 2ITGA 3C6AA 5AQHA 4BR2A 2DFHA 2ATQA 3QNNA 4FLUA 1OH6A 1BWFO 5CZ1A 1LW0A 1N34K 3ITHA 3HZ6A 3QIOA 5LJVA 3KLHA 3SYZA 2CGKA 3OYGA 3A5LC 1O13A 1VQMN 2QWQA 2E2QA 3HPGA 1C0GA 3EE9A 1JCFA 2NRTA 3O4WA 3S41A 3K5NA 4J2EA 4KFBA 4M45A 3L8BA 4NO7A 2OPSA 4LSNA 4DQ8A 4K8ZA 3PY8A 4BE2A 3KLGA 2RPIA 1YVNA 3AV9A 5LL6Z 5AZJA 3OBWA 5MLCQ 5C24A 1KAXA 5AQQA 3OS1A 4H03B 3PLAA 3R3LA 3CIPA 5KTQA 4IWVA 3E01A 4IDKA 5HP1A 3OS0A 3HM8A 1YITN 3VEYA 4K41A 3VEZA 1KAYA 1YVUA 4XIUA 3NMUA 3DLLL 1QVFM 3VQCA 1TKTA 4LF7K 2O4GA 4X65K 1D9FA 1RDAA 1HUXA 3CFPA 3PO4A 4M3YA 2JGUA 3V9WA 2WBNA 3QBWA 3ATUA 1RBVA 3OJSA 2G8IA 4KB0A 5F2RA 5A2QO 4DR2K 4CJ5A 4I7FA 4WYBA 4DTPA 2VGMA 3HBTA 1IBMK 1KVAA 3C7NA 3OYDA 3PIOL 4IOAL 1BUPA 3B8AX 2VQEK 1S1TA 3NH0A 3OBYA 3V4IA 3B6OA 1WSFA 5M1KA 3OYKA 4CZKA 3I0RA 1BI4B 1HJRA 2YI1A 3VEOA 3U4LA 2PYLA 1WN7A 1ATRA 3T1YK 4Z94A 4HUFA 1FW6A 5AQZA 4FL9A 1BL3A 2NRRA 4QS7A 5AQSA 1EX4A 4GVMA 4YY3K 2DTUA 1U04A 3KLFA 4JI3K 3CJAA 4FO0A 4CBUA 1SKSA 1HRHA 1Y97A 1RT7A 4CEAA 2FF3B 5BN9A 2D5RA 4B1ZA 5GADP 3MMVA 5KGXA 4DTUA 3TAGA 1N33K 4JV5K 3DRSA 3G10A 3HRGA 3LPTA 2DY4A 5FROA 2E1YA 3AGKA 4OKEA 4I6MB 1LWCA 3LL3A 1YI2N 1HKGA 1B9FA 4AF1A 4LF6K 4ISGA 2JLEA 3M8QA 4JKFA 4C1NI 3ZSZA 4DS5A 1VSIA 4DSLA 2E2NA 4KI6A 1TAQA 4NYNA 5JVHL 1U6ZA 3VF2A 1TVRA 3DMJA 1VSHA 1D5AA 1Y64A 1T05A 4JI8K 3MEEA 5JLFA 3LDLA 5EXWA 4CGJA 3ID6A 5AQJA 2WOMA 1RTJA 2P9SB 2P9LA 3ZSYA 3WNGA 4DV7K 5CY4A 2LSNA 3V1OA 2F96A 3MN6A 4GV6A 2E2OA 1NU0A 4CK1A 3GBTA 3QETA 1LV5A 3VTIA 2D1KA 2RHKA 2AP1A 2W42A 2Z1IA 4KBOA 1KAZA 5CE3A 3GG4A 4FYDA 2UUCK 2QXFA 1KFSA 3CCEN 1NJWA 1OH5A 5HRNA 4B9SA 3DXMA 1KSPA 4ISFA 2IOCA 5HRPA 1QTMA 3MCPA 2FSKA 3CETA 1NLVA 1VQ6N 1RT1A 2HHHK 1VRUA 5BRFA 4C23A 1QSSA 4CF2A 1BIUA 1NG9A 1VQKN 1ATSA 5M1PA 1Q9XA 3HSTB 3HI0A 2D0PA 2XRIA 4FPAA 1K6YA 3MXIA 3CJCA 4PL8A 1D9DA 2ZJQL 1MWMA 1YJ9N 4BROA 4WE1A 3NF6A 4CEBA 4DQQA 5FRMA 3JXUA 2HHUA 1ZBSA 4ZTFA 4BC5A 4PUOA 4FLZA 3KK1A 3THVA 2YNHA 1QZ6A 3ZLJA 5FPDA 1ZBHA 1LAVA 1VRTA 4CJSA 3Q7CA 4R79A 1BHLA 1SS6A 3FR0A 2P9NB 4CBXA 3LAMA 1OH7A 1C0UA 3CERA 2QK9A 4WFNL 4V19S 1W97L 3TSQA 4RW9A 4DV3K 4DMNA 1U47A 2ASMA 1JCGA 1C1AA 5CYMA 1GLFO 2ZWHA 4ZTJA 4LF9K 4C8LA 1S6PA 3UKRB 2ZGYA 4CI6A 3HPHA 4JKBA 1JXEA 3V1QA 4CGFA 3V1RA 1TKXA 1IKXA 3D2EB 4CESA 4BQLA 3MX5A 5K14A 4DU1A 3H6EA 3NGIA 4AILC 3TU5A 3SNNA 4FWQA 1LAWA 5AFUA 4EP5A 1OVYA 1TL1A 2QWLA 4CEZA 1QHTA 2XY6A 4JYAK 1C0MA 4CEQA 2JWLA 4DR1K 1EWRA 4F8RA 3DM2A 2NRZA 3CMEN 4Y1DA 5E26A 1GLAG 1HMVA 1JKHA 3SLCA 3OYLA 4RW4A 1MU2A 3D6RA 3K9JA 1BCMA 4DWIA 1EQYA 3DLEA 5AQNA 4HWIA 1BA0A 4CF9A 2XO7A 3KD1E 4FLWA 5H1SQ 2KZMA 2B5JA 3GE1A 2KQ2A 3QFPA 3ZSWA 4FJ7A 1BA1A 3QEPA 1RTIA 5CYQA 4KTZA 3TI0A 4FJ5A 2E8AA 1E4FT 5AQVA 3RSEB 4HCBA 2Y1IA 1ZBFA 3VQ5A 1YTUA 3ENBA 3RMDA 3T3FA 4YORA 2P9NA 3VQ7A 5B8HA 2HF4A 2VWJA 4LFCK 4KHNA 5F0XA 4G1QA 2V7YA 3R6MA 4JKAA 3MECA 1U45A 4BRAA 2B4JA 2KKZA 3HXMA 3A5OC 2OTLN 4L8RB 4LH4A 1ATNA 3C6TA 5M1FA 3WQTA 3J7ZO 3RSEA 1J53A 1REVA 3J80O 3AVNA 4H0VB 4B9UA 1W0HA 4IEEA 2VG6A 4JNEA 4RW6A 3ZEUA 1S1WA 3OJUA 5I42A 3TR8A 1J54A 4KB1A 2QEXN 1ASVA 1Q8IA 3HYFA 3VA3A 3QESA 4IOCL 1BQNA 2OPRA 3E9LA 4KV8A 4CJFA 2HMPA 2V52B 3M6GA 1VSLA 3ASMA 4KHWA 3G0ZA 3VF6A 2OANA 1SQKA 4BR5A 3NH1A 4FSVA 5JS1A 4WQ4C 3L3VA 2IVPA 4ISEA 2G8KA 3OA9A 4BRQA 3O8MA 4CK3A 2HHWA 2YKMA 4BE0A 3ZT4A 1QHAA 3S3OA 4OPAA 3QDKA 3B6PA 3M8RA 3RR8A 3O4QA 4AQYK 1TKDA 1KQSM 3LALA 3S9HA 1C0TA 1I39A 4FVUA 1WOQA 3TAMA 3VQAA 4E7LA 3HSCA 2EWSA 4RCHA 4IFYA 3LDSA 1SKRA 5FLXO 3E1YA 4DS4A 4Z0UA 4BREA 4Q5VA 3NFAA 2W40A 4H0XB 3T19A 3AARA 3L0QA 1F21A 4BVPA 2HVHA 3O1BA 2RKIA 1N36K 3NBPA 3RWUA 4ID5A 3BP8A 3LDOA 3I8BA 2UXCK 3VESA 2QM1A 3SQ0A 3K5OA 4CD1A 4DR5K 3MAQA 4H5VA 1SL2A 3T69A 3CCQN 3ISNC 1NBWA 3BGRA 3AGRA 2ETJA 1X3NA 1HNWK 5KQDA 4PWDA 1NKCA 4E7HA 1DGKN 5BPLA 1HYVA 4O8KA 5AQLA 3RMBA 4R5PA 4DUYK 2E20A 4FCYA 4CZEA 5FPEA 3O9TA 1JLFA 1N8RO 4EIAA 3BEXA 3BUZB 3SV4A 3TARA 1NGIA 3OHRA 1CLQA 1RGIA 3VTHA 1BIZA 3TAEA 5AZIA 4F2RA 2UU9K 4C8MA 4CHNA 3V6DA 3CJ9A 4NXNK 4WCEL 4BWMA 4MO4A 5KRSA 5BN8A 3TAQA 2HHQA 3ULDA 4DSIA 4WFAL 3MN5A 1XMOK 3QERA 4IO8A 4TSXA 5EU7A 4X62K 4FK4A 2YNFA 1CZBA 4PA1A 2HHVA 4BRCA 1IKVA 4FWNA 5AQPA 3OYEA 1MDUB 4DR4K 1RTHA 3ZSVA 4B3TK 3L2WA 1NJZA 3THWA 2EX3A 4KHQA 4I9QA 3UB5A 1TUUA 4M3ZA 1GLJO 3C65A 2O4IA 4BR9A 4DSFA 3D2FA 3FZLA 3SZ2A 2YX6A 1M90O 1HNXK 2QKKA 1XC3A 4N76A 1U2VB 4CF1A 2P5GA 4IFEA 1HR0K 2HVIA 3FE1A 4YOXA 2KTQA 4CEFA 3SMSA 3IDHA 3SUNA 2DFEA 2NUBA 3MCAB 3MK6A 3NGYA 4DHYA 1NGJA 2E4LA 1Z26A 2W6KA 3SAGA 3OYBA 3KLIA 4B1XB 4AHUA 3O80A 4I6MA 3H1VX 3H3NO 4OKJA 4OKKA 3M8SA 1SL0A 1L3SA 5FPMA 4CZLA 4EZ9A 5AJ3K 4GY2B 3TANA 2YKNA 1YJNN 2G8HA 1VQPN 1WBBA 1J5OA 1G15A 2HOEA 2NRXA 4FWLA 2BANA 3ZX3A 1WNSA 3LP3A 4Y1CA 3J7AP 3WNEA 2WUSA 2XY8A 2AA4A 4B8CA 1RDUA 1NGBA 2W6LA 4DTSA 3QEXA 4BRIA 1N32K 1V4TA 1X3MA 2DFFA 3LZJA 3SUOA 2P9SA 4GKKK 2A42A 2A1RA 1ZBIA 3AO2A 2E88A 1C1BA 3HT3A 4DF4A 4FJ9A 3SQ1A 3VEXA 4YNQA 3G6EN 1VSJA 3HP9A 4FLYA 1WSJA 4AHVA 2G8WA 3BDPA 1WB9A 5FDLA 4HUEA 4F3TA 4Z4CA 2HW3A 4BG9A 3VEWA 2YV0X 2OYQA 3WEEA 3AAPA 4B08A 4HUGA 3ZT1A 3O6WA 4A5BA 4ELUA 4F2SA 3MX2A 3SQ4A 5HROA 4FW2A 3ENHA 2Y1JA 3TPQA 1RCHA 5JICA 1FJGK 4BC4A 5AQRA 4CIFA 4CGIA 2I7PA 4I2PA 3QFUA 4FM0A 4OGEA 4N5SA 3CPEA 3CJ7A 2P9PB 4QS9A 5C25A 1GOBA 4HTUA 1KLNA 1KVCA 3C7NB 3OYHA 2PZSA 1IG8A 2O8EB 1YAGA 2JWKA 4C8KA 1RILA 1K73O 1GLEG 3DLRA 3FLCO 2Q0RA 3O9RA 2HB5A 4Z4HA 3FZMA 2Q97A 3EKUA 5ADXA 4M3WA 2WC9A 3RRGA 4E7JA 2YHWA 4JK8A 5LJWA 4B1VA 3G71N 2F9TA 4CBWA 4M3RA 4RG8A 5AFUH 1NGFA 1VK0A 5CHIA
chains in the Genus database with same CATH topology
4J2AA 4CEEA 1LAVA 1ZBHA 3VQPA 3AVMA 1VRTA 4CJSA 1TV6A 1JLAA 4B9MA 2OPPA 4BACA 4FLXA 1BHLA 2G8FA 5KI6A 4CFCA 4Z4EA 2AJQA 4DFMA 4AHSA 3HO1A 3TWHA 3SI6A 3D0PA 3QEVA 3LAMA 4DQRA 1CZ9A 1C0UA 2QK9A 3HJFA 1BISA 4LY7A 1KCFA 3DYAA 3EYZA 4RW9A 4DTOA 4DMNA 3SJJA 2FC0A 4CGDA 1U47A 3VQQA 5KRTA 3HP6A 1C1AA 3PX0A 1A5WA 5CYMA 3C95A 4CIEA 1LWEA 4O0JA 1VSMA 3HPOA 3PX4A 4ZTJA 3NGZA 3KTQA 4DSJA 1NJXA 4RW7A 1L3VA 4BDYA 2OA8A 2HNDA 3ALYA 4CHYA 3AVLA 4C8LA 1S6PA 2YHAA 3AVAA 3HPHA 3NH2A 1TAUA 2HMIA 1JXEA 1GOAA 3V1QA 3A2FA 3QO9A 4CGFA 3V1RA 1LWFA 1TKXA 3AO4A 1IKXA 3HVRA 4OLAA 4PY5A 4CESA 1WSHA 3AVJA 5K14A 3H08A 1WSIA 4DU1A 1YT3A 4DTJA 3NGIA 4AILC 4N47A 3ZT0A 3PUFA 3SNNA 1FKOA 1LAWA 1TGOA 4EP5A 1TL1A 4AHTA 1HNIA 4ZHRA 2XY5A 1QE1A 1JL1A 1QHTA 1RDDA 2GBZA 4ICLA 3AO3A 4IG0A 1RDCA 4CERA 1C0MA 1NK6A 4B9NA 4CEQA 3O4NA 2HNYA 1C1CA 1VSEA 3DM2A 4BDPA 4F8RA 1U4BA 3TABA 4FVMA 4FJGA 2F8SA 4IBNA 1NK0A 4ELTA 2Z1JA 3O3FA 4Y1DA 3OYMA 3NE6A 4LD0A 2ZE2A 1HMVA 1JKHA 4CEDA 4CF8A 3OYLA 1NK5A 4RW4A 1MU2A 4CFDA 3MEDA 1TL3A 2YNGA 3NF8A 2KFNA 1KVBA 5J2NA 1BCMA 1ITGA 3P83D 1WSEA 1KFDA 4DWIA 4CGHA 3DLEA 5J1EA 3AA5X 1JLQA 1ASUA 5HRRA 5E41A 4CF9A 4E1MA 2XO7A 3KD1E 3AVIA 3RRHA 4FLWA 3OYFA 3V9ZA 4FJLA 2G8UA 2KZMA 2B5JA 4UQGA 3PV8A 3NHGA 2KQ2A 3ZSWA 1L5UA 4FJ7A 3F73A 3OYCA 3JSMA 3L2QA 3QEPA 4JRPA 4KTQA 3QIPA 1RT3A 1RTIA 4OVLA 5CYQA 3OYNA 1UA0A 3DLKA 4KTZA 2YHBA 5C42A 3EY1A 1IKWA 4H4OA 3TAFA 3TI0A 4FJ5A 4W5QA 4J2BA 3CFRA 4Z4FA 4DFPA 1S9EA 1S1UA 1RNHA 2R7YA 3UIQA 3DOKA 3QNOA 4HCBA 2Y1IA 1B92A 1ZBFA 3VQ5A 3SPYA 4NYFA 1YTUA 2X6NA 3RMDA 5CZ2A 1JL2A 3T3FA 5DMRA 1T7PA 3AO1A 3P5JA 5HLFA 3VQ7A 1TK0A 4FM1A 4EP4A 2VWJA 1RBUA 5J2PA 3CG7A 1B9DA 4G1QA 1S1VA 1BQMA 2X6SA 4O5BA 3MECA 3CM6A 1U45A 4BDZA 2PY5A 3L2UA 2B4JA 3KIOA 3AVKA 1RT4A 3HXMA 1NK9A 3IAYA 3DRPA 4LH4A 4L8RB 1WSGA 3PX6A 4KAZA 3C6TA 1SL1A 4GMJB 4FK2A 1J53A 1REVA 1UWBA 3AVNA 3AO5A 3CM5A 3LPUA 4IG3A 4FLTA 4B9UA 4E7KA 2OZSA 1W0HA 5HRSA 4ELVA 3K5MA 4NCAA 1HYSA 1NJYA 3SPZA 2VG6A 3I0SA 4N56A 3RMCA 1NK8A 4RW6A 4DQIA 3LWMA 3OYJA 4B9TA 1C6VA 3V9SA 1RT6A 1XI1A 2PYJA 1S1WA 4M3XA 4CJEA 3OJUA 5J2MA 2RN2A 3LP0A 5I42A 1ASWA 2FBTA 1J54A 3TR8A 4KB1A 1S6QA 2BGGA 2KZZA 4DG1A 2VWKA 2FBYA 1ASVA 3K57A 4CF0A 1Q8IA 5SWMA 3HYFA 2HNZA 3VA3A 2IC3A 3QESA 3S3MA 3AVHA 1TK8A 3RR7A 2D0BA 1BQNA 2OPRA 4DTXA 4CJPA 4KV8A 4CJFA 3QEWA 1RTDA 1UAXA 1T03A 3O3GA 2IGIA 1VSLA 3ASMA 4QCLA 4KHWA 3G0ZA 3WNHA 4YFUA 1VSKA 3M8PA 1L3TA 3LZIA 5FRNA 3NH1A 1JLBA 3LANA 4CE9A 4DTRA 1HNVA 4J2DA 3DLBA 3AA4A 1IG9A 3O3HA 4CJKA 1D8YA 5JS1A 3KLEA 1TKZA 4CJQA 3KK3A 4E3SA 3NDKA 4Q0BA 2OPQA 3AA2A 4LH5A 3L3VA 3DOLA 2G8KA 1X9WA 3PO5A 4DQPA 3DI6A 3VQ8A 4E1NA 2A1SA 3D45A 3IRXA 4CK3A 4CCHA 2HHWA 2YKMA 1JLEA 4KHSA 4O4GA 4BE0A 3ZT4A 4CHOA 3S3OA 4BE1A 1S9GA 3ZSOA 3B6PA 2YNIA 4FZXC 3L2RA 3M8RA 3KKRA 1JLGA 4I9LA 1RBTA 4DLEA 1ZYQA 3O4QA 3HVTA 3RR8A 2HHXA 1T8EA 3MXMA 1TKDA 3LALA 3S9HA 1C0TA 1I39A 4MQ3A 1U48A 4HVJA 3TAMA 2XY7A 3FFIA 3LP1A 3VQAA 4E7LA 4NCBA 3AVFA 4I2QA 1QSLA 3VQ6A 3KKSA 4CJ3A 1TK5A 2D0CA 4M3UA 2Z1HA 3JYTA 2F8TA 4IFYA 3WNFA 3LDSA 1JLCA 3V9XA 3DLHA 1SKRA 3F9KA 1WLJA 4C8NA 4JRQA 4DS4A 4Z0UA 4CJUA 3SQ2A 4CJ4A 2HHTA 1DTQA 2E6LA 4FW1A 2KW4A 4Q5VA 4H8KA 3NFAA 4B8AB 3HM9A 2ITGA 3U3YA 3AVBA 1A5VA 1HQUA 1XHXA 1S5JA 4PQUA 3T19A 4IFVA 1X9MA 4OLBA 2DFHA 3K5LA 3OVNA 1F21A 2ATQA 3QNNA 4FLUA 2HVHA 2RKIA 3NBPA 4DTMA 1N6QA 1RBRA 4ID5A 5CZ1A 1LW0A 4B9LA 4W5OA 3RWUA 3ITHA 3VQEA 1WAJA 1VSDA 1NOZA 1NKBA 3QIOA 3OY9A 3KLHA 3SQ0A 1A5XA 4CEOA 3SYZA 3RTVA 3K5OA 1JXBA 3NF7A 3OYGA 1O1WA 3MAQA 3NF9A 4CFAA 4KREA 3HPGA 4CHZA 1SKWA 1SL2A 2G8VA 3VN5A 3S3NA 2D0AA 1DLOA 3ISNC 4N41A 4W5RA 3BGRA 3AVCA 1SV5A 2ETJA 3MEGA 3K5NA 4KFBA 4J2EA 4FJXA 4KHYA 3C6UA 4KPYA 4FJKA 3QINA 5JS2A 4M45A 3L8BA 1BI4A 2OPSA 4PWDA 4LSNA 1NKCA 4E7HA 4K8ZA 4KI4A 4B9VA 3PY8A 1HYVA 2ZD1A 4CJRA 4BE2A 3KLGA 3RMBA 2RPIA 3ZCMA 4R5PA 1XHZA 4FCYA 1NKEA 2XY6A 1X9SA 3AV9A 3I8DA 2BDPA 3HK2A 1NK4A 5C24A 1JLFA 2X74A 5SZTA 4FK0A 3OS1A 3SV4A 3TARA 2I5JA 3LP2A 1CLQA 2IAJA 4KHNA 4DFJA 1UA1A 4KKOA 1EETA 1BIZA 5KTQA 1ZBUA 4DU3A 3TAEA 1RDBA 3E01A 4IDKA 5HP1A 3OS0A 4F2RA 4C8MA 3ZSXA 4CHNA 3V6DA 4H4MA 1KRPA 4F4KA 4BWMA 4CHPA 2KFZA 4FZZA 1YVUA 4XIUA 2E6MA 3AVGA 5KRSA 3VQCA 1TKTA 4DQSA 1VSFA 2O4GA 1NK7A 4DF8A 2GV9A 3TAQA 1Q9YA 4CFBA 2HHQA 2X78A 4FJIA 4O55A 3ULDA 2VG7A 3MXJA 4DSIA 2BE2A 1D9FA 3QERA 1RDAA 4CK2A 4TSXA 5EU7A 3CFPA 3PO4A 4FK4A 2YNFA 4M3YA 1BGXT 1S1XA 1CZBA 2JGUA 4PA1A 5HBMA 4AHRA 3V9WA 4KRFA 3T1AA 2HHVA 4FJMA 4QOZB 1IKVA 1RBVA 3ZT2A 3OJSA 5J2QA 2G8IA 3OYEA 4KB0A 4F3OA 3K59A 3V9UA 3VQDA 1RTHA 2IS3A 4OJRA 3ZSVA 4CIGA 3L2WA 1NJZA 4CJ5A 4OPKA 4I7FA 1IO2A 4CJWA 4DTPA 1U49A 4FJNA 3DLGA 1KVAA 2EX3A 4KHQA 3OYDA 4I9QA 1Z25A 4RW8A 1S1TA 3NH0A 3V4IA 1FK9A 3QEIA 4M3ZA 3NAEA 1RT5A 3B6OA 1WSFA 2O4IA 4M41A 1FKPA 3OYKA 4DSFA 3VQ9A 4FLVA 3I0RA 1BI4B 1HJRA 3SZ2A 4M3TA 4DLGA 2QKKA 4Z4GA 1R0AA 1WN7A 2PYLA 4N76A 1RBSA 4HUFA 4CF1A 2P5GA 1BL3A 3L2VA 3KD5E 2HVIA 4IKFA 1EX4A 4GVMA 4CJTA 2Z1GA 2KTQA 4CEFA 2DTUA 1U04A 4ID1A 3KLFA 5D3GA 4AHCA 1J9AA 1EP4A 3RMAA 1SKSA 2P51A 3SUNA 2DFEA 2NUBA 1HRHA 1Y97A 4DTNA 1RT7A 4CEAA 3NGYA 4JLHA 1EKEA 2E4LA 1Z26A 2OZMA 2D5RA 3OYBA 3SUQA 3KLIA 5KGXA 4DTUA 3TAGA 4AHUA 5T7BA 3DRSA 4HCCA 1EXQA 1NOYA 4KO0A 3G10A 2DY4A 3LPTA 4OKJA 3M8SA 3CFOA 4OKKA 4E89A 4HHTA 1SL0A 1L3SA 3ZSQA 5FROA 4OKEA 4FXDA 1LWCA 4W5TA 4NCGA 4EZ9A 1BCOA 1B9FA 3TANA 3U3GA 3EZ5A 2QKBA 2YKNA 2JLEA 3M8QA 3OS2A 2G8HA 1QS4A 3ZSZA 4DS5A 3SUPA 1VSIA 4DSLA 4CGGA 4KI6A 1TAQA 4NYNA 1HYZA 1J5OA 4KHUA 1TVRA 1FXXA 1G15A 4MFBA 3DMJA 1IH7A 1VSHA 4QAGA 1D5AA 1DTTA 4CJVA 1T05A 1QSYA 4CHQA 3MEEA 2P1JA 3KJVA 2BANA 2EHGA 1WNSA 3LP3A 4Y1CA 3OYAA 3WNEA 4CGJA 4DSKA 2XY8A 1YTAA 4B8CA 1QQCA 2WOMA 1RTJA 4DTSA 3QEXA 2XHBA 3SV3A 4GW6A 4JS4A 1XC9A 3AA3A 4CECA 1SUQA 4DSEA 1IKYA 2DFFA 2ZQBA 2RF2A 3LZJA 3LAKA 3VQ4A 3ZSYA 3SUOA 4E0DA 3DRRA 2HHSA 2Q3SA 3WNGA 2A1RA 1ZBIA 5CY4A 3AO2A 1HPZA 1C1BA 1X1PA 1LW2A 3L3UA 2LSNA 3ZT3A 4AH9A 4OPJA 3HT3A 3V1OA 2F96A 4DF4A 4EZ6A 4FJ9A 4B3OA 3SQ1A 2IDOA 4LSLA 4YNQA 1VSJA 4CK1A 4C8OA 3HP9A 4FLYA 1WSJA 3CYMA 4AHVA 4E7IA 2G8WA 3QETA 1LV5A 4KTWA 4O44A 5FDLA 4HUEA 4F3TA 2W42A 2Z1IA 4Z4CA 2VG5A 2HW3A 4FJ8A 3CQ8A 2YV0X 2OYQA 4FYDA 3P1GA 2QXFA 1KFSA 4B08A 1NJWA 4FJJA 4HUGA 3K58A 3ZT1A 3U6FA 3BDPA 5HRNA 3VA0A 4B9SA 4ELUA 1KSPA 4F2SA 1W9HA 1KTQA 3SQ4A 1UOCA 2IOCA 5HRPA 4FM2A 5HROA 1I3AA 3TAPA 5I3UA 1QTMA 1CXUA 3K2PA 4FW2A 4FJHA 2Y1JA 1RT1A 1WAFA 5DK5A 1RCHA 3IS9A 1L3UA 1VRUA 4CEZA 2FBVA 1QSSA 4CIFA 4E19A 4CGIA 4I2PA 3V81A 4CF2A 4FM0A 1BIUA 4OGEA 4N5SA 4O0IA 3LWLA 4CJLA 4M42A 2B6AA 4DFKA 1KLMA 3ZSRA 1Q9XA 3HSTB 5C25A 1GOBA 3SCXA 2GUIA 2XRIA 4HTUA 1K6YA 3IG1A 3MXIA 4DU4A 1KLNA 1KVCA 3OYHA 2FBXA 2WONA 4BWJA 1D9DA 2PZSA 3QLHA 4C8KA 1HQEA 1RILA 4JS5A 4Z4IA 1GOCA 3NF6A 4WE1A 4CEBA 4DQQA 5FRMA 3VQBA 3OYIA 4FZYA 1N5YA 3KK2A 2HHUA 1XWLA 3DLRA 4ZTFA 3NCIA 4Z4HA 3KK1A 4FLZA 2HB5A 4PUOA 3THVA 4W5NA 2YNHA 3C94A 1ZBLA 4M3WA 4K8XA 1RT2A 3RRGA 4E7JA 2P5OA 5KGWA 4OGCA 3HL8A 1CXQA 4M3RA 4RG8A 1VK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J2A A;  4CEE A;  1LAV A;  1ZBH A;  3VQP A;  3AVM A;  1VRT A;  4CJS A;  1TV6 A;  1JLA A;  4B9M A;  2OPP A;  4BAC A;  4FLX A;  1BHL A;  2G8F A;  5KI6 A;  4CFC A;  4Z4E A;  2AJQ A;  4DFM A;  4AHS A;  3HO1 A;  3TWH A;  3SI6 A;  3D0P A;  3QEV A;  3LAM A;  4DQR A;  1CZ9 A;  1C0U A;  2QK9 A;  3HJF A;  1BIS A;  4LY7 A;  1KCF A;  3DYA A;  3EYZ A;  4RW9 A;  4DTO A;  4DMN A;  3SJJ A;  2FC0 A;  4CGD A;  1U47 A;  3VQQ A;  5KRT A;  3HP6 A;  1C1A A;  3PX0 A;  1A5W A;  5CYM A;  3C95 A;  4CIE A;  1LWE A;  4O0J A;  1VSM A;  3HPO A;  3PX4 A;  4ZTJ A;  3NGZ A;  3KTQ A;  4DSJ A;  1NJX A;  4RW7 A;  1L3V A;  4BDY A;  2OA8 A;  2HND A;  3ALY A;  4CHY A;  3AVL A;  4C8L A;  1S6P A;  2YHA A;  3AVA A;  3HPH A;  3NH2 A;  1TAU A;  2HMI A;  1JXE A;  1GOA A;  3V1Q A;  3A2F A;  3QO9 A;  4CGF A;  3V1R A;  1LWF A;  1TKX A;  3AO4 A;  1IKX A;  3HVR A;  4OLA A;  4PY5 A;  4CES A;  1WSH A;  3AVJ A;  5K14 A;  3H08 A;  1WSI A;  4DU1 A;  1YT3 A;  4DTJ A;  3NGI A;  4AIL C;  4N47 A;  3ZT0 A;  3PUF A;  3SNN A;  1FKO A;  1LAW A;  1TGO A;  4EP5 A;  1TL1 A;  4AHT A;  1HNI A;  4ZHR A;  2XY5 A;  1QE1 A;  1JL1 A;  1QHT A;  1RDD A;  2GBZ A;  4ICL A;  3AO3 A;  4IG0 A;  1RDC A;  4CER A;  1C0M A;  1NK6 A;  4B9N A;  4CEQ A;  3O4N A;  2HNY A;  1C1C A;  1VSE A;  3DM2 A;  4BDP A;  4F8R A;  1U4B A;  3TAB A;  4FVM A;  4FJG A;  2F8S A;  4IBN A;  1NK0 A;  4ELT A;  2Z1J A;  3O3F A;  4Y1D A;  3OYM A;  3NE6 A;  4LD0 A;  2ZE2 A;  1HMV A;  1JKH A;  4CED A;  4CF8 A;  3OYL A;  1NK5 A;  4RW4 A;  1MU2 A;  4CFD A;  3MED A;  1TL3 A;  2YNG A;  3NF8 A;  2KFN A;  1KVB A;  5J2N A;  1BCM A;  1ITG A;  3P83 D;  1WSE A;  1KFD A;  4DWI A;  4CGH A;  3DLE A;  5J1E A;  3AA5 X;  1JLQ A;  1ASU A;  5HRR A;  5E41 A;  4CF9 A;  4E1M A;  2XO7 A;  3KD1 E;  3AVI A;  3RRH A;  4FLW A;  3OYF A;  3V9Z A;  4FJL A;  2G8U A;  2KZM A;  2B5J A;  4UQG A;  3PV8 A;  3NHG A;  2KQ2 A;  3ZSW A;  1L5U A;  4FJ7 A;  3F73 A;  3OYC A;  3JSM A;  3L2Q A;  3QEP A;  4JRP A;  4KTQ A;  3QIP A;  1RT3 A;  1RTI A;  4OVL A;  5CYQ A;  3OYN A;  1UA0 A;  3DLK A;  4KTZ A;  2YHB A;  5C42 A;  3EY1 A;  1IKW A;  4H4O A;  3TAF A;  3TI0 A;  4FJ5 A;  4W5Q A;  4J2B A;  3CFR A;  4Z4F A;  4DFP A;  1S9E A;  1S1U A;  1RNH A;  2R7Y A;  3UIQ A;  3DOK A;  3QNO A;  4HCB A;  2Y1I A;  1B92 A;  1ZBF A;  3VQ5 A;  3SPY A;  4NYF A;  1YTU A;  2X6N A;  3RMD A;  5CZ2 A;  1JL2 A;  3T3F A;  5DMR A;  1T7P A;  3AO1 A;  3P5J A;  5HLF A;  3VQ7 A;  1TK0 A;  4FM1 A;  4EP4 A;  2VWJ A;  1RBU A;  5J2P A;  3CG7 A;  1B9D A;  4G1Q A;  1S1V A;  1BQM A;  2X6S A;  4O5B A;  3MEC A;  3CM6 A;  1U45 A;  4BDZ A;  2PY5 A;  3L2U A;  2B4J A;  3KIO A;  3AVK A;  1RT4 A;  3HXM A;  1NK9 A;  3IAY A;  3DRP A;  4LH4 A;  4L8R B;  1WSG A;  3PX6 A;  4KAZ A;  3C6T A;  1SL1 A;  4GMJ B;  4FK2 A;  1J53 A;  1REV A;  1UWB A;  3AVN A;  3AO5 A;  3CM5 A;  3LPU A;  4IG3 A;  4FLT A;  4B9U A;  4E7K A;  2OZS A;  1W0H A;  5HRS A;  4ELV A;  3K5M A;  4NCA A;  1HYS A;  1NJY A;  3SPZ A;  2VG6 A;  3I0S A;  4N56 A;  3RMC A;  1NK8 A;  4RW6 A;  4DQI A;  3LWM A;  3OYJ A;  4B9T A;  1C6V A;  3V9S A;  1RT6 A;  1XI1 A;  2PYJ A;  1S1W A;  4M3X A;  4CJE A;  3OJU A;  5J2M A;  2RN2 A;  3LP0 A;  5I42 A;  1ASW A;  2FBT A;  1J54 A;  3TR8 A;  4KB1 A;  1S6Q A;  2BGG A;  2KZZ A;  4DG1 A;  2VWK A;  2FBY A;  1ASV A;  3K57 A;  4CF0 A;  1Q8I A;  5SWM A;  3HYF A;  2HNZ A;  3VA3 A;  2IC3 A;  3QES A;  3S3M A;  3AVH A;  1TK8 A;  3RR7 A;  2D0B A;  1BQN A;  2OPR A;  4DTX A;  4CJP A;  4KV8 A;  4CJF A;  3QEW A;  1RTD A;  1UAX A;  1T03 A;  3O3G A;  2IGI A;  1VSL A;  3ASM A;  4QCL A;  4KHW A;  3G0Z A;  3WNH A;  4YFU A;  1VSK A;  3M8P A;  1L3T A;  3LZI A;  5FRN A;  3NH1 A;  1JLB A;  3LAN A;  4CE9 A;  4DTR A;  1HNV A;  4J2D A;  3DLB A;  3AA4 A;  1IG9 A;  3O3H A;  4CJK A;  1D8Y A;  5JS1 A;  3KLE A;  1TKZ A;  4CJQ A;  3KK3 A;  4E3S A;  3NDK A;  4Q0B A;  2OPQ A;  3AA2 A;  4LH5 A;  3L3V A;  3DOL A;  2G8K A;  1X9W A;  3PO5 A;  4DQP A;  3DI6 A;  3VQ8 A;  4E1N A;  2A1S A;  3D45 A;  3IRX A;  4CK3 A;  4CCH A;  2HHW A;  2YKM A;  1JLE A;  4KHS A;  4O4G A;  4BE0 A;  3ZT4 A;  4CHO A;  3S3O A;  4BE1 A;  1S9G A;  3ZSO A;  3B6P A;  2YNI A;  4FZX C;  3L2R A;  3M8R A;  3KKR A;  1JLG A;  4I9L A;  1RBT A;  4DLE A;  1ZYQ A;  3O4Q A;  3HVT A;  3RR8 A;  2HHX A;  1T8E A;  3MXM A;  1TKD A;  3LAL A;  3S9H A;  1C0T A;  1I39 A;  4MQ3 A;  1U48 A;  4HVJ A;  3TAM A;  2XY7 A;  3FFI A;  3LP1 A;  3VQA A;  4E7L A;  4NCB A;  3AVF A;  4I2Q A;  1QSL A;  3VQ6 A;  3KKS A;  4CJ3 A;  1TK5 A;  2D0C A;  4M3U A;  2Z1H A;  3JYT A;  2F8T A;  4IFY A;  3WNF A;  3LDS A;  1JLC A;  3V9X A;  3DLH A;  1SKR A;  3F9K A;  1WLJ A;  4C8N A;  4JRQ A;  4DS4 A;  4Z0U A;  4CJU A;  3SQ2 A;  4CJ4 A;  2HHT A;  1DTQ A;  2E6L A;  4FW1 A;  2KW4 A;  4Q5V A;  4H8K A;  3NFA A;  4B8A B;  3HM9 A;  2ITG A;  3U3Y A;  3AVB A;  1A5V A;  1HQU A;  1XHX A;  1S5J A;  4PQU A;  3T19 A;  4IFV A;  1X9M A;  4OLB A;  2DFH A;  3K5L A;  3OVN A;  1F21 A;  2ATQ A;  3QNN A;  4FLU A;  2HVH A;  2RKI A;  3NBP A;  4DTM A;  1N6Q A;  1RBR A;  4ID5 A;  5CZ1 A;  1LW0 A;  4B9L A;  4W5O A;  3RWU A;  3ITH A;  3VQE A;  1WAJ A;  1VSD A;  1NOZ A;  1NKB A;  3QIO A;  3OY9 A;  3KLH A;  3SQ0 A;  1A5X A;  4CEO A;  3SYZ A;  3RTV A;  3K5O A;  1JXB A;  3NF7 A;  3OYG A;  1O1W A;  3MAQ A;  3NF9 A;  4CFA A;  4KRE A;  3HPG A;  4CHZ A;  1SKW A;  1SL2 A;  2G8V A;  3VN5 A;  3S3N A;  2D0A A;  1DLO A;  3ISN C;  4N41 A;  4W5R A;  3BGR A;  3AVC A;  1SV5 A;  2ETJ A;  3MEG A;  3K5N A;  4KFB A;  4J2E A;  4FJX A;  4KHY A;  3C6U A;  4KPY A;  4FJK A;  3QIN A;  5JS2 A;  4M45 A;  3L8B A;  1BI4 A;  2OPS A;  4PWD A;  4LSN A;  1NKC A;  4E7H A;  4K8Z A;  4KI4 A;  4B9V A;  3PY8 A;  1HYV A;  2ZD1 A;  4CJR A;  4BE2 A;  3KLG A;  3RMB A;  2RPI A;  3ZCM A;  4R5P A;  1XHZ A;  4FCY A;  1NKE A;  2XY6 A;  1X9S A;  3AV9 A;  3I8D A;  2BDP A;  3HK2 A;  1NK4 A;  5C24 A;  1JLF A;  2X74 A;  5SZT A;  4FK0 A;  3OS1 A;  3SV4 A;  3TAR A;  2I5J A;  3LP2 A;  1CLQ A;  2IAJ A;  4KHN A;  4DFJ A;  1UA1 A;  4KKO A;  1EET A;  1BIZ A;  5KTQ A;  1ZBU A;  4DU3 A;  3TAE A;  1RDB A;  3E01 A;  4IDK A;  5HP1 A;  3OS0 A;  4F2R A;  4C8M A;  3ZSX A;  4CHN A;  3V6D A;  4H4M A;  1KRP A;  4F4K A;  4BWM A;  4CHP A;  2KFZ A;  4FZZ A;  1YVU A;  4XIU A;  2E6M A;  3AVG A;  5KRS A;  3VQC A;  1TKT A;  4DQS A;  1VSF A;  2O4G A;  1NK7 A;  4DF8 A;  2GV9 A;  3TAQ A;  1Q9Y A;  4CFB A;  2HHQ A;  2X78 A;  4FJI A;  4O55 A;  3ULD A;  2VG7 A;  3MXJ A;  4DSI A;  2BE2 A;  1D9F A;  3QER A;  1RDA A;  4CK2 A;  4TSX A;  5EU7 A;  3CFP A;  3PO4 A;  4FK4 A;  2YNF A;  4M3Y A;  1BGX T;  1S1X A;  1CZB A;  2JGU A;  4PA1 A;  5HBM A;  4AHR A;  3V9W A;  4KRF A;  3T1A A;  2HHV A;  4FJM A;  4QOZ B;  1IKV A;  1RBV A;  3ZT2 A;  3OJS A;  5J2Q A;  2G8I A;  3OYE A;  4KB0 A;  4F3O A;  3K59 A;  3V9U A;  3VQD A;  1RTH A;  2IS3 A;  4OJR A;  3ZSV A;  4CIG A;  3L2W A;  1NJZ A;  4CJ5 A;  4OPK A;  4I7F A;  1IO2 A;  4CJW A;  4DTP A;  1U49 A;  4FJN A;  3DLG A;  1KVA A;  2EX3 A;  4KHQ A;  3OYD A;  4I9Q A;  1Z25 A;  4RW8 A;  1S1T A;  3NH0 A;  3V4I A;  1FK9 A;  3QEI A;  4M3Z A;  3NAE A;  1RT5 A;  3B6O A;  1WSF A;  2O4I A;  4M41 A;  1FKP A;  3OYK A;  4DSF A;  3VQ9 A;  4FLV A;  3I0R A;  1BI4 B;  1HJR A;  3SZ2 A;  4M3T A;  4DLG A;  2QKK A;  4Z4G A;  1R0A A;  1WN7 A;  2PYL A;  4N76 A;  1RBS A;  4HUF A;  4CF1 A;  2P5G A;  1BL3 A;  3L2V A;  3KD5 E;  2HVI A;  4IKF A;  1EX4 A;  4GVM A;  4CJT A;  2Z1G A;  2KTQ A;  4CEF A;  2DTU A;  1U04 A;  4ID1 A;  3KLF A;  5D3G A;  4AHC A;  1J9A A;  1EP4 A;  3RMA A;  1SKS A;  2P51 A;  3SUN A;  2DFE A;  2NUB A;  1HRH A;  1Y97 A;  4DTN A;  1RT7 A;  4CEA A;  3NGY A;  4JLH A;  1EKE A;  2E4L A;  1Z26 A;  2OZM A;  2D5R A;  3OYB A;  3SUQ A;  3KLI A;  5KGX A;  4DTU A;  3TAG A;  4AHU A;  5T7B A;  3DRS A;  4HCC A;  1EXQ A;  1NOY A;  4KO0 A;  3G10 A;  2DY4 A;  3LPT A;  4OKJ A;  3M8S A;  3CFO A;  4OKK A;  4E89 A;  4HHT A;  1SL0 A;  1L3S A;  3ZSQ A;  5FRO A;  4OKE A;  4FXD A;  1LWC A;  4W5T A;  4NCG A;  4EZ9 A;  1BCO A;  1B9F A;  3TAN A;  3U3G A;  3EZ5 A;  2QKB A;  2YKN A;  2JLE A;  3M8Q A;  3OS2 A;  2G8H A;  1QS4 A;  3ZSZ A;  4DS5 A;  3SUP A;  1VSI A;  4DSL A;  4CGG A;  4KI6 A;  1TAQ A;  4NYN A;  1HYZ A;  1J5O A;  4KHU A;  1TVR A;  1FXX A;  1G15 A;  4MFB A;  3DMJ A;  1IH7 A;  1VSH A;  4QAG A;  1D5A A;  1DTT A;  4CJV A;  1T05 A;  1QSY A;  4CHQ A;  3MEE A;  2P1J A;  3KJV A;  2BAN A;  2EHG A;  1WNS A;  3LP3 A;  4Y1C A;  3OYA A;  3WNE A;  4CGJ A;  4DSK A;  2XY8 A;  1YTA A;  4B8C A;  1QQC A;  2WOM A;  1RTJ A;  4DTS A;  3QEX A;  2XHB A;  3SV3 A;  4GW6 A;  4JS4 A;  1XC9 A;  3AA3 A;  4CEC A;  1SUQ A;  4DSE A;  1IKY A;  2DFF A;  2ZQB A;  2RF2 A;  3LZJ A;  3LAK A;  3VQ4 A;  3ZSY A;  3SUO A;  4E0D A;  3DRR A;  2HHS A;  2Q3S A;  3WNG A;  2A1R A;  1ZBI A;  5CY4 A;  3AO2 A;  1HPZ A;  1C1B A;  1X1P A;  1LW2 A;  3L3U A;  2LSN A;  3ZT3 A;  4AH9 A;  4OPJ A;  3HT3 A;  3V1O A;  2F96 A;  4DF4 A;  4EZ6 A;  4FJ9 A;  4B3O A;  3SQ1 A;  2IDO A;  4LSL A;  4YNQ A;  1VSJ A;  4CK1 A;  4C8O A;  3HP9 A;  4FLY A;  1WSJ A;  3CYM A;  4AHV A;  4E7I A;  2G8W A;  3QET A;  1LV5 A;  4KTW A;  4O44 A;  5FDL A;  4HUE A;  4F3T A;  2W42 A;  2Z1I A;  4Z4C A;  2VG5 A;  2HW3 A;  4FJ8 A;  3CQ8 A;  2YV0 X;  2OYQ A;  4FYD A;  3P1G A;  2QXF A;  1KFS A;  4B08 A;  1NJW A;  4FJJ A;  4HUG A;  3K58 A;  3ZT1 A;  3U6F A;  3BDP A;  5HRN A;  3VA0 A;  4B9S A;  4ELU A;  1KSP A;  4F2S A;  1W9H A;  1KTQ A;  3SQ4 A;  1UOC A;  2IOC A;  5HRP A;  4FM2 A;  5HRO A;  1I3A A;  3TAP A;  5I3U A;  1QTM A;  1CXU A;  3K2P A;  4FW2 A;  4FJH A;  2Y1J A;  1RT1 A;  1WAF A;  5DK5 A;  1RCH A;  3IS9 A;  1L3U A;  1VRU A;  4CEZ A;  2FBV A;  1QSS A;  4CIF A;  4E19 A;  4CGI A;  4I2P A;  3V81 A;  4CF2 A;  4FM0 A;  1BIU A;  4OGE A;  4N5S A;  4O0I A;  3LWL A;  4CJL A;  4M42 A;  2B6A A;  4DFK A;  1KLM A;  3ZSR A;  1Q9X A;  3HST B;  5C25 A;  1GOB A;  3SCX A;  2GUI A;  2XRI A;  4HTU A;  1K6Y A;  3IG1 A;  3MXI A;  4DU4 A;  1KLN A;  1KVC A;  3OYH A;  2FBX A;  2WON A;  4BWJ A;  1D9D A;  2PZS A;  3QLH A;  4C8K A;  1HQE A;  1RIL A;  4JS5 A;  4Z4I A;  1GOC A;  3NF6 A;  4WE1 A;  4CEB A;  4DQQ A;  5FRM A;  3VQB A;  3OYI A;  4FZY A;  1N5Y A;  3KK2 A;  2HHU A;  1XWL A;  3DLR A;  4ZTF A;  3NCI A;  4Z4H A;  3KK1 A;  4FLZ A;  2HB5 A;  4PUO A;  3THV A;  4W5N A;  2YNH A;  3C94 A;  1ZBL A;  4M3W A;  4K8X A;  1RT2 A;  3RRG A;  4E7J A;  2P5O A;  5KGW A;  4OGC A;  3HL8 A;  1CXQ A;  4M3R A;  4RG8 A;  1VK0 A; 
#chains in the Genus database with same CATH topology
 4CEE A;  4DV6 K;  3VQP A;  4A57 A;  3CCS N;  1JLA A;  1NGA A;  2OPP A;  5AQF A;  1BDG A;  3SMP A;  5KI6 A;  4CFC A;  3LDP A;  3M5R A;  2AJQ A;  3TWH A;  4BR0 A;  3CMA N;  2V51 B;  4LY7 A;  1KCF A;  3DYA A;  4FWP A;  4DR6 K;  2VYP A;  4CZJ A;  3U8X A;  3VQQ A;  3EEQ A;  3C95 A;  4CIE A;  1LWE A;  4O0J A;  1VSM A;  3PX4 A;  2OA8 A;  4BDY A;  3AVL A;  1DKG D;  3AVA A;  1GOA A;  3LDQ A;  3QO9 A;  4MDB A;  3PIP L;  1LWF A;  1JJ2 M;  3R9P A;  3WUH A;  1YT3 A;  4DTJ A;  4XH1 A;  5F1X A;  2D4W A;  4YDU A;  4RWT A;  2GWK A;  1FKO A;  4PKG A;  1TGO A;  3VMF B;  1HNI A;  3IKM A;  3O9S A;  4ZHR A;  4DV4 K;  3AO3 A;  1RDC A;  4B9N A;  4DV2 K;  1NGE A;  1C1C A;  1VSE A;  1U4B A;  4FJG A;  4FVM A;  4OPH A;  1NK0 A;  2YJF A;  5AQO A;  3OYM A;  1YF5 L;  3CC7 N;  4LD0 A;  4CED A;  3MED A;  3IUC A;  1WSE A;  1KFD A;  2P9L B;  3NVM A;  4PL7 A;  3AA5 X;  1JLQ A;  4JKG A;  1ASU A;  3AVI A;  3OYF A;  2G8U A;  3JSM A;  4KTQ A;  4JRP A;  3QIP A;  3OYN A;  4CZM A;  3THY B;  4WQ4 A;  1IKW A;  3CHW A;  4H4O A;  3QB0 A;  3H46 O;  4ILJ A;  4Z4F A;  4DFP A;  1H1V A;  3UIQ A;  3MWP A;  3VGL A;  3SPY A;  4NYF A;  2X6N A;  2A3Z A;  5CZ2 A;  3P5J A;  1TK0 A;  4JAX A;  4EP4 A;  2A5X A;  5J2P A;  2O8D B;  2X6S A;  4O5B A;  3BZK A;  4BDZ A;  4X66 K;  3L2U A;  5BPM A;  1Q18 A;  1NK9 A;  2V7Z A;  2Q36 A;  3ATV A;  3AVK A;  4BRF A;  3DRP A;  3IAY A;  4JEP A;  5KPR A;  2FLO A;  3LPU A;  2ZF5 O;  4E7K A;  5HRS A;  3K5M A;  1SAZ A;  5EX5 A;  4H5N A;  3RMC A;  1WBD A;  3CC2 N;  4DQI A;  3V9S A;  2PYJ A;  1XI1 A;  1J6Z A;  4A61 A;  5C2F A;  1YJW N;  2FBT A;  1S6Q A;  2VWK A;  3K57 A;  4DCH A;  2HNZ A;  2D0B A;  2CGJ A;  4J8F A;  5AZJ B;  5DM6 L;  3QEW A;  5ADX H;  5BRH A;  2YHY A;  1RTD A;  4BGA A;  4DUZ K;  2PFU A;  4BRM A;  3LZI A;  3LAN A;  4JI4 K;  4CE9 A;  4J2D A;  4H0Y B;  4WQ5 C;  3AA4 A;  3O3H A;  4CJK A;  1D8Y A;  2Q0U A;  5AQK A;  3KLE A;  1TKZ A;  4Q0B A;  4BC3 A;  3AA2 A;  4H0T B;  3W0L A;  4DQP A;  3DI6 A;  3VQ8 A;  4E1N A;  4CCH A;  3KZB A;  1JLE A;  1XQS C;  3MWT A;  4X64 K;  4KHS A;  4CHO A;  1S9G A;  2A41 A;  4JKH A;  3L2R A;  1NMN A;  3KKR A;  1JLG A;  4FWO A;  1RBT A;  4DLE A;  5GIO A;  3W3D A;  3MXM A;  3PSI A;  4BC2 A;  4DKW A;  3J81 O;  3VGK A;  2NZT A;  3LP1 A;  5HOO A;  3AVF A;  4I2Q A;  1QSL A;  1T6C A;  4CJ3 A;  4OO1 J;  3HTV A;  2Z1H A;  4BRL A;  2F8T A;  3WNF A;  3F9K A;  4C8N A;  4PKI A;  4CJU A;  2HHT A;  2HBK A;  3TTC A;  2E6L A;  3BZC A;  4FW1 A;  3T7Z A;  2KW4 A;  3I56 N;  2F4V K;  4DV0 K;  3ZX2 A;  4B8A B;  2QI2 A;  4A5A A;  1HQU A;  2O8B B;  1XHX A;  4PQU A;  2UXD K;  1X9M A;  3K5L A;  3OVN A;  4B9L A;  3VQE A;  1WAJ A;  1VSD A;  1NOZ A;  2W41 A;  2HST A;  2HF3 A;  4YOV A;  2O8C B;  1R59 O;  1A5X A;  1BO5 O;  3NF7 A;  1O1W A;  1M1K O;  3VER A;  4CFA A;  1SKW A;  2G8V A;  3VN5 A;  1ZXO A;  1DLO A;  2P9U B;  1TYQ A;  3AVC A;  1SV5 A;  4KHY A;  3C6U A;  4FJK A;  3QIN A;  5JS2 A;  3D2F B;  4KI4 A;  4CJR A;  3U9Z A;  3A5M C;  1X9S A;  2YCH A;  3I8D A;  3O9U A;  3D2E A;  1NK4 A;  2X74 A;  4KH5 A;  4FK0 A;  3T1H K;  2IAJ A;  3FZF A;  3MN7 A;  3L6Q A;  3A5N C;  3ZSX A;  4H4M A;  4LFA K;  3VET A;  2KFZ A;  1BU6 O;  3WXI A;  1TYQ B;  1RFQ A;  1NK7 A;  1Q9Y A;  4FWK A;  2X78 A;  3O08 A;  4FJI A;  4O55 A;  3MXJ A;  1P90 A;  2BE2 A;  5AQW A;  3FZH A;  1BGX T;  1S1X A;  3P39 A;  4AHR A;  4DR7 K;  4KRF A;  4FJM A;  3ZT2 A;  5J2Q A;  3WXM B;  3UKU A;  3V9U A;  2IS3 A;  4OJR A;  4FWM A;  1NWK A;  1IO2 A;  4CJW A;  1U49 A;  4FJN A;  1VQ4 N;  3DLG A;  2ZJP L;  4MLE A;  2GUP A;  2ASO A;  3QEI A;  3NAE A;  4M41 A;  1FKP A;  1LOT B;  4M3T A;  1NNE A;  4DLG A;  4H5T A;  1X9J A;  4Z4G A;  4EAH D;  2QWN A;  2KHO A;  3L2V A;  3KD5 E;  1HLU A;  2Z1G A;  4B3S K;  1NGG A;  4ID1 A;  3WEE B;  5D3G A;  1J9A A;  3RMA A;  3R8E A;  1VQ7 N;  4IO9 L;  2CH6 A;  1K8K B;  1GLC G;  3DWL A;  4JLH A;  1EKE A;  2OZM A;  1GLL O;  1HX1 A;  4M7Y A;  4IJN A;  4B3R K;  2ZJR L;  3CFO A;  2O8F A;  4FXD A;  4CW7 B;  4NCG A;  4BVO A;  2OTJ N;  1BCO A;  1KXP A;  4CVN E;  3U3G A;  2QKB A;  3U9D A;  4CD3 A;  3SUP A;  2P9I B;  4CGG A;  1HYZ A;  2GEM A;  5BR8 K;  4CJV A;  3CJ1 A;  1QSY A;  4CHQ A;  3ZYY X;  3KJV A;  3TTD A;  2E2P A;  3OYA A;  4B1W B;  1YTA A;  2F7T A;  4XH4 A;  2XHB A;  3SV3 A;  4GW6 A;  3CC4 N;  4JS4 A;  4IZ9 A;  1SUQ A;  4DSE A;  4JN4 A;  1IKY A;  2ZQB A;  3DRR A;  2Q3S A;  5KQ8 A;  2H3G X;  4IEI A;  1ZC6 A;  1LW2 A;  1VQL N;  4YOT A;  3ZT3 A;  3FFK B;  4EZ6 A;  4WFB L;  2IDO A;  5GIP A;  1C0F A;  4C8O A;  2I7N A;  4E7I A;  3CYM A;  4M3X A;  4KTW A;  4O44 A;  2PAV A;  2VG5 A;  4FJ8 A;  4EHU A;  3CQ8 A;  1V4S A;  4FJJ A;  2Q31 A;  4JI1 K;  3U6F A;  4GKJ K;  1UOC A;  4FM2 A;  3TAP A;  1CXU A;  4FJH A;  5DK5 A;  1BG3 A;  3QBX A;  5FPN A;  2GEL A;  1J5E K;  4E19 A;  3CCM N;  3N4Q A;  2FSJ A;  4O0I A;  2B6A A;  2GUI A;  1W7A A;  2ZGZ A;  3IG1 A;  1S22 A;  2CGL A;  4DV1 K;  4JS5 A;  4Z4I A;  2O8F B;  1GOC A;  1QQO A;  3DXM B;  2QA4 N;  1QZ5 A;  1NJI O;  4LF5 K;  2P5O A;  4OGC A;  5C2D A;  3M3Z A;  1CXQ A;  3CPW M;  3K9K A;  2CH5 A;  4EHT A;  2A6A A;  3AVM A;  1TV6 A;  4B9M A;  4JKC A;  5GAH P;  3M1F A;  3E66 A;  1QQN A;  4Z4E A;  1SZ2 A;  4DFM A;  4AHS A;  4O5F A;  3SI6 A;  4GVE A;  1S72 N;  3D0P A;  1CZ9 A;  4O8U A;  1BOT O;  1BIS A;  3CCU N;  3EYZ A;  4EFH A;  3TTF A;  5KRT A;  3TSU A;  1A5W A;  4HTL A;  3KWI A;  1KD1 O;  1IBK K;  4GNI A;  3SK3 A;  3O1W A;  5E84 A;  2YJE A;  3JS6 A;  3NGZ A;  4RW7 A;  4GV3 A;  3AY9 A;  4A59 A;  4YOW A;  2HMI A;  3A2F A;  3P38 A;  1WSH A;  5AR0 A;  4CZI A;  4CZH A;  1WSI A;  1NM1 A;  3ZT0 A;  3PUF A;  3OW2 M;  1DT9 A;  4A2A A;  1HJO A;  2WTU A;  3CCV N;  4BRG A;  2GBZ A;  4IG0 A;  2IVN A;  2GTD A;  4A2B A;  4AM7 A;  2F8S A;  4IBN A;  5GAE P;  3VEV A;  2ZE2 A;  3IFR A;  1NK5 A;  2UUB K;  3TSP A;  2FSN A;  3UKR A;  4CFD A;  2HBM A;  4U67 L;  2YNG A;  3NF8 A;  2KFN A;  2DPN A;  3D7E O;  4CGH A;  5HRR A;  5AQX A;  5E41 A;  4JHD B;  4E1M A;  3I55 N;  1VQO N;  2P9K B;  4BRN A;  3PV8 A;  1XUP O;  1L5U A;  1T44 A;  3L2Q A;  4OVL A;  3DLK A;  3CXC M;  2YHB A;  5BRE A;  4W5Q A;  4J2B A;  1S9E A;  4KH6 A;  1RNH A;  2R7Y A;  4CJ7 A;  3JAM O;  3VGM A;  3QNO A;  3SAH A;  1VAZ A;  1T7P A;  4GV9 A;  3GOI A;  5HLF A;  5M1O A;  4FM1 A;  5C12 A;  1RBU A;  2UYT A;  3CG7 A;  4FJX A;  1BQM A;  3CM6 A;  5GAG P;  3LM9 A;  4BG8 A;  4KHP K;  1HNZ K;  4NLB A;  1RT4 A;  1NGD A;  1WSG A;  1YXQ A;  1SL1 A;  1UWB A;  4NB4 A;  3AO5 A;  4LFB K;  4FLT A;  5JLH A;  4NCA A;  3ZET A;  2A40 A;  2WFB A;  3CCR N;  5ELZ A;  4N56 A;  1NK8 A;  5AQU A;  3LWM A;  3OYJ A;  1C6V A;  1ESV A;  1RT6 A;  4CJE A;  5J2M A;  2KZZ A;  3F9M A;  4CZF A;  2FBY A;  3DJC A;  5BPN A;  3FGU A;  4K0K K;  3RR7 A;  2IC3 A;  2VCP A;  4FWS A;  1EO1 A;  5KPT A;  1UAX A;  1T03 A;  3O3G A;  1VSK A;  3E9P A;  3M8P A;  3KHY A;  3AAQ A;  1JLB A;  4K43 A;  4H0P A;  4DTR A;  3SBG A;  1HNV A;  3DLB A;  3O9Q A;  1IG9 A;  4YDU C;  3ZX0 A;  3KK3 A;  4E3S A;  1K8A O;  4LH5 A;  4F9O A;  3DOL A;  1YIJ N;  1X9W A;  3BF3 A;  2A1S A;  3D45 A;  3IRX A;  1VQ8 N;  3R1X A;  4FOE A;  3CF5 L;  5JVG L;  1Q86 O;  1GLB G;  5AQG A;  3HVT A;  5LY3 A;  1Q7Y O;  4MQ3 A;  4FOI A;  1E4G T;  1U48 A;  3FFI A;  1OH8 A;  4NCB A;  3THX B;  3KKS A;  1XNR K;  1OVQ A;  2Q2R A;  5AQY A;  1VQ5 N;  1KC8 O;  3H3O B;  3N4P A;  3V9X A;  1JLC A;  2Q1N A;  4JRQ A;  1IBL K;  3SQ2 A;  4CJ4 A;  5M1N A;  4BY9 C;  3GDQ A;  4H8K A;  3HM9 A;  3QML A;  3AVB A;  1A5V A;  2NNW A;  5EOY A;  1S5J A;  3P31 A;  3THX A;  4IFV A;  5EVZ A;  4OLB A;  5C10 A;  1QQM A;  3WXL A;  4DTM A;  1N6Q A;  2VWB A;  1RBR A;  4A62 A;  4PHT X;  5DM7 L;  4W5O A;  5AQM A;  1NKB A;  1TUY A;  3VF4 A;  3CQY A;  2D0O A;  3OY9 A;  3C0B A;  4CEO A;  3RTV A;  1JXB A;  3DAW A;  2P9I A;  3J8A A;  4FWR A;  3EE8 A;  3NF9 A;  4LF4 K;  4KRE A;  3FZK A;  4CHZ A;  2VQF K;  3K0S A;  3VPZ A;  3S3N A;  2D0A A;  4N41 A;  4W5R A;  1Q81 O;  2OCE A;  3MEG A;  4FPB A;  4KPY A;  1BI4 A;  4DB3 A;  4B9V A;  2ZD1 A;  4JHD A;  3IMX A;  2O8E A;  3ZCM A;  3THY A;  3KK7 A;  1XHZ A;  1NKE A;  1Z6R A;  2BDP A;  3HK2 A;  3C6H A;  3E9O A;  3G4S N;  4M7X A;  2P9P A;  3F5T A;  5SZT A;  3NVK A;  2I5J A;  3LP2 A;  4DFJ A;  1UA1 A;  4KKO A;  1EET A;  1ZBU A;  4DU3 A;  1VQN N;  1RDB A;  5C0Y A;  1YHQ N;  2GWJ A;  4F4K A;  1KRP A;  4CHP A;  4FZZ A;  1EWQ A;  2E6M A;  3AVG A;  3EKS A;  1GLD G;  4DQS A;  1VSF A;  3F2K A;  4DF8 A;  2GV9 A;  4CFB A;  4JI7 K;  2UUA K;  2VG7 A;  4MO5 A;  3BF1 A;  4CK2 A;  4U7B A;  5HBM A;  3O5B A;  3T1A A;  2QTD A;  4QOZ B;  4IJA A;  3HOT A;  3ID8 A;  1QVG M;  4F3O A;  3K59 A;  3VQD A;  5IT9 O;  5TKW A;  4CIG A;  3OTO K;  4OPK A;  2ZM6 K;  5C15 A;  3QIC A;  4NXM K;  1Z25 A;  4RW8 A;  1FK9 A;  1RT5 A;  5GIN A;  3VQ9 A;  4FLV A;  2QW9 A;  1R0A A;  5M1Q A;  1RBS A;  4IKF A;  4CJT A;  4BQZ A;  1CZA N;  3DXK B;  4XEI A;  4AHC A;  1EP4 A;  2P51 A;  4DTN A;  1MA9 B;  4MDA A;  4H5W A;  1LCU A;  3P4I A;  3SUQ A;  3H45 C;  5T7B A;  4HCC A;  1EXQ A;  1NOY A;  4KO0 A;  4HHT A;  4E89 A;  2FXU A;  3ZSQ A;  4W5T A;  4IOX A;  5BRD A;  3EZ5 A;  4OX9 K;  4CZG A;  3OS2 A;  1QS4 A;  3CJB A;  4UY8 O;  2NLX A;  4BR7 A;  1HPM A;  4KHU A;  1FXX A;  2ASP A;  2FF6 A;  4MFB A;  1IH7 A;  4QAG A;  5AZI B;  1DTT A;  4YOY A;  1VHX A;  2P1J A;  2EHG A;  2HBL A;  4IDH A;  4DSK A;  4YHH K;  1QQC A;  3L4I A;  3KVG A;  5EY4 A;  1IJJ A;  1XC9 A;  3AA3 A;  4CEC A;  2RF2 A;  4E0D A;  3LAK A;  3VQ4 A;  1VQ9 N;  1T6D A;  2HHS A;  1HPZ A;  3L3U A;  1X1P A;  4AH9 A;  4OPJ A;  4IXC A;  5IWA K;  4B3O A;  3RVC A;  4LSL A;  4DR3 K;  3LM2 A;  4JI0 K;  2J4R A;  1HKB A;  3EN9 A;  3ZEU B;  4B1U B;  3MN9 A;  3ENO A;  2GX9 A;  2O8D A;  1K9M O;  5KPZ A;  3P1G A;  2QWO A;  3WXJ A;  1NMD A;  3K58 A;  3WT0 A;  3VA0 A;  4PKH A;  3KWG A;  1W9H A;  1KTQ A;  1I3A A;  5I3U A;  5AQI A;  3K2P A;  1K8K A;  2P9K A;  4BRP A;  1NGH A;  3CCL N;  2F9W A;  1WAF A;  1IV0 A;  4JKG B;  3IS9 A;  3WQU A;  1L3U A;  2FBV A;  2QXL A;  3SBT A;  3V81 A;  3I33 A;  1T3V A;  3EO3 A;  3LWL A;  4CJL A;  4M42 A;  4JI5 K;  4B3M K;  4DFK A;  1KLM A;  3ZSR A;  4B1Y B;  3SCX A;  4DU4 A;  4ILH A;  3LDN A;  2FBX A;  2WON A;  4BWJ A;  3QLH A;  1HQE A;  3ZET B;  1ILY A;  1P8Z A;  2NRH A;  3VQB A;  3SAF A;  3OYI A;  1N5Y A;  4FZY A;  1I94 K;  3KK2 A;  1XWL A;  4RTF D;  3NCI A;  3SJH A;  4W5N A;  3C94 A;  1ZBL A;  4K8X A;  1RT2 A;  5KGW A;  3HL8 A;  3EL2 A;  4BRH A;  4JD2 A;  3G25 A;  4J2A A;  1E3M A;  4BAC A;  4FLX A;  5CR4 A;  2QWM A;  2ITM A;  2G8F A;  3HO1 A;  3QEV A;  4DQR A;  4BRD A;  4JI2 K;  3HJF A;  2IIR A;  2RE2 A;  4DTO A;  3H1Q A;  3SJJ A;  2FC0 A;  4CGD A;  3Q7B A;  4Y0W A;  3THW B;  3HP6 A;  3VEN A;  3PX0 A;  3BY5 A;  3DXK A;  4XH5 A;  2PBD A;  3KTQ A;  3HPO A;  4DSJ A;  1NJX A;  1L3V A;  3J7Y P;  3EZW A;  2HND A;  3ALY A;  5AQT A;  4CHY A;  2YHA A;  3NH2 A;  1TAU A;  1MWK A;  3HVR A;  4OLA A;  3AO4 A;  4NLC A;  4PY5 A;  3AVJ A;  3GL1 A;  3H08 A;  4WF9 L;  1W2B M;  2KLA A;  4N47 A;  4YOU A;  2P9U A;  4KH4 A;  4C1N K;  4QS8 A;  4ILG B;  4BR4 A;  3CI5 A;  4AHT A;  4AM6 A;  2XY5 A;  1QE1 A;  1JL1 A;  1RDD A;  4ICL A;  4CER A;  1NK6 A;  3HOS A;  3O4N A;  2BUP A;  2HNY A;  3PSF A;  4JI6 K;  2QWP A;  4BDP A;  2O8C A;  3TAB A;  4ELT A;  1RDW X;  2Z1J A;  3O3F A;  3NE6 A;  2VGN A;  4E1J A;  4JK7 A;  4CF8 A;  2E1Z A;  2HBJ A;  4K25 A;  4MLH A;  3L4Q A;  1TL3 A;  1KVB A;  5J2N A;  1ITG A;  3P83 D;  1YUW A;  5J1E A;  1Q82 O;  3RRH A;  3V9Z A;  4FJL A;  4UQG A;  3NHG A;  3UE5 A;  3F73 A;  2O8B A;  3OYC A;  4JKD A;  1RT3 A;  3CQX A;  1UA0 A;  3EY1 A;  5C42 A;  3TAF A;  1NGC A;  4M63 C;  3CFR A;  2E5L K;  1S1U A;  4LF8 K;  3DOK A;  3UKU B;  1B92 A;  1G99 A;  1JL2 A;  5DMR A;  3AO1 A;  4JD2 B;  4BGB A;  5HL7 L;  4LC9 B;  1B9D A;  1S1V A;  2PY5 A;  3ULE A;  2YHX A;  3KIO A;  4B9Q A;  4KAZ A;  4H0O A;  3PX6 A;  4FK2 A;  4GMJ B;  3CM5 A;  4IG3 A;  5LMN K;  2OZS A;  4ELV A;  1XNQ K;  1HYS A;  1NJY A;  3SPZ A;  3I0S A;  4BRK A;  2BH1 A;  4B9T A;  2IVO A;  1HKC A;  5LMU K;  2RN2 A;  3LP0 A;  1ASW A;  2BGG A;  4DV5 K;  4DG1 A;  4CF0 A;  5SWM A;  4G9Z A;  3S3M A;  3A0I X;  3CD6 N;  2NRV A;  3AVH A;  1TK8 A;  4DTX A;  4CJP A;  2NRW A;  1D4X A;  2IGI A;  4QCL A;  3WNH A;  4YFU A;  3ULE B;  5I9E B;  1L3T A;  5FRN A;  3VOV A;  3MDQ A;  4H5R A;  1WUA A;  4CJQ A;  1XMQ K;  3NDK A;  2OPQ A;  5BR9 A;  4WQ5 A;  3PO5 A;  3CCJ N;  4L3Q A;  4O4G A;  4BE1 A;  5TKY A;  4K42 A;  3ZSO A;  2YNI A;  4FZX C;  4I9L A;  1ZYQ A;  4JK9 A;  3WXK A;  2HHX A;  1T8E A;  1U2V A;  1JCE A;  4HVJ A;  2XY7 A;  2UXB K;  4JKE A;  3VQ6 A;  3A8Y A;  5JMV A;  1TK5 A;  1OKJ A;  2BTF A;  2D0C A;  2QWR A;  4M3U A;  3JYT A;  3DLH A;  1WLJ A;  1DEJ A;  1DTQ A;  1S3X A;  1Z05 A;  3U3Y A;  2ITG A;  3C6A A;  5AQH A;  4BR2 A;  2DFH A;  2ATQ A;  3QNN A;  4FLU A;  1OH6 A;  1BWF O;  5CZ1 A;  1LW0 A;  1N34 K;  3ITH A;  3HZ6 A;  3QIO A;  5LJV A;  3KLH A;  3SYZ A;  2CGK A;  3OYG A;  3A5L C;  1O13 A;  1VQM N;  2QWQ A;  2E2Q A;  3HPG A;  1C0G A;  3EE9 A;  1JCF A;  2NRT A;  3O4W A;  3S41 A;  3K5N A;  4J2E A;  4KFB A;  4M45 A;  3L8B A;  4NO7 A;  2OPS A;  4LSN A;  4DQ8 A;  4K8Z A;  3PY8 A;  4BE2 A;  3KLG A;  2RPI A;  1YVN A;  3AV9 A;  5LL6 Z;  5AZJ A;  3OBW A;  5MLC Q;  5C24 A;  1KAX A;  5AQQ A;  3OS1 A;  4H03 B;  3PLA A;  3R3L A;  3CIP A;  5KTQ A;  4IWV A;  3E01 A;  4IDK A;  5HP1 A;  3OS0 A;  3HM8 A;  1YIT N;  3VEY A;  4K41 A;  3VEZ A;  1KAY A;  1YVU A;  4XIU A;  3NMU A;  3DLL L;  1QVF M;  3VQC A;  1TKT A;  4LF7 K;  2O4G A;  4X65 K;  1D9F A;  1RDA A;  1HUX A;  3CFP A;  3PO4 A;  4M3Y A;  2JGU A;  3V9W A;  2WBN A;  3QBW A;  3ATU A;  1RBV A;  3OJS A;  2G8I A;  4KB0 A;  5F2R A;  5A2Q O;  4DR2 K;  4CJ5 A;  4I7F A;  4WYB A;  4DTP A;  2VGM A;  3HBT A;  1IBM K;  1KVA A;  3C7N A;  3OYD A;  3PIO L;  4IOA L;  1BUP A;  3B8A X;  2VQE K;  1S1T A;  3NH0 A;  3OBY A;  3V4I A;  3B6O A;  1WSF A;  5M1K A;  3OYK A;  4CZK A;  3I0R A;  1BI4 B;  1HJR A;  2YI1 A;  3VEO A;  3U4L A;  2PYL A;  1WN7 A;  1ATR A;  3T1Y K;  4Z94 A;  4HUF A;  1FW6 A;  5AQZ A;  4FL9 A;  1BL3 A;  2NRR A;  4QS7 A;  5AQS A;  1EX4 A;  4GVM A;  4YY3 K;  2DTU A;  1U04 A;  3KLF A;  4JI3 K;  3CJA A;  4FO0 A;  4CBU A;  1SKS A;  1HRH A;  1Y97 A;  1RT7 A;  4CEA A;  2FF3 B;  5BN9 A;  2D5R A;  4B1Z A;  5GAD P;  3MMV A;  5KGX A;  4DTU A;  3TAG A;  1N33 K;  4JV5 K;  3DRS A;  3G10 A;  3HRG A;  3LPT A;  2DY4 A;  5FRO A;  2E1Y A;  3AGK A;  4OKE A;  4I6M B;  1LWC A;  3LL3 A;  1YI2 N;  1HKG A;  1B9F A;  4AF1 A;  4LF6 K;  4ISG A;  2JLE A;  3M8Q A;  4JKF A;  4C1N I;  3ZSZ A;  4DS5 A;  1VSI A;  4DSL A;  2E2N A;  4KI6 A;  1TAQ A;  4NYN A;  5JVH L;  1U6Z A;  3VF2 A;  1TVR A;  3DMJ A;  1VSH A;  1D5A A;  1Y64 A;  1T05 A;  4JI8 K;  3MEE A;  5JLF A;  3LDL A;  5EXW A;  4CGJ A;  3ID6 A;  5AQJ A;  2WOM A;  1RTJ A;  2P9S B;  2P9L A;  3ZSY A;  3WNG A;  4DV7 K;  5CY4 A;  2LSN A;  3V1O A;  2F96 A;  3MN6 A;  4GV6 A;  2E2O A;  1NU0 A;  4CK1 A;  3GBT A;  3QET A;  1LV5 A;  3VTI A;  2D1K A;  2RHK A;  2AP1 A;  2W42 A;  2Z1I A;  4KBO A;  1KAZ A;  5CE3 A;  3GG4 A;  4FYD A;  2UUC K;  2QXF A;  1KFS A;  3CCE N;  1NJW A;  1OH5 A;  5HRN A;  4B9S A;  3DXM A;  1KSP A;  4ISF A;  2IOC A;  5HRP A;  1QTM A;  3MCP A;  2FSK A;  3CET A;  1NLV A;  1VQ6 N;  1RT1 A;  2HHH K;  1VRU A;  5BRF A;  4C23 A;  1QSS A;  4CF2 A;  1BIU A;  1NG9 A;  1VQK N;  1ATS A;  5M1P A;  1Q9X A;  3HST B;  3HI0 A;  2D0P A;  2XRI A;  4FPA A;  1K6Y A;  3MXI A;  3CJC A;  4PL8 A;  1D9D A;  2ZJQ L;  1MWM A;  1YJ9 N;  4BRO A;  4WE1 A;  3NF6 A;  4CEB A;  4DQQ A;  5FRM A;  3JXU A;  2HHU A;  1ZBS A;  4ZTF A;  4BC5 A;  4PUO A;  4FLZ A;  3KK1 A;  3THV A;  2YNH A;  1QZ6 A;  3ZLJ A;  5FPD A;  1ZBH A;  1LAV A;  1VRT A;  4CJS A;  3Q7C A;  4R79 A;  1BHL A;  1SS6 A;  3FR0 A;  2P9N B;  4CBX A;  3LAM A;  1OH7 A;  1C0U A;  3CER A;  2QK9 A;  4WFN L;  4V19 S;  1W97 L;  3TSQ A;  4RW9 A;  4DV3 K;  4DMN A;  1U47 A;  2ASM A;  1JCG A;  1C1A A;  5CYM A;  1GLF O;  2ZWH A;  4ZTJ A;  4LF9 K;  4C8L A;  1S6P A;  3UKR B;  2ZGY A;  4CI6 A;  3HPH A;  4JKB A;  1JXE A;  3V1Q A;  4CGF A;  3V1R A;  1TKX A;  1IKX A;  3D2E B;  4CES A;  4BQL A;  3MX5 A;  5K14 A;  4DU1 A;  3H6E A;  3NGI A;  4AIL C;  3TU5 A;  3SNN A;  4FWQ A;  1LAW A;  5AFU A;  4EP5 A;  1OVY A;  1TL1 A;  2QWL A;  4CEZ A;  1QHT A;  2XY6 A;  4JYA K;  1C0M A;  4CEQ A;  2JWL A;  4DR1 K;  1EWR A;  4F8R A;  3DM2 A;  2NRZ A;  3CME N;  4Y1D A;  5E26 A;  1GLA G;  1HMV A;  1JKH A;  3SLC A;  3OYL A;  4RW4 A;  1MU2 A;  3D6R A;  3K9J A;  1BCM A;  4DWI A;  1EQY A;  3DLE A;  5AQN A;  4HWI A;  1BA0 A;  4CF9 A;  2XO7 A;  3KD1 E;  4FLW A;  5H1S Q;  2KZM A;  2B5J A;  3GE1 A;  2KQ2 A;  3QFP A;  3ZSW A;  4FJ7 A;  1BA1 A;  3QEP A;  1RTI A;  5CYQ A;  4KTZ A;  3TI0 A;  4FJ5 A;  2E8A A;  1E4F T;  5AQV A;  3RSE B;  4HCB A;  2Y1I A;  1ZBF A;  3VQ5 A;  1YTU A;  3ENB A;  3RMD A;  3T3F A;  4YOR A;  2P9N A;  3VQ7 A;  5B8H A;  2HF4 A;  2VWJ A;  4LFC K;  4KHN A;  5F0X A;  4G1Q A;  2V7Y A;  3R6M A;  4JKA A;  3MEC A;  1U45 A;  4BRA A;  2B4J A;  2KKZ A;  3HXM A;  3A5O C;  2OTL N;  4L8R B;  4LH4 A;  1ATN A;  3C6T A;  5M1F A;  3WQT A;  3J7Z O;  3RSE A;  1J53 A;  1REV A;  3J80 O;  3AVN A;  4H0V B;  4B9U A;  1W0H A;  4IEE A;  2VG6 A;  4JNE A;  4RW6 A;  3ZEU A;  1S1W A;  3OJU A;  5I42 A;  3TR8 A;  1J54 A;  4KB1 A;  2QEX N;  1ASV A;  1Q8I A;  3HYF A;  3VA3 A;  3QES A;  4IOC L;  1BQN A;  2OPR A;  3E9L A;  4KV8 A;  4CJF A;  2HMP A;  2V52 B;  3M6G A;  1VSL A;  3ASM A;  4KHW A;  3G0Z A;  3VF6 A;  2OAN A;  1SQK A;  4BR5 A;  3NH1 A;  4FSV A;  5JS1 A;  4WQ4 C;  3L3V A;  2IVP A;  4ISE A;  2G8K A;  3OA9 A;  4BRQ A;  3O8M A;  4CK3 A;  2HHW A;  2YKM A;  4BE0 A;  3ZT4 A;  1QHA A;  3S3O A;  4OPA A;  3QDK A;  3B6P A;  3M8R A;  3RR8 A;  3O4Q A;  4AQY K;  1TKD A;  1KQS M;  3LAL A;  3S9H A;  1C0T A;  1I39 A;  4FVU A;  1WOQ A;  3TAM A;  3VQA A;  4E7L A;  3HSC A;  2EWS A;  4RCH A;  4IFY A;  3LDS A;  1SKR A;  5FLX O;  3E1Y A;  4DS4 A;  4Z0U A;  4BRE A;  4Q5V A;  3NFA A;  2W40 A;  4H0X B;  3T19 A;  3AAR A;  3L0Q A;  1F21 A;  4BVP A;  2HVH A;  3O1B A;  2RKI A;  1N36 K;  3NBP A;  3RWU A;  4ID5 A;  3BP8 A;  3LDO A;  3I8B A;  2UXC K;  3VES A;  2QM1 A;  3SQ0 A;  3K5O A;  4CD1 A;  4DR5 K;  3MAQ A;  4H5V A;  1SL2 A;  3T69 A;  3CCQ N;  3ISN C;  1NBW A;  3BGR A;  3AGR A;  2ETJ A;  1X3N A;  1HNW K;  5KQD A;  4PWD A;  1NKC A;  4E7H A;  1DGK N;  5BPL A;  1HYV A;  4O8K A;  5AQL A;  3RMB A;  4R5P A;  4DUY K;  2E20 A;  4FCY A;  4CZE A;  5FPE A;  3O9T A;  1JLF A;  1N8R O;  4EIA A;  3BEX A;  3BUZ B;  3SV4 A;  3TAR A;  1NGI A;  3OHR A;  1CLQ A;  1RGI A;  3VTH A;  1BIZ A;  3TAE A;  5AZI A;  4F2R A;  2UU9 K;  4C8M A;  4CHN A;  3V6D A;  3CJ9 A;  4NXN K;  4WCE L;  4BWM A;  4MO4 A;  5KRS A;  5BN8 A;  3TAQ A;  2HHQ A;  3ULD A;  4DSI A;  4WFA L;  3MN5 A;  1XMO K;  3QER A;  4IO8 A;  4TSX A;  5EU7 A;  4X62 K;  4FK4 A;  2YNF A;  1CZB A;  4PA1 A;  2HHV A;  4BRC A;  1IKV A;  4FWN A;  5AQP A;  3OYE A;  1MDU B;  4DR4 K;  1RTH A;  3ZSV A;  4B3T K;  3L2W A;  1NJZ A;  3THW A;  2EX3 A;  4KHQ A;  4I9Q A;  3UB5 A;  1TUU A;  4M3Z A;  1GLJ O;  3C65 A;  2O4I A;  4BR9 A;  4DSF A;  3D2F A;  3FZL A;  3SZ2 A;  2YX6 A;  1M90 O;  1HNX K;  2QKK A;  1XC3 A;  4N76 A;  1U2V B;  4CF1 A;  2P5G A;  4IFE A;  1HR0 K;  2HVI A;  3FE1 A;  4YOX A;  2KTQ A;  4CEF A;  3SMS A;  3IDH A;  3SUN A;  2DFE A;  2NUB A;  3MCA B;  3MK6 A;  3NGY A;  4DHY A;  1NGJ A;  2E4L A;  1Z26 A;  2W6K A;  3SAG A;  3OYB A;  3KLI A;  4B1X B;  4AHU A;  3O80 A;  4I6M A;  3H1V X;  3H3N O;  4OKJ A;  4OKK A;  3M8S A;  1SL0 A;  1L3S A;  5FPM A;  4CZL A;  4EZ9 A;  5AJ3 K;  4GY2 B;  3TAN A;  2YKN A;  1YJN N;  2G8H A;  1VQP N;  1WBB A;  1J5O A;  1G15 A;  2HOE A;  2NRX A;  4FWL A;  2BAN A;  3ZX3 A;  1WNS A;  3LP3 A;  4Y1C A;  3J7A P;  3WNE A;  2WUS A;  2XY8 A;  2AA4 A;  4B8C A;  1RDU A;  1NGB A;  2W6L A;  4DTS A;  3QEX A;  4BRI A;  1N32 K;  1V4T A;  1X3M A;  2DFF A;  3LZJ A;  3SUO A;  2P9S A;  4GKK K;  2A42 A;  2A1R A;  1ZBI A;  3AO2 A;  2E88 A;  1C1B A;  3HT3 A;  4DF4 A;  4FJ9 A;  3SQ1 A;  3VEX A;  4YNQ A;  3G6E N;  1VSJ A;  3HP9 A;  4FLY A;  1WSJ A;  4AHV A;  2G8W A;  3BDP A;  1WB9 A;  5FDL A;  4HUE A;  4F3T A;  4Z4C A;  2HW3 A;  4BG9 A;  3VEW A;  2YV0 X;  2OYQ A;  3WEE A;  3AAP A;  4B08 A;  4HUG A;  3ZT1 A;  3O6W A;  4A5B A;  4ELU A;  4F2S A;  3MX2 A;  3SQ4 A;  5HRO A;  4FW2 A;  3ENH A;  2Y1J A;  3TPQ A;  1RCH A;  5JIC A;  1FJG K;  4BC4 A;  5AQR A;  4CIF A;  4CGI A;  2I7P A;  4I2P A;  3QFU A;  4FM0 A;  4OGE A;  4N5S A;  3CPE A;  3CJ7 A;  2P9P B;  4QS9 A;  5C25 A;  1GOB A;  4HTU A;  1KLN A;  1KVC A;  3C7N B;  3OYH A;  2PZS A;  1IG8 A;  2O8E B;  1YAG A;  2JWK A;  4C8K A;  1RIL A;  1K73 O;  1GLE G;  3DLR A;  3FLC O;  2Q0R A;  3O9R A;  2HB5 A;  4Z4H A;  3FZM A;  2Q97 A;  3EKU A;  5ADX A;  4M3W A;  2WC9 A;  3RRG A;  4E7J A;  2YHW A;  4JK8 A;  5LJW A;  4B1V A;  3G71 N;  2F9T A;  4CBW A;  4M3R A;  4RG8 A;  5AFU H;  1NGF A;  1VK0 A;  5CHI A; 
#chains in the Genus database with same CATH homology
 4J2A A;  4CEE A;  1LAV A;  1ZBH A;  3VQP A;  3AVM A;  1VRT A;  4CJS A;  1TV6 A;  1JLA A;  4B9M A;  2OPP A;  4BAC A;  4FLX A;  1BHL A;  2G8F A;  5KI6 A;  4CFC A;  4Z4E A;  2AJQ A;  4DFM A;  4AHS A;  3HO1 A;  3TWH A;  3SI6 A;  3D0P A;  3QEV A;  3LAM A;  4DQR A;  1CZ9 A;  1C0U A;  2QK9 A;  3HJF A;  1BIS A;  4LY7 A;  1KCF A;  3DYA A;  3EYZ A;  4RW9 A;  4DTO A;  4DMN A;  3SJJ A;  2FC0 A;  4CGD A;  1U47 A;  3VQQ A;  5KRT A;  3HP6 A;  1C1A A;  3PX0 A;  1A5W A;  5CYM A;  3C95 A;  4CIE A;  1LWE A;  4O0J A;  1VSM A;  3HPO A;  3PX4 A;  4ZTJ A;  3NGZ A;  3KTQ A;  4DSJ A;  1NJX A;  4RW7 A;  1L3V A;  4BDY A;  2OA8 A;  2HND A;  3ALY A;  4CHY A;  3AVL A;  4C8L A;  1S6P A;  2YHA A;  3AVA A;  3HPH A;  3NH2 A;  1TAU A;  2HMI A;  1JXE A;  1GOA A;  3V1Q A;  3A2F A;  3QO9 A;  4CGF A;  3V1R A;  1LWF A;  1TKX A;  3AO4 A;  1IKX A;  3HVR A;  4OLA A;  4PY5 A;  4CES A;  1WSH A;  3AVJ A;  5K14 A;  3H08 A;  1WSI A;  4DU1 A;  1YT3 A;  4DTJ A;  3NGI A;  4AIL C;  4N47 A;  3ZT0 A;  3PUF A;  3SNN A;  1FKO A;  1LAW A;  1TGO A;  4EP5 A;  1TL1 A;  4AHT A;  1HNI A;  4ZHR A;  2XY5 A;  1QE1 A;  1JL1 A;  1QHT A;  1RDD A;  2GBZ A;  4ICL A;  3AO3 A;  4IG0 A;  1RDC A;  4CER A;  1C0M A;  1NK6 A;  4B9N A;  4CEQ A;  3O4N A;  2HNY A;  1C1C A;  1VSE A;  3DM2 A;  4BDP A;  4F8R A;  1U4B A;  3TAB A;  4FVM A;  4FJG A;  2F8S A;  4IBN A;  1NK0 A;  4ELT A;  2Z1J A;  3O3F A;  4Y1D A;  3OYM A;  3NE6 A;  4LD0 A;  2ZE2 A;  1HMV A;  1JKH A;  4CED A;  4CF8 A;  3OYL A;  1NK5 A;  4RW4 A;  1MU2 A;  4CFD A;  3MED A;  1TL3 A;  2YNG A;  3NF8 A;  2KFN A;  1KVB A;  5J2N A;  1BCM A;  1ITG A;  3P83 D;  1WSE A;  1KFD A;  4DWI A;  4CGH A;  3DLE A;  5J1E A;  3AA5 X;  1JLQ A;  1ASU A;  5HRR A;  5E41 A;  4CF9 A;  4E1M A;  2XO7 A;  3KD1 E;  3AVI A;  3RRH A;  4FLW A;  3OYF A;  3V9Z A;  4FJL A;  2G8U A;  2KZM A;  2B5J A;  4UQG A;  3PV8 A;  3NHG A;  2KQ2 A;  3ZSW A;  1L5U A;  4FJ7 A;  3F73 A;  3OYC A;  3JSM A;  3L2Q A;  3QEP A;  4JRP A;  4KTQ A;  3QIP A;  1RT3 A;  1RTI A;  4OVL A;  5CYQ A;  3OYN A;  1UA0 A;  3DLK A;  4KTZ A;  2YHB A;  5C42 A;  3EY1 A;  1IKW A;  4H4O A;  3TAF A;  3TI0 A;  4FJ5 A;  4W5Q A;  4J2B A;  3CFR A;  4Z4F A;  4DFP A;  1S9E A;  1S1U A;  1RNH A;  2R7Y A;  3UIQ A;  3DOK A;  3QNO A;  4HCB A;  2Y1I A;  1B92 A;  1ZBF A;  3VQ5 A;  3SPY A;  4NYF A;  1YTU A;  2X6N A;  3RMD A;  5CZ2 A;  1JL2 A;  3T3F A;  5DMR A;  1T7P A;  3AO1 A;  3P5J A;  5HLF A;  3VQ7 A;  1TK0 A;  4FM1 A;  4EP4 A;  2VWJ A;  1RBU A;  5J2P A;  3CG7 A;  1B9D A;  4G1Q A;  1S1V A;  1BQM A;  2X6S A;  4O5B A;  3MEC A;  3CM6 A;  1U45 A;  4BDZ A;  2PY5 A;  3L2U A;  2B4J A;  3KIO A;  3AVK A;  1RT4 A;  3HXM A;  1NK9 A;  3IAY A;  3DRP A;  4LH4 A;  4L8R B;  1WSG A;  3PX6 A;  4KAZ A;  3C6T A;  1SL1 A;  4GMJ B;  4FK2 A;  1J53 A;  1REV A;  1UWB A;  3AVN A;  3AO5 A;  3CM5 A;  3LPU A;  4IG3 A;  4FLT A;  4B9U A;  4E7K A;  2OZS A;  1W0H A;  5HRS A;  4ELV A;  3K5M A;  4NCA A;  1HYS A;  1NJY A;  3SPZ A;  2VG6 A;  3I0S A;  4N56 A;  3RMC A;  1NK8 A;  4RW6 A;  4DQI A;  3LWM A;  3OYJ A;  4B9T A;  1C6V A;  3V9S A;  1RT6 A;  1XI1 A;  2PYJ A;  1S1W A;  4M3X A;  4CJE A;  3OJU A;  5J2M A;  2RN2 A;  3LP0 A;  5I42 A;  1ASW A;  2FBT A;  1J54 A;  3TR8 A;  4KB1 A;  1S6Q A;  2BGG A;  2KZZ A;  4DG1 A;  2VWK A;  2FBY A;  1ASV A;  3K57 A;  4CF0 A;  1Q8I A;  5SWM A;  3HYF A;  2HNZ A;  3VA3 A;  2IC3 A;  3QES A;  3S3M A;  3AVH A;  1TK8 A;  3RR7 A;  2D0B A;  1BQN A;  2OPR A;  4DTX A;  4CJP A;  4KV8 A;  4CJF A;  3QEW A;  1RTD A;  1UAX A;  1T03 A;  3O3G A;  2IGI A;  1VSL A;  3ASM A;  4QCL A;  4KHW A;  3G0Z A;  3WNH A;  4YFU A;  1VSK A;  3M8P A;  1L3T A;  3LZI A;  5FRN A;  3NH1 A;  1JLB A;  3LAN A;  4CE9 A;  4DTR A;  1HNV A;  4J2D A;  3DLB A;  3AA4 A;  1IG9 A;  3O3H A;  4CJK A;  1D8Y A;  5JS1 A;  3KLE A;  1TKZ A;  4CJQ A;  3KK3 A;  4E3S A;  3NDK A;  4Q0B A;  2OPQ A;  3AA2 A;  4LH5 A;  3L3V A;  3DOL A;  2G8K A;  1X9W A;  3PO5 A;  4DQP A;  3DI6 A;  3VQ8 A;  4E1N A;  2A1S A;  3D45 A;  3IRX A;  4CK3 A;  4CCH A;  2HHW A;  2YKM A;  1JLE A;  4KHS A;  4O4G A;  4BE0 A;  3ZT4 A;  4CHO A;  3S3O A;  4BE1 A;  1S9G A;  3ZSO A;  3B6P A;  2YNI A;  4FZX C;  3L2R A;  3M8R A;  3KKR A;  1JLG A;  4I9L A;  1RBT A;  4DLE A;  1ZYQ A;  3O4Q A;  3HVT A;  3RR8 A;  2HHX A;  1T8E A;  3MXM A;  1TKD A;  3LAL A;  3S9H A;  1C0T A;  1I39 A;  4MQ3 A;  1U48 A;  4HVJ A;  3TAM A;  2XY7 A;  3FFI A;  3LP1 A;  3VQA A;  4E7L A;  4NCB A;  3AVF A;  4I2Q A;  1QSL A;  3VQ6 A;  3KKS A;  4CJ3 A;  1TK5 A;  2D0C A;  4M3U A;  2Z1H A;  3JYT A;  2F8T A;  4IFY A;  3WNF A;  3LDS A;  1JLC A;  3V9X A;  3DLH A;  1SKR A;  3F9K A;  1WLJ A;  4C8N A;  4JRQ A;  4DS4 A;  4Z0U A;  4CJU A;  3SQ2 A;  4CJ4 A;  2HHT A;  1DTQ A;  2E6L A;  4FW1 A;  2KW4 A;  4Q5V A;  4H8K A;  3NFA A;  4B8A B;  3HM9 A;  2ITG A;  3U3Y A;  3AVB A;  1A5V A;  1HQU A;  1XHX A;  1S5J A;  4PQU A;  3T19 A;  4IFV A;  1X9M A;  4OLB A;  2DFH A;  3K5L A;  3OVN A;  1F21 A;  2ATQ A;  3QNN A;  4FLU A;  2HVH A;  2RKI A;  3NBP A;  4DTM A;  1N6Q A;  1RBR A;  4ID5 A;  5CZ1 A;  1LW0 A;  4B9L A;  4W5O A;  3RWU A;  3ITH A;  3VQE A;  1WAJ A;  1VSD A;  1NOZ A;  1NKB A;  3QIO A;  3OY9 A;  3KLH A;  3SQ0 A;  1A5X A;  4CEO A;  3SYZ A;  3RTV A;  3K5O A;  1JXB A;  3NF7 A;  3OYG A;  1O1W A;  3MAQ A;  3NF9 A;  4CFA A;  4KRE A;  3HPG A;  4CHZ A;  1SKW A;  1SL2 A;  2G8V A;  3VN5 A;  3S3N A;  2D0A A;  1DLO A;  3ISN C;  4N41 A;  4W5R A;  3BGR A;  3AVC A;  1SV5 A;  2ETJ A;  3MEG A;  3K5N A;  4KFB A;  4J2E A;  4FJX A;  4KHY A;  3C6U A;  4KPY A;  4FJK A;  3QIN A;  5JS2 A;  4M45 A;  3L8B A;  1BI4 A;  2OPS A;  4PWD A;  4LSN A;  1NKC A;  4E7H A;  4K8Z A;  4KI4 A;  4B9V A;  3PY8 A;  1HYV A;  2ZD1 A;  4CJR A;  4BE2 A;  3KLG A;  3RMB A;  2RPI A;  3ZCM A;  4R5P A;  1XHZ A;  4FCY A;  1NKE A;  2XY6 A;  1X9S A;  3AV9 A;  3I8D A;  2BDP A;  3HK2 A;  1NK4 A;  5C24 A;  1JLF A;  2X74 A;  5SZT A;  4FK0 A;  3OS1 A;  3SV4 A;  3TAR A;  2I5J A;  3LP2 A;  1CLQ A;  2IAJ A;  4KHN A;  4DFJ A;  1UA1 A;  4KKO A;  1EET A;  1BIZ A;  5KTQ A;  1ZBU A;  4DU3 A;  3TAE A;  1RDB A;  3E01 A;  4IDK A;  5HP1 A;  3OS0 A;  4F2R A;  4C8M A;  3ZSX A;  4CHN A;  3V6D A;  4H4M A;  1KRP A;  4F4K A;  4BWM A;  4CHP A;  2KFZ A;  4FZZ A;  1YVU A;  4XIU A;  2E6M A;  3AVG A;  5KRS A;  3VQC A;  1TKT A;  4DQS A;  1VSF A;  2O4G A;  1NK7 A;  4DF8 A;  2GV9 A;  3TAQ A;  1Q9Y A;  4CFB A;  2HHQ A;  2X78 A;  4FJI A;  4O55 A;  3ULD A;  2VG7 A;  3MXJ A;  4DSI A;  2BE2 A;  1D9F A;  3QER A;  1RDA A;  4CK2 A;  4TSX A;  5EU7 A;  3CFP A;  3PO4 A;  4FK4 A;  2YNF A;  4M3Y A;  1BGX T;  1S1X A;  1CZB A;  2JGU A;  4PA1 A;  5HBM A;  4AHR A;  3V9W A;  4KRF A;  3T1A A;  2HHV A;  4FJM A;  4QOZ B;  1IKV A;  1RBV A;  3ZT2 A;  3OJS A;  5J2Q A;  2G8I A;  3OYE A;  4KB0 A;  4F3O A;  3K59 A;  3V9U A;  3VQD A;  1RTH A;  2IS3 A;  4OJR A;  3ZSV A;  4CIG A;  3L2W A;  1NJZ A;  4CJ5 A;  4OPK A;  4I7F A;  1IO2 A;  4CJW A;  4DTP A;  1U49 A;  4FJN A;  3DLG A;  1KVA A;  2EX3 A;  4KHQ A;  3OYD A;  4I9Q A;  1Z25 A;  4RW8 A;  1S1T A;  3NH0 A;  3V4I A;  1FK9 A;  3QEI A;  4M3Z A;  3NAE A;  1RT5 A;  3B6O A;  1WSF A;  2O4I A;  4M41 A;  1FKP A;  3OYK A;  4DSF A;  3VQ9 A;  4FLV A;  3I0R A;  1BI4 B;  1HJR A;  3SZ2 A;  4M3T A;  4DLG A;  2QKK A;  4Z4G A;  1R0A A;  1WN7 A;  2PYL A;  4N76 A;  1RBS A;  4HUF A;  4CF1 A;  2P5G A;  1BL3 A;  3L2V A;  3KD5 E;  2HVI A;  4IKF A;  1EX4 A;  4GVM A;  4CJT A;  2Z1G A;  2KTQ A;  4CEF A;  2DTU A;  1U04 A;  4ID1 A;  3KLF A;  5D3G A;  4AHC A;  1J9A A;  1EP4 A;  3RMA A;  1SKS A;  2P51 A;  3SUN A;  2DFE A;  2NUB A;  1HRH A;  1Y97 A;  4DTN A;  1RT7 A;  4CEA A;  3NGY A;  4JLH A;  1EKE A;  2E4L A;  1Z26 A;  2OZM A;  2D5R A;  3OYB A;  3SUQ A;  3KLI A;  5KGX A;  4DTU A;  3TAG A;  4AHU A;  5T7B A;  3DRS A;  4HCC A;  1EXQ A;  1NOY A;  4KO0 A;  3G10 A;  2DY4 A;  3LPT A;  4OKJ A;  3M8S A;  3CFO A;  4OKK A;  4E89 A;  4HHT A;  1SL0 A;  1L3S A;  3ZSQ A;  5FRO A;  4OKE A;  4FXD A;  1LWC A;  4W5T A;  4NCG A;  4EZ9 A;  1BCO A;  1B9F A;  3TAN A;  3U3G A;  3EZ5 A;  2QKB A;  2YKN A;  2JLE A;  3M8Q A;  3OS2 A;  2G8H A;  1QS4 A;  3ZSZ A;  4DS5 A;  3SUP A;  1VSI A;  4DSL A;  4CGG A;  4KI6 A;  1TAQ A;  4NYN A;  1HYZ A;  1J5O A;  4KHU A;  1TVR A;  1FXX A;  1G15 A;  4MFB A;  3DMJ A;  1IH7 A;  1VSH A;  4QAG A;  1D5A A;  1DTT A;  4CJV A;  1T05 A;  1QSY A;  4CHQ A;  3MEE A;  2P1J A;  3KJV A;  2BAN A;  2EHG A;  1WNS A;  3LP3 A;  4Y1C A;  3OYA A;  3WNE A;  4CGJ A;  4DSK A;  2XY8 A;  1YTA A;  4B8C A;  1QQC A;  2WOM A;  1RTJ A;  4DTS A;  3QEX A;  2XHB A;  3SV3 A;  4GW6 A;  4JS4 A;  1XC9 A;  3AA3 A;  4CEC A;  1SUQ A;  4DSE A;  1IKY A;  2DFF A;  2ZQB A;  2RF2 A;  3LZJ A;  3LAK A;  3VQ4 A;  3ZSY A;  3SUO A;  4E0D A;  3DRR A;  2HHS A;  2Q3S A;  3WNG A;  2A1R A;  1ZBI A;  5CY4 A;  3AO2 A;  1HPZ A;  1C1B A;  1X1P A;  1LW2 A;  3L3U A;  2LSN A;  3ZT3 A;  4AH9 A;  4OPJ A;  3HT3 A;  3V1O A;  2F96 A;  4DF4 A;  4EZ6 A;  4FJ9 A;  4B3O A;  3SQ1 A;  2IDO A;  4LSL A;  4YNQ A;  1VSJ A;  4CK1 A;  4C8O A;  3HP9 A;  4FLY A;  1WSJ A;  3CYM A;  4AHV A;  4E7I A;  2G8W A;  3QET A;  1LV5 A;  4KTW A;  4O44 A;  5FDL A;  4HUE A;  4F3T A;  2W42 A;  2Z1I A;  4Z4C A;  2VG5 A;  2HW3 A;  4FJ8 A;  3CQ8 A;  2YV0 X;  2OYQ A;  4FYD A;  3P1G A;  2QXF A;  1KFS A;  4B08 A;  1NJW A;  4FJJ A;  4HUG A;  3K58 A;  3ZT1 A;  3U6F A;  3BDP A;  5HRN A;  3VA0 A;  4B9S A;  4ELU A;  1KSP A;  4F2S A;  1W9H A;  1KTQ A;  3SQ4 A;  1UOC A;  2IOC A;  5HRP A;  4FM2 A;  5HRO A;  1I3A A;  3TAP A;  5I3U A;  1QTM A;  1CXU A;  3K2P A;  4FW2 A;  4FJH A;  2Y1J A;  1RT1 A;  1WAF A;  5DK5 A;  1RCH A;  3IS9 A;  1L3U A;  1VRU A;  4CEZ A;  2FBV A;  1QSS A;  4CIF A;  4E19 A;  4CGI A;  4I2P A;  3V81 A;  4CF2 A;  4FM0 A;  1BIU A;  4OGE A;  4N5S A;  4O0I A;  3LWL A;  4CJL A;  4M42 A;  2B6A A;  4DFK A;  1KLM A;  3ZSR A;  1Q9X A;  3HST B;  5C25 A;  1GOB A;  3SCX A;  2GUI A;  2XRI A;  4HTU A;  1K6Y A;  3IG1 A;  3MXI A;  4DU4 A;  1KLN A;  1KVC A;  3OYH A;  2FBX A;  2WON A;  4BWJ A;  1D9D A;  2PZS A;  3QLH A;  4C8K A;  1HQE A;  1RIL A;  4JS5 A;  4Z4I A;  1GOC A;  3NF6 A;  4WE1 A;  4CEB A;  4DQQ A;  5FRM A;  3VQB A;  3OYI A;  4FZY A;  1N5Y A;  3KK2 A;  2HHU A;  1XWL A;  3DLR A;  4ZTF A;  3NCI A;  4Z4H A;  3KK1 A;  4FLZ A;  2HB5 A;  4PUO A;  3THV A;  4W5N A;  2YNH A;  3C94 A;  1ZBL A;  4M3W A;  4K8X A;  1RT2 A;  3RRG A;  4E7J A;  2P5O A;  5KGW A;  4OGC A;  3HL8 A;  1CXQ A;  4M3R A;  4RG8 A;  1VK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...