4CJEA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 53
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjeA00
3NE6A 3HPOA 1WSIA 3L2QA 3ULDA 3JYTA 4CK1A 4CFBA 5J2PA 1RTJA 1DTQA 2YNFA 3VQBA 4CEAA 2FBXA 4M41A 4CGJA 3OYDA 5KI6A 4LSNA 1T03A 2ZE2A 4C8LA 1NJYA 3DYAA 3RWUA 5CZ2A 1JLBA 4E1NA 3EY1A 4CJ4A 3QEWA 4NCBA 2JGUA 2VWKA 2XRIA 1FKPA 2IS3A 3HM9A 4KHYA 4CEEA 2PZSA 3BDPA 3M8QA 2HNDA 2HVHA 4ELTA 3SUPA 3C6TA 3NF8A 4IG0A 4O0JA 1RTIA 1BIUA 2HW3A 3SQ4A 4BE0A 4HUGA 1U47A 1VSLA 3DLKA 1HMVA 3ZT2A 3THVA 3TABA 4CK3A 1VSIA 1RBUA 1U4BA 3MEEA 3L2VA 3RMCA 1Q9XA 3HPGA 3AVJA 3ZSRA 3VQ8A 2G8KA 3JSMA 1SL0A 3G0ZA 4DU1A 3D45A 4MQ3A 4CHNA 3LALA 4H4OA 4F8RA 3DRSA 3S9HA 3NGIA 4FLTA 4W5NA 4AHCA 2GV9A 4CEOA 3U3GA 1QSSA 3L3UA 1LAVA 2HNYA 4W5RA 4CF9A 3QNNA 4CJVA 3TARA 3NF9A 4AHRA 4CJRA 2YNGA 4FM0A 4B9UA 3VQEA 2P51A 4CJKA 3SQ0A 1X9SA 1LWEA 3O3GA 4FLZA 5J2NA 1CXQA 4BDPA 3NHGA 4JS5A 1QHTA 3EZ5A 4OGEA 4DTJA 2X78A 2HHWA 2ZQBA 2E6MA 3RR8A 4FJ7A 1A5XA 3SJJA 1C1CA 4IG3A 3C95A 4FCYA 4FLVA 1TGOA 1KVAA 1NOZA 3OYAA 3SV4A 4B3OA 4CEZA 3SQ2A 1RTHA 1J53A 1VSDA 1ZBLA 4DTNA 2YNHA 1F21A 1IG9A 4K8XA 2Z1HA 4DU3A 3OYLA 3O3FA 1QTMA 4B8CA 3VQQA 3NF7A 2IDOA 1ASWA 3C6UA 2OPSA 1T7PA 3LZIA 2BGGA 5J1EA 4GW6A 3SPYA 2G8FA 2KTQA 3V1QA 5K14A 2FBTA 3OYKA 1L3SA 3FFIA 4NCGA 3IRXA 2VG7A 1GOBA 1YTAA 1BQNA 5C42A 3VQ9A 5HRNA 5KGXA 2G8VA 1LV5A 2EHGA 5HROA 4FJLA 2AJQA 3CFOA 3K5MA 1TAUA 4OLBA 1NK6A 2XO7A 2QXFA 3C94A 3CFRA 1LAWA 4FLXA 1TV6A 3RRGA 1WAJA 3OY9A 1UOCA 3L8BA 4AHSA 1I39A 3VQAA 3U3YA 3OYGA 3OJSA 3PV8A 1TK0A 2ZD1A 3PY8A 3NGYA 4H8KA 4CEDA 1VSFA 3LZJA 4C8MA 3VQ6A 2Z1IA 4GVMA 4M45A 1IO2A 5KRSA 4E7HA 1KVCA 5J2MA 3LP0A 3NH2A 3QINA 3TAEA 1UA1A 1UAXA 3DI6A 1S5JA 1KFDA 3AVLA 4FVMA 4OGCA 2D0AA 1KSPA 2HHXA 2A1RA 4DWIA 4OVLA 4EZ9A 3VQDA 5E41A 4FW1A 3AA3A 2RN2A 3P83D 1EKEA 1JLAA 3HXMA 3B6OA 1N5YA 3IG1A 3MAQA 1G15A 1WN7A 3LDSA 4W5OA 1NJWA 4RW6A 4HHTA 1A5VA 1VSHA 3DRRA 2LSNA 2Q3SA 2I5JA 2P5GA 4W5TA 4CJEA 4N5SA 1SKRA 3LP1A 1WLJA 4C8KA 3D0PA 4I7FA 2FBYA 2GBZA 4E3SA 3HK2A 1NKCA 1D9DA 3TR8A 2HMIA 4CJFA 4KI4A 4OPJA 1HPZA 3SYZA 1GOAA 4FJ9A 2X6NA 4ID1A 1TK8A 4YNQA 4CF1A 2RPIA 2DFHA 4EP5A 4FM1A 4DSIA 4E89A 3ALYA 1S1UA 2VWJA 4BACA 4FZZA 3V4IA 1IKWA 4CIFA 1VK0A 4E7IA 2YKMA 3ZT0A 2PY5A 3AO1A 3CM6A 4CJPA 4IDKA 4DTRA 3LPUA 1Z26A 3ZSVA 1XC9A 2HNZA 4B9VA 3NFAA 3OYBA 4ZTFA 1BGXT 3U6FA 1S1XA 4CJQA 4M3WA 3MXIA 1NK7A 3DM2A 4CEFA 1SV5A 3KKSA 3M8RA 1C0MA 4PUOA 4Z4FA 2HHUA 2D0BA 3O4QA 3WNEA 4B9SA 4XIUA 4DQQA 2HHTA 4CHZA 3KTQA 3NF6A 4BWJA 4RW7A 1DTTA 5JS1A 2GUIA 5HRPA 1VSJA 2OA8A 4DTXA 3AO3A 4DTMA 4KRFA 4EP4A 1O1WA 4CJSA 3CYMA 4CHQA 4KPYA 4FW2A 1XWLA 3RMDA 2QKKA 3V9XA 1BI4B 4CECA 4FJ8A 4DSJA 5SWMA 2BANA 3RR7A 4Q5VA 2DFEA 5SZTA 1U48A 4K8ZA 1U04A 1U45A 3WNFA 4B8AB 4B9TA 4CCHA 4N56A 3HPHA 1RNHA 1LWCA 3LP2A 1JLGA 1HJRA 2OPRA 3ZSXA 2F96A 2YKNA 3VQ4A 4AHTA 4Z0UA 3L2RA 1NK5A 4Z4CA 3V1OA 3OYJA 4LD0A 3O4NA 4G1QA 3F73A 3HVRA 4ELVA 4PWDA 3VQCA 4LH4A 1JKHA 3ZCMA 3QEVA 2G8HA 2A1SA 1KCFA 3A2FA 4B08A 4QAGA 1RDBA 3ISNC 3QERA 4Z4EA 3VA0A 2R7YA 4PQUA 1RCHA 5I42A 3ZSOA 1GOCA 4M42A 4NYFA 1IH7A 3P5JA 2OZMA 4N47A 1T8EA 3NAEA 1BL3A 3QO9A 4AILC 4N76A 1LW2A 3OS0A 1S1VA 1Q8IA 3OJUA 1QSLA 4PY5A 3AVNA 2PYJA 4Q0BA 2HB5A 3ZT4A 1S9GA 4FK4A 4FJXA 1ZBIA 3RMAA 1TKTA 4Z4GA 1FK9A 4O44A 1ASVA 2DY4A 3TAMA 1WNSA 1KTQA 1WSHA 1TVRA 1HYZA 3L3VA 4IFVA 3ZSWA 4CESA 4CF8A 3SV3A 4HCBA 3V1RA 3QLHA 1RBVA 1VSMA 3L2WA 4JS4A 3I8DA 4CGIA 1J9AA 3DOLA 4M3RA 1SKWA 3AO5A 3DLRA 3V81A 1Q9YA 1RDAA 1YVUA 1NK0A 5HLFA 3OYEA 1JL2A 3PX6A 3K2PA 2G8UA 3AVFA 4DLGA 3AVKA 1C6VA 1ASUA 1TL3A 3VQPA 5KRTA 4FLYA 5EU7A 4NCAA 1RILA 4DS4A 4CFAA 3MEGA 3AA5X 4E19A 4AHUA 4PA1A 3KLHA 1BIZA 4KAZA 1RT5A 4BWMA 1Z25A 2XY6A 4L8RB 4KHQA 2O4IA 1L3TA 4CJTA 4FZYA 3AVCA 3CG7A 2B4JA 4B9LA 4M3UA 2FBVA 1RTDA 2BE2A 1KLMA 3ZSZA 5KTQA 1XHZA 4F4KA 5DK5A 1TKZA 4JRPA 4BDYA 4DQSA 3QEXA 4Z4IA 3M8SA 2YHBA 2HHSA 1ZBHA 1C1BA 3NBPA 4O5BA 2YV0X 4HVJA 2ETJA 4FJGA 3NH0A 2E4LA 1S1TA 1WSGA 3NDKA 3M8PA 4FLUA 4CGHA 1NK4A 1TAQA 1ZYQA 1JLCA 1L3UA 4RW9A 5HP1A 1EX4A 1WSJA 4LH5A 4QCLA 1X9WA 1QE1A 4DQIA 3SUNA 3T19A 1FXXA 4C8NA 2KQ2A 3ZT3A 4DLEA 2BDPA 3P1GA 4F3TA 5FDLA 2DFFA 1LWFA 4ZTJA 2Y1JA 3KLGA 5FRNA 3PUFA 1T05A 4HCCA 3OYIA 3PO4A 4FXDA 4E7LA 3BGRA 1TK5A 1KLNA 4CERA 3K59A 5I3UA 2Z1JA 4ICLA 4Y1DA 1A5WA 2IC3A 4KHNA 1RT1A 3KIOA 3NCIA 3DLHA 2G8WA 3DMJA 3HP6A 2D5RA 3NH1A 3QEPA 4FM2A 4DFKA 4CJWA 3PX4A 4F2RA 4W5QA 3V9SA 4DTSA 3VN5A 3IS9A 3IAYA 3AV9A 3TAGA 4DFJA 1YT3A 4E7JA 3OYHA 3B6PA 1MU2A 1JL1A 1S1WA 3SCXA 4DSLA 1FKOA 4CEQA 3SUQA 3DLEA 3V9ZA 3ASMA 1TKDA 4KV8A 2X74A 3E01A 3UIQA 4O55A 4ELUA 1D9FA 4OKJA 3ZSYA 4IFYA 2RF2A 3OYMA 4LY7A 4DF8A 4CHYA 1CLQA 2DTUA 3LWMA 4KHSA 1YTUA 3AVHA 2NUBA 3RMBA 3LP3A 1XHXA 4O4GA 4E1MA 4KHUA 4DTOA 1NOYA 3PO5A 3V9UA 2Z1GA 3MEDA 2PYLA 4EZ6A 1RT7A 3HO1A 4KHWA 4I9QA 2VG6A 3L2UA 4M3YA 3F9KA 3EYZA 1RBTA 4MFBA 3MECA 4FYDA 2KW4A 4FJKA 1VRTA 3AVIA 3HYFA 1REVA 3WNHA 2P5OA 1HYSA 3TAPA 4CJ3A 4CGFA 3QNOA 4DFMA 1C0TA 3KKRA 3MXMA 3SNNA 4Z4HA 4CFCA 1VRUA 1JXEA 2F8SA 4FK0A 1L5UA 1BHLA 3DRPA 2KZZA 1QS4A 2B6AA 2XHBA 1SUQA 4B9NA 2D0CA 4CIEA 5DMRA 3G10A 1RBRA 2IOCA 4ZHRA 3I0SA 2WOMA 1TKXA 4DS5A 3DOKA 2OPQA 1CZBA 1B9DA 1CXUA 1HQUA 1KVBA 3AO4A 3OVNA 3LAMA 3QIPA 4I2PA 3VQ5A 4AHVA 3KJVA 4M3ZA 2KZMA 4TSXA 2ATQA 4KREA 4AH9A 4J2DA 4M3TA 1JLFA 3SI6A 4M3XA 3TANA 3DLGA 1BI4A 1QQCA 4FJHA 1S9EA 1VSKA 4IBNA 3O3HA 3K58A 4KI6A 1CZ9A 1NK8A 3WNGA 1J54A 4BE2A 4DQRA 2Y1IA 3AA2A 3RTVA 1L3VA 1NJZA 1JLQA 1JXBA 3CQ8A 4O0IA 4KTZA 3KD5E 4JRQA 3SZ2A 4DFPA 3S3OA 1Y97A 4CJUA 4CGGA 3K5OA 3RRHA 2KFNA 3QIOA 5FROA 1ZBUA 3KLFA 3T3FA 2XY7A 3CM5A 1B9FA 3LANA 3S3MA 3SPZA 4IKFA 2B5JA 3QEIA 2OYQA 4CHOA 5D3GA 5T7BA 2G8IA 4FLWA 1ITGA 3KK1A 3OYCA 3DLBA 1X9MA 4F3OA 2O4GA 4FK2A 2JLEA 3OS2A 1NK9A 4DTPA 3HJFA 1BCMA 4I2QA 4UQGA 1IKVA 2XY8A 3AA4A 3VQ7A 1C0UA 4CGDA 1NJXA 3QESA 1HNIA 1J5OA 4B9MA 4KB0A 3HT3A 4E7KA 1UWBA 3SQ1A 4OKEA 4KTQA 1U49A 1TL1A 4HUFA 1UA0A 1RDCA 3I0RA 4J2EA 2E6LA 3KLIA 1BISA 1C1AA 4RG8A 3ZT1A 4CHPA 4CJLA 5JS2A 1HYVA 4HTUA 4RW4A 2W42A 4N41A 4QOZB 4CEBA 4RW8A 1IKYA 1RT3A 4CF2A 4CK2A 1XI1A 5CYMA 4CE9A 2HHQA 4FJMA 2QK9A 4J2AA 2YHAA 4GMJB 3PX0A 3TAQA 1D8YA 1K6YA 5CY4A 3QETA 1KFSA 1RT2A 3KD1E 4I9LA 1EP4A 2OPPA 4JLHA 4CIGA 3NGZA 1BQMA 1EXQA 4ID5A 1LW0A 3T1AA 3KK3A 3OYNA 4DQPA 4J2BA 4FJNA 4WE1A 5HBMA 3AVAA 1WSEA 5C24A 1KRPA 5KGWA 4DG1A 4HUEA 3AVGA 5J2QA 1BCOA 1WAFA 2P1JA 4DF4A 3TAFA 1SKSA 4KFBA 4CFDA 4OPKA 2RKIA 4C8OA 4DSKA 3SUOA 3KLEA 1NKEA 1RT4A 3AO2A 4OLAA 2YNIA 1D5AA 3VA3A 1RT6A 1S6QA 4DSEA 3V6DA 3LWLA 4KO0A 1RDDA 3K57A 4DSFA 2X6SA 5HRSA 2KFZA 4NYNA 1IKXA 4CF0A 3OYFA 2FC0A 2IGIA 4BE1A 2XY5A 4FJ5A 4LSLA 3MXJA 4FJJA 3HP9A 4OKKA 3S3NA 1NKBA 1B92A 5HRRA 4KB1A 3ITHA 2QKBA 4YFUA 1S6PA 5FRMA 2ITGA 1ZBFA 3OS1A 4DMNA 3KK2A 1HNVA 4DU4A 1SL2A 1W9HA 1QSYA 2F8TA 2HVIA 1I3AA 5CYQA 2OZSA 4CJ5A 4H4MA 5CZ1A 3K5NA 1R0AA 4R5PA 1DLOA 4E0DA 3HVTA 4FZXC 3TI0A 2VG5A 4F2SA 1JLEA 4KKOA 4DTUA 4BDZA 3LAKA 3ZSQA 3V9WA 1RBSA 2IAJA 2EX3A 1X1PA 3AVBA 3HSTB 3TWHA 1VSEA 5C25A 1HQEA 1W0HA 3LPTA 3H08A 2HHVA 1N6QA 1SL1A 3K5LA 1WSFA 3CFPA 4OJRA 1HRHA 4KTWA 4FJIA 3HL8A 4Y1CA 1EETA 2WONA 3AVMA
chains in the Genus database with same CATH superfamily
2A40A 3NVKA 1NGDA 5J2PA 1BA0A 4CK1A 1Q86O 1RTJA 2YNFA 4X64K 3R8EA 4CEAA 4CGJA 5KI6A 4C8LA 3WXKA 2ZE2A 1HJOA 3DYAA 1NJYA 3EY1A 2JGUA 1BG3A 1ZBSA 2XRIA 4B1UB 3HM9A 2PZSA 3O9TA 4JAXA 4ELTA 4NXNK 2GWKA 1Q81O 4HUGA 2HBLA 2YI1A 1N33K 1VSIA 3CCEN 3AVJA 3K9KA 1SL0A 3G0ZA 3VEXA 4UY8O 2O8CA 4FVUA 3B8AX 4BRLA 4MQ3A 1N36K 4H4OA 3U8XA 3P4IA 1OH5A 4ISFA 4FLTA 4W5NA 2O8EA 1QSSA 4CJVA 3TARA 4AHRA 4F9OA 3RSEB 5GIOA 4FLZA 3O3GA 5J2NA 2WTUA 1GLCG 3CQXA 3EZ5A 4OGEA 4DTJA 4FJ7A 3RR8A 3SJJA 3ULEA 3SV4A 1KVAA 1NOZA 1N32K 4B1VA 3JXUA 4PHTX 1RTHA 1ZBLA 2FXUA 4DTNA 1JJ2M 3THXA 4JKDA 3VQQA 4LF9K 2OPSA 2ZJRL 1T7PA 1KAXA 3V1QA 4JI2K 3OYKA 1YVNA 3FFIA 4MDBA 1GOBA 1OH8A 5C42A 1BDGA 2VYPA 5HRNA 2G8VA 3C6AA 1QHAA 3CFOA 3C94A 3DLLL 1NG9A 1LAWA 3OY9A 1X9JA 3HRGA 3CJBA 3I55N 5M1QA 4RTFD 3OYGA 3R9PA 2HBKA 1QQNA 4BR2A 4C8MA 3LZJA 1YAGA 4GVMA 1IO2A 5J2MA 2FF3B 3LP0A 3WXJA 1S5JA 1HKCA 2A1RA 3I56N 4OVLA 3VQDA 5E41A 4FW1A 5TKWA 3G4SN 2KLAA 3A5OC 3P83D 2QXLA 1JLAA 3HXMA 4WQ5A 4RW6A 2DPNA 3DXMA 2QW9A 2LSNA 2KHOA 4H5NA 4BR5A 3CMAN 1SKRA 2P9KA 1WLJA 5AQKA 3SBTA 3SMPA 5MLCQ 3GG4A 3CCMN 3HK2A 4B1YB 3TR8A 1IJJA 3CPEA 1GOAA 4ID1A 2IVOA 2RPIA 5FLXO 4E89A 3R3LA 4J8FA 2VWJA 4QS8A 2YKMA 3CJCA 3ZT0A 4CZLA 3IFRA 3CCQN 4CJPA 1U2VA 3NFAA 3J8AA 1BGXT 4CJQA 4M3WA 3VTHA 4KBOA 3H1VX 3M8RA 1C0MA 4Z4FA 4JI6K 2D0BA 3O4QA 3HBTA 4WFBL 1HKGA 3E9OA 3NF6A 4BWJA 2A41A 1VQ8N 1DTTA 2P9IB 5HRPA 4DTXA 4DV0K 4EP4A 2QKKA 1DEJA 4CECA 3UKUA 4DSJA 2ZGZA 3BP8A 4G9ZA 1U48A 4K8ZA 2O8FA 2P9LA 1Q82O 4CCHA 1NBWA 1JLGA 4U7BA 4JI7K 2YKNA 4WFAL 4AHTA 2QEXN 2E2NA 4BG8A 3OYJA 3W0LA 3D2EB 4G1QA 1S22A 3F73A 3CJ7A 4LH4A 1JKHA 2WUSA 2G8HA 3A2FA 3QERA 1BWFO 1K73O 3ZSOA 4M42A 1N34K 3HZ6A 3P5JA 2FF6A 3NAEA 4CZMA 1BL3A 5I9EB 3SAGA 1LW2A 3O5BA 1QSLA 2PYJA 2HB5A 1TYQA 3UE5A 3VF6A 2DY4A 1WNSA 4JNEA 5AQXA 1V4TA 1WOQA 3SV3A 4HCBA 3ENBA 4NB4A 2QWNA 3F9MA 3M3ZA 4JS4A 4CGIA 1LOTB 3DLRA 1RDAA 1NK0A 4DQ8A 1JL2A 3K2PA 1C6VA 1XC3A 3N4PA 4FLYA 3DXKA 4NCAA 3AA5X 4E19A 3WXMB 1BIZA 3A0IX 1RT5A 2XY6A 4KHQA 2UUAK 1L3TA 3OBWA 4FZYA 3AVCA 3CG7A 4B9LA 4M3UA 4IEIA 1Q18A 5BPLA 4ILGB 4BDYA 4YOYA 1ZBHA 2P9NB 2E5LK 4NXMK 1NK4A 1NMNA 4IEEA 1ZYQA 1JLCA 5HP1A 4DQIA 1KAZA 2KQ2A 3ZT3A 2BDPA 4F3TA 1LWFA 1VQ9N 1DKGD 3BF3A 2Y1JA 1T05A 1ZC6A 4E7LA 1D4XA 1TK5A 3K59A 4BC5A 4KHNA 1RT1A 3KIOA 3DMJA 2D5RA 3NH1A 3QEPA 4CI6A 4DFKA 4FWQA 3VN5A 3M6GA 3AV9A 4A2AA 1KQSM 4KH5A 4E7JA 1MU2A 2VQFK 5BRFA 1WUAA 3SAHA 3SUQA 3ASMA 2QWLA 4JHDB 3UIQA 3CMEN 2NRWA 2BH1A 3G25A 1YTUA 4XH1A 1ESVA 1XHXA 3LP3A 4E1MA 3DWLA 4B9QA 5LJVA 4EZ6A 1RT7A 1G99A 2V7ZA 2E2PA 2HF4A 3L2UA 4A59A 5F2RA 3ENOA 2KW4A 4FJKA 3I33A 1BA1A 4B3SK 4H0TB 1C0TA 3ID6A 4YOTA 4FK0A 2KZZA 1SUQA 4B9NA 5DMRA 4ZHRA 2WOMA 4FWOA 4M7XA 1B9DA 1CXUA 1KVBA 4TSXA 3VERA 4KREA 3K9JA 3SLCA 4O8KA 4J2DA 2P9PA 1QVFM 3TANA 4FJHA 5F1XA 3WQUA 3LDLA 1VSKA 1NK8A 1L3VA 1X3NA 5AQRA 4O0IA 4IZ9A 2D0PA 2FSKA 3TPQA 3S3OA 5AQQA 4CJUA 3CHWA 3IKMA 3O9QA 4BRQA 3VMFB 3T3FA 3LANA 3QEIA 2OYQA 4GY2B 4CHOA 4CZIA 5D3GA 3DLBA 1ITGA 3KK1A 5AFUH 2EWSA 1X9MA 2O4GA 1JCFA 4FK2A 3OS2A 1IKVA 3VQ7A 3AA4A 1C0UA 1HNIA 1IBMK 3KLIA 1BISA 4AM6A 3NMUA 2NRVA 5HL7L 1HYVA 2HF3A 4N41A 1RDUA 3WQTA 4CK2A 1M90O 4H0OA 2AA4A 2HHQA 4FJMA 4PKIA 4H0YB 4MO4A 1WB9A 2P9KB 3CJAA 5JVHL 2ZWHA 1BQMA 1EXQA 4ID5A 1LW0A 3T1AA 3OYNA 5C24A 5HBMA 3VF2A 5KGWA 1R59O 2P1JA 3ATVA 3FR0A 2RKIA 3KLEA 3AO2A 4IJNA 1RT6A 1RDDA 5HRSA 4NYNA 4CF0A 4BE1A 3OYFA 3TSUA 2Q31A 2CH5A 2W41A 3MXJA 3S3NA 1S6PA 1K8KA 5BRHA 2ASMA 4DU4A 1SL2A 4JK7A 1W9HA 2HVIA 2OZSA 4BC4A 2YHYA 4R5PA 5BR9A 4F2SA 2E20A 3CD6N 4GVEA 4BDZA 4LF6K 4XH4A 5GINA 3CXCM 3AVBA 3HSTB 4JI8K 1VSEA 3WT0A 1HQEA 3K5LA 1WSFA 4KTWA 3J81O 2YJFA 1WSIA 3ULDA 4BG9A 1T03A 2IS3A 4KHYA 1XMQK 3M8QA 4CZJA 2HSTA 1GLAG 3C6TA 4IG0A 4DV3K 1RTIA 2HW3A 3SQ4A 5EY4A 1U47A 1VSLA 2QM1A 3KZBA 3N4QA 3L4IA 3LALA 5DM6L 4F8RA 3L4QA 3TSPA 3THXB 5AQUA 4AHCA 4CEOA 3L3UA 1LAVA 2BUPA 4CF9A 4X66K 3NF9A 2YNGA 4FM0A 3C7NB 4CJKA 3MWPA 5A2QO 1LWEA 1X9SA 5KQ8A 3NHGA 3ULEB 2X78A 2E6MA 1A5XA 4M63C 4BRGA 5HOOA 3FLCO 1NJIO 4CEZA 1K8KB 3CF5L 1F21A 3CCLN 1RGIA 2Z1HA 3OYLA 3O3FA 3NF7A 2IDOA 4PL7A 1NM1A 4JI0K 1TUYA 2G8FA 1NGFA 2FBTA 1L3SA 1BQNA 3VQ9A 5KGXA 3CI5A 4YDUC 4LF7K 4FJLA 1TAUA 5AR0A 3VGKA 2QWPA 1WAJA 3L8BA 2ASOA 3HI0A 1I39A 3VQAA 3F2KA 4JK9A 3H45C 3OJSA 3PV8A 3PY8A 4AF1A 2OANA 3NGYA 4CEDA 1Q7YO 3EN9A 3VOVA 4K43A 4M45A 5KRSA 4E7HA 5AQFA 3EKUA 3G6EN 1IV0A 1EO1A 2HBJA 1UA1A 3DI6A 2AP1A 2HHXA 1KSPA 4FVMA 4OGCA 4IDHA 4WQ4C 4YOXA 1OH7A 4NO7A 5GADP 3CCSN 1WN7A 4FOEA 4K42A 1W2BM 1VSHA 3THWA 3VEZA 4LF5K 2P5GA 2KKZA 3VEVA 3LP1A 4C8KA 2BTFA 3CPWM 4I7FA 2GBZA 4E3SA 4CJFA 4BRPA 3SYZA 5E84A 4IO9L 4IXCA 2X6NA 1TK8A 4CF1A 4FM1A 3R6MA 4QS7A 3ALYA 4BACA 3V4IA 4CIFA 1VK0A 3BY5A 3AO1A 4BC2A 3OYBA 3SAFA 3U6FA 3MXIA 3DM2A 1SV5A 4PUOA 4QS9A 3SMSA 3E1YA 3QMLA 4IO8A 1RFQA 5C12A 4DV5K 4BRDA 2GWJA 4BRHA 5JS1A 2JWLA 1O1WA 3FZHA 4MLHA 3VGLA 1HX1A 3MCPA 1VQ4N 2BANA 4Q5VA 5SZTA 3WNFA 4B8AB 4N56A 5KPRA 1LWCA 1NGJA 2OPRA 3ZSXA 2F96A 4JV5K 4Z4CA 4LD0A 4ELVA 3O1BA 3CCVN 2A1SA 4DB3A 1KCFA 4BRCA 3VA0A 3VESA 5F0XA 4GV9A 4PQUA 2ZGYA 3ZYYX 2YCHA 4NYFA 4N47A 1T8EA 3OJUA 1S1VA 3AVNA 1NGIA 1XUPO 3UKRB 3ZT4A 4BR0A 5C2FA 2RE2A 2VCPA 4AM7A 1TKTA 4Z4GA 1ASVA 3TAMA 2NRHA 1WSHA 5AQOA 1TVRA 4FWRA 3ZSWA 4CESA 4CF8A 3V1RA 5BRDA 2P9NA 1RBVA 3L2WA 3I8DA 1J9AA 4JKAA 4WCEL 1YVUA 2G8UA 2VWBA 3AVFA 1ASUA 1RILA 4CFAA 3U9ZA 2UUBK 2QTDA 4CJTA 2HHHK 2B4JA 1RTDA 2BE2A 1HNXK 4F4KA 4DQSA 1TKZA 4JRPA 2YHBA 3NBPA 2ETJA 4X62K 3JS6A 4BGBA 4CGHA 4BQZA 3O8MA 3MDQA 1EX4A 3A5NC 2QI2A 4LH5A 1X9WA 3AGKA 4C8NA 3ZETA 3P1GA 1LCUA 2UXDK 2H3GX 3FFKB 4HCCA 3RVCA 1BU6O 2V7YA 1KLNA 4CERA 1A5WA 3VEYA 2E8AA 4F2RA 4W5QA 4CZEA 1YT3A 1K9MO 3O9RA 1JL1A 3SCXA 4BQLA 4DSLA 1FKOA 4CEQA 4U67L 4KV8A 4GKKK 4ISEA 4ELUA 3ZSYA 4DF8A 2O8BB 3OYMA 4CHYA 4KHSA 3AVHA 3RMBA 2CGJA 3CCJN 3QDKA 2PYLA 2Z1GA 3MEDA 4YHHK 4I9QA 2VG6A 3VEOA 3WEEB 2GUPA 3MECA 3THYA 4BVPA 3HYFA 3K0SA 2P5OA 2GX9A 4CJ3A 1BUPA 3UKUB 2QWOA 3QNOA 4KHPK 3SNNA 1S72N 1Y64A 4BY9C 5JMVA 2HMPA 1YF5L 3KVGA 4IFEA 2A5XA 4CIEA 3KK7A 3VEWA 1VQON 4GV6A 4GKJK 5DM7L 1JCGA 3VQ5A 3KJVA 1EWQA 4L3QA 1C0FA 2Q97A 3O6WA 4AH9A 1WBBA 4Y0WA 1S9EA 1CZ9A 1VQLN 3WNGA 3AA2A 3RTVA 1U6ZA 1NJZA 1I94K 1GLJO 3D6RA 4A61A 4JRQA 1YIJN 4NLCA 5EXWA 3K5OA 3RRHA 1S3XA 4BR9A 3KLFA 2XY7A 3CM5A 1B9FA 3QICA 4FLWA 3MK6A 3GBTA 1DGKN 1Z05A 3HJFA 1YHQN 4K8XA 4B9MA 1X3MA 1UWBA 3T7ZA 3SQ1A 4OKEA 3ID8A 1C1AA 3ZT1A 2NRTA 4JKFA 3WXLA 4HTUA 1XNRK 3Q7CA 4CEBA 1BOTO 4C1NK 1XI1A 5CYMA 4CE9A 2YX6A 2QK9A 3TAQA 1EP4A 2OPPA 4M7YA 4CIGA 4KH4A 4EIAA 3NGZA 3SBGA 5LY3A 4J2BA 1FW6A 2VQEK 3O4WA 3ZLJA 3AVAA 1KRPA 5KPZA 4HUEA 3AVGA 4FWLA 5J2QA 1W7AA 4JYAK 4DF4A 3SUOA 3CIPA 1RT4A 5AQMA 2YNIA 3VA3A 1S6QA 4DSEA 4A2BA 4BGAA 4JI5K 3EO3A 3K57A 3U4LA 2KFZA 1IKXA 2Q2RA 2IGIA 4C1NI 4YORA 2XY5A 4LSLA 4DR1K 5JLFA 3HP9A 4OKKA 4FJJA 5M1PA 2QKBA 5FRMA 1VQMN 3KK2A 1HNVA 2W40A 4CJ5A 4H4MA 4E0DA 1DLOA 1HNZK 2ZM6K 4DTUA 1TYQB 2ITMA 1NGAA 3LAKA 2IVPA 3QFUA 2IAJA 3C6HA 1YUWA 2YHWA 2P9SB 3GDQA 1T3VA 1W0HA 4JD2B 1H1VA 4XEIA 1NGHA 1GLBG 2OTLN 2VGNA 3AAQA 3HPOA 3JYTA 2YJEA 1DTQA 4FPBA 3VQBA 2FBXA 4M41A 3AGRA 4E1NA 5KPTA 3KWGA 4RCHA 5AQJA 4E1JA 1FKPA 3BDPA 4IOAL 4JEPA 3NF8A 4ILJA 4O0JA 3CJ9A 1BIUA 1QZ5A 4DUZK 4BE0A 3ZT2A 3DLKA 3GOIA 3TABA 1RBUA 3CC7N 3MEEA 3T1YK 3AAPA 3RMCA 3ZSRA 2UUCK 2UXCK 1SAZA 2G8KA 1GLDG 4DU1A 3D45A 4WYBA 3T69A 3DRSA 3LDQA 3NGIA 3A5MC 1YI2N 2GV9A 3A8YA 1VQ5N 4W5RA 4MLEA 3QNNA 2J4RA 1VQKN 2P9IA 3VQEA 1T44A 3D2EA 4BDPA 1QHTA 4DUYK 3M1FA 2HHWA 2ZQBA 3FGUA 3BZCA 1C1CA 3DJCA 3C95A 3MWTA 4FLVA 5AQZA 1TGOA 3OYAA 3CC4N 2P9LB 1J53A 3CETA 5ADXH 4DU3A 1C0GA 3MCAB 3FZFA 2ZJQL 5FPMA 4GW6A 5J1EA 3SPYA 2KTQA 1WBDA 3TTDA 2E2OA 2FSJA 4NCGA 4EAHD 2VG7A 1YTAA 3IDHA 1LV5A 5HROA 3K5MA 1NK6A 4LFCK 2RHKA 2QXFA 3CFRA 4FLXA 4B3RK 1TV6A 1UOCA 4AHSA 1NMDA 3U3YA 1TK0A 4DR2K 5LJWA 3D2FB 3VQ6A 1IG8A 1KVCA 5H1SQ 5EOYA 3NH2A 4Z94A 3RSEA 1UAXA 3AVLA 1EQYA 1NLVA 3AA3A 1ATNA 3MN5A 1EKEA 5ADXA 5AQHA 4DV2K 3F5TA 3MAQA 1G15A 3LDSA 1A5VA 2Q3SA 4K41A 4N5SA 1TUUA 4WQ4A 4YOVA 2FBYA 2F4VK 3O9UA 2HMIA 4KI4A 1HPZA 2F7TA 5AQVA 1ATSA 4YNQA 4EP5A 3ZEUA 1S1UA 4FZZA 1IKWA 3THYB 2HOEA 4JKGB 5JVGL 2PY5A 1OKJA 3FZMA 4IDKA 4DTRA 3LPUA 1Z26A 3EE8A 4B9VA 4YDUA 5C2DA 3CCRN 1S1XA 3TTFA 1NK7A 1MDUB 1MA9B 2HHUA 5BPNA 4XIUA 4DQQA 5FPDA 2GUIA 1VSJA 3DXMB 2OA8A 3AO3A 5JLHA 4DTMA 4KRFA 4CD3A 1RDWX 4CJSA 3CYMA 4FW2A 3SJHA 1XWLA 3RMDA 3V9XA 4DV4K 5SWMA 3RR7A 2O8CB 5LMUK 1U45A 4B9TA 5BPMA 3HPHA 3UKRA 1RNHA 2O8EB 4A62A 3LP2A 1HJRA 3H1QA 3V1OA 3O4NA 5AQSA 3EE9A 4PKHA 3C7NA 3GL1A 4B08A 1RDBA 5AQPA 5AQYA 4Z4EA 5KQDA 1RCHA 5I42A 1GOCA 4WF9L 3QO9A 4AILC 4N76A 2QA4N 4PY5A 3KWIA 2QWMA 4CZHA 4FJXA 3RMAA 3ZX3A 1SS6A 5GIPA 4CBUA 1KTQA 3P31A 1HYZA 3TU5A 3L3VA 4IFVA 1VSMA 4I6MB 4B1XB 3AO5A 4FOIA 3V81A 2O8DB 3OYEA 3PX6A 4DR7K 4JI4K 2V52B 3ATUA 4DLGA 5AQNA 1TL3A 5EU7A 2UU9K 2PAVA 4PA1A 5BN8A 3KLHA 4BWMA 2O4IA 1Z25A 5M1KA 4L8RB 2NLXA 5FPNA 2FBVA 1KLMA 1XHZA 4Z4IA 3QEXA 3M8SA 1C1BA 4HVJA 4FJGA 4B1ZA 5AQTA 1S1TA 1WSGA 3NH0A 3NDKA 4FLUA 3H6EA 4H5TA 1TAQA 3U9DA 3VENA 4FL9A 2E1YA 1DT9A 1L3UA 4QCLA 4CJ7A 3A5LC 4CVNE 4IOXA 3OYIA 3BGRA 5C15A 4ICLA 1KC8O 1JCEA 4Y1DA 2IC3A 2G8WA 4PL8A 4FM2A 3PX4A 4CJWA 3V9SA 4DTSA 3IS9A 3MN9A 3IAYA 3TAGA 1ILYA 5AZJA 1S1WA 1TKDA 3DLEA 3V9ZA 4O55A 4OKJA 4IFYA 2RF2A 2P9UA 4LY7A 3AY9A 4IWVA 2DTUA 2O8FB 4LF4K 1CLQA 3LWMA 2NUBA 4O4GA 4O8UA 3HO1A 4KHWA 4M3YA 2D4WA 3F9KA 1NU0A 3EYZA 4EHUA 4MFBA 4FYDA 4I6MA 3H3OB 3IUCA 3CERA 3E66A 1VRTA 3WNHA 3H3NO 3TAPA 4OPHA 4CGFA 1VHXA 3KKRA 3MXMA 2F8SA 1L5UA 5C0YA 2NRZA 4V19S 1QS4A 2B6AA 4CZKA 4LC9B 2XHBA 2HBMA 3G10A 2IOCA 3I0SA 2OPQA 3DOKA 3OVNA 1NGCA 4FCYA 3QIPA 4DFJA 4KPYA 1HNWK 4M3ZA 4AHVA 3C65A 1HPMA 2NRXA 4DCHA 4H03B 1SQKA 4M3TA 4JD2A 1JLFA 4M3XA 2I7PA 1KXPA 3DLGA 1BI4A 3O3HA 3K58A 1VAZA 4DQRA 2Y1IA 5CHIA 3CQ8A 4KTZA 4FWKA 1Y97A 4CGGA 2KFNA 1YJ9N 1ZBUA 4H5RA 4H5WA 3SPZA 2B5JA 4LF8K 5T7BA 2G8IA 3QBWA 3OYCA 4F3OA 3PIPL 2JLEA 2W6LA 4DTPA 1BCMA 4I2QA 2XY8A 1J5OA 3QESA 4E7KA 4KTQA 1U49A 4HUFA 1RDCA 3I0RA 4J2EA 4RG8A 4CHPA 2OCEA 4CJLA 3SK3A 1M1KO 1RT3A 5IT9O 4BROA 4GMJB 1QQMA 5GAHP 1K6YA 1D8YA 1KFSA 2OTJN 5M1NA 3MN7A 4DQPA 4WE1A 1WSEA 3D7EO 4HTLA 1BCOA 4KFBA 4OPKA 4XH5A 3OW2M 4CW7B 4DSKA 4DR5K 1VQ7N 4OLAA 1D5AA 2JWKA 4H5VA 4DSFA 3BZKA 2FC0A 1BO5O 4MO5A 4DR4K 3AARA 4EFHA 4JKCA 1NKBA 1B92A 4KB1A 2WC9A 4YFUA 4DMNA 3NVMA 4X65K 1V4SA 1QSYA 2F8TA 4EHTA 1E3MA 3HVTA 1E4GT 4FZXC 2VG5A 3ENHA 1JLEA 3VGMA 1NWKA 4JK8A 3C0BA 3V9WA 2EX3A 3TSQA 1NGGA 5ELZA 1SZ2A 3LPTA 1N6QA 4HWIA 1N8RO 1HRHA 4FJIA 5AZIB 3DAWA 2WONA 3AVMA 3NE6A 3L2QA 4WFNL 4CFBA 4LFAK 3OYDA 4LSNA 3RWUA 5CZ2A 1JLBA 4CD1A 3QEWA 4CJ4A 4NCBA 4A57A 2VWKA 4PKGA 2HVHA 4CEEA 2HNDA 3SUPA 3TTCA 4JN4A 3BEXA 3L0QA 3FE1A 3THVA 1HMVA 3E9PA 4CK3A 1YXQA 1U4BA 3J7AP 3L2VA 1Q9XA 3HPGA 2QWQA 5GAEP 3VQ8A 3JSMA 4H0XB 1ZXOA 4CHNA 2VGMA 3P39A 3CCUN 3S9HA 2Q0UA 3LDOA 3JAMO 3U3GA 5GAGP 2HNYA 3EZWA 4C23A 4CJRA 4B9UA 2P51A 3G71N 3SQ0A 1CXQA 4FO0A 4JS5A 3M5RA 4IG3A 3VF4A 3IMXA 5FPEA 4B3OA 3SQ2A 1VSDA 1HKBA 3CJ1A 2YNHA 3J7YP 1IG9A 2NRRA 1QTMA 4B8CA 1ASWA 3C6UA 2BGGA 3LZIA 2I7NA 5K14A 3IRXA 2E1ZA 2EHGA 2AJQA 4DKWA 4H0PA 3MX5A 4FWPA 4OLBA 1HLUA 1P8ZA 2XO7A 3RRGA 4BRFA 1YJNN 4H0VB 3OTOK 5AQLA 1T6CA 4IOCL 2ZD1A 3MN6A 4H8KA 1VSFA 4AQYK 1P90A 2Z1IA 3OHRA 4GNIA 3QINA 3TAEA 3PSFA 1KFDA 4CZGA 2D0AA 4DWIA 2ASPA 4EZ9A 2RN2A 3B6OA 1N5YA 3IG1A 4W5OA 1NJWA 3QBXA 3HTVA 4HHTA 3DRRA 4NLBA 3HM8A 2I5JA 2FSNA 4W5TA 4CJEA 3Q7BA 1KAYA 3D0PA 4BC3A 1GLEG 3BUZB 1W97L 1NKCA 1D9DA 2WFBA 3VTIA 3ZX2A 4OPJA 4FJ9A 1OVYA 3OBYA 3O1WA 2DFHA 1QZ6A 4DSIA 3PLAA 4A5BA 4E7IA 4BRIA 1T6DA 3CM6A 4JKBA 1NGEA 1MWMA 3ZSVA 1XC9A 3H46O 2HNZA 3MX2A 4BVOA 4ZTFA 1IBLK 2Q1NA 4YOUA 5E26A 1OH6A 4CEFA 5BR8K 2GTDA 3KKSA 3WNEA 4B9SA 2O8BA 1OVQA 3HSCA 2HHTA 4CHZA 3KTQA 3PSIA 4FWNA 4FWMA 4FWSA 4RW7A 4FSVA 4DV1K 3O9SA 4CHQA 2PBDA 3LL3A 5AQIA 5LL6Z 1BI4B 4FJ8A 4DV6K 2DFEA 1U04A 1HR0K 2IVNA 3HOTA 5BN9A 1K8AO 3VQ4A 1NK5A 4FPAA 4Z0UA 3L2RA 3CC2N 1HUXA 4PWDA 3HVRA 3VQCA 3WEEA 4DHYA 3ZCMA 3QEVA 4QAGA 3ISNC 2R7YA 3R1XA 1IH7A 4R79A 2OZMA 4JKEA 2P9PB 3OS0A 1Q8IA 4GV3A 4Q0BA 1S9GA 4FK4A 4OO1J 3O80A 2W6KA 1ZBIA 1FK9A 4O44A 2A6AA 2O8DA 3QLHA 3S41A 3DOLA 4M3RA 1SKWA 1Q9YA 5HLFA 2FLOA 2QWRA 3AVKA 3VQPA 5KRTA 1KD1O 4DS4A 5AJ3K 3MEGA 2UXBK 4AHUA 2CGKA 4BR7A 4CBWA 3DXKB 4K25A 2PFUA 3T1HK 4KAZA 4BRAA 3LDNA 1VQPN 3O08A 1FJGK 2E2QA 3ZSZA 5KTQA 5DK5A 1J5EK 2HHSA 3WUHA 5B8HA 3P38A 2YV0X 4O5BA 2E4LA 4OPAA 3M8PA 4JKHA 4K0KK 5AFUA 4OX9K 4RW9A 1WSJA 3I8BA 1QE1A 3SUNA 3T19A 1FXXA 4DLEA 5FDLA 2DFFA 1YJWN 4ZTJA 3KLGA 5FRNA 3PUFA 3PO4A 4FXDA 1XMOK 5I3UA 5IWAK 2Z1JA 2ZF5O 5LMNK 2CH6A 1NGBA 3NCIA 3UB5A 5EVZA 1EWRA 3DLHA 1XNQK 3HP6A 2F9WA 4BRMA 5M1FA 3OYHA 3BF1A 3B6PA 4DR3K 2X74A 3E01A 5BREA 1ATRA 4O5FA 1D9FA 2NZTA 1VQ6N 2YHXA 3VETA 3ZX0A 4KHUA 4DTOA 1NOYA 4BRKA 3PO5A 5TKYA 2GELA 3V9UA 1GLLO 1O13A 2P9SA 1RBTA 1Z6RA 3EKSA 5AQGA 3AVIA 3FZKA 1REVA 1HYSA 3WXIA 1U2VB 3ZETB 5CE3A 2UYTA 4CZFA 2CGLA 4DFMA 4Z4HA 4CFCA 5JICA 1VRUA 1JXEA 1J6ZA 1BHLA 3DRPA 2D0CA 3QFPA 1RBRA 4B1WB 1TKXA 4DS5A 4I2PA 1HQUA 3AO4A 2E88A 3LAMA 2KZMA 4JI3K 2ATQA 3SI6A 5AZJB 1QQCA 3CQYA 4IBNA 3KHYA 3W3DA 4KI6A 1J54A 4BE2A 4B3MK 4KH6A 3LM2A 1JLQA 1JXBA 3OA9A 5M1OA 3KD5E 2P9UB 3GE1A 3SZ2A 1CZAN 2GEMA 4DFPA 1VQNN 3QIOA 5FROA 4IKFA 3S3MA 3ZEUB 4DV7K 4YOWA 1NK9A 1NNEA 4UQGA 4CGDA 3FZLA 4KB0A 3L6QA 1NJXA 3HT3A 3HOSA 2Q36A 1TL1A 1UA0A 2E6LA 2ZJPL 3MMVA 4YY3K 5JS2A 4RW4A 1XQSC 5C10A 2W42A 4QOZB 3EL2A 5AQWA 4RW8A 1IKYA 4CF2A 1MWKA 4WQ5C 4ILHA 4J2AA 2YHAA 3PX0A 5CY4A 4DR6K 3QETA 1RT2A 3KD1E 4CBXA 4I9LA 4JLHA 4JHDA 4FJNA 3KK3A 3EEQA 4BRNA 3J7ZO 2NNWA 1QVGM 3THWB 4B3TK 4DG1A 5CR4A 1IBKK 3LDPA 3TAFA 1QQOA 1WAFA 1SKSA 4CFDA 4C8OA 3E9LA 4JI1K 1NKEA 4ISGA 4MDAA 4LFBK 3V6DA 3LWLA 4KO0A 2X6SA 2V51B 2A3ZA 3LM9A 4FJ5A 1E4FT 3PIOL 2A42A 2Q0RA 3D2FA 4BR4A 5HRRA 3ITHA 2ITGA 1ZBFA 3OS1A 4RWTA 4BREA 1I3AA 5CYQA 5CZ1A 3VPZA 3K5NA 1R0AA 2D1KA 3TI0A 4A5AA 4KKOA 3ZSQA 5EX5A 3J80O 1YITN 1RBSA 1X1PA 3TWHA 5AZIA 1GLFO 5C25A 2HHVA 3H08A 4IJAA 1SL1A 3CFPA 4JKGA 2F9TA 3HL8A 2D0OA 2WBNA 4Y1CA 1EETA 2IIRA 3QB0A 1CZBA 4OJRA
chains in the Genus database with same CATH topology
3NE6A 3HPOA 1WSIA 3L2QA 3ULDA 3JYTA 4CK1A 4CFBA 5J2PA 1RTJA 1DTQA 2YNFA 3VQBA 4CEAA 2FBXA 4M41A 4CGJA 3OYDA 5KI6A 4LSNA 1T03A 2ZE2A 4C8LA 1NJYA 3DYAA 3RWUA 5CZ2A 1JLBA 4E1NA 3EY1A 4CJ4A 3QEWA 4NCBA 2JGUA 2VWKA 2XRIA 1FKPA 2IS3A 3HM9A 4KHYA 4CEEA 2PZSA 3BDPA 3M8QA 2HNDA 2HVHA 4ELTA 3SUPA 3C6TA 3NF8A 4IG0A 4O0JA 1RTIA 1BIUA 2HW3A 3SQ4A 4BE0A 4HUGA 1U47A 1VSLA 3DLKA 1HMVA 3ZT2A 3THVA 3TABA 4CK3A 1VSIA 1RBUA 1U4BA 3MEEA 3L2VA 3RMCA 1Q9XA 3HPGA 3AVJA 3ZSRA 3VQ8A 2G8KA 3JSMA 1SL0A 3G0ZA 4DU1A 3D45A 4MQ3A 4CHNA 3LALA 4H4OA 4F8RA 3DRSA 3S9HA 3NGIA 4FLTA 4W5NA 4AHCA 2GV9A 4CEOA 3U3GA 1QSSA 3L3UA 1LAVA 2HNYA 4W5RA 4CF9A 3QNNA 4CJVA 3TARA 3NF9A 4AHRA 4CJRA 2YNGA 4FM0A 4B9UA 3VQEA 2P51A 4CJKA 3SQ0A 1X9SA 1LWEA 3O3GA 4FLZA 5J2NA 1CXQA 4BDPA 3NHGA 4JS5A 1QHTA 3EZ5A 4OGEA 4DTJA 2X78A 2HHWA 2ZQBA 2E6MA 3RR8A 4FJ7A 1A5XA 3SJJA 1C1CA 4IG3A 3C95A 4FCYA 4FLVA 1TGOA 1KVAA 1NOZA 3OYAA 3SV4A 4B3OA 4CEZA 3SQ2A 1RTHA 1J53A 1VSDA 1ZBLA 4DTNA 2YNHA 1F21A 1IG9A 4K8XA 2Z1HA 4DU3A 3OYLA 3O3FA 1QTMA 4B8CA 3VQQA 3NF7A 2IDOA 1ASWA 3C6UA 2OPSA 1T7PA 3LZIA 2BGGA 5J1EA 4GW6A 3SPYA 2G8FA 2KTQA 3V1QA 5K14A 2FBTA 3OYKA 1L3SA 3FFIA 4NCGA 3IRXA 2VG7A 1GOBA 1YTAA 1BQNA 5C42A 3VQ9A 5HRNA 5KGXA 2G8VA 1LV5A 2EHGA 5HROA 4FJLA 2AJQA 3CFOA 3K5MA 1TAUA 4OLBA 1NK6A 2XO7A 2QXFA 3C94A 3CFRA 1LAWA 4FLXA 1TV6A 3RRGA 1WAJA 3OY9A 1UOCA 3L8BA 4AHSA 1I39A 3VQAA 3U3YA 3OYGA 3OJSA 3PV8A 1TK0A 2ZD1A 3PY8A 3NGYA 4H8KA 4CEDA 1VSFA 3LZJA 4C8MA 3VQ6A 2Z1IA 4GVMA 4M45A 1IO2A 5KRSA 4E7HA 1KVCA 5J2MA 3LP0A 3NH2A 3QINA 3TAEA 1UA1A 1UAXA 3DI6A 1S5JA 1KFDA 3AVLA 4FVMA 4OGCA 2D0AA 1KSPA 2HHXA 2A1RA 4DWIA 4OVLA 4EZ9A 3VQDA 5E41A 4FW1A 3AA3A 2RN2A 3P83D 1EKEA 1JLAA 3HXMA 3B6OA 1N5YA 3IG1A 3MAQA 1G15A 1WN7A 3LDSA 4W5OA 1NJWA 4RW6A 4HHTA 1A5VA 1VSHA 3DRRA 2LSNA 2Q3SA 2I5JA 2P5GA 4W5TA 4CJEA 4N5SA 1SKRA 3LP1A 1WLJA 4C8KA 3D0PA 4I7FA 2FBYA 2GBZA 4E3SA 3HK2A 1NKCA 1D9DA 3TR8A 2HMIA 4CJFA 4KI4A 4OPJA 1HPZA 3SYZA 1GOAA 4FJ9A 2X6NA 4ID1A 1TK8A 4YNQA 4CF1A 2RPIA 2DFHA 4EP5A 4FM1A 4DSIA 4E89A 3ALYA 1S1UA 2VWJA 4BACA 4FZZA 3V4IA 1IKWA 4CIFA 1VK0A 4E7IA 2YKMA 3ZT0A 2PY5A 3AO1A 3CM6A 4CJPA 4IDKA 4DTRA 3LPUA 1Z26A 3ZSVA 1XC9A 2HNZA 4B9VA 3NFAA 3OYBA 4ZTFA 1BGXT 3U6FA 1S1XA 4CJQA 4M3WA 3MXIA 1NK7A 3DM2A 4CEFA 1SV5A 3KKSA 3M8RA 1C0MA 4PUOA 4Z4FA 2HHUA 2D0BA 3O4QA 3WNEA 4B9SA 4XIUA 4DQQA 2HHTA 4CHZA 3KTQA 3NF6A 4BWJA 4RW7A 1DTTA 5JS1A 2GUIA 5HRPA 1VSJA 2OA8A 4DTXA 3AO3A 4DTMA 4KRFA 4EP4A 1O1WA 4CJSA 3CYMA 4CHQA 4KPYA 4FW2A 1XWLA 3RMDA 2QKKA 3V9XA 1BI4B 4CECA 4FJ8A 4DSJA 5SWMA 2BANA 3RR7A 4Q5VA 2DFEA 5SZTA 1U48A 4K8ZA 1U04A 1U45A 3WNFA 4B8AB 4B9TA 4CCHA 4N56A 3HPHA 1RNHA 1LWCA 3LP2A 1JLGA 1HJRA 2OPRA 3ZSXA 2F96A 2YKNA 3VQ4A 4AHTA 4Z0UA 3L2RA 1NK5A 4Z4CA 3V1OA 3OYJA 4LD0A 3O4NA 4G1QA 3F73A 3HVRA 4ELVA 4PWDA 3VQCA 4LH4A 1JKHA 3ZCMA 3QEVA 2G8HA 2A1SA 1KCFA 3A2FA 4B08A 4QAGA 1RDBA 3ISNC 3QERA 4Z4EA 3VA0A 2R7YA 4PQUA 1RCHA 5I42A 3ZSOA 1GOCA 4M42A 4NYFA 1IH7A 3P5JA 2OZMA 4N47A 1T8EA 3NAEA 1BL3A 3QO9A 4AILC 4N76A 1LW2A 3OS0A 1S1VA 1Q8IA 3OJUA 1QSLA 4PY5A 3AVNA 2PYJA 4Q0BA 2HB5A 3ZT4A 1S9GA 4FK4A 4FJXA 1ZBIA 3RMAA 1TKTA 4Z4GA 1FK9A 4O44A 1ASVA 2DY4A 3TAMA 1WNSA 1KTQA 1WSHA 1TVRA 1HYZA 3L3VA 4IFVA 3ZSWA 4CESA 4CF8A 3SV3A 4HCBA 3V1RA 3QLHA 1RBVA 1VSMA 3L2WA 4JS4A 3I8DA 4CGIA 1J9AA 3DOLA 4M3RA 1SKWA 3AO5A 3DLRA 3V81A 1Q9YA 1RDAA 1YVUA 1NK0A 5HLFA 3OYEA 1JL2A 3PX6A 3K2PA 2G8UA 3AVFA 4DLGA 3AVKA 1C6VA 1ASUA 1TL3A 3VQPA 5KRTA 4FLYA 5EU7A 4NCAA 1RILA 4DS4A 4CFAA 3MEGA 3AA5X 4E19A 4AHUA 4PA1A 3KLHA 1BIZA 4KAZA 1RT5A 4BWMA 1Z25A 2XY6A 4L8RB 4KHQA 2O4IA 1L3TA 4CJTA 4FZYA 3AVCA 3CG7A 2B4JA 4B9LA 4M3UA 2FBVA 1RTDA 2BE2A 1KLMA 3ZSZA 5KTQA 1XHZA 4F4KA 5DK5A 1TKZA 4JRPA 4BDYA 4DQSA 3QEXA 4Z4IA 3M8SA 2YHBA 2HHSA 1ZBHA 1C1BA 3NBPA 4O5BA 2YV0X 4HVJA 2ETJA 4FJGA 3NH0A 2E4LA 1S1TA 1WSGA 3NDKA 3M8PA 4FLUA 4CGHA 1NK4A 1TAQA 1ZYQA 1JLCA 1L3UA 4RW9A 5HP1A 1EX4A 1WSJA 4LH5A 4QCLA 1X9WA 1QE1A 4DQIA 3SUNA 3T19A 1FXXA 4C8NA 2KQ2A 3ZT3A 4DLEA 2BDPA 3P1GA 4F3TA 5FDLA 2DFFA 1LWFA 4ZTJA 2Y1JA 3KLGA 5FRNA 3PUFA 1T05A 4HCCA 3OYIA 3PO4A 4FXDA 4E7LA 3BGRA 1TK5A 1KLNA 4CERA 3K59A 5I3UA 2Z1JA 4ICLA 4Y1DA 1A5WA 2IC3A 4KHNA 1RT1A 3KIOA 3NCIA 3DLHA 2G8WA 3DMJA 3HP6A 2D5RA 3NH1A 3QEPA 4FM2A 4DFKA 4CJWA 3PX4A 4F2RA 4W5QA 3V9SA 4DTSA 3VN5A 3IS9A 3IAYA 3AV9A 3TAGA 4DFJA 1YT3A 4E7JA 3OYHA 3B6PA 1MU2A 1JL1A 1S1WA 3SCXA 4DSLA 1FKOA 4CEQA 3SUQA 3DLEA 3V9ZA 3ASMA 1TKDA 4KV8A 2X74A 3E01A 3UIQA 4O55A 4ELUA 1D9FA 4OKJA 3ZSYA 4IFYA 2RF2A 3OYMA 4LY7A 4DF8A 4CHYA 1CLQA 2DTUA 3LWMA 4KHSA 1YTUA 3AVHA 2NUBA 3RMBA 3LP3A 1XHXA 4O4GA 4E1MA 4KHUA 4DTOA 1NOYA 3PO5A 3V9UA 2Z1GA 3MEDA 2PYLA 4EZ6A 1RT7A 3HO1A 4KHWA 4I9QA 2VG6A 3L2UA 4M3YA 3F9KA 3EYZA 1RBTA 4MFBA 3MECA 4FYDA 2KW4A 4FJKA 1VRTA 3AVIA 3HYFA 1REVA 3WNHA 2P5OA 1HYSA 3TAPA 4CJ3A 4CGFA 3QNOA 4DFMA 1C0TA 3KKRA 3MXMA 3SNNA 4Z4HA 4CFCA 1VRUA 1JXEA 2F8SA 4FK0A 1L5UA 1BHLA 3DRPA 2KZZA 1QS4A 2B6AA 2XHBA 1SUQA 4B9NA 2D0CA 4CIEA 5DMRA 3G10A 1RBRA 2IOCA 4ZHRA 3I0SA 2WOMA 1TKXA 4DS5A 3DOKA 2OPQA 1CZBA 1B9DA 1CXUA 1HQUA 1KVBA 3AO4A 3OVNA 3LAMA 3QIPA 4I2PA 3VQ5A 4AHVA 3KJVA 4M3ZA 2KZMA 4TSXA 2ATQA 4KREA 4AH9A 4J2DA 4M3TA 1JLFA 3SI6A 4M3XA 3TANA 3DLGA 1BI4A 1QQCA 4FJHA 1S9EA 1VSKA 4IBNA 3O3HA 3K58A 4KI6A 1CZ9A 1NK8A 3WNGA 1J54A 4BE2A 4DQRA 2Y1IA 3AA2A 3RTVA 1L3VA 1NJZA 1JLQA 1JXBA 3CQ8A 4O0IA 4KTZA 3KD5E 4JRQA 3SZ2A 4DFPA 3S3OA 1Y97A 4CJUA 4CGGA 3K5OA 3RRHA 2KFNA 3QIOA 5FROA 1ZBUA 3KLFA 3T3FA 2XY7A 3CM5A 1B9FA 3LANA 3S3MA 3SPZA 4IKFA 2B5JA 3QEIA 2OYQA 4CHOA 5D3GA 5T7BA 2G8IA 4FLWA 1ITGA 3KK1A 3OYCA 3DLBA 1X9MA 4F3OA 2O4GA 4FK2A 2JLEA 3OS2A 1NK9A 4DTPA 3HJFA 1BCMA 4I2QA 4UQGA 1IKVA 2XY8A 3AA4A 3VQ7A 1C0UA 4CGDA 1NJXA 3QESA 1HNIA 1J5OA 4B9MA 4KB0A 3HT3A 4E7KA 1UWBA 3SQ1A 4OKEA 4KTQA 1U49A 1TL1A 4HUFA 1UA0A 1RDCA 3I0RA 4J2EA 2E6LA 3KLIA 1BISA 1C1AA 4RG8A 3ZT1A 4CHPA 4CJLA 5JS2A 1HYVA 4HTUA 4RW4A 2W42A 4N41A 4QOZB 4CEBA 4RW8A 1IKYA 1RT3A 4CF2A 4CK2A 1XI1A 5CYMA 4CE9A 2HHQA 4FJMA 2QK9A 4J2AA 2YHAA 4GMJB 3PX0A 3TAQA 1D8YA 1K6YA 5CY4A 3QETA 1KFSA 1RT2A 3KD1E 4I9LA 1EP4A 2OPPA 4JLHA 4CIGA 3NGZA 1BQMA 1EXQA 4ID5A 1LW0A 3T1AA 3KK3A 3OYNA 4DQPA 4J2BA 4FJNA 4WE1A 5HBMA 3AVAA 1WSEA 5C24A 1KRPA 5KGWA 4DG1A 4HUEA 3AVGA 5J2QA 1BCOA 1WAFA 2P1JA 4DF4A 3TAFA 1SKSA 4KFBA 4CFDA 4OPKA 2RKIA 4C8OA 4DSKA 3SUOA 3KLEA 1NKEA 1RT4A 3AO2A 4OLAA 2YNIA 1D5AA 3VA3A 1RT6A 1S6QA 4DSEA 3V6DA 3LWLA 4KO0A 1RDDA 3K57A 4DSFA 2X6SA 5HRSA 2KFZA 4NYNA 1IKXA 4CF0A 3OYFA 2FC0A 2IGIA 4BE1A 2XY5A 4FJ5A 4LSLA 3MXJA 4FJJA 3HP9A 4OKKA 3S3NA 1NKBA 1B92A 5HRRA 4KB1A 3ITHA 2QKBA 4YFUA 1S6PA 5FRMA 2ITGA 1ZBFA 3OS1A 4DMNA 3KK2A 1HNVA 4DU4A 1SL2A 1W9HA 1QSYA 2F8TA 2HVIA 1I3AA 5CYQA 2OZSA 4CJ5A 4H4MA 5CZ1A 3K5NA 1R0AA 4R5PA 1DLOA 4E0DA 3HVTA 4FZXC 3TI0A 2VG5A 4F2SA 1JLEA 4KKOA 4DTUA 4BDZA 3LAKA 3ZSQA 3V9WA 1RBSA 2IAJA 2EX3A 1X1PA 3AVBA 3HSTB 3TWHA 1VSEA 5C25A 1HQEA 1W0HA 3LPTA 3H08A 2HHVA 1N6QA 1SL1A 3K5LA 1WSFA 3CFPA 4OJRA 1HRHA 4KTWA 4FJIA 3HL8A 4Y1CA 1EETA 2WONA 3AVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NE6 A;  3HPO A;  1WSI A;  3L2Q A;  3ULD A;  3JYT A;  4CK1 A;  4CFB A;  5J2P A;  1RTJ A;  1DTQ A;  2YNF A;  3VQB A;  4CEA A;  2FBX A;  4M41 A;  4CGJ A;  3OYD A;  5KI6 A;  4LSN A;  1T03 A;  2ZE2 A;  4C8L A;  1NJY A;  3DYA A;  3RWU A;  5CZ2 A;  1JLB A;  4E1N A;  3EY1 A;  4CJ4 A;  3QEW A;  4NCB A;  2JGU A;  2VWK A;  2XRI A;  1FKP A;  2IS3 A;  3HM9 A;  4KHY A;  4CEE A;  2PZS A;  3BDP A;  3M8Q A;  2HND A;  2HVH A;  4ELT A;  3SUP A;  3C6T A;  3NF8 A;  4IG0 A;  4O0J A;  1RTI A;  1BIU A;  2HW3 A;  3SQ4 A;  4BE0 A;  4HUG A;  1U47 A;  1VSL A;  3DLK A;  1HMV A;  3ZT2 A;  3THV A;  3TAB A;  4CK3 A;  1VSI A;  1RBU A;  1U4B A;  3MEE A;  3L2V A;  3RMC A;  1Q9X A;  3HPG A;  3AVJ A;  3ZSR A;  3VQ8 A;  2G8K A;  3JSM A;  1SL0 A;  3G0Z A;  4DU1 A;  3D45 A;  4MQ3 A;  4CHN A;  3LAL A;  4H4O A;  4F8R A;  3DRS A;  3S9H A;  3NGI A;  4FLT A;  4W5N A;  4AHC A;  2GV9 A;  4CEO A;  3U3G A;  1QSS A;  3L3U A;  1LAV A;  2HNY A;  4W5R A;  4CF9 A;  3QNN A;  4CJV A;  3TAR A;  3NF9 A;  4AHR A;  4CJR A;  2YNG A;  4FM0 A;  4B9U A;  3VQE A;  2P51 A;  4CJK A;  3SQ0 A;  1X9S A;  1LWE A;  3O3G A;  4FLZ A;  5J2N A;  1CXQ A;  4BDP A;  3NHG A;  4JS5 A;  1QHT A;  3EZ5 A;  4OGE A;  4DTJ A;  2X78 A;  2HHW A;  2ZQB A;  2E6M A;  3RR8 A;  4FJ7 A;  1A5X A;  3SJJ A;  1C1C A;  4IG3 A;  3C95 A;  4FCY A;  4FLV A;  1TGO A;  1KVA A;  1NOZ A;  3OYA A;  3SV4 A;  4B3O A;  4CEZ A;  3SQ2 A;  1RTH A;  1J53 A;  1VSD A;  1ZBL A;  4DTN A;  2YNH A;  1F21 A;  1IG9 A;  4K8X A;  2Z1H A;  4DU3 A;  3OYL A;  3O3F A;  1QTM A;  4B8C A;  3VQQ A;  3NF7 A;  2IDO A;  1ASW A;  3C6U A;  2OPS A;  1T7P A;  3LZI A;  2BGG A;  5J1E A;  4GW6 A;  3SPY A;  2G8F A;  2KTQ A;  3V1Q A;  5K14 A;  2FBT A;  3OYK A;  1L3S A;  3FFI A;  4NCG A;  3IRX A;  2VG7 A;  1GOB A;  1YTA A;  1BQN A;  5C42 A;  3VQ9 A;  5HRN A;  5KGX A;  2G8V A;  1LV5 A;  2EHG A;  5HRO A;  4FJL A;  2AJQ A;  3CFO A;  3K5M A;  1TAU A;  4OLB A;  1NK6 A;  2XO7 A;  2QXF A;  3C94 A;  3CFR A;  1LAW A;  4FLX A;  1TV6 A;  3RRG A;  1WAJ A;  3OY9 A;  1UOC A;  3L8B A;  4AHS A;  1I39 A;  3VQA A;  3U3Y A;  3OYG A;  3OJS A;  3PV8 A;  1TK0 A;  2ZD1 A;  3PY8 A;  3NGY A;  4H8K A;  4CED A;  1VSF A;  3LZJ A;  4C8M A;  3VQ6 A;  2Z1I A;  4GVM A;  4M45 A;  1IO2 A;  5KRS A;  4E7H A;  1KVC A;  5J2M A;  3LP0 A;  3NH2 A;  3QIN A;  3TAE A;  1UA1 A;  1UAX A;  3DI6 A;  1S5J A;  1KFD A;  3AVL A;  4FVM A;  4OGC A;  2D0A A;  1KSP A;  2HHX A;  2A1R A;  4DWI A;  4OVL A;  4EZ9 A;  3VQD A;  5E41 A;  4FW1 A;  3AA3 A;  2RN2 A;  3P83 D;  1EKE A;  1JLA A;  3HXM A;  3B6O A;  1N5Y A;  3IG1 A;  3MAQ A;  1G15 A;  1WN7 A;  3LDS A;  4W5O A;  1NJW A;  4RW6 A;  4HHT A;  1A5V A;  1VSH A;  3DRR A;  2LSN A;  2Q3S A;  2I5J A;  2P5G A;  4W5T A;  4CJE A;  4N5S A;  1SKR A;  3LP1 A;  1WLJ A;  4C8K A;  3D0P A;  4I7F A;  2FBY A;  2GBZ A;  4E3S A;  3HK2 A;  1NKC A;  1D9D A;  3TR8 A;  2HMI A;  4CJF A;  4KI4 A;  4OPJ A;  1HPZ A;  3SYZ A;  1GOA A;  4FJ9 A;  2X6N A;  4ID1 A;  1TK8 A;  4YNQ A;  4CF1 A;  2RPI A;  2DFH A;  4EP5 A;  4FM1 A;  4DSI A;  4E89 A;  3ALY A;  1S1U A;  2VWJ A;  4BAC A;  4FZZ A;  3V4I A;  1IKW A;  4CIF A;  1VK0 A;  4E7I A;  2YKM A;  3ZT0 A;  2PY5 A;  3AO1 A;  3CM6 A;  4CJP A;  4IDK A;  4DTR A;  3LPU A;  1Z26 A;  3ZSV A;  1XC9 A;  2HNZ A;  4B9V A;  3NFA A;  3OYB A;  4ZTF A;  1BGX T;  3U6F A;  1S1X A;  4CJQ A;  4M3W A;  3MXI A;  1NK7 A;  3DM2 A;  4CEF A;  1SV5 A;  3KKS A;  3M8R A;  1C0M A;  4PUO A;  4Z4F A;  2HHU A;  2D0B A;  3O4Q A;  3WNE A;  4B9S A;  4XIU A;  4DQQ A;  2HHT A;  4CHZ A;  3KTQ A;  3NF6 A;  4BWJ A;  4RW7 A;  1DTT A;  5JS1 A;  2GUI A;  5HRP A;  1VSJ A;  2OA8 A;  4DTX A;  3AO3 A;  4DTM A;  4KRF A;  4EP4 A;  1O1W A;  4CJS A;  3CYM A;  4CHQ A;  4KPY A;  4FW2 A;  1XWL A;  3RMD A;  2QKK A;  3V9X A;  1BI4 B;  4CEC A;  4FJ8 A;  4DSJ A;  5SWM A;  2BAN A;  3RR7 A;  4Q5V A;  2DFE A;  5SZT A;  1U48 A;  4K8Z A;  1U04 A;  1U45 A;  3WNF A;  4B8A B;  4B9T A;  4CCH A;  4N56 A;  3HPH A;  1RNH A;  1LWC A;  3LP2 A;  1JLG A;  1HJR A;  2OPR A;  3ZSX A;  2F96 A;  2YKN A;  3VQ4 A;  4AHT A;  4Z0U A;  3L2R A;  1NK5 A;  4Z4C A;  3V1O A;  3OYJ A;  4LD0 A;  3O4N A;  4G1Q A;  3F73 A;  3HVR A;  4ELV A;  4PWD A;  3VQC A;  4LH4 A;  1JKH A;  3ZCM A;  3QEV A;  2G8H A;  2A1S A;  1KCF A;  3A2F A;  4B08 A;  4QAG A;  1RDB A;  3ISN C;  3QER A;  4Z4E A;  3VA0 A;  2R7Y A;  4PQU A;  1RCH A;  5I42 A;  3ZSO A;  1GOC A;  4M42 A;  4NYF A;  1IH7 A;  3P5J A;  2OZM A;  4N47 A;  1T8E A;  3NAE A;  1BL3 A;  3QO9 A;  4AIL C;  4N76 A;  1LW2 A;  3OS0 A;  1S1V A;  1Q8I A;  3OJU A;  1QSL A;  4PY5 A;  3AVN A;  2PYJ A;  4Q0B A;  2HB5 A;  3ZT4 A;  1S9G A;  4FK4 A;  4FJX A;  1ZBI A;  3RMA A;  1TKT A;  4Z4G A;  1FK9 A;  4O44 A;  1ASV A;  2DY4 A;  3TAM A;  1WNS A;  1KTQ A;  1WSH A;  1TVR A;  1HYZ A;  3L3V A;  4IFV A;  3ZSW A;  4CES A;  4CF8 A;  3SV3 A;  4HCB A;  3V1R A;  3QLH A;  1RBV A;  1VSM A;  3L2W A;  4JS4 A;  3I8D A;  4CGI A;  1J9A A;  3DOL A;  4M3R A;  1SKW A;  3AO5 A;  3DLR A;  3V81 A;  1Q9Y A;  1RDA A;  1YVU A;  1NK0 A;  5HLF A;  3OYE A;  1JL2 A;  3PX6 A;  3K2P A;  2G8U A;  3AVF A;  4DLG A;  3AVK A;  1C6V A;  1ASU A;  1TL3 A;  3VQP A;  5KRT A;  4FLY A;  5EU7 A;  4NCA A;  1RIL A;  4DS4 A;  4CFA A;  3MEG A;  3AA5 X;  4E19 A;  4AHU A;  4PA1 A;  3KLH A;  1BIZ A;  4KAZ A;  1RT5 A;  4BWM A;  1Z25 A;  2XY6 A;  4L8R B;  4KHQ A;  2O4I A;  1L3T A;  4CJT A;  4FZY A;  3AVC A;  3CG7 A;  2B4J A;  4B9L A;  4M3U A;  2FBV A;  1RTD A;  2BE2 A;  1KLM A;  3ZSZ A;  5KTQ A;  1XHZ A;  4F4K A;  5DK5 A;  1TKZ A;  4JRP A;  4BDY A;  4DQS A;  3QEX A;  4Z4I A;  3M8S A;  2YHB A;  2HHS A;  1ZBH A;  1C1B A;  3NBP A;  4O5B A;  2YV0 X;  4HVJ A;  2ETJ A;  4FJG A;  3NH0 A;  2E4L A;  1S1T A;  1WSG A;  3NDK A;  3M8P A;  4FLU A;  4CGH A;  1NK4 A;  1TAQ A;  1ZYQ A;  1JLC A;  1L3U A;  4RW9 A;  5HP1 A;  1EX4 A;  1WSJ A;  4LH5 A;  4QCL A;  1X9W A;  1QE1 A;  4DQI A;  3SUN A;  3T19 A;  1FXX A;  4C8N A;  2KQ2 A;  3ZT3 A;  4DLE A;  2BDP A;  3P1G A;  4F3T A;  5FDL A;  2DFF A;  1LWF A;  4ZTJ A;  2Y1J A;  3KLG A;  5FRN A;  3PUF A;  1T05 A;  4HCC A;  3OYI A;  3PO4 A;  4FXD A;  4E7L A;  3BGR A;  1TK5 A;  1KLN A;  4CER A;  3K59 A;  5I3U A;  2Z1J A;  4ICL A;  4Y1D A;  1A5W A;  2IC3 A;  4KHN A;  1RT1 A;  3KIO A;  3NCI A;  3DLH A;  2G8W A;  3DMJ A;  3HP6 A;  2D5R A;  3NH1 A;  3QEP A;  4FM2 A;  4DFK A;  4CJW A;  3PX4 A;  4F2R A;  4W5Q A;  3V9S A;  4DTS A;  3VN5 A;  3IS9 A;  3IAY A;  3AV9 A;  3TAG A;  4DFJ A;  1YT3 A;  4E7J A;  3OYH A;  3B6P A;  1MU2 A;  1JL1 A;  1S1W A;  3SCX A;  4DSL A;  1FKO A;  4CEQ A;  3SUQ A;  3DLE A;  3V9Z A;  3ASM A;  1TKD A;  4KV8 A;  2X74 A;  3E01 A;  3UIQ A;  4O55 A;  4ELU A;  1D9F A;  4OKJ A;  3ZSY A;  4IFY A;  2RF2 A;  3OYM A;  4LY7 A;  4DF8 A;  4CHY A;  1CLQ A;  2DTU A;  3LWM A;  4KHS A;  1YTU A;  3AVH A;  2NUB A;  3RMB A;  3LP3 A;  1XHX A;  4O4G A;  4E1M A;  4KHU A;  4DTO A;  1NOY A;  3PO5 A;  3V9U A;  2Z1G A;  3MED A;  2PYL A;  4EZ6 A;  1RT7 A;  3HO1 A;  4KHW A;  4I9Q A;  2VG6 A;  3L2U A;  4M3Y A;  3F9K A;  3EYZ A;  1RBT A;  4MFB A;  3MEC A;  4FYD A;  2KW4 A;  4FJK A;  1VRT A;  3AVI A;  3HYF A;  1REV A;  3WNH A;  2P5O A;  1HYS A;  3TAP A;  4CJ3 A;  4CGF A;  3QNO A;  4DFM A;  1C0T A;  3KKR A;  3MXM A;  3SNN A;  4Z4H A;  4CFC A;  1VRU A;  1JXE A;  2F8S A;  4FK0 A;  1L5U A;  1BHL A;  3DRP A;  2KZZ A;  1QS4 A;  2B6A A;  2XHB A;  1SUQ A;  4B9N A;  2D0C A;  4CIE A;  5DMR A;  3G10 A;  1RBR A;  2IOC A;  4ZHR A;  3I0S A;  2WOM A;  1TKX A;  4DS5 A;  3DOK A;  2OPQ A;  1CZB A;  1B9D A;  1CXU A;  1HQU A;  1KVB A;  3AO4 A;  3OVN A;  3LAM A;  3QIP A;  4I2P A;  3VQ5 A;  4AHV A;  3KJV A;  4M3Z A;  2KZM A;  4TSX A;  2ATQ A;  4KRE A;  4AH9 A;  4J2D A;  4M3T A;  1JLF A;  3SI6 A;  4M3X A;  3TAN A;  3DLG A;  1BI4 A;  1QQC A;  4FJH A;  1S9E A;  1VSK A;  4IBN A;  3O3H A;  3K58 A;  4KI6 A;  1CZ9 A;  1NK8 A;  3WNG A;  1J54 A;  4BE2 A;  4DQR A;  2Y1I A;  3AA2 A;  3RTV A;  1L3V A;  1NJZ A;  1JLQ A;  1JXB A;  3CQ8 A;  4O0I A;  4KTZ A;  3KD5 E;  4JRQ A;  3SZ2 A;  4DFP A;  3S3O A;  1Y97 A;  4CJU A;  4CGG A;  3K5O A;  3RRH A;  2KFN A;  3QIO A;  5FRO A;  1ZBU A;  3KLF A;  3T3F A;  2XY7 A;  3CM5 A;  1B9F A;  3LAN A;  3S3M A;  3SPZ A;  4IKF A;  2B5J A;  3QEI A;  2OYQ A;  4CHO A;  5D3G A;  5T7B A;  2G8I A;  4FLW A;  1ITG A;  3KK1 A;  3OYC A;  3DLB A;  1X9M A;  4F3O A;  2O4G A;  4FK2 A;  2JLE A;  3OS2 A;  1NK9 A;  4DTP A;  3HJF A;  1BCM A;  4I2Q A;  4UQG A;  1IKV A;  2XY8 A;  3AA4 A;  3VQ7 A;  1C0U A;  4CGD A;  1NJX A;  3QES A;  1HNI A;  1J5O A;  4B9M A;  4KB0 A;  3HT3 A;  4E7K A;  1UWB A;  3SQ1 A;  4OKE A;  4KTQ A;  1U49 A;  1TL1 A;  4HUF A;  1UA0 A;  1RDC A;  3I0R A;  4J2E A;  2E6L A;  3KLI A;  1BIS A;  1C1A A;  4RG8 A;  3ZT1 A;  4CHP A;  4CJL A;  5JS2 A;  1HYV A;  4HTU A;  4RW4 A;  2W42 A;  4N41 A;  4QOZ B;  4CEB A;  4RW8 A;  1IKY A;  1RT3 A;  4CF2 A;  4CK2 A;  1XI1 A;  5CYM A;  4CE9 A;  2HHQ A;  4FJM A;  2QK9 A;  4J2A A;  2YHA A;  4GMJ B;  3PX0 A;  3TAQ A;  1D8Y A;  1K6Y A;  5CY4 A;  3QET A;  1KFS A;  1RT2 A;  3KD1 E;  4I9L A;  1EP4 A;  2OPP A;  4JLH A;  4CIG A;  3NGZ A;  1BQM A;  1EXQ A;  4ID5 A;  1LW0 A;  3T1A A;  3KK3 A;  3OYN A;  4DQP A;  4J2B A;  4FJN A;  4WE1 A;  5HBM A;  3AVA A;  1WSE A;  5C24 A;  1KRP A;  5KGW A;  4DG1 A;  4HUE A;  3AVG A;  5J2Q A;  1BCO A;  1WAF A;  2P1J A;  4DF4 A;  3TAF A;  1SKS A;  4KFB A;  4CFD A;  4OPK A;  2RKI A;  4C8O A;  4DSK A;  3SUO A;  3KLE A;  1NKE A;  1RT4 A;  3AO2 A;  4OLA A;  2YNI A;  1D5A A;  3VA3 A;  1RT6 A;  1S6Q A;  4DSE A;  3V6D A;  3LWL A;  4KO0 A;  1RDD A;  3K57 A;  4DSF A;  2X6S A;  5HRS A;  2KFZ A;  4NYN A;  1IKX A;  4CF0 A;  3OYF A;  2FC0 A;  2IGI A;  4BE1 A;  2XY5 A;  4FJ5 A;  4LSL A;  3MXJ A;  4FJJ A;  3HP9 A;  4OKK A;  3S3N A;  1NKB A;  1B92 A;  5HRR A;  4KB1 A;  3ITH A;  2QKB A;  4YFU A;  1S6P A;  5FRM A;  2ITG A;  1ZBF A;  3OS1 A;  4DMN A;  3KK2 A;  1HNV A;  4DU4 A;  1SL2 A;  1W9H A;  1QSY A;  2F8T A;  2HVI A;  1I3A A;  5CYQ A;  2OZS A;  4CJ5 A;  4H4M A;  5CZ1 A;  3K5N A;  1R0A A;  4R5P A;  1DLO A;  4E0D A;  3HVT A;  4FZX C;  3TI0 A;  2VG5 A;  4F2S A;  1JLE A;  4KKO A;  4DTU A;  4BDZ A;  3LAK A;  3ZSQ A;  3V9W A;  1RBS A;  2IAJ A;  2EX3 A;  1X1P A;  3AVB A;  3HST B;  3TWH A;  1VSE A;  5C25 A;  1HQE A;  1W0H A;  3LPT A;  3H08 A;  2HHV A;  1N6Q A;  1SL1 A;  3K5L A;  1WSF A;  3CFP A;  4OJR A;  1HRH A;  4KTW A;  4FJI A;  3HL8 A;  4Y1C A;  1EET A;  2WON A;  3AVM A; 
#chains in the Genus database with same CATH topology
 2A40 A;  3NVK A;  1NGD A;  5J2P A;  1BA0 A;  4CK1 A;  1Q86 O;  1RTJ A;  2YNF A;  4X64 K;  3R8E A;  4CEA A;  4CGJ A;  5KI6 A;  4C8L A;  3WXK A;  2ZE2 A;  1HJO A;  3DYA A;  1NJY A;  3EY1 A;  2JGU A;  1BG3 A;  1ZBS A;  2XRI A;  4B1U B;  3HM9 A;  2PZS A;  3O9T A;  4JAX A;  4ELT A;  4NXN K;  2GWK A;  1Q81 O;  4HUG A;  2HBL A;  2YI1 A;  1N33 K;  1VSI A;  3CCE N;  3AVJ A;  3K9K A;  1SL0 A;  3G0Z A;  3VEX A;  4UY8 O;  2O8C A;  4FVU A;  3B8A X;  4BRL A;  4MQ3 A;  1N36 K;  4H4O A;  3U8X A;  3P4I A;  1OH5 A;  4ISF A;  4FLT A;  4W5N A;  2O8E A;  1QSS A;  4CJV A;  3TAR A;  4AHR A;  4F9O A;  3RSE B;  5GIO A;  4FLZ A;  3O3G A;  5J2N A;  2WTU A;  1GLC G;  3CQX A;  3EZ5 A;  4OGE A;  4DTJ A;  4FJ7 A;  3RR8 A;  3SJJ A;  3ULE A;  3SV4 A;  1KVA A;  1NOZ A;  1N32 K;  4B1V A;  3JXU A;  4PHT X;  1RTH A;  1ZBL A;  2FXU A;  4DTN A;  1JJ2 M;  3THX A;  4JKD A;  3VQQ A;  4LF9 K;  2OPS A;  2ZJR L;  1T7P A;  1KAX A;  3V1Q A;  4JI2 K;  3OYK A;  1YVN A;  3FFI A;  4MDB A;  1GOB A;  1OH8 A;  5C42 A;  1BDG A;  2VYP A;  5HRN A;  2G8V A;  3C6A A;  1QHA A;  3CFO A;  3C94 A;  3DLL L;  1NG9 A;  1LAW A;  3OY9 A;  1X9J A;  3HRG A;  3CJB A;  3I55 N;  5M1Q A;  4RTF D;  3OYG A;  3R9P A;  2HBK A;  1QQN A;  4BR2 A;  4C8M A;  3LZJ A;  1YAG A;  4GVM A;  1IO2 A;  5J2M A;  2FF3 B;  3LP0 A;  3WXJ A;  1S5J A;  1HKC A;  2A1R A;  3I56 N;  4OVL A;  3VQD A;  5E41 A;  4FW1 A;  5TKW A;  3G4S N;  2KLA A;  3A5O C;  3P83 D;  2QXL A;  1JLA A;  3HXM A;  4WQ5 A;  4RW6 A;  2DPN A;  3DXM A;  2QW9 A;  2LSN A;  2KHO A;  4H5N A;  4BR5 A;  3CMA N;  1SKR A;  2P9K A;  1WLJ A;  5AQK A;  3SBT A;  3SMP A;  5MLC Q;  3GG4 A;  3CCM N;  3HK2 A;  4B1Y B;  3TR8 A;  1IJJ A;  3CPE A;  1GOA A;  4ID1 A;  2IVO A;  2RPI A;  5FLX O;  4E89 A;  3R3L A;  4J8F A;  2VWJ A;  4QS8 A;  2YKM A;  3CJC A;  3ZT0 A;  4CZL A;  3IFR A;  3CCQ N;  4CJP A;  1U2V A;  3NFA A;  3J8A A;  1BGX T;  4CJQ A;  4M3W A;  3VTH A;  4KBO A;  3H1V X;  3M8R A;  1C0M A;  4Z4F A;  4JI6 K;  2D0B A;  3O4Q A;  3HBT A;  4WFB L;  1HKG A;  3E9O A;  3NF6 A;  4BWJ A;  2A41 A;  1VQ8 N;  1DTT A;  2P9I B;  5HRP A;  4DTX A;  4DV0 K;  4EP4 A;  2QKK A;  1DEJ A;  4CEC A;  3UKU A;  4DSJ A;  2ZGZ A;  3BP8 A;  4G9Z A;  1U48 A;  4K8Z A;  2O8F A;  2P9L A;  1Q82 O;  4CCH A;  1NBW A;  1JLG A;  4U7B A;  4JI7 K;  2YKN A;  4WFA L;  4AHT A;  2QEX N;  2E2N A;  4BG8 A;  3OYJ A;  3W0L A;  3D2E B;  4G1Q A;  1S22 A;  3F73 A;  3CJ7 A;  4LH4 A;  1JKH A;  2WUS A;  2G8H A;  3A2F A;  3QER A;  1BWF O;  1K73 O;  3ZSO A;  4M42 A;  1N34 K;  3HZ6 A;  3P5J A;  2FF6 A;  3NAE A;  4CZM A;  1BL3 A;  5I9E B;  3SAG A;  1LW2 A;  3O5B A;  1QSL A;  2PYJ A;  2HB5 A;  1TYQ A;  3UE5 A;  3VF6 A;  2DY4 A;  1WNS A;  4JNE A;  5AQX A;  1V4T A;  1WOQ A;  3SV3 A;  4HCB A;  3ENB A;  4NB4 A;  2QWN A;  3F9M A;  3M3Z A;  4JS4 A;  4CGI A;  1LOT B;  3DLR A;  1RDA A;  1NK0 A;  4DQ8 A;  1JL2 A;  3K2P A;  1C6V A;  1XC3 A;  3N4P A;  4FLY A;  3DXK A;  4NCA A;  3AA5 X;  4E19 A;  3WXM B;  1BIZ A;  3A0I X;  1RT5 A;  2XY6 A;  4KHQ A;  2UUA K;  1L3T A;  3OBW A;  4FZY A;  3AVC A;  3CG7 A;  4B9L A;  4M3U A;  4IEI A;  1Q18 A;  5BPL A;  4ILG B;  4BDY A;  4YOY A;  1ZBH A;  2P9N B;  2E5L K;  4NXM K;  1NK4 A;  1NMN A;  4IEE A;  1ZYQ A;  1JLC A;  5HP1 A;  4DQI A;  1KAZ A;  2KQ2 A;  3ZT3 A;  2BDP A;  4F3T A;  1LWF A;  1VQ9 N;  1DKG D;  3BF3 A;  2Y1J A;  1T05 A;  1ZC6 A;  4E7L A;  1D4X A;  1TK5 A;  3K59 A;  4BC5 A;  4KHN A;  1RT1 A;  3KIO A;  3DMJ A;  2D5R A;  3NH1 A;  3QEP A;  4CI6 A;  4DFK A;  4FWQ A;  3VN5 A;  3M6G A;  3AV9 A;  4A2A A;  1KQS M;  4KH5 A;  4E7J A;  1MU2 A;  2VQF K;  5BRF A;  1WUA A;  3SAH A;  3SUQ A;  3ASM A;  2QWL A;  4JHD B;  3UIQ A;  3CME N;  2NRW A;  2BH1 A;  3G25 A;  1YTU A;  4XH1 A;  1ESV A;  1XHX A;  3LP3 A;  4E1M A;  3DWL A;  4B9Q A;  5LJV A;  4EZ6 A;  1RT7 A;  1G99 A;  2V7Z A;  2E2P A;  2HF4 A;  3L2U A;  4A59 A;  5F2R A;  3ENO A;  2KW4 A;  4FJK A;  3I33 A;  1BA1 A;  4B3S K;  4H0T B;  1C0T A;  3ID6 A;  4YOT A;  4FK0 A;  2KZZ A;  1SUQ A;  4B9N A;  5DMR A;  4ZHR A;  2WOM A;  4FWO A;  4M7X A;  1B9D A;  1CXU A;  1KVB A;  4TSX A;  3VER A;  4KRE A;  3K9J A;  3SLC A;  4O8K A;  4J2D A;  2P9P A;  1QVF M;  3TAN A;  4FJH A;  5F1X A;  3WQU A;  3LDL A;  1VSK A;  1NK8 A;  1L3V A;  1X3N A;  5AQR A;  4O0I A;  4IZ9 A;  2D0P A;  2FSK A;  3TPQ A;  3S3O A;  5AQQ A;  4CJU A;  3CHW A;  3IKM A;  3O9Q A;  4BRQ A;  3VMF B;  3T3F A;  3LAN A;  3QEI A;  2OYQ A;  4GY2 B;  4CHO A;  4CZI A;  5D3G A;  3DLB A;  1ITG A;  3KK1 A;  5AFU H;  2EWS A;  1X9M A;  2O4G A;  1JCF A;  4FK2 A;  3OS2 A;  1IKV A;  3VQ7 A;  3AA4 A;  1C0U A;  1HNI A;  1IBM K;  3KLI A;  1BIS A;  4AM6 A;  3NMU A;  2NRV A;  5HL7 L;  1HYV A;  2HF3 A;  4N41 A;  1RDU A;  3WQT A;  4CK2 A;  1M90 O;  4H0O A;  2AA4 A;  2HHQ A;  4FJM A;  4PKI A;  4H0Y B;  4MO4 A;  1WB9 A;  2P9K B;  3CJA A;  5JVH L;  2ZWH A;  1BQM A;  1EXQ A;  4ID5 A;  1LW0 A;  3T1A A;  3OYN A;  5C24 A;  5HBM A;  3VF2 A;  5KGW A;  1R59 O;  2P1J A;  3ATV A;  3FR0 A;  2RKI A;  3KLE A;  3AO2 A;  4IJN A;  1RT6 A;  1RDD A;  5HRS A;  4NYN A;  4CF0 A;  4BE1 A;  3OYF A;  3TSU A;  2Q31 A;  2CH5 A;  2W41 A;  3MXJ A;  3S3N A;  1S6P A;  1K8K A;  5BRH A;  2ASM A;  4DU4 A;  1SL2 A;  4JK7 A;  1W9H A;  2HVI A;  2OZS A;  4BC4 A;  2YHY A;  4R5P A;  5BR9 A;  4F2S A;  2E20 A;  3CD6 N;  4GVE A;  4BDZ A;  4LF6 K;  4XH4 A;  5GIN A;  3CXC M;  3AVB A;  3HST B;  4JI8 K;  1VSE A;  3WT0 A;  1HQE A;  3K5L A;  1WSF A;  4KTW A;  3J81 O;  2YJF A;  1WSI A;  3ULD A;  4BG9 A;  1T03 A;  2IS3 A;  4KHY A;  1XMQ K;  3M8Q A;  4CZJ A;  2HST A;  1GLA G;  3C6T A;  4IG0 A;  4DV3 K;  1RTI A;  2HW3 A;  3SQ4 A;  5EY4 A;  1U47 A;  1VSL A;  2QM1 A;  3KZB A;  3N4Q A;  3L4I A;  3LAL A;  5DM6 L;  4F8R A;  3L4Q A;  3TSP A;  3THX B;  5AQU A;  4AHC A;  4CEO A;  3L3U A;  1LAV A;  2BUP A;  4CF9 A;  4X66 K;  3NF9 A;  2YNG A;  4FM0 A;  3C7N B;  4CJK A;  3MWP A;  5A2Q O;  1LWE A;  1X9S A;  5KQ8 A;  3NHG A;  3ULE B;  2X78 A;  2E6M A;  1A5X A;  4M63 C;  4BRG A;  5HOO A;  3FLC O;  1NJI O;  4CEZ A;  1K8K B;  3CF5 L;  1F21 A;  3CCL N;  1RGI A;  2Z1H A;  3OYL A;  3O3F A;  3NF7 A;  2IDO A;  4PL7 A;  1NM1 A;  4JI0 K;  1TUY A;  2G8F A;  1NGF A;  2FBT A;  1L3S A;  1BQN A;  3VQ9 A;  5KGX A;  3CI5 A;  4YDU C;  4LF7 K;  4FJL A;  1TAU A;  5AR0 A;  3VGK A;  2QWP A;  1WAJ A;  3L8B A;  2ASO A;  3HI0 A;  1I39 A;  3VQA A;  3F2K A;  4JK9 A;  3H45 C;  3OJS A;  3PV8 A;  3PY8 A;  4AF1 A;  2OAN A;  3NGY A;  4CED A;  1Q7Y O;  3EN9 A;  3VOV A;  4K43 A;  4M45 A;  5KRS A;  4E7H A;  5AQF A;  3EKU A;  3G6E N;  1IV0 A;  1EO1 A;  2HBJ A;  1UA1 A;  3DI6 A;  2AP1 A;  2HHX A;  1KSP A;  4FVM A;  4OGC A;  4IDH A;  4WQ4 C;  4YOX A;  1OH7 A;  4NO7 A;  5GAD P;  3CCS N;  1WN7 A;  4FOE A;  4K42 A;  1W2B M;  1VSH A;  3THW A;  3VEZ A;  4LF5 K;  2P5G A;  2KKZ A;  3VEV A;  3LP1 A;  4C8K A;  2BTF A;  3CPW M;  4I7F A;  2GBZ A;  4E3S A;  4CJF A;  4BRP A;  3SYZ A;  5E84 A;  4IO9 L;  4IXC A;  2X6N A;  1TK8 A;  4CF1 A;  4FM1 A;  3R6M A;  4QS7 A;  3ALY A;  4BAC A;  3V4I A;  4CIF A;  1VK0 A;  3BY5 A;  3AO1 A;  4BC2 A;  3OYB A;  3SAF A;  3U6F A;  3MXI A;  3DM2 A;  1SV5 A;  4PUO A;  4QS9 A;  3SMS A;  3E1Y A;  3QML A;  4IO8 A;  1RFQ A;  5C12 A;  4DV5 K;  4BRD A;  2GWJ A;  4BRH A;  5JS1 A;  2JWL A;  1O1W A;  3FZH A;  4MLH A;  3VGL A;  1HX1 A;  3MCP A;  1VQ4 N;  2BAN A;  4Q5V A;  5SZT A;  3WNF A;  4B8A B;  4N56 A;  5KPR A;  1LWC A;  1NGJ A;  2OPR A;  3ZSX A;  2F96 A;  4JV5 K;  4Z4C A;  4LD0 A;  4ELV A;  3O1B A;  3CCV N;  2A1S A;  4DB3 A;  1KCF A;  4BRC A;  3VA0 A;  3VES A;  5F0X A;  4GV9 A;  4PQU A;  2ZGY A;  3ZYY X;  2YCH A;  4NYF A;  4N47 A;  1T8E A;  3OJU A;  1S1V A;  3AVN A;  1NGI A;  1XUP O;  3UKR B;  3ZT4 A;  4BR0 A;  5C2F A;  2RE2 A;  2VCP A;  4AM7 A;  1TKT A;  4Z4G A;  1ASV A;  3TAM A;  2NRH A;  1WSH A;  5AQO A;  1TVR A;  4FWR A;  3ZSW A;  4CES A;  4CF8 A;  3V1R A;  5BRD A;  2P9N A;  1RBV A;  3L2W A;  3I8D A;  1J9A A;  4JKA A;  4WCE L;  1YVU A;  2G8U A;  2VWB A;  3AVF A;  1ASU A;  1RIL A;  4CFA A;  3U9Z A;  2UUB K;  2QTD A;  4CJT A;  2HHH K;  2B4J A;  1RTD A;  2BE2 A;  1HNX K;  4F4K A;  4DQS A;  1TKZ A;  4JRP A;  2YHB A;  3NBP A;  2ETJ A;  4X62 K;  3JS6 A;  4BGB A;  4CGH A;  4BQZ A;  3O8M A;  3MDQ A;  1EX4 A;  3A5N C;  2QI2 A;  4LH5 A;  1X9W A;  3AGK A;  4C8N A;  3ZET A;  3P1G A;  1LCU A;  2UXD K;  2H3G X;  3FFK B;  4HCC A;  3RVC A;  1BU6 O;  2V7Y A;  1KLN A;  4CER A;  1A5W A;  3VEY A;  2E8A A;  4F2R A;  4W5Q A;  4CZE A;  1YT3 A;  1K9M O;  3O9R A;  1JL1 A;  3SCX A;  4BQL A;  4DSL A;  1FKO A;  4CEQ A;  4U67 L;  4KV8 A;  4GKK K;  4ISE A;  4ELU A;  3ZSY A;  4DF8 A;  2O8B B;  3OYM A;  4CHY A;  4KHS A;  3AVH A;  3RMB A;  2CGJ A;  3CCJ N;  3QDK A;  2PYL A;  2Z1G A;  3MED A;  4YHH K;  4I9Q A;  2VG6 A;  3VEO A;  3WEE B;  2GUP A;  3MEC A;  3THY A;  4BVP A;  3HYF A;  3K0S A;  2P5O A;  2GX9 A;  4CJ3 A;  1BUP A;  3UKU B;  2QWO A;  3QNO A;  4KHP K;  3SNN A;  1S72 N;  1Y64 A;  4BY9 C;  5JMV A;  2HMP A;  1YF5 L;  3KVG A;  4IFE A;  2A5X A;  4CIE A;  3KK7 A;  3VEW A;  1VQO N;  4GV6 A;  4GKJ K;  5DM7 L;  1JCG A;  3VQ5 A;  3KJV A;  1EWQ A;  4L3Q A;  1C0F A;  2Q97 A;  3O6W A;  4AH9 A;  1WBB A;  4Y0W A;  1S9E A;  1CZ9 A;  1VQL N;  3WNG A;  3AA2 A;  3RTV A;  1U6Z A;  1NJZ A;  1I94 K;  1GLJ O;  3D6R A;  4A61 A;  4JRQ A;  1YIJ N;  4NLC A;  5EXW A;  3K5O A;  3RRH A;  1S3X A;  4BR9 A;  3KLF A;  2XY7 A;  3CM5 A;  1B9F A;  3QIC A;  4FLW A;  3MK6 A;  3GBT A;  1DGK N;  1Z05 A;  3HJF A;  1YHQ N;  4K8X A;  4B9M A;  1X3M A;  1UWB A;  3T7Z A;  3SQ1 A;  4OKE A;  3ID8 A;  1C1A A;  3ZT1 A;  2NRT A;  4JKF A;  3WXL A;  4HTU A;  1XNR K;  3Q7C A;  4CEB A;  1BOT O;  4C1N K;  1XI1 A;  5CYM A;  4CE9 A;  2YX6 A;  2QK9 A;  3TAQ A;  1EP4 A;  2OPP A;  4M7Y A;  4CIG A;  4KH4 A;  4EIA A;  3NGZ A;  3SBG A;  5LY3 A;  4J2B A;  1FW6 A;  2VQE K;  3O4W A;  3ZLJ A;  3AVA A;  1KRP A;  5KPZ A;  4HUE A;  3AVG A;  4FWL A;  5J2Q A;  1W7A A;  4JYA K;  4DF4 A;  3SUO A;  3CIP A;  1RT4 A;  5AQM A;  2YNI A;  3VA3 A;  1S6Q A;  4DSE A;  4A2B A;  4BGA A;  4JI5 K;  3EO3 A;  3K57 A;  3U4L A;  2KFZ A;  1IKX A;  2Q2R A;  2IGI A;  4C1N I;  4YOR A;  2XY5 A;  4LSL A;  4DR1 K;  5JLF A;  3HP9 A;  4OKK A;  4FJJ A;  5M1P A;  2QKB A;  5FRM A;  1VQM N;  3KK2 A;  1HNV A;  2W40 A;  4CJ5 A;  4H4M A;  4E0D A;  1DLO A;  1HNZ K;  2ZM6 K;  4DTU A;  1TYQ B;  2ITM A;  1NGA A;  3LAK A;  2IVP A;  3QFU A;  2IAJ A;  3C6H A;  1YUW A;  2YHW A;  2P9S B;  3GDQ A;  1T3V A;  1W0H A;  4JD2 B;  1H1V A;  4XEI A;  1NGH A;  1GLB G;  2OTL N;  2VGN A;  3AAQ A;  3HPO A;  3JYT A;  2YJE A;  1DTQ A;  4FPB A;  3VQB A;  2FBX A;  4M41 A;  3AGR A;  4E1N A;  5KPT A;  3KWG A;  4RCH A;  5AQJ A;  4E1J A;  1FKP A;  3BDP A;  4IOA L;  4JEP A;  3NF8 A;  4ILJ A;  4O0J A;  3CJ9 A;  1BIU A;  1QZ5 A;  4DUZ K;  4BE0 A;  3ZT2 A;  3DLK A;  3GOI A;  3TAB A;  1RBU A;  3CC7 N;  3MEE A;  3T1Y K;  3AAP A;  3RMC A;  3ZSR A;  2UUC K;  2UXC K;  1SAZ A;  2G8K A;  1GLD G;  4DU1 A;  3D45 A;  4WYB A;  3T69 A;  3DRS A;  3LDQ A;  3NGI A;  3A5M C;  1YI2 N;  2GV9 A;  3A8Y A;  1VQ5 N;  4W5R A;  4MLE A;  3QNN A;  2J4R A;  1VQK N;  2P9I A;  3VQE A;  1T44 A;  3D2E A;  4BDP A;  1QHT A;  4DUY K;  3M1F A;  2HHW A;  2ZQB A;  3FGU A;  3BZC A;  1C1C A;  3DJC A;  3C95 A;  3MWT A;  4FLV A;  5AQZ A;  1TGO A;  3OYA A;  3CC4 N;  2P9L B;  1J53 A;  3CET A;  5ADX H;  4DU3 A;  1C0G A;  3MCA B;  3FZF A;  2ZJQ L;  5FPM A;  4GW6 A;  5J1E A;  3SPY A;  2KTQ A;  1WBD A;  3TTD A;  2E2O A;  2FSJ A;  4NCG A;  4EAH D;  2VG7 A;  1YTA A;  3IDH A;  1LV5 A;  5HRO A;  3K5M A;  1NK6 A;  4LFC K;  2RHK A;  2QXF A;  3CFR A;  4FLX A;  4B3R K;  1TV6 A;  1UOC A;  4AHS A;  1NMD A;  3U3Y A;  1TK0 A;  4DR2 K;  5LJW A;  3D2F B;  3VQ6 A;  1IG8 A;  1KVC A;  5H1S Q;  5EOY A;  3NH2 A;  4Z94 A;  3RSE A;  1UAX A;  3AVL A;  1EQY A;  1NLV A;  3AA3 A;  1ATN A;  3MN5 A;  1EKE A;  5ADX A;  5AQH A;  4DV2 K;  3F5T A;  3MAQ A;  1G15 A;  3LDS A;  1A5V A;  2Q3S A;  4K41 A;  4N5S A;  1TUU A;  4WQ4 A;  4YOV A;  2FBY A;  2F4V K;  3O9U A;  2HMI A;  4KI4 A;  1HPZ A;  2F7T A;  5AQV A;  1ATS A;  4YNQ A;  4EP5 A;  3ZEU A;  1S1U A;  4FZZ A;  1IKW A;  3THY B;  2HOE A;  4JKG B;  5JVG L;  2PY5 A;  1OKJ A;  3FZM A;  4IDK A;  4DTR A;  3LPU A;  1Z26 A;  3EE8 A;  4B9V A;  4YDU A;  5C2D A;  3CCR N;  1S1X A;  3TTF A;  1NK7 A;  1MDU B;  1MA9 B;  2HHU A;  5BPN A;  4XIU A;  4DQQ A;  5FPD A;  2GUI A;  1VSJ A;  3DXM B;  2OA8 A;  3AO3 A;  5JLH A;  4DTM A;  4KRF A;  4CD3 A;  1RDW X;  4CJS A;  3CYM A;  4FW2 A;  3SJH A;  1XWL A;  3RMD A;  3V9X A;  4DV4 K;  5SWM A;  3RR7 A;  2O8C B;  5LMU K;  1U45 A;  4B9T A;  5BPM A;  3HPH A;  3UKR A;  1RNH A;  2O8E B;  4A62 A;  3LP2 A;  1HJR A;  3H1Q A;  3V1O A;  3O4N A;  5AQS A;  3EE9 A;  4PKH A;  3C7N A;  3GL1 A;  4B08 A;  1RDB A;  5AQP A;  5AQY A;  4Z4E A;  5KQD A;  1RCH A;  5I42 A;  1GOC A;  4WF9 L;  3QO9 A;  4AIL C;  4N76 A;  2QA4 N;  4PY5 A;  3KWI A;  2QWM A;  4CZH A;  4FJX A;  3RMA A;  3ZX3 A;  1SS6 A;  5GIP A;  4CBU A;  1KTQ A;  3P31 A;  1HYZ A;  3TU5 A;  3L3V A;  4IFV A;  1VSM A;  4I6M B;  4B1X B;  3AO5 A;  4FOI A;  3V81 A;  2O8D B;  3OYE A;  3PX6 A;  4DR7 K;  4JI4 K;  2V52 B;  3ATU A;  4DLG A;  5AQN A;  1TL3 A;  5EU7 A;  2UU9 K;  2PAV A;  4PA1 A;  5BN8 A;  3KLH A;  4BWM A;  2O4I A;  1Z25 A;  5M1K A;  4L8R B;  2NLX A;  5FPN A;  2FBV A;  1KLM A;  1XHZ A;  4Z4I A;  3QEX A;  3M8S A;  1C1B A;  4HVJ A;  4FJG A;  4B1Z A;  5AQT A;  1S1T A;  1WSG A;  3NH0 A;  3NDK A;  4FLU A;  3H6E A;  4H5T A;  1TAQ A;  3U9D A;  3VEN A;  4FL9 A;  2E1Y A;  1DT9 A;  1L3U A;  4QCL A;  4CJ7 A;  3A5L C;  4CVN E;  4IOX A;  3OYI A;  3BGR A;  5C15 A;  4ICL A;  1KC8 O;  1JCE A;  4Y1D A;  2IC3 A;  2G8W A;  4PL8 A;  4FM2 A;  3PX4 A;  4CJW A;  3V9S A;  4DTS A;  3IS9 A;  3MN9 A;  3IAY A;  3TAG A;  1ILY A;  5AZJ A;  1S1W A;  1TKD A;  3DLE A;  3V9Z A;  4O55 A;  4OKJ A;  4IFY A;  2RF2 A;  2P9U A;  4LY7 A;  3AY9 A;  4IWV A;  2DTU A;  2O8F B;  4LF4 K;  1CLQ A;  3LWM A;  2NUB A;  4O4G A;  4O8U A;  3HO1 A;  4KHW A;  4M3Y A;  2D4W A;  3F9K A;  1NU0 A;  3EYZ A;  4EHU A;  4MFB A;  4FYD A;  4I6M A;  3H3O B;  3IUC A;  3CER A;  3E66 A;  1VRT A;  3WNH A;  3H3N O;  3TAP A;  4OPH A;  4CGF A;  1VHX A;  3KKR A;  3MXM A;  2F8S A;  1L5U A;  5C0Y A;  2NRZ A;  4V19 S;  1QS4 A;  2B6A A;  4CZK A;  4LC9 B;  2XHB A;  2HBM A;  3G10 A;  2IOC A;  3I0S A;  2OPQ A;  3DOK A;  3OVN A;  1NGC A;  4FCY A;  3QIP A;  4DFJ A;  4KPY A;  1HNW K;  4M3Z A;  4AHV A;  3C65 A;  1HPM A;  2NRX A;  4DCH A;  4H03 B;  1SQK A;  4M3T A;  4JD2 A;  1JLF A;  4M3X A;  2I7P A;  1KXP A;  3DLG A;  1BI4 A;  3O3H A;  3K58 A;  1VAZ A;  4DQR A;  2Y1I A;  5CHI A;  3CQ8 A;  4KTZ A;  4FWK A;  1Y97 A;  4CGG A;  2KFN A;  1YJ9 N;  1ZBU A;  4H5R A;  4H5W A;  3SPZ A;  2B5J A;  4LF8 K;  5T7B A;  2G8I A;  3QBW A;  3OYC A;  4F3O A;  3PIP L;  2JLE A;  2W6L A;  4DTP A;  1BCM A;  4I2Q A;  2XY8 A;  1J5O A;  3QES A;  4E7K A;  4KTQ A;  1U49 A;  4HUF A;  1RDC A;  3I0R A;  4J2E A;  4RG8 A;  4CHP A;  2OCE A;  4CJL A;  3SK3 A;  1M1K O;  1RT3 A;  5IT9 O;  4BRO A;  4GMJ B;  1QQM A;  5GAH P;  1K6Y A;  1D8Y A;  1KFS A;  2OTJ N;  5M1N A;  3MN7 A;  4DQP A;  4WE1 A;  1WSE A;  3D7E O;  4HTL A;  1BCO A;  4KFB A;  4OPK A;  4XH5 A;  3OW2 M;  4CW7 B;  4DSK A;  4DR5 K;  1VQ7 N;  4OLA A;  1D5A A;  2JWK A;  4H5V A;  4DSF A;  3BZK A;  2FC0 A;  1BO5 O;  4MO5 A;  4DR4 K;  3AAR A;  4EFH A;  4JKC A;  1NKB A;  1B92 A;  4KB1 A;  2WC9 A;  4YFU A;  4DMN A;  3NVM A;  4X65 K;  1V4S A;  1QSY A;  2F8T A;  4EHT A;  1E3M A;  3HVT A;  1E4G T;  4FZX C;  2VG5 A;  3ENH A;  1JLE A;  3VGM A;  1NWK A;  4JK8 A;  3C0B A;  3V9W A;  2EX3 A;  3TSQ A;  1NGG A;  5ELZ A;  1SZ2 A;  3LPT A;  1N6Q A;  4HWI A;  1N8R O;  1HRH A;  4FJI A;  5AZI B;  3DAW A;  2WON A;  3AVM A;  3NE6 A;  3L2Q A;  4WFN L;  4CFB A;  4LFA K;  3OYD A;  4LSN A;  3RWU A;  5CZ2 A;  1JLB A;  4CD1 A;  3QEW A;  4CJ4 A;  4NCB A;  4A57 A;  2VWK A;  4PKG A;  2HVH A;  4CEE A;  2HND A;  3SUP A;  3TTC A;  4JN4 A;  3BEX A;  3L0Q A;  3FE1 A;  3THV A;  1HMV A;  3E9P A;  4CK3 A;  1YXQ A;  1U4B A;  3J7A P;  3L2V A;  1Q9X A;  3HPG A;  2QWQ A;  5GAE P;  3VQ8 A;  3JSM A;  4H0X B;  1ZXO A;  4CHN A;  2VGM A;  3P39 A;  3CCU N;  3S9H A;  2Q0U A;  3LDO A;  3JAM O;  3U3G A;  5GAG P;  2HNY A;  3EZW A;  4C23 A;  4CJR A;  4B9U A;  2P51 A;  3G71 N;  3SQ0 A;  1CXQ A;  4FO0 A;  4JS5 A;  3M5R A;  4IG3 A;  3VF4 A;  3IMX A;  5FPE A;  4B3O A;  3SQ2 A;  1VSD A;  1HKB A;  3CJ1 A;  2YNH A;  3J7Y P;  1IG9 A;  2NRR A;  1QTM A;  4B8C A;  1ASW A;  3C6U A;  2BGG A;  3LZI A;  2I7N A;  5K14 A;  3IRX A;  2E1Z A;  2EHG A;  2AJQ A;  4DKW A;  4H0P A;  3MX5 A;  4FWP A;  4OLB A;  1HLU A;  1P8Z A;  2XO7 A;  3RRG A;  4BRF A;  1YJN N;  4H0V B;  3OTO K;  5AQL A;  1T6C A;  4IOC L;  2ZD1 A;  3MN6 A;  4H8K A;  1VSF A;  4AQY K;  1P90 A;  2Z1I A;  3OHR A;  4GNI A;  3QIN A;  3TAE A;  3PSF A;  1KFD A;  4CZG A;  2D0A A;  4DWI A;  2ASP A;  4EZ9 A;  2RN2 A;  3B6O A;  1N5Y A;  3IG1 A;  4W5O A;  1NJW A;  3QBX A;  3HTV A;  4HHT A;  3DRR A;  4NLB A;  3HM8 A;  2I5J A;  2FSN A;  4W5T A;  4CJE A;  3Q7B A;  1KAY A;  3D0P A;  4BC3 A;  1GLE G;  3BUZ B;  1W97 L;  1NKC A;  1D9D A;  2WFB A;  3VTI A;  3ZX2 A;  4OPJ A;  4FJ9 A;  1OVY A;  3OBY A;  3O1W A;  2DFH A;  1QZ6 A;  4DSI A;  3PLA A;  4A5B A;  4E7I A;  4BRI A;  1T6D A;  3CM6 A;  4JKB A;  1NGE A;  1MWM A;  3ZSV A;  1XC9 A;  3H46 O;  2HNZ A;  3MX2 A;  4BVO A;  4ZTF A;  1IBL K;  2Q1N A;  4YOU A;  5E26 A;  1OH6 A;  4CEF A;  5BR8 K;  2GTD A;  3KKS A;  3WNE A;  4B9S A;  2O8B A;  1OVQ A;  3HSC A;  2HHT A;  4CHZ A;  3KTQ A;  3PSI A;  4FWN A;  4FWM A;  4FWS A;  4RW7 A;  4FSV A;  4DV1 K;  3O9S A;  4CHQ A;  2PBD A;  3LL3 A;  5AQI A;  5LL6 Z;  1BI4 B;  4FJ8 A;  4DV6 K;  2DFE A;  1U04 A;  1HR0 K;  2IVN A;  3HOT A;  5BN9 A;  1K8A O;  3VQ4 A;  1NK5 A;  4FPA A;  4Z0U A;  3L2R A;  3CC2 N;  1HUX A;  4PWD A;  3HVR A;  3VQC A;  3WEE A;  4DHY A;  3ZCM A;  3QEV A;  4QAG A;  3ISN C;  2R7Y A;  3R1X A;  1IH7 A;  4R79 A;  2OZM A;  4JKE A;  2P9P B;  3OS0 A;  1Q8I A;  4GV3 A;  4Q0B A;  1S9G A;  4FK4 A;  4OO1 J;  3O80 A;  2W6K A;  1ZBI A;  1FK9 A;  4O44 A;  2A6A A;  2O8D A;  3QLH A;  3S41 A;  3DOL A;  4M3R A;  1SKW A;  1Q9Y A;  5HLF A;  2FLO A;  2QWR A;  3AVK A;  3VQP A;  5KRT A;  1KD1 O;  4DS4 A;  5AJ3 K;  3MEG A;  2UXB K;  4AHU A;  2CGK A;  4BR7 A;  4CBW A;  3DXK B;  4K25 A;  2PFU A;  3T1H K;  4KAZ A;  4BRA A;  3LDN A;  1VQP N;  3O08 A;  1FJG K;  2E2Q A;  3ZSZ A;  5KTQ A;  5DK5 A;  1J5E K;  2HHS A;  3WUH A;  5B8H A;  3P38 A;  2YV0 X;  4O5B A;  2E4L A;  4OPA A;  3M8P A;  4JKH A;  4K0K K;  5AFU A;  4OX9 K;  4RW9 A;  1WSJ A;  3I8B A;  1QE1 A;  3SUN A;  3T19 A;  1FXX A;  4DLE A;  5FDL A;  2DFF A;  1YJW N;  4ZTJ A;  3KLG A;  5FRN A;  3PUF A;  3PO4 A;  4FXD A;  1XMO K;  5I3U A;  5IWA K;  2Z1J A;  2ZF5 O;  5LMN K;  2CH6 A;  1NGB A;  3NCI A;  3UB5 A;  5EVZ A;  1EWR A;  3DLH A;  1XNQ K;  3HP6 A;  2F9W A;  4BRM A;  5M1F A;  3OYH A;  3BF1 A;  3B6P A;  4DR3 K;  2X74 A;  3E01 A;  5BRE A;  1ATR A;  4O5F A;  1D9F A;  2NZT A;  1VQ6 N;  2YHX A;  3VET A;  3ZX0 A;  4KHU A;  4DTO A;  1NOY A;  4BRK A;  3PO5 A;  5TKY A;  2GEL A;  3V9U A;  1GLL O;  1O13 A;  2P9S A;  1RBT A;  1Z6R A;  3EKS A;  5AQG A;  3AVI A;  3FZK A;  1REV A;  1HYS A;  3WXI A;  1U2V B;  3ZET B;  5CE3 A;  2UYT A;  4CZF A;  2CGL A;  4DFM A;  4Z4H A;  4CFC A;  5JIC A;  1VRU A;  1JXE A;  1J6Z A;  1BHL A;  3DRP A;  2D0C A;  3QFP A;  1RBR A;  4B1W B;  1TKX A;  4DS5 A;  4I2P A;  1HQU A;  3AO4 A;  2E88 A;  3LAM A;  2KZM A;  4JI3 K;  2ATQ A;  3SI6 A;  5AZJ B;  1QQC A;  3CQY A;  4IBN A;  3KHY A;  3W3D A;  4KI6 A;  1J54 A;  4BE2 A;  4B3M K;  4KH6 A;  3LM2 A;  1JLQ A;  1JXB A;  3OA9 A;  5M1O A;  3KD5 E;  2P9U B;  3GE1 A;  3SZ2 A;  1CZA N;  2GEM A;  4DFP A;  1VQN N;  3QIO A;  5FRO A;  4IKF A;  3S3M A;  3ZEU B;  4DV7 K;  4YOW A;  1NK9 A;  1NNE A;  4UQG A;  4CGD A;  3FZL A;  4KB0 A;  3L6Q A;  1NJX A;  3HT3 A;  3HOS A;  2Q36 A;  1TL1 A;  1UA0 A;  2E6L A;  2ZJP L;  3MMV A;  4YY3 K;  5JS2 A;  4RW4 A;  1XQS C;  5C10 A;  2W42 A;  4QOZ B;  3EL2 A;  5AQW A;  4RW8 A;  1IKY A;  4CF2 A;  1MWK A;  4WQ5 C;  4ILH A;  4J2A A;  2YHA A;  3PX0 A;  5CY4 A;  4DR6 K;  3QET A;  1RT2 A;  3KD1 E;  4CBX A;  4I9L A;  4JLH A;  4JHD A;  4FJN A;  3KK3 A;  3EEQ A;  4BRN A;  3J7Z O;  2NNW A;  1QVG M;  3THW B;  4B3T K;  4DG1 A;  5CR4 A;  1IBK K;  3LDP A;  3TAF A;  1QQO A;  1WAF A;  1SKS A;  4CFD A;  4C8O A;  3E9L A;  4JI1 K;  1NKE A;  4ISG A;  4MDA A;  4LFB K;  3V6D A;  3LWL A;  4KO0 A;  2X6S A;  2V51 B;  2A3Z A;  3LM9 A;  4FJ5 A;  1E4F T;  3PIO L;  2A42 A;  2Q0R A;  3D2F A;  4BR4 A;  5HRR A;  3ITH A;  2ITG A;  1ZBF A;  3OS1 A;  4RWT A;  4BRE A;  1I3A A;  5CYQ A;  5CZ1 A;  3VPZ A;  3K5N A;  1R0A A;  2D1K A;  3TI0 A;  4A5A A;  4KKO A;  3ZSQ A;  5EX5 A;  3J80 O;  1YIT N;  1RBS A;  1X1P A;  3TWH A;  5AZI A;  1GLF O;  5C25 A;  2HHV A;  3H08 A;  4IJA A;  1SL1 A;  3CFP A;  4JKG A;  2F9T A;  3HL8 A;  2D0O A;  2WBN A;  4Y1C A;  1EET A;  2IIR A;  3QB0 A;  1CZB A;  4OJR A; 
#chains in the Genus database with same CATH homology
 3NE6 A;  3HPO A;  1WSI A;  3L2Q A;  3ULD A;  3JYT A;  4CK1 A;  4CFB A;  5J2P A;  1RTJ A;  1DTQ A;  2YNF A;  3VQB A;  4CEA A;  2FBX A;  4M41 A;  4CGJ A;  3OYD A;  5KI6 A;  4LSN A;  1T03 A;  2ZE2 A;  4C8L A;  1NJY A;  3DYA A;  3RWU A;  5CZ2 A;  1JLB A;  4E1N A;  3EY1 A;  4CJ4 A;  3QEW A;  4NCB A;  2JGU A;  2VWK A;  2XRI A;  1FKP A;  2IS3 A;  3HM9 A;  4KHY A;  4CEE A;  2PZS A;  3BDP A;  3M8Q A;  2HND A;  2HVH A;  4ELT A;  3SUP A;  3C6T A;  3NF8 A;  4IG0 A;  4O0J A;  1RTI A;  1BIU A;  2HW3 A;  3SQ4 A;  4BE0 A;  4HUG A;  1U47 A;  1VSL A;  3DLK A;  1HMV A;  3ZT2 A;  3THV A;  3TAB A;  4CK3 A;  1VSI A;  1RBU A;  1U4B A;  3MEE A;  3L2V A;  3RMC A;  1Q9X A;  3HPG A;  3AVJ A;  3ZSR A;  3VQ8 A;  2G8K A;  3JSM A;  1SL0 A;  3G0Z A;  4DU1 A;  3D45 A;  4MQ3 A;  4CHN A;  3LAL A;  4H4O A;  4F8R A;  3DRS A;  3S9H A;  3NGI A;  4FLT A;  4W5N A;  4AHC A;  2GV9 A;  4CEO A;  3U3G A;  1QSS A;  3L3U A;  1LAV A;  2HNY A;  4W5R A;  4CF9 A;  3QNN A;  4CJV A;  3TAR A;  3NF9 A;  4AHR A;  4CJR A;  2YNG A;  4FM0 A;  4B9U A;  3VQE A;  2P51 A;  4CJK A;  3SQ0 A;  1X9S A;  1LWE A;  3O3G A;  4FLZ A;  5J2N A;  1CXQ A;  4BDP A;  3NHG A;  4JS5 A;  1QHT A;  3EZ5 A;  4OGE A;  4DTJ A;  2X78 A;  2HHW A;  2ZQB A;  2E6M A;  3RR8 A;  4FJ7 A;  1A5X A;  3SJJ A;  1C1C A;  4IG3 A;  3C95 A;  4FCY A;  4FLV A;  1TGO A;  1KVA A;  1NOZ A;  3OYA A;  3SV4 A;  4B3O A;  4CEZ A;  3SQ2 A;  1RTH A;  1J53 A;  1VSD A;  1ZBL A;  4DTN A;  2YNH A;  1F21 A;  1IG9 A;  4K8X A;  2Z1H A;  4DU3 A;  3OYL A;  3O3F A;  1QTM A;  4B8C A;  3VQQ A;  3NF7 A;  2IDO A;  1ASW A;  3C6U A;  2OPS A;  1T7P A;  3LZI A;  2BGG A;  5J1E A;  4GW6 A;  3SPY A;  2G8F A;  2KTQ A;  3V1Q A;  5K14 A;  2FBT A;  3OYK A;  1L3S A;  3FFI A;  4NCG A;  3IRX A;  2VG7 A;  1GOB A;  1YTA A;  1BQN A;  5C42 A;  3VQ9 A;  5HRN A;  5KGX A;  2G8V A;  1LV5 A;  2EHG A;  5HRO A;  4FJL A;  2AJQ A;  3CFO A;  3K5M A;  1TAU A;  4OLB A;  1NK6 A;  2XO7 A;  2QXF A;  3C94 A;  3CFR A;  1LAW A;  4FLX A;  1TV6 A;  3RRG A;  1WAJ A;  3OY9 A;  1UOC A;  3L8B A;  4AHS A;  1I39 A;  3VQA A;  3U3Y A;  3OYG A;  3OJS A;  3PV8 A;  1TK0 A;  2ZD1 A;  3PY8 A;  3NGY A;  4H8K A;  4CED A;  1VSF A;  3LZJ A;  4C8M A;  3VQ6 A;  2Z1I A;  4GVM A;  4M45 A;  1IO2 A;  5KRS A;  4E7H A;  1KVC A;  5J2M A;  3LP0 A;  3NH2 A;  3QIN A;  3TAE A;  1UA1 A;  1UAX A;  3DI6 A;  1S5J A;  1KFD A;  3AVL A;  4FVM A;  4OGC A;  2D0A A;  1KSP A;  2HHX A;  2A1R A;  4DWI A;  4OVL A;  4EZ9 A;  3VQD A;  5E41 A;  4FW1 A;  3AA3 A;  2RN2 A;  3P83 D;  1EKE A;  1JLA A;  3HXM A;  3B6O A;  1N5Y A;  3IG1 A;  3MAQ A;  1G15 A;  1WN7 A;  3LDS A;  4W5O A;  1NJW A;  4RW6 A;  4HHT A;  1A5V A;  1VSH A;  3DRR A;  2LSN A;  2Q3S A;  2I5J A;  2P5G A;  4W5T A;  4CJE A;  4N5S A;  1SKR A;  3LP1 A;  1WLJ A;  4C8K A;  3D0P A;  4I7F A;  2FBY A;  2GBZ A;  4E3S A;  3HK2 A;  1NKC A;  1D9D A;  3TR8 A;  2HMI A;  4CJF A;  4KI4 A;  4OPJ A;  1HPZ A;  3SYZ A;  1GOA A;  4FJ9 A;  2X6N A;  4ID1 A;  1TK8 A;  4YNQ A;  4CF1 A;  2RPI A;  2DFH A;  4EP5 A;  4FM1 A;  4DSI A;  4E89 A;  3ALY A;  1S1U A;  2VWJ A;  4BAC A;  4FZZ A;  3V4I A;  1IKW A;  4CIF A;  1VK0 A;  4E7I A;  2YKM A;  3ZT0 A;  2PY5 A;  3AO1 A;  3CM6 A;  4CJP A;  4IDK A;  4DTR A;  3LPU A;  1Z26 A;  3ZSV A;  1XC9 A;  2HNZ A;  4B9V A;  3NFA A;  3OYB A;  4ZTF A;  1BGX T;  3U6F A;  1S1X A;  4CJQ A;  4M3W A;  3MXI A;  1NK7 A;  3DM2 A;  4CEF A;  1SV5 A;  3KKS A;  3M8R A;  1C0M A;  4PUO A;  4Z4F A;  2HHU A;  2D0B A;  3O4Q A;  3WNE A;  4B9S A;  4XIU A;  4DQQ A;  2HHT A;  4CHZ A;  3KTQ A;  3NF6 A;  4BWJ A;  4RW7 A;  1DTT A;  5JS1 A;  2GUI A;  5HRP A;  1VSJ A;  2OA8 A;  4DTX A;  3AO3 A;  4DTM A;  4KRF A;  4EP4 A;  1O1W A;  4CJS A;  3CYM A;  4CHQ A;  4KPY A;  4FW2 A;  1XWL A;  3RMD A;  2QKK A;  3V9X A;  1BI4 B;  4CEC A;  4FJ8 A;  4DSJ A;  5SWM A;  2BAN A;  3RR7 A;  4Q5V A;  2DFE A;  5SZT A;  1U48 A;  4K8Z A;  1U04 A;  1U45 A;  3WNF A;  4B8A B;  4B9T A;  4CCH A;  4N56 A;  3HPH A;  1RNH A;  1LWC A;  3LP2 A;  1JLG A;  1HJR A;  2OPR A;  3ZSX A;  2F96 A;  2YKN A;  3VQ4 A;  4AHT A;  4Z0U A;  3L2R A;  1NK5 A;  4Z4C A;  3V1O A;  3OYJ A;  4LD0 A;  3O4N A;  4G1Q A;  3F73 A;  3HVR A;  4ELV A;  4PWD A;  3VQC A;  4LH4 A;  1JKH A;  3ZCM A;  3QEV A;  2G8H A;  2A1S A;  1KCF A;  3A2F A;  4B08 A;  4QAG A;  1RDB A;  3ISN C;  3QER A;  4Z4E A;  3VA0 A;  2R7Y A;  4PQU A;  1RCH A;  5I42 A;  3ZSO A;  1GOC A;  4M42 A;  4NYF A;  1IH7 A;  3P5J A;  2OZM A;  4N47 A;  1T8E A;  3NAE A;  1BL3 A;  3QO9 A;  4AIL C;  4N76 A;  1LW2 A;  3OS0 A;  1S1V A;  1Q8I A;  3OJU A;  1QSL A;  4PY5 A;  3AVN A;  2PYJ A;  4Q0B A;  2HB5 A;  3ZT4 A;  1S9G A;  4FK4 A;  4FJX A;  1ZBI A;  3RMA A;  1TKT A;  4Z4G A;  1FK9 A;  4O44 A;  1ASV A;  2DY4 A;  3TAM A;  1WNS A;  1KTQ A;  1WSH A;  1TVR A;  1HYZ A;  3L3V A;  4IFV A;  3ZSW A;  4CES A;  4CF8 A;  3SV3 A;  4HCB A;  3V1R A;  3QLH A;  1RBV A;  1VSM A;  3L2W A;  4JS4 A;  3I8D A;  4CGI A;  1J9A A;  3DOL A;  4M3R A;  1SKW A;  3AO5 A;  3DLR A;  3V81 A;  1Q9Y A;  1RDA A;  1YVU A;  1NK0 A;  5HLF A;  3OYE A;  1JL2 A;  3PX6 A;  3K2P A;  2G8U A;  3AVF A;  4DLG A;  3AVK A;  1C6V A;  1ASU A;  1TL3 A;  3VQP A;  5KRT A;  4FLY A;  5EU7 A;  4NCA A;  1RIL A;  4DS4 A;  4CFA A;  3MEG A;  3AA5 X;  4E19 A;  4AHU A;  4PA1 A;  3KLH A;  1BIZ A;  4KAZ A;  1RT5 A;  4BWM A;  1Z25 A;  2XY6 A;  4L8R B;  4KHQ A;  2O4I A;  1L3T A;  4CJT A;  4FZY A;  3AVC A;  3CG7 A;  2B4J A;  4B9L A;  4M3U A;  2FBV A;  1RTD A;  2BE2 A;  1KLM A;  3ZSZ A;  5KTQ A;  1XHZ A;  4F4K A;  5DK5 A;  1TKZ A;  4JRP A;  4BDY A;  4DQS A;  3QEX A;  4Z4I A;  3M8S A;  2YHB A;  2HHS A;  1ZBH A;  1C1B A;  3NBP A;  4O5B A;  2YV0 X;  4HVJ A;  2ETJ A;  4FJG A;  3NH0 A;  2E4L A;  1S1T A;  1WSG A;  3NDK A;  3M8P A;  4FLU A;  4CGH A;  1NK4 A;  1TAQ A;  1ZYQ A;  1JLC A;  1L3U A;  4RW9 A;  5HP1 A;  1EX4 A;  1WSJ A;  4LH5 A;  4QCL A;  1X9W A;  1QE1 A;  4DQI A;  3SUN A;  3T19 A;  1FXX A;  4C8N A;  2KQ2 A;  3ZT3 A;  4DLE A;  2BDP A;  3P1G A;  4F3T A;  5FDL A;  2DFF A;  1LWF A;  4ZTJ A;  2Y1J A;  3KLG A;  5FRN A;  3PUF A;  1T05 A;  4HCC A;  3OYI A;  3PO4 A;  4FXD A;  4E7L A;  3BGR A;  1TK5 A;  1KLN A;  4CER A;  3K59 A;  5I3U A;  2Z1J A;  4ICL A;  4Y1D A;  1A5W A;  2IC3 A;  4KHN A;  1RT1 A;  3KIO A;  3NCI A;  3DLH A;  2G8W A;  3DMJ A;  3HP6 A;  2D5R A;  3NH1 A;  3QEP A;  4FM2 A;  4DFK A;  4CJW A;  3PX4 A;  4F2R A;  4W5Q A;  3V9S A;  4DTS A;  3VN5 A;  3IS9 A;  3IAY A;  3AV9 A;  3TAG A;  4DFJ A;  1YT3 A;  4E7J A;  3OYH A;  3B6P A;  1MU2 A;  1JL1 A;  1S1W A;  3SCX A;  4DSL A;  1FKO A;  4CEQ A;  3SUQ A;  3DLE A;  3V9Z A;  3ASM A;  1TKD A;  4KV8 A;  2X74 A;  3E01 A;  3UIQ A;  4O55 A;  4ELU A;  1D9F A;  4OKJ A;  3ZSY A;  4IFY A;  2RF2 A;  3OYM A;  4LY7 A;  4DF8 A;  4CHY A;  1CLQ A;  2DTU A;  3LWM A;  4KHS A;  1YTU A;  3AVH A;  2NUB A;  3RMB A;  3LP3 A;  1XHX A;  4O4G A;  4E1M A;  4KHU A;  4DTO A;  1NOY A;  3PO5 A;  3V9U A;  2Z1G A;  3MED A;  2PYL A;  4EZ6 A;  1RT7 A;  3HO1 A;  4KHW A;  4I9Q A;  2VG6 A;  3L2U A;  4M3Y A;  3F9K A;  3EYZ A;  1RBT A;  4MFB A;  3MEC A;  4FYD A;  2KW4 A;  4FJK A;  1VRT A;  3AVI A;  3HYF A;  1REV A;  3WNH A;  2P5O A;  1HYS A;  3TAP A;  4CJ3 A;  4CGF A;  3QNO A;  4DFM A;  1C0T A;  3KKR A;  3MXM A;  3SNN A;  4Z4H A;  4CFC A;  1VRU A;  1JXE A;  2F8S A;  4FK0 A;  1L5U A;  1BHL A;  3DRP A;  2KZZ A;  1QS4 A;  2B6A A;  2XHB A;  1SUQ A;  4B9N A;  2D0C A;  4CIE A;  5DMR A;  3G10 A;  1RBR A;  2IOC A;  4ZHR A;  3I0S A;  2WOM A;  1TKX A;  4DS5 A;  3DOK A;  2OPQ A;  1CZB A;  1B9D A;  1CXU A;  1HQU A;  1KVB A;  3AO4 A;  3OVN A;  3LAM A;  3QIP A;  4I2P A;  3VQ5 A;  4AHV A;  3KJV A;  4M3Z A;  2KZM A;  4TSX A;  2ATQ A;  4KRE A;  4AH9 A;  4J2D A;  4M3T A;  1JLF A;  3SI6 A;  4M3X A;  3TAN A;  3DLG A;  1BI4 A;  1QQC A;  4FJH A;  1S9E A;  1VSK A;  4IBN A;  3O3H A;  3K58 A;  4KI6 A;  1CZ9 A;  1NK8 A;  3WNG A;  1J54 A;  4BE2 A;  4DQR A;  2Y1I A;  3AA2 A;  3RTV A;  1L3V A;  1NJZ A;  1JLQ A;  1JXB A;  3CQ8 A;  4O0I A;  4KTZ A;  3KD5 E;  4JRQ A;  3SZ2 A;  4DFP A;  3S3O A;  1Y97 A;  4CJU A;  4CGG A;  3K5O A;  3RRH A;  2KFN A;  3QIO A;  5FRO A;  1ZBU A;  3KLF A;  3T3F A;  2XY7 A;  3CM5 A;  1B9F A;  3LAN A;  3S3M A;  3SPZ A;  4IKF A;  2B5J A;  3QEI A;  2OYQ A;  4CHO A;  5D3G A;  5T7B A;  2G8I A;  4FLW A;  1ITG A;  3KK1 A;  3OYC A;  3DLB A;  1X9M A;  4F3O A;  2O4G A;  4FK2 A;  2JLE A;  3OS2 A;  1NK9 A;  4DTP A;  3HJF A;  1BCM A;  4I2Q A;  4UQG A;  1IKV A;  2XY8 A;  3AA4 A;  3VQ7 A;  1C0U A;  4CGD A;  1NJX A;  3QES A;  1HNI A;  1J5O A;  4B9M A;  4KB0 A;  3HT3 A;  4E7K A;  1UWB A;  3SQ1 A;  4OKE A;  4KTQ A;  1U49 A;  1TL1 A;  4HUF A;  1UA0 A;  1RDC A;  3I0R A;  4J2E A;  2E6L A;  3KLI A;  1BIS A;  1C1A A;  4RG8 A;  3ZT1 A;  4CHP A;  4CJL A;  5JS2 A;  1HYV A;  4HTU A;  4RW4 A;  2W42 A;  4N41 A;  4QOZ B;  4CEB A;  4RW8 A;  1IKY A;  1RT3 A;  4CF2 A;  4CK2 A;  1XI1 A;  5CYM A;  4CE9 A;  2HHQ A;  4FJM A;  2QK9 A;  4J2A A;  2YHA A;  4GMJ B;  3PX0 A;  3TAQ A;  1D8Y A;  1K6Y A;  5CY4 A;  3QET A;  1KFS A;  1RT2 A;  3KD1 E;  4I9L A;  1EP4 A;  2OPP A;  4JLH A;  4CIG A;  3NGZ A;  1BQM A;  1EXQ A;  4ID5 A;  1LW0 A;  3T1A A;  3KK3 A;  3OYN A;  4DQP A;  4J2B A;  4FJN A;  4WE1 A;  5HBM A;  3AVA A;  1WSE A;  5C24 A;  1KRP A;  5KGW A;  4DG1 A;  4HUE A;  3AVG A;  5J2Q A;  1BCO A;  1WAF A;  2P1J A;  4DF4 A;  3TAF A;  1SKS A;  4KFB A;  4CFD A;  4OPK A;  2RKI A;  4C8O A;  4DSK A;  3SUO A;  3KLE A;  1NKE A;  1RT4 A;  3AO2 A;  4OLA A;  2YNI A;  1D5A A;  3VA3 A;  1RT6 A;  1S6Q A;  4DSE A;  3V6D A;  3LWL A;  4KO0 A;  1RDD A;  3K57 A;  4DSF A;  2X6S A;  5HRS A;  2KFZ A;  4NYN A;  1IKX A;  4CF0 A;  3OYF A;  2FC0 A;  2IGI A;  4BE1 A;  2XY5 A;  4FJ5 A;  4LSL A;  3MXJ A;  4FJJ A;  3HP9 A;  4OKK A;  3S3N A;  1NKB A;  1B92 A;  5HRR A;  4KB1 A;  3ITH A;  2QKB A;  4YFU A;  1S6P A;  5FRM A;  2ITG A;  1ZBF A;  3OS1 A;  4DMN A;  3KK2 A;  1HNV A;  4DU4 A;  1SL2 A;  1W9H A;  1QSY A;  2F8T A;  2HVI A;  1I3A A;  5CYQ A;  2OZS A;  4CJ5 A;  4H4M A;  5CZ1 A;  3K5N A;  1R0A A;  4R5P A;  1DLO A;  4E0D A;  3HVT A;  4FZX C;  3TI0 A;  2VG5 A;  4F2S A;  1JLE A;  4KKO A;  4DTU A;  4BDZ A;  3LAK A;  3ZSQ A;  3V9W A;  1RBS A;  2IAJ A;  2EX3 A;  1X1P A;  3AVB A;  3HST B;  3TWH A;  1VSE A;  5C25 A;  1HQE A;  1W0H A;  3LPT A;  3H08 A;  2HHV A;  1N6Q A;  1SL1 A;  3K5L A;  1WSF A;  3CFP A;  4OJR A;  1HRH A;  4KTW A;  4FJI A;  3HL8 A;  4Y1C A;  1EET A;  2WON A;  3AVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...