4CJFA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 53
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjfA00
3CYMA 1RNHA 3AVNA 3KLEA 1B9DA 3VQ6A 2KW4A 4DMNA 4CGGA 1LAVA 2D0AA 2ZE2A 3VQCA 3KK2A 5FRMA 2HW3A 5C24A 3TAMA 4FJIA 4J2AA 2QXFA 4FJHA 1WSGA 2YNIA 3IG1A 3NF9A 2YKNA 4DF4A 1D9FA 4HCCA 4K8XA 3PUFA 3QO9A 5JS1A 3H08A 1O1WA 2OPRA 1Q9YA 4ZHRA 1S1WA 4BE2A 1IO2A 4F3TA 2IOCA 3MECA 3ZT4A 3MAQA 4FLYA 1JLEA 4LSNA 4XIUA 4M3TA 4CF1A 1U45A 4CIEA 3DRRA 1HYZA 1IKWA 1CZBA 4I9LA 4FLUA 3PO4A 1IKXA 4DSKA 4FYDA 4BE1A 1NK0A 4FJ7A 4EP5A 3VQBA 2DFHA 1HNIA 4Y1DA 4FJ5A 3HM9A 1DTQA 1EETA 3PV8A 1XI1A 1BL3A 1T05A 1BIUA 3IRXA 3OYMA 3M8SA 1SKRA 4BE0A 4DQQA 1NJWA 4WE1A 2HNYA 1C0UA 3TR8A 1S5JA 4LH5A 2BGGA 4CHQA 2FBYA 3SPZA 3DLHA 1KVCA 1S6PA 3L2QA 1L5UA 4E89A 4IFVA 2XO7A 4FM2A 3QEVA 1RT1A 4W5TA 4CJVA 3VQAA 3D0PA 3NGZA 3WNFA 4FJKA 4Z4GA 4FLZA 4DU4A 4BWMA 3SQ1A 2FBXA 3O3FA 4CJPA 4ELTA 4Z4EA 2IAJA 1BIZA 4DU3A 4F2SA 4JLHA 3C94A 2QKKA 4CEZA 4F8RA 3K5MA 2XY6A 3AVBA 3RRHA 3QEIA 4ZTJA 2KQ2A 4C8KA 3KK1A 4CFCA 3OYEA 4H4OA 3NF6A 1C1CA 1J54A 3AA3A 4ELUA 3AVLA 4E7KA 1QSYA 2P51A 4OLBA 4ICLA 2RN2A 2BE2A 3V1OA 3OYHA 4B9LA 4M41A 2B6AA 2KZMA 3VQ7A 5J2QA 3S3OA 2YNGA 4O5BA 4NCAA 3CG7A 4PQUA 1RBTA 1QE1A 5HRSA 3HXMA 4CCHA 4FLXA 4KB1A 3OYLA 1SV5A 2P1JA 1S1UA 5C25A 4YNQA 3TAQA 4M3UA 3ZSVA 2A1RA 3S3MA 3KKSA 1SL2A 3KIOA 1IKYA 2WONA 4O55A 3I8DA 3V9ZA 4CFBA 3TAFA 1NOZA 3AO4A 4AH9A 3ZT1A 3QEXA 4KHQA 4E0DA 3TARA 1HYSA 4ELVA 1IKVA 4B9UA 4G1QA 4YFUA 1RBVA 4KKOA 4O0JA 4CFDA 1D8YA 3ZCMA 3KLIA 4M3YA 3EYZA 3HJFA 3AA5X 3DRSA 3MXMA 4NYNA 1XHZA 3U3GA 4FW2A 3NGYA 2BDPA 4H4MA 1YTUA 5HROA 4PY5A 4DFMA 3T19A 4CK2A 1TAQA 3OYCA 1S9GA 1UAXA 5DK5A 1LW2A 4NCGA 1QSLA 1I39A 4B9SA 4IFYA 3NF7A 4W5OA 1ASVA 1GOBA 3RMAA 1LW0A 2B5JA 5E41A 1X9WA 3L2WA 4PWDA 2KFZA 4CFAA 1RDBA 1WLJA 4DU1A 4DTMA 4HTUA 4L8RB 4RW8A 3V9UA 2XY8A 5I3UA 4KPYA 4OKKA 3DLKA 2YHAA 4OJRA 3K59A 4F3OA 3LP1A 1KTQA 1HQUA 3HL8A 4KTZA 1WSFA 3V1QA 4CJUA 4W5RA 3SV3A 4CECA 2IDOA 3QEPA 4M3WA 4I2PA 5HRRA 3V9SA 3SNNA 1NK8A 3KD1E 1SUQA 3OVNA 4RW9A 3FFIA 1WSEA 4Z4CA 3TWHA 3K57A 4I7FA 2PYJA 3VQ8A 4CF0A 4HVJA 3HYFA 1WAFA 4AHVA 4DTJA 4KHYA 1A5VA 4OPJA 1RT6A 3F73A 1HJRA 4EZ6A 3LALA 3DLRA 4OPKA 1VSHA 4B08A 3K5NA 3DRPA 4DSLA 2VG7A 2YNHA 1FKOA 1C1BA 1TGOA 2R7YA 1GOAA 4CF2A 2GBZA 3ULDA 4HUEA 4KHUA 4OKJA 1JL1A 3LPUA 4DTPA 1RDAA 1R0AA 4OLAA 3I0SA 4CHOA 4QCLA 3C6UA 2JLEA 3AVKA 4AHSA 3LZIA 4IG0A 1BI4B 3M8QA 4CIFA 1NJXA 4NYFA 3HPHA 2ZQBA 1JLGA 4CGDA 1C6VA 3HVRA 3VQPA 4AHTA 1RCHA 3IS9A 1LWFA 1TKTA 3AVCA 4TSXA 3TAGA 3V1RA 4CK3A 3HPOA 3L3UA 1HPZA 2ETJA 4B9VA 4ZTFA 3NE6A 3K5LA 4FLTA 4DQSA 3RWUA 1LV5A 2RKIA 3SQ4A 3VQ9A 5CYQA 1VSKA 1YT3A 2Z1IA 3PX4A 2P5OA 3L2VA 1BCOA 3QIPA 3OJUA 3AV9A 2E6MA 2PY5A 3O4NA 4CERA 2HVIA 1B92A 1BQNA 1HYVA 2OPQA 3QESA 1T7PA 1CLQA 1S9EA 3ZT2A 2KFNA 4E7IA 4KHSA 4FCYA 5HP1A 2IC3A 4C8MA 1Q8IA 2HHSA 4FZYA 2AJQA 3PO5A 2YHBA 1G15A 4FXDA 1JXBA 1RT3A 1KVBA 2G8VA 4J2EA 4HCBA 1VRTA 3ITHA 4RG8A 3VN5A 1EX4A 4FM1A 3BGRA 4CIGA 1ZBIA 3VQEA 1VSIA 4DSJA 3C6TA 3KKRA 1KFDA 3TABA 4IBNA 4CJ5A 1S1XA 3K5OA 1U04A 1NKCA 3U3YA 1T03A 3NH2A 1X9SA 2F96A 3AVGA 2A1SA 3AA2A 3EZ5A 2G8UA 4QOZB 1JLBA 3F9KA 3AVFA 3ZSQA 4CJWA 4EP4A 3NBPA 3EY1A 4DLGA 4B3OA 2XHBA 5HBMA 4Q0BA 4B9TA 5J2MA 3L8BA 3P1GA 3I0RA 3WNHA 3AA4A 1VSEA 4JRPA 1RBRA 4DQPA 2E4LA 1XC9A 3S9HA 4FJ9A 2Y1JA 4M3XA 3TAPA 4M42A 3T1AA 4FZXC 3SV4A 1NOYA 3ALYA 2XY7A 4CJSA 3ZSZA 4FLWA 3KD5E 1J5OA 4CGJA 3AO2A 3QINA 4DLEA 1KSPA 4O4GA 1LWEA 4CF9A 4DFPA 4CK1A 3V9WA 4DWIA 2XY5A 1C1AA 1SKWA 3HPGA 3ZSWA 3DOLA 4N5SA 1RDDA 2D0BA 4UQGA 3LZJA 4C8LA 4EZ9A 1FXXA 3NFAA 3NCIA 4RW7A 4LY7A 1QTMA 3LP3A 4NCBA 1TK8A 3ZSRA 2GV9A 3V6DA 1RTDA 1RDCA 2KZZA 1WSJA 3ZT0A 2IGIA 1TK0A 4QAGA 3OYAA 2HNDA 1XWLA 3RMDA 5HRPA 1KFSA 3HP6A 3SQ2A 4KFBA 1K6YA 1TKZA 1J53A 5CZ1A 2OPPA 3O4QA 3KLFA 1N5YA 4PUOA 4HUGA 2HHQA 1ZBFA 2G8HA 2YKMA 4N47A 4KO0A 4B9NA 3IAYA 5JS2A 1KLNA 5KTQA 3PY8A 1ZBHA 4CJ3A 3D45A 4OGEA 3RMBA 4AHRA 4DSFA 1C0TA 1WSIA 2VWJA 4FJLA 4JS4A 1VSJA 4Q5VA 3SZ2A 4DTXA 1Q9XA 2X74A 3HSTB 3QIOA 4DTNA 3ZSXA 3VQQA 1BHLA 1JLAA 2QKBA 3OS2A 3ISNC 3NAEA 4DS4A 4M3ZA 1RT2A 5CZ2A 3NDKA 3E01A 4AILC 2X6SA 3G0ZA 5K14A 1RT5A 2XRIA 1RT7A 2X78A 2OYQA 1QS4A 4CHNA 1L3VA 5D3GA 2HHTA 4K8ZA 1S1TA 3V4IA 4Z4FA 3OS0A 1RTHA 1U49A 2P5GA 1BISA 3B6OA 3QETA 3MEGA 3OS1A 3OYNA 2ZD1A 4JS5A 1ASUA 4O0IA 1WAJA 5I42A 4N56A 1LAWA 3AVIA 3AVAA 3HP9A 2O4IA 3T3FA 2D5RA 5KGXA 3ZSYA 3HK2A 5HRNA 4KREA 4BDPA 3P5JA 3VQ4A 1LWCA 3KLGA 1KLMA 4CJFA 3B6PA 4DTSA 4DF8A 4FK2A 1UWBA 3OYJA 5FDLA 2IS3A 3AO1A 4GW6A 5KRTA 4E19A 1TL1A 2F8SA 4CJKA 1EP4A 4DTRA 1NJYA 1RILA 4FZZA 4Z0UA 5FROA 1NKEA 3HT3A 2G8IA 3KJVA 3LANA 2G8KA 4DG1A 4AHCA 1EXQA 3C95A 3SUOA 1HNVA 3ASMA 3U6FA 4F4KA 4FJMA 3NHGA 3VA0A 3L3VA 1SL1A 2OZSA 2PZSA 3A2FA 2F8TA 1IG9A 4DTOA 4I9QA 2G8WA 1HRHA 1BQMA 1I3AA 1WNSA 4CGIA 3OYGA 3LPTA 4HUFA 3V9XA 3G10A 3MEDA 1BI4A 5SZTA 4E7HA 4DSEA 1W9HA 3SUNA 3LAKA 4KAZA 4F2RA 1VSDA 3AO3A 3KTQA 3CM6A 4DQIA 3VQ5A 1UOCA 4MFBA 3THVA 4Z4IA 3LAMA 3SUQA 3MXIA 2OPSA 1BCMA 5CY4A 2HHUA 3NH1A 3JSMA 3SUPA 1BGXT 4O44A 3TAEA 1XHXA 2JGUA 5J2NA 2HHXA 4M3RA 3M8PA 1KVAA 3PX0A 4GVMA 3RMCA 4W5QA 3S3NA 4FVMA 4FJNA 1NK5A 1N6QA 2OA8A 1RBSA 1WN7A 2FBVA 4CEFA 3L2UA 4OKEA 3KK3A 1U48A 3SI6A 2DFFA 1KCFA 1KRPA 3RTVA 1TKDA 3HVTA 2RF2A 4ID5A 1NK4A 1RTIA 3LP2A 1NK7A 1TK5A 1IH7A 1VK0A 1TVRA 2EX3A 1NJZA 1VSMA 3TI0A 5HLFA 1JL2A 1RBUA 3CM5A 5KI6A 4CJ4A 1X1PA 4KI4A 4CJEA 2X6NA 3NGIA 1L3TA 4CF8A 1W0HA 4BDYA 1ZBLA 2HHVA 4PA1A 1D5AA 2W42A 5FRNA 4FJXA 1RT4A 3OYKA 2VWKA 1QQCA 4CHYA 4BWJA 3SCXA 1J9AA 4CEBA 3SYZA 3PX6A 1REVA 4N76A 1DTTA 1ASWA 4OGCA 1TAUA 4DFJA 1ZBUA 3BDPA 3AVMA 3NH0A 4LSLA 3CFOA 3DMJA 3OJSA 3OYIA 3HO1A 1Y97A 4IG3A 4KTWA 1QSSA 4E1MA 3OYDA 2B4JA 1NKBA 1B9FA 1VSLA 1UA0A 2HNZA 4GMJB 3O3GA 2O4GA 3DM2A 4E1NA 3K2PA 3WNEA 3JYTA 1D9DA 1VRUA 1S1VA 2Z1GA 3O3HA 4KB0A 4CEOA 1YTAA 1CXUA 3V81A 3TANA 4N41A 2D0CA 3SJJA 4OVLA 1HQEA 4FK4A 4RW4A 1L3SA 1MU2A 2ITGA 3AO5A 2HMIA 4BDZA 1Z26A 2FC0A 4IDKA 4LH4A 3ZT3A 4CE9A 4HHTA 1A5WA 3NF8A 3OY9A 2OZMA 4DSIA 3CFRA 1YVUA 3OYFA 5J1EA 2Z1HA 4Y1CA 2HVHA 2HHWA 1FKPA 4CGFA 3DLGA 3OYBA 2HB5A 3LWMA 3LP0A 4FLVA 3DI6A 4E7LA 5KGWA 2Q3SA 2Z1JA 3M8RA 3CQ8A 3P83D 5KRSA 3UIQA 5J2PA 2RPIA 4LD0A 2KTQA 2GUIA 3CFPA 1TL3A 2YV0X 2BANA 2PYLA 1QHTA 4KV8A 4CHPA 3QNNA 4CHZA 1TV6A 1SKSA 4FM0A 1U4BA 3RRGA 3QNOA 4DFKA 4DTUA 3KLHA 1JXEA 2E6LA 4B9MA 3AVHA 4CJLA 4C8NA 4MQ3A 1SL0A 3DLBA 3QLHA 1L3UA 3L2RA 4B8CA 5C42A 3K58A 4DQRA 4M45A 4FK0A 3VQDA 4KI6A 1WSHA 5SWMA 2VG6A 2NUBA 1EKEA 5T7BA 2VG5A 4DS5A 1U47A 4CESA 3SQ0A 1VSFA 3VA3A 4CJTA 1C0MA 4KRFA 4FJGA 4C8OA 2ATQA 4CEQA 4CEEA 3MEEA 2DFEA 3LWLA 2G8FA 4FW1A 4J2DA 4FJ8A 3SPYA 1CXQA 1JLQA 2YNFA 4KHNA 4KHWA 4AHUA 4CEDA 3DLEA 4CEAA 3LDSA 1X9MA 1NK6A 4CJRA 2I5JA 4W5NA 1ZYQA 2EHGA 3AVJA 3MXJA 4H8KA 2DTUA 1NK9A 1TKXA 1A5XA 4J2BA 1CZ9A 3QEWA 4IKFA 3ZSOA 3WNGA 1JKHA 4ID1A 4I2QA 1UA1A 1F21A 4B8AB 4Z4HA 4JRQA 4KTQA 1HMVA 5CYMA 3DOKA 4CJQA 1DLOA 1ITGA 4RW6A 1JLCA 5DMRA 2FBTA 4FJJA 4BACA 4E7JA 5EU7A 2WOMA 1FK9A 4CGHA 4E3SA 3RR8A 3QERA 1GOCA 1Z25A 1T8EA 2QK9A 1S6QA 2LSNA 2DY4A 3DYAA 1RTJA 4R5PA 2Y1IA 1JLFA 3RR7A
chains in the Genus database with same CATH superfamily
3CYMA 4BR9A 1RNHA 3AVNA 2OTLN 1S22A 1LAVA 4CGGA 1HX1A 2HW3A 4LFBK 1WSGA 3IG1A 1ZC6A 3O5BA 4O8KA 1U2VA 3H08A 3ZT4A 3MECA 4XIUA 2ASMA 4JK7A 2I7NA 3DRRA 4JAXA 5IWAK 1Q18A 3OTOK 4ISGA 4FYDA 2WC9A 4BE1A 1NK0A 2HOEA 1DTQA 1EETA 3PV8A 1BL3A 2FXUA 4WE1A 2HNYA 4LH5A 3CC2N 1R59O 2E88A 3HZ6A 1KVCA 4E89A 4ISFA 5BR9A 3PIOL 2XO7A 3EE8A 3QEVA 5AQVA 1WBBA 3VQAA 4FLZA 3CF5L 3VTHA 3SQ1A 1KAYA 3O3FA 1DKGD 4CJPA 1NGEA 4BRHA 1BIZA 4DU3A 4WFAL 2HHHK 1RDUA 3WUHA 1ATNA 3ZX3A 1NGDA 3IDHA 4C8KA 3KK1A 3NF6A 2NRWA 1J54A 3J8AA 3SAGA 4ELUA 3AVLA 1QSYA 2P51A 3F5TA 4ICLA 2BE2A 2B6AA 5I9EB 2KZMA 4NCAA 2QWOA 1RBTA 3FFKB 5DM6L 4FSVA 5HRSA 1WUAA 5C25A 3ZSVA 3V9ZA 2A5XA 4O55A 1RGIA 4FWNA 3CC7N 3ZT1A 1SS6A 5KQ8A 4YFUA 4O0JA 4KKOA 1HKGA 3ZCMA 3EYZA 3AA5X 1RDWX 3DRSA 4NYNA 3NGYA 3QBWA 4H4MA 3FE1A 4PY5A 1LW2A 4B9SA 2DPNA 1ASVA 3LDPA 5E41A 1X9WA 3L2WA 3HBTA 5C2FA 3J80O 3CI5A 4DTMA 3J7AP 3CMAN 4RW8A 5I3UA 4M63C 4OKKA 4JI2K 3LP1A 1KTQA 1HQUA 3HL8A 4JN4A 4KTZA 5AQMA 4M3WA 4FWRA 5HRRA 2GUPA 4EIAA 3C6AA 2ZM6K 3SNNA 3KD1E 1SUQA 4RW9A 5AR0A 3CXCM 1WSEA 3LM9A 4BG9A 4CF0A 3CJ1A 5LL6Z 1WAFA 5IT9O 1A5VA 2KKZA 3F73A 5EOYA 3DLRA 1VSHA 3DRPA 4DSLA 2VG7A 2YNHA 1FKOA 5M1OA 3ULDA 4HUEA 3M5RA 3D6RA 3H6EA 2NRTA 4CHOA 4DR6K 3M8QA 4CIFA 3ENOA 3K9KA 3IS9A 3AVCA 4TSXA 4B1UB 1J6ZA 3L3UA 1HPZA 3K9JA 2I7PA 4B1VA 4JKGB 3SQ4A 2Z1IA 3GL1A 3DXKA 2P5OA 3L2VA 3QIPA 2E6MA 4CZKA 2P9NA 1YXQA 4NLCA 2YI1A 1S9EA 2BH1A 2KFNA 5BRFA 1N33K 4DV5K 2G8VA 4CIGA 4LF6K 3MK6A 1DGKN 3C6TA 3KKRA 3PSIA 5EY4A 1MDUB 1X9SA 3BF1A 2F96A 2A1SA 4DR5K 3ZSQA 3EY1A 2XHBA 4Q0BA 5LJVA 3WNHA 4M42A 1NWKA 4H0PA 5AFUH 1NOYA 4CJSA 3ZSZA 1KAZA 4CGJA 3OBWA 1EO1A 4OO1J 1VQ9N 1LWEA 3R1XA 1VQMN 3V9WA 3R8EA 4DWIA 1C1AA 2O8DB 1N32K 5EVZA 3VPZA 2E8AA 4N5SA 2QI2A 3NCIA 3AAPA 4RW7A 2A6AA 3LP3A 4NCBA 2W40A 1NJIO 1TK8A 4JI4K 3CCEN 1RTDA 4NXMK 3O9SA 1BG3A 1TK0A 3G4SN 4H5VA 4DV0K 4BQLA 1K8AO 3EN9A 3UKUA 4CVNE 3I8BA 5CZ1A 2OPPA 2YKMA 3RSEB 1EWRA 2Q31A 1KLNA 3R6MA 4B9NA 2O8EA 2YJFA 4CJ3A 3U4LA 1HR0K 4AHRA 1C0TA 3VF2A 4DB3A 2VWJA 3J81O 3SZ2A 4BR5A 5C15A 2X74A 3ZSXA 3VQQA 3W0LA 2NRVA 1YAGA 3NAEA 4M3ZA 5CZ2A 3NDKA 1E3MA 3G0ZA 3SMPA 4YOYA 1RT5A 1RT7A 2OYQA 2HHTA 2YCHA 4Z4FA 4CW7B 3MEGA 3OS1A 1NU0A 4JS5A 2NRHA 1WAJA 5JMVA 4CBWA 4OPAA 3DXMB 2O4IA 3CCRN 3C7NB 3MDQA 3VQ4A 1LWCA 4DTSA 4CJFA 4DF8A 5AJ3K 2QW9A 3UKRA 3AO1A 4GW6A 5KRTA 2UU9K 4E19A 2HF4A 4AM7A 4JHDB 5FROA 2ZJRL 4DG1A 1EXQA 3SUOA 4IOAL 4PHTX 4F4KA 3NHGA 1VQON 3A2FA 5HL7L 1IG9A 4DTOA 4WQ5C 4HUFA 3V9XA 2UXCK 4HWIA 5SZTA 4F2RA 2P9SA 4DQIA 4Z4IA 3LAMA 3SUQA 3VTIA 2V51B 5CY4A 5JICA 1BGXT 3TAEA 5J2NA 1E4FT 3M8PA 3S3NA 1HPMA 1WN7A 4OKEA 3KK3A 1U48A 3BUZB 1XQSC 3N4QA 4FWOA 1YJNN 1VSMA 4XH4A 1JL2A 4CJ4A 3FZMA 2YJEA 3NGIA 1IV0A 1OVYA 4RWTA 3ZETB 1REVA 1ASWA 3FZLA 1N36K 3OJSA 1QSSA 1VQNN 2O8BA 2P9KB 4BR7A 2ITMA 2B4JA 1NKBA 3CIPA 2QWLA 2VQFK 3NVKA 2O4GA 2UUBK 4E1NA 4B1WB 4YDUA 4FWMA 3JAMO 4YOVA 3JYTA 1D9DA 1S1VA 2CGJA 2D0CA 2BTFA 5AZJB 1IBLK 2P9LA 4IDKA 4LH4A 3ZT3A 4CE9A 1A5WA 3NF8A 3VEWA 3OY9A 3CFRA 1KQSM 1K8KA 5J1EA 2HVHA 3D7EO 4Y1CA 5EX5A 3LWMA 2P9IB 3QICA 2Z1JA 4K41A 3TPQA 2E1ZA 4V19S 3RVCA 3CCVN 3J7YP 2E20A 4BC2A 1NMNA 3ZLJA 3CFPA 3ZYYX 2PYLA 4KV8A 3RRGA 4GV3A 1U4BA 1NGAA 3AVHA 4CJLA 3DLBA 3QLHA 2NRRA 5C42A 3VQDA 4DS5A 1NM1A 3GE1A 4CEQA 3MEEA 1VQ6N 2G8FA 4B1YB 3CMEN 1JLQA 2YNFA 5C12A 3VEZA 3DLEA 3GOIA 3CHWA 1NNEA 2I5JA 1ZYQA 2EHGA 2DTUA 1NK9A 1A5XA 1CZ9A 3QEWA 4MLEA 3WNGA 4EHTA 1NGHA 4BRNA 1TUYA 5CYMA 4JKHA 3KVGA 4RW6A 4E7JA 2WOMA 3ID8A 3QERA 2LSNA 2DY4A 4R5PA 3TSUA 3KK7A 4Z0UA 3GBTA 4DV4K 2VWBA 1B9DA 4NB4A 3KK2A 3VQCA 5AQUA 5C24A 4FWSA 3TAMA 2YNIA 4HCCA 3NF9A 2E2PA 2YKNA 4O5FA 1YJWN 4IO8A 1C0FA 5GIOA 2OPRA 1Q9YA 4QS9A 4ZHRA 2IOCA 3MAQA 4FLYA 1JLEA 2NNWA 4CF1A 1CZAN 3CJ7A 4FLUA 3PO4A 4DSKA 3IFRA 2DFHA 4BRAA 2Q2RA 1BIUA 3IRXA 3M8SA 1HLUA 1S5JA 2NRZA 2ZWHA 1NGFA 4JKCA 1TUUA 2ASOA 3E9PA 3I33A 1L5UA 4CJVA 2F9TA 3WNFA 4L3QA 1FJGK 2FBXA 3HI0A 4Z4EA 2IAJA 1ZXOA 4F2SA 1QZ6A 4FWKA 4CEZA 3SLCA 4X66K 4F8RA 3K5MA 2XY6A 4BRDA 3RRHA 3QEIA 5AZIA 1C1CA 4E7KA 4DUYK 4CZEA 3OYHA 3O8MA 3THWA 4B9LA 3VQ7A 3S3OA 4O5BA 1GLDG 4QS7A 4BC3A 2FSKA 1QE1A 1GLFO 3HXMA 4CCHA 3OYLA 4A2AA 3LDOA 1LOTB 1ILYA 4YNQA 3TAQA 1Z05A 3P39A 4K25A 1IKYA 5BN8A 4CFBA 3AO4A 4AH9A 1IBMK 4G1QA 3EKUA 1RBVA 5AQLA 2A3ZA 3EEQA 3PIPL 3CQXA 2BDPA 2VGMA 1HNWK 1MWKA 1YITN 5HROA 5GAEP 5M1QA 3T19A 4CK2A 1UAXA 1QSLA 1I39A 1KD1O 3L4QA 1NLVA 1GOBA 2B5JA 4CFAA 1RDBA 1WLJA 4DU1A 5ELZA 2XY8A 3DLKA 3K59A 4BQZA 3E9LA 5FLXO 3OVNA 3FFIA 2HBKA 4C23A 3K57A 4IFEA 3P4IA 3H3OB 4K42A 3HYFA 3B8AX 3I56N 4DTJA 3WXKA 4KHYA 1N8RO 1HJRA 1BU6O 4BRGA 1C1BA 4I6MA 4CF2A 4PKHA 4OKJA 1JL1A 1P90A 4LFAK 3CJAA 2JLEA 3AVKA 3CCSN 3LZIA 3KZBA 3HVRA 4AHTA 3FLCO 4U7BA 1LWFA 3O1WA 4KBOA 4XH5A 4CK3A 2HF3A 2ETJA 2P9UB 3VF6A 4ZTFA 4B9VA 3K5LA 4FLTA 5EXWA 3VQ9A 2ZF5O 3AARA 5BR8K 3OJUA 3AV9A 2GELA 2PY5A 3ULEB 4ISEA 2P9PA 1T7PA 1CLQA 3WEEB 5HP1A 2IC3A 2W41A 4DQ8A 1VAZA 2YHBA 4FXDA 1KVBA 4HCBA 4RG8A 3BGRA 3TABA 1VQKN 3K5OA 1U04A 4CZHA 4BR4A 3U3YA 3AA2A 3EZ5A 1JLBA 4EP4A 1OH7A 1VQ7N 4B3OA 5AQNA 2GWKA 4B9TA 2O8CB 3AA4A 3FZHA 4K43A 4NLBA 4DQPA 2E4LA 4FJ9A 3S9HA 3TAPA 4FLWA 3VESA 2Q1NA 4FWPA 1SKWA 3O4WA 2D0BA 1FXXA 3V6DA 1H1VA 1YJ9N 3ZT0A 2IGIA 4QAGA 4FL9A 4H0XB 3RMDA 3D2EB 4DR2K 3SAFA 5M1FA 3TSQA 1K6YA 1TKZA 1N5YA 3THYB 1QHAA 3O4QA 1XMOK 5AQZA 2G8HA 2HBJA 3O9RA 3IAYA 3A8YA 1Q82O 1ZBHA 4YOUA 3O08A 3MCPA 1Q9XA 3QIOA 5AQXA 1K9MO 4LF5K 3U9ZA 4AILC 3ZEUB 3E66A 4MDAA 3U9DA 2YHYA 5JVHL 3VMFB 1QS4A 2VYPA 3A5LC 1L3VA 4K8ZA 1S1TA 4KH6A 2P5GA 4DV7K 1BISA 3QETA 3J7ZO 2ZD1A 3G71N 3AVAA 4WQ4A 1RFQA 1ESVA 4FJLA 3P5JA 3B6PA 4FK2A 1IG8A 1TYQA 3OYJA 1TL1A 4CJKA 1RILA 4FZZA 2G8IA 3MN5A 3MWPA 3D2FB 2VCPA 3VGMA 3ASMA 4FJMA 1IBKK 4AM6A 2QXLA 3M3ZA 2VQEK 1KFSA 4JHDA 2V7YA 1BI4A 3MEDA 3SUNA 5FPNA 3LAKA 4KAZA 1U2VB 3KTQA 3CM6A 3VQ5A 1E4GT 4DHYA 3THVA 5AQKA 3FR0A 1U6ZA 3MXIA 1KXPA 2W6KA 4WCEL 2NLXA 2Q0UA 4GVEA 1XHXA 2QWMA 3OW2M 2HHXA 1KVAA 3RMCA 4W5QA 1N6QA 1RBSA 4ILGB 4CEFA 1T3VA 3L2UA 3EL2A 4HTLA 3SI6A 1KCFA 3HVTA 1D4XA 3DWLA 3Q7CA 4A59A 1S72N 4ID5A 1YF5L 5GIPA 1NK4A 1BDGA 1NK7A 1VK0A 1TVRA 3VEYA 3CCQN 3CM5A 4KI4A 5AQQA 4CF8A 4PA1A 5C2DA 2W42A 4JK8A 4FJXA 4BRKA 2IVNA 1J9AA 4BVOA 1O13A 4CEBA 3SYZA 3PX6A 1DTTA 4OGCA 1TAUA 4DFJA 1YVNA 1JCFA 3SJHA 2A42A 3F9MA 3DMJA 1HKCA 1Y97A 2GTDA 1X9JA 3OYDA 1HUXA 3O3GA 4A61A 5LMUK 3K2PA 4X64K 2EWSA 1VRUA 2Z1GA 4JEPA 3O80A 3DAWA 4CEOA 4DR3K 1VQPN 3V81A 4N41A 5M1PA 3F2KA 4A5AA 4PL8A 4RW4A 4FK4A 1MU2A 4BG8A 2HMIA 2FF3B 4BDZA 3S41A 2HBLA 3OYFA 5AQWA 4B3RK 2HHWA 4Y0WA 3OYBA 2HB5A 3LP0A 4FLVA 4DV6K 4IZ9A 2BANA 1SKSA 4CHPA 4CHZA 1TV6A 4FM0A 3QNOA 4DTUA 3KLHA 2E6LA 5HOOA 2P9IA 3BY5A 4B8CA 5FPEA 4DQRA 4M45A 4CZLA 2QEXN 1U47A 2VG5A 3SQ0A 2WFBA 1C0MA 4C8OA 1GLBG 3LWLA 5BN9A 2D1KA 4WF9L 4CZFA 1VQ8N 4BREA 2QTDA 4CJRA 1SQKA 2H3GX 4H8KA 3OBYA 1TKXA 2Q0RA 4IOCL 4IKFA 1NGGA 4OX9K 3ZSOA 3KHYA 4ID1A 4I2QA 4JRQA 4Z4HA 1HMVA 3DOKA 4XH1A 1XC3A 1DLOA 4FJJA 1JLCA 2FBTA 3IMXA 1FK9A 1T6CA 2HSTA 2QK9A 1GOCA 1Z25A 1GLLO 3DYAA 4H0VB 4RTFD 5ADXH 1JLFA 4DV3K 1N34K 3PLAA 2FLOA 4EAHD 3CCJN 3KLEA 4DMNA 5FRMA 4J2AA 4FJHA 3CQYA 2PAVA 1V4TA 1D9FA 3DXKB 3QO9A 1O1WA 3AY9A 4YOTA 4LSNA 4M3TA 2P9NB 1IKWA 1CZBA 4I9LA 1IKXA 3CD6N 4G9ZA 2QWRA 4FJ7A 4Y1DA 3O1BA 4FJ5A 3HM9A 2OCEA 3TTFA 1XI1A 4DR7K 3TU5A 4BGBA 3HTVA 4BE0A 4DQQA 5GAHP 1C0UA 3TR8A 3G25A 2FF6A 3JS6A 2FBYA 3DLHA 3ZX2A 3MN7A 1RT1A 4W5TA 2JWKA 4YDUC 3NGZA 4FJKA 5JVGL 1DEJA 4Z4GA 4DU4A 4QS8A 4BWMA 5FPDA 5AQTA 3LDQA 2QKKA 3C94A 5GAGP 4DCHA 3MCAB 3AVBA 4ZTJA 1X3MA 4H4OA 4FWQA 4BRMA 3AA3A 3CERA 2A40A 4O8UA 2WUSA 1Z6RA 4JNEA 2D0PA 1M90O 2YNGA 3CG7A 1OH6A 3FGUA 1K73O 4KB1A 4FLXA 1NBWA 1BA1A 3BZKA 1S1UA 4M3UA 4GKJK 3G6EN 3UKUB 2A1RA 1SL2A 3M1FA 2WONA 3I8DA 1HNXK 3TAFA 1NOZA 2JWLA 4CZGA 1NGJA 3QEXA 4E0DA 3TARA 4ELVA 1IKVA 5BPLA 3THXA 4B9UA 3EE9A 3KLIA 3HJFA 3MXMA 2O8EB 1XHZA 3HOTA 3VERA 1TAQA 4WYBA 3OYCA 1S9GA 5A2QO 3GDQA 4W5OA 3RMAA 3E1YA 3TTDA 2D0OA 4ILJA 4L8RB 3V9UA 4B3TK 5AQGA 1OVQA 4KPYA 2QWNA 4F3OA 2YHAA 3H46O 3VEOA 3SV3A 3MN6A 2IDOA 4I2PA 4YOWA 2O8FA 4Z4CA 3TWHA 5BPNA 1QQMA 4I7FA 4JD2A 4HVJA 4AHVA 3UKRB 3P31A 3WQTA 2A41A 3VGLA 4OPJA 4EZ6A 3LALA 4OPKA 3SK3A 4MO5A 2R7YA 4MLHA 5BRDA 4JKAA 1R0AA 4OLAA 1NG9A 2E2OA 3I0SA 4QCLA 3C6UA 4AHSA 2ASPA 5TKYA 4NYFA 4AF1A 2ZQBA 3VOVA 1C6VA 2P9SB 3TTCA 3VQPA 2IVPA 3TAGA 3V1RA 3LL3A 4BVPA 3NE6A 4KHPK 3RWUA 2RKIA 1VSKA 1YT3A 2RE2A 3PX4A 2Q36A 1BCOA 3HOSA 4CERA 2HVIA 2P9UA 3L0QA 4EHUA 2OPQA 4A57A 3ZT2A 4E7IA 4KHSA 4FCYA 2OTJN 2HHSA 4C1NK 3KWIA 4FZYA 2AJQA 4H0TB 3AAQA 1G15A 1RT3A 3L4IA 1VRTA 3VN5A 1ZBIA 3R9PA 1VSIA 1NMDA 3AGKA 4YHHK 1T03A 5JLHA 2E1YA 4H5TA 4QOZB 3AVFA 1SAZA 3NBPA 5J2MA 3WXMB 3L8BA 4GV9A 1MWMA 4CD3A 1VHXA 1XC9A 4M3XA 2Y1JA 4YORA 2YHXA 2O8BB 4FZXC 2ZJPL 3ALYA 2XY7A 3HRGA 1J5OA 3WXIA 4O4GA 1YHQN 4CF9A 4CK1A 1ATSA 2XY5A 3ZSWA 2E5LK 3DOLA 1RDDA 2UXBK 3LZJA 4C8LA 4EZ9A 3NFAA 4LY7A 1QTMA 2UXDK 5AFUA 2P9LB 3ZSRA 2KZZA 1K8KB 1WSJA 3OYAA 1XWLA 5HRPA 3HP6A 5CR4A 5C0YA 3SQ2A 4KFBA 1QQOA 3KLFA 4BC4A 4KH4A 2V7ZA 4KO0A 5JS2A 5KTQA 3D45A 4DSFA 4IEIA 1JJ2M 2W6LA 5AQRA 4DTXA 2GWJA 4PKIA 1BHLA 3CETA 4LF4K 3CPEA 3ISNC 2KLAA 2IVOA 3E01A 2UYTA 2X6SA 3FZKA 3SAHA 2X78A 5D3GA 5AQPA 3OS0A 1U49A 3BEXA 4BRIA 5F1XA 2QA4N 1DT9A 1EWQA 3T69A 5I42A 1EQYA 4DV2K 1LAWA 3AVIA 3HP9A 3QMLA 3T3FA 3ZSYA 3HK2A 4BDPA 3KLGA 1ATRA 1KLMA 1UWBA 2YHWA 5FDLA 2IS3A 4NXNK 2F8SA 4DTRA 1NJYA 3QFUA 3KJVA 1P8ZA 3QBXA 3C95A 1HNVA 5C10A 2PZSA 3CJBA 2G8WA 1HRHA 1WNSA 4CGIA 3OYGA 3LPTA 4E7HA 1W9HA 1VSDA 1UOCA 2HHUA 3NH1A 4FWLA 3JSMA 4JKGA 4M3RA 3PX0A 4FVMA 3VENA 3MX5A 1QQNA 5ADXA 2DFFA 4YOXA 1KRPA 3RTVA 3QFPA 3LDLA 4JI0K 1RTIA 4GKKK 1HJOA 4IJNA 1TK5A 1IH7A 3IKMA 2EX3A 3TI0A 5HLFA 1RBUA 4CJEA 2X6NA 1W0HA 5FRNA 3OYKA 3MN9A 2VWKA 1QQCA 5F2RA 3SCXA 5AZIB 4N76A 1V4SA 5BPMA 5MLCQ 1KAXA 5H1SQ 3MMVA 3NH0A 4LSLA 3CFOA 4IG3A 4KTWA 3THWB 3TSPA 5AQFA 1VSLA 2HNZA 4X65K 1Q81O 3WNEA 2O8DA 1YTAA 1CXUA 3TANA 3SJJA 4OVLA 1HQEA 1L3SA 3AO5A 1Z26A 2BUPA 1OKJA 4DSIA 1YVUA 3A5NC 4B1ZA 4CGFA 2CGLA 1VQ4N 5KGWA 3M8RA 3CQ8A 3RR7A 3LM2A 3P83D 3UIQA 4H03B 3L6QA 3EO3A 2RPIA 4LD0A 3SMSA 4WFNL 1WOQA 2KTQA 2YV0X 1BWFO 3QNNA 4R79A 3RSEA 4DFKA 1JXEA 4WQ4C 4B9MA 4C8NA 3K0SA 3L2RA 1HNZK 4C1NI 3K58A 1NGCA 3BF3A 4FK0A 4JK9A 4KI6A 1WSHA 5SWMA 2VG6A 2NUBA 5T7BA 4K0KK 1VSFA 4CJTA 4KRFA 3VETA 2DFEA 4J2DA 4AHUA 1X9MA 3LDSA 4EFHA 3ATUA 4DV1K 1W2BM 2PFUA 4X62K 5M1KA 3DXMA 4I6MB 3KWGA 4CI6A 4FO0A 3C7NA 4B8AB 4KTQA 4CJQA 5TKWA 1ITGA 4CD1A 4BACA 1Q7YO 4E3SA 3RR8A 1S6QA 1YUWA 3GG4A 3H45C 3AGRA 1IJJA 4CBUA 5AQOA 3VQ6A 2KW4A 2D0AA 2NRXA 2ZE2A 3CJ9A 4FJIA 2QXFA 5E26A 3E9OA 4DF4A 4K8XA 4CZJA 2FSJA 3PUFA 3JXUA 5JS1A 1S1WA 4LF9K 4BE2A 1IO2A 1JCEA 4F3TA 2Q97A 3R3LA 2P9PB 1U45A 4CIEA 2OANA 4BRLA 1HYZA 4NO7A 5KPTA 1GLJO 4DKWA 4IDHA 3T1HK 4EP5A 3VQBA 4FPAA 4F9OA 1HNIA 4XEIA 1T05A 1SKRA 4I9QA 3OYMA 1NJWA 3MX2A 4BRFA 2BGGA 4CHQA 4AQYK 4BRPA 3SPZA 1S6PA 4CBXA 3L2QA 4IFVA 4FM2A 3M6GA 3D0PA 3N4PA 3BZCA 2ZGYA 4ELTA 1S3XA 4JLHA 3ZETA 2D4WA 1YIJN 4H5RA 2KQ2A 4CFCA 3OYEA 4PKGA 1GLEG 4OLBA 2RN2A 4J8FA 3V1OA 3T7ZA 4M41A 2P9KA 5J2QA 4JI7K 3LDNA 4PQUA 1Y64A 4UY8O 1SV5A 2HBMA 2P1JA 4E1JA 2UUAK 3S3MA 3KKSA 3KIOA 3UE5A 3BP8A 4BRQA 5AZJA 5BREA 4KHQA 1HYSA 4CFDA 1D8YA 5GADP 4M3YA 5FPMA 4B3MK 1GLCG 3U3GA 4FW2A 4OPHA 1YTUA 3H1VX 4DFMA 1BO5O 4BC5A 5DK5A 1JCGA 3O9UA 4NCGA 4IFYA 3NF7A 4DR1K 3C0BA 1LW0A 4M7XA 4PWDA 3WXLA 2KFZA 4HTUA 4OJRA 1GLAG 1XNRK 4W5RA 2CH5A 1WSFA 3V1QA 4RCHA 4CJUA 3QEPA 4CECA 5M1NA 3V9SA 1NK8A 2F7TA 1WB9A 2PYJA 3VQ8A 4FOIA 3WQUA 1TYQB 2V52B 2F4VK 5BRHA 1RT6A 3ZX0A 4JI5K 4B08A 3K5NA 4YY3K 3OHRA 1TGOA 5CE3A 1GOAA 3EZWA 2GBZA 3A5OC 1OH5A 4KHUA 4H5NA 3LPUA 4DTPA 1RDAA 3Q7BA 4IG0A 1BI4B 4H0YB 1NJXA 3HPHA 1JLGA 4CGDA 1RCHA 2F9WA 3T1YK 1TKTA 3VGKA 2FSNA 3HPOA 4GNIA 4FPBA 1QVGM 4DQSA 3OA9A 3C6HA 1LV5A 5CYQA 4DUZK 1YI2N 5KPRA 3O4NA 1QVFM 1B92A 1BQNA 3FZFA 1HYVA 3QESA 2QWPA 4IXCA 5AQJA 4C8MA 1Q8IA 4WQ5A 3PO5A 1JXBA 4J2EA 3ITHA 1EX4A 4FM1A 3VQEA 1I94K 4DSJA 1G99A 1KFDA 4IBNA 4CJ5A 1S1XA 1NKCA 3NH2A 3WXJA 3AVGA 4IJAA 2G8UA 3NMUA 3F9KA 4PL7A 4CJWA 4DLGA 5HBMA 4CZMA 3VEVA 2RHKA 3P1GA 3I0RA 1VSEA 4JRPA 1RBRA 3UB5A 5JLFA 4DR4K 2AA4A 3T1AA 3SV4A 3KD5E 1ZBSA 2NZTA 3AO2A 3QINA 4DLEA 1KSPA 3ENHA 4DFPA 3ID6A 3HPGA 5AQYA 3VF4A 4H5WA 4UQGA 2CGKA 4GV6A 3CJCA 2GV9A 1RDCA 4JI1K 3QDKA 4CJ7A 2HNDA 4JKBA 2CH6A 1NGIA 2GEMA 3PSFA 1J53A 4PUOA 4HUGA 2HHQA 1ZBFA 3A5MC 1T6DA 4N47A 1XMQK 3PY8A 3EKSA 4OGEA 3RMBA 1WSIA 1VQLN 4FOEA 4JS4A 1VSJA 4MO4A 4Q5VA 2GX9A 3HSTB 4DTNA 4GY2B 1JLAA 2QKBA 3OS2A 2VGNA 4KH5A 4DS4A 1RT2A 4BY9C 3NVMA 5DM7L 5K14A 2XRIA 4BROA 2QWQA 4CHNA 3V4IA 1RTHA 3W3DA 3B6OA 3CCMN 3OYNA 1ASUA 4O0IA 4N56A 1XUPO 5CHIA 3MWTA 3U8XA 2D5RA 5KGXA 3SBGA 4JYAK 2HMPA 5HRNA 4KREA 4B1XB 1VQ5N 1EP4A 1FW6A 1NKEA 4BRCA 3HT3A 3LANA 4JKEA 2G8KA 4AHCA 4JKDA 4BGAA 3U6FA 3VA0A 3L3VA 1SL1A 1J5EK 4FVUA 3SBTA 5LMNK 2OZSA 4IEEA 2F8TA 1BQMA 1I3AA 4JI8K 4DSEA 3G10A 1NGBA 3AO3A 4MFBA 1BUPA 2IIRA 2OPSA 1BCMA 4BR2A 2YX6A 4LF8K 3SUPA 1MA9B 2WBNA 4BR0A 4O44A 2JGUA 5LJWA 4GVMA 4FJNA 1NK5A 2OA8A 3QB0A 2FBVA 4IWVA 1WBDA 3ULEA 1TKDA 1M1KO 2RF2A 2PBDA 3WEEA 3LP2A 4CZIA 1NJZA 5KI6A 4MDBA 3WT0A 1X1PA 4JV5K 2HHVA 1L3TA 2ZJQL 1ZBLA 3HSCA 4BDYA 5AQHA 1D5AA 4U67L 3P38A 4WFBL 1RT4A 1LCUA 3H1QA 4JI3K 4CHYA 1HKBA 4BWJA 2KHOA 2J4RA 4IO9L 4JKFA 4Z94A 3CPWM 1ZBUA 3BDPA 3AVMA 2O8CA 3H3NO 3HO1A 3ATVA 3OYIA 5AQIA 4E1MA 1BOTO 1B9FA 2E2QA 1UA0A 3DLLL 4GMJB 4A2BA 1W97L 3DM2A 4B3SK 3O9QA 1OH8A 3O3HA 4KB0A 3CCUN 3VEXA 2ITGA 5LY3A 2FC0A 3DJCA 3THXB 4ILHA 2OZMA 3A0IX 4HHTA 4JI6K 4A5BA 2Z1HA 4B9QA 1FKPA 5KPZA 2E2NA 5KQDA 3DLGA 4LFCK 4E7LA 3DI6A 1X3NA 2Q3SA 3D2EA 1QZ5A 5KRSA 2UUCK 5J2PA 5GINA 3THYA 5B8HA 2GUIA 1TL3A 1QHTA 3CCLN 1SZ2A 4MQ3A 1SL0A 1L3UA 3C65A 3I55N 5F0XA 1EKEA 4CESA 1T44A 3VA3A 3IUCA 3O9TA 1XNQK 4FJGA 2O8FB 2ATQA 3ENBA 2WTUA 5AQSA 3ZEUA 1KC8O 4CEEA 3HM8A 4FW1A 4FJ8A 3SPYA 1CXQA 4KHNA 4JD2B 1W7AA 4KHWA 4CEDA 4CEAA 3CC4N 4IOXA 1NK6A 3O6WA 4W5NA 3AVJA 4A62A 3MXJA 4J2BA 2ZGZA 4LF7K 5E84A 1UA1A 1JKHA 1F21A 2QM1A 4M7YA 1C0GA 5DMRA 4H0OA 5EU7A 4CGHA 1Q86O 1T8EA 3D2FA 1RTJA 2Y1IA 4LC9B 1BA0A 2AP1A
chains in the Genus database with same CATH topology
3CYMA 1RNHA 3AVNA 3KLEA 1B9DA 3VQ6A 2KW4A 4DMNA 4CGGA 1LAVA 2D0AA 2ZE2A 3VQCA 3KK2A 5FRMA 2HW3A 5C24A 3TAMA 4FJIA 4J2AA 2QXFA 4FJHA 1WSGA 2YNIA 3IG1A 3NF9A 2YKNA 4DF4A 1D9FA 4HCCA 4K8XA 3PUFA 3QO9A 5JS1A 3H08A 1O1WA 2OPRA 1Q9YA 4ZHRA 1S1WA 4BE2A 1IO2A 4F3TA 2IOCA 3MECA 3ZT4A 3MAQA 4FLYA 1JLEA 4LSNA 4XIUA 4M3TA 4CF1A 1U45A 4CIEA 3DRRA 1HYZA 1IKWA 1CZBA 4I9LA 4FLUA 3PO4A 1IKXA 4DSKA 4FYDA 4BE1A 1NK0A 4FJ7A 4EP5A 3VQBA 2DFHA 1HNIA 4Y1DA 4FJ5A 3HM9A 1DTQA 1EETA 3PV8A 1XI1A 1BL3A 1T05A 1BIUA 3IRXA 3OYMA 3M8SA 1SKRA 4BE0A 4DQQA 1NJWA 4WE1A 2HNYA 1C0UA 3TR8A 1S5JA 4LH5A 2BGGA 4CHQA 2FBYA 3SPZA 3DLHA 1KVCA 1S6PA 3L2QA 1L5UA 4E89A 4IFVA 2XO7A 4FM2A 3QEVA 1RT1A 4W5TA 4CJVA 3VQAA 3D0PA 3NGZA 3WNFA 4FJKA 4Z4GA 4FLZA 4DU4A 4BWMA 3SQ1A 2FBXA 3O3FA 4CJPA 4ELTA 4Z4EA 2IAJA 1BIZA 4DU3A 4F2SA 4JLHA 3C94A 2QKKA 4CEZA 4F8RA 3K5MA 2XY6A 3AVBA 3RRHA 3QEIA 4ZTJA 2KQ2A 4C8KA 3KK1A 4CFCA 3OYEA 4H4OA 3NF6A 1C1CA 1J54A 3AA3A 4ELUA 3AVLA 4E7KA 1QSYA 2P51A 4OLBA 4ICLA 2RN2A 2BE2A 3V1OA 3OYHA 4B9LA 4M41A 2B6AA 2KZMA 3VQ7A 5J2QA 3S3OA 2YNGA 4O5BA 4NCAA 3CG7A 4PQUA 1RBTA 1QE1A 5HRSA 3HXMA 4CCHA 4FLXA 4KB1A 3OYLA 1SV5A 2P1JA 1S1UA 5C25A 4YNQA 3TAQA 4M3UA 3ZSVA 2A1RA 3S3MA 3KKSA 1SL2A 3KIOA 1IKYA 2WONA 4O55A 3I8DA 3V9ZA 4CFBA 3TAFA 1NOZA 3AO4A 4AH9A 3ZT1A 3QEXA 4KHQA 4E0DA 3TARA 1HYSA 4ELVA 1IKVA 4B9UA 4G1QA 4YFUA 1RBVA 4KKOA 4O0JA 4CFDA 1D8YA 3ZCMA 3KLIA 4M3YA 3EYZA 3HJFA 3AA5X 3DRSA 3MXMA 4NYNA 1XHZA 3U3GA 4FW2A 3NGYA 2BDPA 4H4MA 1YTUA 5HROA 4PY5A 4DFMA 3T19A 4CK2A 1TAQA 3OYCA 1S9GA 1UAXA 5DK5A 1LW2A 4NCGA 1QSLA 1I39A 4B9SA 4IFYA 3NF7A 4W5OA 1ASVA 1GOBA 3RMAA 1LW0A 2B5JA 5E41A 1X9WA 3L2WA 4PWDA 2KFZA 4CFAA 1RDBA 1WLJA 4DU1A 4DTMA 4HTUA 4L8RB 4RW8A 3V9UA 2XY8A 5I3UA 4KPYA 4OKKA 3DLKA 2YHAA 4OJRA 3K59A 4F3OA 3LP1A 1KTQA 1HQUA 3HL8A 4KTZA 1WSFA 3V1QA 4CJUA 4W5RA 3SV3A 4CECA 2IDOA 3QEPA 4M3WA 4I2PA 5HRRA 3V9SA 3SNNA 1NK8A 3KD1E 1SUQA 3OVNA 4RW9A 3FFIA 1WSEA 4Z4CA 3TWHA 3K57A 4I7FA 2PYJA 3VQ8A 4CF0A 4HVJA 3HYFA 1WAFA 4AHVA 4DTJA 4KHYA 1A5VA 4OPJA 1RT6A 3F73A 1HJRA 4EZ6A 3LALA 3DLRA 4OPKA 1VSHA 4B08A 3K5NA 3DRPA 4DSLA 2VG7A 2YNHA 1FKOA 1C1BA 1TGOA 2R7YA 1GOAA 4CF2A 2GBZA 3ULDA 4HUEA 4KHUA 4OKJA 1JL1A 3LPUA 4DTPA 1RDAA 1R0AA 4OLAA 3I0SA 4CHOA 4QCLA 3C6UA 2JLEA 3AVKA 4AHSA 3LZIA 4IG0A 1BI4B 3M8QA 4CIFA 1NJXA 4NYFA 3HPHA 2ZQBA 1JLGA 4CGDA 1C6VA 3HVRA 3VQPA 4AHTA 1RCHA 3IS9A 1LWFA 1TKTA 3AVCA 4TSXA 3TAGA 3V1RA 4CK3A 3HPOA 3L3UA 1HPZA 2ETJA 4B9VA 4ZTFA 3NE6A 3K5LA 4FLTA 4DQSA 3RWUA 1LV5A 2RKIA 3SQ4A 3VQ9A 5CYQA 1VSKA 1YT3A 2Z1IA 3PX4A 2P5OA 3L2VA 1BCOA 3QIPA 3OJUA 3AV9A 2E6MA 2PY5A 3O4NA 4CERA 2HVIA 1B92A 1BQNA 1HYVA 2OPQA 3QESA 1T7PA 1CLQA 1S9EA 3ZT2A 2KFNA 4E7IA 4KHSA 4FCYA 5HP1A 2IC3A 4C8MA 1Q8IA 2HHSA 4FZYA 2AJQA 3PO5A 2YHBA 1G15A 4FXDA 1JXBA 1RT3A 1KVBA 2G8VA 4J2EA 4HCBA 1VRTA 3ITHA 4RG8A 3VN5A 1EX4A 4FM1A 3BGRA 4CIGA 1ZBIA 3VQEA 1VSIA 4DSJA 3C6TA 3KKRA 1KFDA 3TABA 4IBNA 4CJ5A 1S1XA 3K5OA 1U04A 1NKCA 3U3YA 1T03A 3NH2A 1X9SA 2F96A 3AVGA 2A1SA 3AA2A 3EZ5A 2G8UA 4QOZB 1JLBA 3F9KA 3AVFA 3ZSQA 4CJWA 4EP4A 3NBPA 3EY1A 4DLGA 4B3OA 2XHBA 5HBMA 4Q0BA 4B9TA 5J2MA 3L8BA 3P1GA 3I0RA 3WNHA 3AA4A 1VSEA 4JRPA 1RBRA 4DQPA 2E4LA 1XC9A 3S9HA 4FJ9A 2Y1JA 4M3XA 3TAPA 4M42A 3T1AA 4FZXC 3SV4A 1NOYA 3ALYA 2XY7A 4CJSA 3ZSZA 4FLWA 3KD5E 1J5OA 4CGJA 3AO2A 3QINA 4DLEA 1KSPA 4O4GA 1LWEA 4CF9A 4DFPA 4CK1A 3V9WA 4DWIA 2XY5A 1C1AA 1SKWA 3HPGA 3ZSWA 3DOLA 4N5SA 1RDDA 2D0BA 4UQGA 3LZJA 4C8LA 4EZ9A 1FXXA 3NFAA 3NCIA 4RW7A 4LY7A 1QTMA 3LP3A 4NCBA 1TK8A 3ZSRA 2GV9A 3V6DA 1RTDA 1RDCA 2KZZA 1WSJA 3ZT0A 2IGIA 1TK0A 4QAGA 3OYAA 2HNDA 1XWLA 3RMDA 5HRPA 1KFSA 3HP6A 3SQ2A 4KFBA 1K6YA 1TKZA 1J53A 5CZ1A 2OPPA 3O4QA 3KLFA 1N5YA 4PUOA 4HUGA 2HHQA 1ZBFA 2G8HA 2YKMA 4N47A 4KO0A 4B9NA 3IAYA 5JS2A 1KLNA 5KTQA 3PY8A 1ZBHA 4CJ3A 3D45A 4OGEA 3RMBA 4AHRA 4DSFA 1C0TA 1WSIA 2VWJA 4FJLA 4JS4A 1VSJA 4Q5VA 3SZ2A 4DTXA 1Q9XA 2X74A 3HSTB 3QIOA 4DTNA 3ZSXA 3VQQA 1BHLA 1JLAA 2QKBA 3OS2A 3ISNC 3NAEA 4DS4A 4M3ZA 1RT2A 5CZ2A 3NDKA 3E01A 4AILC 2X6SA 3G0ZA 5K14A 1RT5A 2XRIA 1RT7A 2X78A 2OYQA 1QS4A 4CHNA 1L3VA 5D3GA 2HHTA 4K8ZA 1S1TA 3V4IA 4Z4FA 3OS0A 1RTHA 1U49A 2P5GA 1BISA 3B6OA 3QETA 3MEGA 3OS1A 3OYNA 2ZD1A 4JS5A 1ASUA 4O0IA 1WAJA 5I42A 4N56A 1LAWA 3AVIA 3AVAA 3HP9A 2O4IA 3T3FA 2D5RA 5KGXA 3ZSYA 3HK2A 5HRNA 4KREA 4BDPA 3P5JA 3VQ4A 1LWCA 3KLGA 1KLMA 4CJFA 3B6PA 4DTSA 4DF8A 4FK2A 1UWBA 3OYJA 5FDLA 2IS3A 3AO1A 4GW6A 5KRTA 4E19A 1TL1A 2F8SA 4CJKA 1EP4A 4DTRA 1NJYA 1RILA 4FZZA 4Z0UA 5FROA 1NKEA 3HT3A 2G8IA 3KJVA 3LANA 2G8KA 4DG1A 4AHCA 1EXQA 3C95A 3SUOA 1HNVA 3ASMA 3U6FA 4F4KA 4FJMA 3NHGA 3VA0A 3L3VA 1SL1A 2OZSA 2PZSA 3A2FA 2F8TA 1IG9A 4DTOA 4I9QA 2G8WA 1HRHA 1BQMA 1I3AA 1WNSA 4CGIA 3OYGA 3LPTA 4HUFA 3V9XA 3G10A 3MEDA 1BI4A 5SZTA 4E7HA 4DSEA 1W9HA 3SUNA 3LAKA 4KAZA 4F2RA 1VSDA 3AO3A 3KTQA 3CM6A 4DQIA 3VQ5A 1UOCA 4MFBA 3THVA 4Z4IA 3LAMA 3SUQA 3MXIA 2OPSA 1BCMA 5CY4A 2HHUA 3NH1A 3JSMA 3SUPA 1BGXT 4O44A 3TAEA 1XHXA 2JGUA 5J2NA 2HHXA 4M3RA 3M8PA 1KVAA 3PX0A 4GVMA 3RMCA 4W5QA 3S3NA 4FVMA 4FJNA 1NK5A 1N6QA 2OA8A 1RBSA 1WN7A 2FBVA 4CEFA 3L2UA 4OKEA 3KK3A 1U48A 3SI6A 2DFFA 1KCFA 1KRPA 3RTVA 1TKDA 3HVTA 2RF2A 4ID5A 1NK4A 1RTIA 3LP2A 1NK7A 1TK5A 1IH7A 1VK0A 1TVRA 2EX3A 1NJZA 1VSMA 3TI0A 5HLFA 1JL2A 1RBUA 3CM5A 5KI6A 4CJ4A 1X1PA 4KI4A 4CJEA 2X6NA 3NGIA 1L3TA 4CF8A 1W0HA 4BDYA 1ZBLA 2HHVA 4PA1A 1D5AA 2W42A 5FRNA 4FJXA 1RT4A 3OYKA 2VWKA 1QQCA 4CHYA 4BWJA 3SCXA 1J9AA 4CEBA 3SYZA 3PX6A 1REVA 4N76A 1DTTA 1ASWA 4OGCA 1TAUA 4DFJA 1ZBUA 3BDPA 3AVMA 3NH0A 4LSLA 3CFOA 3DMJA 3OJSA 3OYIA 3HO1A 1Y97A 4IG3A 4KTWA 1QSSA 4E1MA 3OYDA 2B4JA 1NKBA 1B9FA 1VSLA 1UA0A 2HNZA 4GMJB 3O3GA 2O4GA 3DM2A 4E1NA 3K2PA 3WNEA 3JYTA 1D9DA 1VRUA 1S1VA 2Z1GA 3O3HA 4KB0A 4CEOA 1YTAA 1CXUA 3V81A 3TANA 4N41A 2D0CA 3SJJA 4OVLA 1HQEA 4FK4A 4RW4A 1L3SA 1MU2A 2ITGA 3AO5A 2HMIA 4BDZA 1Z26A 2FC0A 4IDKA 4LH4A 3ZT3A 4CE9A 4HHTA 1A5WA 3NF8A 3OY9A 2OZMA 4DSIA 3CFRA 1YVUA 3OYFA 5J1EA 2Z1HA 4Y1CA 2HVHA 2HHWA 1FKPA 4CGFA 3DLGA 3OYBA 2HB5A 3LWMA 3LP0A 4FLVA 3DI6A 4E7LA 5KGWA 2Q3SA 2Z1JA 3M8RA 3CQ8A 3P83D 5KRSA 3UIQA 5J2PA 2RPIA 4LD0A 2KTQA 2GUIA 3CFPA 1TL3A 2YV0X 2BANA 2PYLA 1QHTA 4KV8A 4CHPA 3QNNA 4CHZA 1TV6A 1SKSA 4FM0A 1U4BA 3RRGA 3QNOA 4DFKA 4DTUA 3KLHA 1JXEA 2E6LA 4B9MA 3AVHA 4CJLA 4C8NA 4MQ3A 1SL0A 3DLBA 3QLHA 1L3UA 3L2RA 4B8CA 5C42A 3K58A 4DQRA 4M45A 4FK0A 3VQDA 4KI6A 1WSHA 5SWMA 2VG6A 2NUBA 1EKEA 5T7BA 2VG5A 4DS5A 1U47A 4CESA 3SQ0A 1VSFA 3VA3A 4CJTA 1C0MA 4KRFA 4FJGA 4C8OA 2ATQA 4CEQA 4CEEA 3MEEA 2DFEA 3LWLA 2G8FA 4FW1A 4J2DA 4FJ8A 3SPYA 1CXQA 1JLQA 2YNFA 4KHNA 4KHWA 4AHUA 4CEDA 3DLEA 4CEAA 3LDSA 1X9MA 1NK6A 4CJRA 2I5JA 4W5NA 1ZYQA 2EHGA 3AVJA 3MXJA 4H8KA 2DTUA 1NK9A 1TKXA 1A5XA 4J2BA 1CZ9A 3QEWA 4IKFA 3ZSOA 3WNGA 1JKHA 4ID1A 4I2QA 1UA1A 1F21A 4B8AB 4Z4HA 4JRQA 4KTQA 1HMVA 5CYMA 3DOKA 4CJQA 1DLOA 1ITGA 4RW6A 1JLCA 5DMRA 2FBTA 4FJJA 4BACA 4E7JA 5EU7A 2WOMA 1FK9A 4CGHA 4E3SA 3RR8A 3QERA 1GOCA 1Z25A 1T8EA 2QK9A 1S6QA 2LSNA 2DY4A 3DYAA 1RTJA 4R5PA 2Y1IA 1JLFA 3RR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYM A;  1RNH A;  3AVN A;  3KLE A;  1B9D A;  3VQ6 A;  2KW4 A;  4DMN A;  4CGG A;  1LAV A;  2D0A A;  2ZE2 A;  3VQC A;  3KK2 A;  5FRM A;  2HW3 A;  5C24 A;  3TAM A;  4FJI A;  4J2A A;  2QXF A;  4FJH A;  1WSG A;  2YNI A;  3IG1 A;  3NF9 A;  2YKN A;  4DF4 A;  1D9F A;  4HCC A;  4K8X A;  3PUF A;  3QO9 A;  5JS1 A;  3H08 A;  1O1W A;  2OPR A;  1Q9Y A;  4ZHR A;  1S1W A;  4BE2 A;  1IO2 A;  4F3T A;  2IOC A;  3MEC A;  3ZT4 A;  3MAQ A;  4FLY A;  1JLE A;  4LSN A;  4XIU A;  4M3T A;  4CF1 A;  1U45 A;  4CIE A;  3DRR A;  1HYZ A;  1IKW A;  1CZB A;  4I9L A;  4FLU A;  3PO4 A;  1IKX A;  4DSK A;  4FYD A;  4BE1 A;  1NK0 A;  4FJ7 A;  4EP5 A;  3VQB A;  2DFH A;  1HNI A;  4Y1D A;  4FJ5 A;  3HM9 A;  1DTQ A;  1EET A;  3PV8 A;  1XI1 A;  1BL3 A;  1T05 A;  1BIU A;  3IRX A;  3OYM A;  3M8S A;  1SKR A;  4BE0 A;  4DQQ A;  1NJW A;  4WE1 A;  2HNY A;  1C0U A;  3TR8 A;  1S5J A;  4LH5 A;  2BGG A;  4CHQ A;  2FBY A;  3SPZ A;  3DLH A;  1KVC A;  1S6P A;  3L2Q A;  1L5U A;  4E89 A;  4IFV A;  2XO7 A;  4FM2 A;  3QEV A;  1RT1 A;  4W5T A;  4CJV A;  3VQA A;  3D0P A;  3NGZ A;  3WNF A;  4FJK A;  4Z4G A;  4FLZ A;  4DU4 A;  4BWM A;  3SQ1 A;  2FBX A;  3O3F A;  4CJP A;  4ELT A;  4Z4E A;  2IAJ A;  1BIZ A;  4DU3 A;  4F2S A;  4JLH A;  3C94 A;  2QKK A;  4CEZ A;  4F8R A;  3K5M A;  2XY6 A;  3AVB A;  3RRH A;  3QEI A;  4ZTJ A;  2KQ2 A;  4C8K A;  3KK1 A;  4CFC A;  3OYE A;  4H4O A;  3NF6 A;  1C1C A;  1J54 A;  3AA3 A;  4ELU A;  3AVL A;  4E7K A;  1QSY A;  2P51 A;  4OLB A;  4ICL A;  2RN2 A;  2BE2 A;  3V1O A;  3OYH A;  4B9L A;  4M41 A;  2B6A A;  2KZM A;  3VQ7 A;  5J2Q A;  3S3O A;  2YNG A;  4O5B A;  4NCA A;  3CG7 A;  4PQU A;  1RBT A;  1QE1 A;  5HRS A;  3HXM A;  4CCH A;  4FLX A;  4KB1 A;  3OYL A;  1SV5 A;  2P1J A;  1S1U A;  5C25 A;  4YNQ A;  3TAQ A;  4M3U A;  3ZSV A;  2A1R A;  3S3M A;  3KKS A;  1SL2 A;  3KIO A;  1IKY A;  2WON A;  4O55 A;  3I8D A;  3V9Z A;  4CFB A;  3TAF A;  1NOZ A;  3AO4 A;  4AH9 A;  3ZT1 A;  3QEX A;  4KHQ A;  4E0D A;  3TAR A;  1HYS A;  4ELV A;  1IKV A;  4B9U A;  4G1Q A;  4YFU A;  1RBV A;  4KKO A;  4O0J A;  4CFD A;  1D8Y A;  3ZCM A;  3KLI A;  4M3Y A;  3EYZ A;  3HJF A;  3AA5 X;  3DRS A;  3MXM A;  4NYN A;  1XHZ A;  3U3G A;  4FW2 A;  3NGY A;  2BDP A;  4H4M A;  1YTU A;  5HRO A;  4PY5 A;  4DFM A;  3T19 A;  4CK2 A;  1TAQ A;  3OYC A;  1S9G A;  1UAX A;  5DK5 A;  1LW2 A;  4NCG A;  1QSL A;  1I39 A;  4B9S A;  4IFY A;  3NF7 A;  4W5O A;  1ASV A;  1GOB A;  3RMA A;  1LW0 A;  2B5J A;  5E41 A;  1X9W A;  3L2W A;  4PWD A;  2KFZ A;  4CFA A;  1RDB A;  1WLJ A;  4DU1 A;  4DTM A;  4HTU A;  4L8R B;  4RW8 A;  3V9U A;  2XY8 A;  5I3U A;  4KPY A;  4OKK A;  3DLK A;  2YHA A;  4OJR A;  3K59 A;  4F3O A;  3LP1 A;  1KTQ A;  1HQU A;  3HL8 A;  4KTZ A;  1WSF A;  3V1Q A;  4CJU A;  4W5R A;  3SV3 A;  4CEC A;  2IDO A;  3QEP A;  4M3W A;  4I2P A;  5HRR A;  3V9S A;  3SNN A;  1NK8 A;  3KD1 E;  1SUQ A;  3OVN A;  4RW9 A;  3FFI A;  1WSE A;  4Z4C A;  3TWH A;  3K57 A;  4I7F A;  2PYJ A;  3VQ8 A;  4CF0 A;  4HVJ A;  3HYF A;  1WAF A;  4AHV A;  4DTJ A;  4KHY A;  1A5V A;  4OPJ A;  1RT6 A;  3F73 A;  1HJR A;  4EZ6 A;  3LAL A;  3DLR A;  4OPK A;  1VSH A;  4B08 A;  3K5N A;  3DRP A;  4DSL A;  2VG7 A;  2YNH A;  1FKO A;  1C1B A;  1TGO A;  2R7Y A;  1GOA A;  4CF2 A;  2GBZ A;  3ULD A;  4HUE A;  4KHU A;  4OKJ A;  1JL1 A;  3LPU A;  4DTP A;  1RDA A;  1R0A A;  4OLA A;  3I0S A;  4CHO A;  4QCL A;  3C6U A;  2JLE A;  3AVK A;  4AHS A;  3LZI A;  4IG0 A;  1BI4 B;  3M8Q A;  4CIF A;  1NJX A;  4NYF A;  3HPH A;  2ZQB A;  1JLG A;  4CGD A;  1C6V A;  3HVR A;  3VQP A;  4AHT A;  1RCH A;  3IS9 A;  1LWF A;  1TKT A;  3AVC A;  4TSX A;  3TAG A;  3V1R A;  4CK3 A;  3HPO A;  3L3U A;  1HPZ A;  2ETJ A;  4B9V A;  4ZTF A;  3NE6 A;  3K5L A;  4FLT A;  4DQS A;  3RWU A;  1LV5 A;  2RKI A;  3SQ4 A;  3VQ9 A;  5CYQ A;  1VSK A;  1YT3 A;  2Z1I A;  3PX4 A;  2P5O A;  3L2V A;  1BCO A;  3QIP A;  3OJU A;  3AV9 A;  2E6M A;  2PY5 A;  3O4N A;  4CER A;  2HVI A;  1B92 A;  1BQN A;  1HYV A;  2OPQ A;  3QES A;  1T7P A;  1CLQ A;  1S9E A;  3ZT2 A;  2KFN A;  4E7I A;  4KHS A;  4FCY A;  5HP1 A;  2IC3 A;  4C8M A;  1Q8I A;  2HHS A;  4FZY A;  2AJQ A;  3PO5 A;  2YHB A;  1G15 A;  4FXD A;  1JXB A;  1RT3 A;  1KVB A;  2G8V A;  4J2E A;  4HCB A;  1VRT A;  3ITH A;  4RG8 A;  3VN5 A;  1EX4 A;  4FM1 A;  3BGR A;  4CIG A;  1ZBI A;  3VQE A;  1VSI A;  4DSJ A;  3C6T A;  3KKR A;  1KFD A;  3TAB A;  4IBN A;  4CJ5 A;  1S1X A;  3K5O A;  1U04 A;  1NKC A;  3U3Y A;  1T03 A;  3NH2 A;  1X9S A;  2F96 A;  3AVG A;  2A1S A;  3AA2 A;  3EZ5 A;  2G8U A;  4QOZ B;  1JLB A;  3F9K A;  3AVF A;  3ZSQ A;  4CJW A;  4EP4 A;  3NBP A;  3EY1 A;  4DLG A;  4B3O A;  2XHB A;  5HBM A;  4Q0B A;  4B9T A;  5J2M A;  3L8B A;  3P1G A;  3I0R A;  3WNH A;  3AA4 A;  1VSE A;  4JRP A;  1RBR A;  4DQP A;  2E4L A;  1XC9 A;  3S9H A;  4FJ9 A;  2Y1J A;  4M3X A;  3TAP A;  4M42 A;  3T1A A;  4FZX C;  3SV4 A;  1NOY A;  3ALY A;  2XY7 A;  4CJS A;  3ZSZ A;  4FLW A;  3KD5 E;  1J5O A;  4CGJ A;  3AO2 A;  3QIN A;  4DLE A;  1KSP A;  4O4G A;  1LWE A;  4CF9 A;  4DFP A;  4CK1 A;  3V9W A;  4DWI A;  2XY5 A;  1C1A A;  1SKW A;  3HPG A;  3ZSW A;  3DOL A;  4N5S A;  1RDD A;  2D0B A;  4UQG A;  3LZJ A;  4C8L A;  4EZ9 A;  1FXX A;  3NFA A;  3NCI A;  4RW7 A;  4LY7 A;  1QTM A;  3LP3 A;  4NCB A;  1TK8 A;  3ZSR A;  2GV9 A;  3V6D A;  1RTD A;  1RDC A;  2KZZ A;  1WSJ A;  3ZT0 A;  2IGI A;  1TK0 A;  4QAG A;  3OYA A;  2HND A;  1XWL A;  3RMD A;  5HRP A;  1KFS A;  3HP6 A;  3SQ2 A;  4KFB A;  1K6Y A;  1TKZ A;  1J53 A;  5CZ1 A;  2OPP A;  3O4Q A;  3KLF A;  1N5Y A;  4PUO A;  4HUG A;  2HHQ A;  1ZBF A;  2G8H A;  2YKM A;  4N47 A;  4KO0 A;  4B9N A;  3IAY A;  5JS2 A;  1KLN A;  5KTQ A;  3PY8 A;  1ZBH A;  4CJ3 A;  3D45 A;  4OGE A;  3RMB A;  4AHR A;  4DSF A;  1C0T A;  1WSI A;  2VWJ A;  4FJL A;  4JS4 A;  1VSJ A;  4Q5V A;  3SZ2 A;  4DTX A;  1Q9X A;  2X74 A;  3HST B;  3QIO A;  4DTN A;  3ZSX A;  3VQQ A;  1BHL A;  1JLA A;  2QKB A;  3OS2 A;  3ISN C;  3NAE A;  4DS4 A;  4M3Z A;  1RT2 A;  5CZ2 A;  3NDK A;  3E01 A;  4AIL C;  2X6S A;  3G0Z A;  5K14 A;  1RT5 A;  2XRI A;  1RT7 A;  2X78 A;  2OYQ A;  1QS4 A;  4CHN A;  1L3V A;  5D3G A;  2HHT A;  4K8Z A;  1S1T A;  3V4I A;  4Z4F A;  3OS0 A;  1RTH A;  1U49 A;  2P5G A;  1BIS A;  3B6O A;  3QET A;  3MEG A;  3OS1 A;  3OYN A;  2ZD1 A;  4JS5 A;  1ASU A;  4O0I A;  1WAJ A;  5I42 A;  4N56 A;  1LAW A;  3AVI A;  3AVA A;  3HP9 A;  2O4I A;  3T3F A;  2D5R A;  5KGX A;  3ZSY A;  3HK2 A;  5HRN A;  4KRE A;  4BDP A;  3P5J A;  3VQ4 A;  1LWC A;  3KLG A;  1KLM A;  4CJF A;  3B6P A;  4DTS A;  4DF8 A;  4FK2 A;  1UWB A;  3OYJ A;  5FDL A;  2IS3 A;  3AO1 A;  4GW6 A;  5KRT A;  4E19 A;  1TL1 A;  2F8S A;  4CJK A;  1EP4 A;  4DTR A;  1NJY A;  1RIL A;  4FZZ A;  4Z0U A;  5FRO A;  1NKE A;  3HT3 A;  2G8I A;  3KJV A;  3LAN A;  2G8K A;  4DG1 A;  4AHC A;  1EXQ A;  3C95 A;  3SUO A;  1HNV A;  3ASM A;  3U6F A;  4F4K A;  4FJM A;  3NHG A;  3VA0 A;  3L3V A;  1SL1 A;  2OZS A;  2PZS A;  3A2F A;  2F8T A;  1IG9 A;  4DTO A;  4I9Q A;  2G8W A;  1HRH A;  1BQM A;  1I3A A;  1WNS A;  4CGI A;  3OYG A;  3LPT A;  4HUF A;  3V9X A;  3G10 A;  3MED A;  1BI4 A;  5SZT A;  4E7H A;  4DSE A;  1W9H A;  3SUN A;  3LAK A;  4KAZ A;  4F2R A;  1VSD A;  3AO3 A;  3KTQ A;  3CM6 A;  4DQI A;  3VQ5 A;  1UOC A;  4MFB A;  3THV A;  4Z4I A;  3LAM A;  3SUQ A;  3MXI A;  2OPS A;  1BCM A;  5CY4 A;  2HHU A;  3NH1 A;  3JSM A;  3SUP A;  1BGX T;  4O44 A;  3TAE A;  1XHX A;  2JGU A;  5J2N A;  2HHX A;  4M3R A;  3M8P A;  1KVA A;  3PX0 A;  4GVM A;  3RMC A;  4W5Q A;  3S3N A;  4FVM A;  4FJN A;  1NK5 A;  1N6Q A;  2OA8 A;  1RBS A;  1WN7 A;  2FBV A;  4CEF A;  3L2U A;  4OKE A;  3KK3 A;  1U48 A;  3SI6 A;  2DFF A;  1KCF A;  1KRP A;  3RTV A;  1TKD A;  3HVT A;  2RF2 A;  4ID5 A;  1NK4 A;  1RTI A;  3LP2 A;  1NK7 A;  1TK5 A;  1IH7 A;  1VK0 A;  1TVR A;  2EX3 A;  1NJZ A;  1VSM A;  3TI0 A;  5HLF A;  1JL2 A;  1RBU A;  3CM5 A;  5KI6 A;  4CJ4 A;  1X1P A;  4KI4 A;  4CJE A;  2X6N A;  3NGI A;  1L3T A;  4CF8 A;  1W0H A;  4BDY A;  1ZBL A;  2HHV A;  4PA1 A;  1D5A A;  2W42 A;  5FRN A;  4FJX A;  1RT4 A;  3OYK A;  2VWK A;  1QQC A;  4CHY A;  4BWJ A;  3SCX A;  1J9A A;  4CEB A;  3SYZ A;  3PX6 A;  1REV A;  4N76 A;  1DTT A;  1ASW A;  4OGC A;  1TAU A;  4DFJ A;  1ZBU A;  3BDP A;  3AVM A;  3NH0 A;  4LSL A;  3CFO A;  3DMJ A;  3OJS A;  3OYI A;  3HO1 A;  1Y97 A;  4IG3 A;  4KTW A;  1QSS A;  4E1M A;  3OYD A;  2B4J A;  1NKB A;  1B9F A;  1VSL A;  1UA0 A;  2HNZ A;  4GMJ B;  3O3G A;  2O4G A;  3DM2 A;  4E1N A;  3K2P A;  3WNE A;  3JYT A;  1D9D A;  1VRU A;  1S1V A;  2Z1G A;  3O3H A;  4KB0 A;  4CEO A;  1YTA A;  1CXU A;  3V81 A;  3TAN A;  4N41 A;  2D0C A;  3SJJ A;  4OVL A;  1HQE A;  4FK4 A;  4RW4 A;  1L3S A;  1MU2 A;  2ITG A;  3AO5 A;  2HMI A;  4BDZ A;  1Z26 A;  2FC0 A;  4IDK A;  4LH4 A;  3ZT3 A;  4CE9 A;  4HHT A;  1A5W A;  3NF8 A;  3OY9 A;  2OZM A;  4DSI A;  3CFR A;  1YVU A;  3OYF A;  5J1E A;  2Z1H A;  4Y1C A;  2HVH A;  2HHW A;  1FKP A;  4CGF A;  3DLG A;  3OYB A;  2HB5 A;  3LWM A;  3LP0 A;  4FLV A;  3DI6 A;  4E7L A;  5KGW A;  2Q3S A;  2Z1J A;  3M8R A;  3CQ8 A;  3P83 D;  5KRS A;  3UIQ A;  5J2P A;  2RPI A;  4LD0 A;  2KTQ A;  2GUI A;  3CFP A;  1TL3 A;  2YV0 X;  2BAN A;  2PYL A;  1QHT A;  4KV8 A;  4CHP A;  3QNN A;  4CHZ A;  1TV6 A;  1SKS A;  4FM0 A;  1U4B A;  3RRG A;  3QNO A;  4DFK A;  4DTU A;  3KLH A;  1JXE A;  2E6L A;  4B9M A;  3AVH A;  4CJL A;  4C8N A;  4MQ3 A;  1SL0 A;  3DLB A;  3QLH A;  1L3U A;  3L2R A;  4B8C A;  5C42 A;  3K58 A;  4DQR A;  4M45 A;  4FK0 A;  3VQD A;  4KI6 A;  1WSH A;  5SWM A;  2VG6 A;  2NUB A;  1EKE A;  5T7B A;  2VG5 A;  4DS5 A;  1U47 A;  4CES A;  3SQ0 A;  1VSF A;  3VA3 A;  4CJT A;  1C0M A;  4KRF A;  4FJG A;  4C8O A;  2ATQ A;  4CEQ A;  4CEE A;  3MEE A;  2DFE A;  3LWL A;  2G8F A;  4FW1 A;  4J2D A;  4FJ8 A;  3SPY A;  1CXQ A;  1JLQ A;  2YNF A;  4KHN A;  4KHW A;  4AHU A;  4CED A;  3DLE A;  4CEA A;  3LDS A;  1X9M A;  1NK6 A;  4CJR A;  2I5J A;  4W5N A;  1ZYQ A;  2EHG A;  3AVJ A;  3MXJ A;  4H8K A;  2DTU A;  1NK9 A;  1TKX A;  1A5X A;  4J2B A;  1CZ9 A;  3QEW A;  4IKF A;  3ZSO A;  3WNG A;  1JKH A;  4ID1 A;  4I2Q A;  1UA1 A;  1F21 A;  4B8A B;  4Z4H A;  4JRQ A;  4KTQ A;  1HMV A;  5CYM A;  3DOK A;  4CJQ A;  1DLO A;  1ITG A;  4RW6 A;  1JLC A;  5DMR A;  2FBT A;  4FJJ A;  4BAC A;  4E7J A;  5EU7 A;  2WOM A;  1FK9 A;  4CGH A;  4E3S A;  3RR8 A;  3QER A;  1GOC A;  1Z25 A;  1T8E A;  2QK9 A;  1S6Q A;  2LSN A;  2DY4 A;  3DYA A;  1RTJ A;  4R5P A;  2Y1I A;  1JLF A;  3RR7 A; 
#chains in the Genus database with same CATH topology
 3CYM A;  4BR9 A;  1RNH A;  3AVN A;  2OTL N;  1S22 A;  1LAV A;  4CGG A;  1HX1 A;  2HW3 A;  4LFB K;  1WSG A;  3IG1 A;  1ZC6 A;  3O5B A;  4O8K A;  1U2V A;  3H08 A;  3ZT4 A;  3MEC A;  4XIU A;  2ASM A;  4JK7 A;  2I7N A;  3DRR A;  4JAX A;  5IWA K;  1Q18 A;  3OTO K;  4ISG A;  4FYD A;  2WC9 A;  4BE1 A;  1NK0 A;  2HOE A;  1DTQ A;  1EET A;  3PV8 A;  1BL3 A;  2FXU A;  4WE1 A;  2HNY A;  4LH5 A;  3CC2 N;  1R59 O;  2E88 A;  3HZ6 A;  1KVC A;  4E89 A;  4ISF A;  5BR9 A;  3PIO L;  2XO7 A;  3EE8 A;  3QEV A;  5AQV A;  1WBB A;  3VQA A;  4FLZ A;  3CF5 L;  3VTH A;  3SQ1 A;  1KAY A;  3O3F A;  1DKG D;  4CJP A;  1NGE A;  4BRH A;  1BIZ A;  4DU3 A;  4WFA L;  2HHH K;  1RDU A;  3WUH A;  1ATN A;  3ZX3 A;  1NGD A;  3IDH A;  4C8K A;  3KK1 A;  3NF6 A;  2NRW A;  1J54 A;  3J8A A;  3SAG A;  4ELU A;  3AVL A;  1QSY A;  2P51 A;  3F5T A;  4ICL A;  2BE2 A;  2B6A A;  5I9E B;  2KZM A;  4NCA A;  2QWO A;  1RBT A;  3FFK B;  5DM6 L;  4FSV A;  5HRS A;  1WUA A;  5C25 A;  3ZSV A;  3V9Z A;  2A5X A;  4O55 A;  1RGI A;  4FWN A;  3CC7 N;  3ZT1 A;  1SS6 A;  5KQ8 A;  4YFU A;  4O0J A;  4KKO A;  1HKG A;  3ZCM A;  3EYZ A;  3AA5 X;  1RDW X;  3DRS A;  4NYN A;  3NGY A;  3QBW A;  4H4M A;  3FE1 A;  4PY5 A;  1LW2 A;  4B9S A;  2DPN A;  1ASV A;  3LDP A;  5E41 A;  1X9W A;  3L2W A;  3HBT A;  5C2F A;  3J80 O;  3CI5 A;  4DTM A;  3J7A P;  3CMA N;  4RW8 A;  5I3U A;  4M63 C;  4OKK A;  4JI2 K;  3LP1 A;  1KTQ A;  1HQU A;  3HL8 A;  4JN4 A;  4KTZ A;  5AQM A;  4M3W A;  4FWR A;  5HRR A;  2GUP A;  4EIA A;  3C6A A;  2ZM6 K;  3SNN A;  3KD1 E;  1SUQ A;  4RW9 A;  5AR0 A;  3CXC M;  1WSE A;  3LM9 A;  4BG9 A;  4CF0 A;  3CJ1 A;  5LL6 Z;  1WAF A;  5IT9 O;  1A5V A;  2KKZ A;  3F73 A;  5EOY A;  3DLR A;  1VSH A;  3DRP A;  4DSL A;  2VG7 A;  2YNH A;  1FKO A;  5M1O A;  3ULD A;  4HUE A;  3M5R A;  3D6R A;  3H6E A;  2NRT A;  4CHO A;  4DR6 K;  3M8Q A;  4CIF A;  3ENO A;  3K9K A;  3IS9 A;  3AVC A;  4TSX A;  4B1U B;  1J6Z A;  3L3U A;  1HPZ A;  3K9J A;  2I7P A;  4B1V A;  4JKG B;  3SQ4 A;  2Z1I A;  3GL1 A;  3DXK A;  2P5O A;  3L2V A;  3QIP A;  2E6M A;  4CZK A;  2P9N A;  1YXQ A;  4NLC A;  2YI1 A;  1S9E A;  2BH1 A;  2KFN A;  5BRF A;  1N33 K;  4DV5 K;  2G8V A;  4CIG A;  4LF6 K;  3MK6 A;  1DGK N;  3C6T A;  3KKR A;  3PSI A;  5EY4 A;  1MDU B;  1X9S A;  3BF1 A;  2F96 A;  2A1S A;  4DR5 K;  3ZSQ A;  3EY1 A;  2XHB A;  4Q0B A;  5LJV A;  3WNH A;  4M42 A;  1NWK A;  4H0P A;  5AFU H;  1NOY A;  4CJS A;  3ZSZ A;  1KAZ A;  4CGJ A;  3OBW A;  1EO1 A;  4OO1 J;  1VQ9 N;  1LWE A;  3R1X A;  1VQM N;  3V9W A;  3R8E A;  4DWI A;  1C1A A;  2O8D B;  1N32 K;  5EVZ A;  3VPZ A;  2E8A A;  4N5S A;  2QI2 A;  3NCI A;  3AAP A;  4RW7 A;  2A6A A;  3LP3 A;  4NCB A;  2W40 A;  1NJI O;  1TK8 A;  4JI4 K;  3CCE N;  1RTD A;  4NXM K;  3O9S A;  1BG3 A;  1TK0 A;  3G4S N;  4H5V A;  4DV0 K;  4BQL A;  1K8A O;  3EN9 A;  3UKU A;  4CVN E;  3I8B A;  5CZ1 A;  2OPP A;  2YKM A;  3RSE B;  1EWR A;  2Q31 A;  1KLN A;  3R6M A;  4B9N A;  2O8E A;  2YJF A;  4CJ3 A;  3U4L A;  1HR0 K;  4AHR A;  1C0T A;  3VF2 A;  4DB3 A;  2VWJ A;  3J81 O;  3SZ2 A;  4BR5 A;  5C15 A;  2X74 A;  3ZSX A;  3VQQ A;  3W0L A;  2NRV A;  1YAG A;  3NAE A;  4M3Z A;  5CZ2 A;  3NDK A;  1E3M A;  3G0Z A;  3SMP A;  4YOY A;  1RT5 A;  1RT7 A;  2OYQ A;  2HHT A;  2YCH A;  4Z4F A;  4CW7 B;  3MEG A;  3OS1 A;  1NU0 A;  4JS5 A;  2NRH A;  1WAJ A;  5JMV A;  4CBW A;  4OPA A;  3DXM B;  2O4I A;  3CCR N;  3C7N B;  3MDQ A;  3VQ4 A;  1LWC A;  4DTS A;  4CJF A;  4DF8 A;  5AJ3 K;  2QW9 A;  3UKR A;  3AO1 A;  4GW6 A;  5KRT A;  2UU9 K;  4E19 A;  2HF4 A;  4AM7 A;  4JHD B;  5FRO A;  2ZJR L;  4DG1 A;  1EXQ A;  3SUO A;  4IOA L;  4PHT X;  4F4K A;  3NHG A;  1VQO N;  3A2F A;  5HL7 L;  1IG9 A;  4DTO A;  4WQ5 C;  4HUF A;  3V9X A;  2UXC K;  4HWI A;  5SZT A;  4F2R A;  2P9S A;  4DQI A;  4Z4I A;  3LAM A;  3SUQ A;  3VTI A;  2V51 B;  5CY4 A;  5JIC A;  1BGX T;  3TAE A;  5J2N A;  1E4F T;  3M8P A;  3S3N A;  1HPM A;  1WN7 A;  4OKE A;  3KK3 A;  1U48 A;  3BUZ B;  1XQS C;  3N4Q A;  4FWO A;  1YJN N;  1VSM A;  4XH4 A;  1JL2 A;  4CJ4 A;  3FZM A;  2YJE A;  3NGI A;  1IV0 A;  1OVY A;  4RWT A;  3ZET B;  1REV A;  1ASW A;  3FZL A;  1N36 K;  3OJS A;  1QSS A;  1VQN N;  2O8B A;  2P9K B;  4BR7 A;  2ITM A;  2B4J A;  1NKB A;  3CIP A;  2QWL A;  2VQF K;  3NVK A;  2O4G A;  2UUB K;  4E1N A;  4B1W B;  4YDU A;  4FWM A;  3JAM O;  4YOV A;  3JYT A;  1D9D A;  1S1V A;  2CGJ A;  2D0C A;  2BTF A;  5AZJ B;  1IBL K;  2P9L A;  4IDK A;  4LH4 A;  3ZT3 A;  4CE9 A;  1A5W A;  3NF8 A;  3VEW A;  3OY9 A;  3CFR A;  1KQS M;  1K8K A;  5J1E A;  2HVH A;  3D7E O;  4Y1C A;  5EX5 A;  3LWM A;  2P9I B;  3QIC A;  2Z1J A;  4K41 A;  3TPQ A;  2E1Z A;  4V19 S;  3RVC A;  3CCV N;  3J7Y P;  2E20 A;  4BC2 A;  1NMN A;  3ZLJ A;  3CFP A;  3ZYY X;  2PYL A;  4KV8 A;  3RRG A;  4GV3 A;  1U4B A;  1NGA A;  3AVH A;  4CJL A;  3DLB A;  3QLH A;  2NRR A;  5C42 A;  3VQD A;  4DS5 A;  1NM1 A;  3GE1 A;  4CEQ A;  3MEE A;  1VQ6 N;  2G8F A;  4B1Y B;  3CME N;  1JLQ A;  2YNF A;  5C12 A;  3VEZ A;  3DLE A;  3GOI A;  3CHW A;  1NNE A;  2I5J A;  1ZYQ A;  2EHG A;  2DTU A;  1NK9 A;  1A5X A;  1CZ9 A;  3QEW A;  4MLE A;  3WNG A;  4EHT A;  1NGH A;  4BRN A;  1TUY A;  5CYM A;  4JKH A;  3KVG A;  4RW6 A;  4E7J A;  2WOM A;  3ID8 A;  3QER A;  2LSN A;  2DY4 A;  4R5P A;  3TSU A;  3KK7 A;  4Z0U A;  3GBT A;  4DV4 K;  2VWB A;  1B9D A;  4NB4 A;  3KK2 A;  3VQC A;  5AQU A;  5C24 A;  4FWS A;  3TAM A;  2YNI A;  4HCC A;  3NF9 A;  2E2P A;  2YKN A;  4O5F A;  1YJW N;  4IO8 A;  1C0F A;  5GIO A;  2OPR A;  1Q9Y A;  4QS9 A;  4ZHR A;  2IOC A;  3MAQ A;  4FLY A;  1JLE A;  2NNW A;  4CF1 A;  1CZA N;  3CJ7 A;  4FLU A;  3PO4 A;  4DSK A;  3IFR A;  2DFH A;  4BRA A;  2Q2R A;  1BIU A;  3IRX A;  3M8S A;  1HLU A;  1S5J A;  2NRZ A;  2ZWH A;  1NGF A;  4JKC A;  1TUU A;  2ASO A;  3E9P A;  3I33 A;  1L5U A;  4CJV A;  2F9T A;  3WNF A;  4L3Q A;  1FJG K;  2FBX A;  3HI0 A;  4Z4E A;  2IAJ A;  1ZXO A;  4F2S A;  1QZ6 A;  4FWK A;  4CEZ A;  3SLC A;  4X66 K;  4F8R A;  3K5M A;  2XY6 A;  4BRD A;  3RRH A;  3QEI A;  5AZI A;  1C1C A;  4E7K A;  4DUY K;  4CZE A;  3OYH A;  3O8M A;  3THW A;  4B9L A;  3VQ7 A;  3S3O A;  4O5B A;  1GLD G;  4QS7 A;  4BC3 A;  2FSK A;  1QE1 A;  1GLF O;  3HXM A;  4CCH A;  3OYL A;  4A2A A;  3LDO A;  1LOT B;  1ILY A;  4YNQ A;  3TAQ A;  1Z05 A;  3P39 A;  4K25 A;  1IKY A;  5BN8 A;  4CFB A;  3AO4 A;  4AH9 A;  1IBM K;  4G1Q A;  3EKU A;  1RBV A;  5AQL A;  2A3Z A;  3EEQ A;  3PIP L;  3CQX A;  2BDP A;  2VGM A;  1HNW K;  1MWK A;  1YIT N;  5HRO A;  5GAE P;  5M1Q A;  3T19 A;  4CK2 A;  1UAX A;  1QSL A;  1I39 A;  1KD1 O;  3L4Q A;  1NLV A;  1GOB A;  2B5J A;  4CFA A;  1RDB A;  1WLJ A;  4DU1 A;  5ELZ A;  2XY8 A;  3DLK A;  3K59 A;  4BQZ A;  3E9L A;  5FLX O;  3OVN A;  3FFI A;  2HBK A;  4C23 A;  3K57 A;  4IFE A;  3P4I A;  3H3O B;  4K42 A;  3HYF A;  3B8A X;  3I56 N;  4DTJ A;  3WXK A;  4KHY A;  1N8R O;  1HJR A;  1BU6 O;  4BRG A;  1C1B A;  4I6M A;  4CF2 A;  4PKH A;  4OKJ A;  1JL1 A;  1P90 A;  4LFA K;  3CJA A;  2JLE A;  3AVK A;  3CCS N;  3LZI A;  3KZB A;  3HVR A;  4AHT A;  3FLC O;  4U7B A;  1LWF A;  3O1W A;  4KBO A;  4XH5 A;  4CK3 A;  2HF3 A;  2ETJ A;  2P9U B;  3VF6 A;  4ZTF A;  4B9V A;  3K5L A;  4FLT A;  5EXW A;  3VQ9 A;  2ZF5 O;  3AAR A;  5BR8 K;  3OJU A;  3AV9 A;  2GEL A;  2PY5 A;  3ULE B;  4ISE A;  2P9P A;  1T7P A;  1CLQ A;  3WEE B;  5HP1 A;  2IC3 A;  2W41 A;  4DQ8 A;  1VAZ A;  2YHB A;  4FXD A;  1KVB A;  4HCB A;  4RG8 A;  3BGR A;  3TAB A;  1VQK N;  3K5O A;  1U04 A;  4CZH A;  4BR4 A;  3U3Y A;  3AA2 A;  3EZ5 A;  1JLB A;  4EP4 A;  1OH7 A;  1VQ7 N;  4B3O A;  5AQN A;  2GWK A;  4B9T A;  2O8C B;  3AA4 A;  3FZH A;  4K43 A;  4NLB A;  4DQP A;  2E4L A;  4FJ9 A;  3S9H A;  3TAP A;  4FLW A;  3VES A;  2Q1N A;  4FWP A;  1SKW A;  3O4W A;  2D0B A;  1FXX A;  3V6D A;  1H1V A;  1YJ9 N;  3ZT0 A;  2IGI A;  4QAG A;  4FL9 A;  4H0X B;  3RMD A;  3D2E B;  4DR2 K;  3SAF A;  5M1F A;  3TSQ A;  1K6Y A;  1TKZ A;  1N5Y A;  3THY B;  1QHA A;  3O4Q A;  1XMO K;  5AQZ A;  2G8H A;  2HBJ A;  3O9R A;  3IAY A;  3A8Y A;  1Q82 O;  1ZBH A;  4YOU A;  3O08 A;  3MCP A;  1Q9X A;  3QIO A;  5AQX A;  1K9M O;  4LF5 K;  3U9Z A;  4AIL C;  3ZEU B;  3E66 A;  4MDA A;  3U9D A;  2YHY A;  5JVH L;  3VMF B;  1QS4 A;  2VYP A;  3A5L C;  1L3V A;  4K8Z A;  1S1T A;  4KH6 A;  2P5G A;  4DV7 K;  1BIS A;  3QET A;  3J7Z O;  2ZD1 A;  3G71 N;  3AVA A;  4WQ4 A;  1RFQ A;  1ESV A;  4FJL A;  3P5J A;  3B6P A;  4FK2 A;  1IG8 A;  1TYQ A;  3OYJ A;  1TL1 A;  4CJK A;  1RIL A;  4FZZ A;  2G8I A;  3MN5 A;  3MWP A;  3D2F B;  2VCP A;  3VGM A;  3ASM A;  4FJM A;  1IBK K;  4AM6 A;  2QXL A;  3M3Z A;  2VQE K;  1KFS A;  4JHD A;  2V7Y A;  1BI4 A;  3MED A;  3SUN A;  5FPN A;  3LAK A;  4KAZ A;  1U2V B;  3KTQ A;  3CM6 A;  3VQ5 A;  1E4G T;  4DHY A;  3THV A;  5AQK A;  3FR0 A;  1U6Z A;  3MXI A;  1KXP A;  2W6K A;  4WCE L;  2NLX A;  2Q0U A;  4GVE A;  1XHX A;  2QWM A;  3OW2 M;  2HHX A;  1KVA A;  3RMC A;  4W5Q A;  1N6Q A;  1RBS A;  4ILG B;  4CEF A;  1T3V A;  3L2U A;  3EL2 A;  4HTL A;  3SI6 A;  1KCF A;  3HVT A;  1D4X A;  3DWL A;  3Q7C A;  4A59 A;  1S72 N;  4ID5 A;  1YF5 L;  5GIP A;  1NK4 A;  1BDG A;  1NK7 A;  1VK0 A;  1TVR A;  3VEY A;  3CCQ N;  3CM5 A;  4KI4 A;  5AQQ A;  4CF8 A;  4PA1 A;  5C2D A;  2W42 A;  4JK8 A;  4FJX A;  4BRK A;  2IVN A;  1J9A A;  4BVO A;  1O13 A;  4CEB A;  3SYZ A;  3PX6 A;  1DTT A;  4OGC A;  1TAU A;  4DFJ A;  1YVN A;  1JCF A;  3SJH A;  2A42 A;  3F9M A;  3DMJ A;  1HKC A;  1Y97 A;  2GTD A;  1X9J A;  3OYD A;  1HUX A;  3O3G A;  4A61 A;  5LMU K;  3K2P A;  4X64 K;  2EWS A;  1VRU A;  2Z1G A;  4JEP A;  3O80 A;  3DAW A;  4CEO A;  4DR3 K;  1VQP N;  3V81 A;  4N41 A;  5M1P A;  3F2K A;  4A5A A;  4PL8 A;  4RW4 A;  4FK4 A;  1MU2 A;  4BG8 A;  2HMI A;  2FF3 B;  4BDZ A;  3S41 A;  2HBL A;  3OYF A;  5AQW A;  4B3R K;  2HHW A;  4Y0W A;  3OYB A;  2HB5 A;  3LP0 A;  4FLV A;  4DV6 K;  4IZ9 A;  2BAN A;  1SKS A;  4CHP A;  4CHZ A;  1TV6 A;  4FM0 A;  3QNO A;  4DTU A;  3KLH A;  2E6L A;  5HOO A;  2P9I A;  3BY5 A;  4B8C A;  5FPE A;  4DQR A;  4M45 A;  4CZL A;  2QEX N;  1U47 A;  2VG5 A;  3SQ0 A;  2WFB A;  1C0M A;  4C8O A;  1GLB G;  3LWL A;  5BN9 A;  2D1K A;  4WF9 L;  4CZF A;  1VQ8 N;  4BRE A;  2QTD A;  4CJR A;  1SQK A;  2H3G X;  4H8K A;  3OBY A;  1TKX A;  2Q0R A;  4IOC L;  4IKF A;  1NGG A;  4OX9 K;  3ZSO A;  3KHY A;  4ID1 A;  4I2Q A;  4JRQ A;  4Z4H A;  1HMV A;  3DOK A;  4XH1 A;  1XC3 A;  1DLO A;  4FJJ A;  1JLC A;  2FBT A;  3IMX A;  1FK9 A;  1T6C A;  2HST A;  2QK9 A;  1GOC A;  1Z25 A;  1GLL O;  3DYA A;  4H0V B;  4RTF D;  5ADX H;  1JLF A;  4DV3 K;  1N34 K;  3PLA A;  2FLO A;  4EAH D;  3CCJ N;  3KLE A;  4DMN A;  5FRM A;  4J2A A;  4FJH A;  3CQY A;  2PAV A;  1V4T A;  1D9F A;  3DXK B;  3QO9 A;  1O1W A;  3AY9 A;  4YOT A;  4LSN A;  4M3T A;  2P9N B;  1IKW A;  1CZB A;  4I9L A;  1IKX A;  3CD6 N;  4G9Z A;  2QWR A;  4FJ7 A;  4Y1D A;  3O1B A;  4FJ5 A;  3HM9 A;  2OCE A;  3TTF A;  1XI1 A;  4DR7 K;  3TU5 A;  4BGB A;  3HTV A;  4BE0 A;  4DQQ A;  5GAH P;  1C0U A;  3TR8 A;  3G25 A;  2FF6 A;  3JS6 A;  2FBY A;  3DLH A;  3ZX2 A;  3MN7 A;  1RT1 A;  4W5T A;  2JWK A;  4YDU C;  3NGZ A;  4FJK A;  5JVG L;  1DEJ A;  4Z4G A;  4DU4 A;  4QS8 A;  4BWM A;  5FPD A;  5AQT A;  3LDQ A;  2QKK A;  3C94 A;  5GAG P;  4DCH A;  3MCA B;  3AVB A;  4ZTJ A;  1X3M A;  4H4O A;  4FWQ A;  4BRM A;  3AA3 A;  3CER A;  2A40 A;  4O8U A;  2WUS A;  1Z6R A;  4JNE A;  2D0P A;  1M90 O;  2YNG A;  3CG7 A;  1OH6 A;  3FGU A;  1K73 O;  4KB1 A;  4FLX A;  1NBW A;  1BA1 A;  3BZK A;  1S1U A;  4M3U A;  4GKJ K;  3G6E N;  3UKU B;  2A1R A;  1SL2 A;  3M1F A;  2WON A;  3I8D A;  1HNX K;  3TAF A;  1NOZ A;  2JWL A;  4CZG A;  1NGJ A;  3QEX A;  4E0D A;  3TAR A;  4ELV A;  1IKV A;  5BPL A;  3THX A;  4B9U A;  3EE9 A;  3KLI A;  3HJF A;  3MXM A;  2O8E B;  1XHZ A;  3HOT A;  3VER A;  1TAQ A;  4WYB A;  3OYC A;  1S9G A;  5A2Q O;  3GDQ A;  4W5O A;  3RMA A;  3E1Y A;  3TTD A;  2D0O A;  4ILJ A;  4L8R B;  3V9U A;  4B3T K;  5AQG A;  1OVQ A;  4KPY A;  2QWN A;  4F3O A;  2YHA A;  3H46 O;  3VEO A;  3SV3 A;  3MN6 A;  2IDO A;  4I2P A;  4YOW A;  2O8F A;  4Z4C A;  3TWH A;  5BPN A;  1QQM A;  4I7F A;  4JD2 A;  4HVJ A;  4AHV A;  3UKR B;  3P31 A;  3WQT A;  2A41 A;  3VGL A;  4OPJ A;  4EZ6 A;  3LAL A;  4OPK A;  3SK3 A;  4MO5 A;  2R7Y A;  4MLH A;  5BRD A;  4JKA A;  1R0A A;  4OLA A;  1NG9 A;  2E2O A;  3I0S A;  4QCL A;  3C6U A;  4AHS A;  2ASP A;  5TKY A;  4NYF A;  4AF1 A;  2ZQB A;  3VOV A;  1C6V A;  2P9S B;  3TTC A;  3VQP A;  2IVP A;  3TAG A;  3V1R A;  3LL3 A;  4BVP A;  3NE6 A;  4KHP K;  3RWU A;  2RKI A;  1VSK A;  1YT3 A;  2RE2 A;  3PX4 A;  2Q36 A;  1BCO A;  3HOS A;  4CER A;  2HVI A;  2P9U A;  3L0Q A;  4EHU A;  2OPQ A;  4A57 A;  3ZT2 A;  4E7I A;  4KHS A;  4FCY A;  2OTJ N;  2HHS A;  4C1N K;  3KWI A;  4FZY A;  2AJQ A;  4H0T B;  3AAQ A;  1G15 A;  1RT3 A;  3L4I A;  1VRT A;  3VN5 A;  1ZBI A;  3R9P A;  1VSI A;  1NMD A;  3AGK A;  4YHH K;  1T03 A;  5JLH A;  2E1Y A;  4H5T A;  4QOZ B;  3AVF A;  1SAZ A;  3NBP A;  5J2M A;  3WXM B;  3L8B A;  4GV9 A;  1MWM A;  4CD3 A;  1VHX A;  1XC9 A;  4M3X A;  2Y1J A;  4YOR A;  2YHX A;  2O8B B;  4FZX C;  2ZJP L;  3ALY A;  2XY7 A;  3HRG A;  1J5O A;  3WXI A;  4O4G A;  1YHQ N;  4CF9 A;  4CK1 A;  1ATS A;  2XY5 A;  3ZSW A;  2E5L K;  3DOL A;  1RDD A;  2UXB K;  3LZJ A;  4C8L A;  4EZ9 A;  3NFA A;  4LY7 A;  1QTM A;  2UXD K;  5AFU A;  2P9L B;  3ZSR A;  2KZZ A;  1K8K B;  1WSJ A;  3OYA A;  1XWL A;  5HRP A;  3HP6 A;  5CR4 A;  5C0Y A;  3SQ2 A;  4KFB A;  1QQO A;  3KLF A;  4BC4 A;  4KH4 A;  2V7Z A;  4KO0 A;  5JS2 A;  5KTQ A;  3D45 A;  4DSF A;  4IEI A;  1JJ2 M;  2W6L A;  5AQR A;  4DTX A;  2GWJ A;  4PKI A;  1BHL A;  3CET A;  4LF4 K;  3CPE A;  3ISN C;  2KLA A;  2IVO A;  3E01 A;  2UYT A;  2X6S A;  3FZK A;  3SAH A;  2X78 A;  5D3G A;  5AQP A;  3OS0 A;  1U49 A;  3BEX A;  4BRI A;  5F1X A;  2QA4 N;  1DT9 A;  1EWQ A;  3T69 A;  5I42 A;  1EQY A;  4DV2 K;  1LAW A;  3AVI A;  3HP9 A;  3QML A;  3T3F A;  3ZSY A;  3HK2 A;  4BDP A;  3KLG A;  1ATR A;  1KLM A;  1UWB A;  2YHW A;  5FDL A;  2IS3 A;  4NXN K;  2F8S A;  4DTR A;  1NJY A;  3QFU A;  3KJV A;  1P8Z A;  3QBX A;  3C95 A;  1HNV A;  5C10 A;  2PZS A;  3CJB A;  2G8W A;  1HRH A;  1WNS A;  4CGI A;  3OYG A;  3LPT A;  4E7H A;  1W9H A;  1VSD A;  1UOC A;  2HHU A;  3NH1 A;  4FWL A;  3JSM A;  4JKG A;  4M3R A;  3PX0 A;  4FVM A;  3VEN A;  3MX5 A;  1QQN A;  5ADX A;  2DFF A;  4YOX A;  1KRP A;  3RTV A;  3QFP A;  3LDL A;  4JI0 K;  1RTI A;  4GKK K;  1HJO A;  4IJN A;  1TK5 A;  1IH7 A;  3IKM A;  2EX3 A;  3TI0 A;  5HLF A;  1RBU A;  4CJE A;  2X6N A;  1W0H A;  5FRN A;  3OYK A;  3MN9 A;  2VWK A;  1QQC A;  5F2R A;  3SCX A;  5AZI B;  4N76 A;  1V4S A;  5BPM A;  5MLC Q;  1KAX A;  5H1S Q;  3MMV A;  3NH0 A;  4LSL A;  3CFO A;  4IG3 A;  4KTW A;  3THW B;  3TSP A;  5AQF A;  1VSL A;  2HNZ A;  4X65 K;  1Q81 O;  3WNE A;  2O8D A;  1YTA A;  1CXU A;  3TAN A;  3SJJ A;  4OVL A;  1HQE A;  1L3S A;  3AO5 A;  1Z26 A;  2BUP A;  1OKJ A;  4DSI A;  1YVU A;  3A5N C;  4B1Z A;  4CGF A;  2CGL A;  1VQ4 N;  5KGW A;  3M8R A;  3CQ8 A;  3RR7 A;  3LM2 A;  3P83 D;  3UIQ A;  4H03 B;  3L6Q A;  3EO3 A;  2RPI A;  4LD0 A;  3SMS A;  4WFN L;  1WOQ A;  2KTQ A;  2YV0 X;  1BWF O;  3QNN A;  4R79 A;  3RSE A;  4DFK A;  1JXE A;  4WQ4 C;  4B9M A;  4C8N A;  3K0S A;  3L2R A;  1HNZ K;  4C1N I;  3K58 A;  1NGC A;  3BF3 A;  4FK0 A;  4JK9 A;  4KI6 A;  1WSH A;  5SWM A;  2VG6 A;  2NUB A;  5T7B A;  4K0K K;  1VSF A;  4CJT A;  4KRF A;  3VET A;  2DFE A;  4J2D A;  4AHU A;  1X9M A;  3LDS A;  4EFH A;  3ATU A;  4DV1 K;  1W2B M;  2PFU A;  4X62 K;  5M1K A;  3DXM A;  4I6M B;  3KWG A;  4CI6 A;  4FO0 A;  3C7N A;  4B8A B;  4KTQ A;  4CJQ A;  5TKW A;  1ITG A;  4CD1 A;  4BAC A;  1Q7Y O;  4E3S A;  3RR8 A;  1S6Q A;  1YUW A;  3GG4 A;  3H45 C;  3AGR A;  1IJJ A;  4CBU A;  5AQO A;  3VQ6 A;  2KW4 A;  2D0A A;  2NRX A;  2ZE2 A;  3CJ9 A;  4FJI A;  2QXF A;  5E26 A;  3E9O A;  4DF4 A;  4K8X A;  4CZJ A;  2FSJ A;  3PUF A;  3JXU A;  5JS1 A;  1S1W A;  4LF9 K;  4BE2 A;  1IO2 A;  1JCE A;  4F3T A;  2Q97 A;  3R3L A;  2P9P B;  1U45 A;  4CIE A;  2OAN A;  4BRL A;  1HYZ A;  4NO7 A;  5KPT A;  1GLJ O;  4DKW A;  4IDH A;  3T1H K;  4EP5 A;  3VQB A;  4FPA A;  4F9O A;  1HNI A;  4XEI A;  1T05 A;  1SKR A;  4I9Q A;  3OYM A;  1NJW A;  3MX2 A;  4BRF A;  2BGG A;  4CHQ A;  4AQY K;  4BRP A;  3SPZ A;  1S6P A;  4CBX A;  3L2Q A;  4IFV A;  4FM2 A;  3M6G A;  3D0P A;  3N4P A;  3BZC A;  2ZGY A;  4ELT A;  1S3X A;  4JLH A;  3ZET A;  2D4W A;  1YIJ N;  4H5R A;  2KQ2 A;  4CFC A;  3OYE A;  4PKG A;  1GLE G;  4OLB A;  2RN2 A;  4J8F A;  3V1O A;  3T7Z A;  4M41 A;  2P9K A;  5J2Q A;  4JI7 K;  3LDN A;  4PQU A;  1Y64 A;  4UY8 O;  1SV5 A;  2HBM A;  2P1J A;  4E1J A;  2UUA K;  3S3M A;  3KKS A;  3KIO A;  3UE5 A;  3BP8 A;  4BRQ A;  5AZJ A;  5BRE A;  4KHQ A;  1HYS A;  4CFD A;  1D8Y A;  5GAD P;  4M3Y A;  5FPM A;  4B3M K;  1GLC G;  3U3G A;  4FW2 A;  4OPH A;  1YTU A;  3H1V X;  4DFM A;  1BO5 O;  4BC5 A;  5DK5 A;  1JCG A;  3O9U A;  4NCG A;  4IFY A;  3NF7 A;  4DR1 K;  3C0B A;  1LW0 A;  4M7X A;  4PWD A;  3WXL A;  2KFZ A;  4HTU A;  4OJR A;  1GLA G;  1XNR K;  4W5R A;  2CH5 A;  1WSF A;  3V1Q A;  4RCH A;  4CJU A;  3QEP A;  4CEC A;  5M1N A;  3V9S A;  1NK8 A;  2F7T A;  1WB9 A;  2PYJ A;  3VQ8 A;  4FOI A;  3WQU A;  1TYQ B;  2V52 B;  2F4V K;  5BRH A;  1RT6 A;  3ZX0 A;  4JI5 K;  4B08 A;  3K5N A;  4YY3 K;  3OHR A;  1TGO A;  5CE3 A;  1GOA A;  3EZW A;  2GBZ A;  3A5O C;  1OH5 A;  4KHU A;  4H5N A;  3LPU A;  4DTP A;  1RDA A;  3Q7B A;  4IG0 A;  1BI4 B;  4H0Y B;  1NJX A;  3HPH A;  1JLG A;  4CGD A;  1RCH A;  2F9W A;  3T1Y K;  1TKT A;  3VGK A;  2FSN A;  3HPO A;  4GNI A;  4FPB A;  1QVG M;  4DQS A;  3OA9 A;  3C6H A;  1LV5 A;  5CYQ A;  4DUZ K;  1YI2 N;  5KPR A;  3O4N A;  1QVF M;  1B92 A;  1BQN A;  3FZF A;  1HYV A;  3QES A;  2QWP A;  4IXC A;  5AQJ A;  4C8M A;  1Q8I A;  4WQ5 A;  3PO5 A;  1JXB A;  4J2E A;  3ITH A;  1EX4 A;  4FM1 A;  3VQE A;  1I94 K;  4DSJ A;  1G99 A;  1KFD A;  4IBN A;  4CJ5 A;  1S1X A;  1NKC A;  3NH2 A;  3WXJ A;  3AVG A;  4IJA A;  2G8U A;  3NMU A;  3F9K A;  4PL7 A;  4CJW A;  4DLG A;  5HBM A;  4CZM A;  3VEV A;  2RHK A;  3P1G A;  3I0R A;  1VSE A;  4JRP A;  1RBR A;  3UB5 A;  5JLF A;  4DR4 K;  2AA4 A;  3T1A A;  3SV4 A;  3KD5 E;  1ZBS A;  2NZT A;  3AO2 A;  3QIN A;  4DLE A;  1KSP A;  3ENH A;  4DFP A;  3ID6 A;  3HPG A;  5AQY A;  3VF4 A;  4H5W A;  4UQG A;  2CGK A;  4GV6 A;  3CJC A;  2GV9 A;  1RDC A;  4JI1 K;  3QDK A;  4CJ7 A;  2HND A;  4JKB A;  2CH6 A;  1NGI A;  2GEM A;  3PSF A;  1J53 A;  4PUO A;  4HUG A;  2HHQ A;  1ZBF A;  3A5M C;  1T6D A;  4N47 A;  1XMQ K;  3PY8 A;  3EKS A;  4OGE A;  3RMB A;  1WSI A;  1VQL N;  4FOE A;  4JS4 A;  1VSJ A;  4MO4 A;  4Q5V A;  2GX9 A;  3HST B;  4DTN A;  4GY2 B;  1JLA A;  2QKB A;  3OS2 A;  2VGN A;  4KH5 A;  4DS4 A;  1RT2 A;  4BY9 C;  3NVM A;  5DM7 L;  5K14 A;  2XRI A;  4BRO A;  2QWQ A;  4CHN A;  3V4I A;  1RTH A;  3W3D A;  3B6O A;  3CCM N;  3OYN A;  1ASU A;  4O0I A;  4N56 A;  1XUP O;  5CHI A;  3MWT A;  3U8X A;  2D5R A;  5KGX A;  3SBG A;  4JYA K;  2HMP A;  5HRN A;  4KRE A;  4B1X B;  1VQ5 N;  1EP4 A;  1FW6 A;  1NKE A;  4BRC A;  3HT3 A;  3LAN A;  4JKE A;  2G8K A;  4AHC A;  4JKD A;  4BGA A;  3U6F A;  3VA0 A;  3L3V A;  1SL1 A;  1J5E K;  4FVU A;  3SBT A;  5LMN K;  2OZS A;  4IEE A;  2F8T A;  1BQM A;  1I3A A;  4JI8 K;  4DSE A;  3G10 A;  1NGB A;  3AO3 A;  4MFB A;  1BUP A;  2IIR A;  2OPS A;  1BCM A;  4BR2 A;  2YX6 A;  4LF8 K;  3SUP A;  1MA9 B;  2WBN A;  4BR0 A;  4O44 A;  2JGU A;  5LJW A;  4GVM A;  4FJN A;  1NK5 A;  2OA8 A;  3QB0 A;  2FBV A;  4IWV A;  1WBD A;  3ULE A;  1TKD A;  1M1K O;  2RF2 A;  2PBD A;  3WEE A;  3LP2 A;  4CZI A;  1NJZ A;  5KI6 A;  4MDB A;  3WT0 A;  1X1P A;  4JV5 K;  2HHV A;  1L3T A;  2ZJQ L;  1ZBL A;  3HSC A;  4BDY A;  5AQH A;  1D5A A;  4U67 L;  3P38 A;  4WFB L;  1RT4 A;  1LCU A;  3H1Q A;  4JI3 K;  4CHY A;  1HKB A;  4BWJ A;  2KHO A;  2J4R A;  4IO9 L;  4JKF A;  4Z94 A;  3CPW M;  1ZBU A;  3BDP A;  3AVM A;  2O8C A;  3H3N O;  3HO1 A;  3ATV A;  3OYI A;  5AQI A;  4E1M A;  1BOT O;  1B9F A;  2E2Q A;  1UA0 A;  3DLL L;  4GMJ B;  4A2B A;  1W97 L;  3DM2 A;  4B3S K;  3O9Q A;  1OH8 A;  3O3H A;  4KB0 A;  3CCU N;  3VEX A;  2ITG A;  5LY3 A;  2FC0 A;  3DJC A;  3THX B;  4ILH A;  2OZM A;  3A0I X;  4HHT A;  4JI6 K;  4A5B A;  2Z1H A;  4B9Q A;  1FKP A;  5KPZ A;  2E2N A;  5KQD A;  3DLG A;  4LFC K;  4E7L A;  3DI6 A;  1X3N A;  2Q3S A;  3D2E A;  1QZ5 A;  5KRS A;  2UUC K;  5J2P A;  5GIN A;  3THY A;  5B8H A;  2GUI A;  1TL3 A;  1QHT A;  3CCL N;  1SZ2 A;  4MQ3 A;  1SL0 A;  1L3U A;  3C65 A;  3I55 N;  5F0X A;  1EKE A;  4CES A;  1T44 A;  3VA3 A;  3IUC A;  3O9T A;  1XNQ K;  4FJG A;  2O8F B;  2ATQ A;  3ENB A;  2WTU A;  5AQS A;  3ZEU A;  1KC8 O;  4CEE A;  3HM8 A;  4FW1 A;  4FJ8 A;  3SPY A;  1CXQ A;  4KHN A;  4JD2 B;  1W7A A;  4KHW A;  4CED A;  4CEA A;  3CC4 N;  4IOX A;  1NK6 A;  3O6W A;  4W5N A;  3AVJ A;  4A62 A;  3MXJ A;  4J2B A;  2ZGZ A;  4LF7 K;  5E84 A;  1UA1 A;  1JKH A;  1F21 A;  2QM1 A;  4M7Y A;  1C0G A;  5DMR A;  4H0O A;  5EU7 A;  4CGH A;  1Q86 O;  1T8E A;  3D2F A;  1RTJ A;  2Y1I A;  4LC9 B;  1BA0 A;  2AP1 A; 
#chains in the Genus database with same CATH homology
 3CYM A;  1RNH A;  3AVN A;  3KLE A;  1B9D A;  3VQ6 A;  2KW4 A;  4DMN A;  4CGG A;  1LAV A;  2D0A A;  2ZE2 A;  3VQC A;  3KK2 A;  5FRM A;  2HW3 A;  5C24 A;  3TAM A;  4FJI A;  4J2A A;  2QXF A;  4FJH A;  1WSG A;  2YNI A;  3IG1 A;  3NF9 A;  2YKN A;  4DF4 A;  1D9F A;  4HCC A;  4K8X A;  3PUF A;  3QO9 A;  5JS1 A;  3H08 A;  1O1W A;  2OPR A;  1Q9Y A;  4ZHR A;  1S1W A;  4BE2 A;  1IO2 A;  4F3T A;  2IOC A;  3MEC A;  3ZT4 A;  3MAQ A;  4FLY A;  1JLE A;  4LSN A;  4XIU A;  4M3T A;  4CF1 A;  1U45 A;  4CIE A;  3DRR A;  1HYZ A;  1IKW A;  1CZB A;  4I9L A;  4FLU A;  3PO4 A;  1IKX A;  4DSK A;  4FYD A;  4BE1 A;  1NK0 A;  4FJ7 A;  4EP5 A;  3VQB A;  2DFH A;  1HNI A;  4Y1D A;  4FJ5 A;  3HM9 A;  1DTQ A;  1EET A;  3PV8 A;  1XI1 A;  1BL3 A;  1T05 A;  1BIU A;  3IRX A;  3OYM A;  3M8S A;  1SKR A;  4BE0 A;  4DQQ A;  1NJW A;  4WE1 A;  2HNY A;  1C0U A;  3TR8 A;  1S5J A;  4LH5 A;  2BGG A;  4CHQ A;  2FBY A;  3SPZ A;  3DLH A;  1KVC A;  1S6P A;  3L2Q A;  1L5U A;  4E89 A;  4IFV A;  2XO7 A;  4FM2 A;  3QEV A;  1RT1 A;  4W5T A;  4CJV A;  3VQA A;  3D0P A;  3NGZ A;  3WNF A;  4FJK A;  4Z4G A;  4FLZ A;  4DU4 A;  4BWM A;  3SQ1 A;  2FBX A;  3O3F A;  4CJP A;  4ELT A;  4Z4E A;  2IAJ A;  1BIZ A;  4DU3 A;  4F2S A;  4JLH A;  3C94 A;  2QKK A;  4CEZ A;  4F8R A;  3K5M A;  2XY6 A;  3AVB A;  3RRH A;  3QEI A;  4ZTJ A;  2KQ2 A;  4C8K A;  3KK1 A;  4CFC A;  3OYE A;  4H4O A;  3NF6 A;  1C1C A;  1J54 A;  3AA3 A;  4ELU A;  3AVL A;  4E7K A;  1QSY A;  2P51 A;  4OLB A;  4ICL A;  2RN2 A;  2BE2 A;  3V1O A;  3OYH A;  4B9L A;  4M41 A;  2B6A A;  2KZM A;  3VQ7 A;  5J2Q A;  3S3O A;  2YNG A;  4O5B A;  4NCA A;  3CG7 A;  4PQU A;  1RBT A;  1QE1 A;  5HRS A;  3HXM A;  4CCH A;  4FLX A;  4KB1 A;  3OYL A;  1SV5 A;  2P1J A;  1S1U A;  5C25 A;  4YNQ A;  3TAQ A;  4M3U A;  3ZSV A;  2A1R A;  3S3M A;  3KKS A;  1SL2 A;  3KIO A;  1IKY A;  2WON A;  4O55 A;  3I8D A;  3V9Z A;  4CFB A;  3TAF A;  1NOZ A;  3AO4 A;  4AH9 A;  3ZT1 A;  3QEX A;  4KHQ A;  4E0D A;  3TAR A;  1HYS A;  4ELV A;  1IKV A;  4B9U A;  4G1Q A;  4YFU A;  1RBV A;  4KKO A;  4O0J A;  4CFD A;  1D8Y A;  3ZCM A;  3KLI A;  4M3Y A;  3EYZ A;  3HJF A;  3AA5 X;  3DRS A;  3MXM A;  4NYN A;  1XHZ A;  3U3G A;  4FW2 A;  3NGY A;  2BDP A;  4H4M A;  1YTU A;  5HRO A;  4PY5 A;  4DFM A;  3T19 A;  4CK2 A;  1TAQ A;  3OYC A;  1S9G A;  1UAX A;  5DK5 A;  1LW2 A;  4NCG A;  1QSL A;  1I39 A;  4B9S A;  4IFY A;  3NF7 A;  4W5O A;  1ASV A;  1GOB A;  3RMA A;  1LW0 A;  2B5J A;  5E41 A;  1X9W A;  3L2W A;  4PWD A;  2KFZ A;  4CFA A;  1RDB A;  1WLJ A;  4DU1 A;  4DTM A;  4HTU A;  4L8R B;  4RW8 A;  3V9U A;  2XY8 A;  5I3U A;  4KPY A;  4OKK A;  3DLK A;  2YHA A;  4OJR A;  3K59 A;  4F3O A;  3LP1 A;  1KTQ A;  1HQU A;  3HL8 A;  4KTZ A;  1WSF A;  3V1Q A;  4CJU A;  4W5R A;  3SV3 A;  4CEC A;  2IDO A;  3QEP A;  4M3W A;  4I2P A;  5HRR A;  3V9S A;  3SNN A;  1NK8 A;  3KD1 E;  1SUQ A;  3OVN A;  4RW9 A;  3FFI A;  1WSE A;  4Z4C A;  3TWH A;  3K57 A;  4I7F A;  2PYJ A;  3VQ8 A;  4CF0 A;  4HVJ A;  3HYF A;  1WAF A;  4AHV A;  4DTJ A;  4KHY A;  1A5V A;  4OPJ A;  1RT6 A;  3F73 A;  1HJR A;  4EZ6 A;  3LAL A;  3DLR A;  4OPK A;  1VSH A;  4B08 A;  3K5N A;  3DRP A;  4DSL A;  2VG7 A;  2YNH A;  1FKO A;  1C1B A;  1TGO A;  2R7Y A;  1GOA A;  4CF2 A;  2GBZ A;  3ULD A;  4HUE A;  4KHU A;  4OKJ A;  1JL1 A;  3LPU A;  4DTP A;  1RDA A;  1R0A A;  4OLA A;  3I0S A;  4CHO A;  4QCL A;  3C6U A;  2JLE A;  3AVK A;  4AHS A;  3LZI A;  4IG0 A;  1BI4 B;  3M8Q A;  4CIF A;  1NJX A;  4NYF A;  3HPH A;  2ZQB A;  1JLG A;  4CGD A;  1C6V A;  3HVR A;  3VQP A;  4AHT A;  1RCH A;  3IS9 A;  1LWF A;  1TKT A;  3AVC A;  4TSX A;  3TAG A;  3V1R A;  4CK3 A;  3HPO A;  3L3U A;  1HPZ A;  2ETJ A;  4B9V A;  4ZTF A;  3NE6 A;  3K5L A;  4FLT A;  4DQS A;  3RWU A;  1LV5 A;  2RKI A;  3SQ4 A;  3VQ9 A;  5CYQ A;  1VSK A;  1YT3 A;  2Z1I A;  3PX4 A;  2P5O A;  3L2V A;  1BCO A;  3QIP A;  3OJU A;  3AV9 A;  2E6M A;  2PY5 A;  3O4N A;  4CER A;  2HVI A;  1B92 A;  1BQN A;  1HYV A;  2OPQ A;  3QES A;  1T7P A;  1CLQ A;  1S9E A;  3ZT2 A;  2KFN A;  4E7I A;  4KHS A;  4FCY A;  5HP1 A;  2IC3 A;  4C8M A;  1Q8I A;  2HHS A;  4FZY A;  2AJQ A;  3PO5 A;  2YHB A;  1G15 A;  4FXD A;  1JXB A;  1RT3 A;  1KVB A;  2G8V A;  4J2E A;  4HCB A;  1VRT A;  3ITH A;  4RG8 A;  3VN5 A;  1EX4 A;  4FM1 A;  3BGR A;  4CIG A;  1ZBI A;  3VQE A;  1VSI A;  4DSJ A;  3C6T A;  3KKR A;  1KFD A;  3TAB A;  4IBN A;  4CJ5 A;  1S1X A;  3K5O A;  1U04 A;  1NKC A;  3U3Y A;  1T03 A;  3NH2 A;  1X9S A;  2F96 A;  3AVG A;  2A1S A;  3AA2 A;  3EZ5 A;  2G8U A;  4QOZ B;  1JLB A;  3F9K A;  3AVF A;  3ZSQ A;  4CJW A;  4EP4 A;  3NBP A;  3EY1 A;  4DLG A;  4B3O A;  2XHB A;  5HBM A;  4Q0B A;  4B9T A;  5J2M A;  3L8B A;  3P1G A;  3I0R A;  3WNH A;  3AA4 A;  1VSE A;  4JRP A;  1RBR A;  4DQP A;  2E4L A;  1XC9 A;  3S9H A;  4FJ9 A;  2Y1J A;  4M3X A;  3TAP A;  4M42 A;  3T1A A;  4FZX C;  3SV4 A;  1NOY A;  3ALY A;  2XY7 A;  4CJS A;  3ZSZ A;  4FLW A;  3KD5 E;  1J5O A;  4CGJ A;  3AO2 A;  3QIN A;  4DLE A;  1KSP A;  4O4G A;  1LWE A;  4CF9 A;  4DFP A;  4CK1 A;  3V9W A;  4DWI A;  2XY5 A;  1C1A A;  1SKW A;  3HPG A;  3ZSW A;  3DOL A;  4N5S A;  1RDD A;  2D0B A;  4UQG A;  3LZJ A;  4C8L A;  4EZ9 A;  1FXX A;  3NFA A;  3NCI A;  4RW7 A;  4LY7 A;  1QTM A;  3LP3 A;  4NCB A;  1TK8 A;  3ZSR A;  2GV9 A;  3V6D A;  1RTD A;  1RDC A;  2KZZ A;  1WSJ A;  3ZT0 A;  2IGI A;  1TK0 A;  4QAG A;  3OYA A;  2HND A;  1XWL A;  3RMD A;  5HRP A;  1KFS A;  3HP6 A;  3SQ2 A;  4KFB A;  1K6Y A;  1TKZ A;  1J53 A;  5CZ1 A;  2OPP A;  3O4Q A;  3KLF A;  1N5Y A;  4PUO A;  4HUG A;  2HHQ A;  1ZBF A;  2G8H A;  2YKM A;  4N47 A;  4KO0 A;  4B9N A;  3IAY A;  5JS2 A;  1KLN A;  5KTQ A;  3PY8 A;  1ZBH A;  4CJ3 A;  3D45 A;  4OGE A;  3RMB A;  4AHR A;  4DSF A;  1C0T A;  1WSI A;  2VWJ A;  4FJL A;  4JS4 A;  1VSJ A;  4Q5V A;  3SZ2 A;  4DTX A;  1Q9X A;  2X74 A;  3HST B;  3QIO A;  4DTN A;  3ZSX A;  3VQQ A;  1BHL A;  1JLA A;  2QKB A;  3OS2 A;  3ISN C;  3NAE A;  4DS4 A;  4M3Z A;  1RT2 A;  5CZ2 A;  3NDK A;  3E01 A;  4AIL C;  2X6S A;  3G0Z A;  5K14 A;  1RT5 A;  2XRI A;  1RT7 A;  2X78 A;  2OYQ A;  1QS4 A;  4CHN A;  1L3V A;  5D3G A;  2HHT A;  4K8Z A;  1S1T A;  3V4I A;  4Z4F A;  3OS0 A;  1RTH A;  1U49 A;  2P5G A;  1BIS A;  3B6O A;  3QET A;  3MEG A;  3OS1 A;  3OYN A;  2ZD1 A;  4JS5 A;  1ASU A;  4O0I A;  1WAJ A;  5I42 A;  4N56 A;  1LAW A;  3AVI A;  3AVA A;  3HP9 A;  2O4I A;  3T3F A;  2D5R A;  5KGX A;  3ZSY A;  3HK2 A;  5HRN A;  4KRE A;  4BDP A;  3P5J A;  3VQ4 A;  1LWC A;  3KLG A;  1KLM A;  4CJF A;  3B6P A;  4DTS A;  4DF8 A;  4FK2 A;  1UWB A;  3OYJ A;  5FDL A;  2IS3 A;  3AO1 A;  4GW6 A;  5KRT A;  4E19 A;  1TL1 A;  2F8S A;  4CJK A;  1EP4 A;  4DTR A;  1NJY A;  1RIL A;  4FZZ A;  4Z0U A;  5FRO A;  1NKE A;  3HT3 A;  2G8I A;  3KJV A;  3LAN A;  2G8K A;  4DG1 A;  4AHC A;  1EXQ A;  3C95 A;  3SUO A;  1HNV A;  3ASM A;  3U6F A;  4F4K A;  4FJM A;  3NHG A;  3VA0 A;  3L3V A;  1SL1 A;  2OZS A;  2PZS A;  3A2F A;  2F8T A;  1IG9 A;  4DTO A;  4I9Q A;  2G8W A;  1HRH A;  1BQM A;  1I3A A;  1WNS A;  4CGI A;  3OYG A;  3LPT A;  4HUF A;  3V9X A;  3G10 A;  3MED A;  1BI4 A;  5SZT A;  4E7H A;  4DSE A;  1W9H A;  3SUN A;  3LAK A;  4KAZ A;  4F2R A;  1VSD A;  3AO3 A;  3KTQ A;  3CM6 A;  4DQI A;  3VQ5 A;  1UOC A;  4MFB A;  3THV A;  4Z4I A;  3LAM A;  3SUQ A;  3MXI A;  2OPS A;  1BCM A;  5CY4 A;  2HHU A;  3NH1 A;  3JSM A;  3SUP A;  1BGX T;  4O44 A;  3TAE A;  1XHX A;  2JGU A;  5J2N A;  2HHX A;  4M3R A;  3M8P A;  1KVA A;  3PX0 A;  4GVM A;  3RMC A;  4W5Q A;  3S3N A;  4FVM A;  4FJN A;  1NK5 A;  1N6Q A;  2OA8 A;  1RBS A;  1WN7 A;  2FBV A;  4CEF A;  3L2U A;  4OKE A;  3KK3 A;  1U48 A;  3SI6 A;  2DFF A;  1KCF A;  1KRP A;  3RTV A;  1TKD A;  3HVT A;  2RF2 A;  4ID5 A;  1NK4 A;  1RTI A;  3LP2 A;  1NK7 A;  1TK5 A;  1IH7 A;  1VK0 A;  1TVR A;  2EX3 A;  1NJZ A;  1VSM A;  3TI0 A;  5HLF A;  1JL2 A;  1RBU A;  3CM5 A;  5KI6 A;  4CJ4 A;  1X1P A;  4KI4 A;  4CJE A;  2X6N A;  3NGI A;  1L3T A;  4CF8 A;  1W0H A;  4BDY A;  1ZBL A;  2HHV A;  4PA1 A;  1D5A A;  2W42 A;  5FRN A;  4FJX A;  1RT4 A;  3OYK A;  2VWK A;  1QQC A;  4CHY A;  4BWJ A;  3SCX A;  1J9A A;  4CEB A;  3SYZ A;  3PX6 A;  1REV A;  4N76 A;  1DTT A;  1ASW A;  4OGC A;  1TAU A;  4DFJ A;  1ZBU A;  3BDP A;  3AVM A;  3NH0 A;  4LSL A;  3CFO A;  3DMJ A;  3OJS A;  3OYI A;  3HO1 A;  1Y97 A;  4IG3 A;  4KTW A;  1QSS A;  4E1M A;  3OYD A;  2B4J A;  1NKB A;  1B9F A;  1VSL A;  1UA0 A;  2HNZ A;  4GMJ B;  3O3G A;  2O4G A;  3DM2 A;  4E1N A;  3K2P A;  3WNE A;  3JYT A;  1D9D A;  1VRU A;  1S1V A;  2Z1G A;  3O3H A;  4KB0 A;  4CEO A;  1YTA A;  1CXU A;  3V81 A;  3TAN A;  4N41 A;  2D0C A;  3SJJ A;  4OVL A;  1HQE A;  4FK4 A;  4RW4 A;  1L3S A;  1MU2 A;  2ITG A;  3AO5 A;  2HMI A;  4BDZ A;  1Z26 A;  2FC0 A;  4IDK A;  4LH4 A;  3ZT3 A;  4CE9 A;  4HHT A;  1A5W A;  3NF8 A;  3OY9 A;  2OZM A;  4DSI A;  3CFR A;  1YVU A;  3OYF A;  5J1E A;  2Z1H A;  4Y1C A;  2HVH A;  2HHW A;  1FKP A;  4CGF A;  3DLG A;  3OYB A;  2HB5 A;  3LWM A;  3LP0 A;  4FLV A;  3DI6 A;  4E7L A;  5KGW A;  2Q3S A;  2Z1J A;  3M8R A;  3CQ8 A;  3P83 D;  5KRS A;  3UIQ A;  5J2P A;  2RPI A;  4LD0 A;  2KTQ A;  2GUI A;  3CFP A;  1TL3 A;  2YV0 X;  2BAN A;  2PYL A;  1QHT A;  4KV8 A;  4CHP A;  3QNN A;  4CHZ A;  1TV6 A;  1SKS A;  4FM0 A;  1U4B A;  3RRG A;  3QNO A;  4DFK A;  4DTU A;  3KLH A;  1JXE A;  2E6L A;  4B9M A;  3AVH A;  4CJL A;  4C8N A;  4MQ3 A;  1SL0 A;  3DLB A;  3QLH A;  1L3U A;  3L2R A;  4B8C A;  5C42 A;  3K58 A;  4DQR A;  4M45 A;  4FK0 A;  3VQD A;  4KI6 A;  1WSH A;  5SWM A;  2VG6 A;  2NUB A;  1EKE A;  5T7B A;  2VG5 A;  4DS5 A;  1U47 A;  4CES A;  3SQ0 A;  1VSF A;  3VA3 A;  4CJT A;  1C0M A;  4KRF A;  4FJG A;  4C8O A;  2ATQ A;  4CEQ A;  4CEE A;  3MEE A;  2DFE A;  3LWL A;  2G8F A;  4FW1 A;  4J2D A;  4FJ8 A;  3SPY A;  1CXQ A;  1JLQ A;  2YNF A;  4KHN A;  4KHW A;  4AHU A;  4CED A;  3DLE A;  4CEA A;  3LDS A;  1X9M A;  1NK6 A;  4CJR A;  2I5J A;  4W5N A;  1ZYQ A;  2EHG A;  3AVJ A;  3MXJ A;  4H8K A;  2DTU A;  1NK9 A;  1TKX A;  1A5X A;  4J2B A;  1CZ9 A;  3QEW A;  4IKF A;  3ZSO A;  3WNG A;  1JKH A;  4ID1 A;  4I2Q A;  1UA1 A;  1F21 A;  4B8A B;  4Z4H A;  4JRQ A;  4KTQ A;  1HMV A;  5CYM A;  3DOK A;  4CJQ A;  1DLO A;  1ITG A;  4RW6 A;  1JLC A;  5DMR A;  2FBT A;  4FJJ A;  4BAC A;  4E7J A;  5EU7 A;  2WOM A;  1FK9 A;  4CGH A;  4E3S A;  3RR8 A;  3QER A;  1GOC A;  1Z25 A;  1T8E A;  2QK9 A;  1S6Q A;  2LSN A;  2DY4 A;  3DYA A;  1RTJ A;  4R5P A;  2Y1I A;  1JLF A;  3RR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...