4CJFA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 53
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjfA00
1IG9A 3IS9A 1SL0A 3SQ4A 3QO9A 3CG7A 3KLGA 5I3UA 4CJFA 5HROA 4Z4IA 4N5SA 3DOLA 1YVUA 3OYDA 4W5OA 1C1BA 3DM2A 4CJ4A 4FW2A 2PZSA 1RT3A 1VSDA 5J2MA 1WSHA 2OPSA 2PYJA 2E6LA 3NH0A 1NKEA 1O1WA 2I5JA 4M3WA 1TL1A 1N5YA 3ZT0A 1U4BA 3NGIA 3O3FA 4RW6A 3LWLA 1QSYA 1U49A 4O44A 3DLHA 2HW3A 2KQ2A 4OGEA 3O4NA 4JS4A 3JYTA 3SUNA 4J2EA 2JGUA 3LP3A 3TWHA 3VQEA 2D0BA 4AHRA 3TABA 1BQMA 1RNHA 4Y1DA 1YTUA 2X74A 3OYKA 3TANA 5K14A 3TAQA 3NF6A 4CGJA 1LW2A 2YHAA 4BDYA 4E7IA 2YNGA 1TK8A 3P83D 3QIPA 1CXUA 3V1QA 2FC0A 4CF8A 3MEDA 4M3TA 4CK3A 3V9ZA 3KD5E 4CESA 2X6SA 1IKWA 3QERA 4C8KA 4BDPA 1NKBA 1YTAA 4NCAA 3QEVA 3O4QA 4Q5VA 3OYAA 2G8HA 4CECA 1LAVA 2Z1HA 4FJ7A 1HNIA 3HPGA 1CZ9A 4KTZA 4KKOA 5HBMA 4LD0A 3ZSWA 2ETJA 3AVKA 2A1RA 5KI6A 2XRIA 3QIOA 3TI0A 2B6AA 4DF8A 1NJYA 4B9TA 5DMRA 3ISNC 4I7FA 4DTJA 3MEGA 1REVA 1J53A 2HNYA 3VQQA 1VSKA 3OYCA 4M3RA 1D5AA 4CF2A 1Z25A 1S6QA 4KFBA 2BGGA 2FBVA 1RBVA 4HHTA 1HNVA 3NGZA 4FJLA 1XHZA 4FJ9A 4CEQA 2HHTA 4AHUA 2HHUA 4DU3A 3S3MA 5DK5A 4M3ZA 4FLWA 4DTOA 3FFIA 1VSEA 3QEWA 3KTQA 3AA3A 2GV9A 4CJ5A 3OYIA 2WOMA 2ITGA 1SKWA 2PY5A 2OZMA 1HYSA 4FLZA 1QQCA 3DLGA 1RTDA 4IKFA 1EKEA 3LP2A 3F9KA 4B8AB 1RT5A 2P1JA 3L2QA 3RRHA 4F2RA 1KFSA 5FRMA 4CEEA 4CFAA 3C95A 1D9DA 3L3UA 3U6FA 3S9HA 4BE2A 1NOYA 5EU7A 1VSMA 1X9MA 2DFFA 4MQ3A 4OJRA 1U48A 4E89A 5D3GA 1B9FA 1CXQA 4E19A 1TAUA 1EETA 4EZ9A 4LH5A 1J54A 3DYAA 4KAZA 4IFVA 3V1OA 3QESA 2Q3SA 2DFEA 4BWMA 4OPKA 3VA3A 3K2PA 4DQIA 2BE2A 4KRFA 3AVLA 4ELTA 1L3SA 1RDCA 4M3YA 4KHNA 4TSXA 3V1RA 4CJ3A 4OLBA 3LZIA 1N6QA 1G15A 3ZSVA 1L3TA 1EXQA 5HRPA 2VWJA 2HVHA 1NOZA 3C94A 3K57A 3L2RA 1NK0A 3DLRA 4KHYA 3QLHA 4KB0A 1BQNA 1BISA 4OGCA 1KRPA 1C0UA 3AO3A 5HRSA 4KI6A 5E41A 4FJ5A 3PO5A 3LAKA 1RT6A 3OYFA 3CFPA 4OKKA 3THVA 2O4IA 1BCMA 3CYMA 1JL2A 4FJNA 1KSPA 4GMJB 5J2PA 2IGIA 2ZQBA 4ELVA 1RBRA 1CLQA 4M41A 3V9WA 1Z26A 1HQEA 3NDKA 3B6PA 1NK7A 1L3VA 3PY8A 3HO1A 4F3TA 2HHSA 1JLAA 3VQBA 3HVTA 5FROA 4CERA 3VQ8A 4DSKA 1C0TA 3T1AA 1WNSA 1BI4B 1ZBLA 1HRHA 3SJJA 3T3FA 1C6VA 4K8XA 4FW1A 3RR8A 4B9VA 4O4GA 2IS3A 1L5UA 3V9SA 2HHXA 3AVJA 4O55A 3KLIA 1TAQA 3AVGA 1JLBA 4C8LA 3WNEA 1TVRA 3VN5A 4DU1A 3V4IA 5I42A 1D9FA 2FBTA 2HHQA 2FBXA 3LPUA 1K6YA 1ZBUA 4I2PA 4BE0A 3NF8A 3KK2A 3TAGA 4FLYA 1LWFA 4CJRA 3OYHA 1JLFA 1NK4A 2EHGA 3A2FA 3TR8A 1QTMA 1EP4A 1TKDA 4FJXA 3OYMA 1GOAA 4DTRA 3OS0A 4RW4A 1BIZA 1JLGA 1WSIA 2RPIA 2PYLA 3VQAA 3U3GA 1RILA 3K5LA 2IOCA 4FJGA 3QEPA 1U04A 2EX3A 1RDAA 4IG0A 4RW8A 5T7BA 4DLGA 1NJZA 1NK6A 3HXMA 1UOCA 1RTIA 1L3UA 4HUEA 3ZT1A 1ASVA 4DQSA 4ID5A 4CJSA 3I0SA 1RTHA 1TV6A 4AH9A 3U3YA 3SV4A 1TKZA 1LV5A 3AA4A 1RT2A 4Z4FA 3HM9A 3LZJA 4EP4A 3RWUA 4KB1A 4KHSA 4PY5A 4FYDA 2G8WA 3UIQA 4CEOA 4M3XA 5HP1A 3HK2A 4ELUA 3TAMA 1KCFA 4KI4A 4CEZA 1YT3A 4CIFA 3WNFA 4CE9A 1QSLA 3RMAA 3WNHA 4FK0A 4H4MA 3AO2A 3VA0A 3ZT3A 1S1TA 1GOCA 2JLEA 3VQ7A 1KLNA 3S3OA 1WSFA 2AJQA 1XWLA 1JL1A 2G8VA 3LDSA 4PWDA 4J2BA 1QS4A 3HP6A 1JXEA 3DOKA 3NE6A 1BHLA 3VQ9A 1XI1A 1GOBA 3SPZA 4DFJA 1ZBIA 1SL1A 4KHWA 1FKOA 3DI6A 4CGFA 2GBZA 4JRQA 4O0IA 3AVBA 3DMJA 4AHVA 1B92A 3ALYA 2WONA 3ZSQA 4NYFA 1RBSA 1S6PA 4DLEA 1I3AA 1UA1A 4DS5A 1U47A 4I9QA 1VSJA 3ZSZA 3SQ0A 4B9LA 1JLCA 1B9DA 3NH2A 3OYGA 3SQ1A 4FK4A 4ICLA 3NGYA 4CIEA 3DRPA 1S1UA 1IKXA 3C6UA 3G0ZA 4FLVA 3SNNA 4I2QA 2KFZA 3QINA 4CEFA 1UA0A 2BANA 4KV8A 2OYQA 2QKBA 2RN2A 5JS1A 1ASWA 5KTQA 3SYZA 1S1VA 3V9XA 3ZSRA 2KZMA 1S1WA 3MAQA 3AVCA 4DSIA 4DMNA 3BDPA 2Z1IA 4IG3A 3M8QA 4DSLA 4ID1A 3OYJA 2R7YA 3HYFA 4G1QA 2HNZA 4FVMA 4DG1A 3JSMA 3EY1A 2QK9A 1T05A 4ZTFA 3EZ5A 2O4GA 4NYNA 4M45A 3AVIA 4CHZA 1SKRA 4N56A 2YNIA 4YFUA 1IO2A 1NJXA 3DLEA 4OKJA 3AVAA 4KO0A 4KHUA 1VSHA 4NCBA 3PUFA 1FK9A 4CF9A 4KPYA 3BGRA 1HPZA 4ZTJA 5FRNA 2X6NA 2YNFA 4DTSA 3CFRA 1SUQA 4IDKA 4CHYA 4LY7A 2P5OA 4OLAA 2HNDA 4DSEA 1S9EA 1WSJA 2YKMA 4E1MA 1WN7A 1MU2A 4RG8A 4CGHA 3VQ6A 3VQ5A 4L8RB 2G8IA 3M8PA 1WAJA 3SQ2A 3SUOA 4HCBA 3KK1A 4AHTA 2YKNA 4MFBA 4AHCA 2XY6A 4WE1A 1BI4A 4CEDA 2QXFA 3ZSOA 4CGDA 3SV3A 3RR7A 3L2VA 1S1XA 4CIGA 1JLEA 4PA1A 2OPQA 4FLXA 1A5WA 4EZ6A 4B3OA 3AO4A 1TL3A 1ITGA 5KGXA 4FM0A 1NKCA 3OJUA 3SI6A 4ZHRA 5J2NA 3LP1A 1U45A 3NFAA 1C0MA 5SWMA 3HSTB 4FM2A 4CJUA 2XO7A 4I9LA 5KGWA 1NJWA 3V6DA 4B9MA 1TKXA 4O0JA 5CYMA 4C8NA 2NUBA 3DLKA 2IC3A 3LANA 1C1AA 2D0CA 4CEBA 1LAWA 4LSNA 4RW9A 3V9UA 2YHBA 3ZT4A 2ZE2A 1KVBA 4E1NA 2G8UA 4CHQA 1UAXA 3CM5A 3L2WA 3QNNA 4DFKA 3HJFA 2D0AA 4IBNA 1RT7A 3OYLA 4DTPA 1Q9YA 4Y1CA 2IDOA 4BDZA 3HVRA 3PX4A 2VG5A 3ITHA 3SPYA 4Z4CA 4CJWA 4N41A 4QOZB 4W5QA 4DQQA 1VSIA 1CZBA 1FXXA 3AO1A 1J5OA 4BE1A 4DTUA 2Y1IA 4W5NA 3P1GA 1C1CA 3V81A 1TK0A 5HLFA 1RDBA 3VQPA 5J1EA 4KHQA 1R0AA 4K8ZA 1HQUA 5JS2A 5KRTA 3PX6A 4CHOA 3KKSA 3S3NA 4FZXC 4FZYA 3K59A 4EP5A 4BACA 1HYZA 3RMBA 1W9HA 4CGGA 4DS4A 1S9GA 4E0DA 4KTWA 3AA2A 2VG6A 4FK2A 3T19A 4JLHA 4DQRA 4IFYA 2VWKA 4CFCA 4F2SA 2F8SA 3TAPA 5C24A 4W5TA 2RKIA 3KK3A 3QETA 2VG7A 3PX0A 1HYVA 3HP9A 1Q8IA 1S5JA 2KW4A 4DU4A 2E6MA 4E7JA 1SL2A 1BGXT 3MXJA 3E01A 1VSLA 1T03A 4E3SA 4KREA 1WSEA 3ZSXA 4M42A 3ZT2A 3B6OA 1KTQA 3NH1A 4H4OA 2GUIA 1XC9A 3IAYA 1TKTA 2KTQA 4C8MA 4YNQA 4HTUA 4FJHA 3CFOA 3OJSA 1LWCA 4NCGA 3PO4A 3CQ8A 3OYEA 1Y97A 3LP0A 2FBYA 3KLFA 2HHWA 4F4KA 1QHTA 1DLOA 1A5XA 3QNOA 4KTQA 4J2AA 4FJ8A 2YV0X 4GW6A 1BL3A 1WSGA 1TK5A 4CCHA 2W42A 5HRRA 3KIOA 3TARA 3M8SA 2KFNA 4RW7A 3ZSYA 2DY4A 1JKHA 1RCHA 3I8DA 1RTJA 4CHNA 4R5PA 1JXBA 2F96A 3HT3A 4FZZA 4Z4GA 1DTQA 3K58A 4C8OA 3F73A 3AO5A 4DF4A 3MXIA 4N76A 5HRNA 2X78A 3SUQA 3KJVA 3WNGA 4FLTA 3I0RA 2HB5A 1DTTA 4GVMA 1NK8A 3RMDA 3HL8A 2B4JA 2DTUA 3HPOA 2XY8A 3LALA 4H8KA 3M8RA 3VQCA 1RBTA 1ZBHA 4DSFA 3NF9A 3SCXA 1QSSA 1HMVA 1UWBA 1RT1A 1IH7A 2B5JA 3ASMA 3QEXA 4CF0A 1VK0A 4JS5A 2BDPA 3VQ4A 2HHVA 2OZSA 4FM1A 2XY5A 3DLBA 1VRUA 4FXDA 1I39A 1J9AA 1X1PA 3P5JA 1T7PA 2ATQA 5CYQA 1WAFA 3MECA 3SUPA 3NF7A 2LSNA 2Y1JA 4E7LA 3ULDA 1TGOA 4E7HA 3AVNA 1NK5A 3H08A 4CFBA 2XHBA 3VQDA 2P5GA 4DTNA 1SV5A 2G8FA 2OPRA 4B08A 1KVAA 4DTMA 1X9WA 1LWEA 1Q9XA 3RTVA 1LW0A 4DFPA 1QE1A 3L3VA 3O3HA 1F21A 2E4LA 3EYZA 3QEIA 4F8RA 5KRSA 1HJRA 4M3UA 5SZTA 1D8YA 5CY4A 1NK9A 1JLQA 3SZ2A 4CF1A 4CHPA 1EX4A 4QCLA 3KLEA 4Q0BA 3KLHA 3AVHA 3OYBA 3NHGA 4HCCA 1IKYA 2F8TA 1KVCA 1RBUA 3CM6A 3LAMA 3NBPA 3G10A 1SKSA 5C25A 2A1SA 3IG1A 5CZ2A 3PV8A 4BWJA 4OPJA 2Z1JA 3TAEA 3NAEA 3OVNA 2IAJA 4E7KA 3K5OA 1ZBFA 1W0HA 4B9UA 3L8BA 1T8EA 3K5NA 4FJJA 3DRSA 4LH4A 3NCIA 1VRTA 3K5MA 4B9SA 4HUGA 1BIUA 4CJEA 3L2UA 2XY7A 1ZYQA 3RRGA 4DSJA 4F3OA 2OPPA 3MXMA 2DFHA 5C42A 3AVMA 4OKEA 1KFDA 4CJQA 1ASUA 2KZZA 1RDDA 3ZCMA 1IKVA 3AV9A 4DFMA 3D45A 3AVFA 4CJVA 1KLMA 4O5BA 3LPTA 2Z1GA 3OY9A 5J2QA 5CZ1A 3OS2A 3OYNA 5FDLA 3KD1E 1BCOA 2G8KA 4HVJA 4CK2A 4OVLA 4UQGA 4DQPA 1RT4A 4W5RA 1X9SA 3O3GA 4CJTA 4N47A 2P51A 4CJLA 4CFDA 2HMIA 1WLJA 3MEEA 4QAGA 4AHSA 3RMCA 4FJIA 4PQUA 4PUOA 3KKRA 4Z0UA 2OA8A 3AA5X 4CEAA 3D0PA 4FCYA 4FLUA 4DWIA 2YNHA 4B8CA 4CGIA 4DTXA 3DRRA 4AILC 4FJKA 4J2DA 2RF2A 4XIUA 4HUFA 2HVIA 2D5RA 4LSLA 3OS1A 4CJPA 4FJMA 4JRPA 4CJKA 1XHXA 3LWMA 2QKKA 4Z4EA 3IRXA 2ZD1A 3HPHA 3TAFA 1A5VA 1VSFA 3C6TA 4B9NA 1FKPA 4CK1A 4Z4HA
chains in the Genus database with same CATH superfamily
1IG9A 3IS9A 4CBXA 3CG7A 5I3UA 3VENA 3EO3A 3QBWA 4W5OA 1C1BA 1KQSM 4FW2A 1RT3A 1NMDA 2WUSA 4K25A 2P9IA 2VGNA 3NH0A 1TL1A 3HZ6A 3U9DA 3DLHA 1DKGD 4JS4A 3VESA 3TWHA 2D0BA 3ENBA 2IIRA 3SBGA 4LF5K 1YTUA 3TAQA 3A5LC 2YNGA 1TK8A 3W3DA 4M3TA 3MEDA 2Q36A 4CZFA 4MLEA 5BREA 1NKBA 4IFEA 4NCAA 4Q5VA 1MWKA 3CJ7A 2KLAA 4BRNA 4KTZA 4KKOA 2IVOA 3ZSWA 3CC4N 3L4IA 4KH4A 5KI6A 2XRIA 3QIOA 3L0QA 1REVA 1J53A 3VQQA 5GAGP 5KPRA 4KFBA 4XEIA 4EHUA 1EO1A 1HNVA 1XHZA 3D2EA 3CQXA 3S3MA 3UKUB 1K73O 3J7ZO 4CJ5A 2ITGA 3D2EB 1RTDA 3DXKB 4YORA 5GIOA 1ILYA 1RT5A 4JK8A 3U9ZA 5ADXH 3C65A 5FRMA 4CFAA 3L6QA 3VEYA 4BVOA 4FWPA 3CMAN 1NLVA 5AZJB 1VSMA 1X9MA 1CXQA 1EETA 4LF7K 4LH5A 1J54A 3DYAA 4IFVA 5C10A 1QHAA 2DFEA 5FLXO 3A5NC 1RDCA 4KHNA 4TSXA 4CJ3A 4OLBA 1G15A 2VCPA 1EXQA 5HRPA 2VWJA 4DV2K 2E88A 1ZBSA 1X9JA 3L2RA 3OHRA 2V52B 1YJWN 1BQNA 4OGCA 1KRPA 3ZLJA 1XNRK 3WXMB 4BGBA 5FPMA 2O4IA 4YDUC 1BCMA 3FLCO 4FVUA 1OVQA 2HF3A 2Q0RA 4CW7B 4R79A 1CLQA 5AQYA 1L3VA 3CCEN 4F3TA 5FROA 3FR0A 3VQ8A 3ZEUA 5BPLA 1BI4B 1R59O 1C6VA 3OBYA 4B9VA 3D6RA 4O4GA 1L5UA 4DV7K 2HHXA 4O55A 3T69A 1TAQA 2KKZA 1JLBA 3WNEA 1TVRA 5I42A 3H3OB 2FBTA 3QBXA 3EEQA 5BRFA 1VQ7N 4DR2K 3THXA 3NF8A 4FLYA 4BGAA 3SAHA 4CJRA 4GV6A 5KPZA 1TKDA 1M1KO 3OYMA 5AQTA 4DTRA 4RW4A 1JLGA 3N4QA 1RILA 3EE8A 3MK6A 3QEPA 1K9MO 3RVCA 1U04A 4DR1K 5T7BA 3HXMA 1MDUB 4KBOA 3C0BA 3ZT1A 1S3XA 1ASVA 4DQSA 4ID5A 4CJSA 1L3UA 2F4VK 1TV6A 3U3YA 1RT2A 3HM9A 3LZJA 4KB1A 3O6WA 3WEEA 4DV6K 2G8WA 4CEOA 4M3XA 2O8EB 3DLLL 5HP1A 4DUZK 4KI4A 3CERA 4CIFA 4MO4A 3WNFA 3WNHA 4H5RA 1KLNA 1X3NA 4IEEA 4CBWA 2G8VA 3LDSA 1QS4A 3NE6A 1JCFA 1XI1A 1SL1A 4KHWA 1FKOA 3VGMA 2D1KA 3VMFB 3B8AX 4JRQA 4B1WB 3AVBA 3ZSQA 3P4IA 1RBSA 1S6PA 3LDOA 1YF5L 1B9DA 3NH2A 4FK4A 3NGYA 4CIEA 1S1UA 1IKXA 3THYA 3SNNA 4I2QA 3QINA 3EN9A 3CJBA 2BANA 4KV8A 2OYQA 2VQEK 1N32K 2UXCK 3ZSRA 1S1WA 3MAQA 1VQ4N 4F9OA 1CZAN 4DSLA 3M5RA 4ID1A 3AARA 3EKSA 2HNZA 4DG1A 3Q7CA 3EY1A 4ZTFA 4CHZA 1SKRA 4N56A 3DLEA 4OKJA 3AVAA 4BR4A 1VSHA 2A6AA 3M6GA 3BGRA 1HPZA 4ZTJA 3G6EN 1VQ5N 3PSFA 4JK7A 1YUWA 1S9EA 2YKMA 3OW2M 4DSEA 2HBKA 3P39A 4RG8A 4CGHA 5AQKA 4B9QA 3VQ6A 2G8IA 3SUOA 4A59A 2P9PA 4AHTA 2YKNA 4AHCA 4WE1A 3ZYYX 3FZKA 3RR7A 1T6CA 4JI2K 1JLEA 4FLXA 4EZ6A 5H1SQ 4B3OA 1TL3A 2ZJQL 3SI6A 4ZHRA 3NFAA 1C0MA 1Q86O 4OPHA 1W2BM 4B9MA 5AZIB 5M1OA 5AQQA 1UAXA 1QQOA 2RHKA 2IDOA 4JKDA 3SPYA 1E4GT 4CJWA 4GV3A 3VGKA 4YY3K 4DQQA 1S72N 5HL7L 4A5AA 1NNEA 1ESVA 3WXJA 5JS2A 5KRTA 1QZ6A 4LF9K 3ULEB 4B3SK 4CHOA 3KKSA 3S3NA 4EP5A 4BACA 4MDAA 1HYZA 4KH6A 3VPZA 4JLHA 4CFCA 1XUPO 5C24A 2RKIA 2P9LA 4JKBA 3VF4A 2QWOA 4DR5K 3HP9A 3BY5A 3E01A 1HPMA 4X64K 1YAGA 4H4OA 3WQUA 4QS8A 1NGIA 4C8MA 4FJHA 4EHTA 3CFOA 1HJOA 4BC4A 3PO4A 3CQ8A 3OYEA 3KLFA 4F4KA 4FJ8A 1A5XA 4GW6A 3CC2N 4CCHA 2UXBK 3KIOA 3ZX3A 4R5PA 4CZJA 1OH7A 3K58A 4C8OA 3F73A 2CGLA 4LF4K 3NVKA 1XQSC 2QWPA 5HRNA 2X78A 3SUQA 4CD3A 3C7NB 1HUXA 3I0RA 1DTTA 3N4PA 3RMDA 2DTUA 2XY8A 4YOUA 4H8KA 4H03B 1HMVA 1UWBA 4WQ5A 1IH7A 2BDPA 4CF0A 4JS5A 5AQWA 1VRUA 3P5JA 3MECA 1NGFA 5JVGL 4BR9A 4CFBA 4J8FA 1X9WA 1LWEA 4H5VA 1ATSA 1BA1A 3EYZA 3MWTA 1HJRA 5KRSA 3HOTA 4M3UA 5CY4A 3SZ2A 1EX4A 2QWNA 1KAXA 3OYBA 3GL1A 1IKYA 1SKSA 5CZ2A 3PV8A 4BWJA 3NAEA 4JI1K 3K5OA 4JAXA 3H3NO 3WXIA 4B9UA 1DGKN 3J7AP 3VF2A 3NVMA 3NCIA 4DR3K 5BRDA 4B9SA 4F3OA 4CJEA 5BPNA 1ZYQA 2DFHA 4FWSA 4EIAA 3AVMA 3VEXA 1IKVA 3A5MC 4DFMA 4CJVA 2ASMA 1KLMA 2Z1GA 1NGHA 5CZ1A 3OS2A 3BF3A 2P9UB 4OVLA 1RT4A 4H0VB 1X9SA 4CJTA 3CPEA 4JI6K 3D0PA 4FCYA 3HM8A 4DWIA 4CGIA 4DV4K 4IOAL 3MN9A 3MN5A 2O8EA 4CJKA 2E5LK 3TAFA 4BE1A 4DTUA 3OVNA 2O8CB 1SL0A 3MN7A 2NRRA 3SQ4A 2FF3B 4N5SA 3DOLA 3CQYA 3O9QA 4MLHA 2PZSA 1VSDA 5J2MA 1WSHA 2OPSA 2I5JA 2P9SA 3ATVA 1U4BA 4C1NK 4O44A 3CJCA 2HW3A 3SUNA 5LMUK 3CC7N 3LP3A 3TABA 1BQMA 1RNHA 4WCEL 5K14A 1N33K 2I7PA 3NF6A 4BDYA 4E7IA 2P9IB 4UY8O 3V9ZA 3KD5E 2X6SA 4C8KA 2ITMA 1BO5O 3O4QA 2Q97A 3FGUA 2G8HA 4CECA 3LL3A 1LAVA 3MX2A 3PLAA 4B1XB 4BRMA 4FJ7A 1HKBA 3HPGA 1CZ9A 2NRTA 4CZHA 1NJYA 4FPAA 4B9TA 4ISEA 4I7FA 3OYCA 1VSKA 4IWVA 5AQOA 4M3RA 4CF2A 1Z25A 4DV1K 1ZC6A 2BGGA 3F5TA 4BR7A 3H46O 4JI5K 5DM6L 4CJ7A 3NGZA 4FJ9A 1U2VB 2HHTA 2HHUA 1VQLN 4C23A 1XMOK 4DTOA 3CCJN 3FFIA 3A5OC 3QEWA 3CMEN 3EE9A 3THWA 4FLZA 3WEEB 4GKJK 1E4FT 4JKGA 1OH5A 1DT9A 3LP2A 2W41A 4B8AB 3L2QA 4F2RA 1KFSA 2VYPA 3C95A 5B8HA 1D9DA 3L3UA 2AP1A 1P90A 4FWKA 3H1VX 2DFFA 4MQ3A 1WOQA 1BUPA 2JWKA 1U48A 4E89A 3AGKA 2ZJPL 1K8KB 4AF1A 2Q3SA 3VEVA 3K2PA 2BE2A 4GV9A 4KRFA 1L3SA 4PHTX 1BDGA 3SK3A 4B1YB 1NOZA 3K57A 1NJIO 1O13A 4JI4K 1NK0A 3DJCA 3DLRA 4WYBA 4KHYA 1BISA 1C0UA 3AO3A 5E41A 4V19S 1QVFM 3OYFA 3THVA 4OKKA 4BG9A 4B3RK 1JL2A 4JI7K 5J2PA 4BQZA 2ZQBA 4M41A 4LC9B 1Z26A 1Z6RA 4CERA 4DSKA 4B3MK 1KD1O 4IEIA 3I56N 3BZKA 4FW1A 2QTDA 3O9UA 4O8UA 3AVJA 1QQMA 4DU1A 1YXQA 4FOIA 5GAEP 3V4IA 2HHQA 3U4LA 3VTIA 4I2PA 1LWFA 3TR8A 5AQVA 3OS0A 1BIZA 1D4XA 2P9KA 2RPIA 2WBNA 2PYLA 3CJ1A 1GLDG 4BVPA 2IOCA 4GKKK 1VQ8N 2EX3A 5F1XA 2Q2RA 3I0SA 1RTHA 4AH9A 1TKZA 1SAZA 4EP4A 3RWUA 4KHSA 5HOOA 3UIQA 2A41A 4PKGA 1WBDA 3KHYA 1M90O 3RMAA 3AO2A 5AZJA 3VA0A 1GOCA 1KXPA 1WSFA 1XWLA 3GOIA 4PWDA 3MCAB 4J2BA 3VQ9A 3SPZA 4KHPK 4CGFA 3DMJA 1VAZA 1B92A 1IBMK 3P31A 4XH4A 4DLEA 2O8DA 3CXCM 4I9QA 1VSJA 3ENOA 3ZSZA 1JLCA 4I6MA 2O8DB 1UA0A 2E2OA 5JS1A 4EFHA 3V9XA 1GLCG 2UYTA 3WT0A 3AVCA 4DMNA 4CZIA 2Z1IA 4X62K 3OYJA 1TYQA 1GLJO 4G1QA 2D0PA 3JSMA 4AM7A 1KC8O 5M1QA 2P9SB 5AQSA 3UKRA 2ZJRL 3EKUA 4KHUA 3LDLA 4NCBA 4BRFA 5FRNA 2YNFA 4DTSA 4CHYA 4OLAA 2HNDA 4E1MA 1MU2A 5LJWA 3SQ2A 4MFBA 2XY6A 3K9KA 1YJNN 2QXFA 1NGGA 1S1XA 4E1JA 4FJIA 3OJUA 3LP1A 2YI1A 1EWQA 4BRKA 4BRGA 1TKXA 3VEZA 3DLKA 4CEBA 4LSNA 3V9UA 1W7AA 1J6ZA 2YHBA 2O8FA 1KVBA 4E1NA 2G8UA 4CHQA 3CM5A 3L2WA 4DFKA 2D0AA 4IBNA 1NBWA 1RT7A 3O1BA 3OYLA 1Q9YA 4Y1CA 3E66A 2VG5A 1IBLK 4K41A 2QA4N 4QOZB 4LF6K 1VSIA 1CZBA 3AO1A 4FL9A 4O5FA 3CF5L 5M1PA 1J5OA 1C1CA 3V81A 4XH1A 3VQPA 4BC3A 5J1EA 5HLFA 4CZKA 3SJHA 3FE1A 4LFAK 5BR9A 3SAGA 3RMBA 4CGGA 3TSQA 4FPBA 2VG6A 4YDUA 4DQRA 4F2SA 3JXUA 5GAHP 3QETA 3OTOK 5KPTA 1Q8IA 2KW4A 3BF1A 2HHHK 2E6MA 1SL2A 3MXJA 3SMSA 1VSLA 3I33A 4KREA 1WSEA 2JWLA 1TKTA 1Q82O 3O9RA 4HTUA 3OJSA 1LWCA 2UUCK 3G71N 4J2AA 3VF6A 4IO8A 3QNOA 5AQNA 5EY4A 3DAWA 1BL3A 2NRXA 3TARA 4RWTA 3R3LA 2KFNA 2W6KA 3ZSYA 1V4SA 5M1NA 2GELA 1RTJA 4CHNA 4LFCK 1FW6A 4FZZA 3HT3A 5JVHL 4Z4GA 3DXKA 3U8XA 4DF4A 4ISGA 3BEXA 1Q81O 3KJVA 1NK8A 3ATUA 3ZX0A 5E26A 3HPOA 3LALA 4WQ4A 4DSFA 3SCXA 2GWJA 3IUCA 1RT1A 2B5JA 3KWGA 3MWPA 3SMPA 5JLFA 1X1PA 1J9AA 4QS9A 1WAFA 2LSNA 2Y1JA 4E7HA 1TGOA 2QM1A 3TU5A 1NK5A 5AQUA 3K9JA 1SV5A 2NNWA 4B1VA 2OPRA 4B08A 3RTVA 4DFPA 3L3VA 1F21A 4A2AA 4RCHA 1D8YA 1NK9A 4JKAA 4CF1A 2FSJA 3DXMB 3NHGA 3UKUA 3CM6A 4DUYK 3GBTA 3IG1A 3TAEA 1QQNA 2QWMA 4E7KA 1OKJA 1KAYA 1ATNA 1T8EA 4A62A 1VRTA 3K5MA 5EVZA 1JCEA 3C6HA 1ASUA 3PSIA 3AV9A 3D45A 3A0IX 3AVFA 2HBJA 4FWOA 3LPTA 5AJ3K 3OY9A 3F2KA 5FDLA 4UQGA 4BG8A 4N47A 2P51A 4H0YB 3TTDA 4CJLA 1KAZA 4CD1A 4PQUA 3HRGA 4PUOA 3KKRA 2OA8A 2YNHA 1ATRA 3DRRA 4AILC 1T3VA 2RF2A 1YVNA 3OA9A 4U7BA 3LWMA 5BPMA 3THYB 3IKMA 2CGKA 3RSEB 4BY9C 3KLGA 4CJFA 3LM2A 5HROA 4Z4IA 4DV3K 1YVUA 3DM2A 4CJ4A 3RSEA 1K8AO 4BRAA 3T1YK 2P9LB 1RDUA 1O1WA 1N5YA 3ZT0A 4RW6A 4BR2A 1SZ2A 2KQ2A 4OGEA 4J2EA 3JYTA 5LJVA 4BRDA 4Y1DA 1SQKA 2X74A 3MCPA 3OYKA 3TANA 4JN4A 2YHAA 3THXB 1VQMN 3V1QA 2FC0A 3KK7A 4CESA 3TTFA 1VQNN 3QERA 3M1FA 3R8EA 3G25A 5AQIA 5IWAK 3MMVA 4G9ZA 1YITN 4QS7A 2P9NA 3WXLA 2UXDK 2YCHA 3OBWA 5C15A 5AQRA 1NM1A 4BC5A 4LD0A 2A1RA 2ETJA 3AVKA 2B6AA 3ISNC 4DTJA 3MEGA 1BG3A 2E8AA 2P9KB 3S41A 2FBVA 1RBVA 4HHTA 1W97L 1N8RO 4CEQA 4AHUA 4DU3A 5DK5A 4DCHA 1XC3A 4M3ZA 2ZGZA 1VSEA 4BRCA 2WOMA 1Z05A 4YOTA 1HNZK 2PY5A 2OZMA 1HYSA 4U67L 1QQCA 3DLGA 4IKFA 3LDPA 4M7XA 3F9KA 3RRHA 3FZMA 3S9HA 4BE2A 1U2VA 5EU7A 4JK9A 4OJRA 1YIJN 5D3GA 4E19A 3PIOL 2E2QA 4EZ9A 3Q7BA 3ULEA 4KAZA 3FZFA 3V1OA 4BWMA 4OPKA 3VA3A 4IJAA 4ELTA 1XNQK 1XMQK 5LL6Z 1WUAA 4M3YA 1MWMA 3LZIA 1N6QA 2BH1A 3ZSVA 2HVHA 3VEOA 1WB9A 4YOYA 2VWBA 5BN8A 4A57A 4B1ZA 5JICA 3SLCA 4KB0A 4FJ5A 3PO5A 3LAKA 1LOTB 4DV0K 4FJNA 1T6DA 1NGAA 4BR5A 1Q18A 1RBRA 2FF6A 1NGCA 3V9WA 3HOSA 3NDKA 2HHSA 5EX5A 5JLHA 3VQBA 3HVTA 3O9SA 1C0TA 3T1AA 1WNSA 1ZBLA 1HRHA 5KQDA 4K8XA 5AFUH 5EXWA 3J81O 2IS3A 4IOCL 3V9SA 4M7YA 3KLIA 4WQ5C 1EWRA 4IO9L 4C8LA 3VN5A 4DR6K 1D9FA 2FBXA 3LPUA 1ZBUA 4BE0A 3CJAA 2HSTA 5AQGA 3TAGA 3OYHA 4DB3A 1K8KA 4NXNK 1QTMA 1EP4A 3CPWM 3H1QA 1GOAA 2V7ZA 1WSIA 2UUAK 3VQAA 3U3GA 3HSCA 3QDKA 4PKHA 4IG0A 1RDAA 4RW8A 4DLGA 4JKEA 3ZETB 1UOCA 1H1VA 2GEMA 1NGBA 1RGIA 1LV5A 3SV4A 2OTJN 3AA4A 4PY5A 3FFKB 3KZBA 3PIPL 4ELUA 3TAMA 4JHDB 2E1YA 1QSLA 1ZXOA 4FK0A 1S1TA 2Q0UA 3VQ7A 3S3OA 1J5EK 1JL1A 3QFUA 1JXEA 3DOKA 5AQZA 1GOBA 1HLUA 2YHWA 3DI6A 5AQHA 3HTVA 4K43A 2GBZA 4C1NI 2A40A 4O0IA 4JKFA 2WONA 1I3AA 2CH5A 4DS5A 1U47A 2D4WA 4CZEA 3MN6A 3SQ0A 4B9LA 3OYGA 4EAHD 3DRPA 3G0ZA 4FLVA 4H5TA 2KFZA 2RN2A 5KTQA 4DV5K 3SYZA 1HNXK 2KZMA 2QW9A 4DSIA 3BDPA 5AQMA 2R7YA 2QK9A 1IJJA 1T05A 3EZ5A 4NYNA 4M45A 4YFUA 1NJXA 4KO0A 3PUFA 2X6NA 2NRWA 4IDKA 5M1FA 4B1UB 1RDWX 4K42A 2QI2A 3MDQA 3VQ5A 4L8RB 2FXUA 1WAJA 3UB5A 3ID6A 1JCGA 3GG4A 3CI5A 1BI4A 3F9MA 1RFQA 3ZSOA 3L2VA 4CIGA 3O9TA 4FWNA 1A5WA 4FWMA 4FM0A 1FJGK 2E1ZA 5J2NA 1G99A 3FZHA 3QFPA 3HSTB 4B3TK 3A8YA 4CJUA 4I9LA 5KGWA 2XO7A 1NJWA 4FSVA 5CYMA 2NUBA 2IC3A 4JV5K 1C1AA 3VETA 1LAWA 2GUPA 3LDNA 3ZT4A 2ZE2A 4H5NA 3AY9A 3J7YP 3QNNA 4DTPA 3JAMO 4BDZA 3HVRA 3PX4A 3ITHA 4L3QA 4Z4CA 5AR0A 4N41A 1FXXA 5EOYA 2Y1IA 2QWRA 1TK0A 2ASOA 5FPDA 3H6EA 1HQUA 4FZXC 4FZYA 3QMLA 1I94K 3CJ9A 4BRPA 1W9HA 2P9NB 5A2QO 4KTWA 1QZ5A 3T19A 4FK2A 4IFYA 2VWKA 2F8SA 4PL8A 4Y0WA 3WUHA 3C7NA 1S5JA 4DU4A 4E7JA 5AQPA 1GLEG 4E3SA 4X66K 4M42A 3ZT2A 3B6OA 1KTQA 3GDQA 5AFUA 1IV0A 4JKHA 2KTQA 4YNQA 3CCQN 2F7TA 1GLLO 4NCGA 3LDQA 4NB4A 4FO0A 5AQFA 1Y97A 3LP0A 4JKCA 4KTQA 1WSGA 1TK5A 4CZMA 2WC9A 4RW7A 1JKHA 1RCHA 3I8DA 1IG8A 2F96A 3E9OA 4LF8K 1DTQA 3MXIA 2YHXA 1TUYA 2CH6A 1X3MA 2QWLA 1MA9B 2ZF5O 3P38A 3O8MA 3ENHA 4YHHK 2Q1NA 1RBTA 1ZBHA 1QSSA 5I9EB 3ASMA 3QEXA 1V4TA 4MDBA 2OZSA 3FZLA 4FM1A 2XY5A 4FXDA 2UUBK 4Z94A 2ATQA 5CYQA 4FOEA 3SUPA 3DXMA 5GADP 4E7LA 3ULDA 3VQDA 4DTNA 4AQYK 1Q9XA 1LW0A 3K0SA 2E4LA 4FWQA 4CZGA 3EZWA 1WBBA 2ZWHA 4KH5A 4NLBA 1JLQA 5TKWA 4CHPA 4HCCA 1N36K 2F8TA 1KVCA 1RBUA 3LAMA 3NBPA 3G10A 5C25A 2A1SA 2BUPA 4OPJA 2Z1JA 1GLFO 1W0HA 1ZBFA 3AAQA 3L8BA 4BROA 4FJJA 3DRSA 3CETA 3L2UA 4DSJA 2XY7A 1NMNA 2OPPA 3MXMA 1KFDA 1NGEA 4CJQA 2OCEA 4PL7A 2KZZA 1RDDA 4BREA 2D0OA 3TSPA 4BRHA 5J2QA 3OYNA 1BCOA 2G8KA 4HVJA 4W5RA 5GINA 2FSNA 2OANA 3R9PA 1WLJA 3MEEA 4QAGA 2FSKA 3RMCA 4Z0UA 2P9UA 3AA5X 4CEAA 3CCUN 3O4WA 4CZLA 4JD2B 4BR0A 4J2DA 4XIUA 4HUFA 5ELZA 4LSLA 3OS1A 1QVGM 4RTFD 5JMVA 4JRPA 5F2RA 1XHXA 2QKKA 4Z4EA 3HPHA 2OTLN 4AHVA 1VSFA 1FKPA 4CK1A 4Z4HA 2GWKA 2WFBA 3QO9A 2PFUA 2V7YA 3E9PA 3OYDA 4DR7K 1BA0A 3T7ZA 2Q31A 3BZCA 4YOWA 2PYJA 2E6LA 1NKEA 4M3WA 3NGIA 3O3FA 3LWLA 1QSYA 1U49A 2FLOA 3O4NA 2JGUA 3VQEA 3E9LA 4JHDA 4AHRA 3C6AA 4CGJA 1NGDA 1LW2A 2A3ZA 4CBUA 3P83D 3QIPA 1CXUA 4CF8A 4CK3A 4DR4K 5LMNK 1IKWA 4BDPA 5MLCQ 1YTAA 3QEVA 4BC2A 3OYAA 2PBDA 2WTUA 2YHYA 2Z1HA 3TPQA 5FPNA 4NXMK 1HNIA 5HBMA 2I7NA 4H0OA 3TI0A 4DF8A 5DMRA 3VERA 4HTLA 2HNYA 4H5WA 1D5AA 1NGJA 1S6QA 3G4SN 3KWIA 2P9PB 4FWRA 4GNIA 4FJLA 3UE5A 3GE1A 3THWB 4FLWA 5DM7L 3AA3A 2GV9A 3KTQA 3OYIA 4BQLA 4FWLA 1SKWA 1Q7YO 1EKEA 3CCSN 4A2BA 2P1JA 4AM6A 5BR8K 4CEEA 1LCUA 2E2PA 1HKGA 1NWKA 3U6FA 1NOYA 2YJEA 4GY2B 5AQJA 1TAUA 1B9FA 3QESA 4IDHA 1BU6O 5M1KA 3DWLA 4DQIA 3AVLA 1HR0K 2VQFK 1GLAG 2IVPA 3V1RA 3ZETA 1L3TA 3C94A 1C0FA 4JKGB 1T44A 3QLHA 4H0PA 2HMPA 5HRSA 4KI6A 4IXCA 3I55N 2GTDA 1BOTO 1RT6A 5GIPA 3CFPA 3CYMA 3SBTA 5C12A 4GMJB 1KSPA 3KVGA 2IGIA 4ELVA 4CVNE 3IMXA 1U6ZA 4A5BA 1HQEA 2QXLA 3B6PA 1NK7A 3PY8A 3HO1A 1JLAA 4NO7A 4ISFA 3SJJA 3T3FA 1VQ9N 1S22A 2A5XA 3RR8A 4H0TB 4WQ4C 1HKCA 2O8BB 3AVGA 3AGRA 4NLCA 1K6YA 1OVYA 3WQTA 3TTCA 3KK2A 3NMUA 2O8FB 1JLFA 1NK4A 2EHGA 5AQXA 3A2FA 4FJXA 4WFNL 2NLXA 5CR4A 4DHYA 5C0YA 1VQKN 3VOVA 3K5LA 2ZM6K 4FJGA 3IDHA 3LM9A 1NJZA 1NK6A 1RTIA 4HUEA 3O1WA 5CE3A 4BRQA 3H45C 4Z4FA 4FYDA 1DEJA 2HBLA 2NRVA 3HK2A 5TKYA 5C2DA 1KCFA 3ID8A 4CEZA 2HBMA 1YT3A 3EL2A 1C0GA 4CE9A 3L4QA 2AA4A 5CHIA 4H4MA 3O80A 3VEWA 1VHXA 3ZT3A 2AJQA 2JLEA 5KQ8A 3HP6A 3BP8A 1TUUA 1BHLA 1ZBIA 2UU9K 2HOEA 4DFJA 3CIPA 1IBKK 3ALYA 3D7EO 4YOVA 5C2FA 4NYFA 4CI6A 1YJ9N 1UA1A 2GX9A 1N34K 3SQ1A 4ICLA 3O08A 3C6UA 4M63C 5F0XA 2PAVA 2O8CA 4CEFA 2QKBA 1ASWA 1S1VA 2HF4A 2J4RA 5IT9O 2YX6A 2QWQA 4IG3A 3M8QA 4JYAK 4DKWA 3HYFA 4FVMA 4WFAL 4BRLA 2O4GA 1VQPN 3AVIA 2YNIA 5BN9A 1IO2A 1TYQB 4CF9A 1FK9A 4KPYA 2H3GX 3CCVN 2VGMA 3CFRA 1SUQA 4LY7A 3CCLN 2P5OA 1WSJA 1WN7A 3M8PA 3R1XA 4I6MB 4HCBA 3KK1A 2E2NA 4ILJA 4CEDA 4CGDA 3SV3A 4PA1A 3VGLA 2OPQA 3R6MA 3AO4A 1ITGA 5KGXA 1NKCA 1U45A 1HNWK 1BWFO 5SWMA 4FM2A 3V6DA 4O0JA 4C8NA 3I8BA 3LANA 2D0CA 3CCRN 4RW9A 3HJFA 3ZX2A 2O8BA 4GVEA 4X65K 4W5QA 5AZIA 4W5NA 2NRZA 3P1GA 4KHQA 1RDBA 3ZEUB 1R0AA 4K8ZA 3AAPA 2BTFA 3PX6A 4OX9K 2CGJA 3K59A 2W6LA 4JNEA 2RE2A 4DS4A 1S9GA 4E0DA 3AA2A 4OO1J 4PKIA 3HBTA 3TAPA 4W5TA 3KK3A 2VG7A 2IVNA 3PX0A 1HYVA 1BGXT 1T03A 1YI2N 3BUZB 4LFBK 3ZSXA 4DQ8A 3NH1A 1XC9A 2GUIA 4WF9L 3IAYA 3UKRB 1SS6A 1VQ6N 2F9WA 3M3ZA 2V51B 4JI0K 5BRHA 2FBYA 3D2FB 4JD2A 1OH6A 2HHWA 1QHTA 1DLOA 2QEXN 4YOXA 2DPNA 4IZ9A 2YV0X 4JI3K 5ADXA 2ZGYA 5HRRA 2W42A 3M8SA 2DY4A 1JXBA 3SAFA 5E84A 4N76A 3AO5A 4BRIA 1JJ2M 3E1YA 2E20A 3WNGA 4FLTA 1VQON 1EQYA 2HB5A 4GVMA 3HL8A 5FPEA 1Y64A 2B4JA 2W40A 2EWSA 3M8RA 3VQCA 2NRHA 3NF9A 3CD6N 2F9TA 4MO5A 1OH8A 1VK0A 4WFBL 3J80O 3VQ4A 2HHVA 3DLBA 1I39A 1T7PA 3NF7A 3AVNA 3H08A 1E3MA 2XHBA 2P5GA 3IFRA 2G8FA 3JS6A 4IJNA 1KVAA 4DTMA 1QE1A 3O3HA 4O8KA 3VTHA 1HX1A 3QB0A 4IOXA 3QEIA 4JI8K 3CCMN 4F8RA 5SZTA 4ILGB 3T1HK 3KLEA 4Q0BA 3KLHA 4QCLA 3AVHA 2KHOA 3MX5A 2ASPA 2IAJA 3K5NA 4XH5A 4LH4A 4H0XB 4OPAA 4HUGA 1BIUA 3RRGA 3HI0A 4K0KK 5C42A 4OKEA 2YJFA 3WXKA 3ZCMA 4JEPA 4ILHA 4O5BA 3KD1E 3D2FA 3W0LA 4CK2A 4DQPA 3O3GA 5AQLA 3CHWA 3QICA 4CFDA 1NU0A 1NG9A 2HMIA 4AHSA 3TSUA 2A42A 1YHQN 1GLBG 4FLUA 4B8CA 4DTXA 1P8ZA 4FJKA 2NZTA 2HVIA 2D5RA 4A61A 4CJPA 4FJMA 5LY3A 3J8AA 3O5BA 3IRXA 2ZD1A 1A5VA 3C6TA 4B9NA 4HWIA
chains in the Genus database with same CATH topology
1IG9A 3IS9A 1SL0A 3SQ4A 3QO9A 3CG7A 3KLGA 5I3UA 4CJFA 5HROA 4Z4IA 4N5SA 3DOLA 1YVUA 3OYDA 4W5OA 1C1BA 3DM2A 4CJ4A 4FW2A 2PZSA 1RT3A 1VSDA 5J2MA 1WSHA 2OPSA 2PYJA 2E6LA 3NH0A 1NKEA 1O1WA 2I5JA 4M3WA 1TL1A 1N5YA 3ZT0A 1U4BA 3NGIA 3O3FA 4RW6A 3LWLA 1QSYA 1U49A 4O44A 3DLHA 2HW3A 2KQ2A 4OGEA 3O4NA 4JS4A 3JYTA 3SUNA 4J2EA 2JGUA 3LP3A 3TWHA 3VQEA 2D0BA 4AHRA 3TABA 1BQMA 1RNHA 4Y1DA 1YTUA 2X74A 3OYKA 3TANA 5K14A 3TAQA 3NF6A 4CGJA 1LW2A 2YHAA 4BDYA 4E7IA 2YNGA 1TK8A 3P83D 3QIPA 1CXUA 3V1QA 2FC0A 4CF8A 3MEDA 4M3TA 4CK3A 3V9ZA 3KD5E 4CESA 2X6SA 1IKWA 3QERA 4C8KA 4BDPA 1NKBA 1YTAA 4NCAA 3QEVA 3O4QA 4Q5VA 3OYAA 2G8HA 4CECA 1LAVA 2Z1HA 4FJ7A 1HNIA 3HPGA 1CZ9A 4KTZA 4KKOA 5HBMA 4LD0A 3ZSWA 2ETJA 3AVKA 2A1RA 5KI6A 2XRIA 3QIOA 3TI0A 2B6AA 4DF8A 1NJYA 4B9TA 5DMRA 3ISNC 4I7FA 4DTJA 3MEGA 1REVA 1J53A 2HNYA 3VQQA 1VSKA 3OYCA 4M3RA 1D5AA 4CF2A 1Z25A 1S6QA 4KFBA 2BGGA 2FBVA 1RBVA 4HHTA 1HNVA 3NGZA 4FJLA 1XHZA 4FJ9A 4CEQA 2HHTA 4AHUA 2HHUA 4DU3A 3S3MA 5DK5A 4M3ZA 4FLWA 4DTOA 3FFIA 1VSEA 3QEWA 3KTQA 3AA3A 2GV9A 4CJ5A 3OYIA 2WOMA 2ITGA 1SKWA 2PY5A 2OZMA 1HYSA 4FLZA 1QQCA 3DLGA 1RTDA 4IKFA 1EKEA 3LP2A 3F9KA 4B8AB 1RT5A 2P1JA 3L2QA 3RRHA 4F2RA 1KFSA 5FRMA 4CEEA 4CFAA 3C95A 1D9DA 3L3UA 3U6FA 3S9HA 4BE2A 1NOYA 5EU7A 1VSMA 1X9MA 2DFFA 4MQ3A 4OJRA 1U48A 4E89A 5D3GA 1B9FA 1CXQA 4E19A 1TAUA 1EETA 4EZ9A 4LH5A 1J54A 3DYAA 4KAZA 4IFVA 3V1OA 3QESA 2Q3SA 2DFEA 4BWMA 4OPKA 3VA3A 3K2PA 4DQIA 2BE2A 4KRFA 3AVLA 4ELTA 1L3SA 1RDCA 4M3YA 4KHNA 4TSXA 3V1RA 4CJ3A 4OLBA 3LZIA 1N6QA 1G15A 3ZSVA 1L3TA 1EXQA 5HRPA 2VWJA 2HVHA 1NOZA 3C94A 3K57A 3L2RA 1NK0A 3DLRA 4KHYA 3QLHA 4KB0A 1BQNA 1BISA 4OGCA 1KRPA 1C0UA 3AO3A 5HRSA 4KI6A 5E41A 4FJ5A 3PO5A 3LAKA 1RT6A 3OYFA 3CFPA 4OKKA 3THVA 2O4IA 1BCMA 3CYMA 1JL2A 4FJNA 1KSPA 4GMJB 5J2PA 2IGIA 2ZQBA 4ELVA 1RBRA 1CLQA 4M41A 3V9WA 1Z26A 1HQEA 3NDKA 3B6PA 1NK7A 1L3VA 3PY8A 3HO1A 4F3TA 2HHSA 1JLAA 3VQBA 3HVTA 5FROA 4CERA 3VQ8A 4DSKA 1C0TA 3T1AA 1WNSA 1BI4B 1ZBLA 1HRHA 3SJJA 3T3FA 1C6VA 4K8XA 4FW1A 3RR8A 4B9VA 4O4GA 2IS3A 1L5UA 3V9SA 2HHXA 3AVJA 4O55A 3KLIA 1TAQA 3AVGA 1JLBA 4C8LA 3WNEA 1TVRA 3VN5A 4DU1A 3V4IA 5I42A 1D9FA 2FBTA 2HHQA 2FBXA 3LPUA 1K6YA 1ZBUA 4I2PA 4BE0A 3NF8A 3KK2A 3TAGA 4FLYA 1LWFA 4CJRA 3OYHA 1JLFA 1NK4A 2EHGA 3A2FA 3TR8A 1QTMA 1EP4A 1TKDA 4FJXA 3OYMA 1GOAA 4DTRA 3OS0A 4RW4A 1BIZA 1JLGA 1WSIA 2RPIA 2PYLA 3VQAA 3U3GA 1RILA 3K5LA 2IOCA 4FJGA 3QEPA 1U04A 2EX3A 1RDAA 4IG0A 4RW8A 5T7BA 4DLGA 1NJZA 1NK6A 3HXMA 1UOCA 1RTIA 1L3UA 4HUEA 3ZT1A 1ASVA 4DQSA 4ID5A 4CJSA 3I0SA 1RTHA 1TV6A 4AH9A 3U3YA 3SV4A 1TKZA 1LV5A 3AA4A 1RT2A 4Z4FA 3HM9A 3LZJA 4EP4A 3RWUA 4KB1A 4KHSA 4PY5A 4FYDA 2G8WA 3UIQA 4CEOA 4M3XA 5HP1A 3HK2A 4ELUA 3TAMA 1KCFA 4KI4A 4CEZA 1YT3A 4CIFA 3WNFA 4CE9A 1QSLA 3RMAA 3WNHA 4FK0A 4H4MA 3AO2A 3VA0A 3ZT3A 1S1TA 1GOCA 2JLEA 3VQ7A 1KLNA 3S3OA 1WSFA 2AJQA 1XWLA 1JL1A 2G8VA 3LDSA 4PWDA 4J2BA 1QS4A 3HP6A 1JXEA 3DOKA 3NE6A 1BHLA 3VQ9A 1XI1A 1GOBA 3SPZA 4DFJA 1ZBIA 1SL1A 4KHWA 1FKOA 3DI6A 4CGFA 2GBZA 4JRQA 4O0IA 3AVBA 3DMJA 4AHVA 1B92A 3ALYA 2WONA 3ZSQA 4NYFA 1RBSA 1S6PA 4DLEA 1I3AA 1UA1A 4DS5A 1U47A 4I9QA 1VSJA 3ZSZA 3SQ0A 4B9LA 1JLCA 1B9DA 3NH2A 3OYGA 3SQ1A 4FK4A 4ICLA 3NGYA 4CIEA 3DRPA 1S1UA 1IKXA 3C6UA 3G0ZA 4FLVA 3SNNA 4I2QA 2KFZA 3QINA 4CEFA 1UA0A 2BANA 4KV8A 2OYQA 2QKBA 2RN2A 5JS1A 1ASWA 5KTQA 3SYZA 1S1VA 3V9XA 3ZSRA 2KZMA 1S1WA 3MAQA 3AVCA 4DSIA 4DMNA 3BDPA 2Z1IA 4IG3A 3M8QA 4DSLA 4ID1A 3OYJA 2R7YA 3HYFA 4G1QA 2HNZA 4FVMA 4DG1A 3JSMA 3EY1A 2QK9A 1T05A 4ZTFA 3EZ5A 2O4GA 4NYNA 4M45A 3AVIA 4CHZA 1SKRA 4N56A 2YNIA 4YFUA 1IO2A 1NJXA 3DLEA 4OKJA 3AVAA 4KO0A 4KHUA 1VSHA 4NCBA 3PUFA 1FK9A 4CF9A 4KPYA 3BGRA 1HPZA 4ZTJA 5FRNA 2X6NA 2YNFA 4DTSA 3CFRA 1SUQA 4IDKA 4CHYA 4LY7A 2P5OA 4OLAA 2HNDA 4DSEA 1S9EA 1WSJA 2YKMA 4E1MA 1WN7A 1MU2A 4RG8A 4CGHA 3VQ6A 3VQ5A 4L8RB 2G8IA 3M8PA 1WAJA 3SQ2A 3SUOA 4HCBA 3KK1A 4AHTA 2YKNA 4MFBA 4AHCA 2XY6A 4WE1A 1BI4A 4CEDA 2QXFA 3ZSOA 4CGDA 3SV3A 3RR7A 3L2VA 1S1XA 4CIGA 1JLEA 4PA1A 2OPQA 4FLXA 1A5WA 4EZ6A 4B3OA 3AO4A 1TL3A 1ITGA 5KGXA 4FM0A 1NKCA 3OJUA 3SI6A 4ZHRA 5J2NA 3LP1A 1U45A 3NFAA 1C0MA 5SWMA 3HSTB 4FM2A 4CJUA 2XO7A 4I9LA 5KGWA 1NJWA 3V6DA 4B9MA 1TKXA 4O0JA 5CYMA 4C8NA 2NUBA 3DLKA 2IC3A 3LANA 1C1AA 2D0CA 4CEBA 1LAWA 4LSNA 4RW9A 3V9UA 2YHBA 3ZT4A 2ZE2A 1KVBA 4E1NA 2G8UA 4CHQA 1UAXA 3CM5A 3L2WA 3QNNA 4DFKA 3HJFA 2D0AA 4IBNA 1RT7A 3OYLA 4DTPA 1Q9YA 4Y1CA 2IDOA 4BDZA 3HVRA 3PX4A 2VG5A 3ITHA 3SPYA 4Z4CA 4CJWA 4N41A 4QOZB 4W5QA 4DQQA 1VSIA 1CZBA 1FXXA 3AO1A 1J5OA 4BE1A 4DTUA 2Y1IA 4W5NA 3P1GA 1C1CA 3V81A 1TK0A 5HLFA 1RDBA 3VQPA 5J1EA 4KHQA 1R0AA 4K8ZA 1HQUA 5JS2A 5KRTA 3PX6A 4CHOA 3KKSA 3S3NA 4FZXC 4FZYA 3K59A 4EP5A 4BACA 1HYZA 3RMBA 1W9HA 4CGGA 4DS4A 1S9GA 4E0DA 4KTWA 3AA2A 2VG6A 4FK2A 3T19A 4JLHA 4DQRA 4IFYA 2VWKA 4CFCA 4F2SA 2F8SA 3TAPA 5C24A 4W5TA 2RKIA 3KK3A 3QETA 2VG7A 3PX0A 1HYVA 3HP9A 1Q8IA 1S5JA 2KW4A 4DU4A 2E6MA 4E7JA 1SL2A 1BGXT 3MXJA 3E01A 1VSLA 1T03A 4E3SA 4KREA 1WSEA 3ZSXA 4M42A 3ZT2A 3B6OA 1KTQA 3NH1A 4H4OA 2GUIA 1XC9A 3IAYA 1TKTA 2KTQA 4C8MA 4YNQA 4HTUA 4FJHA 3CFOA 3OJSA 1LWCA 4NCGA 3PO4A 3CQ8A 3OYEA 1Y97A 3LP0A 2FBYA 3KLFA 2HHWA 4F4KA 1QHTA 1DLOA 1A5XA 3QNOA 4KTQA 4J2AA 4FJ8A 2YV0X 4GW6A 1BL3A 1WSGA 1TK5A 4CCHA 2W42A 5HRRA 3KIOA 3TARA 3M8SA 2KFNA 4RW7A 3ZSYA 2DY4A 1JKHA 1RCHA 3I8DA 1RTJA 4CHNA 4R5PA 1JXBA 2F96A 3HT3A 4FZZA 4Z4GA 1DTQA 3K58A 4C8OA 3F73A 3AO5A 4DF4A 3MXIA 4N76A 5HRNA 2X78A 3SUQA 3KJVA 3WNGA 4FLTA 3I0RA 2HB5A 1DTTA 4GVMA 1NK8A 3RMDA 3HL8A 2B4JA 2DTUA 3HPOA 2XY8A 3LALA 4H8KA 3M8RA 3VQCA 1RBTA 1ZBHA 4DSFA 3NF9A 3SCXA 1QSSA 1HMVA 1UWBA 1RT1A 1IH7A 2B5JA 3ASMA 3QEXA 4CF0A 1VK0A 4JS5A 2BDPA 3VQ4A 2HHVA 2OZSA 4FM1A 2XY5A 3DLBA 1VRUA 4FXDA 1I39A 1J9AA 1X1PA 3P5JA 1T7PA 2ATQA 5CYQA 1WAFA 3MECA 3SUPA 3NF7A 2LSNA 2Y1JA 4E7LA 3ULDA 1TGOA 4E7HA 3AVNA 1NK5A 3H08A 4CFBA 2XHBA 3VQDA 2P5GA 4DTNA 1SV5A 2G8FA 2OPRA 4B08A 1KVAA 4DTMA 1X9WA 1LWEA 1Q9XA 3RTVA 1LW0A 4DFPA 1QE1A 3L3VA 3O3HA 1F21A 2E4LA 3EYZA 3QEIA 4F8RA 5KRSA 1HJRA 4M3UA 5SZTA 1D8YA 5CY4A 1NK9A 1JLQA 3SZ2A 4CF1A 4CHPA 1EX4A 4QCLA 3KLEA 4Q0BA 3KLHA 3AVHA 3OYBA 3NHGA 4HCCA 1IKYA 2F8TA 1KVCA 1RBUA 3CM6A 3LAMA 3NBPA 3G10A 1SKSA 5C25A 2A1SA 3IG1A 5CZ2A 3PV8A 4BWJA 4OPJA 2Z1JA 3TAEA 3NAEA 3OVNA 2IAJA 4E7KA 3K5OA 1ZBFA 1W0HA 4B9UA 3L8BA 1T8EA 3K5NA 4FJJA 3DRSA 4LH4A 3NCIA 1VRTA 3K5MA 4B9SA 4HUGA 1BIUA 4CJEA 3L2UA 2XY7A 1ZYQA 3RRGA 4DSJA 4F3OA 2OPPA 3MXMA 2DFHA 5C42A 3AVMA 4OKEA 1KFDA 4CJQA 1ASUA 2KZZA 1RDDA 3ZCMA 1IKVA 3AV9A 4DFMA 3D45A 3AVFA 4CJVA 1KLMA 4O5BA 3LPTA 2Z1GA 3OY9A 5J2QA 5CZ1A 3OS2A 3OYNA 5FDLA 3KD1E 1BCOA 2G8KA 4HVJA 4CK2A 4OVLA 4UQGA 4DQPA 1RT4A 4W5RA 1X9SA 3O3GA 4CJTA 4N47A 2P51A 4CJLA 4CFDA 2HMIA 1WLJA 3MEEA 4QAGA 4AHSA 3RMCA 4FJIA 4PQUA 4PUOA 3KKRA 4Z0UA 2OA8A 3AA5X 4CEAA 3D0PA 4FCYA 4FLUA 4DWIA 2YNHA 4B8CA 4CGIA 4DTXA 3DRRA 4AILC 4FJKA 4J2DA 2RF2A 4XIUA 4HUFA 2HVIA 2D5RA 4LSLA 3OS1A 4CJPA 4FJMA 4JRPA 4CJKA 1XHXA 3LWMA 2QKKA 4Z4EA 3IRXA 2ZD1A 3HPHA 3TAFA 1A5VA 1VSFA 3C6TA 4B9NA 1FKPA 4CK1A 4Z4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IG9 A;  3IS9 A;  1SL0 A;  3SQ4 A;  3QO9 A;  3CG7 A;  3KLG A;  5I3U A;  4CJF A;  5HRO A;  4Z4I A;  4N5S A;  3DOL A;  1YVU A;  3OYD A;  4W5O A;  1C1B A;  3DM2 A;  4CJ4 A;  4FW2 A;  2PZS A;  1RT3 A;  1VSD A;  5J2M A;  1WSH A;  2OPS A;  2PYJ A;  2E6L A;  3NH0 A;  1NKE A;  1O1W A;  2I5J A;  4M3W A;  1TL1 A;  1N5Y A;  3ZT0 A;  1U4B A;  3NGI A;  3O3F A;  4RW6 A;  3LWL A;  1QSY A;  1U49 A;  4O44 A;  3DLH A;  2HW3 A;  2KQ2 A;  4OGE A;  3O4N A;  4JS4 A;  3JYT A;  3SUN A;  4J2E A;  2JGU A;  3LP3 A;  3TWH A;  3VQE A;  2D0B A;  4AHR A;  3TAB A;  1BQM A;  1RNH A;  4Y1D A;  1YTU A;  2X74 A;  3OYK A;  3TAN A;  5K14 A;  3TAQ A;  3NF6 A;  4CGJ A;  1LW2 A;  2YHA A;  4BDY A;  4E7I A;  2YNG A;  1TK8 A;  3P83 D;  3QIP A;  1CXU A;  3V1Q A;  2FC0 A;  4CF8 A;  3MED A;  4M3T A;  4CK3 A;  3V9Z A;  3KD5 E;  4CES A;  2X6S A;  1IKW A;  3QER A;  4C8K A;  4BDP A;  1NKB A;  1YTA A;  4NCA A;  3QEV A;  3O4Q A;  4Q5V A;  3OYA A;  2G8H A;  4CEC A;  1LAV A;  2Z1H A;  4FJ7 A;  1HNI A;  3HPG A;  1CZ9 A;  4KTZ A;  4KKO A;  5HBM A;  4LD0 A;  3ZSW A;  2ETJ A;  3AVK A;  2A1R A;  5KI6 A;  2XRI A;  3QIO A;  3TI0 A;  2B6A A;  4DF8 A;  1NJY A;  4B9T A;  5DMR A;  3ISN C;  4I7F A;  4DTJ A;  3MEG A;  1REV A;  1J53 A;  2HNY A;  3VQQ A;  1VSK A;  3OYC A;  4M3R A;  1D5A A;  4CF2 A;  1Z25 A;  1S6Q A;  4KFB A;  2BGG A;  2FBV A;  1RBV A;  4HHT A;  1HNV A;  3NGZ A;  4FJL A;  1XHZ A;  4FJ9 A;  4CEQ A;  2HHT A;  4AHU A;  2HHU A;  4DU3 A;  3S3M A;  5DK5 A;  4M3Z A;  4FLW A;  4DTO A;  3FFI A;  1VSE A;  3QEW A;  3KTQ A;  3AA3 A;  2GV9 A;  4CJ5 A;  3OYI A;  2WOM A;  2ITG A;  1SKW A;  2PY5 A;  2OZM A;  1HYS A;  4FLZ A;  1QQC A;  3DLG A;  1RTD A;  4IKF A;  1EKE A;  3LP2 A;  3F9K A;  4B8A B;  1RT5 A;  2P1J A;  3L2Q A;  3RRH A;  4F2R A;  1KFS A;  5FRM A;  4CEE A;  4CFA A;  3C95 A;  1D9D A;  3L3U A;  3U6F A;  3S9H A;  4BE2 A;  1NOY A;  5EU7 A;  1VSM A;  1X9M A;  2DFF A;  4MQ3 A;  4OJR A;  1U48 A;  4E89 A;  5D3G A;  1B9F A;  1CXQ A;  4E19 A;  1TAU A;  1EET A;  4EZ9 A;  4LH5 A;  1J54 A;  3DYA A;  4KAZ A;  4IFV A;  3V1O A;  3QES A;  2Q3S A;  2DFE A;  4BWM A;  4OPK A;  3VA3 A;  3K2P A;  4DQI A;  2BE2 A;  4KRF A;  3AVL A;  4ELT A;  1L3S A;  1RDC A;  4M3Y A;  4KHN A;  4TSX A;  3V1R A;  4CJ3 A;  4OLB A;  3LZI A;  1N6Q A;  1G15 A;  3ZSV A;  1L3T A;  1EXQ A;  5HRP A;  2VWJ A;  2HVH A;  1NOZ A;  3C94 A;  3K57 A;  3L2R A;  1NK0 A;  3DLR A;  4KHY A;  3QLH A;  4KB0 A;  1BQN A;  1BIS A;  4OGC A;  1KRP A;  1C0U A;  3AO3 A;  5HRS A;  4KI6 A;  5E41 A;  4FJ5 A;  3PO5 A;  3LAK A;  1RT6 A;  3OYF A;  3CFP A;  4OKK A;  3THV A;  2O4I A;  1BCM A;  3CYM A;  1JL2 A;  4FJN A;  1KSP A;  4GMJ B;  5J2P A;  2IGI A;  2ZQB A;  4ELV A;  1RBR A;  1CLQ A;  4M41 A;  3V9W A;  1Z26 A;  1HQE A;  3NDK A;  3B6P A;  1NK7 A;  1L3V A;  3PY8 A;  3HO1 A;  4F3T A;  2HHS A;  1JLA A;  3VQB A;  3HVT A;  5FRO A;  4CER A;  3VQ8 A;  4DSK A;  1C0T A;  3T1A A;  1WNS A;  1BI4 B;  1ZBL A;  1HRH A;  3SJJ A;  3T3F A;  1C6V A;  4K8X A;  4FW1 A;  3RR8 A;  4B9V A;  4O4G A;  2IS3 A;  1L5U A;  3V9S A;  2HHX A;  3AVJ A;  4O55 A;  3KLI A;  1TAQ A;  3AVG A;  1JLB A;  4C8L A;  3WNE A;  1TVR A;  3VN5 A;  4DU1 A;  3V4I A;  5I42 A;  1D9F A;  2FBT A;  2HHQ A;  2FBX A;  3LPU A;  1K6Y A;  1ZBU A;  4I2P A;  4BE0 A;  3NF8 A;  3KK2 A;  3TAG A;  4FLY A;  1LWF A;  4CJR A;  3OYH A;  1JLF A;  1NK4 A;  2EHG A;  3A2F A;  3TR8 A;  1QTM A;  1EP4 A;  1TKD A;  4FJX A;  3OYM A;  1GOA A;  4DTR A;  3OS0 A;  4RW4 A;  1BIZ A;  1JLG A;  1WSI A;  2RPI A;  2PYL A;  3VQA A;  3U3G A;  1RIL A;  3K5L A;  2IOC A;  4FJG A;  3QEP A;  1U04 A;  2EX3 A;  1RDA A;  4IG0 A;  4RW8 A;  5T7B A;  4DLG A;  1NJZ A;  1NK6 A;  3HXM A;  1UOC A;  1RTI A;  1L3U A;  4HUE A;  3ZT1 A;  1ASV A;  4DQS A;  4ID5 A;  4CJS A;  3I0S A;  1RTH A;  1TV6 A;  4AH9 A;  3U3Y A;  3SV4 A;  1TKZ A;  1LV5 A;  3AA4 A;  1RT2 A;  4Z4F A;  3HM9 A;  3LZJ A;  4EP4 A;  3RWU A;  4KB1 A;  4KHS A;  4PY5 A;  4FYD A;  2G8W A;  3UIQ A;  4CEO A;  4M3X A;  5HP1 A;  3HK2 A;  4ELU A;  3TAM A;  1KCF A;  4KI4 A;  4CEZ A;  1YT3 A;  4CIF A;  3WNF A;  4CE9 A;  1QSL A;  3RMA A;  3WNH A;  4FK0 A;  4H4M A;  3AO2 A;  3VA0 A;  3ZT3 A;  1S1T A;  1GOC A;  2JLE A;  3VQ7 A;  1KLN A;  3S3O A;  1WSF A;  2AJQ A;  1XWL A;  1JL1 A;  2G8V A;  3LDS A;  4PWD A;  4J2B A;  1QS4 A;  3HP6 A;  1JXE A;  3DOK A;  3NE6 A;  1BHL A;  3VQ9 A;  1XI1 A;  1GOB A;  3SPZ A;  4DFJ A;  1ZBI A;  1SL1 A;  4KHW A;  1FKO A;  3DI6 A;  4CGF A;  2GBZ A;  4JRQ A;  4O0I A;  3AVB A;  3DMJ A;  4AHV A;  1B92 A;  3ALY A;  2WON A;  3ZSQ A;  4NYF A;  1RBS A;  1S6P A;  4DLE A;  1I3A A;  1UA1 A;  4DS5 A;  1U47 A;  4I9Q A;  1VSJ A;  3ZSZ A;  3SQ0 A;  4B9L A;  1JLC A;  1B9D A;  3NH2 A;  3OYG A;  3SQ1 A;  4FK4 A;  4ICL A;  3NGY A;  4CIE A;  3DRP A;  1S1U A;  1IKX A;  3C6U A;  3G0Z A;  4FLV A;  3SNN A;  4I2Q A;  2KFZ A;  3QIN A;  4CEF A;  1UA0 A;  2BAN A;  4KV8 A;  2OYQ A;  2QKB A;  2RN2 A;  5JS1 A;  1ASW A;  5KTQ A;  3SYZ A;  1S1V A;  3V9X A;  3ZSR A;  2KZM A;  1S1W A;  3MAQ A;  3AVC A;  4DSI A;  4DMN A;  3BDP A;  2Z1I A;  4IG3 A;  3M8Q A;  4DSL A;  4ID1 A;  3OYJ A;  2R7Y A;  3HYF A;  4G1Q A;  2HNZ A;  4FVM A;  4DG1 A;  3JSM A;  3EY1 A;  2QK9 A;  1T05 A;  4ZTF A;  3EZ5 A;  2O4G A;  4NYN A;  4M45 A;  3AVI A;  4CHZ A;  1SKR A;  4N56 A;  2YNI A;  4YFU A;  1IO2 A;  1NJX A;  3DLE A;  4OKJ A;  3AVA A;  4KO0 A;  4KHU A;  1VSH A;  4NCB A;  3PUF A;  1FK9 A;  4CF9 A;  4KPY A;  3BGR A;  1HPZ A;  4ZTJ A;  5FRN A;  2X6N A;  2YNF A;  4DTS A;  3CFR A;  1SUQ A;  4IDK A;  4CHY A;  4LY7 A;  2P5O A;  4OLA A;  2HND A;  4DSE A;  1S9E A;  1WSJ A;  2YKM A;  4E1M A;  1WN7 A;  1MU2 A;  4RG8 A;  4CGH A;  3VQ6 A;  3VQ5 A;  4L8R B;  2G8I A;  3M8P A;  1WAJ A;  3SQ2 A;  3SUO A;  4HCB A;  3KK1 A;  4AHT A;  2YKN A;  4MFB A;  4AHC A;  2XY6 A;  4WE1 A;  1BI4 A;  4CED A;  2QXF A;  3ZSO A;  4CGD A;  3SV3 A;  3RR7 A;  3L2V A;  1S1X A;  4CIG A;  1JLE A;  4PA1 A;  2OPQ A;  4FLX A;  1A5W A;  4EZ6 A;  4B3O A;  3AO4 A;  1TL3 A;  1ITG A;  5KGX A;  4FM0 A;  1NKC A;  3OJU A;  3SI6 A;  4ZHR A;  5J2N A;  3LP1 A;  1U45 A;  3NFA A;  1C0M A;  5SWM A;  3HST B;  4FM2 A;  4CJU A;  2XO7 A;  4I9L A;  5KGW A;  1NJW A;  3V6D A;  4B9M A;  1TKX A;  4O0J A;  5CYM A;  4C8N A;  2NUB A;  3DLK A;  2IC3 A;  3LAN A;  1C1A A;  2D0C A;  4CEB A;  1LAW A;  4LSN A;  4RW9 A;  3V9U A;  2YHB A;  3ZT4 A;  2ZE2 A;  1KVB A;  4E1N A;  2G8U A;  4CHQ A;  1UAX A;  3CM5 A;  3L2W A;  3QNN A;  4DFK A;  3HJF A;  2D0A A;  4IBN A;  1RT7 A;  3OYL A;  4DTP A;  1Q9Y A;  4Y1C A;  2IDO A;  4BDZ A;  3HVR A;  3PX4 A;  2VG5 A;  3ITH A;  3SPY A;  4Z4C A;  4CJW A;  4N41 A;  4QOZ B;  4W5Q A;  4DQQ A;  1VSI A;  1CZB A;  1FXX A;  3AO1 A;  1J5O A;  4BE1 A;  4DTU A;  2Y1I A;  4W5N A;  3P1G A;  1C1C A;  3V81 A;  1TK0 A;  5HLF A;  1RDB A;  3VQP A;  5J1E A;  4KHQ A;  1R0A A;  4K8Z A;  1HQU A;  5JS2 A;  5KRT A;  3PX6 A;  4CHO A;  3KKS A;  3S3N A;  4FZX C;  4FZY A;  3K59 A;  4EP5 A;  4BAC A;  1HYZ A;  3RMB A;  1W9H A;  4CGG A;  4DS4 A;  1S9G A;  4E0D A;  4KTW A;  3AA2 A;  2VG6 A;  4FK2 A;  3T19 A;  4JLH A;  4DQR A;  4IFY A;  2VWK A;  4CFC A;  4F2S A;  2F8S A;  3TAP A;  5C24 A;  4W5T A;  2RKI A;  3KK3 A;  3QET A;  2VG7 A;  3PX0 A;  1HYV A;  3HP9 A;  1Q8I A;  1S5J A;  2KW4 A;  4DU4 A;  2E6M A;  4E7J A;  1SL2 A;  1BGX T;  3MXJ A;  3E01 A;  1VSL A;  1T03 A;  4E3S A;  4KRE A;  1WSE A;  3ZSX A;  4M42 A;  3ZT2 A;  3B6O A;  1KTQ A;  3NH1 A;  4H4O A;  2GUI A;  1XC9 A;  3IAY A;  1TKT A;  2KTQ A;  4C8M A;  4YNQ A;  4HTU A;  4FJH A;  3CFO A;  3OJS A;  1LWC A;  4NCG A;  3PO4 A;  3CQ8 A;  3OYE A;  1Y97 A;  3LP0 A;  2FBY A;  3KLF A;  2HHW A;  4F4K A;  1QHT A;  1DLO A;  1A5X A;  3QNO A;  4KTQ A;  4J2A A;  4FJ8 A;  2YV0 X;  4GW6 A;  1BL3 A;  1WSG A;  1TK5 A;  4CCH A;  2W42 A;  5HRR A;  3KIO A;  3TAR A;  3M8S A;  2KFN A;  4RW7 A;  3ZSY A;  2DY4 A;  1JKH A;  1RCH A;  3I8D A;  1RTJ A;  4CHN A;  4R5P A;  1JXB A;  2F96 A;  3HT3 A;  4FZZ A;  4Z4G A;  1DTQ A;  3K58 A;  4C8O A;  3F73 A;  3AO5 A;  4DF4 A;  3MXI A;  4N76 A;  5HRN A;  2X78 A;  3SUQ A;  3KJV A;  3WNG A;  4FLT A;  3I0R A;  2HB5 A;  1DTT A;  4GVM A;  1NK8 A;  3RMD A;  3HL8 A;  2B4J A;  2DTU A;  3HPO A;  2XY8 A;  3LAL A;  4H8K A;  3M8R A;  3VQC A;  1RBT A;  1ZBH A;  4DSF A;  3NF9 A;  3SCX A;  1QSS A;  1HMV A;  1UWB A;  1RT1 A;  1IH7 A;  2B5J A;  3ASM A;  3QEX A;  4CF0 A;  1VK0 A;  4JS5 A;  2BDP A;  3VQ4 A;  2HHV A;  2OZS A;  4FM1 A;  2XY5 A;  3DLB A;  1VRU A;  4FXD A;  1I39 A;  1J9A A;  1X1P A;  3P5J A;  1T7P A;  2ATQ A;  5CYQ A;  1WAF A;  3MEC A;  3SUP A;  3NF7 A;  2LSN A;  2Y1J A;  4E7L A;  3ULD A;  1TGO A;  4E7H A;  3AVN A;  1NK5 A;  3H08 A;  4CFB A;  2XHB A;  3VQD A;  2P5G A;  4DTN A;  1SV5 A;  2G8F A;  2OPR A;  4B08 A;  1KVA A;  4DTM A;  1X9W A;  1LWE A;  1Q9X A;  3RTV A;  1LW0 A;  4DFP A;  1QE1 A;  3L3V A;  3O3H A;  1F21 A;  2E4L A;  3EYZ A;  3QEI A;  4F8R A;  5KRS A;  1HJR A;  4M3U A;  5SZT A;  1D8Y A;  5CY4 A;  1NK9 A;  1JLQ A;  3SZ2 A;  4CF1 A;  4CHP A;  1EX4 A;  4QCL A;  3KLE A;  4Q0B A;  3KLH A;  3AVH A;  3OYB A;  3NHG A;  4HCC A;  1IKY A;  2F8T A;  1KVC A;  1RBU A;  3CM6 A;  3LAM A;  3NBP A;  3G10 A;  1SKS A;  5C25 A;  2A1S A;  3IG1 A;  5CZ2 A;  3PV8 A;  4BWJ A;  4OPJ A;  2Z1J A;  3TAE A;  3NAE A;  3OVN A;  2IAJ A;  4E7K A;  3K5O A;  1ZBF A;  1W0H A;  4B9U A;  3L8B A;  1T8E A;  3K5N A;  4FJJ A;  3DRS A;  4LH4 A;  3NCI A;  1VRT A;  3K5M A;  4B9S A;  4HUG A;  1BIU A;  4CJE A;  3L2U A;  2XY7 A;  1ZYQ A;  3RRG A;  4DSJ A;  4F3O A;  2OPP A;  3MXM A;  2DFH A;  5C42 A;  3AVM A;  4OKE A;  1KFD A;  4CJQ A;  1ASU A;  2KZZ A;  1RDD A;  3ZCM A;  1IKV A;  3AV9 A;  4DFM A;  3D45 A;  3AVF A;  4CJV A;  1KLM A;  4O5B A;  3LPT A;  2Z1G A;  3OY9 A;  5J2Q A;  5CZ1 A;  3OS2 A;  3OYN A;  5FDL A;  3KD1 E;  1BCO A;  2G8K A;  4HVJ A;  4CK2 A;  4OVL A;  4UQG A;  4DQP A;  1RT4 A;  4W5R A;  1X9S A;  3O3G A;  4CJT A;  4N47 A;  2P51 A;  4CJL A;  4CFD A;  2HMI A;  1WLJ A;  3MEE A;  4QAG A;  4AHS A;  3RMC A;  4FJI A;  4PQU A;  4PUO A;  3KKR A;  4Z0U A;  2OA8 A;  3AA5 X;  4CEA A;  3D0P A;  4FCY A;  4FLU A;  4DWI A;  2YNH A;  4B8C A;  4CGI A;  4DTX A;  3DRR A;  4AIL C;  4FJK A;  4J2D A;  2RF2 A;  4XIU A;  4HUF A;  2HVI A;  2D5R A;  4LSL A;  3OS1 A;  4CJP A;  4FJM A;  4JRP A;  4CJK A;  1XHX A;  3LWM A;  2QKK A;  4Z4E A;  3IRX A;  2ZD1 A;  3HPH A;  3TAF A;  1A5V A;  1VSF A;  3C6T A;  4B9N A;  1FKP A;  4CK1 A;  4Z4H A; 
#chains in the Genus database with same CATH topology
 1IG9 A;  3IS9 A;  4CBX A;  3CG7 A;  5I3U A;  3VEN A;  3EO3 A;  3QBW A;  4W5O A;  1C1B A;  1KQS M;  4FW2 A;  1RT3 A;  1NMD A;  2WUS A;  4K25 A;  2P9I A;  2VGN A;  3NH0 A;  1TL1 A;  3HZ6 A;  3U9D A;  3DLH A;  1DKG D;  4JS4 A;  3VES A;  3TWH A;  2D0B A;  3ENB A;  2IIR A;  3SBG A;  4LF5 K;  1YTU A;  3TAQ A;  3A5L C;  2YNG A;  1TK8 A;  3W3D A;  4M3T A;  3MED A;  2Q36 A;  4CZF A;  4MLE A;  5BRE A;  1NKB A;  4IFE A;  4NCA A;  4Q5V A;  1MWK A;  3CJ7 A;  2KLA A;  4BRN A;  4KTZ A;  4KKO A;  2IVO A;  3ZSW A;  3CC4 N;  3L4I A;  4KH4 A;  5KI6 A;  2XRI A;  3QIO A;  3L0Q A;  1REV A;  1J53 A;  3VQQ A;  5GAG P;  5KPR A;  4KFB A;  4XEI A;  4EHU A;  1EO1 A;  1HNV A;  1XHZ A;  3D2E A;  3CQX A;  3S3M A;  3UKU B;  1K73 O;  3J7Z O;  4CJ5 A;  2ITG A;  3D2E B;  1RTD A;  3DXK B;  4YOR A;  5GIO A;  1ILY A;  1RT5 A;  4JK8 A;  3U9Z A;  5ADX H;  3C65 A;  5FRM A;  4CFA A;  3L6Q A;  3VEY A;  4BVO A;  4FWP A;  3CMA N;  1NLV A;  5AZJ B;  1VSM A;  1X9M A;  1CXQ A;  1EET A;  4LF7 K;  4LH5 A;  1J54 A;  3DYA A;  4IFV A;  5C10 A;  1QHA A;  2DFE A;  5FLX O;  3A5N C;  1RDC A;  4KHN A;  4TSX A;  4CJ3 A;  4OLB A;  1G15 A;  2VCP A;  1EXQ A;  5HRP A;  2VWJ A;  4DV2 K;  2E88 A;  1ZBS A;  1X9J A;  3L2R A;  3OHR A;  2V52 B;  1YJW N;  1BQN A;  4OGC A;  1KRP A;  3ZLJ A;  1XNR K;  3WXM B;  4BGB A;  5FPM A;  2O4I A;  4YDU C;  1BCM A;  3FLC O;  4FVU A;  1OVQ A;  2HF3 A;  2Q0R A;  4CW7 B;  4R79 A;  1CLQ A;  5AQY A;  1L3V A;  3CCE N;  4F3T A;  5FRO A;  3FR0 A;  3VQ8 A;  3ZEU A;  5BPL A;  1BI4 B;  1R59 O;  1C6V A;  3OBY A;  4B9V A;  3D6R A;  4O4G A;  1L5U A;  4DV7 K;  2HHX A;  4O55 A;  3T69 A;  1TAQ A;  2KKZ A;  1JLB A;  3WNE A;  1TVR A;  5I42 A;  3H3O B;  2FBT A;  3QBX A;  3EEQ A;  5BRF A;  1VQ7 N;  4DR2 K;  3THX A;  3NF8 A;  4FLY A;  4BGA A;  3SAH A;  4CJR A;  4GV6 A;  5KPZ A;  1TKD A;  1M1K O;  3OYM A;  5AQT A;  4DTR A;  4RW4 A;  1JLG A;  3N4Q A;  1RIL A;  3EE8 A;  3MK6 A;  3QEP A;  1K9M O;  3RVC A;  1U04 A;  4DR1 K;  5T7B A;  3HXM A;  1MDU B;  4KBO A;  3C0B A;  3ZT1 A;  1S3X A;  1ASV A;  4DQS A;  4ID5 A;  4CJS A;  1L3U A;  2F4V K;  1TV6 A;  3U3Y A;  1RT2 A;  3HM9 A;  3LZJ A;  4KB1 A;  3O6W A;  3WEE A;  4DV6 K;  2G8W A;  4CEO A;  4M3X A;  2O8E B;  3DLL L;  5HP1 A;  4DUZ K;  4KI4 A;  3CER A;  4CIF A;  4MO4 A;  3WNF A;  3WNH A;  4H5R A;  1KLN A;  1X3N A;  4IEE A;  4CBW A;  2G8V A;  3LDS A;  1QS4 A;  3NE6 A;  1JCF A;  1XI1 A;  1SL1 A;  4KHW A;  1FKO A;  3VGM A;  2D1K A;  3VMF B;  3B8A X;  4JRQ A;  4B1W B;  3AVB A;  3ZSQ A;  3P4I A;  1RBS A;  1S6P A;  3LDO A;  1YF5 L;  1B9D A;  3NH2 A;  4FK4 A;  3NGY A;  4CIE A;  1S1U A;  1IKX A;  3THY A;  3SNN A;  4I2Q A;  3QIN A;  3EN9 A;  3CJB A;  2BAN A;  4KV8 A;  2OYQ A;  2VQE K;  1N32 K;  2UXC K;  3ZSR A;  1S1W A;  3MAQ A;  1VQ4 N;  4F9O A;  1CZA N;  4DSL A;  3M5R A;  4ID1 A;  3AAR A;  3EKS A;  2HNZ A;  4DG1 A;  3Q7C A;  3EY1 A;  4ZTF A;  4CHZ A;  1SKR A;  4N56 A;  3DLE A;  4OKJ A;  3AVA A;  4BR4 A;  1VSH A;  2A6A A;  3M6G A;  3BGR A;  1HPZ A;  4ZTJ A;  3G6E N;  1VQ5 N;  3PSF A;  4JK7 A;  1YUW A;  1S9E A;  2YKM A;  3OW2 M;  4DSE A;  2HBK A;  3P39 A;  4RG8 A;  4CGH A;  5AQK A;  4B9Q A;  3VQ6 A;  2G8I A;  3SUO A;  4A59 A;  2P9P A;  4AHT A;  2YKN A;  4AHC A;  4WE1 A;  3ZYY X;  3FZK A;  3RR7 A;  1T6C A;  4JI2 K;  1JLE A;  4FLX A;  4EZ6 A;  5H1S Q;  4B3O A;  1TL3 A;  2ZJQ L;  3SI6 A;  4ZHR A;  3NFA A;  1C0M A;  1Q86 O;  4OPH A;  1W2B M;  4B9M A;  5AZI B;  5M1O A;  5AQQ A;  1UAX A;  1QQO A;  2RHK A;  2IDO A;  4JKD A;  3SPY A;  1E4G T;  4CJW A;  4GV3 A;  3VGK A;  4YY3 K;  4DQQ A;  1S72 N;  5HL7 L;  4A5A A;  1NNE A;  1ESV A;  3WXJ A;  5JS2 A;  5KRT A;  1QZ6 A;  4LF9 K;  3ULE B;  4B3S K;  4CHO A;  3KKS A;  3S3N A;  4EP5 A;  4BAC A;  4MDA A;  1HYZ A;  4KH6 A;  3VPZ A;  4JLH A;  4CFC A;  1XUP O;  5C24 A;  2RKI A;  2P9L A;  4JKB A;  3VF4 A;  2QWO A;  4DR5 K;  3HP9 A;  3BY5 A;  3E01 A;  1HPM A;  4X64 K;  1YAG A;  4H4O A;  3WQU A;  4QS8 A;  1NGI A;  4C8M A;  4FJH A;  4EHT A;  3CFO A;  1HJO A;  4BC4 A;  3PO4 A;  3CQ8 A;  3OYE A;  3KLF A;  4F4K A;  4FJ8 A;  1A5X A;  4GW6 A;  3CC2 N;  4CCH A;  2UXB K;  3KIO A;  3ZX3 A;  4R5P A;  4CZJ A;  1OH7 A;  3K58 A;  4C8O A;  3F73 A;  2CGL A;  4LF4 K;  3NVK A;  1XQS C;  2QWP A;  5HRN A;  2X78 A;  3SUQ A;  4CD3 A;  3C7N B;  1HUX A;  3I0R A;  1DTT A;  3N4P A;  3RMD A;  2DTU A;  2XY8 A;  4YOU A;  4H8K A;  4H03 B;  1HMV A;  1UWB A;  4WQ5 A;  1IH7 A;  2BDP A;  4CF0 A;  4JS5 A;  5AQW A;  1VRU A;  3P5J A;  3MEC A;  1NGF A;  5JVG L;  4BR9 A;  4CFB A;  4J8F A;  1X9W A;  1LWE A;  4H5V A;  1ATS A;  1BA1 A;  3EYZ A;  3MWT A;  1HJR A;  5KRS A;  3HOT A;  4M3U A;  5CY4 A;  3SZ2 A;  1EX4 A;  2QWN A;  1KAX A;  3OYB A;  3GL1 A;  1IKY A;  1SKS A;  5CZ2 A;  3PV8 A;  4BWJ A;  3NAE A;  4JI1 K;  3K5O A;  4JAX A;  3H3N O;  3WXI A;  4B9U A;  1DGK N;  3J7A P;  3VF2 A;  3NVM A;  3NCI A;  4DR3 K;  5BRD A;  4B9S A;  4F3O A;  4CJE A;  5BPN A;  1ZYQ A;  2DFH A;  4FWS A;  4EIA A;  3AVM A;  3VEX A;  1IKV A;  3A5M C;  4DFM A;  4CJV A;  2ASM A;  1KLM A;  2Z1G A;  1NGH A;  5CZ1 A;  3OS2 A;  3BF3 A;  2P9U B;  4OVL A;  1RT4 A;  4H0V B;  1X9S A;  4CJT A;  3CPE A;  4JI6 K;  3D0P A;  4FCY A;  3HM8 A;  4DWI A;  4CGI A;  4DV4 K;  4IOA L;  3MN9 A;  3MN5 A;  2O8E A;  4CJK A;  2E5L K;  3TAF A;  4BE1 A;  4DTU A;  3OVN A;  2O8C B;  1SL0 A;  3MN7 A;  2NRR A;  3SQ4 A;  2FF3 B;  4N5S A;  3DOL A;  3CQY A;  3O9Q A;  4MLH A;  2PZS A;  1VSD A;  5J2M A;  1WSH A;  2OPS A;  2I5J A;  2P9S A;  3ATV A;  1U4B A;  4C1N K;  4O44 A;  3CJC A;  2HW3 A;  3SUN A;  5LMU K;  3CC7 N;  3LP3 A;  3TAB A;  1BQM A;  1RNH A;  4WCE L;  5K14 A;  1N33 K;  2I7P A;  3NF6 A;  4BDY A;  4E7I A;  2P9I B;  4UY8 O;  3V9Z A;  3KD5 E;  2X6S A;  4C8K A;  2ITM A;  1BO5 O;  3O4Q A;  2Q97 A;  3FGU A;  2G8H A;  4CEC A;  3LL3 A;  1LAV A;  3MX2 A;  3PLA A;  4B1X B;  4BRM A;  4FJ7 A;  1HKB A;  3HPG A;  1CZ9 A;  2NRT A;  4CZH A;  1NJY A;  4FPA A;  4B9T A;  4ISE A;  4I7F A;  3OYC A;  1VSK A;  4IWV A;  5AQO A;  4M3R A;  4CF2 A;  1Z25 A;  4DV1 K;  1ZC6 A;  2BGG A;  3F5T A;  4BR7 A;  3H46 O;  4JI5 K;  5DM6 L;  4CJ7 A;  3NGZ A;  4FJ9 A;  1U2V B;  2HHT A;  2HHU A;  1VQL N;  4C23 A;  1XMO K;  4DTO A;  3CCJ N;  3FFI A;  3A5O C;  3QEW A;  3CME N;  3EE9 A;  3THW A;  4FLZ A;  3WEE B;  4GKJ K;  1E4F T;  4JKG A;  1OH5 A;  1DT9 A;  3LP2 A;  2W41 A;  4B8A B;  3L2Q A;  4F2R A;  1KFS A;  2VYP A;  3C95 A;  5B8H A;  1D9D A;  3L3U A;  2AP1 A;  1P90 A;  4FWK A;  3H1V X;  2DFF A;  4MQ3 A;  1WOQ A;  1BUP A;  2JWK A;  1U48 A;  4E89 A;  3AGK A;  2ZJP L;  1K8K B;  4AF1 A;  2Q3S A;  3VEV A;  3K2P A;  2BE2 A;  4GV9 A;  4KRF A;  1L3S A;  4PHT X;  1BDG A;  3SK3 A;  4B1Y B;  1NOZ A;  3K57 A;  1NJI O;  1O13 A;  4JI4 K;  1NK0 A;  3DJC A;  3DLR A;  4WYB A;  4KHY A;  1BIS A;  1C0U A;  3AO3 A;  5E41 A;  4V19 S;  1QVF M;  3OYF A;  3THV A;  4OKK A;  4BG9 A;  4B3R K;  1JL2 A;  4JI7 K;  5J2P A;  4BQZ A;  2ZQB A;  4M41 A;  4LC9 B;  1Z26 A;  1Z6R A;  4CER A;  4DSK A;  4B3M K;  1KD1 O;  4IEI A;  3I56 N;  3BZK A;  4FW1 A;  2QTD A;  3O9U A;  4O8U A;  3AVJ A;  1QQM A;  4DU1 A;  1YXQ A;  4FOI A;  5GAE P;  3V4I A;  2HHQ A;  3U4L A;  3VTI A;  4I2P A;  1LWF A;  3TR8 A;  5AQV A;  3OS0 A;  1BIZ A;  1D4X A;  2P9K A;  2RPI A;  2WBN A;  2PYL A;  3CJ1 A;  1GLD G;  4BVP A;  2IOC A;  4GKK K;  1VQ8 N;  2EX3 A;  5F1X A;  2Q2R A;  3I0S A;  1RTH A;  4AH9 A;  1TKZ A;  1SAZ A;  4EP4 A;  3RWU A;  4KHS A;  5HOO A;  3UIQ A;  2A41 A;  4PKG A;  1WBD A;  3KHY A;  1M90 O;  3RMA A;  3AO2 A;  5AZJ A;  3VA0 A;  1GOC A;  1KXP A;  1WSF A;  1XWL A;  3GOI A;  4PWD A;  3MCA B;  4J2B A;  3VQ9 A;  3SPZ A;  4KHP K;  4CGF A;  3DMJ A;  1VAZ A;  1B92 A;  1IBM K;  3P31 A;  4XH4 A;  4DLE A;  2O8D A;  3CXC M;  4I9Q A;  1VSJ A;  3ENO A;  3ZSZ A;  1JLC A;  4I6M A;  2O8D B;  1UA0 A;  2E2O A;  5JS1 A;  4EFH A;  3V9X A;  1GLC G;  2UYT A;  3WT0 A;  3AVC A;  4DMN A;  4CZI A;  2Z1I A;  4X62 K;  3OYJ A;  1TYQ A;  1GLJ O;  4G1Q A;  2D0P A;  3JSM A;  4AM7 A;  1KC8 O;  5M1Q A;  2P9S B;  5AQS A;  3UKR A;  2ZJR L;  3EKU A;  4KHU A;  3LDL A;  4NCB A;  4BRF A;  5FRN A;  2YNF A;  4DTS A;  4CHY A;  4OLA A;  2HND A;  4E1M A;  1MU2 A;  5LJW A;  3SQ2 A;  4MFB A;  2XY6 A;  3K9K A;  1YJN N;  2QXF A;  1NGG A;  1S1X A;  4E1J A;  4FJI A;  3OJU A;  3LP1 A;  2YI1 A;  1EWQ A;  4BRK A;  4BRG A;  1TKX A;  3VEZ A;  3DLK A;  4CEB A;  4LSN A;  3V9U A;  1W7A A;  1J6Z A;  2YHB A;  2O8F A;  1KVB A;  4E1N A;  2G8U A;  4CHQ A;  3CM5 A;  3L2W A;  4DFK A;  2D0A A;  4IBN A;  1NBW A;  1RT7 A;  3O1B A;  3OYL A;  1Q9Y A;  4Y1C A;  3E66 A;  2VG5 A;  1IBL K;  4K41 A;  2QA4 N;  4QOZ B;  4LF6 K;  1VSI A;  1CZB A;  3AO1 A;  4FL9 A;  4O5F A;  3CF5 L;  5M1P A;  1J5O A;  1C1C A;  3V81 A;  4XH1 A;  3VQP A;  4BC3 A;  5J1E A;  5HLF A;  4CZK A;  3SJH A;  3FE1 A;  4LFA K;  5BR9 A;  3SAG A;  3RMB A;  4CGG A;  3TSQ A;  4FPB A;  2VG6 A;  4YDU A;  4DQR A;  4F2S A;  3JXU A;  5GAH P;  3QET A;  3OTO K;  5KPT A;  1Q8I A;  2KW4 A;  3BF1 A;  2HHH K;  2E6M A;  1SL2 A;  3MXJ A;  3SMS A;  1VSL A;  3I33 A;  4KRE A;  1WSE A;  2JWL A;  1TKT A;  1Q82 O;  3O9R A;  4HTU A;  3OJS A;  1LWC A;  2UUC K;  3G71 N;  4J2A A;  3VF6 A;  4IO8 A;  3QNO A;  5AQN A;  5EY4 A;  3DAW A;  1BL3 A;  2NRX A;  3TAR A;  4RWT A;  3R3L A;  2KFN A;  2W6K A;  3ZSY A;  1V4S A;  5M1N A;  2GEL A;  1RTJ A;  4CHN A;  4LFC K;  1FW6 A;  4FZZ A;  3HT3 A;  5JVH L;  4Z4G A;  3DXK A;  3U8X A;  4DF4 A;  4ISG A;  3BEX A;  1Q81 O;  3KJV A;  1NK8 A;  3ATU A;  3ZX0 A;  5E26 A;  3HPO A;  3LAL A;  4WQ4 A;  4DSF A;  3SCX A;  2GWJ A;  3IUC A;  1RT1 A;  2B5J A;  3KWG A;  3MWP A;  3SMP A;  5JLF A;  1X1P A;  1J9A A;  4QS9 A;  1WAF A;  2LSN A;  2Y1J A;  4E7H A;  1TGO A;  2QM1 A;  3TU5 A;  1NK5 A;  5AQU A;  3K9J A;  1SV5 A;  2NNW A;  4B1V A;  2OPR A;  4B08 A;  3RTV A;  4DFP A;  3L3V A;  1F21 A;  4A2A A;  4RCH A;  1D8Y A;  1NK9 A;  4JKA A;  4CF1 A;  2FSJ A;  3DXM B;  3NHG A;  3UKU A;  3CM6 A;  4DUY K;  3GBT A;  3IG1 A;  3TAE A;  1QQN A;  2QWM A;  4E7K A;  1OKJ A;  1KAY A;  1ATN A;  1T8E A;  4A62 A;  1VRT A;  3K5M A;  5EVZ A;  1JCE A;  3C6H A;  1ASU A;  3PSI A;  3AV9 A;  3D45 A;  3A0I X;  3AVF A;  2HBJ A;  4FWO A;  3LPT A;  5AJ3 K;  3OY9 A;  3F2K A;  5FDL A;  4UQG A;  4BG8 A;  4N47 A;  2P51 A;  4H0Y B;  3TTD A;  4CJL A;  1KAZ A;  4CD1 A;  4PQU A;  3HRG A;  4PUO A;  3KKR A;  2OA8 A;  2YNH A;  1ATR A;  3DRR A;  4AIL C;  1T3V A;  2RF2 A;  1YVN A;  3OA9 A;  4U7B A;  3LWM A;  5BPM A;  3THY B;  3IKM A;  2CGK A;  3RSE B;  4BY9 C;  3KLG A;  4CJF A;  3LM2 A;  5HRO A;  4Z4I A;  4DV3 K;  1YVU A;  3DM2 A;  4CJ4 A;  3RSE A;  1K8A O;  4BRA A;  3T1Y K;  2P9L B;  1RDU A;  1O1W A;  1N5Y A;  3ZT0 A;  4RW6 A;  4BR2 A;  1SZ2 A;  2KQ2 A;  4OGE A;  4J2E A;  3JYT A;  5LJV A;  4BRD A;  4Y1D A;  1SQK A;  2X74 A;  3MCP A;  3OYK A;  3TAN A;  4JN4 A;  2YHA A;  3THX B;  1VQM N;  3V1Q A;  2FC0 A;  3KK7 A;  4CES A;  3TTF A;  1VQN N;  3QER A;  3M1F A;  3R8E A;  3G25 A;  5AQI A;  5IWA K;  3MMV A;  4G9Z A;  1YIT N;  4QS7 A;  2P9N A;  3WXL A;  2UXD K;  2YCH A;  3OBW A;  5C15 A;  5AQR A;  1NM1 A;  4BC5 A;  4LD0 A;  2A1R A;  2ETJ A;  3AVK A;  2B6A A;  3ISN C;  4DTJ A;  3MEG A;  1BG3 A;  2E8A A;  2P9K B;  3S41 A;  2FBV A;  1RBV A;  4HHT A;  1W97 L;  1N8R O;  4CEQ A;  4AHU A;  4DU3 A;  5DK5 A;  4DCH A;  1XC3 A;  4M3Z A;  2ZGZ A;  1VSE A;  4BRC A;  2WOM A;  1Z05 A;  4YOT A;  1HNZ K;  2PY5 A;  2OZM A;  1HYS A;  4U67 L;  1QQC A;  3DLG A;  4IKF A;  3LDP A;  4M7X A;  3F9K A;  3RRH A;  3FZM A;  3S9H A;  4BE2 A;  1U2V A;  5EU7 A;  4JK9 A;  4OJR A;  1YIJ N;  5D3G A;  4E19 A;  3PIO L;  2E2Q A;  4EZ9 A;  3Q7B A;  3ULE A;  4KAZ A;  3FZF A;  3V1O A;  4BWM A;  4OPK A;  3VA3 A;  4IJA A;  4ELT A;  1XNQ K;  1XMQ K;  5LL6 Z;  1WUA A;  4M3Y A;  1MWM A;  3LZI A;  1N6Q A;  2BH1 A;  3ZSV A;  2HVH A;  3VEO A;  1WB9 A;  4YOY A;  2VWB A;  5BN8 A;  4A57 A;  4B1Z A;  5JIC A;  3SLC A;  4KB0 A;  4FJ5 A;  3PO5 A;  3LAK A;  1LOT B;  4DV0 K;  4FJN A;  1T6D A;  1NGA A;  4BR5 A;  1Q18 A;  1RBR A;  2FF6 A;  1NGC A;  3V9W A;  3HOS A;  3NDK A;  2HHS A;  5EX5 A;  5JLH A;  3VQB A;  3HVT A;  3O9S A;  1C0T A;  3T1A A;  1WNS A;  1ZBL A;  1HRH A;  5KQD A;  4K8X A;  5AFU H;  5EXW A;  3J81 O;  2IS3 A;  4IOC L;  3V9S A;  4M7Y A;  3KLI A;  4WQ5 C;  1EWR A;  4IO9 L;  4C8L A;  3VN5 A;  4DR6 K;  1D9F A;  2FBX A;  3LPU A;  1ZBU A;  4BE0 A;  3CJA A;  2HST A;  5AQG A;  3TAG A;  3OYH A;  4DB3 A;  1K8K A;  4NXN K;  1QTM A;  1EP4 A;  3CPW M;  3H1Q A;  1GOA A;  2V7Z A;  1WSI A;  2UUA K;  3VQA A;  3U3G A;  3HSC A;  3QDK A;  4PKH A;  4IG0 A;  1RDA A;  4RW8 A;  4DLG A;  4JKE A;  3ZET B;  1UOC A;  1H1V A;  2GEM A;  1NGB A;  1RGI A;  1LV5 A;  3SV4 A;  2OTJ N;  3AA4 A;  4PY5 A;  3FFK B;  3KZB A;  3PIP L;  4ELU A;  3TAM A;  4JHD B;  2E1Y A;  1QSL A;  1ZXO A;  4FK0 A;  1S1T A;  2Q0U A;  3VQ7 A;  3S3O A;  1J5E K;  1JL1 A;  3QFU A;  1JXE A;  3DOK A;  5AQZ A;  1GOB A;  1HLU A;  2YHW A;  3DI6 A;  5AQH A;  3HTV A;  4K43 A;  2GBZ A;  4C1N I;  2A40 A;  4O0I A;  4JKF A;  2WON A;  1I3A A;  2CH5 A;  4DS5 A;  1U47 A;  2D4W A;  4CZE A;  3MN6 A;  3SQ0 A;  4B9L A;  3OYG A;  4EAH D;  3DRP A;  3G0Z A;  4FLV A;  4H5T A;  2KFZ A;  2RN2 A;  5KTQ A;  4DV5 K;  3SYZ A;  1HNX K;  2KZM A;  2QW9 A;  4DSI A;  3BDP A;  5AQM A;  2R7Y A;  2QK9 A;  1IJJ A;  1T05 A;  3EZ5 A;  4NYN A;  4M45 A;  4YFU A;  1NJX A;  4KO0 A;  3PUF A;  2X6N A;  2NRW A;  4IDK A;  5M1F A;  4B1U B;  1RDW X;  4K42 A;  2QI2 A;  3MDQ A;  3VQ5 A;  4L8R B;  2FXU A;  1WAJ A;  3UB5 A;  3ID6 A;  1JCG A;  3GG4 A;  3CI5 A;  1BI4 A;  3F9M A;  1RFQ A;  3ZSO A;  3L2V A;  4CIG A;  3O9T A;  4FWN A;  1A5W A;  4FWM A;  4FM0 A;  1FJG K;  2E1Z A;  5J2N A;  1G99 A;  3FZH A;  3QFP A;  3HST B;  4B3T K;  3A8Y A;  4CJU A;  4I9L A;  5KGW A;  2XO7 A;  1NJW A;  4FSV A;  5CYM A;  2NUB A;  2IC3 A;  4JV5 K;  1C1A A;  3VET A;  1LAW A;  2GUP A;  3LDN A;  3ZT4 A;  2ZE2 A;  4H5N A;  3AY9 A;  3J7Y P;  3QNN A;  4DTP A;  3JAM O;  4BDZ A;  3HVR A;  3PX4 A;  3ITH A;  4L3Q A;  4Z4C A;  5AR0 A;  4N41 A;  1FXX A;  5EOY A;  2Y1I A;  2QWR A;  1TK0 A;  2ASO A;  5FPD A;  3H6E A;  1HQU A;  4FZX C;  4FZY A;  3QML A;  1I94 K;  3CJ9 A;  4BRP A;  1W9H A;  2P9N B;  5A2Q O;  4KTW A;  1QZ5 A;  3T19 A;  4FK2 A;  4IFY A;  2VWK A;  2F8S A;  4PL8 A;  4Y0W A;  3WUH A;  3C7N A;  1S5J A;  4DU4 A;  4E7J A;  5AQP A;  1GLE G;  4E3S A;  4X66 K;  4M42 A;  3ZT2 A;  3B6O A;  1KTQ A;  3GDQ A;  5AFU A;  1IV0 A;  4JKH A;  2KTQ A;  4YNQ A;  3CCQ N;  2F7T A;  1GLL O;  4NCG A;  3LDQ A;  4NB4 A;  4FO0 A;  5AQF A;  1Y97 A;  3LP0 A;  4JKC A;  4KTQ A;  1WSG A;  1TK5 A;  4CZM A;  2WC9 A;  4RW7 A;  1JKH A;  1RCH A;  3I8D A;  1IG8 A;  2F96 A;  3E9O A;  4LF8 K;  1DTQ A;  3MXI A;  2YHX A;  1TUY A;  2CH6 A;  1X3M A;  2QWL A;  1MA9 B;  2ZF5 O;  3P38 A;  3O8M A;  3ENH A;  4YHH K;  2Q1N A;  1RBT A;  1ZBH A;  1QSS A;  5I9E B;  3ASM A;  3QEX A;  1V4T A;  4MDB A;  2OZS A;  3FZL A;  4FM1 A;  2XY5 A;  4FXD A;  2UUB K;  4Z94 A;  2ATQ A;  5CYQ A;  4FOE A;  3SUP A;  3DXM A;  5GAD P;  4E7L A;  3ULD A;  3VQD A;  4DTN A;  4AQY K;  1Q9X A;  1LW0 A;  3K0S A;  2E4L A;  4FWQ A;  4CZG A;  3EZW A;  1WBB A;  2ZWH A;  4KH5 A;  4NLB A;  1JLQ A;  5TKW A;  4CHP A;  4HCC A;  1N36 K;  2F8T A;  1KVC A;  1RBU A;  3LAM A;  3NBP A;  3G10 A;  5C25 A;  2A1S A;  2BUP A;  4OPJ A;  2Z1J A;  1GLF O;  1W0H A;  1ZBF A;  3AAQ A;  3L8B A;  4BRO A;  4FJJ A;  3DRS A;  3CET A;  3L2U A;  4DSJ A;  2XY7 A;  1NMN A;  2OPP A;  3MXM A;  1KFD A;  1NGE A;  4CJQ A;  2OCE A;  4PL7 A;  2KZZ A;  1RDD A;  4BRE A;  2D0O A;  3TSP A;  4BRH A;  5J2Q A;  3OYN A;  1BCO A;  2G8K A;  4HVJ A;  4W5R A;  5GIN A;  2FSN A;  2OAN A;  3R9P A;  1WLJ A;  3MEE A;  4QAG A;  2FSK A;  3RMC A;  4Z0U A;  2P9U A;  3AA5 X;  4CEA A;  3CCU N;  3O4W A;  4CZL A;  4JD2 B;  4BR0 A;  4J2D A;  4XIU A;  4HUF A;  5ELZ A;  4LSL A;  3OS1 A;  1QVG M;  4RTF D;  5JMV A;  4JRP A;  5F2R A;  1XHX A;  2QKK A;  4Z4E A;  3HPH A;  2OTL N;  4AHV A;  1VSF A;  1FKP A;  4CK1 A;  4Z4H A;  2GWK A;  2WFB A;  3QO9 A;  2PFU A;  2V7Y A;  3E9P A;  3OYD A;  4DR7 K;  1BA0 A;  3T7Z A;  2Q31 A;  3BZC A;  4YOW A;  2PYJ A;  2E6L A;  1NKE A;  4M3W A;  3NGI A;  3O3F A;  3LWL A;  1QSY A;  1U49 A;  2FLO A;  3O4N A;  2JGU A;  3VQE A;  3E9L A;  4JHD A;  4AHR A;  3C6A A;  4CGJ A;  1NGD A;  1LW2 A;  2A3Z A;  4CBU A;  3P83 D;  3QIP A;  1CXU A;  4CF8 A;  4CK3 A;  4DR4 K;  5LMN K;  1IKW A;  4BDP A;  5MLC Q;  1YTA A;  3QEV A;  4BC2 A;  3OYA A;  2PBD A;  2WTU A;  2YHY A;  2Z1H A;  3TPQ A;  5FPN A;  4NXM K;  1HNI A;  5HBM A;  2I7N A;  4H0O A;  3TI0 A;  4DF8 A;  5DMR A;  3VER A;  4HTL A;  2HNY A;  4H5W A;  1D5A A;  1NGJ A;  1S6Q A;  3G4S N;  3KWI A;  2P9P B;  4FWR A;  4GNI A;  4FJL A;  3UE5 A;  3GE1 A;  3THW B;  4FLW A;  5DM7 L;  3AA3 A;  2GV9 A;  3KTQ A;  3OYI A;  4BQL A;  4FWL A;  1SKW A;  1Q7Y O;  1EKE A;  3CCS N;  4A2B A;  2P1J A;  4AM6 A;  5BR8 K;  4CEE A;  1LCU A;  2E2P A;  1HKG A;  1NWK A;  3U6F A;  1NOY A;  2YJE A;  4GY2 B;  5AQJ A;  1TAU A;  1B9F A;  3QES A;  4IDH A;  1BU6 O;  5M1K A;  3DWL A;  4DQI A;  3AVL A;  1HR0 K;  2VQF K;  1GLA G;  2IVP A;  3V1R A;  3ZET A;  1L3T A;  3C94 A;  1C0F A;  4JKG B;  1T44 A;  3QLH A;  4H0P A;  2HMP A;  5HRS A;  4KI6 A;  4IXC A;  3I55 N;  2GTD A;  1BOT O;  1RT6 A;  5GIP A;  3CFP A;  3CYM A;  3SBT A;  5C12 A;  4GMJ B;  1KSP A;  3KVG A;  2IGI A;  4ELV A;  4CVN E;  3IMX A;  1U6Z A;  4A5B A;  1HQE A;  2QXL A;  3B6P A;  1NK7 A;  3PY8 A;  3HO1 A;  1JLA A;  4NO7 A;  4ISF A;  3SJJ A;  3T3F A;  1VQ9 N;  1S22 A;  2A5X A;  3RR8 A;  4H0T B;  4WQ4 C;  1HKC A;  2O8B B;  3AVG A;  3AGR A;  4NLC A;  1K6Y A;  1OVY A;  3WQT A;  3TTC A;  3KK2 A;  3NMU A;  2O8F B;  1JLF A;  1NK4 A;  2EHG A;  5AQX A;  3A2F A;  4FJX A;  4WFN L;  2NLX A;  5CR4 A;  4DHY A;  5C0Y A;  1VQK N;  3VOV A;  3K5L A;  2ZM6 K;  4FJG A;  3IDH A;  3LM9 A;  1NJZ A;  1NK6 A;  1RTI A;  4HUE A;  3O1W A;  5CE3 A;  4BRQ A;  3H45 C;  4Z4F A;  4FYD A;  1DEJ A;  2HBL A;  2NRV A;  3HK2 A;  5TKY A;  5C2D A;  1KCF A;  3ID8 A;  4CEZ A;  2HBM A;  1YT3 A;  3EL2 A;  1C0G A;  4CE9 A;  3L4Q A;  2AA4 A;  5CHI A;  4H4M A;  3O80 A;  3VEW A;  1VHX A;  3ZT3 A;  2AJQ A;  2JLE A;  5KQ8 A;  3HP6 A;  3BP8 A;  1TUU A;  1BHL A;  1ZBI A;  2UU9 K;  2HOE A;  4DFJ A;  3CIP A;  1IBK K;  3ALY A;  3D7E O;  4YOV A;  5C2F A;  4NYF A;  4CI6 A;  1YJ9 N;  1UA1 A;  2GX9 A;  1N34 K;  3SQ1 A;  4ICL A;  3O08 A;  3C6U A;  4M63 C;  5F0X A;  2PAV A;  2O8C A;  4CEF A;  2QKB A;  1ASW A;  1S1V A;  2HF4 A;  2J4R A;  5IT9 O;  2YX6 A;  2QWQ A;  4IG3 A;  3M8Q A;  4JYA K;  4DKW A;  3HYF A;  4FVM A;  4WFA L;  4BRL A;  2O4G A;  1VQP N;  3AVI A;  2YNI A;  5BN9 A;  1IO2 A;  1TYQ B;  4CF9 A;  1FK9 A;  4KPY A;  2H3G X;  3CCV N;  2VGM A;  3CFR A;  1SUQ A;  4LY7 A;  3CCL N;  2P5O A;  1WSJ A;  1WN7 A;  3M8P A;  3R1X A;  4I6M B;  4HCB A;  3KK1 A;  2E2N A;  4ILJ A;  4CED A;  4CGD A;  3SV3 A;  4PA1 A;  3VGL A;  2OPQ A;  3R6M A;  3AO4 A;  1ITG A;  5KGX A;  1NKC A;  1U45 A;  1HNW K;  1BWF O;  5SWM A;  4FM2 A;  3V6D A;  4O0J A;  4C8N A;  3I8B A;  3LAN A;  2D0C A;  3CCR N;  4RW9 A;  3HJF A;  3ZX2 A;  2O8B A;  4GVE A;  4X65 K;  4W5Q A;  5AZI A;  4W5N A;  2NRZ A;  3P1G A;  4KHQ A;  1RDB A;  3ZEU B;  1R0A A;  4K8Z A;  3AAP A;  2BTF A;  3PX6 A;  4OX9 K;  2CGJ A;  3K59 A;  2W6L A;  4JNE A;  2RE2 A;  4DS4 A;  1S9G A;  4E0D A;  3AA2 A;  4OO1 J;  4PKI A;  3HBT A;  3TAP A;  4W5T A;  3KK3 A;  2VG7 A;  2IVN A;  3PX0 A;  1HYV A;  1BGX T;  1T03 A;  1YI2 N;  3BUZ B;  4LFB K;  3ZSX A;  4DQ8 A;  3NH1 A;  1XC9 A;  2GUI A;  4WF9 L;  3IAY A;  3UKR B;  1SS6 A;  1VQ6 N;  2F9W A;  3M3Z A;  2V51 B;  4JI0 K;  5BRH A;  2FBY A;  3D2F B;  4JD2 A;  1OH6 A;  2HHW A;  1QHT A;  1DLO A;  2QEX N;  4YOX A;  2DPN A;  4IZ9 A;  2YV0 X;  4JI3 K;  5ADX A;  2ZGY A;  5HRR A;  2W42 A;  3M8S A;  2DY4 A;  1JXB A;  3SAF A;  5E84 A;  4N76 A;  3AO5 A;  4BRI A;  1JJ2 M;  3E1Y A;  2E20 A;  3WNG A;  4FLT A;  1VQO N;  1EQY A;  2HB5 A;  4GVM A;  3HL8 A;  5FPE A;  1Y64 A;  2B4J A;  2W40 A;  2EWS A;  3M8R A;  3VQC A;  2NRH A;  3NF9 A;  3CD6 N;  2F9T A;  4MO5 A;  1OH8 A;  1VK0 A;  4WFB L;  3J80 O;  3VQ4 A;  2HHV A;  3DLB A;  1I39 A;  1T7P A;  3NF7 A;  3AVN A;  3H08 A;  1E3M A;  2XHB A;  2P5G A;  3IFR A;  2G8F A;  3JS6 A;  4IJN A;  1KVA A;  4DTM A;  1QE1 A;  3O3H A;  4O8K A;  3VTH A;  1HX1 A;  3QB0 A;  4IOX A;  3QEI A;  4JI8 K;  3CCM N;  4F8R A;  5SZT A;  4ILG B;  3T1H K;  3KLE A;  4Q0B A;  3KLH A;  4QCL A;  3AVH A;  2KHO A;  3MX5 A;  2ASP A;  2IAJ A;  3K5N A;  4XH5 A;  4LH4 A;  4H0X B;  4OPA A;  4HUG A;  1BIU A;  3RRG A;  3HI0 A;  4K0K K;  5C42 A;  4OKE A;  2YJF A;  3WXK A;  3ZCM A;  4JEP A;  4ILH A;  4O5B A;  3KD1 E;  3D2F A;  3W0L A;  4CK2 A;  4DQP A;  3O3G A;  5AQL A;  3CHW A;  3QIC A;  4CFD A;  1NU0 A;  1NG9 A;  2HMI A;  4AHS A;  3TSU A;  2A42 A;  1YHQ N;  1GLB G;  4FLU A;  4B8C A;  4DTX A;  1P8Z A;  4FJK A;  2NZT A;  2HVI A;  2D5R A;  4A61 A;  4CJP A;  4FJM A;  5LY3 A;  3J8A A;  3O5B A;  3IRX A;  2ZD1 A;  1A5V A;  3C6T A;  4B9N A;  4HWI A; 
#chains in the Genus database with same CATH homology
 1IG9 A;  3IS9 A;  1SL0 A;  3SQ4 A;  3QO9 A;  3CG7 A;  3KLG A;  5I3U A;  4CJF A;  5HRO A;  4Z4I A;  4N5S A;  3DOL A;  1YVU A;  3OYD A;  4W5O A;  1C1B A;  3DM2 A;  4CJ4 A;  4FW2 A;  2PZS A;  1RT3 A;  1VSD A;  5J2M A;  1WSH A;  2OPS A;  2PYJ A;  2E6L A;  3NH0 A;  1NKE A;  1O1W A;  2I5J A;  4M3W A;  1TL1 A;  1N5Y A;  3ZT0 A;  1U4B A;  3NGI A;  3O3F A;  4RW6 A;  3LWL A;  1QSY A;  1U49 A;  4O44 A;  3DLH A;  2HW3 A;  2KQ2 A;  4OGE A;  3O4N A;  4JS4 A;  3JYT A;  3SUN A;  4J2E A;  2JGU A;  3LP3 A;  3TWH A;  3VQE A;  2D0B A;  4AHR A;  3TAB A;  1BQM A;  1RNH A;  4Y1D A;  1YTU A;  2X74 A;  3OYK A;  3TAN A;  5K14 A;  3TAQ A;  3NF6 A;  4CGJ A;  1LW2 A;  2YHA A;  4BDY A;  4E7I A;  2YNG A;  1TK8 A;  3P83 D;  3QIP A;  1CXU A;  3V1Q A;  2FC0 A;  4CF8 A;  3MED A;  4M3T A;  4CK3 A;  3V9Z A;  3KD5 E;  4CES A;  2X6S A;  1IKW A;  3QER A;  4C8K A;  4BDP A;  1NKB A;  1YTA A;  4NCA A;  3QEV A;  3O4Q A;  4Q5V A;  3OYA A;  2G8H A;  4CEC A;  1LAV A;  2Z1H A;  4FJ7 A;  1HNI A;  3HPG A;  1CZ9 A;  4KTZ A;  4KKO A;  5HBM A;  4LD0 A;  3ZSW A;  2ETJ A;  3AVK A;  2A1R A;  5KI6 A;  2XRI A;  3QIO A;  3TI0 A;  2B6A A;  4DF8 A;  1NJY A;  4B9T A;  5DMR A;  3ISN C;  4I7F A;  4DTJ A;  3MEG A;  1REV A;  1J53 A;  2HNY A;  3VQQ A;  1VSK A;  3OYC A;  4M3R A;  1D5A A;  4CF2 A;  1Z25 A;  1S6Q A;  4KFB A;  2BGG A;  2FBV A;  1RBV A;  4HHT A;  1HNV A;  3NGZ A;  4FJL A;  1XHZ A;  4FJ9 A;  4CEQ A;  2HHT A;  4AHU A;  2HHU A;  4DU3 A;  3S3M A;  5DK5 A;  4M3Z A;  4FLW A;  4DTO A;  3FFI A;  1VSE A;  3QEW A;  3KTQ A;  3AA3 A;  2GV9 A;  4CJ5 A;  3OYI A;  2WOM A;  2ITG A;  1SKW A;  2PY5 A;  2OZM A;  1HYS A;  4FLZ A;  1QQC A;  3DLG A;  1RTD A;  4IKF A;  1EKE A;  3LP2 A;  3F9K A;  4B8A B;  1RT5 A;  2P1J A;  3L2Q A;  3RRH A;  4F2R A;  1KFS A;  5FRM A;  4CEE A;  4CFA A;  3C95 A;  1D9D A;  3L3U A;  3U6F A;  3S9H A;  4BE2 A;  1NOY A;  5EU7 A;  1VSM A;  1X9M A;  2DFF A;  4MQ3 A;  4OJR A;  1U48 A;  4E89 A;  5D3G A;  1B9F A;  1CXQ A;  4E19 A;  1TAU A;  1EET A;  4EZ9 A;  4LH5 A;  1J54 A;  3DYA A;  4KAZ A;  4IFV A;  3V1O A;  3QES A;  2Q3S A;  2DFE A;  4BWM A;  4OPK A;  3VA3 A;  3K2P A;  4DQI A;  2BE2 A;  4KRF A;  3AVL A;  4ELT A;  1L3S A;  1RDC A;  4M3Y A;  4KHN A;  4TSX A;  3V1R A;  4CJ3 A;  4OLB A;  3LZI A;  1N6Q A;  1G15 A;  3ZSV A;  1L3T A;  1EXQ A;  5HRP A;  2VWJ A;  2HVH A;  1NOZ A;  3C94 A;  3K57 A;  3L2R A;  1NK0 A;  3DLR A;  4KHY A;  3QLH A;  4KB0 A;  1BQN A;  1BIS A;  4OGC A;  1KRP A;  1C0U A;  3AO3 A;  5HRS A;  4KI6 A;  5E41 A;  4FJ5 A;  3PO5 A;  3LAK A;  1RT6 A;  3OYF A;  3CFP A;  4OKK A;  3THV A;  2O4I A;  1BCM A;  3CYM A;  1JL2 A;  4FJN A;  1KSP A;  4GMJ B;  5J2P A;  2IGI A;  2ZQB A;  4ELV A;  1RBR A;  1CLQ A;  4M41 A;  3V9W A;  1Z26 A;  1HQE A;  3NDK A;  3B6P A;  1NK7 A;  1L3V A;  3PY8 A;  3HO1 A;  4F3T A;  2HHS A;  1JLA A;  3VQB A;  3HVT A;  5FRO A;  4CER A;  3VQ8 A;  4DSK A;  1C0T A;  3T1A A;  1WNS A;  1BI4 B;  1ZBL A;  1HRH A;  3SJJ A;  3T3F A;  1C6V A;  4K8X A;  4FW1 A;  3RR8 A;  4B9V A;  4O4G A;  2IS3 A;  1L5U A;  3V9S A;  2HHX A;  3AVJ A;  4O55 A;  3KLI A;  1TAQ A;  3AVG A;  1JLB A;  4C8L A;  3WNE A;  1TVR A;  3VN5 A;  4DU1 A;  3V4I A;  5I42 A;  1D9F A;  2FBT A;  2HHQ A;  2FBX A;  3LPU A;  1K6Y A;  1ZBU A;  4I2P A;  4BE0 A;  3NF8 A;  3KK2 A;  3TAG A;  4FLY A;  1LWF A;  4CJR A;  3OYH A;  1JLF A;  1NK4 A;  2EHG A;  3A2F A;  3TR8 A;  1QTM A;  1EP4 A;  1TKD A;  4FJX A;  3OYM A;  1GOA A;  4DTR A;  3OS0 A;  4RW4 A;  1BIZ A;  1JLG A;  1WSI A;  2RPI A;  2PYL A;  3VQA A;  3U3G A;  1RIL A;  3K5L A;  2IOC A;  4FJG A;  3QEP A;  1U04 A;  2EX3 A;  1RDA A;  4IG0 A;  4RW8 A;  5T7B A;  4DLG A;  1NJZ A;  1NK6 A;  3HXM A;  1UOC A;  1RTI A;  1L3U A;  4HUE A;  3ZT1 A;  1ASV A;  4DQS A;  4ID5 A;  4CJS A;  3I0S A;  1RTH A;  1TV6 A;  4AH9 A;  3U3Y A;  3SV4 A;  1TKZ A;  1LV5 A;  3AA4 A;  1RT2 A;  4Z4F A;  3HM9 A;  3LZJ A;  4EP4 A;  3RWU A;  4KB1 A;  4KHS A;  4PY5 A;  4FYD A;  2G8W A;  3UIQ A;  4CEO A;  4M3X A;  5HP1 A;  3HK2 A;  4ELU A;  3TAM A;  1KCF A;  4KI4 A;  4CEZ A;  1YT3 A;  4CIF A;  3WNF A;  4CE9 A;  1QSL A;  3RMA A;  3WNH A;  4FK0 A;  4H4M A;  3AO2 A;  3VA0 A;  3ZT3 A;  1S1T A;  1GOC A;  2JLE A;  3VQ7 A;  1KLN A;  3S3O A;  1WSF A;  2AJQ A;  1XWL A;  1JL1 A;  2G8V A;  3LDS A;  4PWD A;  4J2B A;  1QS4 A;  3HP6 A;  1JXE A;  3DOK A;  3NE6 A;  1BHL A;  3VQ9 A;  1XI1 A;  1GOB A;  3SPZ A;  4DFJ A;  1ZBI A;  1SL1 A;  4KHW A;  1FKO A;  3DI6 A;  4CGF A;  2GBZ A;  4JRQ A;  4O0I A;  3AVB A;  3DMJ A;  4AHV A;  1B92 A;  3ALY A;  2WON A;  3ZSQ A;  4NYF A;  1RBS A;  1S6P A;  4DLE A;  1I3A A;  1UA1 A;  4DS5 A;  1U47 A;  4I9Q A;  1VSJ A;  3ZSZ A;  3SQ0 A;  4B9L A;  1JLC A;  1B9D A;  3NH2 A;  3OYG A;  3SQ1 A;  4FK4 A;  4ICL A;  3NGY A;  4CIE A;  3DRP A;  1S1U A;  1IKX A;  3C6U A;  3G0Z A;  4FLV A;  3SNN A;  4I2Q A;  2KFZ A;  3QIN A;  4CEF A;  1UA0 A;  2BAN A;  4KV8 A;  2OYQ A;  2QKB A;  2RN2 A;  5JS1 A;  1ASW A;  5KTQ A;  3SYZ A;  1S1V A;  3V9X A;  3ZSR A;  2KZM A;  1S1W A;  3MAQ A;  3AVC A;  4DSI A;  4DMN A;  3BDP A;  2Z1I A;  4IG3 A;  3M8Q A;  4DSL A;  4ID1 A;  3OYJ A;  2R7Y A;  3HYF A;  4G1Q A;  2HNZ A;  4FVM A;  4DG1 A;  3JSM A;  3EY1 A;  2QK9 A;  1T05 A;  4ZTF A;  3EZ5 A;  2O4G A;  4NYN A;  4M45 A;  3AVI A;  4CHZ A;  1SKR A;  4N56 A;  2YNI A;  4YFU A;  1IO2 A;  1NJX A;  3DLE A;  4OKJ A;  3AVA A;  4KO0 A;  4KHU A;  1VSH A;  4NCB A;  3PUF A;  1FK9 A;  4CF9 A;  4KPY A;  3BGR A;  1HPZ A;  4ZTJ A;  5FRN A;  2X6N A;  2YNF A;  4DTS A;  3CFR A;  1SUQ A;  4IDK A;  4CHY A;  4LY7 A;  2P5O A;  4OLA A;  2HND A;  4DSE A;  1S9E A;  1WSJ A;  2YKM A;  4E1M A;  1WN7 A;  1MU2 A;  4RG8 A;  4CGH A;  3VQ6 A;  3VQ5 A;  4L8R B;  2G8I A;  3M8P A;  1WAJ A;  3SQ2 A;  3SUO A;  4HCB A;  3KK1 A;  4AHT A;  2YKN A;  4MFB A;  4AHC A;  2XY6 A;  4WE1 A;  1BI4 A;  4CED A;  2QXF A;  3ZSO A;  4CGD A;  3SV3 A;  3RR7 A;  3L2V A;  1S1X A;  4CIG A;  1JLE A;  4PA1 A;  2OPQ A;  4FLX A;  1A5W A;  4EZ6 A;  4B3O A;  3AO4 A;  1TL3 A;  1ITG A;  5KGX A;  4FM0 A;  1NKC A;  3OJU A;  3SI6 A;  4ZHR A;  5J2N A;  3LP1 A;  1U45 A;  3NFA A;  1C0M A;  5SWM A;  3HST B;  4FM2 A;  4CJU A;  2XO7 A;  4I9L A;  5KGW A;  1NJW A;  3V6D A;  4B9M A;  1TKX A;  4O0J A;  5CYM A;  4C8N A;  2NUB A;  3DLK A;  2IC3 A;  3LAN A;  1C1A A;  2D0C A;  4CEB A;  1LAW A;  4LSN A;  4RW9 A;  3V9U A;  2YHB A;  3ZT4 A;  2ZE2 A;  1KVB A;  4E1N A;  2G8U A;  4CHQ A;  1UAX A;  3CM5 A;  3L2W A;  3QNN A;  4DFK A;  3HJF A;  2D0A A;  4IBN A;  1RT7 A;  3OYL A;  4DTP A;  1Q9Y A;  4Y1C A;  2IDO A;  4BDZ A;  3HVR A;  3PX4 A;  2VG5 A;  3ITH A;  3SPY A;  4Z4C A;  4CJW A;  4N41 A;  4QOZ B;  4W5Q A;  4DQQ A;  1VSI A;  1CZB A;  1FXX A;  3AO1 A;  1J5O A;  4BE1 A;  4DTU A;  2Y1I A;  4W5N A;  3P1G A;  1C1C A;  3V81 A;  1TK0 A;  5HLF A;  1RDB A;  3VQP A;  5J1E A;  4KHQ A;  1R0A A;  4K8Z A;  1HQU A;  5JS2 A;  5KRT A;  3PX6 A;  4CHO A;  3KKS A;  3S3N A;  4FZX C;  4FZY A;  3K59 A;  4EP5 A;  4BAC A;  1HYZ A;  3RMB A;  1W9H A;  4CGG A;  4DS4 A;  1S9G A;  4E0D A;  4KTW A;  3AA2 A;  2VG6 A;  4FK2 A;  3T19 A;  4JLH A;  4DQR A;  4IFY A;  2VWK A;  4CFC A;  4F2S A;  2F8S A;  3TAP A;  5C24 A;  4W5T A;  2RKI A;  3KK3 A;  3QET A;  2VG7 A;  3PX0 A;  1HYV A;  3HP9 A;  1Q8I A;  1S5J A;  2KW4 A;  4DU4 A;  2E6M A;  4E7J A;  1SL2 A;  1BGX T;  3MXJ A;  3E01 A;  1VSL A;  1T03 A;  4E3S A;  4KRE A;  1WSE A;  3ZSX A;  4M42 A;  3ZT2 A;  3B6O A;  1KTQ A;  3NH1 A;  4H4O A;  2GUI A;  1XC9 A;  3IAY A;  1TKT A;  2KTQ A;  4C8M A;  4YNQ A;  4HTU A;  4FJH A;  3CFO A;  3OJS A;  1LWC A;  4NCG A;  3PO4 A;  3CQ8 A;  3OYE A;  1Y97 A;  3LP0 A;  2FBY A;  3KLF A;  2HHW A;  4F4K A;  1QHT A;  1DLO A;  1A5X A;  3QNO A;  4KTQ A;  4J2A A;  4FJ8 A;  2YV0 X;  4GW6 A;  1BL3 A;  1WSG A;  1TK5 A;  4CCH A;  2W42 A;  5HRR A;  3KIO A;  3TAR A;  3M8S A;  2KFN A;  4RW7 A;  3ZSY A;  2DY4 A;  1JKH A;  1RCH A;  3I8D A;  1RTJ A;  4CHN A;  4R5P A;  1JXB A;  2F96 A;  3HT3 A;  4FZZ A;  4Z4G A;  1DTQ A;  3K58 A;  4C8O A;  3F73 A;  3AO5 A;  4DF4 A;  3MXI A;  4N76 A;  5HRN A;  2X78 A;  3SUQ A;  3KJV A;  3WNG A;  4FLT A;  3I0R A;  2HB5 A;  1DTT A;  4GVM A;  1NK8 A;  3RMD A;  3HL8 A;  2B4J A;  2DTU A;  3HPO A;  2XY8 A;  3LAL A;  4H8K A;  3M8R A;  3VQC A;  1RBT A;  1ZBH A;  4DSF A;  3NF9 A;  3SCX A;  1QSS A;  1HMV A;  1UWB A;  1RT1 A;  1IH7 A;  2B5J A;  3ASM A;  3QEX A;  4CF0 A;  1VK0 A;  4JS5 A;  2BDP A;  3VQ4 A;  2HHV A;  2OZS A;  4FM1 A;  2XY5 A;  3DLB A;  1VRU A;  4FXD A;  1I39 A;  1J9A A;  1X1P A;  3P5J A;  1T7P A;  2ATQ A;  5CYQ A;  1WAF A;  3MEC A;  3SUP A;  3NF7 A;  2LSN A;  2Y1J A;  4E7L A;  3ULD A;  1TGO A;  4E7H A;  3AVN A;  1NK5 A;  3H08 A;  4CFB A;  2XHB A;  3VQD A;  2P5G A;  4DTN A;  1SV5 A;  2G8F A;  2OPR A;  4B08 A;  1KVA A;  4DTM A;  1X9W A;  1LWE A;  1Q9X A;  3RTV A;  1LW0 A;  4DFP A;  1QE1 A;  3L3V A;  3O3H A;  1F21 A;  2E4L A;  3EYZ A;  3QEI A;  4F8R A;  5KRS A;  1HJR A;  4M3U A;  5SZT A;  1D8Y A;  5CY4 A;  1NK9 A;  1JLQ A;  3SZ2 A;  4CF1 A;  4CHP A;  1EX4 A;  4QCL A;  3KLE A;  4Q0B A;  3KLH A;  3AVH A;  3OYB A;  3NHG A;  4HCC A;  1IKY A;  2F8T A;  1KVC A;  1RBU A;  3CM6 A;  3LAM A;  3NBP A;  3G10 A;  1SKS A;  5C25 A;  2A1S A;  3IG1 A;  5CZ2 A;  3PV8 A;  4BWJ A;  4OPJ A;  2Z1J A;  3TAE A;  3NAE A;  3OVN A;  2IAJ A;  4E7K A;  3K5O A;  1ZBF A;  1W0H A;  4B9U A;  3L8B A;  1T8E A;  3K5N A;  4FJJ A;  3DRS A;  4LH4 A;  3NCI A;  1VRT A;  3K5M A;  4B9S A;  4HUG A;  1BIU A;  4CJE A;  3L2U A;  2XY7 A;  1ZYQ A;  3RRG A;  4DSJ A;  4F3O A;  2OPP A;  3MXM A;  2DFH A;  5C42 A;  3AVM A;  4OKE A;  1KFD A;  4CJQ A;  1ASU A;  2KZZ A;  1RDD A;  3ZCM A;  1IKV A;  3AV9 A;  4DFM A;  3D45 A;  3AVF A;  4CJV A;  1KLM A;  4O5B A;  3LPT A;  2Z1G A;  3OY9 A;  5J2Q A;  5CZ1 A;  3OS2 A;  3OYN A;  5FDL A;  3KD1 E;  1BCO A;  2G8K A;  4HVJ A;  4CK2 A;  4OVL A;  4UQG A;  4DQP A;  1RT4 A;  4W5R A;  1X9S A;  3O3G A;  4CJT A;  4N47 A;  2P51 A;  4CJL A;  4CFD A;  2HMI A;  1WLJ A;  3MEE A;  4QAG A;  4AHS A;  3RMC A;  4FJI A;  4PQU A;  4PUO A;  3KKR A;  4Z0U A;  2OA8 A;  3AA5 X;  4CEA A;  3D0P A;  4FCY A;  4FLU A;  4DWI A;  2YNH A;  4B8C A;  4CGI A;  4DTX A;  3DRR A;  4AIL C;  4FJK A;  4J2D A;  2RF2 A;  4XIU A;  4HUF A;  2HVI A;  2D5R A;  4LSL A;  3OS1 A;  4CJP A;  4FJM A;  4JRP A;  4CJK A;  1XHX A;  3LWM A;  2QKK A;  4Z4E A;  3IRX A;  2ZD1 A;  3HPH A;  3TAF A;  1A5V A;  1VSF A;  3C6T A;  4B9N A;  1FKP A;  4CK1 A;  4Z4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...