4CJFA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 53
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjfA00
3D45A 4N47A 2GV9A 3L3UA 3U6FA 1NK7A 4PA1A 3HYFA 5HP1A 1VRUA 4BE1A 1BCMA 2KW4A 3NDKA 4I2PA 4OJRA 2P5GA 4WE1A 1FXXA 1XC9A 4DFJA 3NF8A 3CM5A 3QEXA 4F8RA 4KTWA 2LSNA 3OYJA 4E7IA 1F21A 3OJSA 1QSSA 1BHLA 4DLGA 1T03A 4KHQA 2QXFA 4ICLA 3ZT3A 3DRSA 3O3FA 4B9LA 4FJ8A 4J2DA 1HRHA 1U04A 4MQ3A 1RDCA 2OYQA 1JXBA 3ITHA 1DTTA 4KHUA 2X6SA 4DSFA 3L2RA 4CJSA 3ZT4A 4RW7A 1FKPA 1J53A 3ZT2A 3MXIA 3KLGA 2BDPA 4FLZA 1ZBUA 2JLEA 5SZTA 4JS4A 1HMVA 1QSYA 5KGXA 3OYDA 3V9SA 3M8RA 2E6LA 1CZ9A 2HVHA 2RF2A 4AHUA 4IDKA 1WNSA 3U3GA 4M45A 5HRNA 3L2VA 1R0AA 3ZT0A 4DS5A 4DSJA 1RT4A 3I0SA 3RMBA 5J1EA 4RW4A 1D9FA 4KHWA 2G8IA 3CFRA 3BDPA 3NH1A 4CJQA 3K5NA 3O4QA 1VK0A 3QESA 5HLFA 2Z1JA 4G1QA 3SUPA 5EU7A 4FLYA 3OYCA 2Y1JA 1JLFA 1EXQA 4CHYA 4CEEA 3L2QA 4KI4A 3TAFA 2X78A 1BQMA 1RBTA 3PX4A 3VQDA 3HPOA 1L3TA 4RW6A 2BANA 1XHXA 3WNEA 3TAMA 4KO0A 3C94A 3OYMA 5C24A 3TI0A 2NUBA 2VWJA 4DG1A 3DYAA 2YHAA 1IG9A 3THVA 4CJRA 4F3OA 3QIOA 1WSGA 4FM0A 4KHYA 3CFPA 1TAUA 1S9GA 1RILA 4CJPA 4BACA 1N5YA 3RR8A 4DSLA 4OLBA 1EX4A 2YNGA 2IS3A 4CEAA 4HHTA 1KVBA 4TSXA 4CFCA 3OYKA 5J2PA 1HQEA 3K5OA 4DTJA 3ZSYA 3KTQA 1LW0A 1VSMA 2KFZA 3CFOA 1HQUA 3IS9A 2F96A 4FW2A 4FVMA 1VSHA 3WNGA 3ZCMA 3OYGA 3RTVA 5D3GA 3NGZA 4CF0A 1EKEA 3FFIA 2GBZA 3AVJA 4Z4HA 4F4KA 2OPPA 1LAVA 4KPYA 4C8KA 2Y1IA 3G10A 3NGIA 4E3SA 1SL2A 1J54A 3PO5A 3SPYA 2KTQA 3VQCA 1RBVA 1B9FA 2HHXA 3RWUA 1SKSA 4OKKA 3SQ1A 3KD5E 3OYAA 3HL8A 4CHOA 3OYLA 2HB5A 3TAQA 5FDLA 4ZTFA 4Z4IA 3RR7A 4DF4A 3HJFA 1QHTA 1WLJA 4PWDA 1D9DA 3OYEA 2PZSA 4B9NA 1JLAA 3AVCA 1X9MA 2E4LA 3V9UA 3JYTA 4CEZA 2RKIA 4IFYA 3NCIA 2VG5A 4DFPA 1IKXA 1UA0A 4ELTA 3KLIA 3AVKA 1NKEA 1YT3A 1ZYQA 4M3WA 1RBRA 5FROA 3NF6A 3VQ9A 3TR8A 4CF8A 1SKRA 3KIOA 1L3UA 1IKYA 4E7JA 1QTMA 2G8FA 3PV8A 3V9XA 4O5BA 3S3MA 3SZ2A 1Z26A 2OA8A 3VQAA 2E6MA 3HP6A 4B9SA 4J2EA 1ASVA 2HHWA 1NKBA 2Z1HA 3JSMA 4DF8A 3NFAA 4DQRA 3LPUA 2ZD1A 3TWHA 1CZBA 3HVRA 3HO1A 5CY4A 1NJYA 4E7HA 4DTPA 5FRNA 4DU4A 3G0ZA 4YFUA 4KAZA 4M3XA 4FJGA 2HNZA 1BIUA 1TKXA 3AVGA 3WNHA 4DTNA 4OLAA 3S3OA 1YTAA 4QAGA 3V81A 1TK5A 1VSLA 4CGDA 4FJXA 3AVBA 4FLTA 4DU3A 1NK8A 1KFSA 4FJ5A 3M8PA 2HNDA 5HRRA 1UAXA 2VWKA 4FJMA 4AH9A 3ZSOA 5HRSA 5HBMA 4B9VA 4E7KA 1KSPA 3AVHA 3QO9A 4KTZA 1VRTA 4DSKA 4K8ZA 1S6PA 2BGGA 2DTUA 1VSFA 5CYMA 4RW8A 4ELVA 3MECA 4PY5A 4AHCA 3D0PA 1WAJA 3AO5A 2F8TA 3DM2A 1D5AA 1NJZA 1UWBA 1NOZA 4NCAA 1SUQA 4CEFA 1C0MA 3LAKA 3EY1A 3CM6A 2VG6A 4AHVA 3DLEA 1L3VA 4C8LA 4DU1A 1WSJA 3RMDA 4CJWA 2A1SA 4CESA 4N41A 1EP4A 1ASWA 2O4GA 4AHRA 3DLRA 5FRMA 4HUFA 4FYDA 1W0HA 5C25A 1HYVA 4FLUA 4B3OA 4GW6A 4AILC 4GVMA 2XY6A 4B9TA 5DMRA 3K5LA 3SV4A 1HNIA 3ZSVA 4HUEA 3UIQA 3OYFA 1QSLA 2OZSA 3V1RA 3CYMA 4LH4A 3V1OA 4BE2A 4AHSA 4FK0A 3SQ2A 1YVUA 4CK3A 3NF7A 4C8MA 1TKDA 4CHQA 2IOCA 2OPSA 4EZ6A 1RTHA 4B8CA 4GMJB 4CGFA 4FCYA 1RT3A 4EP5A 3P1GA 3SQ4A 1NJXA 1K6YA 4F2SA 3TAGA 3TARA 3MXMA 3DLBA 2QKBA 1GOCA 2B4JA 1T7PA 2OPQA 1IKVA 3IG1A 4FM2A 5J2QA 1S5JA 4DFMA 4CGGA 4CEOA 3F73A 5J2MA 3SUNA 4FJ9A 1ZBHA 2X74A 3HT3A 3T19A 1TAQA 2KFNA 4FLWA 1RDAA 4RW9A 4FXDA 1JL1A 3HPGA 1VSDA 2R7YA 5KTQA 3KLHA 1W9HA 3DRPA 1B92A 2ZE2A 1C1CA 3E01A 3SI6A 2HMIA 1REVA 4O55A 2G8WA 4FJIA 3AVLA 1RNHA 3ULDA 1YTUA 4BDYA 3DRRA 4HTUA 4Z4GA 4B8AB 1KRPA 1WAFA 3QNNA 4FLVA 3U3YA 4FZYA 1RT2A 1S1UA 1A5VA 5C42A 4CIGA 3NHGA 2VG7A 2Q3SA 2YNFA 4DTUA 4Q0BA 1XHZA 3LP0A 4I9QA 2XY5A 1WSHA 1UOCA 1C1BA 1DLOA 1RT6A 3ZSRA 4CERA 2YNIA 1JLGA 1U49A 1C1AA 3S9HA 1RT7A 1RDDA 3RMAA 2I5JA 2PYLA 4IG0A 1TKTA 4CFDA 4KB0A 1NK9A 1KLMA 3ZSWA 3KLEA 4DQSA 1U45A 4CK2A 3HXMA 1T05A 1JL2A 3K2PA 4IBNA 4UQGA 3LZJA 1BIZA 3OYIA 4C8OA 3SPZA 2G8UA 4FZXC 3OVNA 3AO2A 4HCCA 1FK9A 1RBSA 2EHGA 1ZBFA 1ZBIA 4PUOA 1G15A 3MXJA 2YHBA 3HSTB 3SUOA 1A5WA 1KTQA 4N5SA 3LALA 4Y1DA 1I39A 2YKMA 5KRSA 4QOZB 1VSEA 3VQBA 1ZBLA 3LWLA 1BL3A 3SYZA 1EETA 4ID1A 3DLGA 3SJJA 4FZZA 1CLQA 1C6VA 4J2AA 1X9WA 2IDOA 1SKWA 1TKZA 3S3NA 4O44A 4DFKA 2DFFA 3BGRA 4CJLA 5T7BA 3IRXA 3V6DA 3AA2A 3MEGA 1BGXT 1BI4B 4AHTA 4DMNA 5E41A 1SL1A 1FKOA 3ISNC 2FBTA 1NOYA 3VA0A 1VSJA 1S6QA 3OY9A 1HYZA 4K8XA 1U4BA 1NK0A 2Z1GA 1JLEA 5HRPA 4E7LA 4M3RA 3A2FA 1A5XA 4E1NA 4DLEA 4W5TA 3T1AA 1BQNA 3NAEA 1JLCA 2XRIA 3KK2A 3K58A 1KCFA 3AA3A 5KGWA 4CJ3A 4CGIA 2P51A 3AVFA 4Q5VA 5HROA 5I42A 5KRTA 3NF9A 4LSLA 5CZ2A 4QCLA 4FW1A 4M42A 3AVAA 4FJLA 3OS2A 1GOBA 4CCHA 2X6NA 4JS5A 2HHVA 1U47A 1HYSA 4OKJA 3O4NA 4W5RA 2O4IA 4CJFA 3K59A 1NKCA 4FJKA 2B6AA 3KK3A 3LDSA 4DQQA 1J9AA 1SV5A 2W42A 1N6QA 3IAYA 4FJNA 2AJQA 4KKOA 4JRQA 3KKSA 4ZTJA 2D5RA 4OKEA 1JLQA 1S1WA 2IAJA 3F9KA 4M3ZA 2ETJA 4HUGA 3MEDA 3RMCA 1BCOA 1ASUA 1TK8A 2G8KA 4C8NA 2XY7A 4OPJA 4CF9A 3ASMA 3QEVA 2P5OA 1JKHA 1QS4A 2ITGA 4DTRA 4DSEA 1D8YA 2FBXA 3KKRA 1JLBA 3AA5X 2GUIA 1Z25A 3AVIA 4M3YA 4W5NA 4HVJA 1JXEA 4FJ7A 1HNVA 3B6PA 3O3GA 3PX0A 2YKNA 3OS1A 4F2RA 3NGYA 3DOLA 1LAWA 4BDPA 4KREA 3SUQA 3AA4A 1QQCA 2Z1IA 3PUFA 5DK5A 4B9UA 4N76A 4PQUA 2XY8A 1TGOA 4LH5A 4JLHA 5CYQA 3KD1E 2ZQBA 3I8DA 4BDZA 1LW2A 1B9DA 3LAMA 4J2BA 4I2QA 2YNHA 1X1PA 4CF1A 4E89A 4DWIA 2F8SA 1RTDA 3ZSXA 3PX6A 2QKKA 3LP1A 3NH0A 4CFBA 4NYFA 4LD0A 4W5QA 3RRHA 3AV9A 4CFAA 3VQ4A 1VSIA 3HVTA 1TK0A 1SL0A 4F3TA 3QEPA 4OPKA 1XWLA 4M41A 1L5UA 4KV8A 3QNOA 4CEBA 3KJVA 2KZZA 1NK4A 1RCHA 2RN2A 4L8RB 1BI4A 4DTMA 3SCXA 4E0DA 3DMJA 3VQQA 4JRPA 3M8QA 1CXQA 4CIFA 1KVAA 1O1WA 3HM9A 4BWJA 3NE6A 4DTOA 4LY7A 3OYHA 1BISA 3O3HA 3HP9A 3OYNA 4H8KA 2D0CA 3SV3A 3AO3A 3VQ5A 3MAQA 3K5MA 4E19A 2DFHA 3VQ8A 5CZ1A 3SNNA 1UA1A 3HPHA 1KVCA 4CJ5A 4BE0A 4FLXA 1I3AA 3VQPA 3QETA 2DFEA 1RDBA 5SWMA 4O4GA 4KB1A 1LWEA 3VQ6A 1L3SA 2PYJA 2HW3A 3P5JA 4IKFA 4OVLA 5K14A 5KI6A 3LANA 1GOAA 2ATQA 4CJEA 4Z4CA 3KK1A 3EYZA 1MU2A 3LWMA 4ZHRA 3QEIA 4EZ9A 2PY5A 3ZSZA 3NH2A 3V9ZA 1ITGA 1U48A 3CQ8A 3P83D 3RRGA 1RT1A 2B5JA 2HHTA 1TVRA 3I0RA 4E1MA 1TV6A 2EX3A 3C95A 1CXUA 3ALYA 3SQ0A 4ID5A 3DLKA 3DLHA 4OGCA 3CG7A 4DS4A 4RG8A 1S9EA 4KRFA 3M8SA 2P1JA 4KHNA 2A1RA 4OGEA 1HJRA 4M3UA 3WNFA 1RT5A 1J5OA 2OZMA 1IO2A 3OS0A 4Y1CA 1LWCA 4CECA 5J2NA 1S1VA 3H08A 3LP2A 1S1TA 4CJTA 3AO1A 3ZT1A 2HHSA 5JS2A 4NCBA 3VQ7A 2FBVA 4MFBA 1Q9XA 4KHSA 2HVIA 4M3TA 2JGUA 1Q9YA 4CHPA 3QEWA 3ZSQA 2WONA 4NYNA 3C6UA 4IFVA 4LSNA 4KI6A 4DSIA 4CHNA 4DQPA 4KTQA 3T3FA 3TAPA 2D0AA 4W5OA 2QK9A 3QLHA 3QIPA 4O0JA 2FC0A 1WSEA 3C6TA 2G8HA 3AO4A 1IH7A 2DY4A 4FK2A 2WOMA 4CGJA 4B9MA 4FJJA 4HCBA 3B6OA 3L8BA 1NK5A 4Z4FA 2HHUA 4B08A 4H4MA 3VN5A 2HNYA 2YV0X 4CJKA 4XIUA 2FBYA 3QINA 4KFBA 4BWMA 3VA3A 3EZ5A 4DTXA 4O0IA 4CJ4A 4CK1A 2KQ2A 3L2UA 3NBPA 1HPZA 2XO7A 3HK2A 1DTQA 2IC3A 4N56A 3PO4A 1VSKA 4CIEA 4CEQA 1S1XA 2RPIA 1T8EA 5JS1A 1IKWA 1NJWA 3AVNA 1NK6A 1XI1A 3V1QA 1WSIA 2KZMA 1RTJA 1WSFA 4NCGA 4R5PA 3K57A 3V9WA 4CF2A 1C0TA 4IG3A 1QE1A 3QERA 3TAEA 2OPRA 4CE9A 4FJHA 4CHZA 4DTSA 1RTIA 4CGHA 3OJUA 1KFDA 4EP4A 4H4OA 3DOKA 3LP3A 2XHBA 4FK4A 3DI6A 3KLFA 1TL1A 1Q8IA 3TANA 4Z4EA 5I3UA 2HHQA 3V4IA 1KLNA 4ELUA 3LPTA 1TL3A 1X9SA 2BE2A 1WN7A 3L3VA 3LZIA 4CEDA 3MEEA 4CJUA 4I7FA 3L2WA 4DQIA 4I9LA 3TABA 1LWFA 1C0UA 2D0BA 4Z0UA 2IGIA 2G8VA 4CJVA 4YNQA 3PY8A 3AVMA 1Y97A 4FM1A 3VQEA 3OYBA 1LV5A 1RBUA
chains in the Genus database with same CATH superfamily
4N47A 4CZFA 1NK7A 4EHTA 3NDKA 2GELA 3LDOA 5DM6L 4WE1A 3A5NC 1C0FA 1OH6A 3OJSA 2QXFA 4ICLA 3DRSA 1HRHA 4DV3K 1T44A 1P90A 4KHUA 2X6SA 1S22A 3MXIA 2BDPA 4FLZA 1ZBUA 2P9UA 1D4XA 1YHQN 1HMVA 3OYDA 2UUCK 1WNSA 1VQLN 4M45A 4FWNA 4MDAA 4DS5A 1RT4A 1EO1A 4RW4A 4CJQA 5CE3A 4JNEA 3O4QA 3QESA 2VWBA 4G1QA 3HOSA 4YOTA 4FLYA 3BZCA 3L2QA 3HPOA 3VTIA 1HPMA 3KVGA 3OYMA 3IFRA 4JI1K 3VF6A 2PFUA 4B1ZA 4QS8A 4CJRA 1RILA 4BACA 4OLBA 2IS3A 4YHHK 3P31A 4TSXA 5AZJB 1BOTO 4CZKA 3H3NO 2D0PA 3F5TA 4DTJA 2QWMA 2OANA 1HQUA 4FVMA 4H0TB 1VSHA 3WNGA 1KAZA 1OH8A 1QQNA 1EKEA 4KPYA 2A42A 4F4KA 1N33K 1HUXA 3G10A 4E3SA 4JD2A 3PO5A 2KTQA 5EX5A 4DV5K 1BA0A 3SQ1A 4CHOA 3TAQA 2YJEA 4DF4A 1QHTA 2P9LA 2PZSA 4B9NA 1JLAA 3ID6A 1ZBSA 3SMSA 4IFYA 3SAGA 2VG5A 4IOXA 4JKEA 4DFPA 4CJ7A 3KLIA 3LDPA 3OBWA 3T1HK 5AQPA 5FROA 1XNRK 4CF8A 1L3UA 2G8FA 3V9XA 4O5BA 1Z26A 4B9QA 2E6MA 3BP8A 2Z1HA 5BN8A 3NFAA 4DQRA 3LPUA 3TWHA 5CY4A 5E84A 5FRNA 4DU4A 4LF5K 3UKRA 3C6HA 3WNHA 1NWKA 4BGAA 3S3OA 4BQZA 4QAGA 3V81A 1TK5A 1VSLA 2YHXA 4DU3A 1NK8A 3H45C 3SBGA 3AVHA 4BRCA 4DV2K 5CYMA 2YHWA 4QS9A 2QA4N 1NJZA 2YHYA 4C1NI 1SUQA 3LAKA 1U2VB 3RMDA 1IG8A 1ASWA 4AHRA 3O9SA 4HUFA 4FYDA 1W0HA 3DWLA 5JVGL 4AILC 4GVMA 4B9TA 4LF7K 4B3MK 5LMUK 3OYFA 2HF4A 3CYMA 4FK0A 1ESVA 2RHKA 3NF7A 4FWPA 3DJCA 4CHQA 4CZEA 3ZX0A 4ILJA 4GMJB 1Q86O 4EP5A 2ASOA 1K6YA 2P9KA 2Q0UA 3TAGA 3MXMA 4F2SA 1GOCA 4H5TA 4J8FA 4DFMA 1YJWN 3SUNA 4C23A 2X74A 5AQSA 5M1OA 1HKBA 1VSDA 3HPGA 3ZETB 5KTQA 4MO5A 2ZE2A 1NNEA 1C1CA 3SI6A 1K8KA 4O8UA 4FJIA 3AVLA 1RNHA 3ULDA 4BDYA 4FLVA 3U3YA 5KPTA 4FZYA 3MX5A 3O8MA 4CIGA 3VGMA 4NXMK 4I9QA 5AQRA 2XY5A 1UOCA 4H0OA 5MLCQ 5EXWA 1C1AA 3S9HA 3KHYA 1J5EK 2PYLA 4IG0A 2A40A 2KKZA 4DQSA 3BUZB 1U45A 3K2PA 5KQDA 2D4WA 3FR0A 4FZXC 1FK9A 1ZBFA 1G15A 4B3SK 1A5WA 1YI2N 1KTQA 3GBTA 3CCQN 3LDLA 3ZLJA 4QOZB 1KAYA 3VQBA 2V7ZA 4ID1A 4BG9A 3DLGA 4DUYK 1CLQA 2IDOA 1SKWA 3MEGA 4AHTA 1HNWK 1OKJA 4NLCA 1VSJA 3CERA 3O9RA 4OO1J 1U4BA 4M3RA 3A2FA 3DXMB 4FWMA 4LF8K 4C1NK 2XRIA 4Q5VA 5KGWA 2P51A 3AVFA 4L3QA 1SZ2A 3NF9A 5KRTA 4QCLA 3WEEA 3D2FA 3H1VX 2Q36A 3K9JA 4KKOA 4BRGA 2PAVA 4GY2B 4BC4A 1ASUA 1EWQA 1YIJN 4OPJA 3ASMA 1JKHA 2ITGA 2WTUA 3KKRA 3AA5X 2GUIA 4M3YA 4CZHA 3NMUA 3B6PA 2YKNA 3OS1A 2VQFK 3P4IA 5M1PA 1LAWA 4BDPA 3TSUA 4KREA 2O8FA 5DK5A 4B9UA 4N76A 3O9QA 4MO4A 1JCEA 5BPLA 1LW2A 4I2QA 4E89A 4DWIA 3ZSXA 3NH0A 4NYFA 4DV1K 3U4LA 1NU0A 3CMEN 3QEPA 4BR7A 3MN9A 1L5UA 4NO7A 5BRFA 4R79A 2E1ZA 2KZZA 1NK4A 4PKGA 4L8RB 3SCXA 4E0DA 1CXQA 1BISA 5FPNA 3HP9A 2NRTA 3QFPA 5KPRA 4H8KA 2AA4A 4YOUA 5CZ1A 3VQ8A 3QETA 1I3AA 3TPQA 2BTFA 4BRNA 4KB1A 1LWEA 3TSQA 2UU9K 3VQ6A 1L3SA 3D7EO 3LANA 2BUPA 4WFAL 4EZ9A 5JLFA 1VQKN 1RFQA 1U48A 4LF6K 4WFBL 3P83D 3T69A 2HHTA 3I0RA 2QI2A 1TV6A 1K8AO 4IDHA 3DLKA 3DLHA 4H0XB 3CG7A 4DS4A 1SAZA 4IJAA 1S9EA 4YOWA 4KRFA 2P1JA 4OGEA 5GAGP 4M3UA 1IO2A 1NGIA 3OS0A 4Y1CA 1LWCA 3LM2A 1IBLK 4Y0WA 3EE8A 3H08A 3LP2A 1S1TA 2HHSA 3ZT1A 1P8ZA 4NCBA 2FF6A 1NLVA 3THYA 3J7ZO 4M3TA 2JGUA 2Q97A 3ENHA 4BREA 2WONA 3VF4A 3EKSA 3FZMA 4PL8A 2FSJA 3T3FA 2D0AA 4W5OA 4EIAA 1NGCA 5ADXH 3C6TA 4JI5K 3E1YA 3HM8A 2HMPA 1ILYA 1U2VA 5HOOA 2P9PB 2UXCK 3WT0A 2WOMA 4FJJA 4Z4FA 3B6OA 1NK5A 2HHUA 2IVPA 3N4PA 5M1KA 2YV0X 4KFBA 4BWMA 3EZ5A 2P9IB 1MWMA 1HLUA 1WBBA 1DTQA 2IVOA 5F0XA 3VERA 1NGHA 3RSEB 1S1XA 3MX2A 4MLEA 4YOXA 2HOEA 1IKWA 1NJWA 1NK6A 2KZMA 1C0TA 5AQYA 4FJHA 1RTIA 1Q82O 4H4OA 3DI6A 3KLFA 3S41A 1KLNA 3LPTA 3MK6A 2P9PA 1X9SA 5FPMA 4K25A 3L2WA 3WQTA 4Z0UA 4YNQA 3AVMA 4FM1A 4CZLA 1HNZK 1LV5A 4KHQA 3U6FA 1VAZA 4PA1A 3C6AA 5HP1A 4OJRA 4CZGA 1FXXA 1XC9A 4DFJA 4F8RA 3OYJA 3CD6N 2ITMA 1BHLA 2HBJA 3SK3A 5AR0A 3ZT3A 2QXLA 4AF1A 3O3FA 1RDCA 1JXBA 3ITHA 3UKUA 2A3ZA 2O8DA 4DSFA 2IIRA 4RW7A 1J53A 3ATUA 3ZT2A 2QWRA 3CJBA 1KC8O 3M8RA 2HVHA 4FPBA 4AHUA 4A2AA 1NGFA 5HRNA 3ZT0A 4DSJA 3WXIA 3H3OB 4BROA 3CCUN 4O8KA 3CFRA 3BDPA 3T7ZA 2A6AA 4WCEL 2Z1JA 1XC3A 2WFBA 1ZXOA 3QDKA 4FPAA 2Y1JA 4CHYA 5M1QA 4OX9K 3TAFA 1BQMA 4LF4K 1RBTA 1L3TA 4FVUA 5FPEA 3LDNA 3TAMA 4KO0A 3C94A 1GLFO 1VQON 4IOCL 4DG1A 3DYAA 1IG9A 1XQSC 4KHYA 4FM0A 3DXMA 1VQMN 2UUBK 4CEAA 1N34K 1KVBA 3VEZA 3OYKA 3MCPA 3K5OA 3KTQA 1YJ9N 2GWJA 2KFZA 3CFOA 3ZCMA 3IS9A 3OYGA 1HJOA 4ISEA 5D3GA 3A5MC 3QB0A 1LAVA 3EL2A 4CBUA 3NGIA 5M1NA 3CCEN 1B9FA 2HHXA 4OKKA 1T3VA 3OYAA 2W40A 3FZFA 3A5LC 2IVNA 1FJGK 3PIOL 3RR7A 5AZIB 3OYEA 4JHDA 4CI6A 3V9UA 3NCIA 1IKXA 4ELTA 3U9DA 1NKEA 3LL3A 1OVQA 3KIOA 1IKYA 2OA8A 3SZ2A 3E66A 2HHWA 3HP6A 1ASVA 4YOVA 3JSMA 2FSKA 3WQUA 4XH1A 4A2BA 4YFUA 4KAZA 3CC7N 4FJGA 1BIUA 1TKXA 4OLAA 2A41A 5EY4A 5IT9O 3VEYA 4CGDA 4FJ5A 1KFSA 3M8PA 4AH9A 5HRSA 3HZ6A 2DPNA 5AQKA 2ZWHA 4M7XA 4K8ZA 1VRTA 3L6QA 1VSFA 4ELVA 4RW8A 1N8RO 3MECA 3O1BA 5BR8K 3D0PA 3AO5A 3DM2A 3FFKB 1UWBA 3D2FB 4CEFA 3EY1A 3CM6A 4AHVA 1L3VA 4C8LA 4DU1A 1TYQB 4CJWA 1EP4A 4BRKA 3DLRA 4DR7K 3IMXA 4DUZK 1HYVA 4Z94A 4FLUA 1VQ9N 3SV4A 5BREA 2P9LB 4B1WB 3V1RA 4BE2A 4AHSA 3SQ2A 4FL9A 3O9TA 1TKDA 2YI1A 3THWA 2IOCA 2OPSA 4AM7A 4EZ6A 4I6MA 1RTHA 4B8CA 3DLBA 3TARA 3G25A 1T7PA 2OPQA 1IKVA 3IG1A 3MN5A 3VTHA 4H5NA 4CGGA 5J2MA 3T19A 3O9UA 4FLWA 4RW9A 1ATSA 3D6RA 4DR1K 2HMIA 1REVA 3R9PA 5C2FA 3RVCA 4B8AB 2W41A 1WAFA 3VGKA 1A5VA 3J81O 4DTUA 2Q3SA 2YNFA 4DR2K 1HNXK 2ASMA 4FWKA 1DLOA 4CERA 1BG3A 1JLGA 1RT7A 1RDDA 3RMAA 4JKCA 4PKHA 1NK9A 3KLEA 4V19S 4H5WA 3HXMA 1T05A 3AAPA 1BIZA 3OYIA 2G8UA 4A59A 3OVNA 2YJFA 4O5FA 4PUOA 2JWKA 2YHBA 3HSTB 3SUOA 4Y1DA 3M3ZA 2YKMA 5KRSA 1BL3A 3SYZA 1DT9A 1LCUA 4FZZA 1OVYA 1C6VA 4JI4K 4DFKA 3BGRA 4CJLA 5T7BA 3IRXA 5TKWA 3V6DA 4BRMA 1BGXT 3ZEUB 5E41A 5GAHP 1RDUA 3ISNC 2UXDK 3OY9A 2HHHK 1HYZA 3L0QA 4M7YA 5LL6Z 4E7LA 4BR2A 2UXBK 4DB3A 4W5TA 3NAEA 1JLCA 4BC3A 4EAHD 1NGBA 3AA3A 4JKFA 4CGIA 5I42A 1W2BM 4LSLA 2HBLA 3CJ9A 3OS2A 1GOBA 3HBTA 1YITN 2X6NA 4JS5A 4CCHA 1HYSA 4CJFA 3RSEA 1EWRA 2B6AA 2AJQA 2W42A 1CZAN 5ADXA 3KKSA 4JI8K 2D5RA 3C0BA 1JLQA 4AM6A 4HUGA 3MCAB 5AQXA 4XH5A 2VYPA 4K42A 2P5OA 1QS4A 1D8YA 2GX9A 1JLBA 2QTDA 3U9ZA 3AVIA 1Z05A 3O3GA 3NGYA 3DOLA 4RCHA 1W7AA 1WUAA 3SUQA 1QQCA 2Z1IA 3PUFA 4ILGB 2Q0RA 1TGOA 4U7BA 4JLHA 2Q2RA 2ZQBA 3CIPA 3LP1A 4CFBA 3HTVA 3RRHA 4CFAA 3VQ4A 4GV3A 1VSIA 1TK0A 1SL0A 3PLAA 1BDGA 5LMNK 5CHIA 3VQQA 4JRPA 1O1WA 4B3TK 4BWJA 1YJNN 3KK7A 1QVFM 3VEVA 3OYNA 2D0CA 3SNNA 3K5MA 1BWFO 3CI5A 3HPHA 4CJ5A 4O4GA 5ELZA 2QEXN 3P5JA 1M1KO 4CJEA 1GOAA 3PX6A 4Z4CA 3LWMA 4ZHRA 3NH2A 1ITGA 1K73O 1RT1A 4ILHA 1GLDG 3C95A 4ID5A 4YDUC 1QQOA 3JAMO 4RG8A 2GTDA 1VQPN 2NZTA 5BPNA 1HJRA 3WNFA 1RT5A 4CECA 5J2NA 4ISFA 4YY3K 1X9JA 2FBVA 4MFBA 1Q9YA 4CHPA 3AAQA 3ZSQA 4NYNA 3C6UA 4LSNA 5AQJA 4CHNA 4YORA 2QK9A 2NRVA 2FC0A 1IBMK 1TUUA 4DR4K 1BA1A 2F9TA 2OTJN 1IH7A 2P9SB 4DR6K 2DY4A 4FK2A 4CGJA 3IKMA 4HCBA 4BRFA 3IUCA 4B08A 2HNYA 4CJKA 1Q18A 3D2EB 3VA3A 4AQYK 1VQ6N 4O0IA 2KQ2A 2IC3A 4CIEA 3VEXA 1BUPA 2RPIA 3CCLN 5JS1A 3E9PA 1WSIA 4FWLA 5AQVA 3K57A 4JKGA 4IG3A 4G9ZA 1QE1A 4DTSA 3OJUA 4RTFD 1KFDA 4EP4A 5B8HA 3DOKA 2F7TA 3WXKA 4DHYA 1TL1A 2P9UB 2HHQA 3V4IA 3ZETA 2H3GX 1TL3A 4Z4GA 1WN7A 3EO3A 2G8VA 1C0UA 2QWQA 4BGBA 3OYBA 3QBXA 1CXUA 1XMOK 3D45A 2P9NB 1Q81O 2GV9A 3L3UA 4WQ4C 1T6CA 2KW4A 5I9EB 3B8AX 4I2PA 2P5GA 4IEIA 3NF8A 3CC4N 4KTWA 2LSNA 2V52B 1QVGM 1QSSA 4DLGA 1T03A 1Q7YO 4WQ5C 4JN4A 4B9LA 4FJ8A 4UY8O 1U04A 4MQ3A 3CHWA 3R8EA 5LJWA 3ZT4A 3CPWM 1FKPA 3PIPL 3J7YP 4DCHA 2JLEA 5SZTA 4JS4A 4GKKK 5KGXA 4B1XB 4WF9L 3V9SA 3KWGA 1CZ9A 4B1UB 2E2NA 3U3GA 4E1JA 3L2VA 2HBMA 5J1EA 1D9FA 4KHWA 2G8IA 5F1XA 5HLFA 3GOIA 3SUPA 5EU7A 1VQ5N 3OYCA 1JLFA 1EXQA 4KI4A 3W3DA 4CEEA 2X78A 1NGAA 4BY9C 4RW6A 3CC2N 4BRPA 3BF3A 2BANA 3WNEA 2Q31A 5AFUH 2PBDA 2NRRA 3SAHA 1T6DA 4YDUA 2VWJA 5LJVA 3O80A 3K0SA 3THVA 3CF5L 1TAUA 3QIOA 1WSGA 1S9GA 3RR8A 4IJNA 3TSPA 2YNGA 4CFCA 1HQEA 4BRAA 5BR9A 3NGZA 4Z4HA 3ULEB 4RWTA 4C8KA 5AJ3K 4H5VA 3VOVA 1HX1A 2O8CB 4LFBK 1SL2A 1NMDA 1YAGA 3SPYA 1YXQA 1RBVA 3VQCA 3HI0A 3G71N 3RWUA 1WOQA 2CGJA 5LY3A 1SKSA 3HL8A 3BF1A 3OYLA 2E2QA 5FDLA 4Z4IA 3NVMA 3THXB 4GVEA 3HJFA 4PWDA 1D9DA 4BRIA 1X9MA 1DGKN 2O8BB 2E4LA 2RKIA 2CH6A 3AVKA 1ZC6A 1ZYQA 5AFUA 4M3WA 1RBRA 1YUWA 4IXCA 4E7JA 1NGEA 3PV8A 3S3MA 3OA9A 4A62A 1NKBA 2NLXA 3HO1A 2ZD1A 1CZBA 3HVRA 3SAFA 1NJYA 4E7HA 2GWKA 1NGDA 4M3XA 1GLJO 2HNZA 3AVGA 4JK7A 1YTAA 4JKBA 3EN9A 2GUPA 3AVBA 2HNDA 5HRRA 3J80O 1UAXA 4X65K 3ZSOA 5HBMA 4B9VA 1KSPA 4DSKA 2CGKA 4KTZA 1S6PA 1I94K 2BGGA 3SMPA 2E8AA 4PY5A 4BRDA 4AHCA 1D5AA 1W97L 3WXJA 1O13A 1K9MO 2WUSA 3ULEA 3CXCM 5AQTA 2VG6A 3DLEA 1VQ7N 3CQYA 1RDWX 4CESA 2BH1A 5FRMA 1E3MA 4H0PA 5C25A 1MA9B 4PL7A 1IJJA 3UKRB 5GADP 1HNIA 3ZSVA 1RGIA 4HUEA 3UIQA 3T1YK 1FW6A 4CK3A 4C8MA 2EWSA 5AQWA 1X3MA 3VESA 2ZJRL 3P1GA 3SQ4A 2QKBA 4BVOA 4OPHA 2KHOA 1ZBHA 4WFNL 3KZBA 1RDAA 4H0VB 1TYQA 3KLHA 4A5BA 5BRDA 4CZMA 2P9IA 1YTUA 3FLCO 1KXPA 3G6EN 2I7PA 4CZJA 3QNNA 2Q1NA 1RT2A 1S1UA 1XUPO 3AGKA 5C42A 3HRGA 2O8EB 2VG7A 5AQGA 4A61A 4Q0BA 4FWOA 5A2QO 1WSHA 2E1YA 1C1BA 5BPMA 3OBYA 4FWSA 2YNIA 2W6KA 3A0IX 3UKUB 2O8DB 1TKTA 4KB0A 4JHDB 2ZJPL 2O8BA 4CK2A 1JL2A 1JCFA 4IBNA 3LZJA 4C8OA 3R3LA 4HCCA 1RBSA 3DXKB 1ZBIA 4WQ4A 3MXJA 2D0OA 3LALA 5E26A 1VSEA 1ZBLA 3BZKA 3LWLA 1EETA 4CBWA 4IO9L 3ZYYX 4J2AA 1TKZA 3S3NA 2FF3B 2DFFA 4LFCK 4M63C 3AA2A 4BR9A 1E4FT 2OCEA 1SL1A 1V4SA 1FKOA 3VA0A 5GIOA 1S6QA 3MN7A 4K8XA 1NK0A 5HRPA 5IWAK 2I7NA 4E1NA 5C2DA 4GV6A 4EFHA 5GAEP 3DLLL 3L4IA 4HTLA 3K58A 3VGLA 1KCFA 5GIPA 4BRLA 5HROA 2WBNA 5CZ2A 2D1KA 2J4RA 4FW1A 4M42A 4FJLA 4DQ8A 2HHVA 1U47A 4K0KK 4OKJA 3O4NA 4W5RA 2O4IA 4FJKA 3IAYA 2QWNA 1J9AA 1N6QA 4DV6K 3TU5A 3F9KA 4M3ZA 2G8KA 5AQOA 1TK8A 4CF9A 4DR3K 4DTRA 4DSEA 3J7AP 5FPDA 1Z25A 4CVNE 4HVJA 3I55N 4W5NA 3MDQA 3CJCA 1OH5A 3TTCA 4F2RA 1X3NA 3CCSN 3AA4A 4PQUA 3CJAA 4JKAA 4JYAK 3I8DA 3OTOK 2P9NA 4CF1A 1RTDA 3QICA 3O4WA 2YX6A 3AV9A 4B3RK 3CMAN 2P9SA 4FOEA 3MWPA 1XWLA 4M41A 4OPKA 4X64K 1RCHA 3N4QA 4JI3K 4PHTX 4DTMA 3M8QA 3HM9A 1KVAA 3NE6A 2V7YA 4DTOA 3AY9A 4LY7A 2E88A 5FLXO 3O3HA 3AO3A 3MAQA 2DFHA 3THYB 4BE0A 3QFUA 1RDBA 3ZX2A 2PYJA 4IKFA 5AQNA 4B3OA 2ATQA 3EYZA 3QEIA 1J6ZA 2PY5A 4F9OA 3O6WA 3CQ8A 3RRGA 2B5JA 3VMFB 4E1MA 4OGCA 2E5LK 3DXKA 3M8SA 4KHNA 3L4QA 1WBDA 2OZMA 2F4VK 3CQXA 4CJTA 1IV0A 3AGRA 2FLOA 3OHRA 1Q9XA 4JKDA 1NJIO 4NLBA 3VPZA 2FSNA 3CPEA 3VEWA 4KI6A 4DSIA 3DAWA 3TAPA 1GLLO 1C0GA 3QIPA 1NGGA 5EVZA 1MDUB 4CD3A 3GG4A 2VGMA 3BY5A 4JAXA 4B9MA 2CGLA 3FZHA 3VN5A 3MN6A 2FBYA 3WEEB 4CK1A 3KWIA 3L2UA 3NBPA 3HK2A 4N56A 4EHUA 1VSKA 4CEQA 1JJ2M 2O8EA 3AVNA 3V1QA 1RTJA 1VQ4N 3V9WA 1Y64A 3J8AA 3WUHA 3O08A 3TAEA 2OPRA 4CE9A 4LFAK 4CGHA 4JI0K 3F2KA 1SS6A 2XHBA 1QQMA 4Z4EA 4B1YB 3M6GA 4ELUA 3K9KA 3L3VA 3LZIA 4CJUA 3MEEA 3QBWA 4I7FA 2OTLN 4I9LA 1LWFA 2VGNA 3PY8A 3VQEA 2RE2A 2QM1A 2YCHA 5C10A 3HYFA 1GLBG 1VRUA 4BE1A 1BCMA 5AQZA 4GKJK 1GLEG 5C0YA 3QMLA 3CM5A 3QEXA 4E7IA 3H6EA 3CJ7A 1F21A 5C15A 4JD2B 3WXLA 4CW7B 2E20A 5BN9A 4J2DA 2OYQA 4XH4A 5BRHA 1DTTA 3L2RA 4CJSA 2QWLA 3KLGA 1HKCA 1YVNA 3CETA 1QSYA 2E6LA 4BRHA 2RF2A 3E9OA 4IDKA 1G99A 2NRXA 3D2EA 1R0AA 3I0SA 5CR4A 4KBOA 1KAXA 3ATVA 3RMBA 2GEMA 3CCJN 1DKGD 2HBKA 3NH1A 3K5NA 1VK0A 5AQLA 2O8CA 3LDQA 3PSFA 5AQIA 3O5BA 3SJHA 4JKGB 3VQDA 3PX4A 4CBXA 1XHXA 4BVPA 3C7NA 4B1VA 3MWTA 5C24A 4H5RA 3TI0A 2NUBA 3A5OC 2YHAA 4F3OA 4CJPA 2WC9A 1N5YA 4DSLA 1EX4A 4FO0A 4HHTA 3VF2A 5J2PA 4QS7A 3ZSYA 1LW0A 3HOTA 1VSMA 4MDBA 1DEJA 2F96A 4FW2A 1V4TA 3RTVA 4CF0A 2ASPA 2GBZA 3AVJA 3FFIA 1QZ6A 3TTDA 2OPPA 3ID8A 4CD1A 1E4GT 2Y1IA 3FZKA 1WB9A 1LOTB 1J54A 1IBKK 3KD5E 2ZGYA 2HB5A 3C7NB 4ZTFA 4NB4A 1WLJA 5DM7L 3AVCA 1HR0K 1YF5L 5JVHL 3JYTA 4CEZA 2O8FB 1UA0A 4I6MB 4U67L 1YT3A 3NVKA 2A5XA 5AQFA 4MLHA 3NF6A 3VQ9A 3TR8A 3VETA 1SKRA 3JS6A 1QTMA 4FWRA 4J2EA 3VQAA 4B9SA 3CCRN 4DF8A 1JCGA 4DTPA 3G0ZA 3ENBA 4IWVA 4DTNA 3CCVN 2UYTA 3ENOA 4FSVA 4FJXA 4FLTA 3EE9A 2VWKA 3VENA 4FJMA 2ZF5O 3THWB 4E7KA 4YOYA 4IO8A 4DV7K 3QO9A 3WXMB 4IEEA 2DTUA 3EEQA 1WAJA 2F8TA 3JXUA 1NOZA 3M1FA 1XMQK 2ZM6K 4NCAA 1C0MA 1WSJA 2A1SA 4JV5K 4N41A 4LC9B 1GLCG 2O4GA 1NM1A 3Q7BA 3UE5A 4BR4A 5HL7L 4DKWA 4GW6A 5M1FA 2XY6A 5DMRA 4PKIA 3K5LA 1NG9A 5AZIA 4BQLA 1QSLA 5JMVA 2OZSA 4LH4A 3V1OA 1YVUA 2QWOA 1NMNA 4CGFA 4FCYA 1RT3A 4KH6A 3W0LA 2NNWA 1HKGA 1NJXA 1VHXA 4WQ5A 2B4JA 3A8YA 4FM2A 5J2QA 1S5JA 3F73A 4CEOA 4FJ9A 3HT3A 2KFNA 1TAQA 1BU6O 4FXDA 1JL1A 4XEIA 3R6MA 2R7YA 5JLHA 5AQQA 1W9HA 3DRPA 2E2PA 1B92A 3E01A 4O55A 2G8WA 3DRRA 4HTUA 1VQNN 1KRPA 3PSIA 5GINA 4LF9K 2NRWA 3NHGA 3GDQA 1XNQK 1N32K 4KHPK 1XHZA 3LP0A 1N36K 3VEOA 3ZSRA 1RT6A 3MMVA 4JI6K 1U49A 2P9KB 3HSCA 4DV0K 1VQ8N 2I5JA 1KD1O 4BC2A 4CFDA 3THXA 1KLMA 3ZSWA 4JI7K 4JK8A 1OH7A 4UQGA 5TKYA 3SPZA 3AO2A 5KQ8A 2EHGA 2HF3A 4N5SA 1I39A 1U6ZA 5AQUA 3SJJA 3O1WA 1S72N 1X9WA 4O44A 5F2RA 1GLAG 1BI4B 5H1SQ 4BRQA 4DMNA 2FBTA 1M90O 1NOYA 4FWQA 3CCMN 1S3XA 3M5RA 4IZ9A 3E9LA 2Z1GA 1JLEA 1A5XA 4DLEA 3T1AA 1BQNA 2ZGZA 3KK2A 3SBTA 3R1XA 3LM9A 4CJ3A 1R59O 1H1VA 4K41A 3AVAA 3K59A 1NKCA 4H03B 3LDSA 3KK3A 4DQQA 1SV5A 3GE1A 4FJNA 4JRQA 2QW9A 4ZTJA 4OKEA 3F9MA 4BR5A 1S1WA 2IAJA 4FOIA 2ETJA 3MEDA 3RMCA 1BCOA 2NRHA 4C8NA 3ZEUA 2XY7A 5KPZA 3QEVA 5C12A 1TUYA 5AQMA 2E2OA 3CJ1A 2FBXA 1JXEA 4FJ7A 1HNVA 3PX0A 4KH5A 3G4SN 4GV9A 2ZJQL 4IOAL 5AZJA 4JEPA 3TTFA 1NGJA 2QWPA 2XY8A 4LH5A 4BG8A 5CYQA 3KD1E 1ATNA 4J2BA 4BDZA 1B9DA 1EQYA 3LAMA 2JWLA 2YNHA 1X1PA 3GL1A 2F8SA 4WYBA 2QKKA 3C65A 4W5QA 4LD0A 1QHAA 3HVTA 4F3TA 4X66K 4KV8A 3QNOA 3EKUA 4ISGA 4CEBA 3KJVA 4K43A 4CZIA 2RN2A 1BI4A 3DMJA 4CIFA 2AP1A 3OYHA 1MWKA 4NXNK 1KQSM 4DV4K 3U8XA 3SV3A 3VQ5A 4JI2K 4E19A 1UA1A 1KVCA 3BEXA 3H1QA 2W6LA 3VQPA 4FLXA 2DFEA 5AQHA 5SWMA 2HW3A 4OVLA 5KI6A 5K14A 4A57A 3KK1A 3CFPA 5EOYA 1SQKA 3UB5A 1MU2A 3ZSZA 1Z6RA 3V9ZA 4IFEA 1TVRA 2EX3A 3SQ0A 3ALYA 2NRZA 3P38A 4BC5A 4A5AA 3AARA 3FZLA 2A1RA 4H0YB 1J5OA 1S1VA 3AO1A 1NBWA 5JS2A 3EZWA 5JICA 3VQ7A 3IDHA 3H46O 1ATRA 4KHSA 2HVIA 3SLCA 3QEWA 4OPAA 3ZX3A 4JK9A 4IFVA 4DQPA 4KTQA 2UUAK 3QLHA 3I56N 4O0JA 1WSEA 4X62K 2G8HA 3AO4A 2FXUA 3FGUA 3L8BA 2VCPA 2VQEK 3I8BA 1K8KB 4H4MA 4XIUA 3QINA 4KH4A 4DTXA 4CJ4A 1HPZA 2XO7A 4GNIA 3P39A 3PO4A 1T8EA 1XI1A 4R5PA 1WSFA 4NCGA 4JKHA 4CF2A 4DR5K 2V51B 3I33A 3OW2M 3QERA 2F9WA 4CHZA 1QZ5A 3LP3A 4BR0A 4FK4A 4HWIA 1Q8IA 3FE1A 3TANA 5I3UA 2HSTA 2BE2A 4DQIA 4CEDA 2CH5A 3TABA 2D0BA 2IGIA 4CJVA 1BO5O 2KLAA 3Q7CA 1Y97A 1RBUA
chains in the Genus database with same CATH topology
3D45A 4N47A 2GV9A 3L3UA 3U6FA 1NK7A 4PA1A 3HYFA 5HP1A 1VRUA 4BE1A 1BCMA 2KW4A 3NDKA 4I2PA 4OJRA 2P5GA 4WE1A 1FXXA 1XC9A 4DFJA 3NF8A 3CM5A 3QEXA 4F8RA 4KTWA 2LSNA 3OYJA 4E7IA 1F21A 3OJSA 1QSSA 1BHLA 4DLGA 1T03A 4KHQA 2QXFA 4ICLA 3ZT3A 3DRSA 3O3FA 4B9LA 4FJ8A 4J2DA 1HRHA 1U04A 4MQ3A 1RDCA 2OYQA 1JXBA 3ITHA 1DTTA 4KHUA 2X6SA 4DSFA 3L2RA 4CJSA 3ZT4A 4RW7A 1FKPA 1J53A 3ZT2A 3MXIA 3KLGA 2BDPA 4FLZA 1ZBUA 2JLEA 5SZTA 4JS4A 1HMVA 1QSYA 5KGXA 3OYDA 3V9SA 3M8RA 2E6LA 1CZ9A 2HVHA 2RF2A 4AHUA 4IDKA 1WNSA 3U3GA 4M45A 5HRNA 3L2VA 1R0AA 3ZT0A 4DS5A 4DSJA 1RT4A 3I0SA 3RMBA 5J1EA 4RW4A 1D9FA 4KHWA 2G8IA 3CFRA 3BDPA 3NH1A 4CJQA 3K5NA 3O4QA 1VK0A 3QESA 5HLFA 2Z1JA 4G1QA 3SUPA 5EU7A 4FLYA 3OYCA 2Y1JA 1JLFA 1EXQA 4CHYA 4CEEA 3L2QA 4KI4A 3TAFA 2X78A 1BQMA 1RBTA 3PX4A 3VQDA 3HPOA 1L3TA 4RW6A 2BANA 1XHXA 3WNEA 3TAMA 4KO0A 3C94A 3OYMA 5C24A 3TI0A 2NUBA 2VWJA 4DG1A 3DYAA 2YHAA 1IG9A 3THVA 4CJRA 4F3OA 3QIOA 1WSGA 4FM0A 4KHYA 3CFPA 1TAUA 1S9GA 1RILA 4CJPA 4BACA 1N5YA 3RR8A 4DSLA 4OLBA 1EX4A 2YNGA 2IS3A 4CEAA 4HHTA 1KVBA 4TSXA 4CFCA 3OYKA 5J2PA 1HQEA 3K5OA 4DTJA 3ZSYA 3KTQA 1LW0A 1VSMA 2KFZA 3CFOA 1HQUA 3IS9A 2F96A 4FW2A 4FVMA 1VSHA 3WNGA 3ZCMA 3OYGA 3RTVA 5D3GA 3NGZA 4CF0A 1EKEA 3FFIA 2GBZA 3AVJA 4Z4HA 4F4KA 2OPPA 1LAVA 4KPYA 4C8KA 2Y1IA 3G10A 3NGIA 4E3SA 1SL2A 1J54A 3PO5A 3SPYA 2KTQA 3VQCA 1RBVA 1B9FA 2HHXA 3RWUA 1SKSA 4OKKA 3SQ1A 3KD5E 3OYAA 3HL8A 4CHOA 3OYLA 2HB5A 3TAQA 5FDLA 4ZTFA 4Z4IA 3RR7A 4DF4A 3HJFA 1QHTA 1WLJA 4PWDA 1D9DA 3OYEA 2PZSA 4B9NA 1JLAA 3AVCA 1X9MA 2E4LA 3V9UA 3JYTA 4CEZA 2RKIA 4IFYA 3NCIA 2VG5A 4DFPA 1IKXA 1UA0A 4ELTA 3KLIA 3AVKA 1NKEA 1YT3A 1ZYQA 4M3WA 1RBRA 5FROA 3NF6A 3VQ9A 3TR8A 4CF8A 1SKRA 3KIOA 1L3UA 1IKYA 4E7JA 1QTMA 2G8FA 3PV8A 3V9XA 4O5BA 3S3MA 3SZ2A 1Z26A 2OA8A 3VQAA 2E6MA 3HP6A 4B9SA 4J2EA 1ASVA 2HHWA 1NKBA 2Z1HA 3JSMA 4DF8A 3NFAA 4DQRA 3LPUA 2ZD1A 3TWHA 1CZBA 3HVRA 3HO1A 5CY4A 1NJYA 4E7HA 4DTPA 5FRNA 4DU4A 3G0ZA 4YFUA 4KAZA 4M3XA 4FJGA 2HNZA 1BIUA 1TKXA 3AVGA 3WNHA 4DTNA 4OLAA 3S3OA 1YTAA 4QAGA 3V81A 1TK5A 1VSLA 4CGDA 4FJXA 3AVBA 4FLTA 4DU3A 1NK8A 1KFSA 4FJ5A 3M8PA 2HNDA 5HRRA 1UAXA 2VWKA 4FJMA 4AH9A 3ZSOA 5HRSA 5HBMA 4B9VA 4E7KA 1KSPA 3AVHA 3QO9A 4KTZA 1VRTA 4DSKA 4K8ZA 1S6PA 2BGGA 2DTUA 1VSFA 5CYMA 4RW8A 4ELVA 3MECA 4PY5A 4AHCA 3D0PA 1WAJA 3AO5A 2F8TA 3DM2A 1D5AA 1NJZA 1UWBA 1NOZA 4NCAA 1SUQA 4CEFA 1C0MA 3LAKA 3EY1A 3CM6A 2VG6A 4AHVA 3DLEA 1L3VA 4C8LA 4DU1A 1WSJA 3RMDA 4CJWA 2A1SA 4CESA 4N41A 1EP4A 1ASWA 2O4GA 4AHRA 3DLRA 5FRMA 4HUFA 4FYDA 1W0HA 5C25A 1HYVA 4FLUA 4B3OA 4GW6A 4AILC 4GVMA 2XY6A 4B9TA 5DMRA 3K5LA 3SV4A 1HNIA 3ZSVA 4HUEA 3UIQA 3OYFA 1QSLA 2OZSA 3V1RA 3CYMA 4LH4A 3V1OA 4BE2A 4AHSA 4FK0A 3SQ2A 1YVUA 4CK3A 3NF7A 4C8MA 1TKDA 4CHQA 2IOCA 2OPSA 4EZ6A 1RTHA 4B8CA 4GMJB 4CGFA 4FCYA 1RT3A 4EP5A 3P1GA 3SQ4A 1NJXA 1K6YA 4F2SA 3TAGA 3TARA 3MXMA 3DLBA 2QKBA 1GOCA 2B4JA 1T7PA 2OPQA 1IKVA 3IG1A 4FM2A 5J2QA 1S5JA 4DFMA 4CGGA 4CEOA 3F73A 5J2MA 3SUNA 4FJ9A 1ZBHA 2X74A 3HT3A 3T19A 1TAQA 2KFNA 4FLWA 1RDAA 4RW9A 4FXDA 1JL1A 3HPGA 1VSDA 2R7YA 5KTQA 3KLHA 1W9HA 3DRPA 1B92A 2ZE2A 1C1CA 3E01A 3SI6A 2HMIA 1REVA 4O55A 2G8WA 4FJIA 3AVLA 1RNHA 3ULDA 1YTUA 4BDYA 3DRRA 4HTUA 4Z4GA 4B8AB 1KRPA 1WAFA 3QNNA 4FLVA 3U3YA 4FZYA 1RT2A 1S1UA 1A5VA 5C42A 4CIGA 3NHGA 2VG7A 2Q3SA 2YNFA 4DTUA 4Q0BA 1XHZA 3LP0A 4I9QA 2XY5A 1WSHA 1UOCA 1C1BA 1DLOA 1RT6A 3ZSRA 4CERA 2YNIA 1JLGA 1U49A 1C1AA 3S9HA 1RT7A 1RDDA 3RMAA 2I5JA 2PYLA 4IG0A 1TKTA 4CFDA 4KB0A 1NK9A 1KLMA 3ZSWA 3KLEA 4DQSA 1U45A 4CK2A 3HXMA 1T05A 1JL2A 3K2PA 4IBNA 4UQGA 3LZJA 1BIZA 3OYIA 4C8OA 3SPZA 2G8UA 4FZXC 3OVNA 3AO2A 4HCCA 1FK9A 1RBSA 2EHGA 1ZBFA 1ZBIA 4PUOA 1G15A 3MXJA 2YHBA 3HSTB 3SUOA 1A5WA 1KTQA 4N5SA 3LALA 4Y1DA 1I39A 2YKMA 5KRSA 4QOZB 1VSEA 3VQBA 1ZBLA 3LWLA 1BL3A 3SYZA 1EETA 4ID1A 3DLGA 3SJJA 4FZZA 1CLQA 1C6VA 4J2AA 1X9WA 2IDOA 1SKWA 1TKZA 3S3NA 4O44A 4DFKA 2DFFA 3BGRA 4CJLA 5T7BA 3IRXA 3V6DA 3AA2A 3MEGA 1BGXT 1BI4B 4AHTA 4DMNA 5E41A 1SL1A 1FKOA 3ISNC 2FBTA 1NOYA 3VA0A 1VSJA 1S6QA 3OY9A 1HYZA 4K8XA 1U4BA 1NK0A 2Z1GA 1JLEA 5HRPA 4E7LA 4M3RA 3A2FA 1A5XA 4E1NA 4DLEA 4W5TA 3T1AA 1BQNA 3NAEA 1JLCA 2XRIA 3KK2A 3K58A 1KCFA 3AA3A 5KGWA 4CJ3A 4CGIA 2P51A 3AVFA 4Q5VA 5HROA 5I42A 5KRTA 3NF9A 4LSLA 5CZ2A 4QCLA 4FW1A 4M42A 3AVAA 4FJLA 3OS2A 1GOBA 4CCHA 2X6NA 4JS5A 2HHVA 1U47A 1HYSA 4OKJA 3O4NA 4W5RA 2O4IA 4CJFA 3K59A 1NKCA 4FJKA 2B6AA 3KK3A 3LDSA 4DQQA 1J9AA 1SV5A 2W42A 1N6QA 3IAYA 4FJNA 2AJQA 4KKOA 4JRQA 3KKSA 4ZTJA 2D5RA 4OKEA 1JLQA 1S1WA 2IAJA 3F9KA 4M3ZA 2ETJA 4HUGA 3MEDA 3RMCA 1BCOA 1ASUA 1TK8A 2G8KA 4C8NA 2XY7A 4OPJA 4CF9A 3ASMA 3QEVA 2P5OA 1JKHA 1QS4A 2ITGA 4DTRA 4DSEA 1D8YA 2FBXA 3KKRA 1JLBA 3AA5X 2GUIA 1Z25A 3AVIA 4M3YA 4W5NA 4HVJA 1JXEA 4FJ7A 1HNVA 3B6PA 3O3GA 3PX0A 2YKNA 3OS1A 4F2RA 3NGYA 3DOLA 1LAWA 4BDPA 4KREA 3SUQA 3AA4A 1QQCA 2Z1IA 3PUFA 5DK5A 4B9UA 4N76A 4PQUA 2XY8A 1TGOA 4LH5A 4JLHA 5CYQA 3KD1E 2ZQBA 3I8DA 4BDZA 1LW2A 1B9DA 3LAMA 4J2BA 4I2QA 2YNHA 1X1PA 4CF1A 4E89A 4DWIA 2F8SA 1RTDA 3ZSXA 3PX6A 2QKKA 3LP1A 3NH0A 4CFBA 4NYFA 4LD0A 4W5QA 3RRHA 3AV9A 4CFAA 3VQ4A 1VSIA 3HVTA 1TK0A 1SL0A 4F3TA 3QEPA 4OPKA 1XWLA 4M41A 1L5UA 4KV8A 3QNOA 4CEBA 3KJVA 2KZZA 1NK4A 1RCHA 2RN2A 4L8RB 1BI4A 4DTMA 3SCXA 4E0DA 3DMJA 3VQQA 4JRPA 3M8QA 1CXQA 4CIFA 1KVAA 1O1WA 3HM9A 4BWJA 3NE6A 4DTOA 4LY7A 3OYHA 1BISA 3O3HA 3HP9A 3OYNA 4H8KA 2D0CA 3SV3A 3AO3A 3VQ5A 3MAQA 3K5MA 4E19A 2DFHA 3VQ8A 5CZ1A 3SNNA 1UA1A 3HPHA 1KVCA 4CJ5A 4BE0A 4FLXA 1I3AA 3VQPA 3QETA 2DFEA 1RDBA 5SWMA 4O4GA 4KB1A 1LWEA 3VQ6A 1L3SA 2PYJA 2HW3A 3P5JA 4IKFA 4OVLA 5K14A 5KI6A 3LANA 1GOAA 2ATQA 4CJEA 4Z4CA 3KK1A 3EYZA 1MU2A 3LWMA 4ZHRA 3QEIA 4EZ9A 2PY5A 3ZSZA 3NH2A 3V9ZA 1ITGA 1U48A 3CQ8A 3P83D 3RRGA 1RT1A 2B5JA 2HHTA 1TVRA 3I0RA 4E1MA 1TV6A 2EX3A 3C95A 1CXUA 3ALYA 3SQ0A 4ID5A 3DLKA 3DLHA 4OGCA 3CG7A 4DS4A 4RG8A 1S9EA 4KRFA 3M8SA 2P1JA 4KHNA 2A1RA 4OGEA 1HJRA 4M3UA 3WNFA 1RT5A 1J5OA 2OZMA 1IO2A 3OS0A 4Y1CA 1LWCA 4CECA 5J2NA 1S1VA 3H08A 3LP2A 1S1TA 4CJTA 3AO1A 3ZT1A 2HHSA 5JS2A 4NCBA 3VQ7A 2FBVA 4MFBA 1Q9XA 4KHSA 2HVIA 4M3TA 2JGUA 1Q9YA 4CHPA 3QEWA 3ZSQA 2WONA 4NYNA 3C6UA 4IFVA 4LSNA 4KI6A 4DSIA 4CHNA 4DQPA 4KTQA 3T3FA 3TAPA 2D0AA 4W5OA 2QK9A 3QLHA 3QIPA 4O0JA 2FC0A 1WSEA 3C6TA 2G8HA 3AO4A 1IH7A 2DY4A 4FK2A 2WOMA 4CGJA 4B9MA 4FJJA 4HCBA 3B6OA 3L8BA 1NK5A 4Z4FA 2HHUA 4B08A 4H4MA 3VN5A 2HNYA 2YV0X 4CJKA 4XIUA 2FBYA 3QINA 4KFBA 4BWMA 3VA3A 3EZ5A 4DTXA 4O0IA 4CJ4A 4CK1A 2KQ2A 3L2UA 3NBPA 1HPZA 2XO7A 3HK2A 1DTQA 2IC3A 4N56A 3PO4A 1VSKA 4CIEA 4CEQA 1S1XA 2RPIA 1T8EA 5JS1A 1IKWA 1NJWA 3AVNA 1NK6A 1XI1A 3V1QA 1WSIA 2KZMA 1RTJA 1WSFA 4NCGA 4R5PA 3K57A 3V9WA 4CF2A 1C0TA 4IG3A 1QE1A 3QERA 3TAEA 2OPRA 4CE9A 4FJHA 4CHZA 4DTSA 1RTIA 4CGHA 3OJUA 1KFDA 4EP4A 4H4OA 3DOKA 3LP3A 2XHBA 4FK4A 3DI6A 3KLFA 1TL1A 1Q8IA 3TANA 4Z4EA 5I3UA 2HHQA 3V4IA 1KLNA 4ELUA 3LPTA 1TL3A 1X9SA 2BE2A 1WN7A 3L3VA 3LZIA 4CEDA 3MEEA 4CJUA 4I7FA 3L2WA 4DQIA 4I9LA 3TABA 1LWFA 1C0UA 2D0BA 4Z0UA 2IGIA 2G8VA 4CJVA 4YNQA 3PY8A 3AVMA 1Y97A 4FM1A 3VQEA 3OYBA 1LV5A 1RBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D45 A;  4N47 A;  2GV9 A;  3L3U A;  3U6F A;  1NK7 A;  4PA1 A;  3HYF A;  5HP1 A;  1VRU A;  4BE1 A;  1BCM A;  2KW4 A;  3NDK A;  4I2P A;  4OJR A;  2P5G A;  4WE1 A;  1FXX A;  1XC9 A;  4DFJ A;  3NF8 A;  3CM5 A;  3QEX A;  4F8R A;  4KTW A;  2LSN A;  3OYJ A;  4E7I A;  1F21 A;  3OJS A;  1QSS A;  1BHL A;  4DLG A;  1T03 A;  4KHQ A;  2QXF A;  4ICL A;  3ZT3 A;  3DRS A;  3O3F A;  4B9L A;  4FJ8 A;  4J2D A;  1HRH A;  1U04 A;  4MQ3 A;  1RDC A;  2OYQ A;  1JXB A;  3ITH A;  1DTT A;  4KHU A;  2X6S A;  4DSF A;  3L2R A;  4CJS A;  3ZT4 A;  4RW7 A;  1FKP A;  1J53 A;  3ZT2 A;  3MXI A;  3KLG A;  2BDP A;  4FLZ A;  1ZBU A;  2JLE A;  5SZT A;  4JS4 A;  1HMV A;  1QSY A;  5KGX A;  3OYD A;  3V9S A;  3M8R A;  2E6L A;  1CZ9 A;  2HVH A;  2RF2 A;  4AHU A;  4IDK A;  1WNS A;  3U3G A;  4M45 A;  5HRN A;  3L2V A;  1R0A A;  3ZT0 A;  4DS5 A;  4DSJ A;  1RT4 A;  3I0S A;  3RMB A;  5J1E A;  4RW4 A;  1D9F A;  4KHW A;  2G8I A;  3CFR A;  3BDP A;  3NH1 A;  4CJQ A;  3K5N A;  3O4Q A;  1VK0 A;  3QES A;  5HLF A;  2Z1J A;  4G1Q A;  3SUP A;  5EU7 A;  4FLY A;  3OYC A;  2Y1J A;  1JLF A;  1EXQ A;  4CHY A;  4CEE A;  3L2Q A;  4KI4 A;  3TAF A;  2X78 A;  1BQM A;  1RBT A;  3PX4 A;  3VQD A;  3HPO A;  1L3T A;  4RW6 A;  2BAN A;  1XHX A;  3WNE A;  3TAM A;  4KO0 A;  3C94 A;  3OYM A;  5C24 A;  3TI0 A;  2NUB A;  2VWJ A;  4DG1 A;  3DYA A;  2YHA A;  1IG9 A;  3THV A;  4CJR A;  4F3O A;  3QIO A;  1WSG A;  4FM0 A;  4KHY A;  3CFP A;  1TAU A;  1S9G A;  1RIL A;  4CJP A;  4BAC A;  1N5Y A;  3RR8 A;  4DSL A;  4OLB A;  1EX4 A;  2YNG A;  2IS3 A;  4CEA A;  4HHT A;  1KVB A;  4TSX A;  4CFC A;  3OYK A;  5J2P A;  1HQE A;  3K5O A;  4DTJ A;  3ZSY A;  3KTQ A;  1LW0 A;  1VSM A;  2KFZ A;  3CFO A;  1HQU A;  3IS9 A;  2F96 A;  4FW2 A;  4FVM A;  1VSH A;  3WNG A;  3ZCM A;  3OYG A;  3RTV A;  5D3G A;  3NGZ A;  4CF0 A;  1EKE A;  3FFI A;  2GBZ A;  3AVJ A;  4Z4H A;  4F4K A;  2OPP A;  1LAV A;  4KPY A;  4C8K A;  2Y1I A;  3G10 A;  3NGI A;  4E3S A;  1SL2 A;  1J54 A;  3PO5 A;  3SPY A;  2KTQ A;  3VQC A;  1RBV A;  1B9F A;  2HHX A;  3RWU A;  1SKS A;  4OKK A;  3SQ1 A;  3KD5 E;  3OYA A;  3HL8 A;  4CHO A;  3OYL A;  2HB5 A;  3TAQ A;  5FDL A;  4ZTF A;  4Z4I A;  3RR7 A;  4DF4 A;  3HJF A;  1QHT A;  1WLJ A;  4PWD A;  1D9D A;  3OYE A;  2PZS A;  4B9N A;  1JLA A;  3AVC A;  1X9M A;  2E4L A;  3V9U A;  3JYT A;  4CEZ A;  2RKI A;  4IFY A;  3NCI A;  2VG5 A;  4DFP A;  1IKX A;  1UA0 A;  4ELT A;  3KLI A;  3AVK A;  1NKE A;  1YT3 A;  1ZYQ A;  4M3W A;  1RBR A;  5FRO A;  3NF6 A;  3VQ9 A;  3TR8 A;  4CF8 A;  1SKR A;  3KIO A;  1L3U A;  1IKY A;  4E7J A;  1QTM A;  2G8F A;  3PV8 A;  3V9X A;  4O5B A;  3S3M A;  3SZ2 A;  1Z26 A;  2OA8 A;  3VQA A;  2E6M A;  3HP6 A;  4B9S A;  4J2E A;  1ASV A;  2HHW A;  1NKB A;  2Z1H A;  3JSM A;  4DF8 A;  3NFA A;  4DQR A;  3LPU A;  2ZD1 A;  3TWH A;  1CZB A;  3HVR A;  3HO1 A;  5CY4 A;  1NJY A;  4E7H A;  4DTP A;  5FRN A;  4DU4 A;  3G0Z A;  4YFU A;  4KAZ A;  4M3X A;  4FJG A;  2HNZ A;  1BIU A;  1TKX A;  3AVG A;  3WNH A;  4DTN A;  4OLA A;  3S3O A;  1YTA A;  4QAG A;  3V81 A;  1TK5 A;  1VSL A;  4CGD A;  4FJX A;  3AVB A;  4FLT A;  4DU3 A;  1NK8 A;  1KFS A;  4FJ5 A;  3M8P A;  2HND A;  5HRR A;  1UAX A;  2VWK A;  4FJM A;  4AH9 A;  3ZSO A;  5HRS A;  5HBM A;  4B9V A;  4E7K A;  1KSP A;  3AVH A;  3QO9 A;  4KTZ A;  1VRT A;  4DSK A;  4K8Z A;  1S6P A;  2BGG A;  2DTU A;  1VSF A;  5CYM A;  4RW8 A;  4ELV A;  3MEC A;  4PY5 A;  4AHC A;  3D0P A;  1WAJ A;  3AO5 A;  2F8T A;  3DM2 A;  1D5A A;  1NJZ A;  1UWB A;  1NOZ A;  4NCA A;  1SUQ A;  4CEF A;  1C0M A;  3LAK A;  3EY1 A;  3CM6 A;  2VG6 A;  4AHV A;  3DLE A;  1L3V A;  4C8L A;  4DU1 A;  1WSJ A;  3RMD A;  4CJW A;  2A1S A;  4CES A;  4N41 A;  1EP4 A;  1ASW A;  2O4G A;  4AHR A;  3DLR A;  5FRM A;  4HUF A;  4FYD A;  1W0H A;  5C25 A;  1HYV A;  4FLU A;  4B3O A;  4GW6 A;  4AIL C;  4GVM A;  2XY6 A;  4B9T A;  5DMR A;  3K5L A;  3SV4 A;  1HNI A;  3ZSV A;  4HUE A;  3UIQ A;  3OYF A;  1QSL A;  2OZS A;  3V1R A;  3CYM A;  4LH4 A;  3V1O A;  4BE2 A;  4AHS A;  4FK0 A;  3SQ2 A;  1YVU A;  4CK3 A;  3NF7 A;  4C8M A;  1TKD A;  4CHQ A;  2IOC A;  2OPS A;  4EZ6 A;  1RTH A;  4B8C A;  4GMJ B;  4CGF A;  4FCY A;  1RT3 A;  4EP5 A;  3P1G A;  3SQ4 A;  1NJX A;  1K6Y A;  4F2S A;  3TAG A;  3TAR A;  3MXM A;  3DLB A;  2QKB A;  1GOC A;  2B4J A;  1T7P A;  2OPQ A;  1IKV A;  3IG1 A;  4FM2 A;  5J2Q A;  1S5J A;  4DFM A;  4CGG A;  4CEO A;  3F73 A;  5J2M A;  3SUN A;  4FJ9 A;  1ZBH A;  2X74 A;  3HT3 A;  3T19 A;  1TAQ A;  2KFN A;  4FLW A;  1RDA A;  4RW9 A;  4FXD A;  1JL1 A;  3HPG A;  1VSD A;  2R7Y A;  5KTQ A;  3KLH A;  1W9H A;  3DRP A;  1B92 A;  2ZE2 A;  1C1C A;  3E01 A;  3SI6 A;  2HMI A;  1REV A;  4O55 A;  2G8W A;  4FJI A;  3AVL A;  1RNH A;  3ULD A;  1YTU A;  4BDY A;  3DRR A;  4HTU A;  4Z4G A;  4B8A B;  1KRP A;  1WAF A;  3QNN A;  4FLV A;  3U3Y A;  4FZY A;  1RT2 A;  1S1U A;  1A5V A;  5C42 A;  4CIG A;  3NHG A;  2VG7 A;  2Q3S A;  2YNF A;  4DTU A;  4Q0B A;  1XHZ A;  3LP0 A;  4I9Q A;  2XY5 A;  1WSH A;  1UOC A;  1C1B A;  1DLO A;  1RT6 A;  3ZSR A;  4CER A;  2YNI A;  1JLG A;  1U49 A;  1C1A A;  3S9H A;  1RT7 A;  1RDD A;  3RMA A;  2I5J A;  2PYL A;  4IG0 A;  1TKT A;  4CFD A;  4KB0 A;  1NK9 A;  1KLM A;  3ZSW A;  3KLE A;  4DQS A;  1U45 A;  4CK2 A;  3HXM A;  1T05 A;  1JL2 A;  3K2P A;  4IBN A;  4UQG A;  3LZJ A;  1BIZ A;  3OYI A;  4C8O A;  3SPZ A;  2G8U A;  4FZX C;  3OVN A;  3AO2 A;  4HCC A;  1FK9 A;  1RBS A;  2EHG A;  1ZBF A;  1ZBI A;  4PUO A;  1G15 A;  3MXJ A;  2YHB A;  3HST B;  3SUO A;  1A5W A;  1KTQ A;  4N5S A;  3LAL A;  4Y1D A;  1I39 A;  2YKM A;  5KRS A;  4QOZ B;  1VSE A;  3VQB A;  1ZBL A;  3LWL A;  1BL3 A;  3SYZ A;  1EET A;  4ID1 A;  3DLG A;  3SJJ A;  4FZZ A;  1CLQ A;  1C6V A;  4J2A A;  1X9W A;  2IDO A;  1SKW A;  1TKZ A;  3S3N A;  4O44 A;  4DFK A;  2DFF A;  3BGR A;  4CJL A;  5T7B A;  3IRX A;  3V6D A;  3AA2 A;  3MEG A;  1BGX T;  1BI4 B;  4AHT A;  4DMN A;  5E41 A;  1SL1 A;  1FKO A;  3ISN C;  2FBT A;  1NOY A;  3VA0 A;  1VSJ A;  1S6Q A;  3OY9 A;  1HYZ A;  4K8X A;  1U4B A;  1NK0 A;  2Z1G A;  1JLE A;  5HRP A;  4E7L A;  4M3R A;  3A2F A;  1A5X A;  4E1N A;  4DLE A;  4W5T A;  3T1A A;  1BQN A;  3NAE A;  1JLC A;  2XRI A;  3KK2 A;  3K58 A;  1KCF A;  3AA3 A;  5KGW A;  4CJ3 A;  4CGI A;  2P51 A;  3AVF A;  4Q5V A;  5HRO A;  5I42 A;  5KRT A;  3NF9 A;  4LSL A;  5CZ2 A;  4QCL A;  4FW1 A;  4M42 A;  3AVA A;  4FJL A;  3OS2 A;  1GOB A;  4CCH A;  2X6N A;  4JS5 A;  2HHV A;  1U47 A;  1HYS A;  4OKJ A;  3O4N A;  4W5R A;  2O4I A;  4CJF A;  3K59 A;  1NKC A;  4FJK A;  2B6A A;  3KK3 A;  3LDS A;  4DQQ A;  1J9A A;  1SV5 A;  2W42 A;  1N6Q A;  3IAY A;  4FJN A;  2AJQ A;  4KKO A;  4JRQ A;  3KKS A;  4ZTJ A;  2D5R A;  4OKE A;  1JLQ A;  1S1W A;  2IAJ A;  3F9K A;  4M3Z A;  2ETJ A;  4HUG A;  3MED A;  3RMC A;  1BCO A;  1ASU A;  1TK8 A;  2G8K A;  4C8N A;  2XY7 A;  4OPJ A;  4CF9 A;  3ASM A;  3QEV A;  2P5O A;  1JKH A;  1QS4 A;  2ITG A;  4DTR A;  4DSE A;  1D8Y A;  2FBX A;  3KKR A;  1JLB A;  3AA5 X;  2GUI A;  1Z25 A;  3AVI A;  4M3Y A;  4W5N A;  4HVJ A;  1JXE A;  4FJ7 A;  1HNV A;  3B6P A;  3O3G A;  3PX0 A;  2YKN A;  3OS1 A;  4F2R A;  3NGY A;  3DOL A;  1LAW A;  4BDP A;  4KRE A;  3SUQ A;  3AA4 A;  1QQC A;  2Z1I A;  3PUF A;  5DK5 A;  4B9U A;  4N76 A;  4PQU A;  2XY8 A;  1TGO A;  4LH5 A;  4JLH A;  5CYQ A;  3KD1 E;  2ZQB A;  3I8D A;  4BDZ A;  1LW2 A;  1B9D A;  3LAM A;  4J2B A;  4I2Q A;  2YNH A;  1X1P A;  4CF1 A;  4E89 A;  4DWI A;  2F8S A;  1RTD A;  3ZSX A;  3PX6 A;  2QKK A;  3LP1 A;  3NH0 A;  4CFB A;  4NYF A;  4LD0 A;  4W5Q A;  3RRH A;  3AV9 A;  4CFA A;  3VQ4 A;  1VSI A;  3HVT A;  1TK0 A;  1SL0 A;  4F3T A;  3QEP A;  4OPK A;  1XWL A;  4M41 A;  1L5U A;  4KV8 A;  3QNO A;  4CEB A;  3KJV A;  2KZZ A;  1NK4 A;  1RCH A;  2RN2 A;  4L8R B;  1BI4 A;  4DTM A;  3SCX A;  4E0D A;  3DMJ A;  3VQQ A;  4JRP A;  3M8Q A;  1CXQ A;  4CIF A;  1KVA A;  1O1W A;  3HM9 A;  4BWJ A;  3NE6 A;  4DTO A;  4LY7 A;  3OYH A;  1BIS A;  3O3H A;  3HP9 A;  3OYN A;  4H8K A;  2D0C A;  3SV3 A;  3AO3 A;  3VQ5 A;  3MAQ A;  3K5M A;  4E19 A;  2DFH A;  3VQ8 A;  5CZ1 A;  3SNN A;  1UA1 A;  3HPH A;  1KVC A;  4CJ5 A;  4BE0 A;  4FLX A;  1I3A A;  3VQP A;  3QET A;  2DFE A;  1RDB A;  5SWM A;  4O4G A;  4KB1 A;  1LWE A;  3VQ6 A;  1L3S A;  2PYJ A;  2HW3 A;  3P5J A;  4IKF A;  4OVL A;  5K14 A;  5KI6 A;  3LAN A;  1GOA A;  2ATQ A;  4CJE A;  4Z4C A;  3KK1 A;  3EYZ A;  1MU2 A;  3LWM A;  4ZHR A;  3QEI A;  4EZ9 A;  2PY5 A;  3ZSZ A;  3NH2 A;  3V9Z A;  1ITG A;  1U48 A;  3CQ8 A;  3P83 D;  3RRG A;  1RT1 A;  2B5J A;  2HHT A;  1TVR A;  3I0R A;  4E1M A;  1TV6 A;  2EX3 A;  3C95 A;  1CXU A;  3ALY A;  3SQ0 A;  4ID5 A;  3DLK A;  3DLH A;  4OGC A;  3CG7 A;  4DS4 A;  4RG8 A;  1S9E A;  4KRF A;  3M8S A;  2P1J A;  4KHN A;  2A1R A;  4OGE A;  1HJR A;  4M3U A;  3WNF A;  1RT5 A;  1J5O A;  2OZM A;  1IO2 A;  3OS0 A;  4Y1C A;  1LWC A;  4CEC A;  5J2N A;  1S1V A;  3H08 A;  3LP2 A;  1S1T A;  4CJT A;  3AO1 A;  3ZT1 A;  2HHS A;  5JS2 A;  4NCB A;  3VQ7 A;  2FBV A;  4MFB A;  1Q9X A;  4KHS A;  2HVI A;  4M3T A;  2JGU A;  1Q9Y A;  4CHP A;  3QEW A;  3ZSQ A;  2WON A;  4NYN A;  3C6U A;  4IFV A;  4LSN A;  4KI6 A;  4DSI A;  4CHN A;  4DQP A;  4KTQ A;  3T3F A;  3TAP A;  2D0A A;  4W5O A;  2QK9 A;  3QLH A;  3QIP A;  4O0J A;  2FC0 A;  1WSE A;  3C6T A;  2G8H A;  3AO4 A;  1IH7 A;  2DY4 A;  4FK2 A;  2WOM A;  4CGJ A;  4B9M A;  4FJJ A;  4HCB A;  3B6O A;  3L8B A;  1NK5 A;  4Z4F A;  2HHU A;  4B08 A;  4H4M A;  3VN5 A;  2HNY A;  2YV0 X;  4CJK A;  4XIU A;  2FBY A;  3QIN A;  4KFB A;  4BWM A;  3VA3 A;  3EZ5 A;  4DTX A;  4O0I A;  4CJ4 A;  4CK1 A;  2KQ2 A;  3L2U A;  3NBP A;  1HPZ A;  2XO7 A;  3HK2 A;  1DTQ A;  2IC3 A;  4N56 A;  3PO4 A;  1VSK A;  4CIE A;  4CEQ A;  1S1X A;  2RPI A;  1T8E A;  5JS1 A;  1IKW A;  1NJW A;  3AVN A;  1NK6 A;  1XI1 A;  3V1Q A;  1WSI A;  2KZM A;  1RTJ A;  1WSF A;  4NCG A;  4R5P A;  3K57 A;  3V9W A;  4CF2 A;  1C0T A;  4IG3 A;  1QE1 A;  3QER A;  3TAE A;  2OPR A;  4CE9 A;  4FJH A;  4CHZ A;  4DTS A;  1RTI A;  4CGH A;  3OJU A;  1KFD A;  4EP4 A;  4H4O A;  3DOK A;  3LP3 A;  2XHB A;  4FK4 A;  3DI6 A;  3KLF A;  1TL1 A;  1Q8I A;  3TAN A;  4Z4E A;  5I3U A;  2HHQ A;  3V4I A;  1KLN A;  4ELU A;  3LPT A;  1TL3 A;  1X9S A;  2BE2 A;  1WN7 A;  3L3V A;  3LZI A;  4CED A;  3MEE A;  4CJU A;  4I7F A;  3L2W A;  4DQI A;  4I9L A;  3TAB A;  1LWF A;  1C0U A;  2D0B A;  4Z0U A;  2IGI A;  2G8V A;  4CJV A;  4YNQ A;  3PY8 A;  3AVM A;  1Y97 A;  4FM1 A;  3VQE A;  3OYB A;  1LV5 A;  1RBU A; 
#chains in the Genus database with same CATH topology
 4N47 A;  4CZF A;  1NK7 A;  4EHT A;  3NDK A;  2GEL A;  3LDO A;  5DM6 L;  4WE1 A;  3A5N C;  1C0F A;  1OH6 A;  3OJS A;  2QXF A;  4ICL A;  3DRS A;  1HRH A;  4DV3 K;  1T44 A;  1P90 A;  4KHU A;  2X6S A;  1S22 A;  3MXI A;  2BDP A;  4FLZ A;  1ZBU A;  2P9U A;  1D4X A;  1YHQ N;  1HMV A;  3OYD A;  2UUC K;  1WNS A;  1VQL N;  4M45 A;  4FWN A;  4MDA A;  4DS5 A;  1RT4 A;  1EO1 A;  4RW4 A;  4CJQ A;  5CE3 A;  4JNE A;  3O4Q A;  3QES A;  2VWB A;  4G1Q A;  3HOS A;  4YOT A;  4FLY A;  3BZC A;  3L2Q A;  3HPO A;  3VTI A;  1HPM A;  3KVG A;  3OYM A;  3IFR A;  4JI1 K;  3VF6 A;  2PFU A;  4B1Z A;  4QS8 A;  4CJR A;  1RIL A;  4BAC A;  4OLB A;  2IS3 A;  4YHH K;  3P31 A;  4TSX A;  5AZJ B;  1BOT O;  4CZK A;  3H3N O;  2D0P A;  3F5T A;  4DTJ A;  2QWM A;  2OAN A;  1HQU A;  4FVM A;  4H0T B;  1VSH A;  3WNG A;  1KAZ A;  1OH8 A;  1QQN A;  1EKE A;  4KPY A;  2A42 A;  4F4K A;  1N33 K;  1HUX A;  3G10 A;  4E3S A;  4JD2 A;  3PO5 A;  2KTQ A;  5EX5 A;  4DV5 K;  1BA0 A;  3SQ1 A;  4CHO A;  3TAQ A;  2YJE A;  4DF4 A;  1QHT A;  2P9L A;  2PZS A;  4B9N A;  1JLA A;  3ID6 A;  1ZBS A;  3SMS A;  4IFY A;  3SAG A;  2VG5 A;  4IOX A;  4JKE A;  4DFP A;  4CJ7 A;  3KLI A;  3LDP A;  3OBW A;  3T1H K;  5AQP A;  5FRO A;  1XNR K;  4CF8 A;  1L3U A;  2G8F A;  3V9X A;  4O5B A;  1Z26 A;  4B9Q A;  2E6M A;  3BP8 A;  2Z1H A;  5BN8 A;  3NFA A;  4DQR A;  3LPU A;  3TWH A;  5CY4 A;  5E84 A;  5FRN A;  4DU4 A;  4LF5 K;  3UKR A;  3C6H A;  3WNH A;  1NWK A;  4BGA A;  3S3O A;  4BQZ A;  4QAG A;  3V81 A;  1TK5 A;  1VSL A;  2YHX A;  4DU3 A;  1NK8 A;  3H45 C;  3SBG A;  3AVH A;  4BRC A;  4DV2 K;  5CYM A;  2YHW A;  4QS9 A;  2QA4 N;  1NJZ A;  2YHY A;  4C1N I;  1SUQ A;  3LAK A;  1U2V B;  3RMD A;  1IG8 A;  1ASW A;  4AHR A;  3O9S A;  4HUF A;  4FYD A;  1W0H A;  3DWL A;  5JVG L;  4AIL C;  4GVM A;  4B9T A;  4LF7 K;  4B3M K;  5LMU K;  3OYF A;  2HF4 A;  3CYM A;  4FK0 A;  1ESV A;  2RHK A;  3NF7 A;  4FWP A;  3DJC A;  4CHQ A;  4CZE A;  3ZX0 A;  4ILJ A;  4GMJ B;  1Q86 O;  4EP5 A;  2ASO A;  1K6Y A;  2P9K A;  2Q0U A;  3TAG A;  3MXM A;  4F2S A;  1GOC A;  4H5T A;  4J8F A;  4DFM A;  1YJW N;  3SUN A;  4C23 A;  2X74 A;  5AQS A;  5M1O A;  1HKB A;  1VSD A;  3HPG A;  3ZET B;  5KTQ A;  4MO5 A;  2ZE2 A;  1NNE A;  1C1C A;  3SI6 A;  1K8K A;  4O8U A;  4FJI A;  3AVL A;  1RNH A;  3ULD A;  4BDY A;  4FLV A;  3U3Y A;  5KPT A;  4FZY A;  3MX5 A;  3O8M A;  4CIG A;  3VGM A;  4NXM K;  4I9Q A;  5AQR A;  2XY5 A;  1UOC A;  4H0O A;  5MLC Q;  5EXW A;  1C1A A;  3S9H A;  3KHY A;  1J5E K;  2PYL A;  4IG0 A;  2A40 A;  2KKZ A;  4DQS A;  3BUZ B;  1U45 A;  3K2P A;  5KQD A;  2D4W A;  3FR0 A;  4FZX C;  1FK9 A;  1ZBF A;  1G15 A;  4B3S K;  1A5W A;  1YI2 N;  1KTQ A;  3GBT A;  3CCQ N;  3LDL A;  3ZLJ A;  4QOZ B;  1KAY A;  3VQB A;  2V7Z A;  4ID1 A;  4BG9 A;  3DLG A;  4DUY K;  1CLQ A;  2IDO A;  1SKW A;  3MEG A;  4AHT A;  1HNW K;  1OKJ A;  4NLC A;  1VSJ A;  3CER A;  3O9R A;  4OO1 J;  1U4B A;  4M3R A;  3A2F A;  3DXM B;  4FWM A;  4LF8 K;  4C1N K;  2XRI A;  4Q5V A;  5KGW A;  2P51 A;  3AVF A;  4L3Q A;  1SZ2 A;  3NF9 A;  5KRT A;  4QCL A;  3WEE A;  3D2F A;  3H1V X;  2Q36 A;  3K9J A;  4KKO A;  4BRG A;  2PAV A;  4GY2 B;  4BC4 A;  1ASU A;  1EWQ A;  1YIJ N;  4OPJ A;  3ASM A;  1JKH A;  2ITG A;  2WTU A;  3KKR A;  3AA5 X;  2GUI A;  4M3Y A;  4CZH A;  3NMU A;  3B6P A;  2YKN A;  3OS1 A;  2VQF K;  3P4I A;  5M1P A;  1LAW A;  4BDP A;  3TSU A;  4KRE A;  2O8F A;  5DK5 A;  4B9U A;  4N76 A;  3O9Q A;  4MO4 A;  1JCE A;  5BPL A;  1LW2 A;  4I2Q A;  4E89 A;  4DWI A;  3ZSX A;  3NH0 A;  4NYF A;  4DV1 K;  3U4L A;  1NU0 A;  3CME N;  3QEP A;  4BR7 A;  3MN9 A;  1L5U A;  4NO7 A;  5BRF A;  4R79 A;  2E1Z A;  2KZZ A;  1NK4 A;  4PKG A;  4L8R B;  3SCX A;  4E0D A;  1CXQ A;  1BIS A;  5FPN A;  3HP9 A;  2NRT A;  3QFP A;  5KPR A;  4H8K A;  2AA4 A;  4YOU A;  5CZ1 A;  3VQ8 A;  3QET A;  1I3A A;  3TPQ A;  2BTF A;  4BRN A;  4KB1 A;  1LWE A;  3TSQ A;  2UU9 K;  3VQ6 A;  1L3S A;  3D7E O;  3LAN A;  2BUP A;  4WFA L;  4EZ9 A;  5JLF A;  1VQK N;  1RFQ A;  1U48 A;  4LF6 K;  4WFB L;  3P83 D;  3T69 A;  2HHT A;  3I0R A;  2QI2 A;  1TV6 A;  1K8A O;  4IDH A;  3DLK A;  3DLH A;  4H0X B;  3CG7 A;  4DS4 A;  1SAZ A;  4IJA A;  1S9E A;  4YOW A;  4KRF A;  2P1J A;  4OGE A;  5GAG P;  4M3U A;  1IO2 A;  1NGI A;  3OS0 A;  4Y1C A;  1LWC A;  3LM2 A;  1IBL K;  4Y0W A;  3EE8 A;  3H08 A;  3LP2 A;  1S1T A;  2HHS A;  3ZT1 A;  1P8Z A;  4NCB A;  2FF6 A;  1NLV A;  3THY A;  3J7Z O;  4M3T A;  2JGU A;  2Q97 A;  3ENH A;  4BRE A;  2WON A;  3VF4 A;  3EKS A;  3FZM A;  4PL8 A;  2FSJ A;  3T3F A;  2D0A A;  4W5O A;  4EIA A;  1NGC A;  5ADX H;  3C6T A;  4JI5 K;  3E1Y A;  3HM8 A;  2HMP A;  1ILY A;  1U2V A;  5HOO A;  2P9P B;  2UXC K;  3WT0 A;  2WOM A;  4FJJ A;  4Z4F A;  3B6O A;  1NK5 A;  2HHU A;  2IVP A;  3N4P A;  5M1K A;  2YV0 X;  4KFB A;  4BWM A;  3EZ5 A;  2P9I B;  1MWM A;  1HLU A;  1WBB A;  1DTQ A;  2IVO A;  5F0X A;  3VER A;  1NGH A;  3RSE B;  1S1X A;  3MX2 A;  4MLE A;  4YOX A;  2HOE A;  1IKW A;  1NJW A;  1NK6 A;  2KZM A;  1C0T A;  5AQY A;  4FJH A;  1RTI A;  1Q82 O;  4H4O A;  3DI6 A;  3KLF A;  3S41 A;  1KLN A;  3LPT A;  3MK6 A;  2P9P A;  1X9S A;  5FPM A;  4K25 A;  3L2W A;  3WQT A;  4Z0U A;  4YNQ A;  3AVM A;  4FM1 A;  4CZL A;  1HNZ K;  1LV5 A;  4KHQ A;  3U6F A;  1VAZ A;  4PA1 A;  3C6A A;  5HP1 A;  4OJR A;  4CZG A;  1FXX A;  1XC9 A;  4DFJ A;  4F8R A;  3OYJ A;  3CD6 N;  2ITM A;  1BHL A;  2HBJ A;  3SK3 A;  5AR0 A;  3ZT3 A;  2QXL A;  4AF1 A;  3O3F A;  1RDC A;  1JXB A;  3ITH A;  3UKU A;  2A3Z A;  2O8D A;  4DSF A;  2IIR A;  4RW7 A;  1J53 A;  3ATU A;  3ZT2 A;  2QWR A;  3CJB A;  1KC8 O;  3M8R A;  2HVH A;  4FPB A;  4AHU A;  4A2A A;  1NGF A;  5HRN A;  3ZT0 A;  4DSJ A;  3WXI A;  3H3O B;  4BRO A;  3CCU N;  4O8K A;  3CFR A;  3BDP A;  3T7Z A;  2A6A A;  4WCE L;  2Z1J A;  1XC3 A;  2WFB A;  1ZXO A;  3QDK A;  4FPA A;  2Y1J A;  4CHY A;  5M1Q A;  4OX9 K;  3TAF A;  1BQM A;  4LF4 K;  1RBT A;  1L3T A;  4FVU A;  5FPE A;  3LDN A;  3TAM A;  4KO0 A;  3C94 A;  1GLF O;  1VQO N;  4IOC L;  4DG1 A;  3DYA A;  1IG9 A;  1XQS C;  4KHY A;  4FM0 A;  3DXM A;  1VQM N;  2UUB K;  4CEA A;  1N34 K;  1KVB A;  3VEZ A;  3OYK A;  3MCP A;  3K5O A;  3KTQ A;  1YJ9 N;  2GWJ A;  2KFZ A;  3CFO A;  3ZCM A;  3IS9 A;  3OYG A;  1HJO A;  4ISE A;  5D3G A;  3A5M C;  3QB0 A;  1LAV A;  3EL2 A;  4CBU A;  3NGI A;  5M1N A;  3CCE N;  1B9F A;  2HHX A;  4OKK A;  1T3V A;  3OYA A;  2W40 A;  3FZF A;  3A5L C;  2IVN A;  1FJG K;  3PIO L;  3RR7 A;  5AZI B;  3OYE A;  4JHD A;  4CI6 A;  3V9U A;  3NCI A;  1IKX A;  4ELT A;  3U9D A;  1NKE A;  3LL3 A;  1OVQ A;  3KIO A;  1IKY A;  2OA8 A;  3SZ2 A;  3E66 A;  2HHW A;  3HP6 A;  1ASV A;  4YOV A;  3JSM A;  2FSK A;  3WQU A;  4XH1 A;  4A2B A;  4YFU A;  4KAZ A;  3CC7 N;  4FJG A;  1BIU A;  1TKX A;  4OLA A;  2A41 A;  5EY4 A;  5IT9 O;  3VEY A;  4CGD A;  4FJ5 A;  1KFS A;  3M8P A;  4AH9 A;  5HRS A;  3HZ6 A;  2DPN A;  5AQK A;  2ZWH A;  4M7X A;  4K8Z A;  1VRT A;  3L6Q A;  1VSF A;  4ELV A;  4RW8 A;  1N8R O;  3MEC A;  3O1B A;  5BR8 K;  3D0P A;  3AO5 A;  3DM2 A;  3FFK B;  1UWB A;  3D2F B;  4CEF A;  3EY1 A;  3CM6 A;  4AHV A;  1L3V A;  4C8L A;  4DU1 A;  1TYQ B;  4CJW A;  1EP4 A;  4BRK A;  3DLR A;  4DR7 K;  3IMX A;  4DUZ K;  1HYV A;  4Z94 A;  4FLU A;  1VQ9 N;  3SV4 A;  5BRE A;  2P9L B;  4B1W B;  3V1R A;  4BE2 A;  4AHS A;  3SQ2 A;  4FL9 A;  3O9T A;  1TKD A;  2YI1 A;  3THW A;  2IOC A;  2OPS A;  4AM7 A;  4EZ6 A;  4I6M A;  1RTH A;  4B8C A;  3DLB A;  3TAR A;  3G25 A;  1T7P A;  2OPQ A;  1IKV A;  3IG1 A;  3MN5 A;  3VTH A;  4H5N A;  4CGG A;  5J2M A;  3T19 A;  3O9U A;  4FLW A;  4RW9 A;  1ATS A;  3D6R A;  4DR1 K;  2HMI A;  1REV A;  3R9P A;  5C2F A;  3RVC A;  4B8A B;  2W41 A;  1WAF A;  3VGK A;  1A5V A;  3J81 O;  4DTU A;  2Q3S A;  2YNF A;  4DR2 K;  1HNX K;  2ASM A;  4FWK A;  1DLO A;  4CER A;  1BG3 A;  1JLG A;  1RT7 A;  1RDD A;  3RMA A;  4JKC A;  4PKH A;  1NK9 A;  3KLE A;  4V19 S;  4H5W A;  3HXM A;  1T05 A;  3AAP A;  1BIZ A;  3OYI A;  2G8U A;  4A59 A;  3OVN A;  2YJF A;  4O5F A;  4PUO A;  2JWK A;  2YHB A;  3HST B;  3SUO A;  4Y1D A;  3M3Z A;  2YKM A;  5KRS A;  1BL3 A;  3SYZ A;  1DT9 A;  1LCU A;  4FZZ A;  1OVY A;  1C6V A;  4JI4 K;  4DFK A;  3BGR A;  4CJL A;  5T7B A;  3IRX A;  5TKW A;  3V6D A;  4BRM A;  1BGX T;  3ZEU B;  5E41 A;  5GAH P;  1RDU A;  3ISN C;  2UXD K;  3OY9 A;  2HHH K;  1HYZ A;  3L0Q A;  4M7Y A;  5LL6 Z;  4E7L A;  4BR2 A;  2UXB K;  4DB3 A;  4W5T A;  3NAE A;  1JLC A;  4BC3 A;  4EAH D;  1NGB A;  3AA3 A;  4JKF A;  4CGI A;  5I42 A;  1W2B M;  4LSL A;  2HBL A;  3CJ9 A;  3OS2 A;  1GOB A;  3HBT A;  1YIT N;  2X6N A;  4JS5 A;  4CCH A;  1HYS A;  4CJF A;  3RSE A;  1EWR A;  2B6A A;  2AJQ A;  2W42 A;  1CZA N;  5ADX A;  3KKS A;  4JI8 K;  2D5R A;  3C0B A;  1JLQ A;  4AM6 A;  4HUG A;  3MCA B;  5AQX A;  4XH5 A;  2VYP A;  4K42 A;  2P5O A;  1QS4 A;  1D8Y A;  2GX9 A;  1JLB A;  2QTD A;  3U9Z A;  3AVI A;  1Z05 A;  3O3G A;  3NGY A;  3DOL A;  4RCH A;  1W7A A;  1WUA A;  3SUQ A;  1QQC A;  2Z1I A;  3PUF A;  4ILG B;  2Q0R A;  1TGO A;  4U7B A;  4JLH A;  2Q2R A;  2ZQB A;  3CIP A;  3LP1 A;  4CFB A;  3HTV A;  3RRH A;  4CFA A;  3VQ4 A;  4GV3 A;  1VSI A;  1TK0 A;  1SL0 A;  3PLA A;  1BDG A;  5LMN K;  5CHI A;  3VQQ A;  4JRP A;  1O1W A;  4B3T K;  4BWJ A;  1YJN N;  3KK7 A;  1QVF M;  3VEV A;  3OYN A;  2D0C A;  3SNN A;  3K5M A;  1BWF O;  3CI5 A;  3HPH A;  4CJ5 A;  4O4G A;  5ELZ A;  2QEX N;  3P5J A;  1M1K O;  4CJE A;  1GOA A;  3PX6 A;  4Z4C A;  3LWM A;  4ZHR A;  3NH2 A;  1ITG A;  1K73 O;  1RT1 A;  4ILH A;  1GLD G;  3C95 A;  4ID5 A;  4YDU C;  1QQO A;  3JAM O;  4RG8 A;  2GTD A;  1VQP N;  2NZT A;  5BPN A;  1HJR A;  3WNF A;  1RT5 A;  4CEC A;  5J2N A;  4ISF A;  4YY3 K;  1X9J A;  2FBV A;  4MFB A;  1Q9Y A;  4CHP A;  3AAQ A;  3ZSQ A;  4NYN A;  3C6U A;  4LSN A;  5AQJ A;  4CHN A;  4YOR A;  2QK9 A;  2NRV A;  2FC0 A;  1IBM K;  1TUU A;  4DR4 K;  1BA1 A;  2F9T A;  2OTJ N;  1IH7 A;  2P9S B;  4DR6 K;  2DY4 A;  4FK2 A;  4CGJ A;  3IKM A;  4HCB A;  4BRF A;  3IUC A;  4B08 A;  2HNY A;  4CJK A;  1Q18 A;  3D2E B;  3VA3 A;  4AQY K;  1VQ6 N;  4O0I A;  2KQ2 A;  2IC3 A;  4CIE A;  3VEX A;  1BUP A;  2RPI A;  3CCL N;  5JS1 A;  3E9P A;  1WSI A;  4FWL A;  5AQV A;  3K57 A;  4JKG A;  4IG3 A;  4G9Z A;  1QE1 A;  4DTS A;  3OJU A;  4RTF D;  1KFD A;  4EP4 A;  5B8H A;  3DOK A;  2F7T A;  3WXK A;  4DHY A;  1TL1 A;  2P9U B;  2HHQ A;  3V4I A;  3ZET A;  2H3G X;  1TL3 A;  4Z4G A;  1WN7 A;  3EO3 A;  2G8V A;  1C0U A;  2QWQ A;  4BGB A;  3OYB A;  3QBX A;  1CXU A;  1XMO K;  3D45 A;  2P9N B;  1Q81 O;  2GV9 A;  3L3U A;  4WQ4 C;  1T6C A;  2KW4 A;  5I9E B;  3B8A X;  4I2P A;  2P5G A;  4IEI A;  3NF8 A;  3CC4 N;  4KTW A;  2LSN A;  2V52 B;  1QVG M;  1QSS A;  4DLG A;  1T03 A;  1Q7Y O;  4WQ5 C;  4JN4 A;  4B9L A;  4FJ8 A;  4UY8 O;  1U04 A;  4MQ3 A;  3CHW A;  3R8E A;  5LJW A;  3ZT4 A;  3CPW M;  1FKP A;  3PIP L;  3J7Y P;  4DCH A;  2JLE A;  5SZT A;  4JS4 A;  4GKK K;  5KGX A;  4B1X B;  4WF9 L;  3V9S A;  3KWG A;  1CZ9 A;  4B1U B;  2E2N A;  3U3G A;  4E1J A;  3L2V A;  2HBM A;  5J1E A;  1D9F A;  4KHW A;  2G8I A;  5F1X A;  5HLF A;  3GOI A;  3SUP A;  5EU7 A;  1VQ5 N;  3OYC A;  1JLF A;  1EXQ A;  4KI4 A;  3W3D A;  4CEE A;  2X78 A;  1NGA A;  4BY9 C;  4RW6 A;  3CC2 N;  4BRP A;  3BF3 A;  2BAN A;  3WNE A;  2Q31 A;  5AFU H;  2PBD A;  2NRR A;  3SAH A;  1T6D A;  4YDU A;  2VWJ A;  5LJV A;  3O80 A;  3K0S A;  3THV A;  3CF5 L;  1TAU A;  3QIO A;  1WSG A;  1S9G A;  3RR8 A;  4IJN A;  3TSP A;  2YNG A;  4CFC A;  1HQE A;  4BRA A;  5BR9 A;  3NGZ A;  4Z4H A;  3ULE B;  4RWT A;  4C8K A;  5AJ3 K;  4H5V A;  3VOV A;  1HX1 A;  2O8C B;  4LFB K;  1SL2 A;  1NMD A;  1YAG A;  3SPY A;  1YXQ A;  1RBV A;  3VQC A;  3HI0 A;  3G71 N;  3RWU A;  1WOQ A;  2CGJ A;  5LY3 A;  1SKS A;  3HL8 A;  3BF1 A;  3OYL A;  2E2Q A;  5FDL A;  4Z4I A;  3NVM A;  3THX B;  4GVE A;  3HJF A;  4PWD A;  1D9D A;  4BRI A;  1X9M A;  1DGK N;  2O8B B;  2E4L A;  2RKI A;  2CH6 A;  3AVK A;  1ZC6 A;  1ZYQ A;  5AFU A;  4M3W A;  1RBR A;  1YUW A;  4IXC A;  4E7J A;  1NGE A;  3PV8 A;  3S3M A;  3OA9 A;  4A62 A;  1NKB A;  2NLX A;  3HO1 A;  2ZD1 A;  1CZB A;  3HVR A;  3SAF A;  1NJY A;  4E7H A;  2GWK A;  1NGD A;  4M3X A;  1GLJ O;  2HNZ A;  3AVG A;  4JK7 A;  1YTA A;  4JKB A;  3EN9 A;  2GUP A;  3AVB A;  2HND A;  5HRR A;  3J80 O;  1UAX A;  4X65 K;  3ZSO A;  5HBM A;  4B9V A;  1KSP A;  4DSK A;  2CGK A;  4KTZ A;  1S6P A;  1I94 K;  2BGG A;  3SMP A;  2E8A A;  4PY5 A;  4BRD A;  4AHC A;  1D5A A;  1W97 L;  3WXJ A;  1O13 A;  1K9M O;  2WUS A;  3ULE A;  3CXC M;  5AQT A;  2VG6 A;  3DLE A;  1VQ7 N;  3CQY A;  1RDW X;  4CES A;  2BH1 A;  5FRM A;  1E3M A;  4H0P A;  5C25 A;  1MA9 B;  4PL7 A;  1IJJ A;  3UKR B;  5GAD P;  1HNI A;  3ZSV A;  1RGI A;  4HUE A;  3UIQ A;  3T1Y K;  1FW6 A;  4CK3 A;  4C8M A;  2EWS A;  5AQW A;  1X3M A;  3VES A;  2ZJR L;  3P1G A;  3SQ4 A;  2QKB A;  4BVO A;  4OPH A;  2KHO A;  1ZBH A;  4WFN L;  3KZB A;  1RDA A;  4H0V B;  1TYQ A;  3KLH A;  4A5B A;  5BRD A;  4CZM A;  2P9I A;  1YTU A;  3FLC O;  1KXP A;  3G6E N;  2I7P A;  4CZJ A;  3QNN A;  2Q1N A;  1RT2 A;  1S1U A;  1XUP O;  3AGK A;  5C42 A;  3HRG A;  2O8E B;  2VG7 A;  5AQG A;  4A61 A;  4Q0B A;  4FWO A;  5A2Q O;  1WSH A;  2E1Y A;  1C1B A;  5BPM A;  3OBY A;  4FWS A;  2YNI A;  2W6K A;  3A0I X;  3UKU B;  2O8D B;  1TKT A;  4KB0 A;  4JHD B;  2ZJP L;  2O8B A;  4CK2 A;  1JL2 A;  1JCF A;  4IBN A;  3LZJ A;  4C8O A;  3R3L A;  4HCC A;  1RBS A;  3DXK B;  1ZBI A;  4WQ4 A;  3MXJ A;  2D0O A;  3LAL A;  5E26 A;  1VSE A;  1ZBL A;  3BZK A;  3LWL A;  1EET A;  4CBW A;  4IO9 L;  3ZYY X;  4J2A A;  1TKZ A;  3S3N A;  2FF3 B;  2DFF A;  4LFC K;  4M63 C;  3AA2 A;  4BR9 A;  1E4F T;  2OCE A;  1SL1 A;  1V4S A;  1FKO A;  3VA0 A;  5GIO A;  1S6Q A;  3MN7 A;  4K8X A;  1NK0 A;  5HRP A;  5IWA K;  2I7N A;  4E1N A;  5C2D A;  4GV6 A;  4EFH A;  5GAE P;  3DLL L;  3L4I A;  4HTL A;  3K58 A;  3VGL A;  1KCF A;  5GIP A;  4BRL A;  5HRO A;  2WBN A;  5CZ2 A;  2D1K A;  2J4R A;  4FW1 A;  4M42 A;  4FJL A;  4DQ8 A;  2HHV A;  1U47 A;  4K0K K;  4OKJ A;  3O4N A;  4W5R A;  2O4I A;  4FJK A;  3IAY A;  2QWN A;  1J9A A;  1N6Q A;  4DV6 K;  3TU5 A;  3F9K A;  4M3Z A;  2G8K A;  5AQO A;  1TK8 A;  4CF9 A;  4DR3 K;  4DTR A;  4DSE A;  3J7A P;  5FPD A;  1Z25 A;  4CVN E;  4HVJ A;  3I55 N;  4W5N A;  3MDQ A;  3CJC A;  1OH5 A;  3TTC A;  4F2R A;  1X3N A;  3CCS N;  3AA4 A;  4PQU A;  3CJA A;  4JKA A;  4JYA K;  3I8D A;  3OTO K;  2P9N A;  4CF1 A;  1RTD A;  3QIC A;  3O4W A;  2YX6 A;  3AV9 A;  4B3R K;  3CMA N;  2P9S A;  4FOE A;  3MWP A;  1XWL A;  4M41 A;  4OPK A;  4X64 K;  1RCH A;  3N4Q A;  4JI3 K;  4PHT X;  4DTM A;  3M8Q A;  3HM9 A;  1KVA A;  3NE6 A;  2V7Y A;  4DTO A;  3AY9 A;  4LY7 A;  2E88 A;  5FLX O;  3O3H A;  3AO3 A;  3MAQ A;  2DFH A;  3THY B;  4BE0 A;  3QFU A;  1RDB A;  3ZX2 A;  2PYJ A;  4IKF A;  5AQN A;  4B3O A;  2ATQ A;  3EYZ A;  3QEI A;  1J6Z A;  2PY5 A;  4F9O A;  3O6W A;  3CQ8 A;  3RRG A;  2B5J A;  3VMF B;  4E1M A;  4OGC A;  2E5L K;  3DXK A;  3M8S A;  4KHN A;  3L4Q A;  1WBD A;  2OZM A;  2F4V K;  3CQX A;  4CJT A;  1IV0 A;  3AGR A;  2FLO A;  3OHR A;  1Q9X A;  4JKD A;  1NJI O;  4NLB A;  3VPZ A;  2FSN A;  3CPE A;  3VEW A;  4KI6 A;  4DSI A;  3DAW A;  3TAP A;  1GLL O;  1C0G A;  3QIP A;  1NGG A;  5EVZ A;  1MDU B;  4CD3 A;  3GG4 A;  2VGM A;  3BY5 A;  4JAX A;  4B9M A;  2CGL A;  3FZH A;  3VN5 A;  3MN6 A;  2FBY A;  3WEE B;  4CK1 A;  3KWI A;  3L2U A;  3NBP A;  3HK2 A;  4N56 A;  4EHU A;  1VSK A;  4CEQ A;  1JJ2 M;  2O8E A;  3AVN A;  3V1Q A;  1RTJ A;  1VQ4 N;  3V9W A;  1Y64 A;  3J8A A;  3WUH A;  3O08 A;  3TAE A;  2OPR A;  4CE9 A;  4LFA K;  4CGH A;  4JI0 K;  3F2K A;  1SS6 A;  2XHB A;  1QQM A;  4Z4E A;  4B1Y B;  3M6G A;  4ELU A;  3K9K A;  3L3V A;  3LZI A;  4CJU A;  3MEE A;  3QBW A;  4I7F A;  2OTL N;  4I9L A;  1LWF A;  2VGN A;  3PY8 A;  3VQE A;  2RE2 A;  2QM1 A;  2YCH A;  5C10 A;  3HYF A;  1GLB G;  1VRU A;  4BE1 A;  1BCM A;  5AQZ A;  4GKJ K;  1GLE G;  5C0Y A;  3QML A;  3CM5 A;  3QEX A;  4E7I A;  3H6E A;  3CJ7 A;  1F21 A;  5C15 A;  4JD2 B;  3WXL A;  4CW7 B;  2E20 A;  5BN9 A;  4J2D A;  2OYQ A;  4XH4 A;  5BRH A;  1DTT A;  3L2R A;  4CJS A;  2QWL A;  3KLG A;  1HKC A;  1YVN A;  3CET A;  1QSY A;  2E6L A;  4BRH A;  2RF2 A;  3E9O A;  4IDK A;  1G99 A;  2NRX A;  3D2E A;  1R0A A;  3I0S A;  5CR4 A;  4KBO A;  1KAX A;  3ATV A;  3RMB A;  2GEM A;  3CCJ N;  1DKG D;  2HBK A;  3NH1 A;  3K5N A;  1VK0 A;  5AQL A;  2O8C A;  3LDQ A;  3PSF A;  5AQI A;  3O5B A;  3SJH A;  4JKG B;  3VQD A;  3PX4 A;  4CBX A;  1XHX A;  4BVP A;  3C7N A;  4B1V A;  3MWT A;  5C24 A;  4H5R A;  3TI0 A;  2NUB A;  3A5O C;  2YHA A;  4F3O A;  4CJP A;  2WC9 A;  1N5Y A;  4DSL A;  1EX4 A;  4FO0 A;  4HHT A;  3VF2 A;  5J2P A;  4QS7 A;  3ZSY A;  1LW0 A;  3HOT A;  1VSM A;  4MDB A;  1DEJ A;  2F96 A;  4FW2 A;  1V4T A;  3RTV A;  4CF0 A;  2ASP A;  2GBZ A;  3AVJ A;  3FFI A;  1QZ6 A;  3TTD A;  2OPP A;  3ID8 A;  4CD1 A;  1E4G T;  2Y1I A;  3FZK A;  1WB9 A;  1LOT B;  1J54 A;  1IBK K;  3KD5 E;  2ZGY A;  2HB5 A;  3C7N B;  4ZTF A;  4NB4 A;  1WLJ A;  5DM7 L;  3AVC A;  1HR0 K;  1YF5 L;  5JVH L;  3JYT A;  4CEZ A;  2O8F B;  1UA0 A;  4I6M B;  4U67 L;  1YT3 A;  3NVK A;  2A5X A;  5AQF A;  4MLH A;  3NF6 A;  3VQ9 A;  3TR8 A;  3VET A;  1SKR A;  3JS6 A;  1QTM A;  4FWR A;  4J2E A;  3VQA A;  4B9S A;  3CCR N;  4DF8 A;  1JCG A;  4DTP A;  3G0Z A;  3ENB A;  4IWV A;  4DTN A;  3CCV N;  2UYT A;  3ENO A;  4FSV A;  4FJX A;  4FLT A;  3EE9 A;  2VWK A;  3VEN A;  4FJM A;  2ZF5 O;  3THW B;  4E7K A;  4YOY A;  4IO8 A;  4DV7 K;  3QO9 A;  3WXM B;  4IEE A;  2DTU A;  3EEQ A;  1WAJ A;  2F8T A;  3JXU A;  1NOZ A;  3M1F A;  1XMQ K;  2ZM6 K;  4NCA A;  1C0M A;  1WSJ A;  2A1S A;  4JV5 K;  4N41 A;  4LC9 B;  1GLC G;  2O4G A;  1NM1 A;  3Q7B A;  3UE5 A;  4BR4 A;  5HL7 L;  4DKW A;  4GW6 A;  5M1F A;  2XY6 A;  5DMR A;  4PKI A;  3K5L A;  1NG9 A;  5AZI A;  4BQL A;  1QSL A;  5JMV A;  2OZS A;  4LH4 A;  3V1O A;  1YVU A;  2QWO A;  1NMN A;  4CGF A;  4FCY A;  1RT3 A;  4KH6 A;  3W0L A;  2NNW A;  1HKG A;  1NJX A;  1VHX A;  4WQ5 A;  2B4J A;  3A8Y A;  4FM2 A;  5J2Q A;  1S5J A;  3F73 A;  4CEO A;  4FJ9 A;  3HT3 A;  2KFN A;  1TAQ A;  1BU6 O;  4FXD A;  1JL1 A;  4XEI A;  3R6M A;  2R7Y A;  5JLH A;  5AQQ A;  1W9H A;  3DRP A;  2E2P A;  1B92 A;  3E01 A;  4O55 A;  2G8W A;  3DRR A;  4HTU A;  1VQN N;  1KRP A;  3PSI A;  5GIN A;  4LF9 K;  2NRW A;  3NHG A;  3GDQ A;  1XNQ K;  1N32 K;  4KHP K;  1XHZ A;  3LP0 A;  1N36 K;  3VEO A;  3ZSR A;  1RT6 A;  3MMV A;  4JI6 K;  1U49 A;  2P9K B;  3HSC A;  4DV0 K;  1VQ8 N;  2I5J A;  1KD1 O;  4BC2 A;  4CFD A;  3THX A;  1KLM A;  3ZSW A;  4JI7 K;  4JK8 A;  1OH7 A;  4UQG A;  5TKY A;  3SPZ A;  3AO2 A;  5KQ8 A;  2EHG A;  2HF3 A;  4N5S A;  1I39 A;  1U6Z A;  5AQU A;  3SJJ A;  3O1W A;  1S72 N;  1X9W A;  4O44 A;  5F2R A;  1GLA G;  1BI4 B;  5H1S Q;  4BRQ A;  4DMN A;  2FBT A;  1M90 O;  1NOY A;  4FWQ A;  3CCM N;  1S3X A;  3M5R A;  4IZ9 A;  3E9L A;  2Z1G A;  1JLE A;  1A5X A;  4DLE A;  3T1A A;  1BQN A;  2ZGZ A;  3KK2 A;  3SBT A;  3R1X A;  3LM9 A;  4CJ3 A;  1R59 O;  1H1V A;  4K41 A;  3AVA A;  3K59 A;  1NKC A;  4H03 B;  3LDS A;  3KK3 A;  4DQQ A;  1SV5 A;  3GE1 A;  4FJN A;  4JRQ A;  2QW9 A;  4ZTJ A;  4OKE A;  3F9M A;  4BR5 A;  1S1W A;  2IAJ A;  4FOI A;  2ETJ A;  3MED A;  3RMC A;  1BCO A;  2NRH A;  4C8N A;  3ZEU A;  2XY7 A;  5KPZ A;  3QEV A;  5C12 A;  1TUY A;  5AQM A;  2E2O A;  3CJ1 A;  2FBX A;  1JXE A;  4FJ7 A;  1HNV A;  3PX0 A;  4KH5 A;  3G4S N;  4GV9 A;  2ZJQ L;  4IOA L;  5AZJ A;  4JEP A;  3TTF A;  1NGJ A;  2QWP A;  2XY8 A;  4LH5 A;  4BG8 A;  5CYQ A;  3KD1 E;  1ATN A;  4J2B A;  4BDZ A;  1B9D A;  1EQY A;  3LAM A;  2JWL A;  2YNH A;  1X1P A;  3GL1 A;  2F8S A;  4WYB A;  2QKK A;  3C65 A;  4W5Q A;  4LD0 A;  1QHA A;  3HVT A;  4F3T A;  4X66 K;  4KV8 A;  3QNO A;  3EKU A;  4ISG A;  4CEB A;  3KJV A;  4K43 A;  4CZI A;  2RN2 A;  1BI4 A;  3DMJ A;  4CIF A;  2AP1 A;  3OYH A;  1MWK A;  4NXN K;  1KQS M;  4DV4 K;  3U8X A;  3SV3 A;  3VQ5 A;  4JI2 K;  4E19 A;  1UA1 A;  1KVC A;  3BEX A;  3H1Q A;  2W6L A;  3VQP A;  4FLX A;  2DFE A;  5AQH A;  5SWM A;  2HW3 A;  4OVL A;  5KI6 A;  5K14 A;  4A57 A;  3KK1 A;  3CFP A;  5EOY A;  1SQK A;  3UB5 A;  1MU2 A;  3ZSZ A;  1Z6R A;  3V9Z A;  4IFE A;  1TVR A;  2EX3 A;  3SQ0 A;  3ALY A;  2NRZ A;  3P38 A;  4BC5 A;  4A5A A;  3AAR A;  3FZL A;  2A1R A;  4H0Y B;  1J5O A;  1S1V A;  3AO1 A;  1NBW A;  5JS2 A;  3EZW A;  5JIC A;  3VQ7 A;  3IDH A;  3H46 O;  1ATR A;  4KHS A;  2HVI A;  3SLC A;  3QEW A;  4OPA A;  3ZX3 A;  4JK9 A;  4IFV A;  4DQP A;  4KTQ A;  2UUA K;  3QLH A;  3I56 N;  4O0J A;  1WSE A;  4X62 K;  2G8H A;  3AO4 A;  2FXU A;  3FGU A;  3L8B A;  2VCP A;  2VQE K;  3I8B A;  1K8K B;  4H4M A;  4XIU A;  3QIN A;  4KH4 A;  4DTX A;  4CJ4 A;  1HPZ A;  2XO7 A;  4GNI A;  3P39 A;  3PO4 A;  1T8E A;  1XI1 A;  4R5P A;  1WSF A;  4NCG A;  4JKH A;  4CF2 A;  4DR5 K;  2V51 B;  3I33 A;  3OW2 M;  3QER A;  2F9W A;  4CHZ A;  1QZ5 A;  3LP3 A;  4BR0 A;  4FK4 A;  4HWI A;  1Q8I A;  3FE1 A;  3TAN A;  5I3U A;  2HST A;  2BE2 A;  4DQI A;  4CED A;  2CH5 A;  3TAB A;  2D0B A;  2IGI A;  4CJV A;  1BO5 O;  2KLA A;  3Q7C A;  1Y97 A;  1RBU A; 
#chains in the Genus database with same CATH homology
 3D45 A;  4N47 A;  2GV9 A;  3L3U A;  3U6F A;  1NK7 A;  4PA1 A;  3HYF A;  5HP1 A;  1VRU A;  4BE1 A;  1BCM A;  2KW4 A;  3NDK A;  4I2P A;  4OJR A;  2P5G A;  4WE1 A;  1FXX A;  1XC9 A;  4DFJ A;  3NF8 A;  3CM5 A;  3QEX A;  4F8R A;  4KTW A;  2LSN A;  3OYJ A;  4E7I A;  1F21 A;  3OJS A;  1QSS A;  1BHL A;  4DLG A;  1T03 A;  4KHQ A;  2QXF A;  4ICL A;  3ZT3 A;  3DRS A;  3O3F A;  4B9L A;  4FJ8 A;  4J2D A;  1HRH A;  1U04 A;  4MQ3 A;  1RDC A;  2OYQ A;  1JXB A;  3ITH A;  1DTT A;  4KHU A;  2X6S A;  4DSF A;  3L2R A;  4CJS A;  3ZT4 A;  4RW7 A;  1FKP A;  1J53 A;  3ZT2 A;  3MXI A;  3KLG A;  2BDP A;  4FLZ A;  1ZBU A;  2JLE A;  5SZT A;  4JS4 A;  1HMV A;  1QSY A;  5KGX A;  3OYD A;  3V9S A;  3M8R A;  2E6L A;  1CZ9 A;  2HVH A;  2RF2 A;  4AHU A;  4IDK A;  1WNS A;  3U3G A;  4M45 A;  5HRN A;  3L2V A;  1R0A A;  3ZT0 A;  4DS5 A;  4DSJ A;  1RT4 A;  3I0S A;  3RMB A;  5J1E A;  4RW4 A;  1D9F A;  4KHW A;  2G8I A;  3CFR A;  3BDP A;  3NH1 A;  4CJQ A;  3K5N A;  3O4Q A;  1VK0 A;  3QES A;  5HLF A;  2Z1J A;  4G1Q A;  3SUP A;  5EU7 A;  4FLY A;  3OYC A;  2Y1J A;  1JLF A;  1EXQ A;  4CHY A;  4CEE A;  3L2Q A;  4KI4 A;  3TAF A;  2X78 A;  1BQM A;  1RBT A;  3PX4 A;  3VQD A;  3HPO A;  1L3T A;  4RW6 A;  2BAN A;  1XHX A;  3WNE A;  3TAM A;  4KO0 A;  3C94 A;  3OYM A;  5C24 A;  3TI0 A;  2NUB A;  2VWJ A;  4DG1 A;  3DYA A;  2YHA A;  1IG9 A;  3THV A;  4CJR A;  4F3O A;  3QIO A;  1WSG A;  4FM0 A;  4KHY A;  3CFP A;  1TAU A;  1S9G A;  1RIL A;  4CJP A;  4BAC A;  1N5Y A;  3RR8 A;  4DSL A;  4OLB A;  1EX4 A;  2YNG A;  2IS3 A;  4CEA A;  4HHT A;  1KVB A;  4TSX A;  4CFC A;  3OYK A;  5J2P A;  1HQE A;  3K5O A;  4DTJ A;  3ZSY A;  3KTQ A;  1LW0 A;  1VSM A;  2KFZ A;  3CFO A;  1HQU A;  3IS9 A;  2F96 A;  4FW2 A;  4FVM A;  1VSH A;  3WNG A;  3ZCM A;  3OYG A;  3RTV A;  5D3G A;  3NGZ A;  4CF0 A;  1EKE A;  3FFI A;  2GBZ A;  3AVJ A;  4Z4H A;  4F4K A;  2OPP A;  1LAV A;  4KPY A;  4C8K A;  2Y1I A;  3G10 A;  3NGI A;  4E3S A;  1SL2 A;  1J54 A;  3PO5 A;  3SPY A;  2KTQ A;  3VQC A;  1RBV A;  1B9F A;  2HHX A;  3RWU A;  1SKS A;  4OKK A;  3SQ1 A;  3KD5 E;  3OYA A;  3HL8 A;  4CHO A;  3OYL A;  2HB5 A;  3TAQ A;  5FDL A;  4ZTF A;  4Z4I A;  3RR7 A;  4DF4 A;  3HJF A;  1QHT A;  1WLJ A;  4PWD A;  1D9D A;  3OYE A;  2PZS A;  4B9N A;  1JLA A;  3AVC A;  1X9M A;  2E4L A;  3V9U A;  3JYT A;  4CEZ A;  2RKI A;  4IFY A;  3NCI A;  2VG5 A;  4DFP A;  1IKX A;  1UA0 A;  4ELT A;  3KLI A;  3AVK A;  1NKE A;  1YT3 A;  1ZYQ A;  4M3W A;  1RBR A;  5FRO A;  3NF6 A;  3VQ9 A;  3TR8 A;  4CF8 A;  1SKR A;  3KIO A;  1L3U A;  1IKY A;  4E7J A;  1QTM A;  2G8F A;  3PV8 A;  3V9X A;  4O5B A;  3S3M A;  3SZ2 A;  1Z26 A;  2OA8 A;  3VQA A;  2E6M A;  3HP6 A;  4B9S A;  4J2E A;  1ASV A;  2HHW A;  1NKB A;  2Z1H A;  3JSM A;  4DF8 A;  3NFA A;  4DQR A;  3LPU A;  2ZD1 A;  3TWH A;  1CZB A;  3HVR A;  3HO1 A;  5CY4 A;  1NJY A;  4E7H A;  4DTP A;  5FRN A;  4DU4 A;  3G0Z A;  4YFU A;  4KAZ A;  4M3X A;  4FJG A;  2HNZ A;  1BIU A;  1TKX A;  3AVG A;  3WNH A;  4DTN A;  4OLA A;  3S3O A;  1YTA A;  4QAG A;  3V81 A;  1TK5 A;  1VSL A;  4CGD A;  4FJX A;  3AVB A;  4FLT A;  4DU3 A;  1NK8 A;  1KFS A;  4FJ5 A;  3M8P A;  2HND A;  5HRR A;  1UAX A;  2VWK A;  4FJM A;  4AH9 A;  3ZSO A;  5HRS A;  5HBM A;  4B9V A;  4E7K A;  1KSP A;  3AVH A;  3QO9 A;  4KTZ A;  1VRT A;  4DSK A;  4K8Z A;  1S6P A;  2BGG A;  2DTU A;  1VSF A;  5CYM A;  4RW8 A;  4ELV A;  3MEC A;  4PY5 A;  4AHC A;  3D0P A;  1WAJ A;  3AO5 A;  2F8T A;  3DM2 A;  1D5A A;  1NJZ A;  1UWB A;  1NOZ A;  4NCA A;  1SUQ A;  4CEF A;  1C0M A;  3LAK A;  3EY1 A;  3CM6 A;  2VG6 A;  4AHV A;  3DLE A;  1L3V A;  4C8L A;  4DU1 A;  1WSJ A;  3RMD A;  4CJW A;  2A1S A;  4CES A;  4N41 A;  1EP4 A;  1ASW A;  2O4G A;  4AHR A;  3DLR A;  5FRM A;  4HUF A;  4FYD A;  1W0H A;  5C25 A;  1HYV A;  4FLU A;  4B3O A;  4GW6 A;  4AIL C;  4GVM A;  2XY6 A;  4B9T A;  5DMR A;  3K5L A;  3SV4 A;  1HNI A;  3ZSV A;  4HUE A;  3UIQ A;  3OYF A;  1QSL A;  2OZS A;  3V1R A;  3CYM A;  4LH4 A;  3V1O A;  4BE2 A;  4AHS A;  4FK0 A;  3SQ2 A;  1YVU A;  4CK3 A;  3NF7 A;  4C8M A;  1TKD A;  4CHQ A;  2IOC A;  2OPS A;  4EZ6 A;  1RTH A;  4B8C A;  4GMJ B;  4CGF A;  4FCY A;  1RT3 A;  4EP5 A;  3P1G A;  3SQ4 A;  1NJX A;  1K6Y A;  4F2S A;  3TAG A;  3TAR A;  3MXM A;  3DLB A;  2QKB A;  1GOC A;  2B4J A;  1T7P A;  2OPQ A;  1IKV A;  3IG1 A;  4FM2 A;  5J2Q A;  1S5J A;  4DFM A;  4CGG A;  4CEO A;  3F73 A;  5J2M A;  3SUN A;  4FJ9 A;  1ZBH A;  2X74 A;  3HT3 A;  3T19 A;  1TAQ A;  2KFN A;  4FLW A;  1RDA A;  4RW9 A;  4FXD A;  1JL1 A;  3HPG A;  1VSD A;  2R7Y A;  5KTQ A;  3KLH A;  1W9H A;  3DRP A;  1B92 A;  2ZE2 A;  1C1C A;  3E01 A;  3SI6 A;  2HMI A;  1REV A;  4O55 A;  2G8W A;  4FJI A;  3AVL A;  1RNH A;  3ULD A;  1YTU A;  4BDY A;  3DRR A;  4HTU A;  4Z4G A;  4B8A B;  1KRP A;  1WAF A;  3QNN A;  4FLV A;  3U3Y A;  4FZY A;  1RT2 A;  1S1U A;  1A5V A;  5C42 A;  4CIG A;  3NHG A;  2VG7 A;  2Q3S A;  2YNF A;  4DTU A;  4Q0B A;  1XHZ A;  3LP0 A;  4I9Q A;  2XY5 A;  1WSH A;  1UOC A;  1C1B A;  1DLO A;  1RT6 A;  3ZSR A;  4CER A;  2YNI A;  1JLG A;  1U49 A;  1C1A A;  3S9H A;  1RT7 A;  1RDD A;  3RMA A;  2I5J A;  2PYL A;  4IG0 A;  1TKT A;  4CFD A;  4KB0 A;  1NK9 A;  1KLM A;  3ZSW A;  3KLE A;  4DQS A;  1U45 A;  4CK2 A;  3HXM A;  1T05 A;  1JL2 A;  3K2P A;  4IBN A;  4UQG A;  3LZJ A;  1BIZ A;  3OYI A;  4C8O A;  3SPZ A;  2G8U A;  4FZX C;  3OVN A;  3AO2 A;  4HCC A;  1FK9 A;  1RBS A;  2EHG A;  1ZBF A;  1ZBI A;  4PUO A;  1G15 A;  3MXJ A;  2YHB A;  3HST B;  3SUO A;  1A5W A;  1KTQ A;  4N5S A;  3LAL A;  4Y1D A;  1I39 A;  2YKM A;  5KRS A;  4QOZ B;  1VSE A;  3VQB A;  1ZBL A;  3LWL A;  1BL3 A;  3SYZ A;  1EET A;  4ID1 A;  3DLG A;  3SJJ A;  4FZZ A;  1CLQ A;  1C6V A;  4J2A A;  1X9W A;  2IDO A;  1SKW A;  1TKZ A;  3S3N A;  4O44 A;  4DFK A;  2DFF A;  3BGR A;  4CJL A;  5T7B A;  3IRX A;  3V6D A;  3AA2 A;  3MEG A;  1BGX T;  1BI4 B;  4AHT A;  4DMN A;  5E41 A;  1SL1 A;  1FKO A;  3ISN C;  2FBT A;  1NOY A;  3VA0 A;  1VSJ A;  1S6Q A;  3OY9 A;  1HYZ A;  4K8X A;  1U4B A;  1NK0 A;  2Z1G A;  1JLE A;  5HRP A;  4E7L A;  4M3R A;  3A2F A;  1A5X A;  4E1N A;  4DLE A;  4W5T A;  3T1A A;  1BQN A;  3NAE A;  1JLC A;  2XRI A;  3KK2 A;  3K58 A;  1KCF A;  3AA3 A;  5KGW A;  4CJ3 A;  4CGI A;  2P51 A;  3AVF A;  4Q5V A;  5HRO A;  5I42 A;  5KRT A;  3NF9 A;  4LSL A;  5CZ2 A;  4QCL A;  4FW1 A;  4M42 A;  3AVA A;  4FJL A;  3OS2 A;  1GOB A;  4CCH A;  2X6N A;  4JS5 A;  2HHV A;  1U47 A;  1HYS A;  4OKJ A;  3O4N A;  4W5R A;  2O4I A;  4CJF A;  3K59 A;  1NKC A;  4FJK A;  2B6A A;  3KK3 A;  3LDS A;  4DQQ A;  1J9A A;  1SV5 A;  2W42 A;  1N6Q A;  3IAY A;  4FJN A;  2AJQ A;  4KKO A;  4JRQ A;  3KKS A;  4ZTJ A;  2D5R A;  4OKE A;  1JLQ A;  1S1W A;  2IAJ A;  3F9K A;  4M3Z A;  2ETJ A;  4HUG A;  3MED A;  3RMC A;  1BCO A;  1ASU A;  1TK8 A;  2G8K A;  4C8N A;  2XY7 A;  4OPJ A;  4CF9 A;  3ASM A;  3QEV A;  2P5O A;  1JKH A;  1QS4 A;  2ITG A;  4DTR A;  4DSE A;  1D8Y A;  2FBX A;  3KKR A;  1JLB A;  3AA5 X;  2GUI A;  1Z25 A;  3AVI A;  4M3Y A;  4W5N A;  4HVJ A;  1JXE A;  4FJ7 A;  1HNV A;  3B6P A;  3O3G A;  3PX0 A;  2YKN A;  3OS1 A;  4F2R A;  3NGY A;  3DOL A;  1LAW A;  4BDP A;  4KRE A;  3SUQ A;  3AA4 A;  1QQC A;  2Z1I A;  3PUF A;  5DK5 A;  4B9U A;  4N76 A;  4PQU A;  2XY8 A;  1TGO A;  4LH5 A;  4JLH A;  5CYQ A;  3KD1 E;  2ZQB A;  3I8D A;  4BDZ A;  1LW2 A;  1B9D A;  3LAM A;  4J2B A;  4I2Q A;  2YNH A;  1X1P A;  4CF1 A;  4E89 A;  4DWI A;  2F8S A;  1RTD A;  3ZSX A;  3PX6 A;  2QKK A;  3LP1 A;  3NH0 A;  4CFB A;  4NYF A;  4LD0 A;  4W5Q A;  3RRH A;  3AV9 A;  4CFA A;  3VQ4 A;  1VSI A;  3HVT A;  1TK0 A;  1SL0 A;  4F3T A;  3QEP A;  4OPK A;  1XWL A;  4M41 A;  1L5U A;  4KV8 A;  3QNO A;  4CEB A;  3KJV A;  2KZZ A;  1NK4 A;  1RCH A;  2RN2 A;  4L8R B;  1BI4 A;  4DTM A;  3SCX A;  4E0D A;  3DMJ A;  3VQQ A;  4JRP A;  3M8Q A;  1CXQ A;  4CIF A;  1KVA A;  1O1W A;  3HM9 A;  4BWJ A;  3NE6 A;  4DTO A;  4LY7 A;  3OYH A;  1BIS A;  3O3H A;  3HP9 A;  3OYN A;  4H8K A;  2D0C A;  3SV3 A;  3AO3 A;  3VQ5 A;  3MAQ A;  3K5M A;  4E19 A;  2DFH A;  3VQ8 A;  5CZ1 A;  3SNN A;  1UA1 A;  3HPH A;  1KVC A;  4CJ5 A;  4BE0 A;  4FLX A;  1I3A A;  3VQP A;  3QET A;  2DFE A;  1RDB A;  5SWM A;  4O4G A;  4KB1 A;  1LWE A;  3VQ6 A;  1L3S A;  2PYJ A;  2HW3 A;  3P5J A;  4IKF A;  4OVL A;  5K14 A;  5KI6 A;  3LAN A;  1GOA A;  2ATQ A;  4CJE A;  4Z4C A;  3KK1 A;  3EYZ A;  1MU2 A;  3LWM A;  4ZHR A;  3QEI A;  4EZ9 A;  2PY5 A;  3ZSZ A;  3NH2 A;  3V9Z A;  1ITG A;  1U48 A;  3CQ8 A;  3P83 D;  3RRG A;  1RT1 A;  2B5J A;  2HHT A;  1TVR A;  3I0R A;  4E1M A;  1TV6 A;  2EX3 A;  3C95 A;  1CXU A;  3ALY A;  3SQ0 A;  4ID5 A;  3DLK A;  3DLH A;  4OGC A;  3CG7 A;  4DS4 A;  4RG8 A;  1S9E A;  4KRF A;  3M8S A;  2P1J A;  4KHN A;  2A1R A;  4OGE A;  1HJR A;  4M3U A;  3WNF A;  1RT5 A;  1J5O A;  2OZM A;  1IO2 A;  3OS0 A;  4Y1C A;  1LWC A;  4CEC A;  5J2N A;  1S1V A;  3H08 A;  3LP2 A;  1S1T A;  4CJT A;  3AO1 A;  3ZT1 A;  2HHS A;  5JS2 A;  4NCB A;  3VQ7 A;  2FBV A;  4MFB A;  1Q9X A;  4KHS A;  2HVI A;  4M3T A;  2JGU A;  1Q9Y A;  4CHP A;  3QEW A;  3ZSQ A;  2WON A;  4NYN A;  3C6U A;  4IFV A;  4LSN A;  4KI6 A;  4DSI A;  4CHN A;  4DQP A;  4KTQ A;  3T3F A;  3TAP A;  2D0A A;  4W5O A;  2QK9 A;  3QLH A;  3QIP A;  4O0J A;  2FC0 A;  1WSE A;  3C6T A;  2G8H A;  3AO4 A;  1IH7 A;  2DY4 A;  4FK2 A;  2WOM A;  4CGJ A;  4B9M A;  4FJJ A;  4HCB A;  3B6O A;  3L8B A;  1NK5 A;  4Z4F A;  2HHU A;  4B08 A;  4H4M A;  3VN5 A;  2HNY A;  2YV0 X;  4CJK A;  4XIU A;  2FBY A;  3QIN A;  4KFB A;  4BWM A;  3VA3 A;  3EZ5 A;  4DTX A;  4O0I A;  4CJ4 A;  4CK1 A;  2KQ2 A;  3L2U A;  3NBP A;  1HPZ A;  2XO7 A;  3HK2 A;  1DTQ A;  2IC3 A;  4N56 A;  3PO4 A;  1VSK A;  4CIE A;  4CEQ A;  1S1X A;  2RPI A;  1T8E A;  5JS1 A;  1IKW A;  1NJW A;  3AVN A;  1NK6 A;  1XI1 A;  3V1Q A;  1WSI A;  2KZM A;  1RTJ A;  1WSF A;  4NCG A;  4R5P A;  3K57 A;  3V9W A;  4CF2 A;  1C0T A;  4IG3 A;  1QE1 A;  3QER A;  3TAE A;  2OPR A;  4CE9 A;  4FJH A;  4CHZ A;  4DTS A;  1RTI A;  4CGH A;  3OJU A;  1KFD A;  4EP4 A;  4H4O A;  3DOK A;  3LP3 A;  2XHB A;  4FK4 A;  3DI6 A;  3KLF A;  1TL1 A;  1Q8I A;  3TAN A;  4Z4E A;  5I3U A;  2HHQ A;  3V4I A;  1KLN A;  4ELU A;  3LPT A;  1TL3 A;  1X9S A;  2BE2 A;  1WN7 A;  3L3V A;  3LZI A;  4CED A;  3MEE A;  4CJU A;  4I7F A;  3L2W A;  4DQI A;  4I9L A;  3TAB A;  1LWF A;  1C0U A;  2D0B A;  4Z0U A;  2IGI A;  2G8V A;  4CJV A;  4YNQ A;  3PY8 A;  3AVM A;  1Y97 A;  4FM1 A;  3VQE A;  3OYB A;  1LV5 A;  1RBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...