4CJRA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
148
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjrA00
1SL1A 2IC3A 1BISA 3DRRA 4JS5A 4J2AA 1W9HA 3HPGA 4CERA 4KI6A 1TAQA 2E4LA 3AA4A 4CHQA 3ALYA 4DS4A 3QESA 1IKVA 1CLQA 2KZMA 3K5MA 3CG7A 3L2RA 1X9SA 3NFAA 1ZBIA 4ICLA 2YNFA 3NAEA 4CHNA 1LW0A 1F21A 3ITHA 1QSLA 4I9QA 3OYJA 1BHLA 1QSSA 2F8SA 3NGZA 1C6VA 1JL1A 4FJ8A 4MQ3A 4ID1A 5CYMA 1RBUA 2HW3A 1NOZA 1RILA 1RT1A 1RT3A 3NF9A 4Z0UA 3V9WA 4RW4A 4YFUA 1CXQA 4FVMA 4KTWA 5DMRA 3TWHA 3RRHA 1JXEA 5D3GA 1VSDA 2DFHA 4NYNA 3T3FA 3M8QA 4M3TA 2GBZA 2P5GA 1VSKA 1KTQA 4CK3A 3L2WA 4DS5A 1ZBFA 2FBXA 3LP1A 3NGYA 4C8KA 1NK4A 4DSEA 1GOCA 3I8DA 4DTNA 3O4QA 4LY7A 1RDCA 3OYKA 4M41A 1SKWA 2F8TA 2OPQA 2FBVA 2YNHA 1C1AA 1LAWA 4F2SA 4NCAA 3ISNC 3K5OA 5CYQA 4CE9A 5HRRA 2Y1IA 1L3SA 1WSIA 1UOCA 3SI6A 4BE1A 2HVIA 4OPJA 4BE2A 5I42A 3QEIA 1HMVA 1HJRA 3K58A 1RBTA 5HLFA 1N5YA 4FJHA 4CF8A 4M3YA 1S1VA 3DLEA 1C1BA 4XIUA 2RF2A 4FZXC 1C0TA 2I5JA 4E7HA 4N5SA 2PY5A 3RTVA 1DTTA 2D0BA 2ITGA 3A2FA 4CJ4A 3TI0A 3AVBA 1Q9YA 3RMAA 2DFEA 3THVA 1R0AA 4F3TA 3OVNA 4KKOA 3L8BA 4FCYA 4DTRA 2HHQA 2G8HA 4BWMA 4QCLA 1HQEA 3VQ7A 3RMCA 3VQ6A 1IO2A 4FJIA 2XY5A 4FLWA 3KKSA 1RCHA 1SUQA 2IDOA 4CF2A 3VQEA 3U6FA 3PO4A 2JLEA 3DLBA 3NF7A 3QIOA 1D8YA 3SJJA 4FJLA 2O4IA 1GOAA 3O3FA 5J2NA 1G15A 3CYMA 2P51A 4ID5A 3AO2A 1D9FA 2PZSA 3NE6A 4BACA 3LANA 3HT3A 3QIPA 4FK2A 2HNZA 4ELUA 3LALA 4IFYA 4CEDA 3S3MA 4IBNA 1B9FA 4CGDA 1NJWA 4ELTA 3KK2A 3ZCMA 1CZ9A 1KFDA 1WSGA 4Z4FA 1ITGA 1W0HA 3AO5A 4KTQA 3NDKA 4FM2A 3ZSWA 5KRTA 4W5TA 4ELVA 1NJYA 1T7PA 1JLQA 4PUOA 2BDPA 3IAYA 4PA1A 1X9MA 2XY8A 2E6MA 3SPZA 4DSJA 2D0CA 4DLEA 3DYAA 4ZHRA 1JLCA 5CY4A 1A5WA 3T19A 3OY9A 4FK4A 3WNFA 3TAQA 2O4GA 4CEOA 3LZIA 5E41A 2ZD1A 4AHRA 4CJ3A 2OZMA 2FBTA 3RR8A 1BQNA 3I0RA 4PY5A 4KB0A 2A1SA 3KJVA 4IG0A 1Y97A 3SQ2A 1NK0A 3HP9A 4DFMA 3L2UA 4M3ZA 3SNNA 1X1PA 1EX4A 3QLHA 4IDKA 3NGIA 3TAEA 2ETJA 1KCFA 4M3XA 3ASMA 4CJPA 3QEPA 1Z25A 3QEXA 3HPHA 4EP4A 5HBMA 5HROA 1C0UA 1YT3A 3MXMA 4C8NA 1LV5A 1I3AA 1HPZA 3BDPA 4IFVA 3ZSOA 4CJTA 3L3UA 3JYTA 3TANA 3KTQA 4DQPA 3RMDA 4HUFA 1S6QA 4CF1A 1IG9A 4F2RA 4O55A 2KZZA 4DFKA 1IKXA 1S6PA 3SV3A 4M3WA 5EU7A 4CFBA 3NH0A 1RDDA 4LSLA 1RDAA 4FJMA 2X6NA 3ZSYA 1Q9XA 3V9SA 4CJ5A 1TGOA 4Q0BA 4CHOA 4FJNA 4AHTA 4OKJA 3C6UA 1WSFA 5HRPA 4ZTJA 4WE1A 1L3VA 4N47A 2VWKA 4B9UA 4FW2A 3WNEA 3DM2A 1LWCA 5T7BA 4J2DA 2G8VA 1T03A 4G1QA 4CJLA 4DTMA 2BE2A 3LDSA 3SZ2A 4RW9A 1KVAA 1VSEA 3MXJA 4BWJA 1SL2A 4CJEA 1IH7A 4CGFA 4FZYA 4I9LA 4CJQA 3HPOA 4J2EA 3HK2A 3SQ0A 1S5JA 3PX4A 4NYFA 3K2PA 3SUNA 4FYDA 3V9UA 5C42A 1TKTA 4JLHA 3KK3A 3D0PA 4I2QA 5J1EA 4FJGA 5KGWA 3HO1A 2D5RA 4OVLA 5KTQA 3V1QA 3TAGA 4ZTFA 5KI6A 2RPIA 3AVKA 3L2VA 4JS4A 3LWMA 3WNHA 1RBRA 1U47A 4FLVA 4JRPA 1JLGA 4O0JA 4CEEA 4DTPA 1JLEA 1TL3A 3U3YA 5FRNA 1VSJA 2HB5A 2YKNA 3DLGA 3I0SA 3AVFA 1IKWA 3NF8A 3PO5A 1B92A 1WLJA 4CFDA 3VQ8A 1HQUA 5DK5A 4Z4HA 4DU1A 3PY8A 1QTMA 1EETA 1JLBA 3AVLA 4DTUA 4EP5A 1NKEA 3D45A 4LD0A 3T1AA 1BIZA 4OKEA 3PX6A 4NCBA 5KRSA 1KVCA 2XO7A 1BL3A 3K57A 1UWBA 3ZT1A 4EZ6A 4TSXA 4I7FA 4KTZA 1JLAA 3AVAA 3CM5A 3CM6A 4KV8A 3LPTA 4R5PA 4Z4IA 4B9SA 2YHAA 4B3OA 1NJXA 1TK5A 3P5JA 1S1XA 2Q3SA 1BCMA 3ULDA 2HVHA 5FROA 4PQUA 3DOLA 1TKZA 3OYFA 2B4JA 3ZT4A 1RTHA 3BGRA 4CIGA 4DU3A 4B9LA 2GV9A 4HUGA 3LZJA 4F8RA 4B8AB 3KLIA 4N56A 3MAQA 1WSHA 4HHTA 2PYLA 2KTQA 2WONA 4K8ZA 1LWFA 4K8XA 1WN7A 3O3GA 1XI1A 3C94A 1QSYA 3LP0A 4M3UA 3PV8A 1VK0A 4E7LA 2RN2A 4Y1DA 4DQSA 4DQIA 1J54A 1U04A 4GW6A 5J2MA 3G10A 4FM0A 3ZSRA 4CCHA 4HCCA 4L8RB 1J5OA 1NK9A 3JSMA 3OJSA 1A5XA 4W5OA 4CJUA 2KW4A 1B9DA 2HHSA 2W42A 3KLGA 3TAPA 1RT2A 1D9DA 3QO9A 5JS1A 4GMJB 4DF4A 2OYQA 1BIUA 4CJFA 1RTJA 3OYLA 3VQ9A 3V81A 1VSIA 4CESA 4CGJA 3KK1A 3LWLA 4FJKA 4M45A 3CQ8A 2FBYA 4E89A 2E6LA 1XHZA 1WNSA 2OPPA 2QKKA 1FXXA 3DI6A 3KLEA 3NHGA 2JGUA 5C25A 4B08A 1ZBUA 1LAVA 3AO1A 1JXBA 4EZ9A 4KFBA 1KLNA 4AH9A 4F4KA 4KO0A 4H4OA 3RMBA 2IGIA 4LH4A 4KHWA 2GUIA 3MEGA 4IG3A 3ZSXA 4E7IA 3V9XA 4DLGA 4CFCA 2NUBA 3QEWA 1RT5A 4B9VA 3UIQA 3L2QA 3AO4A 4KHQA 4OLBA 3EY1A 1SKSA 2OPRA 3P83D 4M3RA 4DTOA 3AVNA 3FFIA 3HSTB 1ASWA 4FLXA 1JL2A 1N6QA 4QAGA 4FZZA 1XWLA 3IG1A 1J53A 2ATQA 4CJKA 1S1WA 5J2PA 1KSPA 5C24A 1I39A 2HNYA 4CFAA 3VQ5A 3NH1A 1VSLA 2IS3A 1RT6A 3HVTA 1TK0A 1HRHA 4E1MA 2G8UA 4KI4A 4KREA 1QE1A 3E01A 3HL8A 3KLHA 1BI4B 3OYCA 4HTUA 1DLOA 4DSFA 4DFJA 2P5OA 3VQAA 4BDZA 1BQMA 1NKCA 2HMIA 3RRGA 3V1RA 2XHBA 3H08A 4AHCA 3VQQA 3AV9A 4E7JA 2VG7A 1T05A 3M8SA 3S3NA 2B5JA 2FC0A 3MXIA 4CEQA 4Z4EA 4FJ5A 1WSEA 3HYFA 4H4MA 3NH2A 4FM1A 2Z1IA 1REVA 2RKIA 3SV4A 3PX0A 2WOMA 3G0ZA 4CEBA 1TV6A 1SL0A 1NK6A 5HRNA 1L5UA 4RW7A 1WSJA 5FRMA 4QOZB 1VSHA 2YV0X 4Y1CA 1K6YA 5SZTA 3TAMA 3K5LA 2Y1JA 4F3OA 4FLZA 4C8MA 2YNIA 1LWEA 2OA8A 3LP3A 4CF9A 3AVHA 4RW6A 3QNOA 2XRIA 2BANA 2HNDA 4DMNA 1NKBA 3M8RA 4CJSA 4JRQA 4CHPA 5HRSA 1VRUA 3B6OA 2OPSA 3AVIA 5FDLA 3VQCA 5SWMA 4W5QA 4E7KA 4Z4GA 3K5NA 1KLMA 3F9KA 1QS4A 2ZE2A 4E1NA 1EKEA 1NK8A 4B9MA 2HHXA 3VQPA 4AHSA 2F96A 4PWDA 1U45A 4DFPA 5JS2A 4DSLA 3OYMA 3DLHA 4DTJA 2R7YA 4C8OA 4LH5A 4AHUA 1HNIA 5KGXA 5CZ1A 4DF8A 4W5RA 1NOYA 2KFNA 4E19A 1VRTA 4IKFA 1L3UA 1QQCA 3QNNA 3DOKA 1VSFA 1S9GA 3LPUA 4E3SA 5I3UA 2XY6A 2G8IA 3QETA 3MEDA 2D0AA 1MU2A 2KFZA 4B8CA 1S1TA 3AVMA 3VA0A 1TK8A 3LP2A 3QINA 3VQDA 3KD5E 1IKYA 5K14A 4KHYA 3DMJA 3S3OA 3SUPA 2A1RA 3CFOA 1EP4A 4FXDA 4N76A 1GOBA 3VN5A 4CIEA 2BGGA 3AA2A 5J2QA 1JKHA 1SV5A 1WAJA 3OYAA 3NF6A 3O4NA 3V9ZA 1ZYQA 4DWIA 2HHVA 2Z1HA 2VG6A 4RW8A 3SPYA 1RTDA 2DY4A 3OS2A 1S1UA 3LAMA 1YVUA 3OYDA 3U3GA 3QEVA 4DSKA 4CJWA 5CZ2A 4DQRA 4KAZA 3C95A 1JLFA 2XY7A 3TABA 3AA5X 4KHSA 2VG5A 3KLFA 1J9AA 2OZSA 2IAJA 3MECA 1U4BA 2P1JA 1KVBA 3SUOA 3TARA 2HHUA 4FJ9A 4AILC 4RG8A 4DSIA 4O0IA 3OYGA 3HP6A 1TL1A 2Z1GA 3PUFA 3SQ1A 2B6AA 1RDBA 1YTAA 1RT7A 2KQ2A 3KKRA 3SYZA 3HXMA 4FW1A 1CXUA 4CGGA 4DQQA 3V1OA 1S9EA 4CK1A 1Z26A 1HYVA 4KHUA 3OYHA 2X6SA 1HNVA 1A5VA 1LW2A 2LSNA 4FLYA 2QKBA 3L3VA 3HM9A 4DU4A 3HVRA 1YTUA 1VSMA 3V6DA 1NK5A 4HCBA 4NCGA 4DTSA 4CJVA 3OJUA 1Q8IA 3VA3A 4CGHA 2YHBA 3ZT2A 3SQ4A 4KPYA 3P1GA 4OPKA 3K59A 4KB1A 2ZQBA 3IRXA 4FLTA 4I2PA 4OKKA 4OGEA 2VWJA 5HP1A 3VQ4A 3OYBA 2Z1JA 3OYEA 4B9NA 1HYSA 3ZSVA 3SUQA 1UA1A 3RR7A 3OYNA 1BCOA 3AVCA 1RTIA 4CECA 3SCXA 4FJJA 1TKDA 4MFBA 4KHNA 4GVMA 4FJ7A 1SKRA 1NK7A 1XHXA 4HUEA 4Z4CA 2HHWA 3OS0A 1DTQA 1BGXT 2QXFA 3AO3A 1EXQA 3WNGA 4O5BA 3ZT0A 4CEAA 1FKPA 4YNQA 3QERA 3KD1E 3F73A 1UA0A 3RWUA 4DTXA 4FK0A 3TAFA 4OGCA 4C8LA 1FKOA 1ZBLA 4CJRA 4W5NA 2IOCA 3M8PA 1RT4A 1RBVA 3LAKA 3KIOA 3ZSZA 4CEFA 4E0DA 3DLRA 1ASUA 4CIFA 4KRFA 1QHTA 4LSNA 3EYZA 3IS9A 4OLAA 4FLUA 3AVGA 1C0MA 3O3HA 2HHTA 4BDYA 3NBPA 4J2BA 3NCIA 2EX3A 4CF0A 4UQGA 4CK2A 2EHGA 3ZT3A 1U49A 1CZBA 1NJZA 2G8KA 1D5AA 2PYJA 4AHVA 2YKMA 3AVJA 1FK9A 3DRSA 1T8EA 1TKXA 3DLKA 3TR8A 3CFPA 4B9TA 1BI4A 4CGIA 3S9HA 1ZBHA 2QK9A 2DTUA 2YNGA 1KRPA 3HJFA 2X74A 3ZSQA 1WAFA 1C1CA 1HYZA 1UAXA 4O4GA 3V4IA 1TVRA 4BDPA 2G8FA 4O44A 4BE0A 3VQBA 4N41A 4OJRA 3OYIA 3CFRA 1RBSA 2G8WA 3MEEA 1XC9A 4CHZA 1X9WA 2DFFA 1L3TA 2X78A 4Q5VA 4DG1A 1KFSA 3EZ5A 4CEZA 3DRPA 4CHYA 3OS1A 4M42A 1O1WA 1U48A 2AJQA 3B6PA 3C6TA 1ASVA 4HVJA 1RNHA 4FJXA 3AA3A 1TAUA 4H8KA
chains in the Genus database with same CATH superfamily
3OTOK 4WYBA 4CERA 2QWNA 2E4LA 3AA4A 4H0VB 2NRWA 3K5MA 2F9WA 1YUWA 3L2RA 4AM6A 3NAEA 2NRXA 1F21A 3OYJA 5GAEP 2HW3A 4MQ3A 2Q31A 1DEJA 3O8MA 1RT3A 4A5AA 4CBXA 3NF9A 3V9WA 2E8AA 1N32K 1H1VA 4KTWA 5DMRA 1HKGA 4IJAA 3RRHA 5D3GA 5C15A 4CZLA 3L2WA 5BRDA 3TTDA 4DS5A 1NK4A 4BR4A 3F2KA 4B1WB 1X3MA 3O4QA 4YOWA 1TUYA 1VAZA 1C1AA 3THWA 3A5MC 4F2SA 2VGNA 3GL1A 5HRRA 3C7NB 2GTDA 2YX6A 4BR9A 3SI6A 4O8UA 4H0XB 2UUAK 3IKMA 3CQXA 2F4VK 4A61A 4C1NI 4JI7K 2RF2A 3DXKB 1C0TA 1VQNN 4N5SA 2D0BA 3KHYA 4FWPA 3A2FA 4CJ4A 3THVA 4F3TA 3L8BA 4KKOA 5AQPA 1T6CA 3KKSA 1SUQA 5FPEA 2O8FA 3U6FA 3DLBA 4YOTA 5BN9A 4DB3A 5J2NA 1M1KO 3AO2A 1D9FA 3NE6A 3QIPA 2HNZA 3LM2A 2Q1NA 1NJWA 2P9NA 4ELTA 4YOYA 4JI8K 3AO5A 4FM2A 4PL8A 3ZSWA 5KRTA 2ZJRL 3UKUA 3K9JA 4NO7A 3SPZA 4ZHRA 4FK4A 3WNFA 3LZIA 1XNRK 2ZD1A 1SS6A 3VEOA 1BQNA 2F9TA 2A1SA 2ZM6K 1VQ5N 4JKFA 4DUYK 3HP9A 5BRHA 3L2UA 4M3ZA 1X1PA 1N34K 1KCFA 2ETJA 3ASMA 1Z25A 3HPHA 5HROA 1C0UA 4ILJA 4GNIA 2UUCK 1HR0K 1LV5A 4IFVA 4JEPA 4CJTA 3NVMA 4HUFA 1JCGA 1S6QA 3CMEN 4B1XB 2KZZA 4O55A 4DFKA 1S6PA 1C0GA 5EU7A 3NH0A 4LSLA 3ZEUA 4BQZA 1N8RO 3ZX3A 1QZ6A 2YHWA 2KHOA 3CCUN 4N47A 2V7ZA 4J2DA 2PFUA 1NGJA 4YY3K 2BE2A 4JNEA 3H1QA 3SZ2A 1VSEA 4FZYA 1Z05A 3WXLA 3A8YA 4J2EA 4BR7A 3SUNA 4NYFA 3K2PA 5C42A 3ULEA 4O8KA 4QS9A 5J1EA 5KTQA 3A5OC 4ZTFA 3AVKA 2YHYA 4RCHA 4LF8K 3GOIA 3DXMB 3S41A 3DLGA 2YKNA 3NF8A 3CF5L 4WFNL 1MWMA 1MWKA 3WXIA 1HLUA 3EL2A 4OKEA 4NCBA 2QWRA 5KRSA 1KVCA 5AQKA 3PSIA 3NVKA 2A41A 3AVAA 4B9SA 2YHAA 3LDOA 2E2NA 1NJXA 2Q3SA 2YHXA 2HVHA 5FROA 2HBKA 4PQUA 1BUPA 1VQ6N 3LDQA 3ZT4A 1RTHA 3BGRA 5EVZA 2GEMA 3ENOA 1WN7A 3O3GA 2YJEA 1QSYA 5FLXO 2WC9A 1VK0A 3PV8A 4IEIA 2RN2A 1GLCG 4LF7K 4L8RB 2BUPA 1WBBA 5AZIB 4LF5K 1OVQA 2KW4A 2HHSA 2NRHA 1KQSM 3QO9A 4GMJB 4YOUA 1VSIA 4CESA 1YJNN 4M45A 4BGBA 2FSNA 1WNSA 1P90A 3DI6A 3KLEA 4B08A 1JXBA 3F5TA 4AM7A 4JI0K 3THYA 4KFBA 4B1ZA 1KLNA 4KO0A 4M7YA 2GUIA 4IG3A 4E7IA 3BUZB 4A59A 5EXWA 2NUBA 3QEWA 1NM1A 1K73O 3L2QA 3JS6A 4OLBA 3TSPA 3CCQN 4DR6K 2E1ZA 3H3OB 3FFIA 4GKJK 4FZZA 3IG1A 4IOCL 2ATQA 4QS8A 1I39A 3D2EB 2NRZA 5BPNA 1TK0A 4KI4A 4E1MA 2G8UA 4DKWA 4KREA 3E01A 3KLHA 3E9PA 2P5OA 4BDZA 2HMIA 3MX5A 3ZLJA 3AAPA 4IFEA 2XHBA 2E5LK 5AZJB 4E7JA 2VG7A 2ASPA 2B5JA 1HPMA 1MA9B 4PL7A 2UXDK 1WSEA 3HYFA 3PSFA 3SV4A 4FL9A 1L5UA 2P9LA 1YI2N 1K6YA 2Y1JA 2QEXN 1LWEA 3EKUA 3AVHA 3QNOA 5TKWA 2HNDA 1NGIA 4JRQA 4IO9L 5FDLA 4E7KA 1XUPO 4Z4GA 3HM8A 3TPQA 2O8EA 2ZE2A 4B9MA 4PWDA 2E1YA 4DTJA 2CH6A 3FZFA 4ISFA 4JKHA 4FVUA 5CZ1A 4W5RA 1NOYA 1J6ZA 4IKFA 5AQMA 4K42A 3TTFA 3LPUA 2PAVA 5JVHL 3QETA 3AVMA 1TK8A 3ZX0A 3CFOA 4FXDA 3THWB 1GOBA 4CIEA 2BGGA 4PUOA 3NF6A 3FFKB 2P9IB 3O4NA 4X66K 3V9ZA 2O8CB 3VENA 4RW8A 1RTDA 3HZ6A 3VGKA 3SMSA 3C95A 3OBWA 2J4RA 1BU6O 4JI2K 1Z6RA 3MECA 4M63C 3SUOA 3OYGA 3SQ1A 1TL1A 1EQYA 4A62A 1RFQA 3VGMA 1RT7A 2O8FB 3BY5A 2HF4A 1S9EA 2QTDA 3AAQA 2AP1A 1E4GT 3WEEA 2LSNA 3L3VA 4DU4A 1YITN 3V6DA 3M6GA 4HCBA 4DTSA 5GAGP 3VA3A 2YHBA 5AQLA 3ZT2A 4KPYA 1BWFO 4BRNA 4I2PA 4OKKA 4OGEA 2VWJA 5HP1A 2Z1JA 3OYEA 1HYSA 3ZSVA 1UA1A 3AVCA 4EHUA 3O9SA 2GWKA 1BGXT 4CEAA 4YNQA 4O5BA 1V4SA 3QERA 1FKPA 3SBTA 1HNZK 4NB4A 4DTXA 3TAFA 4OGCA 2P9SB 4MLEA 3Q7BA 3M8PA 3LAKA 2V7YA 1FJGK 3HRGA 1DT9A 4WFBL 3IS9A 3AVGA 3O3HA 3K0SA 2A40A 4BDYA 2JWLA 1GLEG 4J2BA 3NCIA 5AQRA 4GV9A 2EHGA 3CCEN 1U49A 3ENHA 2PYJA 2YKMA 1HNXK 3DLKA 4KBOA 1KRPA 2X74A 3ZSQA 4FWLA 3AY9A 3OYIA 3CFRA 3H3NO 2FLOA 3MEEA 4WQ5C 5M1OA 4B3RK 4Q5VA 3OS1A 4CZHA 3VEVA 1OH8A 4YDUA 1ASVA 1RNHA 1KAZA 4JI5K 4BRMA 1W7AA 1CZAN 4KI6A 4YOVA 1CLQA 1IKVA 1X9SA 5C2DA 4ICLA 2YNFA 3L4IA 3R8EA 1QQOA 4CHNA 1LW0A 3LL3A 3UKRA 1W97L 1E3MA 2AA4A 1FW6A 4YFUA 4FVMA 3MX2A 3TSUA 2DFHA 3CJ1A 4M3TA 2P5GA 1VSKA 4A57A 3CCRN 1ZBFA 3LP1A 3NGYA 4DQ8A 3I8DA 1RDCA 1SKWA 2O8DA 5JICA 3CPEA 1HX1A 3C6AA 4NCAA 3ISNC 5AQQA 2GX9A 4DV3K 4BROA 4Y0WA 5I42A 3QEIA 2O8BA 1RBTA 4FWQA 4FJHA 3RSEA 2VWBA 4E7HA 2ITGA 4FWMA 1N36K 3AVBA 2KTQA 2HHQA 4FCYA 2G8HA 2NZTA 4QCLA 2DPNA 5F0XA 4FLWA 5LMUK 2IDOA 4CF2A 3VQEA 2JLEA 1D8YA 3VESA 1HUXA 3VEXA 1S22A 4FJLA 2O4IA 1GOAA 1NGAA 1IBMK 2PZSA 5AFUA 4BQLA 3THYB 4IFYA 3S3MA 4IBNA 4CGDA 5KPTA 4CZFA 1YHQN 1CZ9A 1GLDG 1KFDA 4JK9A 1RGIA 4RTFD 4W5TA 2VQEK 1T7PA 2PBDA 1KAYA 4PA1A 4DSJA 2E6MA 2D0CA 4BRCA 3T19A 3OY9A 4JI6K 3TAQA 3ZX2A 3MMVA 3I0RA 2EWSA 4PY5A 3KJVA 5KPZA 3SQ2A 1NK0A 4DFMA 4NXNK 3TAEA 1EX4A 3QEPA 2IVPA 4MO4A 4EP4A 5LMNK 3VMFB 3MXMA 5M1FA 1BO5O 3BF1A 4DQPA 3JYTA 3RMDA 4OO1J 4F2RA 1IKXA 3A5LC 4CFBA 1RDDA 3U9ZA 5HL7L 3DLLL 1RDAA 4FJMA 2X6NA 1Q9XA 3V9SA 3EE8A 4CJ5A 4Q0BA 4CHOA 4BR0A 3N4PA 3C6UA 4FWSA 3DAWA 1L3VA 1XMOK 3O9QA 4FW2A 3WNEA 3GG4A 4FPBA 1LWCA 2QA4N 1NGEA 1NWKA 5AQXA 1HNWK 3FGUA 4CJLA 3CERA 1SL2A 3MXJA 1IH7A 4CGFA 1ATRA 4I9LA 4CJQA 3D2FB 1GLFO 3WUHA 5AQGA 4FYDA 4JLHA 3VGLA 3HO1A 4OVLA 1ATNA 3N4QA 2Q97A 5KI6A 2UU9K 4BRIA 3MCAB 4H0OA 4KH4A 1JLGA 1JLEA 1OH7A 1VSJA 3I0SA 1IKWA 3SAFA 2WBNA 5DK5A 4QOZB 3PY8A 1EETA 1NKEA 4IOXA 3T1AA 5CE3A 3GE1A 4NLCA 4JI1K 2XO7A 1BL3A 4TSXA 3TU5A 2GUPA 5MLCQ 4ILHA 1T3VA 4PKIA 3CM6A 1TK5A 3O1WA 1S1XA 4CBUA 1YVNA 3FZKA 1TKZA 3OYFA 4AQYK 1YJ9N 4F8RA 3LZJA 3KLIA 3MAQA 4HHTA 4JYAK 1BG3A 3MN9A 3WEEB 1XI1A 3C94A 4JD2A 3CC2N 1KC8O 4Y1DA 4DQSA 4DQIA 1N33K 1J54A 1U04A 4IJNA 5J2MA 5BN8A 4HCCA 3ZSRA 3THXA 4CJUA 1B9DA 3TAPA 4DF4A 1RTJA 3VQ9A 4CGJA 4I6MA 3O5BA 3KK1A 3LWLA 2FBYA 4E89A 1XHZA 1W2BM 1VQLN 2HBJA 1XNQK 1FXXA 5JLFA 2JGUA 1K9MO 1ZBUA 4DR2K 4EZ9A 1ILYA 1HKBA 3SBGA 4H4OA 3ZSXA 3ATVA 5KQDA 3JAMO 4JHDA 1NMDA 3UIQA 3AO4A 5FPMA 4BRKA 3EY1A 4M3RA 2OZMA 3KD5E 3HSTB 1ASWA 2RE2A 1XWLA 1KSPA 1VSLA 2IS3A 3HVTA 2E2QA 1OH5A 1QE1A 3HL8A 3OYCA 2HBLA 4DFJA 3ENBA 3VQAA 4BG8A 2HBMA 3H08A 2BTFA 3AV9A 4LFAK 3S3NA 5CHIA 1TUUA 4Z4EA 2E20A 4FM1A 1REVA 4WF9L 3G0ZA 1SL0A 5HRNA 3QDKA 5GADP 5BREA 1Q86O 2P9KA 5AQWA 3K5LA 4F3OA 4B1UB 3HSCA 4LF6K 4BC5A 4FLZA 3G25A 4CF9A 4RW6A 2XRIA 4DMNA 1NKBA 2E2OA 4CJSA 5HRSA 2FF6A 5E26A 5SWMA 2W6KA 3AVIA 3D6RA 4E1NA 2ZJPL 4AHSA 3UKRB 5JS2A 2R7YA 4LH5A 1HNIA 1G99A 2KFNA 3B8AX 4E19A 1QQCA 4JKGA 3QNNA 1U2VA 3DOKA 5I3UA 3UB5A 2D0AA 1S1TA 4BC3A 3ID8A 3QINA 2O8DB 1YAGA 2A1RA 3OW2M 5AR0A 1EP4A 4PKGA 3MN5A 3AA2A 5F2RA 1ZYQA 2HHVA 5B8HA 3J80O 2OTLN 3QEVA 4DQRA 2FSKA 2XY7A 3TABA 2VG5A 1J9AA 2HMPA 1SQKA 4A2AA 1U4BA 2Q0RA 1X9JA 3ATUA 4RG8A 4DSIA 4O0IA 4CJ7A 3QMLA 3PUFA 2Z1GA 3HP6A 1RDBA 4FW1A 4CGGA 4YOXA 1BA0A 2IVOA 1ZXOA 4HTLA 4FLYA 1IG8A 1VSMA 1TYQA 3IUCA 1NK5A 3OJUA 4CGHA 5DM7L 4FPAA 4FLTA 4JKDA 3OYBA 2CH5A 1RTIA 3SCXA 3WXKA 4G9ZA 4FJ7A 1NK7A 5ADXH 2HHWA 4E1JA 1DTQA 2QXFA 4H0TB 3KD1E 3ZETB 3RWUA 4C8LA 4W5NA 2IOCA 4E0DA 1ASUA 2NLXA 4LSNA 4FWOA 4IXCA 1C0MA 5M1KA 1WUAA 3KVGA 3L4QA 2HHTA 4CF0A 3KZBA 1E4FT 1NJZA 5I9EB 2G8KA 3AVJA 3DRSA 1TKXA 3TR8A 4FOIA 3P39A 4CGIA 3CFPA 4IDHA 3HJFA 3PIOL 1WAFA 3HOSA 3CJCA 1TVRA 3O9TA 4GKKK 3VQBA 4N41A 4OJRA 1XC9A 2DFFA 5IWAK 1KFSA 3BF3A 4CEZA 4CHYA 3MN6A 3BP8A 3B6PA 1NU0A 3F9MA 3CMAN 1DGKN 4DV7K 4FJXA 2HSTA 1HJOA 2IC3A 1C0FA 2OANA 4JS5A 4J2AA 1W9HA 1D4XA 1VQON 1XQSC 3ALYA 3QESA 2KZMA 3NFAA 3ITHA 4I9QA 3M1FA 1QSSA 2F8SA 1JL1A 3P38A 4H0YB 5CYMA 4ID1A 4FJ8A 1RBUA 4K0KK 1NOZA 1NGGA 4DHYA 4DR3K 3VF2A 1R59O 4OPHA 4FSVA 1XMQK 3TWHA 1VSDA 4NYNA 1NGBA 2GBZA 2ZGZA 4CK3A 1I94K 4C8KA 5KQ8A 4DSEA 3VTIA 1GOCA 4DTNA 4LY7A 3OYKA 4M41A 5AQOA 2OPQA 2FBVA 2UXBK 3K5OA 1KXPA 1GLLO 5CYQA 5AQYA 1M90O 2P9PA 1WSIA 4DV2K 3KWIA 4JK7A 4OPJA 5C0YA 1HMVA 1HJRA 3K58A 3GDQA 1N5YA 4CF8A 4GY2B 4M3YA 1C1BA 2HHHK 4FZXC 2I5JA 3CIPA 2A5XA 2PY5A 2DFEA 1R0AA 4CW7B 4DTRA 3OHRA 1HQEA 3VQ7A 3E9LA 3RMCA 4ILGB 1IO2A 2E2PA 2P9NB 4FJIA 1GLBG 1Y64A 4I6MB 4DV5K 2ZF5O 3QIOA 3SJJA 3SMPA 2ASMA 1G15A 3UKUB 2P51A 3J7YP 3E66A 4B3SK 1SZ2A 3LANA 4FK2A 4CZMA 4DV0K 3ZCMA 4X64K 1ITGA 2V52B 4KTQA 4K43A 2V51B 3VF6A 1NJYA 1BOTO 2YCHA 3IAYA 2XY8A 1V4TA 4DLEA 3DYAA 3I55N 5CY4A 1A5WA 2NNWA 1NGDA 2O4GA 4Z94A 5E41A 4AF1A 4CJ3A 1NGHA 2FBTA 3RR8A 3FR0A 2CGLA 4IG0A 3TSQA 4YDUC 3FZHA 2E88A 3R3LA 3QLHA 3NGIA 3ZEUB 4M3XA 5DM6L 3QEXA 5HBMA 3AGRA 3O9RA 4C8NA 4CD1A 2D0OA 3W3DA 3BDPA 3L3UA 3KTQA 5ELZA 2FSJA 4M3WA 2P9KB 3ZSYA 3E9OA 3IMXA 4OX9K 4DR4K 4FJNA 3MDQA 4OKJA 4ZTJA 5GIPA 4B1VA 5JVGL 4WE1A 3O4WA 4B9UA 2VWKA 3M5RA 3ULEB 3DM2A 4MLHA 5T7BA 2FF3B 2G8VA 1T03A 4G1QA 4DTMA 3LDSA 4RW9A 4CJEA 3CD6N 3SQ0A 1P8ZA 1S5JA 3KWGA 1VQPN 3V9UA 1NNEA 3HI0A 3KK3A 3D0PA 4FJGA 5KGWA 5JLHA 3I56N 3V1QA 3TAGA 1QQMA 3G71N 3LWMA 3WNHA 1U47A 4XH5A 3CHWA 4O0JA 1TL3A 4BRQA 5FRNA 3AVFA 3PO5A 1B92A 1WLJA 4CFDA 5IT9O 1HQUA 1K8KA 4IWVA 4DU1A 1QTMA 1JLBA 4DCHA 4EP5A 2RHKA 2GWJA 3D45A 2QM1A 4LD0A 3MCPA 3PX6A 3HBTA 1UWBA 3ZT1A 1T44A 3DXMA 4KTZA 1NGCA 4DUZK 3LPTA 4Z4IA 3P5JA 1BCMA 4LC9B 4WQ4A 3HTVA 1YJWN 4QS7A 4CIGA 4B9LA 2GV9A 4HUGA 4B8AB 4O5FA 3EE9A 4BRFA 5TKYA 2JWKA 2HF3A 2WONA 5EX5A 1LWFA 3O6WA 3J7AP 5BPLA 3LP0A 3R1XA 1TYQB 4BY9C 4GW6A 4LFBK 3G10A 4CD3A 4H5VA 3CPWM 4FM0A 1EWRA 3EO3A 3JSMA 3OJSA 1A5XA 3BZKA 4DR5K 1LOTB 2P9UA 3KLGA 4LF9K 1RT2A 1D9DA 5JS1A 2QW9A 3WQUA 1BIUA 3JXUA 3V81A 3EKSA 2NRRA 4JKAA 4FJKA 2BH1A 5AQUA 2KLAA 4K41A 2OPPA 3M3ZA 2IIRA 5C25A 3AO1A 1KAXA 1LAVA 5AZIA 4AH9A 2D1KA 4LH4A 3MEGA 3V9XA 1ZBSA 4CFCA 4H5RA 3VETA 1RT5A 3TTCA 4DR1K 4B9VA 4CZGA 2OPRA 3P83D 4DTOA 3AVNA 5LJVA 1JL2A 1J53A 2NRTA 3U9DA 3NH1A 3VQ5A 4BC4A 1RT6A 1HRHA 2QXLA 2P9LB 4DSFA 1BQMA 4J8FA 3VPZA 4ISGA 2FC0A 3D2EA 3MXIA 1IV0A 3NH2A 2WOMA 1TV6A 5M1QA 1NK6A 2O8EB 3VF4A 1VSHA 1X3NA 4Y1CA 5SZTA 3TAMA 4C8MA 3UE5A 2BANA 3M8RA 4CHPA 1VRUA 3VQCA 4W5QA 3K5NA 1QS4A 4BREA 1EKEA 1NK8A 2D4WA 4DFPA 1U45A 4DSLA 5BR8K 3OYMA 3DLHA 3QBXA 4C8OA 4V19S 4AHUA 3H1VX 5BR9A 5KGXA 4DF8A 4H0PA 1VSFA 4E3SA 3A0IX 3QICA 2G8IA 3MEDA 2KFZA 1MU2A 2WTUA 3LP2A 4KHYA 1NLVA 3S3OA 3SUPA 4DV4K 4MDBA 1QQNA 1WAJA 2VYPA 3OYAA 5J2QA 4DWIA 1NMNA 2P9PB 2Z1HA 1S3XA 3MWPA 4FWKA 3FZMA 4CZEA 2F7TA 1YVUA 3LAMA 3OYDA 3U3GA 4CJWA 3O1BA 1JLFA 2QWMA 4KHSA 2UUBK 2IAJA 5A2QO 2CGJA 2P1JA 4JKBA 2HHUA 1WOQA 2O8CA 2P9IA 4LFCK 3FLCO 5HOOA 2Q0UA 2B6AA 3CQYA 1YTAA 3SYZA 3KKRA 3FE1A 3HXMA 1K8AO 1CXUA 1Q82O 4DQQA 3V1OA 3PLAA 5LY3A 4B3MK 3L0QA 4KH5A 1HYVA 2X6SA 1HNVA 2ZGYA 3HM9A 4NXMK 3G6EN 3SQ4A 3P1GA 3K59A 3EN9A 2ZQBA 3IRXA 4IZ9A 3VQ4A 1YF5L 4B9NA 5LJWA 5AQZA 3OYNA 4CECA 4FJJA 4MFBA 4JK8A 4GVMA 1SKRA 1VQMN 4HUEA 4Z4CA 4EHTA 2A6AA 3AO3A 3WNGA 3CETA 3ZT0A 3NMUA 3I33A 1UA0A 4CBWA 5EOYA 3CCJN 2YI1A 2OTJN 1FKOA 3IDHA 4CJRA 1ZBLA 1RBVA 5FPNA 3ZSZA 4CEFA 2Q36A 4JKEA 3EYZA 4OLAA 1Q18A 1VHXA 4FLUA 1Q7YO 2ASOA 3NBPA 1ESVA 5KPRA 4ISEA 3QB0A 3RVCA 2P9SA 1HKCA 3DWLA 4CK2A 1CZBA 1D5AA 3FZLA 5AQHA 2A3ZA 1FK9A 4JAXA 1ZBHA 1BI4A 3S9HA 2YNGA 3MWTA 5AQVA 3VOVA 1C1CA 1HYZA 1UAXA 4O4GA 3ZYYX 3CCVN 1RBSA 4CHZA 3EZ5A 3DRPA 1O1WA 3C6TA 4HVJA 3AA3A 3CCMN 4X65K 1SL1A 1BISA 3DRRA 3HPGA 1TAQA 4CHQA 4DS4A 3CG7A 1ZBIA 1QSLA 1BHLA 4CZJA 3NGZA 1C6VA 3CJ9A 4B1YB 1K8KB 5C2FA 1RILA 1RT1A 1T6DA 4NLBA 4Z0UA 4RW4A 4CZKA 1CXQA 1JXEA 3LM9A 3T3FA 3M8QA 4LF4K 1NJIO 1KTQA 5ADXA 3VEYA 2O8BB 2FBXA 1S72N 5BRFA 3T1HK 3RSEB 1DKGD 2F8TA 3O9UA 2YNHA 4GV6A 4BG9A 1LAWA 3WQTA 1XC3A 4CE9A 3HOTA 2Y1IA 1L3SA 2ITMA 1UOCA 4XH4A 4BE1A 4F9OA 2HVIA 4KHPK 4BE2A 3O08A 5HLFA 2QWLA 1S1VA 3DLEA 1BA1A 3T7ZA 3WT0A 4XIUA 4DV6K 3CJBA 3CJAA 4BR5A 3RTVA 1DTTA 4BC2A 3TI0A 3R6MA 1Q9YA 3RMAA 2P9UB 3OVNA 4BWMA 2VQFK 3VQ6A 2XY5A 1RCHA 4H03B 4XEIA 3PO4A 3NF7A 4WCEL 2I7PA 3O3FA 3LDLA 3CYMA 1WBDA 4ID5A 4BACA 3HT3A 4ELUA 3C65A 3LALA 4CEDA 3SK3A 1B9FA 3OBYA 3KK2A 1WSGA 4Z4FA 2VGMA 1W0HA 1JCFA 3NDKA 4ELVA 1JLQA 2BDPA 1X9MA 3CCSN 4C23A 1JLCA 4CEOA 1GLAG 3CJ7A 4AHRA 1YIJN 4KB0A 3BZCA 1Y97A 4PKHA 5E84A 3I8BA 3SNNA 4IDKA 3SAHA 4R79A 4JI4K 4CJPA 2I7NA 1YT3A 4IO8A 3G4SN 1I3AA 1HPZA 3ZSOA 5LL6Z 3TANA 2UYTA 5AQSA 4CF1A 1IG9A 5AQFA 3SV3A 5GAHP 3CC7N 4U7BA 3U4LA 5EY4A 1TGOA 3MK6A 2W6LA 4AHTA 5HRPA 1WSFA 4H5TA 1KD1O 4H5WA 3QBWA 1VQ8N 4DR7K 3AGKA 1ZC6A 2NRVA 1KVAA 4BWJA 2QI2A 3J8AA 4U67L 3HPOA 3HK2A 2D0PA 3PX4A 1Q81O 1TKTA 1IBKK 4I2QA 2D5RA 5FPDA 4M7XA 2RPIA 3L2VA 2IVNA 4JS4A 1RBRA 4FLVA 4JRPA 3AARA 4HWIA 4CEEA 4DTPA 1JJ2M 3U3YA 3D2FA 2HB5A 1GLJO 3BEXA 4BRHA 4BRDA 2OCEA 3VQ8A 1EO1A 4Z4HA 3C0BA 3AVLA 1JCEA 4YHHK 3P31A 4DTUA 4FOEA 1OH6A 1BIZA 4IEEA 3WXMB 4BRGA 3K57A 1RDUA 4EZ6A 4I7FA 1QVGM 1ATSA 1JLAA 3CM5A 4KV8A 4JD2B 4R5PA 4BRPA 4B3OA 4EFHA 4H5NA 3ULDA 3DOLA 2B4JA 3THXB 3QFUA 4DU3A 5AQJA 3C7NA 3P4IA 4N56A 2PYLA 1WSHA 3LDPA 3SJHA 4K8XA 4K8ZA 4CVNE 3MN7A 4M3UA 4E7LA 2YJFA 2WFBA 2WUSA 2QWPA 3DXKA 4CCHA 1J5OA 1NK9A 4W5OA 2CGKA 2W42A 1IJJA 1IBLK 2OYQA 4CJFA 3OYLA 1QHAA 4JHDB 3K9KA 3CQ8A 2E6LA 4L3QA 3W0LA 4WFAL 2QKKA 3NHGA 4KH6A 3E1YA 1EWQA 4GVEA 1BDGA 5C10A 2UXCK 4F4KA 3RMBA 2IGIA 2QWOA 4KHWA 5C12A 4DLGA 4B3TK 4CZIA 3VERA 4KHQA 5CR4A 5AQIA 1SKSA 3OA9A 3T1YK 1N6QA 3EEQA 4FLXA 1QZ5A 3EZWA 4QAGA 4DV1K 4CJKA 5F1XA 1S1WA 5J2PA 4K25A 5C24A 2HNYA 4CFAA 4JKCA 4JN4A 4PHTX 5AQTA 1BI4B 4BR2A 4HTUA 1DLOA 4YORA 1NKCA 3RRGA 4X62K 3C6HA 3V1RA 5GINA 4AHCA 4EAHD 3VQQA 1J5EK 4XH1A 4FWRA 4A2BA 1T05A 3M8SA 1U6ZA 4CEQA 4JI3K 2H3GX 4FJ5A 4H4MA 2ZJQL 3J7ZO 2Z1IA 2RKIA 3PX0A 4CEBA 5FRMA 2ZWHA 4RW7A 1WSJA 2YV0X 2KKZA 4IOAL 1O13A 2FXUA 2YNIA 2OA8A 3LP3A 1LCUA 3B6OA 2OPSA 4JKGB 1OKJA 1U2VB 3IFRA 1KLMA 3F9KA 3L6QA 2HHXA 3VQPA 4WQ4C 2F96A 2HOEA 5H1SQ 2W41A 3CC4N 1VRTA 1L3UA 3H46O 4C1NK 1S9GA 2XY6A 4B8CA 3H6EA 3CCLN 3VA0A 3VQDA 1IKYA 5K14A 4MDAA 3DMJA 4EIAA 4WQ5A 4N76A 3VN5A 1NGFA 1JKHA 1SV5A 4CI6A 4RWTA 3QFPA 2VG6A 3PIPL 3SPYA 2DY4A 3OS2A 1S1UA 1YXQA 3VTHA 4DSKA 4KAZA 5CZ2A 3AA5X 3KLFA 2OZSA 1SAZA 1OVYA 4BVOA 1KVBA 3TARA 2VCPA 3CI5A 3A5NC 5M1PA 4FJ9A 4AILC 4BGAA 4OPAA 5GIOA 4A5BA 1QVFM 2KQ2A 4FO0A 4CK1A 1Z26A 2A42A 4KHUA 3OYHA 1A5VA 1LW2A 2Q2RA 2QKBA 4BVPA 3HVRA 1YTUA 1VQ7N 4NCGA 2W40A 4CJVA 1Q8IA 1VQ9N 4JV5K 1NG9A 4OPKA 4KB1A 4FWNA 4UY8O 2QWQA 3RR7A 1BCOA 3WXJA 3SLCA 4BRAA 1VQKN 1TKDA 4KHNA 3LDNA 1WB9A 1XHXA 3CXCM 3OS0A 3SUQA 1EXQA 3F73A 3KK7A 3J81O 4FK0A 5AJ3K 4GV3A 1VQ4N 1RT4A 3KIOA 1NBWA 3DLRA 4CIFA 4KRFA 1QHTA 5JMVA 3Q7CA 3U8XA 3ZETA 3T69A 2EX3A 4UQGA 3GBTA 3ZT3A 4B9QA 3VEWA 3SAGA 2GELA 3D7EO 5BPMA 3VEZA 4AHVA 3DJCA 3H45C 1T8EA 4B9TA 1MDUB 2QK9A 2DTUA 3ID6A 4MO5A 3V4IA 4BDPA 1RDWX 2G8FA 4O44A 5AZJA 4BE0A 2G8WA 5AFUH 1X9WA 1L3TA 2X78A 4BRLA 5M1NA 4DG1A 4M42A 1U48A 2AJQA 3R9PA 5AQNA 3O80A 1TAUA 4H8KA
chains in the Genus database with same CATH topology
1SL1A 2IC3A 1BISA 3DRRA 4JS5A 4J2AA 1W9HA 3HPGA 4CERA 4KI6A 1TAQA 2E4LA 3AA4A 4CHQA 3ALYA 4DS4A 3QESA 1IKVA 1CLQA 2KZMA 3K5MA 3CG7A 3L2RA 1X9SA 3NFAA 1ZBIA 4ICLA 2YNFA 3NAEA 4CHNA 1LW0A 1F21A 3ITHA 1QSLA 4I9QA 3OYJA 1BHLA 1QSSA 2F8SA 3NGZA 1C6VA 1JL1A 4FJ8A 4MQ3A 4ID1A 5CYMA 1RBUA 2HW3A 1NOZA 1RILA 1RT1A 1RT3A 3NF9A 4Z0UA 3V9WA 4RW4A 4YFUA 1CXQA 4FVMA 4KTWA 5DMRA 3TWHA 3RRHA 1JXEA 5D3GA 1VSDA 2DFHA 4NYNA 3T3FA 3M8QA 4M3TA 2GBZA 2P5GA 1VSKA 1KTQA 4CK3A 3L2WA 4DS5A 1ZBFA 2FBXA 3LP1A 3NGYA 4C8KA 1NK4A 4DSEA 1GOCA 3I8DA 4DTNA 3O4QA 4LY7A 1RDCA 3OYKA 4M41A 1SKWA 2F8TA 2OPQA 2FBVA 2YNHA 1C1AA 1LAWA 4F2SA 4NCAA 3ISNC 3K5OA 5CYQA 4CE9A 5HRRA 2Y1IA 1L3SA 1WSIA 1UOCA 3SI6A 4BE1A 2HVIA 4OPJA 4BE2A 5I42A 3QEIA 1HMVA 1HJRA 3K58A 1RBTA 5HLFA 1N5YA 4FJHA 4CF8A 4M3YA 1S1VA 3DLEA 1C1BA 4XIUA 2RF2A 4FZXC 1C0TA 2I5JA 4E7HA 4N5SA 2PY5A 3RTVA 1DTTA 2D0BA 2ITGA 3A2FA 4CJ4A 3TI0A 3AVBA 1Q9YA 3RMAA 2DFEA 3THVA 1R0AA 4F3TA 3OVNA 4KKOA 3L8BA 4FCYA 4DTRA 2HHQA 2G8HA 4BWMA 4QCLA 1HQEA 3VQ7A 3RMCA 3VQ6A 1IO2A 4FJIA 2XY5A 4FLWA 3KKSA 1RCHA 1SUQA 2IDOA 4CF2A 3VQEA 3U6FA 3PO4A 2JLEA 3DLBA 3NF7A 3QIOA 1D8YA 3SJJA 4FJLA 2O4IA 1GOAA 3O3FA 5J2NA 1G15A 3CYMA 2P51A 4ID5A 3AO2A 1D9FA 2PZSA 3NE6A 4BACA 3LANA 3HT3A 3QIPA 4FK2A 2HNZA 4ELUA 3LALA 4IFYA 4CEDA 3S3MA 4IBNA 1B9FA 4CGDA 1NJWA 4ELTA 3KK2A 3ZCMA 1CZ9A 1KFDA 1WSGA 4Z4FA 1ITGA 1W0HA 3AO5A 4KTQA 3NDKA 4FM2A 3ZSWA 5KRTA 4W5TA 4ELVA 1NJYA 1T7PA 1JLQA 4PUOA 2BDPA 3IAYA 4PA1A 1X9MA 2XY8A 2E6MA 3SPZA 4DSJA 2D0CA 4DLEA 3DYAA 4ZHRA 1JLCA 5CY4A 1A5WA 3T19A 3OY9A 4FK4A 3WNFA 3TAQA 2O4GA 4CEOA 3LZIA 5E41A 2ZD1A 4AHRA 4CJ3A 2OZMA 2FBTA 3RR8A 1BQNA 3I0RA 4PY5A 4KB0A 2A1SA 3KJVA 4IG0A 1Y97A 3SQ2A 1NK0A 3HP9A 4DFMA 3L2UA 4M3ZA 3SNNA 1X1PA 1EX4A 3QLHA 4IDKA 3NGIA 3TAEA 2ETJA 1KCFA 4M3XA 3ASMA 4CJPA 3QEPA 1Z25A 3QEXA 3HPHA 4EP4A 5HBMA 5HROA 1C0UA 1YT3A 3MXMA 4C8NA 1LV5A 1I3AA 1HPZA 3BDPA 4IFVA 3ZSOA 4CJTA 3L3UA 3JYTA 3TANA 3KTQA 4DQPA 3RMDA 4HUFA 1S6QA 4CF1A 1IG9A 4F2RA 4O55A 2KZZA 4DFKA 1IKXA 1S6PA 3SV3A 4M3WA 5EU7A 4CFBA 3NH0A 1RDDA 4LSLA 1RDAA 4FJMA 2X6NA 3ZSYA 1Q9XA 3V9SA 4CJ5A 1TGOA 4Q0BA 4CHOA 4FJNA 4AHTA 4OKJA 3C6UA 1WSFA 5HRPA 4ZTJA 4WE1A 1L3VA 4N47A 2VWKA 4B9UA 4FW2A 3WNEA 3DM2A 1LWCA 5T7BA 4J2DA 2G8VA 1T03A 4G1QA 4CJLA 4DTMA 2BE2A 3LDSA 3SZ2A 4RW9A 1KVAA 1VSEA 3MXJA 4BWJA 1SL2A 4CJEA 1IH7A 4CGFA 4FZYA 4I9LA 4CJQA 3HPOA 4J2EA 3HK2A 3SQ0A 1S5JA 3PX4A 4NYFA 3K2PA 3SUNA 4FYDA 3V9UA 5C42A 1TKTA 4JLHA 3KK3A 3D0PA 4I2QA 5J1EA 4FJGA 5KGWA 3HO1A 2D5RA 4OVLA 5KTQA 3V1QA 3TAGA 4ZTFA 5KI6A 2RPIA 3AVKA 3L2VA 4JS4A 3LWMA 3WNHA 1RBRA 1U47A 4FLVA 4JRPA 1JLGA 4O0JA 4CEEA 4DTPA 1JLEA 1TL3A 3U3YA 5FRNA 1VSJA 2HB5A 2YKNA 3DLGA 3I0SA 3AVFA 1IKWA 3NF8A 3PO5A 1B92A 1WLJA 4CFDA 3VQ8A 1HQUA 5DK5A 4Z4HA 4DU1A 3PY8A 1QTMA 1EETA 1JLBA 3AVLA 4DTUA 4EP5A 1NKEA 3D45A 4LD0A 3T1AA 1BIZA 4OKEA 3PX6A 4NCBA 5KRSA 1KVCA 2XO7A 1BL3A 3K57A 1UWBA 3ZT1A 4EZ6A 4TSXA 4I7FA 4KTZA 1JLAA 3AVAA 3CM5A 3CM6A 4KV8A 3LPTA 4R5PA 4Z4IA 4B9SA 2YHAA 4B3OA 1NJXA 1TK5A 3P5JA 1S1XA 2Q3SA 1BCMA 3ULDA 2HVHA 5FROA 4PQUA 3DOLA 1TKZA 3OYFA 2B4JA 3ZT4A 1RTHA 3BGRA 4CIGA 4DU3A 4B9LA 2GV9A 4HUGA 3LZJA 4F8RA 4B8AB 3KLIA 4N56A 3MAQA 1WSHA 4HHTA 2PYLA 2KTQA 2WONA 4K8ZA 1LWFA 4K8XA 1WN7A 3O3GA 1XI1A 3C94A 1QSYA 3LP0A 4M3UA 3PV8A 1VK0A 4E7LA 2RN2A 4Y1DA 4DQSA 4DQIA 1J54A 1U04A 4GW6A 5J2MA 3G10A 4FM0A 3ZSRA 4CCHA 4HCCA 4L8RB 1J5OA 1NK9A 3JSMA 3OJSA 1A5XA 4W5OA 4CJUA 2KW4A 1B9DA 2HHSA 2W42A 3KLGA 3TAPA 1RT2A 1D9DA 3QO9A 5JS1A 4GMJB 4DF4A 2OYQA 1BIUA 4CJFA 1RTJA 3OYLA 3VQ9A 3V81A 1VSIA 4CESA 4CGJA 3KK1A 3LWLA 4FJKA 4M45A 3CQ8A 2FBYA 4E89A 2E6LA 1XHZA 1WNSA 2OPPA 2QKKA 1FXXA 3DI6A 3KLEA 3NHGA 2JGUA 5C25A 4B08A 1ZBUA 1LAVA 3AO1A 1JXBA 4EZ9A 4KFBA 1KLNA 4AH9A 4F4KA 4KO0A 4H4OA 3RMBA 2IGIA 4LH4A 4KHWA 2GUIA 3MEGA 4IG3A 3ZSXA 4E7IA 3V9XA 4DLGA 4CFCA 2NUBA 3QEWA 1RT5A 4B9VA 3UIQA 3L2QA 3AO4A 4KHQA 4OLBA 3EY1A 1SKSA 2OPRA 3P83D 4M3RA 4DTOA 3AVNA 3FFIA 3HSTB 1ASWA 4FLXA 1JL2A 1N6QA 4QAGA 4FZZA 1XWLA 3IG1A 1J53A 2ATQA 4CJKA 1S1WA 5J2PA 1KSPA 5C24A 1I39A 2HNYA 4CFAA 3VQ5A 3NH1A 1VSLA 2IS3A 1RT6A 3HVTA 1TK0A 1HRHA 4E1MA 2G8UA 4KI4A 4KREA 1QE1A 3E01A 3HL8A 3KLHA 1BI4B 3OYCA 4HTUA 1DLOA 4DSFA 4DFJA 2P5OA 3VQAA 4BDZA 1BQMA 1NKCA 2HMIA 3RRGA 3V1RA 2XHBA 3H08A 4AHCA 3VQQA 3AV9A 4E7JA 2VG7A 1T05A 3M8SA 3S3NA 2B5JA 2FC0A 3MXIA 4CEQA 4Z4EA 4FJ5A 1WSEA 3HYFA 4H4MA 3NH2A 4FM1A 2Z1IA 1REVA 2RKIA 3SV4A 3PX0A 2WOMA 3G0ZA 4CEBA 1TV6A 1SL0A 1NK6A 5HRNA 1L5UA 4RW7A 1WSJA 5FRMA 4QOZB 1VSHA 2YV0X 4Y1CA 1K6YA 5SZTA 3TAMA 3K5LA 2Y1JA 4F3OA 4FLZA 4C8MA 2YNIA 1LWEA 2OA8A 3LP3A 4CF9A 3AVHA 4RW6A 3QNOA 2XRIA 2BANA 2HNDA 4DMNA 1NKBA 3M8RA 4CJSA 4JRQA 4CHPA 5HRSA 1VRUA 3B6OA 2OPSA 3AVIA 5FDLA 3VQCA 5SWMA 4W5QA 4E7KA 4Z4GA 3K5NA 1KLMA 3F9KA 1QS4A 2ZE2A 4E1NA 1EKEA 1NK8A 4B9MA 2HHXA 3VQPA 4AHSA 2F96A 4PWDA 1U45A 4DFPA 5JS2A 4DSLA 3OYMA 3DLHA 4DTJA 2R7YA 4C8OA 4LH5A 4AHUA 1HNIA 5KGXA 5CZ1A 4DF8A 4W5RA 1NOYA 2KFNA 4E19A 1VRTA 4IKFA 1L3UA 1QQCA 3QNNA 3DOKA 1VSFA 1S9GA 3LPUA 4E3SA 5I3UA 2XY6A 2G8IA 3QETA 3MEDA 2D0AA 1MU2A 2KFZA 4B8CA 1S1TA 3AVMA 3VA0A 1TK8A 3LP2A 3QINA 3VQDA 3KD5E 1IKYA 5K14A 4KHYA 3DMJA 3S3OA 3SUPA 2A1RA 3CFOA 1EP4A 4FXDA 4N76A 1GOBA 3VN5A 4CIEA 2BGGA 3AA2A 5J2QA 1JKHA 1SV5A 1WAJA 3OYAA 3NF6A 3O4NA 3V9ZA 1ZYQA 4DWIA 2HHVA 2Z1HA 2VG6A 4RW8A 3SPYA 1RTDA 2DY4A 3OS2A 1S1UA 3LAMA 1YVUA 3OYDA 3U3GA 3QEVA 4DSKA 4CJWA 5CZ2A 4DQRA 4KAZA 3C95A 1JLFA 2XY7A 3TABA 3AA5X 4KHSA 2VG5A 3KLFA 1J9AA 2OZSA 2IAJA 3MECA 1U4BA 2P1JA 1KVBA 3SUOA 3TARA 2HHUA 4FJ9A 4AILC 4RG8A 4DSIA 4O0IA 3OYGA 3HP6A 1TL1A 2Z1GA 3PUFA 3SQ1A 2B6AA 1RDBA 1YTAA 1RT7A 2KQ2A 3KKRA 3SYZA 3HXMA 4FW1A 1CXUA 4CGGA 4DQQA 3V1OA 1S9EA 4CK1A 1Z26A 1HYVA 4KHUA 3OYHA 2X6SA 1HNVA 1A5VA 1LW2A 2LSNA 4FLYA 2QKBA 3L3VA 3HM9A 4DU4A 3HVRA 1YTUA 1VSMA 3V6DA 1NK5A 4HCBA 4NCGA 4DTSA 4CJVA 3OJUA 1Q8IA 3VA3A 4CGHA 2YHBA 3ZT2A 3SQ4A 4KPYA 3P1GA 4OPKA 3K59A 4KB1A 2ZQBA 3IRXA 4FLTA 4I2PA 4OKKA 4OGEA 2VWJA 5HP1A 3VQ4A 3OYBA 2Z1JA 3OYEA 4B9NA 1HYSA 3ZSVA 3SUQA 1UA1A 3RR7A 3OYNA 1BCOA 3AVCA 1RTIA 4CECA 3SCXA 4FJJA 1TKDA 4MFBA 4KHNA 4GVMA 4FJ7A 1SKRA 1NK7A 1XHXA 4HUEA 4Z4CA 2HHWA 3OS0A 1DTQA 1BGXT 2QXFA 3AO3A 1EXQA 3WNGA 4O5BA 3ZT0A 4CEAA 1FKPA 4YNQA 3QERA 3KD1E 3F73A 1UA0A 3RWUA 4DTXA 4FK0A 3TAFA 4OGCA 4C8LA 1FKOA 1ZBLA 4CJRA 4W5NA 2IOCA 3M8PA 1RT4A 1RBVA 3LAKA 3KIOA 3ZSZA 4CEFA 4E0DA 3DLRA 1ASUA 4CIFA 4KRFA 1QHTA 4LSNA 3EYZA 3IS9A 4OLAA 4FLUA 3AVGA 1C0MA 3O3HA 2HHTA 4BDYA 3NBPA 4J2BA 3NCIA 2EX3A 4CF0A 4UQGA 4CK2A 2EHGA 3ZT3A 1U49A 1CZBA 1NJZA 2G8KA 1D5AA 2PYJA 4AHVA 2YKMA 3AVJA 1FK9A 3DRSA 1T8EA 1TKXA 3DLKA 3TR8A 3CFPA 4B9TA 1BI4A 4CGIA 3S9HA 1ZBHA 2QK9A 2DTUA 2YNGA 1KRPA 3HJFA 2X74A 3ZSQA 1WAFA 1C1CA 1HYZA 1UAXA 4O4GA 3V4IA 1TVRA 4BDPA 2G8FA 4O44A 4BE0A 3VQBA 4N41A 4OJRA 3OYIA 3CFRA 1RBSA 2G8WA 3MEEA 1XC9A 4CHZA 1X9WA 2DFFA 1L3TA 2X78A 4Q5VA 4DG1A 1KFSA 3EZ5A 4CEZA 3DRPA 4CHYA 3OS1A 4M42A 1O1WA 1U48A 2AJQA 3B6PA 3C6TA 1ASVA 4HVJA 1RNHA 4FJXA 3AA3A 1TAUA 4H8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SL1 A;  2IC3 A;  1BIS A;  3DRR A;  4JS5 A;  4J2A A;  1W9H A;  3HPG A;  4CER A;  4KI6 A;  1TAQ A;  2E4L A;  3AA4 A;  4CHQ A;  3ALY A;  4DS4 A;  3QES A;  1IKV A;  1CLQ A;  2KZM A;  3K5M A;  3CG7 A;  3L2R A;  1X9S A;  3NFA A;  1ZBI A;  4ICL A;  2YNF A;  3NAE A;  4CHN A;  1LW0 A;  1F21 A;  3ITH A;  1QSL A;  4I9Q A;  3OYJ A;  1BHL A;  1QSS A;  2F8S A;  3NGZ A;  1C6V A;  1JL1 A;  4FJ8 A;  4MQ3 A;  4ID1 A;  5CYM A;  1RBU A;  2HW3 A;  1NOZ A;  1RIL A;  1RT1 A;  1RT3 A;  3NF9 A;  4Z0U A;  3V9W A;  4RW4 A;  4YFU A;  1CXQ A;  4FVM A;  4KTW A;  5DMR A;  3TWH A;  3RRH A;  1JXE A;  5D3G A;  1VSD A;  2DFH A;  4NYN A;  3T3F A;  3M8Q A;  4M3T A;  2GBZ A;  2P5G A;  1VSK A;  1KTQ A;  4CK3 A;  3L2W A;  4DS5 A;  1ZBF A;  2FBX A;  3LP1 A;  3NGY A;  4C8K A;  1NK4 A;  4DSE A;  1GOC A;  3I8D A;  4DTN A;  3O4Q A;  4LY7 A;  1RDC A;  3OYK A;  4M41 A;  1SKW A;  2F8T A;  2OPQ A;  2FBV A;  2YNH A;  1C1A A;  1LAW A;  4F2S A;  4NCA A;  3ISN C;  3K5O A;  5CYQ A;  4CE9 A;  5HRR A;  2Y1I A;  1L3S A;  1WSI A;  1UOC A;  3SI6 A;  4BE1 A;  2HVI A;  4OPJ A;  4BE2 A;  5I42 A;  3QEI A;  1HMV A;  1HJR A;  3K58 A;  1RBT A;  5HLF A;  1N5Y A;  4FJH A;  4CF8 A;  4M3Y A;  1S1V A;  3DLE A;  1C1B A;  4XIU A;  2RF2 A;  4FZX C;  1C0T A;  2I5J A;  4E7H A;  4N5S A;  2PY5 A;  3RTV A;  1DTT A;  2D0B A;  2ITG A;  3A2F A;  4CJ4 A;  3TI0 A;  3AVB A;  1Q9Y A;  3RMA A;  2DFE A;  3THV A;  1R0A A;  4F3T A;  3OVN A;  4KKO A;  3L8B A;  4FCY A;  4DTR A;  2HHQ A;  2G8H A;  4BWM A;  4QCL A;  1HQE A;  3VQ7 A;  3RMC A;  3VQ6 A;  1IO2 A;  4FJI A;  2XY5 A;  4FLW A;  3KKS A;  1RCH A;  1SUQ A;  2IDO A;  4CF2 A;  3VQE A;  3U6F A;  3PO4 A;  2JLE A;  3DLB A;  3NF7 A;  3QIO A;  1D8Y A;  3SJJ A;  4FJL A;  2O4I A;  1GOA A;  3O3F A;  5J2N A;  1G15 A;  3CYM A;  2P51 A;  4ID5 A;  3AO2 A;  1D9F A;  2PZS A;  3NE6 A;  4BAC A;  3LAN A;  3HT3 A;  3QIP A;  4FK2 A;  2HNZ A;  4ELU A;  3LAL A;  4IFY A;  4CED A;  3S3M A;  4IBN A;  1B9F A;  4CGD A;  1NJW A;  4ELT A;  3KK2 A;  3ZCM A;  1CZ9 A;  1KFD A;  1WSG A;  4Z4F A;  1ITG A;  1W0H A;  3AO5 A;  4KTQ A;  3NDK A;  4FM2 A;  3ZSW A;  5KRT A;  4W5T A;  4ELV A;  1NJY A;  1T7P A;  1JLQ A;  4PUO A;  2BDP A;  3IAY A;  4PA1 A;  1X9M A;  2XY8 A;  2E6M A;  3SPZ A;  4DSJ A;  2D0C A;  4DLE A;  3DYA A;  4ZHR A;  1JLC A;  5CY4 A;  1A5W A;  3T19 A;  3OY9 A;  4FK4 A;  3WNF A;  3TAQ A;  2O4G A;  4CEO A;  3LZI A;  5E41 A;  2ZD1 A;  4AHR A;  4CJ3 A;  2OZM A;  2FBT A;  3RR8 A;  1BQN A;  3I0R A;  4PY5 A;  4KB0 A;  2A1S A;  3KJV A;  4IG0 A;  1Y97 A;  3SQ2 A;  1NK0 A;  3HP9 A;  4DFM A;  3L2U A;  4M3Z A;  3SNN A;  1X1P A;  1EX4 A;  3QLH A;  4IDK A;  3NGI A;  3TAE A;  2ETJ A;  1KCF A;  4M3X A;  3ASM A;  4CJP A;  3QEP A;  1Z25 A;  3QEX A;  3HPH A;  4EP4 A;  5HBM A;  5HRO A;  1C0U A;  1YT3 A;  3MXM A;  4C8N A;  1LV5 A;  1I3A A;  1HPZ A;  3BDP A;  4IFV A;  3ZSO A;  4CJT A;  3L3U A;  3JYT A;  3TAN A;  3KTQ A;  4DQP A;  3RMD A;  4HUF A;  1S6Q A;  4CF1 A;  1IG9 A;  4F2R A;  4O55 A;  2KZZ A;  4DFK A;  1IKX A;  1S6P A;  3SV3 A;  4M3W A;  5EU7 A;  4CFB A;  3NH0 A;  1RDD A;  4LSL A;  1RDA A;  4FJM A;  2X6N A;  3ZSY A;  1Q9X A;  3V9S A;  4CJ5 A;  1TGO A;  4Q0B A;  4CHO A;  4FJN A;  4AHT A;  4OKJ A;  3C6U A;  1WSF A;  5HRP A;  4ZTJ A;  4WE1 A;  1L3V A;  4N47 A;  2VWK A;  4B9U A;  4FW2 A;  3WNE A;  3DM2 A;  1LWC A;  5T7B A;  4J2D A;  2G8V A;  1T03 A;  4G1Q A;  4CJL A;  4DTM A;  2BE2 A;  3LDS A;  3SZ2 A;  4RW9 A;  1KVA A;  1VSE A;  3MXJ A;  4BWJ A;  1SL2 A;  4CJE A;  1IH7 A;  4CGF A;  4FZY A;  4I9L A;  4CJQ A;  3HPO A;  4J2E A;  3HK2 A;  3SQ0 A;  1S5J A;  3PX4 A;  4NYF A;  3K2P A;  3SUN A;  4FYD A;  3V9U A;  5C42 A;  1TKT A;  4JLH A;  3KK3 A;  3D0P A;  4I2Q A;  5J1E A;  4FJG A;  5KGW A;  3HO1 A;  2D5R A;  4OVL A;  5KTQ A;  3V1Q A;  3TAG A;  4ZTF A;  5KI6 A;  2RPI A;  3AVK A;  3L2V A;  4JS4 A;  3LWM A;  3WNH A;  1RBR A;  1U47 A;  4FLV A;  4JRP A;  1JLG A;  4O0J A;  4CEE A;  4DTP A;  1JLE A;  1TL3 A;  3U3Y A;  5FRN A;  1VSJ A;  2HB5 A;  2YKN A;  3DLG A;  3I0S A;  3AVF A;  1IKW A;  3NF8 A;  3PO5 A;  1B92 A;  1WLJ A;  4CFD A;  3VQ8 A;  1HQU A;  5DK5 A;  4Z4H A;  4DU1 A;  3PY8 A;  1QTM A;  1EET A;  1JLB A;  3AVL A;  4DTU A;  4EP5 A;  1NKE A;  3D45 A;  4LD0 A;  3T1A A;  1BIZ A;  4OKE A;  3PX6 A;  4NCB A;  5KRS A;  1KVC A;  2XO7 A;  1BL3 A;  3K57 A;  1UWB A;  3ZT1 A;  4EZ6 A;  4TSX A;  4I7F A;  4KTZ A;  1JLA A;  3AVA A;  3CM5 A;  3CM6 A;  4KV8 A;  3LPT A;  4R5P A;  4Z4I A;  4B9S A;  2YHA A;  4B3O A;  1NJX A;  1TK5 A;  3P5J A;  1S1X A;  2Q3S A;  1BCM A;  3ULD A;  2HVH A;  5FRO A;  4PQU A;  3DOL A;  1TKZ A;  3OYF A;  2B4J A;  3ZT4 A;  1RTH A;  3BGR A;  4CIG A;  4DU3 A;  4B9L A;  2GV9 A;  4HUG A;  3LZJ A;  4F8R A;  4B8A B;  3KLI A;  4N56 A;  3MAQ A;  1WSH A;  4HHT A;  2PYL A;  2KTQ A;  2WON A;  4K8Z A;  1LWF A;  4K8X A;  1WN7 A;  3O3G A;  1XI1 A;  3C94 A;  1QSY A;  3LP0 A;  4M3U A;  3PV8 A;  1VK0 A;  4E7L A;  2RN2 A;  4Y1D A;  4DQS A;  4DQI A;  1J54 A;  1U04 A;  4GW6 A;  5J2M A;  3G10 A;  4FM0 A;  3ZSR A;  4CCH A;  4HCC A;  4L8R B;  1J5O A;  1NK9 A;  3JSM A;  3OJS A;  1A5X A;  4W5O A;  4CJU A;  2KW4 A;  1B9D A;  2HHS A;  2W42 A;  3KLG A;  3TAP A;  1RT2 A;  1D9D A;  3QO9 A;  5JS1 A;  4GMJ B;  4DF4 A;  2OYQ A;  1BIU A;  4CJF A;  1RTJ A;  3OYL A;  3VQ9 A;  3V81 A;  1VSI A;  4CES A;  4CGJ A;  3KK1 A;  3LWL A;  4FJK A;  4M45 A;  3CQ8 A;  2FBY A;  4E89 A;  2E6L A;  1XHZ A;  1WNS A;  2OPP A;  2QKK A;  1FXX A;  3DI6 A;  3KLE A;  3NHG A;  2JGU A;  5C25 A;  4B08 A;  1ZBU A;  1LAV A;  3AO1 A;  1JXB A;  4EZ9 A;  4KFB A;  1KLN A;  4AH9 A;  4F4K A;  4KO0 A;  4H4O A;  3RMB A;  2IGI A;  4LH4 A;  4KHW A;  2GUI A;  3MEG A;  4IG3 A;  3ZSX A;  4E7I A;  3V9X A;  4DLG A;  4CFC A;  2NUB A;  3QEW A;  1RT5 A;  4B9V A;  3UIQ A;  3L2Q A;  3AO4 A;  4KHQ A;  4OLB A;  3EY1 A;  1SKS A;  2OPR A;  3P83 D;  4M3R A;  4DTO A;  3AVN A;  3FFI A;  3HST B;  1ASW A;  4FLX A;  1JL2 A;  1N6Q A;  4QAG A;  4FZZ A;  1XWL A;  3IG1 A;  1J53 A;  2ATQ A;  4CJK A;  1S1W A;  5J2P A;  1KSP A;  5C24 A;  1I39 A;  2HNY A;  4CFA A;  3VQ5 A;  3NH1 A;  1VSL A;  2IS3 A;  1RT6 A;  3HVT A;  1TK0 A;  1HRH A;  4E1M A;  2G8U A;  4KI4 A;  4KRE A;  1QE1 A;  3E01 A;  3HL8 A;  3KLH A;  1BI4 B;  3OYC A;  4HTU A;  1DLO A;  4DSF A;  4DFJ A;  2P5O A;  3VQA A;  4BDZ A;  1BQM A;  1NKC A;  2HMI A;  3RRG A;  3V1R A;  2XHB A;  3H08 A;  4AHC A;  3VQQ A;  3AV9 A;  4E7J A;  2VG7 A;  1T05 A;  3M8S A;  3S3N A;  2B5J A;  2FC0 A;  3MXI A;  4CEQ A;  4Z4E A;  4FJ5 A;  1WSE A;  3HYF A;  4H4M A;  3NH2 A;  4FM1 A;  2Z1I A;  1REV A;  2RKI A;  3SV4 A;  3PX0 A;  2WOM A;  3G0Z A;  4CEB A;  1TV6 A;  1SL0 A;  1NK6 A;  5HRN A;  1L5U A;  4RW7 A;  1WSJ A;  5FRM A;  4QOZ B;  1VSH A;  2YV0 X;  4Y1C A;  1K6Y A;  5SZT A;  3TAM A;  3K5L A;  2Y1J A;  4F3O A;  4FLZ A;  4C8M A;  2YNI A;  1LWE A;  2OA8 A;  3LP3 A;  4CF9 A;  3AVH A;  4RW6 A;  3QNO A;  2XRI A;  2BAN A;  2HND A;  4DMN A;  1NKB A;  3M8R A;  4CJS A;  4JRQ A;  4CHP A;  5HRS A;  1VRU A;  3B6O A;  2OPS A;  3AVI A;  5FDL A;  3VQC A;  5SWM A;  4W5Q A;  4E7K A;  4Z4G A;  3K5N A;  1KLM A;  3F9K A;  1QS4 A;  2ZE2 A;  4E1N A;  1EKE A;  1NK8 A;  4B9M A;  2HHX A;  3VQP A;  4AHS A;  2F96 A;  4PWD A;  1U45 A;  4DFP A;  5JS2 A;  4DSL A;  3OYM A;  3DLH A;  4DTJ A;  2R7Y A;  4C8O A;  4LH5 A;  4AHU A;  1HNI A;  5KGX A;  5CZ1 A;  4DF8 A;  4W5R A;  1NOY A;  2KFN A;  4E19 A;  1VRT A;  4IKF A;  1L3U A;  1QQC A;  3QNN A;  3DOK A;  1VSF A;  1S9G A;  3LPU A;  4E3S A;  5I3U A;  2XY6 A;  2G8I A;  3QET A;  3MED A;  2D0A A;  1MU2 A;  2KFZ A;  4B8C A;  1S1T A;  3AVM A;  3VA0 A;  1TK8 A;  3LP2 A;  3QIN A;  3VQD A;  3KD5 E;  1IKY A;  5K14 A;  4KHY A;  3DMJ A;  3S3O A;  3SUP A;  2A1R A;  3CFO A;  1EP4 A;  4FXD A;  4N76 A;  1GOB A;  3VN5 A;  4CIE A;  2BGG A;  3AA2 A;  5J2Q A;  1JKH A;  1SV5 A;  1WAJ A;  3OYA A;  3NF6 A;  3O4N A;  3V9Z A;  1ZYQ A;  4DWI A;  2HHV A;  2Z1H A;  2VG6 A;  4RW8 A;  3SPY A;  1RTD A;  2DY4 A;  3OS2 A;  1S1U A;  3LAM A;  1YVU A;  3OYD A;  3U3G A;  3QEV A;  4DSK A;  4CJW A;  5CZ2 A;  4DQR A;  4KAZ A;  3C95 A;  1JLF A;  2XY7 A;  3TAB A;  3AA5 X;  4KHS A;  2VG5 A;  3KLF A;  1J9A A;  2OZS A;  2IAJ A;  3MEC A;  1U4B A;  2P1J A;  1KVB A;  3SUO A;  3TAR A;  2HHU A;  4FJ9 A;  4AIL C;  4RG8 A;  4DSI A;  4O0I A;  3OYG A;  3HP6 A;  1TL1 A;  2Z1G A;  3PUF A;  3SQ1 A;  2B6A A;  1RDB A;  1YTA A;  1RT7 A;  2KQ2 A;  3KKR A;  3SYZ A;  3HXM A;  4FW1 A;  1CXU A;  4CGG A;  4DQQ A;  3V1O A;  1S9E A;  4CK1 A;  1Z26 A;  1HYV A;  4KHU A;  3OYH A;  2X6S A;  1HNV A;  1A5V A;  1LW2 A;  2LSN A;  4FLY A;  2QKB A;  3L3V A;  3HM9 A;  4DU4 A;  3HVR A;  1YTU A;  1VSM A;  3V6D A;  1NK5 A;  4HCB A;  4NCG A;  4DTS A;  4CJV A;  3OJU A;  1Q8I A;  3VA3 A;  4CGH A;  2YHB A;  3ZT2 A;  3SQ4 A;  4KPY A;  3P1G A;  4OPK A;  3K59 A;  4KB1 A;  2ZQB A;  3IRX A;  4FLT A;  4I2P A;  4OKK A;  4OGE A;  2VWJ A;  5HP1 A;  3VQ4 A;  3OYB A;  2Z1J A;  3OYE A;  4B9N A;  1HYS A;  3ZSV A;  3SUQ A;  1UA1 A;  3RR7 A;  3OYN A;  1BCO A;  3AVC A;  1RTI A;  4CEC A;  3SCX A;  4FJJ A;  1TKD A;  4MFB A;  4KHN A;  4GVM A;  4FJ7 A;  1SKR A;  1NK7 A;  1XHX A;  4HUE A;  4Z4C A;  2HHW A;  3OS0 A;  1DTQ A;  1BGX T;  2QXF A;  3AO3 A;  1EXQ A;  3WNG A;  4O5B A;  3ZT0 A;  4CEA A;  1FKP A;  4YNQ A;  3QER A;  3KD1 E;  3F73 A;  1UA0 A;  3RWU A;  4DTX A;  4FK0 A;  3TAF A;  4OGC A;  4C8L A;  1FKO A;  1ZBL A;  4CJR A;  4W5N A;  2IOC A;  3M8P A;  1RT4 A;  1RBV A;  3LAK A;  3KIO A;  3ZSZ A;  4CEF A;  4E0D A;  3DLR A;  1ASU A;  4CIF A;  4KRF A;  1QHT A;  4LSN A;  3EYZ A;  3IS9 A;  4OLA A;  4FLU A;  3AVG A;  1C0M A;  3O3H A;  2HHT A;  4BDY A;  3NBP A;  4J2B A;  3NCI A;  2EX3 A;  4CF0 A;  4UQG A;  4CK2 A;  2EHG A;  3ZT3 A;  1U49 A;  1CZB A;  1NJZ A;  2G8K A;  1D5A A;  2PYJ A;  4AHV A;  2YKM A;  3AVJ A;  1FK9 A;  3DRS A;  1T8E A;  1TKX A;  3DLK A;  3TR8 A;  3CFP A;  4B9T A;  1BI4 A;  4CGI A;  3S9H A;  1ZBH A;  2QK9 A;  2DTU A;  2YNG A;  1KRP A;  3HJF A;  2X74 A;  3ZSQ A;  1WAF A;  1C1C A;  1HYZ A;  1UAX A;  4O4G A;  3V4I A;  1TVR A;  4BDP A;  2G8F A;  4O44 A;  4BE0 A;  3VQB A;  4N41 A;  4OJR A;  3OYI A;  3CFR A;  1RBS A;  2G8W A;  3MEE A;  1XC9 A;  4CHZ A;  1X9W A;  2DFF A;  1L3T A;  2X78 A;  4Q5V A;  4DG1 A;  1KFS A;  3EZ5 A;  4CEZ A;  3DRP A;  4CHY A;  3OS1 A;  4M42 A;  1O1W A;  1U48 A;  2AJQ A;  3B6P A;  3C6T A;  1ASV A;  4HVJ A;  1RNH A;  4FJX A;  3AA3 A;  1TAU A;  4H8K A; 
#chains in the Genus database with same CATH topology
 3OTO K;  4WYB A;  4CER A;  2QWN A;  2E4L A;  3AA4 A;  4H0V B;  2NRW A;  3K5M A;  2F9W A;  1YUW A;  3L2R A;  4AM6 A;  3NAE A;  2NRX A;  1F21 A;  3OYJ A;  5GAE P;  2HW3 A;  4MQ3 A;  2Q31 A;  1DEJ A;  3O8M A;  1RT3 A;  4A5A A;  4CBX A;  3NF9 A;  3V9W A;  2E8A A;  1N32 K;  1H1V A;  4KTW A;  5DMR A;  1HKG A;  4IJA A;  3RRH A;  5D3G A;  5C15 A;  4CZL A;  3L2W A;  5BRD A;  3TTD A;  4DS5 A;  1NK4 A;  4BR4 A;  3F2K A;  4B1W B;  1X3M A;  3O4Q A;  4YOW A;  1TUY A;  1VAZ A;  1C1A A;  3THW A;  3A5M C;  4F2S A;  2VGN A;  3GL1 A;  5HRR A;  3C7N B;  2GTD A;  2YX6 A;  4BR9 A;  3SI6 A;  4O8U A;  4H0X B;  2UUA K;  3IKM A;  3CQX A;  2F4V K;  4A61 A;  4C1N I;  4JI7 K;  2RF2 A;  3DXK B;  1C0T A;  1VQN N;  4N5S A;  2D0B A;  3KHY A;  4FWP A;  3A2F A;  4CJ4 A;  3THV A;  4F3T A;  3L8B A;  4KKO A;  5AQP A;  1T6C A;  3KKS A;  1SUQ A;  5FPE A;  2O8F A;  3U6F A;  3DLB A;  4YOT A;  5BN9 A;  4DB3 A;  5J2N A;  1M1K O;  3AO2 A;  1D9F A;  3NE6 A;  3QIP A;  2HNZ A;  3LM2 A;  2Q1N A;  1NJW A;  2P9N A;  4ELT A;  4YOY A;  4JI8 K;  3AO5 A;  4FM2 A;  4PL8 A;  3ZSW A;  5KRT A;  2ZJR L;  3UKU A;  3K9J A;  4NO7 A;  3SPZ A;  4ZHR A;  4FK4 A;  3WNF A;  3LZI A;  1XNR K;  2ZD1 A;  1SS6 A;  3VEO A;  1BQN A;  2F9T A;  2A1S A;  2ZM6 K;  1VQ5 N;  4JKF A;  4DUY K;  3HP9 A;  5BRH A;  3L2U A;  4M3Z A;  1X1P A;  1N34 K;  1KCF A;  2ETJ A;  3ASM A;  1Z25 A;  3HPH A;  5HRO A;  1C0U A;  4ILJ A;  4GNI A;  2UUC K;  1HR0 K;  1LV5 A;  4IFV A;  4JEP A;  4CJT A;  3NVM A;  4HUF A;  1JCG A;  1S6Q A;  3CME N;  4B1X B;  2KZZ A;  4O55 A;  4DFK A;  1S6P A;  1C0G A;  5EU7 A;  3NH0 A;  4LSL A;  3ZEU A;  4BQZ A;  1N8R O;  3ZX3 A;  1QZ6 A;  2YHW A;  2KHO A;  3CCU N;  4N47 A;  2V7Z A;  4J2D A;  2PFU A;  1NGJ A;  4YY3 K;  2BE2 A;  4JNE A;  3H1Q A;  3SZ2 A;  1VSE A;  4FZY A;  1Z05 A;  3WXL A;  3A8Y A;  4J2E A;  4BR7 A;  3SUN A;  4NYF A;  3K2P A;  5C42 A;  3ULE A;  4O8K A;  4QS9 A;  5J1E A;  5KTQ A;  3A5O C;  4ZTF A;  3AVK A;  2YHY A;  4RCH A;  4LF8 K;  3GOI A;  3DXM B;  3S41 A;  3DLG A;  2YKN A;  3NF8 A;  3CF5 L;  4WFN L;  1MWM A;  1MWK A;  3WXI A;  1HLU A;  3EL2 A;  4OKE A;  4NCB A;  2QWR A;  5KRS A;  1KVC A;  5AQK A;  3PSI A;  3NVK A;  2A41 A;  3AVA A;  4B9S A;  2YHA A;  3LDO A;  2E2N A;  1NJX A;  2Q3S A;  2YHX A;  2HVH A;  5FRO A;  2HBK A;  4PQU A;  1BUP A;  1VQ6 N;  3LDQ A;  3ZT4 A;  1RTH A;  3BGR A;  5EVZ A;  2GEM A;  3ENO A;  1WN7 A;  3O3G A;  2YJE A;  1QSY A;  5FLX O;  2WC9 A;  1VK0 A;  3PV8 A;  4IEI A;  2RN2 A;  1GLC G;  4LF7 K;  4L8R B;  2BUP A;  1WBB A;  5AZI B;  4LF5 K;  1OVQ A;  2KW4 A;  2HHS A;  2NRH A;  1KQS M;  3QO9 A;  4GMJ B;  4YOU A;  1VSI A;  4CES A;  1YJN N;  4M45 A;  4BGB A;  2FSN A;  1WNS A;  1P90 A;  3DI6 A;  3KLE A;  4B08 A;  1JXB A;  3F5T A;  4AM7 A;  4JI0 K;  3THY A;  4KFB A;  4B1Z A;  1KLN A;  4KO0 A;  4M7Y A;  2GUI A;  4IG3 A;  4E7I A;  3BUZ B;  4A59 A;  5EXW A;  2NUB A;  3QEW A;  1NM1 A;  1K73 O;  3L2Q A;  3JS6 A;  4OLB A;  3TSP A;  3CCQ N;  4DR6 K;  2E1Z A;  3H3O B;  3FFI A;  4GKJ K;  4FZZ A;  3IG1 A;  4IOC L;  2ATQ A;  4QS8 A;  1I39 A;  3D2E B;  2NRZ A;  5BPN A;  1TK0 A;  4KI4 A;  4E1M A;  2G8U A;  4DKW A;  4KRE A;  3E01 A;  3KLH A;  3E9P A;  2P5O A;  4BDZ A;  2HMI A;  3MX5 A;  3ZLJ A;  3AAP A;  4IFE A;  2XHB A;  2E5L K;  5AZJ B;  4E7J A;  2VG7 A;  2ASP A;  2B5J A;  1HPM A;  1MA9 B;  4PL7 A;  2UXD K;  1WSE A;  3HYF A;  3PSF A;  3SV4 A;  4FL9 A;  1L5U A;  2P9L A;  1YI2 N;  1K6Y A;  2Y1J A;  2QEX N;  1LWE A;  3EKU A;  3AVH A;  3QNO A;  5TKW A;  2HND A;  1NGI A;  4JRQ A;  4IO9 L;  5FDL A;  4E7K A;  1XUP O;  4Z4G A;  3HM8 A;  3TPQ A;  2O8E A;  2ZE2 A;  4B9M A;  4PWD A;  2E1Y A;  4DTJ A;  2CH6 A;  3FZF A;  4ISF A;  4JKH A;  4FVU A;  5CZ1 A;  4W5R A;  1NOY A;  1J6Z A;  4IKF A;  5AQM A;  4K42 A;  3TTF A;  3LPU A;  2PAV A;  5JVH L;  3QET A;  3AVM A;  1TK8 A;  3ZX0 A;  3CFO A;  4FXD A;  3THW B;  1GOB A;  4CIE A;  2BGG A;  4PUO A;  3NF6 A;  3FFK B;  2P9I B;  3O4N A;  4X66 K;  3V9Z A;  2O8C B;  3VEN A;  4RW8 A;  1RTD A;  3HZ6 A;  3VGK A;  3SMS A;  3C95 A;  3OBW A;  2J4R A;  1BU6 O;  4JI2 K;  1Z6R A;  3MEC A;  4M63 C;  3SUO A;  3OYG A;  3SQ1 A;  1TL1 A;  1EQY A;  4A62 A;  1RFQ A;  3VGM A;  1RT7 A;  2O8F B;  3BY5 A;  2HF4 A;  1S9E A;  2QTD A;  3AAQ A;  2AP1 A;  1E4G T;  3WEE A;  2LSN A;  3L3V A;  4DU4 A;  1YIT N;  3V6D A;  3M6G A;  4HCB A;  4DTS A;  5GAG P;  3VA3 A;  2YHB A;  5AQL A;  3ZT2 A;  4KPY A;  1BWF O;  4BRN A;  4I2P A;  4OKK A;  4OGE A;  2VWJ A;  5HP1 A;  2Z1J A;  3OYE A;  1HYS A;  3ZSV A;  1UA1 A;  3AVC A;  4EHU A;  3O9S A;  2GWK A;  1BGX T;  4CEA A;  4YNQ A;  4O5B A;  1V4S A;  3QER A;  1FKP A;  3SBT A;  1HNZ K;  4NB4 A;  4DTX A;  3TAF A;  4OGC A;  2P9S B;  4MLE A;  3Q7B A;  3M8P A;  3LAK A;  2V7Y A;  1FJG K;  3HRG A;  1DT9 A;  4WFB L;  3IS9 A;  3AVG A;  3O3H A;  3K0S A;  2A40 A;  4BDY A;  2JWL A;  1GLE G;  4J2B A;  3NCI A;  5AQR A;  4GV9 A;  2EHG A;  3CCE N;  1U49 A;  3ENH A;  2PYJ A;  2YKM A;  1HNX K;  3DLK A;  4KBO A;  1KRP A;  2X74 A;  3ZSQ A;  4FWL A;  3AY9 A;  3OYI A;  3CFR A;  3H3N O;  2FLO A;  3MEE A;  4WQ5 C;  5M1O A;  4B3R K;  4Q5V A;  3OS1 A;  4CZH A;  3VEV A;  1OH8 A;  4YDU A;  1ASV A;  1RNH A;  1KAZ A;  4JI5 K;  4BRM A;  1W7A A;  1CZA N;  4KI6 A;  4YOV A;  1CLQ A;  1IKV A;  1X9S A;  5C2D A;  4ICL A;  2YNF A;  3L4I A;  3R8E A;  1QQO A;  4CHN A;  1LW0 A;  3LL3 A;  3UKR A;  1W97 L;  1E3M A;  2AA4 A;  1FW6 A;  4YFU A;  4FVM A;  3MX2 A;  3TSU A;  2DFH A;  3CJ1 A;  4M3T A;  2P5G A;  1VSK A;  4A57 A;  3CCR N;  1ZBF A;  3LP1 A;  3NGY A;  4DQ8 A;  3I8D A;  1RDC A;  1SKW A;  2O8D A;  5JIC A;  3CPE A;  1HX1 A;  3C6A A;  4NCA A;  3ISN C;  5AQQ A;  2GX9 A;  4DV3 K;  4BRO A;  4Y0W A;  5I42 A;  3QEI A;  2O8B A;  1RBT A;  4FWQ A;  4FJH A;  3RSE A;  2VWB A;  4E7H A;  2ITG A;  4FWM A;  1N36 K;  3AVB A;  2KTQ A;  2HHQ A;  4FCY A;  2G8H A;  2NZT A;  4QCL A;  2DPN A;  5F0X A;  4FLW A;  5LMU K;  2IDO A;  4CF2 A;  3VQE A;  2JLE A;  1D8Y A;  3VES A;  1HUX A;  3VEX A;  1S22 A;  4FJL A;  2O4I A;  1GOA A;  1NGA A;  1IBM K;  2PZS A;  5AFU A;  4BQL A;  3THY B;  4IFY A;  3S3M A;  4IBN A;  4CGD A;  5KPT A;  4CZF A;  1YHQ N;  1CZ9 A;  1GLD G;  1KFD A;  4JK9 A;  1RGI A;  4RTF D;  4W5T A;  2VQE K;  1T7P A;  2PBD A;  1KAY A;  4PA1 A;  4DSJ A;  2E6M A;  2D0C A;  4BRC A;  3T19 A;  3OY9 A;  4JI6 K;  3TAQ A;  3ZX2 A;  3MMV A;  3I0R A;  2EWS A;  4PY5 A;  3KJV A;  5KPZ A;  3SQ2 A;  1NK0 A;  4DFM A;  4NXN K;  3TAE A;  1EX4 A;  3QEP A;  2IVP A;  4MO4 A;  4EP4 A;  5LMN K;  3VMF B;  3MXM A;  5M1F A;  1BO5 O;  3BF1 A;  4DQP A;  3JYT A;  3RMD A;  4OO1 J;  4F2R A;  1IKX A;  3A5L C;  4CFB A;  1RDD A;  3U9Z A;  5HL7 L;  3DLL L;  1RDA A;  4FJM A;  2X6N A;  1Q9X A;  3V9S A;  3EE8 A;  4CJ5 A;  4Q0B A;  4CHO A;  4BR0 A;  3N4P A;  3C6U A;  4FWS A;  3DAW A;  1L3V A;  1XMO K;  3O9Q A;  4FW2 A;  3WNE A;  3GG4 A;  4FPB A;  1LWC A;  2QA4 N;  1NGE A;  1NWK A;  5AQX A;  1HNW K;  3FGU A;  4CJL A;  3CER A;  1SL2 A;  3MXJ A;  1IH7 A;  4CGF A;  1ATR A;  4I9L A;  4CJQ A;  3D2F B;  1GLF O;  3WUH A;  5AQG A;  4FYD A;  4JLH A;  3VGL A;  3HO1 A;  4OVL A;  1ATN A;  3N4Q A;  2Q97 A;  5KI6 A;  2UU9 K;  4BRI A;  3MCA B;  4H0O A;  4KH4 A;  1JLG A;  1JLE A;  1OH7 A;  1VSJ A;  3I0S A;  1IKW A;  3SAF A;  2WBN A;  5DK5 A;  4QOZ B;  3PY8 A;  1EET A;  1NKE A;  4IOX A;  3T1A A;  5CE3 A;  3GE1 A;  4NLC A;  4JI1 K;  2XO7 A;  1BL3 A;  4TSX A;  3TU5 A;  2GUP A;  5MLC Q;  4ILH A;  1T3V A;  4PKI A;  3CM6 A;  1TK5 A;  3O1W A;  1S1X A;  4CBU A;  1YVN A;  3FZK A;  1TKZ A;  3OYF A;  4AQY K;  1YJ9 N;  4F8R A;  3LZJ A;  3KLI A;  3MAQ A;  4HHT A;  4JYA K;  1BG3 A;  3MN9 A;  3WEE B;  1XI1 A;  3C94 A;  4JD2 A;  3CC2 N;  1KC8 O;  4Y1D A;  4DQS A;  4DQI A;  1N33 K;  1J54 A;  1U04 A;  4IJN A;  5J2M A;  5BN8 A;  4HCC A;  3ZSR A;  3THX A;  4CJU A;  1B9D A;  3TAP A;  4DF4 A;  1RTJ A;  3VQ9 A;  4CGJ A;  4I6M A;  3O5B A;  3KK1 A;  3LWL A;  2FBY A;  4E89 A;  1XHZ A;  1W2B M;  1VQL N;  2HBJ A;  1XNQ K;  1FXX A;  5JLF A;  2JGU A;  1K9M O;  1ZBU A;  4DR2 K;  4EZ9 A;  1ILY A;  1HKB A;  3SBG A;  4H4O A;  3ZSX A;  3ATV A;  5KQD A;  3JAM O;  4JHD A;  1NMD A;  3UIQ A;  3AO4 A;  5FPM A;  4BRK A;  3EY1 A;  4M3R A;  2OZM A;  3KD5 E;  3HST B;  1ASW A;  2RE2 A;  1XWL A;  1KSP A;  1VSL A;  2IS3 A;  3HVT A;  2E2Q A;  1OH5 A;  1QE1 A;  3HL8 A;  3OYC A;  2HBL A;  4DFJ A;  3ENB A;  3VQA A;  4BG8 A;  2HBM A;  3H08 A;  2BTF A;  3AV9 A;  4LFA K;  3S3N A;  5CHI A;  1TUU A;  4Z4E A;  2E20 A;  4FM1 A;  1REV A;  4WF9 L;  3G0Z A;  1SL0 A;  5HRN A;  3QDK A;  5GAD P;  5BRE A;  1Q86 O;  2P9K A;  5AQW A;  3K5L A;  4F3O A;  4B1U B;  3HSC A;  4LF6 K;  4BC5 A;  4FLZ A;  3G25 A;  4CF9 A;  4RW6 A;  2XRI A;  4DMN A;  1NKB A;  2E2O A;  4CJS A;  5HRS A;  2FF6 A;  5E26 A;  5SWM A;  2W6K A;  3AVI A;  3D6R A;  4E1N A;  2ZJP L;  4AHS A;  3UKR B;  5JS2 A;  2R7Y A;  4LH5 A;  1HNI A;  1G99 A;  2KFN A;  3B8A X;  4E19 A;  1QQC A;  4JKG A;  3QNN A;  1U2V A;  3DOK A;  5I3U A;  3UB5 A;  2D0A A;  1S1T A;  4BC3 A;  3ID8 A;  3QIN A;  2O8D B;  1YAG A;  2A1R A;  3OW2 M;  5AR0 A;  1EP4 A;  4PKG A;  3MN5 A;  3AA2 A;  5F2R A;  1ZYQ A;  2HHV A;  5B8H A;  3J80 O;  2OTL N;  3QEV A;  4DQR A;  2FSK A;  2XY7 A;  3TAB A;  2VG5 A;  1J9A A;  2HMP A;  1SQK A;  4A2A A;  1U4B A;  2Q0R A;  1X9J A;  3ATU A;  4RG8 A;  4DSI A;  4O0I A;  4CJ7 A;  3QML A;  3PUF A;  2Z1G A;  3HP6 A;  1RDB A;  4FW1 A;  4CGG A;  4YOX A;  1BA0 A;  2IVO A;  1ZXO A;  4HTL A;  4FLY A;  1IG8 A;  1VSM A;  1TYQ A;  3IUC A;  1NK5 A;  3OJU A;  4CGH A;  5DM7 L;  4FPA A;  4FLT A;  4JKD A;  3OYB A;  2CH5 A;  1RTI A;  3SCX A;  3WXK A;  4G9Z A;  4FJ7 A;  1NK7 A;  5ADX H;  2HHW A;  4E1J A;  1DTQ A;  2QXF A;  4H0T B;  3KD1 E;  3ZET B;  3RWU A;  4C8L A;  4W5N A;  2IOC A;  4E0D A;  1ASU A;  2NLX A;  4LSN A;  4FWO A;  4IXC A;  1C0M A;  5M1K A;  1WUA A;  3KVG A;  3L4Q A;  2HHT A;  4CF0 A;  3KZB A;  1E4F T;  1NJZ A;  5I9E B;  2G8K A;  3AVJ A;  3DRS A;  1TKX A;  3TR8 A;  4FOI A;  3P39 A;  4CGI A;  3CFP A;  4IDH A;  3HJF A;  3PIO L;  1WAF A;  3HOS A;  3CJC A;  1TVR A;  3O9T A;  4GKK K;  3VQB A;  4N41 A;  4OJR A;  1XC9 A;  2DFF A;  5IWA K;  1KFS A;  3BF3 A;  4CEZ A;  4CHY A;  3MN6 A;  3BP8 A;  3B6P A;  1NU0 A;  3F9M A;  3CMA N;  1DGK N;  4DV7 K;  4FJX A;  2HST A;  1HJO A;  2IC3 A;  1C0F A;  2OAN A;  4JS5 A;  4J2A A;  1W9H A;  1D4X A;  1VQO N;  1XQS C;  3ALY A;  3QES A;  2KZM A;  3NFA A;  3ITH A;  4I9Q A;  3M1F A;  1QSS A;  2F8S A;  1JL1 A;  3P38 A;  4H0Y B;  5CYM A;  4ID1 A;  4FJ8 A;  1RBU A;  4K0K K;  1NOZ A;  1NGG A;  4DHY A;  4DR3 K;  3VF2 A;  1R59 O;  4OPH A;  4FSV A;  1XMQ K;  3TWH A;  1VSD A;  4NYN A;  1NGB A;  2GBZ A;  2ZGZ A;  4CK3 A;  1I94 K;  4C8K A;  5KQ8 A;  4DSE A;  3VTI A;  1GOC A;  4DTN A;  4LY7 A;  3OYK A;  4M41 A;  5AQO A;  2OPQ A;  2FBV A;  2UXB K;  3K5O A;  1KXP A;  1GLL O;  5CYQ A;  5AQY A;  1M90 O;  2P9P A;  1WSI A;  4DV2 K;  3KWI A;  4JK7 A;  4OPJ A;  5C0Y A;  1HMV A;  1HJR A;  3K58 A;  3GDQ A;  1N5Y A;  4CF8 A;  4GY2 B;  4M3Y A;  1C1B A;  2HHH K;  4FZX C;  2I5J A;  3CIP A;  2A5X A;  2PY5 A;  2DFE A;  1R0A A;  4CW7 B;  4DTR A;  3OHR A;  1HQE A;  3VQ7 A;  3E9L A;  3RMC A;  4ILG B;  1IO2 A;  2E2P A;  2P9N B;  4FJI A;  1GLB G;  1Y64 A;  4I6M B;  4DV5 K;  2ZF5 O;  3QIO A;  3SJJ A;  3SMP A;  2ASM A;  1G15 A;  3UKU B;  2P51 A;  3J7Y P;  3E66 A;  4B3S K;  1SZ2 A;  3LAN A;  4FK2 A;  4CZM A;  4DV0 K;  3ZCM A;  4X64 K;  1ITG A;  2V52 B;  4KTQ A;  4K43 A;  2V51 B;  3VF6 A;  1NJY A;  1BOT O;  2YCH A;  3IAY A;  2XY8 A;  1V4T A;  4DLE A;  3DYA A;  3I55 N;  5CY4 A;  1A5W A;  2NNW A;  1NGD A;  2O4G A;  4Z94 A;  5E41 A;  4AF1 A;  4CJ3 A;  1NGH A;  2FBT A;  3RR8 A;  3FR0 A;  2CGL A;  4IG0 A;  3TSQ A;  4YDU C;  3FZH A;  2E88 A;  3R3L A;  3QLH A;  3NGI A;  3ZEU B;  4M3X A;  5DM6 L;  3QEX A;  5HBM A;  3AGR A;  3O9R A;  4C8N A;  4CD1 A;  2D0O A;  3W3D A;  3BDP A;  3L3U A;  3KTQ A;  5ELZ A;  2FSJ A;  4M3W A;  2P9K B;  3ZSY A;  3E9O A;  3IMX A;  4OX9 K;  4DR4 K;  4FJN A;  3MDQ A;  4OKJ A;  4ZTJ A;  5GIP A;  4B1V A;  5JVG L;  4WE1 A;  3O4W A;  4B9U A;  2VWK A;  3M5R A;  3ULE B;  3DM2 A;  4MLH A;  5T7B A;  2FF3 B;  2G8V A;  1T03 A;  4G1Q A;  4DTM A;  3LDS A;  4RW9 A;  4CJE A;  3CD6 N;  3SQ0 A;  1P8Z A;  1S5J A;  3KWG A;  1VQP N;  3V9U A;  1NNE A;  3HI0 A;  3KK3 A;  3D0P A;  4FJG A;  5KGW A;  5JLH A;  3I56 N;  3V1Q A;  3TAG A;  1QQM A;  3G71 N;  3LWM A;  3WNH A;  1U47 A;  4XH5 A;  3CHW A;  4O0J A;  1TL3 A;  4BRQ A;  5FRN A;  3AVF A;  3PO5 A;  1B92 A;  1WLJ A;  4CFD A;  5IT9 O;  1HQU A;  1K8K A;  4IWV A;  4DU1 A;  1QTM A;  1JLB A;  4DCH A;  4EP5 A;  2RHK A;  2GWJ A;  3D45 A;  2QM1 A;  4LD0 A;  3MCP A;  3PX6 A;  3HBT A;  1UWB A;  3ZT1 A;  1T44 A;  3DXM A;  4KTZ A;  1NGC A;  4DUZ K;  3LPT A;  4Z4I A;  3P5J A;  1BCM A;  4LC9 B;  4WQ4 A;  3HTV A;  1YJW N;  4QS7 A;  4CIG A;  4B9L A;  2GV9 A;  4HUG A;  4B8A B;  4O5F A;  3EE9 A;  4BRF A;  5TKY A;  2JWK A;  2HF3 A;  2WON A;  5EX5 A;  1LWF A;  3O6W A;  3J7A P;  5BPL A;  3LP0 A;  3R1X A;  1TYQ B;  4BY9 C;  4GW6 A;  4LFB K;  3G10 A;  4CD3 A;  4H5V A;  3CPW M;  4FM0 A;  1EWR A;  3EO3 A;  3JSM A;  3OJS A;  1A5X A;  3BZK A;  4DR5 K;  1LOT B;  2P9U A;  3KLG A;  4LF9 K;  1RT2 A;  1D9D A;  5JS1 A;  2QW9 A;  3WQU A;  1BIU A;  3JXU A;  3V81 A;  3EKS A;  2NRR A;  4JKA A;  4FJK A;  2BH1 A;  5AQU A;  2KLA A;  4K41 A;  2OPP A;  3M3Z A;  2IIR A;  5C25 A;  3AO1 A;  1KAX A;  1LAV A;  5AZI A;  4AH9 A;  2D1K A;  4LH4 A;  3MEG A;  3V9X A;  1ZBS A;  4CFC A;  4H5R A;  3VET A;  1RT5 A;  3TTC A;  4DR1 K;  4B9V A;  4CZG A;  2OPR A;  3P83 D;  4DTO A;  3AVN A;  5LJV A;  1JL2 A;  1J53 A;  2NRT A;  3U9D A;  3NH1 A;  3VQ5 A;  4BC4 A;  1RT6 A;  1HRH A;  2QXL A;  2P9L B;  4DSF A;  1BQM A;  4J8F A;  3VPZ A;  4ISG A;  2FC0 A;  3D2E A;  3MXI A;  1IV0 A;  3NH2 A;  2WOM A;  1TV6 A;  5M1Q A;  1NK6 A;  2O8E B;  3VF4 A;  1VSH A;  1X3N A;  4Y1C A;  5SZT A;  3TAM A;  4C8M A;  3UE5 A;  2BAN A;  3M8R A;  4CHP A;  1VRU A;  3VQC A;  4W5Q A;  3K5N A;  1QS4 A;  4BRE A;  1EKE A;  1NK8 A;  2D4W A;  4DFP A;  1U45 A;  4DSL A;  5BR8 K;  3OYM A;  3DLH A;  3QBX A;  4C8O A;  4V19 S;  4AHU A;  3H1V X;  5BR9 A;  5KGX A;  4DF8 A;  4H0P A;  1VSF A;  4E3S A;  3A0I X;  3QIC A;  2G8I A;  3MED A;  2KFZ A;  1MU2 A;  2WTU A;  3LP2 A;  4KHY A;  1NLV A;  3S3O A;  3SUP A;  4DV4 K;  4MDB A;  1QQN A;  1WAJ A;  2VYP A;  3OYA A;  5J2Q A;  4DWI A;  1NMN A;  2P9P B;  2Z1H A;  1S3X A;  3MWP A;  4FWK A;  3FZM A;  4CZE A;  2F7T A;  1YVU A;  3LAM A;  3OYD A;  3U3G A;  4CJW A;  3O1B A;  1JLF A;  2QWM A;  4KHS A;  2UUB K;  2IAJ A;  5A2Q O;  2CGJ A;  2P1J A;  4JKB A;  2HHU A;  1WOQ A;  2O8C A;  2P9I A;  4LFC K;  3FLC O;  5HOO A;  2Q0U A;  2B6A A;  3CQY A;  1YTA A;  3SYZ A;  3KKR A;  3FE1 A;  3HXM A;  1K8A O;  1CXU A;  1Q82 O;  4DQQ A;  3V1O A;  3PLA A;  5LY3 A;  4B3M K;  3L0Q A;  4KH5 A;  1HYV A;  2X6S A;  1HNV A;  2ZGY A;  3HM9 A;  4NXM K;  3G6E N;  3SQ4 A;  3P1G A;  3K59 A;  3EN9 A;  2ZQB A;  3IRX A;  4IZ9 A;  3VQ4 A;  1YF5 L;  4B9N A;  5LJW A;  5AQZ A;  3OYN A;  4CEC A;  4FJJ A;  4MFB A;  4JK8 A;  4GVM A;  1SKR A;  1VQM N;  4HUE A;  4Z4C A;  4EHT A;  2A6A A;  3AO3 A;  3WNG A;  3CET A;  3ZT0 A;  3NMU A;  3I33 A;  1UA0 A;  4CBW A;  5EOY A;  3CCJ N;  2YI1 A;  2OTJ N;  1FKO A;  3IDH A;  4CJR A;  1ZBL A;  1RBV A;  5FPN A;  3ZSZ A;  4CEF A;  2Q36 A;  4JKE A;  3EYZ A;  4OLA A;  1Q18 A;  1VHX A;  4FLU A;  1Q7Y O;  2ASO A;  3NBP A;  1ESV A;  5KPR A;  4ISE A;  3QB0 A;  3RVC A;  2P9S A;  1HKC A;  3DWL A;  4CK2 A;  1CZB A;  1D5A A;  3FZL A;  5AQH A;  2A3Z A;  1FK9 A;  4JAX A;  1ZBH A;  1BI4 A;  3S9H A;  2YNG A;  3MWT A;  5AQV A;  3VOV A;  1C1C A;  1HYZ A;  1UAX A;  4O4G A;  3ZYY X;  3CCV N;  1RBS A;  4CHZ A;  3EZ5 A;  3DRP A;  1O1W A;  3C6T A;  4HVJ A;  3AA3 A;  3CCM N;  4X65 K;  1SL1 A;  1BIS A;  3DRR A;  3HPG A;  1TAQ A;  4CHQ A;  4DS4 A;  3CG7 A;  1ZBI A;  1QSL A;  1BHL A;  4CZJ A;  3NGZ A;  1C6V A;  3CJ9 A;  4B1Y B;  1K8K B;  5C2F A;  1RIL A;  1RT1 A;  1T6D A;  4NLB A;  4Z0U A;  4RW4 A;  4CZK A;  1CXQ A;  1JXE A;  3LM9 A;  3T3F A;  3M8Q A;  4LF4 K;  1NJI O;  1KTQ A;  5ADX A;  3VEY A;  2O8B B;  2FBX A;  1S72 N;  5BRF A;  3T1H K;  3RSE B;  1DKG D;  2F8T A;  3O9U A;  2YNH A;  4GV6 A;  4BG9 A;  1LAW A;  3WQT A;  1XC3 A;  4CE9 A;  3HOT A;  2Y1I A;  1L3S A;  2ITM A;  1UOC A;  4XH4 A;  4BE1 A;  4F9O A;  2HVI A;  4KHP K;  4BE2 A;  3O08 A;  5HLF A;  2QWL A;  1S1V A;  3DLE A;  1BA1 A;  3T7Z A;  3WT0 A;  4XIU A;  4DV6 K;  3CJB A;  3CJA A;  4BR5 A;  3RTV A;  1DTT A;  4BC2 A;  3TI0 A;  3R6M A;  1Q9Y A;  3RMA A;  2P9U B;  3OVN A;  4BWM A;  2VQF K;  3VQ6 A;  2XY5 A;  1RCH A;  4H03 B;  4XEI A;  3PO4 A;  3NF7 A;  4WCE L;  2I7P A;  3O3F A;  3LDL A;  3CYM A;  1WBD A;  4ID5 A;  4BAC A;  3HT3 A;  4ELU A;  3C65 A;  3LAL A;  4CED A;  3SK3 A;  1B9F A;  3OBY A;  3KK2 A;  1WSG A;  4Z4F A;  2VGM A;  1W0H A;  1JCF A;  3NDK A;  4ELV A;  1JLQ A;  2BDP A;  1X9M A;  3CCS N;  4C23 A;  1JLC A;  4CEO A;  1GLA G;  3CJ7 A;  4AHR A;  1YIJ N;  4KB0 A;  3BZC A;  1Y97 A;  4PKH A;  5E84 A;  3I8B A;  3SNN A;  4IDK A;  3SAH A;  4R79 A;  4JI4 K;  4CJP A;  2I7N A;  1YT3 A;  4IO8 A;  3G4S N;  1I3A A;  1HPZ A;  3ZSO A;  5LL6 Z;  3TAN A;  2UYT A;  5AQS A;  4CF1 A;  1IG9 A;  5AQF A;  3SV3 A;  5GAH P;  3CC7 N;  4U7B A;  3U4L A;  5EY4 A;  1TGO A;  3MK6 A;  2W6L A;  4AHT A;  5HRP A;  1WSF A;  4H5T A;  1KD1 O;  4H5W A;  3QBW A;  1VQ8 N;  4DR7 K;  3AGK A;  1ZC6 A;  2NRV A;  1KVA A;  4BWJ A;  2QI2 A;  3J8A A;  4U67 L;  3HPO A;  3HK2 A;  2D0P A;  3PX4 A;  1Q81 O;  1TKT A;  1IBK K;  4I2Q A;  2D5R A;  5FPD A;  4M7X A;  2RPI A;  3L2V A;  2IVN A;  4JS4 A;  1RBR A;  4FLV A;  4JRP A;  3AAR A;  4HWI A;  4CEE A;  4DTP A;  1JJ2 M;  3U3Y A;  3D2F A;  2HB5 A;  1GLJ O;  3BEX A;  4BRH A;  4BRD A;  2OCE A;  3VQ8 A;  1EO1 A;  4Z4H A;  3C0B A;  3AVL A;  1JCE A;  4YHH K;  3P31 A;  4DTU A;  4FOE A;  1OH6 A;  1BIZ A;  4IEE A;  3WXM B;  4BRG A;  3K57 A;  1RDU A;  4EZ6 A;  4I7F A;  1QVG M;  1ATS A;  1JLA A;  3CM5 A;  4KV8 A;  4JD2 B;  4R5P A;  4BRP A;  4B3O A;  4EFH A;  4H5N A;  3ULD A;  3DOL A;  2B4J A;  3THX B;  3QFU A;  4DU3 A;  5AQJ A;  3C7N A;  3P4I A;  4N56 A;  2PYL A;  1WSH A;  3LDP A;  3SJH A;  4K8X A;  4K8Z A;  4CVN E;  3MN7 A;  4M3U A;  4E7L A;  2YJF A;  2WFB A;  2WUS A;  2QWP A;  3DXK A;  4CCH A;  1J5O A;  1NK9 A;  4W5O A;  2CGK A;  2W42 A;  1IJJ A;  1IBL K;  2OYQ A;  4CJF A;  3OYL A;  1QHA A;  4JHD B;  3K9K A;  3CQ8 A;  2E6L A;  4L3Q A;  3W0L A;  4WFA L;  2QKK A;  3NHG A;  4KH6 A;  3E1Y A;  1EWQ A;  4GVE A;  1BDG A;  5C10 A;  2UXC K;  4F4K A;  3RMB A;  2IGI A;  2QWO A;  4KHW A;  5C12 A;  4DLG A;  4B3T K;  4CZI A;  3VER A;  4KHQ A;  5CR4 A;  5AQI A;  1SKS A;  3OA9 A;  3T1Y K;  1N6Q A;  3EEQ A;  4FLX A;  1QZ5 A;  3EZW A;  4QAG A;  4DV1 K;  4CJK A;  5F1X A;  1S1W A;  5J2P A;  4K25 A;  5C24 A;  2HNY A;  4CFA A;  4JKC A;  4JN4 A;  4PHT X;  5AQT A;  1BI4 B;  4BR2 A;  4HTU A;  1DLO A;  4YOR A;  1NKC A;  3RRG A;  4X62 K;  3C6H A;  3V1R A;  5GIN A;  4AHC A;  4EAH D;  3VQQ A;  1J5E K;  4XH1 A;  4FWR A;  4A2B A;  1T05 A;  3M8S A;  1U6Z A;  4CEQ A;  4JI3 K;  2H3G X;  4FJ5 A;  4H4M A;  2ZJQ L;  3J7Z O;  2Z1I A;  2RKI A;  3PX0 A;  4CEB A;  5FRM A;  2ZWH A;  4RW7 A;  1WSJ A;  2YV0 X;  2KKZ A;  4IOA L;  1O13 A;  2FXU A;  2YNI A;  2OA8 A;  3LP3 A;  1LCU A;  3B6O A;  2OPS A;  4JKG B;  1OKJ A;  1U2V B;  3IFR A;  1KLM A;  3F9K A;  3L6Q A;  2HHX A;  3VQP A;  4WQ4 C;  2F96 A;  2HOE A;  5H1S Q;  2W41 A;  3CC4 N;  1VRT A;  1L3U A;  3H46 O;  4C1N K;  1S9G A;  2XY6 A;  4B8C A;  3H6E A;  3CCL N;  3VA0 A;  3VQD A;  1IKY A;  5K14 A;  4MDA A;  3DMJ A;  4EIA A;  4WQ5 A;  4N76 A;  3VN5 A;  1NGF A;  1JKH A;  1SV5 A;  4CI6 A;  4RWT A;  3QFP A;  2VG6 A;  3PIP L;  3SPY A;  2DY4 A;  3OS2 A;  1S1U A;  1YXQ A;  3VTH A;  4DSK A;  4KAZ A;  5CZ2 A;  3AA5 X;  3KLF A;  2OZS A;  1SAZ A;  1OVY A;  4BVO A;  1KVB A;  3TAR A;  2VCP A;  3CI5 A;  3A5N C;  5M1P A;  4FJ9 A;  4AIL C;  4BGA A;  4OPA A;  5GIO A;  4A5B A;  1QVF M;  2KQ2 A;  4FO0 A;  4CK1 A;  1Z26 A;  2A42 A;  4KHU A;  3OYH A;  1A5V A;  1LW2 A;  2Q2R A;  2QKB A;  4BVP A;  3HVR A;  1YTU A;  1VQ7 N;  4NCG A;  2W40 A;  4CJV A;  1Q8I A;  1VQ9 N;  4JV5 K;  1NG9 A;  4OPK A;  4KB1 A;  4FWN A;  4UY8 O;  2QWQ A;  3RR7 A;  1BCO A;  3WXJ A;  3SLC A;  4BRA A;  1VQK N;  1TKD A;  4KHN A;  3LDN A;  1WB9 A;  1XHX A;  3CXC M;  3OS0 A;  3SUQ A;  1EXQ A;  3F73 A;  3KK7 A;  3J81 O;  4FK0 A;  5AJ3 K;  4GV3 A;  1VQ4 N;  1RT4 A;  3KIO A;  1NBW A;  3DLR A;  4CIF A;  4KRF A;  1QHT A;  5JMV A;  3Q7C A;  3U8X A;  3ZET A;  3T69 A;  2EX3 A;  4UQG A;  3GBT A;  3ZT3 A;  4B9Q A;  3VEW A;  3SAG A;  2GEL A;  3D7E O;  5BPM A;  3VEZ A;  4AHV A;  3DJC A;  3H45 C;  1T8E A;  4B9T A;  1MDU B;  2QK9 A;  2DTU A;  3ID6 A;  4MO5 A;  3V4I A;  4BDP A;  1RDW X;  2G8F A;  4O44 A;  5AZJ A;  4BE0 A;  2G8W A;  5AFU H;  1X9W A;  1L3T A;  2X78 A;  4BRL A;  5M1N A;  4DG1 A;  4M42 A;  1U48 A;  2AJQ A;  3R9P A;  5AQN A;  3O80 A;  1TAU A;  4H8K A; 
#chains in the Genus database with same CATH homology
 1SL1 A;  2IC3 A;  1BIS A;  3DRR A;  4JS5 A;  4J2A A;  1W9H A;  3HPG A;  4CER A;  4KI6 A;  1TAQ A;  2E4L A;  3AA4 A;  4CHQ A;  3ALY A;  4DS4 A;  3QES A;  1IKV A;  1CLQ A;  2KZM A;  3K5M A;  3CG7 A;  3L2R A;  1X9S A;  3NFA A;  1ZBI A;  4ICL A;  2YNF A;  3NAE A;  4CHN A;  1LW0 A;  1F21 A;  3ITH A;  1QSL A;  4I9Q A;  3OYJ A;  1BHL A;  1QSS A;  2F8S A;  3NGZ A;  1C6V A;  1JL1 A;  4FJ8 A;  4MQ3 A;  4ID1 A;  5CYM A;  1RBU A;  2HW3 A;  1NOZ A;  1RIL A;  1RT1 A;  1RT3 A;  3NF9 A;  4Z0U A;  3V9W A;  4RW4 A;  4YFU A;  1CXQ A;  4FVM A;  4KTW A;  5DMR A;  3TWH A;  3RRH A;  1JXE A;  5D3G A;  1VSD A;  2DFH A;  4NYN A;  3T3F A;  3M8Q A;  4M3T A;  2GBZ A;  2P5G A;  1VSK A;  1KTQ A;  4CK3 A;  3L2W A;  4DS5 A;  1ZBF A;  2FBX A;  3LP1 A;  3NGY A;  4C8K A;  1NK4 A;  4DSE A;  1GOC A;  3I8D A;  4DTN A;  3O4Q A;  4LY7 A;  1RDC A;  3OYK A;  4M41 A;  1SKW A;  2F8T A;  2OPQ A;  2FBV A;  2YNH A;  1C1A A;  1LAW A;  4F2S A;  4NCA A;  3ISN C;  3K5O A;  5CYQ A;  4CE9 A;  5HRR A;  2Y1I A;  1L3S A;  1WSI A;  1UOC A;  3SI6 A;  4BE1 A;  2HVI A;  4OPJ A;  4BE2 A;  5I42 A;  3QEI A;  1HMV A;  1HJR A;  3K58 A;  1RBT A;  5HLF A;  1N5Y A;  4FJH A;  4CF8 A;  4M3Y A;  1S1V A;  3DLE A;  1C1B A;  4XIU A;  2RF2 A;  4FZX C;  1C0T A;  2I5J A;  4E7H A;  4N5S A;  2PY5 A;  3RTV A;  1DTT A;  2D0B A;  2ITG A;  3A2F A;  4CJ4 A;  3TI0 A;  3AVB A;  1Q9Y A;  3RMA A;  2DFE A;  3THV A;  1R0A A;  4F3T A;  3OVN A;  4KKO A;  3L8B A;  4FCY A;  4DTR A;  2HHQ A;  2G8H A;  4BWM A;  4QCL A;  1HQE A;  3VQ7 A;  3RMC A;  3VQ6 A;  1IO2 A;  4FJI A;  2XY5 A;  4FLW A;  3KKS A;  1RCH A;  1SUQ A;  2IDO A;  4CF2 A;  3VQE A;  3U6F A;  3PO4 A;  2JLE A;  3DLB A;  3NF7 A;  3QIO A;  1D8Y A;  3SJJ A;  4FJL A;  2O4I A;  1GOA A;  3O3F A;  5J2N A;  1G15 A;  3CYM A;  2P51 A;  4ID5 A;  3AO2 A;  1D9F A;  2PZS A;  3NE6 A;  4BAC A;  3LAN A;  3HT3 A;  3QIP A;  4FK2 A;  2HNZ A;  4ELU A;  3LAL A;  4IFY A;  4CED A;  3S3M A;  4IBN A;  1B9F A;  4CGD A;  1NJW A;  4ELT A;  3KK2 A;  3ZCM A;  1CZ9 A;  1KFD A;  1WSG A;  4Z4F A;  1ITG A;  1W0H A;  3AO5 A;  4KTQ A;  3NDK A;  4FM2 A;  3ZSW A;  5KRT A;  4W5T A;  4ELV A;  1NJY A;  1T7P A;  1JLQ A;  4PUO A;  2BDP A;  3IAY A;  4PA1 A;  1X9M A;  2XY8 A;  2E6M A;  3SPZ A;  4DSJ A;  2D0C A;  4DLE A;  3DYA A;  4ZHR A;  1JLC A;  5CY4 A;  1A5W A;  3T19 A;  3OY9 A;  4FK4 A;  3WNF A;  3TAQ A;  2O4G A;  4CEO A;  3LZI A;  5E41 A;  2ZD1 A;  4AHR A;  4CJ3 A;  2OZM A;  2FBT A;  3RR8 A;  1BQN A;  3I0R A;  4PY5 A;  4KB0 A;  2A1S A;  3KJV A;  4IG0 A;  1Y97 A;  3SQ2 A;  1NK0 A;  3HP9 A;  4DFM A;  3L2U A;  4M3Z A;  3SNN A;  1X1P A;  1EX4 A;  3QLH A;  4IDK A;  3NGI A;  3TAE A;  2ETJ A;  1KCF A;  4M3X A;  3ASM A;  4CJP A;  3QEP A;  1Z25 A;  3QEX A;  3HPH A;  4EP4 A;  5HBM A;  5HRO A;  1C0U A;  1YT3 A;  3MXM A;  4C8N A;  1LV5 A;  1I3A A;  1HPZ A;  3BDP A;  4IFV A;  3ZSO A;  4CJT A;  3L3U A;  3JYT A;  3TAN A;  3KTQ A;  4DQP A;  3RMD A;  4HUF A;  1S6Q A;  4CF1 A;  1IG9 A;  4F2R A;  4O55 A;  2KZZ A;  4DFK A;  1IKX A;  1S6P A;  3SV3 A;  4M3W A;  5EU7 A;  4CFB A;  3NH0 A;  1RDD A;  4LSL A;  1RDA A;  4FJM A;  2X6N A;  3ZSY A;  1Q9X A;  3V9S A;  4CJ5 A;  1TGO A;  4Q0B A;  4CHO A;  4FJN A;  4AHT A;  4OKJ A;  3C6U A;  1WSF A;  5HRP A;  4ZTJ A;  4WE1 A;  1L3V A;  4N47 A;  2VWK A;  4B9U A;  4FW2 A;  3WNE A;  3DM2 A;  1LWC A;  5T7B A;  4J2D A;  2G8V A;  1T03 A;  4G1Q A;  4CJL A;  4DTM A;  2BE2 A;  3LDS A;  3SZ2 A;  4RW9 A;  1KVA A;  1VSE A;  3MXJ A;  4BWJ A;  1SL2 A;  4CJE A;  1IH7 A;  4CGF A;  4FZY A;  4I9L A;  4CJQ A;  3HPO A;  4J2E A;  3HK2 A;  3SQ0 A;  1S5J A;  3PX4 A;  4NYF A;  3K2P A;  3SUN A;  4FYD A;  3V9U A;  5C42 A;  1TKT A;  4JLH A;  3KK3 A;  3D0P A;  4I2Q A;  5J1E A;  4FJG A;  5KGW A;  3HO1 A;  2D5R A;  4OVL A;  5KTQ A;  3V1Q A;  3TAG A;  4ZTF A;  5KI6 A;  2RPI A;  3AVK A;  3L2V A;  4JS4 A;  3LWM A;  3WNH A;  1RBR A;  1U47 A;  4FLV A;  4JRP A;  1JLG A;  4O0J A;  4CEE A;  4DTP A;  1JLE A;  1TL3 A;  3U3Y A;  5FRN A;  1VSJ A;  2HB5 A;  2YKN A;  3DLG A;  3I0S A;  3AVF A;  1IKW A;  3NF8 A;  3PO5 A;  1B92 A;  1WLJ A;  4CFD A;  3VQ8 A;  1HQU A;  5DK5 A;  4Z4H A;  4DU1 A;  3PY8 A;  1QTM A;  1EET A;  1JLB A;  3AVL A;  4DTU A;  4EP5 A;  1NKE A;  3D45 A;  4LD0 A;  3T1A A;  1BIZ A;  4OKE A;  3PX6 A;  4NCB A;  5KRS A;  1KVC A;  2XO7 A;  1BL3 A;  3K57 A;  1UWB A;  3ZT1 A;  4EZ6 A;  4TSX A;  4I7F A;  4KTZ A;  1JLA A;  3AVA A;  3CM5 A;  3CM6 A;  4KV8 A;  3LPT A;  4R5P A;  4Z4I A;  4B9S A;  2YHA A;  4B3O A;  1NJX A;  1TK5 A;  3P5J A;  1S1X A;  2Q3S A;  1BCM A;  3ULD A;  2HVH A;  5FRO A;  4PQU A;  3DOL A;  1TKZ A;  3OYF A;  2B4J A;  3ZT4 A;  1RTH A;  3BGR A;  4CIG A;  4DU3 A;  4B9L A;  2GV9 A;  4HUG A;  3LZJ A;  4F8R A;  4B8A B;  3KLI A;  4N56 A;  3MAQ A;  1WSH A;  4HHT A;  2PYL A;  2KTQ A;  2WON A;  4K8Z A;  1LWF A;  4K8X A;  1WN7 A;  3O3G A;  1XI1 A;  3C94 A;  1QSY A;  3LP0 A;  4M3U A;  3PV8 A;  1VK0 A;  4E7L A;  2RN2 A;  4Y1D A;  4DQS A;  4DQI A;  1J54 A;  1U04 A;  4GW6 A;  5J2M A;  3G10 A;  4FM0 A;  3ZSR A;  4CCH A;  4HCC A;  4L8R B;  1J5O A;  1NK9 A;  3JSM A;  3OJS A;  1A5X A;  4W5O A;  4CJU A;  2KW4 A;  1B9D A;  2HHS A;  2W42 A;  3KLG A;  3TAP A;  1RT2 A;  1D9D A;  3QO9 A;  5JS1 A;  4GMJ B;  4DF4 A;  2OYQ A;  1BIU A;  4CJF A;  1RTJ A;  3OYL A;  3VQ9 A;  3V81 A;  1VSI A;  4CES A;  4CGJ A;  3KK1 A;  3LWL A;  4FJK A;  4M45 A;  3CQ8 A;  2FBY A;  4E89 A;  2E6L A;  1XHZ A;  1WNS A;  2OPP A;  2QKK A;  1FXX A;  3DI6 A;  3KLE A;  3NHG A;  2JGU A;  5C25 A;  4B08 A;  1ZBU A;  1LAV A;  3AO1 A;  1JXB A;  4EZ9 A;  4KFB A;  1KLN A;  4AH9 A;  4F4K A;  4KO0 A;  4H4O A;  3RMB A;  2IGI A;  4LH4 A;  4KHW A;  2GUI A;  3MEG A;  4IG3 A;  3ZSX A;  4E7I A;  3V9X A;  4DLG A;  4CFC A;  2NUB A;  3QEW A;  1RT5 A;  4B9V A;  3UIQ A;  3L2Q A;  3AO4 A;  4KHQ A;  4OLB A;  3EY1 A;  1SKS A;  2OPR A;  3P83 D;  4M3R A;  4DTO A;  3AVN A;  3FFI A;  3HST B;  1ASW A;  4FLX A;  1JL2 A;  1N6Q A;  4QAG A;  4FZZ A;  1XWL A;  3IG1 A;  1J53 A;  2ATQ A;  4CJK A;  1S1W A;  5J2P A;  1KSP A;  5C24 A;  1I39 A;  2HNY A;  4CFA A;  3VQ5 A;  3NH1 A;  1VSL A;  2IS3 A;  1RT6 A;  3HVT A;  1TK0 A;  1HRH A;  4E1M A;  2G8U A;  4KI4 A;  4KRE A;  1QE1 A;  3E01 A;  3HL8 A;  3KLH A;  1BI4 B;  3OYC A;  4HTU A;  1DLO A;  4DSF A;  4DFJ A;  2P5O A;  3VQA A;  4BDZ A;  1BQM A;  1NKC A;  2HMI A;  3RRG A;  3V1R A;  2XHB A;  3H08 A;  4AHC A;  3VQQ A;  3AV9 A;  4E7J A;  2VG7 A;  1T05 A;  3M8S A;  3S3N A;  2B5J A;  2FC0 A;  3MXI A;  4CEQ A;  4Z4E A;  4FJ5 A;  1WSE A;  3HYF A;  4H4M A;  3NH2 A;  4FM1 A;  2Z1I A;  1REV A;  2RKI A;  3SV4 A;  3PX0 A;  2WOM A;  3G0Z A;  4CEB A;  1TV6 A;  1SL0 A;  1NK6 A;  5HRN A;  1L5U A;  4RW7 A;  1WSJ A;  5FRM A;  4QOZ B;  1VSH A;  2YV0 X;  4Y1C A;  1K6Y A;  5SZT A;  3TAM A;  3K5L A;  2Y1J A;  4F3O A;  4FLZ A;  4C8M A;  2YNI A;  1LWE A;  2OA8 A;  3LP3 A;  4CF9 A;  3AVH A;  4RW6 A;  3QNO A;  2XRI A;  2BAN A;  2HND A;  4DMN A;  1NKB A;  3M8R A;  4CJS A;  4JRQ A;  4CHP A;  5HRS A;  1VRU A;  3B6O A;  2OPS A;  3AVI A;  5FDL A;  3VQC A;  5SWM A;  4W5Q A;  4E7K A;  4Z4G A;  3K5N A;  1KLM A;  3F9K A;  1QS4 A;  2ZE2 A;  4E1N A;  1EKE A;  1NK8 A;  4B9M A;  2HHX A;  3VQP A;  4AHS A;  2F96 A;  4PWD A;  1U45 A;  4DFP A;  5JS2 A;  4DSL A;  3OYM A;  3DLH A;  4DTJ A;  2R7Y A;  4C8O A;  4LH5 A;  4AHU A;  1HNI A;  5KGX A;  5CZ1 A;  4DF8 A;  4W5R A;  1NOY A;  2KFN A;  4E19 A;  1VRT A;  4IKF A;  1L3U A;  1QQC A;  3QNN A;  3DOK A;  1VSF A;  1S9G A;  3LPU A;  4E3S A;  5I3U A;  2XY6 A;  2G8I A;  3QET A;  3MED A;  2D0A A;  1MU2 A;  2KFZ A;  4B8C A;  1S1T A;  3AVM A;  3VA0 A;  1TK8 A;  3LP2 A;  3QIN A;  3VQD A;  3KD5 E;  1IKY A;  5K14 A;  4KHY A;  3DMJ A;  3S3O A;  3SUP A;  2A1R A;  3CFO A;  1EP4 A;  4FXD A;  4N76 A;  1GOB A;  3VN5 A;  4CIE A;  2BGG A;  3AA2 A;  5J2Q A;  1JKH A;  1SV5 A;  1WAJ A;  3OYA A;  3NF6 A;  3O4N A;  3V9Z A;  1ZYQ A;  4DWI A;  2HHV A;  2Z1H A;  2VG6 A;  4RW8 A;  3SPY A;  1RTD A;  2DY4 A;  3OS2 A;  1S1U A;  3LAM A;  1YVU A;  3OYD A;  3U3G A;  3QEV A;  4DSK A;  4CJW A;  5CZ2 A;  4DQR A;  4KAZ A;  3C95 A;  1JLF A;  2XY7 A;  3TAB A;  3AA5 X;  4KHS A;  2VG5 A;  3KLF A;  1J9A A;  2OZS A;  2IAJ A;  3MEC A;  1U4B A;  2P1J A;  1KVB A;  3SUO A;  3TAR A;  2HHU A;  4FJ9 A;  4AIL C;  4RG8 A;  4DSI A;  4O0I A;  3OYG A;  3HP6 A;  1TL1 A;  2Z1G A;  3PUF A;  3SQ1 A;  2B6A A;  1RDB A;  1YTA A;  1RT7 A;  2KQ2 A;  3KKR A;  3SYZ A;  3HXM A;  4FW1 A;  1CXU A;  4CGG A;  4DQQ A;  3V1O A;  1S9E A;  4CK1 A;  1Z26 A;  1HYV A;  4KHU A;  3OYH A;  2X6S A;  1HNV A;  1A5V A;  1LW2 A;  2LSN A;  4FLY A;  2QKB A;  3L3V A;  3HM9 A;  4DU4 A;  3HVR A;  1YTU A;  1VSM A;  3V6D A;  1NK5 A;  4HCB A;  4NCG A;  4DTS A;  4CJV A;  3OJU A;  1Q8I A;  3VA3 A;  4CGH A;  2YHB A;  3ZT2 A;  3SQ4 A;  4KPY A;  3P1G A;  4OPK A;  3K59 A;  4KB1 A;  2ZQB A;  3IRX A;  4FLT A;  4I2P A;  4OKK A;  4OGE A;  2VWJ A;  5HP1 A;  3VQ4 A;  3OYB A;  2Z1J A;  3OYE A;  4B9N A;  1HYS A;  3ZSV A;  3SUQ A;  1UA1 A;  3RR7 A;  3OYN A;  1BCO A;  3AVC A;  1RTI A;  4CEC A;  3SCX A;  4FJJ A;  1TKD A;  4MFB A;  4KHN A;  4GVM A;  4FJ7 A;  1SKR A;  1NK7 A;  1XHX A;  4HUE A;  4Z4C A;  2HHW A;  3OS0 A;  1DTQ A;  1BGX T;  2QXF A;  3AO3 A;  1EXQ A;  3WNG A;  4O5B A;  3ZT0 A;  4CEA A;  1FKP A;  4YNQ A;  3QER A;  3KD1 E;  3F73 A;  1UA0 A;  3RWU A;  4DTX A;  4FK0 A;  3TAF A;  4OGC A;  4C8L A;  1FKO A;  1ZBL A;  4CJR A;  4W5N A;  2IOC A;  3M8P A;  1RT4 A;  1RBV A;  3LAK A;  3KIO A;  3ZSZ A;  4CEF A;  4E0D A;  3DLR A;  1ASU A;  4CIF A;  4KRF A;  1QHT A;  4LSN A;  3EYZ A;  3IS9 A;  4OLA A;  4FLU A;  3AVG A;  1C0M A;  3O3H A;  2HHT A;  4BDY A;  3NBP A;  4J2B A;  3NCI A;  2EX3 A;  4CF0 A;  4UQG A;  4CK2 A;  2EHG A;  3ZT3 A;  1U49 A;  1CZB A;  1NJZ A;  2G8K A;  1D5A A;  2PYJ A;  4AHV A;  2YKM A;  3AVJ A;  1FK9 A;  3DRS A;  1T8E A;  1TKX A;  3DLK A;  3TR8 A;  3CFP A;  4B9T A;  1BI4 A;  4CGI A;  3S9H A;  1ZBH A;  2QK9 A;  2DTU A;  2YNG A;  1KRP A;  3HJF A;  2X74 A;  3ZSQ A;  1WAF A;  1C1C A;  1HYZ A;  1UAX A;  4O4G A;  3V4I A;  1TVR A;  4BDP A;  2G8F A;  4O44 A;  4BE0 A;  3VQB A;  4N41 A;  4OJR A;  3OYI A;  3CFR A;  1RBS A;  2G8W A;  3MEE A;  1XC9 A;  4CHZ A;  1X9W A;  2DFF A;  1L3T A;  2X78 A;  4Q5V A;  4DG1 A;  1KFS A;  3EZ5 A;  4CEZ A;  3DRP A;  4CHY A;  3OS1 A;  4M42 A;  1O1W A;  1U48 A;  2AJQ A;  3B6P A;  3C6T A;  1ASV A;  4HVJ A;  1RNH A;  4FJX A;  3AA3 A;  1TAU A;  4H8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...