4CJRA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjrA00
2O4GA 1LW0A 3OJUA 1LW2A 4JRPA 3OS1A 3MXJA 4KV8A 3AVAA 4CJKA 3L2UA 5CYMA 4CGIA 4I9LA 3OYDA 1A5XA 3V4IA 4M3UA 3VQ4A 4XIUA 4J2BA 1RT4A 4FW2A 3ISNC 3DRSA 3LANA 1SUQA 3QEXA 1UA0A 1U48A 4CHYA 3ZSWA 4GW6A 3LPTA 4JS5A 4DSFA 3S3NA 1J5OA 2KW4A 3RR7A 4EZ6A 3KK3A 4IKFA 1FXXA 1JLEA 3OS2A 3L2QA 1BIUA 3ZCMA 1R0AA 3OYHA 4RW8A 2XRIA 3CM5A 3KLFA 3S3MA 3LP2A 1RBTA 3ZT3A 3SCXA 3KKSA 1KRPA 4Z4IA 1RTDA 4O0JA 3HT3A 1L5UA 5CZ1A 3AO2A 3VQDA 3WNEA 4ELVA 4IG0A 3DRRA 3NH1A 3K5LA 1CXQA 1GOAA 3WNFA 4DFKA 1CZBA 4O5BA 1LWEA 4WE1A 1TL1A 3TAGA 1QHTA 2KZMA 5JS1A 1BIZA 4QCLA 4CHQA 1KVCA 4RW4A 4E7HA 3EYZA 3M8RA 1S1XA 4LSNA 4FCYA 4DU3A 2G8KA 3TWHA 4KI6A 4UQGA 4DTNA 4LSLA 4M3RA 4K8ZA 3OYNA 3BGRA 4B9UA 1HYVA 4FJXA 1MU2A 3SZ2A 2G8IA 3MEGA 1ZBHA 4BDZA 4LH4A 2IDOA 1JL2A 5HLFA 4CJ5A 4CGFA 4Q0BA 3QNNA 4KHNA 3JSMA 4N47A 3LAMA 4M3XA 1BQMA 4OLBA 3K5MA 3DLHA 4FZYA 1IO2A 4RW9A 3VA0A 2KTQA 4EP5A 4W5RA 1GOCA 1S1WA 4CF0A 3TAFA 4CF1A 5EU7A 1IKYA 4NYFA 5HP1A 4DTPA 3MECA 2YKMA 2F8TA 2HHTA 5J2NA 3HPHA 4PUOA 3SQ0A 1LWCA 4HUGA 4CGGA 3O4QA 3OYKA 4CF2A 3M8SA 3LZIA 1NK9A 2DFFA 1VSFA 4E89A 4DSKA 3I0SA 3L2RA 1BCOA 1Z26A 1Q9YA 4ELUA 2HVHA 4W5NA 4LD0A 4FXDA 1TAUA 1B92A 5K14A 4CEZA 1BCMA 4DG1A 4FLVA 3VQ8A 1QSSA 4KB1A 3NF9A 3LWLA 1U04A 3MAQA 2X6SA 2ZE2A 2D0AA 2HB5A 2XY7A 1VSLA 4I7FA 3KTQA 4HUFA 1VK0A 4AH9A 4KI4A 4J2EA 2X74A 4OKKA 2RKIA 3P1GA 4AHUA 4FVMA 3AO1A 3V6DA 1KFSA 4E7KA 1FKOA 1WN7A 3HL8A 2G8WA 2HHWA 4DQRA 4NYNA 3QERA 3SQ4A 1BI4B 3NBPA 4F4KA 1HYZA 5CYQA 3L2VA 4CEDA 2HVIA 1QE1A 2WONA 3K2PA 3EZ5A 1JLQA 3RMDA 3KK1A 1JLCA 3VQAA 1T03A 1NKEA 2OPRA 4PWDA 4LH5A 4CK1A 3SUNA 3D0PA 2F96A 2IGIA 2OYQA 1UOCA 1WSHA 3B6PA 3QEIA 4C8KA 3NHGA 3VQ9A 3ZSRA 2EHGA 4CJ3A 1S6QA 2XO7A 1ZBUA 4CFCA 3DLRA 2PY5A 3QEWA 3OYBA 2XY6A 3AA2A 3TR8A 1YTUA 3V81A 2Z1GA 3G10A 1BHLA 5HROA 3TAQA 1LV5A 1QTMA 2I5JA 4C8LA 4L8RB 2E6LA 3ZT0A 2QK9A 2YV0X 3QLHA 1J54A 1VRUA 3OVNA 3NE6A 3T3FA 2HNYA 3AVGA 5HBMA 3QETA 2Z1HA 1VSEA 1NKBA 3DMJA 1EXQA 3VQCA 4Z0UA 4FJJA 1TL3A 3PY8A 1HQUA 1RDDA 2Y1IA 4FZZA 4HUEA 4ID1A 3O3FA 4CE9A 4CESA 1C1AA 4CEEA 4CF8A 3JYTA 2XY8A 3EY1A 4FK4A 4PQUA 4DU4A 4NCBA 1W0HA 3P5JA 1SKSA 2G8VA 2GV9A 1UAXA 4I2PA 4HHTA 1TK0A 4DLEA 4MFBA 3ZSQA 4ID5A 1DLOA 3KD5E 1RTHA 1JLBA 4ZTFA 3SPYA 4CEQA 3OYJA 3KK2A 3V9WA 1CLQA 1Z25A 1ZBLA 4KRFA 3IG1A 4CGJA 2DFHA 3S9HA 2FBVA 4CHZA 3QIPA 4CFDA 5KRTA 1SKRA 1NK6A 4CJTA 2OPPA 4FLYA 4HTUA 3IS9A 4B9NA 4FJKA 3RMAA 1L3TA 4B9VA 3LP0A 2PZSA 5J1EA 1S6PA 3AVMA 2FBXA 1RT7A 4O0IA 1C6VA 3T19A 3V1QA 1EP4A 1S9GA 4M3YA 3LP3A 4CJLA 3OYIA 2F8SA 3OYLA 1W9HA 3AO4A 2BDPA 1HYSA 3KLEA 3AVLA 4DFPA 1NK5A 4DWIA 4CHOA 2XY5A 3RMCA 4KHSA 3G0ZA 4IBNA 4BWJA 5KGXA 2PYLA 1B9DA 1RDAA 4FK2A 3DLKA 2NUBA 1KLNA 3VQ6A 4FJIA 3AA5X 4W5QA 4QAGA 1HPZA 4C8NA 4CEOA 4FK0A 2QKKA 1BISA 1TKZA 4CEAA 4KPYA 5DK5A 4CEBA 5D3GA 4AHRA 4Z4HA 2BE2A 1QSYA 1K6YA 1KVAA 4BDYA 3ALYA 1N5YA 2JLEA 4E7IA 2DTUA 1KCFA 1VSJA 1RT2A 5HRPA 2Z1IA 4OGCA 1U4BA 2IAJA 2WOMA 4CJFA 5HRNA 3CFRA 2RN2A 3U6FA 4CJQA 1S9EA 4E3SA 5FRNA 1UA1A 4BDPA 1BQNA 2E4LA 5CY4A 4FLTA 4DTMA 4DF4A 3AVBA 1S1VA 3QIOA 3OS0A 4AHTA 4YNQA 1WSIA 3RMBA 1DTTA 5HRSA 2W42A 1NOYA 4KREA 4IDKA 1X9MA 1D9FA 4CJSA 3NH0A 3V9SA 1FKPA 3ZSXA 1QS4A 2D5RA 3OYEA 3CYMA 4DU1A 1C0UA 1JL1A 4CJ4A 3SQ1A 3S3OA 4CHPA 3F9KA 3ZSVA 4FW1A 1NJWA 4DTRA 4DMNA 4F2SA 1TKTA 3P83D 4CGHA 4CJEA 5SWMA 1NK0A 3C94A 4DQIA 3CG7A 4OLAA 3ZSZA 2FBTA 4CJPA 4J2DA 5T7BA 3HVRA 1A5WA 1EKEA 4E0DA 4O4GA 3NF7A 5J2QA 3NGIA 2YNIA 4KO0A 1F21A 2AJQA 1RBUA 4JRQA 4H4OA 1FK9A 3VQ7A 1KVBA 4KHYA 3HP9A 4Q5VA 3FFIA 3TAPA 4F3OA 2ITGA 4IFVA 4FJ5A 2P5GA 4AHSA 1CZ9A 1JXBA 2LSNA 3SJJA 3HJFA 5C24A 1X9SA 3LWMA 3IAYA 4J2AA 2VWKA 1KFDA 3PX4A 1UWBA 3HPOA 2BGGA 2ZD1A 4W5OA 3AVIA 3OYGA 2E6MA 4CHNA 3ZT2A 3CQ8A 1NJZA 4KHWA 4EZ9A 2HHUA 1RBSA 1HJRA 3NGYA 2BANA 2IC3A 4JLHA 3F73A 4CGDA 4QOZB 4FLZA 3QEPA 1RBVA 1WSGA 3D45A 3VQPA 4TSXA 3KJVA 3DOLA 1TKXA 3SQ2A 3SPZA 3TI0A 4FJHA 2O4IA 5SZTA 4DQPA 2OZMA 3LP1A 4FM2A 4DS4A 2YNGA 4PA1A 2A1SA 4W5TA 3TANA 3A2FA 1HMVA 3NF8A 4KTWA 3WNHA 3V9UA 1S1TA 3MEDA 1ZYQA 4F3TA 1KTQA 2ZQBA 3K57A 2HMIA 2P5OA 3DRPA 2FBYA 4MQ3A 2YKNA 1HQEA 2VG5A 4R5PA 3HVTA 3O3HA 4ELTA 4FJNA 1EETA 3O3GA 4B9SA 4CIGA 3NGZA 1YT3A 1T8EA 1N6QA 1VSHA 3OYFA 4ICLA 4E19A 4B9LA 1T05A 1S5JA 2B4JA 3V1OA 3K59A 4BWMA 4BE2A 3AVNA 2Y1JA 3MXMA 1ASVA 3RTVA 3QEVA 4DF8A 3ZSOA 1KSPA 1JXEA 4GMJB 4OPJA 1NJYA 2RPIA 1WAJA 5C42A 4OGEA 4HCBA 2GUIA 4FJ7A 1I39A 1RBRA 4LY7A 1ZBFA 1ASWA 4M45A 1C0MA 3OYMA 1EX4A 4H4MA 3AA4A 3HXMA 3QO9A 1QSLA 5C25A 2YNHA 1SKWA 1O1WA 1WAFA 4Z4GA 2HW3A 1IKVA 3LAKA 4RG8A 3SV4A 4Y1CA 4O55A 3KD1E 4CFAA 4F2RA 3V9ZA 1ZBIA 4E7LA 1SL1A 1NKCA 2DY4A 4I2QA 4FLXA 1SL2A 3ZT1A 1NK7A 3ITHA 4CIFA 4DQSA 1VRTA 1D5AA 1QQCA 3T1AA 1WSEA 4OKEA 1U47A 3RWUA 1NOZA 4KAZA 3AVFA 3AV9A 4FJGA 2QXFA 4DQQA 1RDBA 3QINA 4CIEA 3OYCA 4B9MA 4F8RA 3K5OA 3V1RA 4KKOA 3LZJA 4FJMA 2KQ2A 1C1CA 4AILC 4FZXC 4N76A 4N41A 5KGWA 3SYZA 3VQQA 4AHVA 4G1QA 4NCGA 2ATQA 3C6UA 4CK2A 4E1NA 4OPKA 3ULDA 3SUPA 1X9WA 3U3YA 4DSIA 4K8XA 2D0BA 1ASUA 1Q8IA 4N56A 3OJSA 3L8BA 4DSEA 4ZHRA 2B5JA 2D0CA 3U3GA 1RTIA 2IOCA 4DS5A 5J2PA 1TK5A 4IG3A 3SUOA 3DLBA 1REVA 5FDLA 3B6OA 1B9FA 2P51A 4CJUA 4M41A 4E1MA 3PO4A 4Y1DA 1IKWA 4HCCA 3ZSYA 4B8AB 2OPSA 5KRSA 1NJXA 2OPQA 5KTQA 3I8DA 4KHUA 2GBZA 1JLAA 2B6AA 1HRHA 1IH7A 1KLMA 1WNSA 3WNGA 3KIOA 4RW6A 1RILA 1RT5A 3KLGA 3HPGA 5FROA 1C0TA 3NCIA 3MXIA 1LWFA 3TAMA 4KFBA 1L3UA 1NK4A 3BDPA 4FJLA 2Z1JA 4M3TA 4DTXA 1J53A 3HK2A 1XHZA 4B8CA 5J2MA 2HHXA 4HVJA 3QNOA 4KB0A 4IFYA 3IRXA 3LALA 4M3ZA 1TVRA 1VSDA 3VQBA 4AHCA 4BE0A 5I3UA 4Z4EA 1Y97A 4DFMA 2PYJA 3OY9A 4FJ9A 4FM1A 4M42A 2P1JA 2Q3SA 1A5VA 1VSKA 1RT6A 2RF2A 4DLGA 4JS4A 1T7PA 4M3WA 3M8QA 1U45A 1BGXT 1JLFA 1RTJA 1TAQA 1X1PA 3DOKA 4H8KA 5DMRA 1RT1A 3DLGA 5KI6A 3SUQA 1NK8A 4Z4FA 1LAWA 4CECA 4N5SA 4CJVA 1HNVA 4KHQA 4PY5A 1JKHA 3HO1A 4B9TA 3AO3A 1D8YA 4DFJA 5I42A 4B3OA 3I0RA 3VN5A 4CK3A 3KKRA 4CFBA 1WSJA 3PX6A 5CZ2A 2HHQA 2VG7A 3DM2A 1HNIA 3LDSA 4CCHA 2IS3A 2XHBA 4DSJA 3PO5A 3AVJA 1DTQA 1IG9A 3QESA 2ETJA 2DFEA 1WLJA 4DTUA 3THVA 2G8UA 4EP4A 5FRMA 4DTSA 2VWJA 3NF6A 3L2WA 2HHSA 1VSIA 5HRRA 2KZZA 3M8PA 1YTAA 4OKJA 3HYFA 2G8HA 1BL3A 2KFNA 4OJRA 3HP6A 1L3VA 3L3UA 4NCAA 1JLGA 2FC0A 4DSLA 4O44A 4FM0A 3SI6A 4CF9A 2OZSA 3C6TA 3O4NA 1BI4A 3L3VA 4ZTJA 1ITGA 4DTJA 1TGOA 3RRHA 3PX0A 1S1UA 3NAEA 2YHAA 3ZT4A 3E01A 1SL0A 4YFUA 3CFOA 2OA8A 2QKBA 1C1BA 5E41A 3TAEA 1D9DA 4FLUA 1L3SA 3DLEA 4GVMA 1XC9A 2YNFA 1TK8A 3NFAA 4RW7A 1XHXA 3HSTB 3H08A 1XWLA 3PUFA 3AA3A 3AO5A 1WSFA 4FJ8A 4B08A 1TKDA 2HNZA 3DI6A 4BE1A 4CERA 4CEFA 4C8OA 1RCHA 3CM6A 3OYAA 2YHBA 3KLHA 1XI1A 2A1RA 3CFPA 1Q9XA 1G15A 1I3AA 3RR8A 5JS2A 3LPUA 3NDKA 4CJRA 1VSMA 2X6NA 1RDCA 3MEEA 3VQEA 3V9XA 1CXUA 2X78A 3PV8A 1GOBA 1RT3A 2JGUA 3TARA 3AVCA 3SV3A 1LAVA 3HM9A 3AVHA 4C8MA 1YVUA 3NH2A 3K5NA 4E7JA 1U49A 4CJWA 1J9AA 4FLWA 3SNNA 2HNDA 1SV5A 3KLIA 2EX3A 2HHVA 3RRGA 3C95A 3UIQA 4Z4CA 4KTQA 4FYDA 4BACA 3ASMA 4OVLA 3VQ5A 3K58A 3VA3A 2KFZA 3AVKA 4I9QA 4DTOA 3DYAA 2VG6A 1RNHA 1TV6A 4KTZA 2R7YA 2G8FA 3TABA 1IKXA
chains in the Genus database with same CATH superfamily
3BEXA 3OJUA 1LW2A 4JRPA 4DV5K 5CYMA 4I9LA 3VQ4A 4FW2A 4JN4A 5AQWA 1R59O 2EWSA 3ZSWA 2KW4A 4X62K 1QQMA 1BO5O 3LP2A 1RBTA 3VTIA 3ZT3A 3KKSA 4Z4IA 4O0JA 3HT3A 3MN9A 1CXQA 4DFKA 1CZBA 4LFBK 2Q1NA 3M6GA 2W40A 1QHTA 3QFPA 1KVCA 4E7HA 4B3RK 3EYZA 3M8RA 2G8KA 4LSLA 3CCRN 4JK7A 3BGRA 1VQMN 1MU2A 2VWBA 3MEGA 4BDZA 1WBBA 3JSMA 3LAMA 3HSCA 4H5WA 2WTUA 4OLBA 3K5MA 4FZYA 4A62A 2VQFK 4GV3A 1S1WA 2O8CA 4QS8A 5AR0A 5EU7A 2F8TA 4B1WB 3J7AP 1NGDA 3RSEA 3HRGA 3HPHA 4PUOA 4IEIA 4HUGA 4CGGA 3O4QA 4DR1K 3M8SA 4DV4K 1NK9A 2DFFA 5BREA 4DSKA 2A6AA 3I0SA 1RFQA 2Q31A 4AF1A 4FXDA 4BRQA 1XQSC 3GDQA 4F9OA 4FLVA 4XH5A 2D0AA 1VSLA 1YJWN 4B3OA 4J2EA 2X74A 4DKWA 4AHUA 1LOTB 4FVMA 4BRLA 1FKOA 1WN7A 2G8WA 3QERA 4CD3A 3K2PA 4DV0K 3RVCA 2OPRA 4PWDA 1GLBG 4CK1A 5LY3A 1XMQK 3NHGA 2PY5A 2QM1A 2XY6A 3W3DA 2VGNA 1BHLA 1LV5A 1QTMA 3TTDA 4L8RB 3VESA 3ZT0A 2QK9A 3OVNA 3GOIA 1VQON 5E26A 2QWLA 4JI4K 5HBMA 4DV3K 3H1VX 4ISGA 4BGAA 1HNWK 1HQUA 3SLCA 4AQYK 2Y1IA 3G25A 4CE9A 5JMVA 4CZHA 3EY1A 4FK4A 4DU4A 4NCBA 4JK9A 4I2PA 5HOOA 4HHTA 3D6RA 3MX2A 3SPYA 4CEQA 2QWQA 1CLQA 3IG1A 4CGJA 1NG9A 1NK6A 4CJTA 5A2QO 1VQPN 4B9NA 3RMAA 1L3TA 4DUZK 3HTVA 5J1EA 2FBXA 3MWTA 1HR0K 1S9GA 3LP3A 4CJLA 2F8SA 3AO4A 1E4GT 2BDPA 4OO1J 4NO7A 1NK5A 2XY5A 4HTLA 4BWJA 2UXBK 4BROA 5KGXA 1YJNN 4FK2A 2D0PA 5KPZA 4W5QA 1GLLO 3D2FA 4CEOA 3VPZA 5DK5A 4AHRA 4Z4HA 1K6YA 3LDOA 4BDYA 1BA1A 5AQYA 1U6ZA 4OGCA 3ZETA 4JYAK 2RN2A 4CJQA 5AQTA 1S9EA 2HMPA 1KXPA 3MN7A 4BDPA 2E4LA 5LJWA 3NMUA 3AVBA 1S1VA 3QIOA 2W42A 3CCSN 4CJSA 4H0PA 1FKPA 3SQ1A 3S3OA 3CD6N 4DTRA 4F2SA 4X65K 5BN8A 3P83D 4CJEA 4J2DA 3CC4N 3FGUA 3C6AA 2YNIA 4GKJK 2P9LB 3VQ7A 3HP9A 5AQOA 2BUPA 4BC5A 2ITGA 2P5GA 5IWAK 4DHYA 1X9SA 3LWMA 1KFDA 3PX4A 3HPOA 3AVIA 2VQEK 1NJZA 4L3QA 4CHNA 4EZ9A 2P9KB 4CGDA 4QOZB 2JWLA 3QEPA 4NCAA 3D45A 4TSXA 3SQ2A 3TI0A 1WB9A 3CJ1A 4DQPA 3TU5A 4PL8A 2OZMA 3VGMA 4FM2A 2YNGA 4PA1A 3SK3A 5M1OA 2OTLN 3DRPA 2FBYA 4MQ3A 2YKNA 3THWA 3HVTA 3I8BA 4ELTA 1EETA 1N6QA 3I33A 3OYFA 3TTFA 5GAHP 5FLXO 1ASVA 3RTVA 3QEVA 3ZSOA 1KSPA 1GLEG 4GMJB 2RPIA 2QWMA 3WUHA 3LDQA 4FJ7A 2ZJQL 1ASWA 4LF6K 1J6ZA 3ATVA 1QSLA 5C25A 1SKWA 1O1WA 3LAKA 3O80A 3JXUA 2D4WA 4DUYK 3SV4A 4DV7K 4O8UA 4IXCA 4JI0K 4F2RA 2F9TA 3A5MC 3ITHA 3OA9A 2JWKA 4K42A 3T1AA 1D5AA 1QQCA 3RWUA 3HO1A 1U47A 1NOZA 2QXFA 4CD1A 3CCMN 4CIEA 4B9MA 3K5OA 1Q81O 3V1RA 5M1NA 2KQ2A 4AILC 4N76A 4N41A 4OPHA 3LDNA 3CJ9A 4AHVA 3P38A 4CK2A 3ULDA 3SUPA 3WEEB 1X9WA 1Q82O 4BY9C 3EE9A 3L8BA 2B5JA 2D0CA 3U3GA 1TK5A 2QA4N 3SUOA 3E1YA 3WXIA 1REVA 4YOVA 1VQ6N 4CJUA 4M41A 1HPMA 2KLAA 2OPSA 2QWOA 1W97L 2YCHA 2B6AA 1HRHA 1KLMA 1WNSA 4RW6A 4BRMA 4BC4A 4NXNK 3KLGA 4H0VB 3JAMO 1C0TA 3SBTA 3VEYA 4WQ5C 1NK4A 4FJLA 1HKCA 4HVJA 1HUXA 4IFYA 1IG8A 4Z4EA 1EWQA 4PL7A 1A5VA 2RF2A 4M3WA 1X1PA 4O5FA 3SUQA 3DLGA 4CECA 3VF6A 4CJVA 4KHQA 3AO3A 5CE3A 2NRVA 4CK3A 2WC9A 4CFBA 3BUZB 4JI7K 1NGHA 5I9EB 4A5BA 4IO8A 3VGKA 3LDSA 1YIJN 1BG3A 2IS3A 4H5TA 4CCHA 1SAZA 5JICA 1DTQA 3QBXA 4ILJA 4C23A 4EP4A 4DV1K 4DTSA 1SZ2A 2Q97A 4YOXA 1YTAA 3HYFA 1BL3A 1OH6A 1RGIA 4DSLA 4O44A 3SI6A 3O4NA 4QS7A 4DR6K 4B1VA 4LFAK 1TGOA 3HOTA 3PX0A 4DV2K 3NAEA 5ELZA 1SL0A 4YFUA 5E41A 1D9DA 1E4FT 3CCUN 1TK8A 1XC9A 4YDUC 3AA3A 2A42A 2NZTA 1TKDA 5E84A 4JKCA 4BE1A 1MDUB 1YF5L 2O8EA 4DQ8A 4Z94A 1XI1A 2KKZA 4CZLA 3CFPA 1Q9XA 2GUPA 4LF7K 1G15A 1I3AA 3LPUA 3NDKA 3SBGA 2X6NA 3VQEA 4EIAA 1RDWX 5M1KA 3TARA 3WQTA 1IBLK 4BR7A 3SV3A 1YVUA 1U49A 4NLCA 1HKBA 3QBWA 2E5LK 2UYTA 3ULEB 3KLIA 4KTQA 3KWGA 3VA3A 1T3VA 4DTOA 4WQ5A 5AFUH 3VERA 2R7YA 2YHWA 3TABA 4B8CA 2O4GA 1LW0A 3OS1A 3THXB 4KV8A 4CJKA 3AVAA 4YOTA 4CGIA 4XEIA 4M3UA 1BU6O 4FWLA 3DXMB 3LANA 1UA0A 1NGEA 1U48A 4GW6A 3KK3A 1FXXA 3L2QA 1R0AA 3ZCMA 3OYHA 3S3MA 1RTDA 1L5UA 3C7NB 3VQDA 3BP8A 2QXLA 1NWKA 4O5BA 2NRRA 4WE1A 2CH5A 3QFUA 2KZMA 3KK7A 1HLUA 4X66K 3CQXA 4CHQA 3TSQA 3TWHA 2CGJA 3OYNA 1QVGM 1HYVA 4C1NI 2A41A 1ZBHA 4H5RA 5C0YA 2O8FA 4MDBA 4DCHA 4BQLA 4RCHA 4CJ5A 1ATSA 3HBTA 1GLDG 2GELA 3AY9A 1BQMA 2I7NA 3JS6A 4WQ4A 4JI5K 3VA0A 2KTQA 4EP5A 4W5RA 4CF0A 4CF1A 3VEWA 3RSEB 1KAYA 2HHTA 3MECA 4FWKA 2Q36A 4YDUA 3SQ0A 1LWCA 2QEXN 2QTDA 4FPAA 4E89A 4BREA 1Z26A 4BR2A 4ELUA 1JCGA 2W6LA 2HVHA 4KH4A 4W5NA 1TAUA 1QSSA 3SMSA 1GLJO 4KB1A 3LWLA 1U04A 2HB5A 4CZGA 2IVOA 4HUFA 1VK0A 4AH9A 1DEJA 4KI4A 4PKIA 3I55N 4DQRA 3SQ4A 4MO4A 1HYZA 1T03A 3ID8A 3Q7CA 3SUNA 2F96A 3GL1A 5EY4A 3B6PA 3QEIA 1S6QA 2XO7A 1ZBUA 3ZEUA 3J81O 1Q18A 3OYBA 3TR8A 1YTUA 3V81A 3TAQA 1NGAA 4C8LA 3QLHA 1J54A 2IVPA 3NE6A 3UE5A 2Z1HA 2NRTA 1NKBA 1EXQA 2NRWA 4FJJA 3I56N 4AM7A 4BC3A 4FZZA 4PKHA 3QICA 1MA9B 4CESA 1JJ2M 1W0HA 2E2PA 3A5LC 1TK0A 4DLEA 4CVNE 1TYQA 5B8HA 3KD5E 1RTHA 4ZTFA 3OYJA 3V9WA 1Z25A 3FE1A 1ZBLA 4KRFA 4CHZA 5KRTA 3AAQA 3CQYA 3CPEA 1X3NA 1N8RO 1RT7A 4BRPA 3G4SN 1S22A 3T19A 1EP4A 3KVGA 4FWOA 2CGLA 3OYIA 3OYLA 1HYSA 3AVLA 4DFPA 4DWIA 4KHSA 4ISEA 4IBNA 5AZJB 3FZHA 1RDAA 4QS9A 3DLKA 1KLNA 4FJIA 1D4XA 2YI1A 5AQRA 5AQNA 5AQJA 2QKKA 4KPYA 4CEAA 5FPDA 1K8AO 3MDQA 5AZIA 4CEBA 5D3GA 5DM7L 2BE2A 3FLCO 3UKUA 2H3GX 5AQZA 3IDHA 5BRHA 1N5YA 1XNQK 2E20A 2J4RA 3ZETB 1RT2A 2A5XA 2IAJA 3ATUA 2HBKA 2ZWHA 1HNZK 3PSIA 4YNQA 1WSIA 1EQYA 1DTTA 5BPMA 1GLAG 4BRCA 3NH0A 3V9SA 1OVQA 1JL1A 5AQGA 1BA0A 4FWNA 5SWMA 2PAVA 1YITN 1NK0A 3C94A 1Y64A 4OLAA 3G6EN 3O8MA 4CJPA 2QI2A 5GADP 3HVRA 3DAWA 4O4GA 3VEXA 4FPBA 3NGIA 1E3MA 4DB3A 2AJQA 4JRQA 4H4OA 1FK9A 1N32K 4CJ7A 5GAEP 5GIOA 5CHIA 4F3OA 4IFVA 1XMOK 4ISFA 1CZ9A 3L0QA 1QQNA 1QHAA 2ZJRL 2P9SA 3OYGA 2E6MA 3ZT2A 4KHWA 3UKRA 3F73A 4CZJA 3N4QA 3DOLA 4RTFD 3SPZA 2E2OA 1VAZA 2A1SA 1HMVA 4KTWA 3WNHA 3MEDA 1ZYQA 5AQFA 3K57A 2HMIA 3THWB 2Q0RA 2F7TA 3O3GA 1YT3A 3CCVN 1NLVA 1VSHA 4E19A 3E9OA 1T05A 3V1OA 4BE2A 2Y1JA 1DGKN 3ID6A 4DF8A 1X3MA 4OPJA 4B3TK 3H46O 2A40A 4HCBA 2GUIA 3O08A 1RBRA 5F1XA 4H4MA 3AA4A 3ZLJA 4JNEA 2OANA 4RG8A 3O9TA 4Y1CA 4O55A 3KD1E 3V9ZA 1SL1A 4I6MB 4FLXA 1SL2A 5AQVA 3ZT1A 4GV9A 4CIFA 1VQNN 3SAFA 1RDBA 4FSVA 4F8RA 5DM6L 4FJMA 1C1CA 3SYZA 2V52B 1CZAN 3SAGA 3O4WA 5AQLA 3C6UA 4E1NA 2ASMA 4K8XA 2D0BA 1YI2N 1Q8IA 4DSEA 3ENBA 4UY8O 2IOCA 4DS5A 4IG3A 4OPAA 4K41A 4ILHA 4B1XB 3KWIA 5FDLA 3B6OA 4HCCA 1NJXA 2OPQA 3I8DA 2GBZA 1K8KB 5AQPA 1RILA 1RT5A 1W7AA 3F5TA 1NNEA 5BR8K 1LWFA 3TAMA 3EKUA 4OX9K 5AQXA 3OHRA 3HK2A 3VEZA 1XHZA 2HHXA 4KB0A 3CC2N 3IRXA 4M3ZA 4H0XB 1U2VB 1Y97A 2OCEA 4LFCK 4IWVA 3CCJN 4FJ9A 4FM1A 5AJ3K 4DLGA 3EO3A 5AQQA 1BGXT 1NJIO 3M1FA 4H8KA 5KI6A 4CZIA 3BF1A 1OVYA 1HNVA 4PY5A 4B9TA 3DJCA 1OKJA 1D8YA 4K0KK 2VG7A 3DM2A 1HNIA 4FWRA 2XHBA 2ETJA 2YHXA 4H0OA 1WLJA 4U7BA 4DTUA 3THVA 2G8UA 5FRMA 1N34K 3VETA 2VWJA 3NF6A 2HHSA 1IBMK 4JKFA 4EHTA 3M8PA 1EWRA 4XH4A 5AFUA 2KFNA 3H6EA 3L3UA 1JLGA 3KZBA 4FM0A 4CF9A 3SAHA 2OZSA 5LJVA 4U67L 1GLCG 3RRHA 3NVMA 4IOXA 1HX1A 2E1YA 4DR5K 3T7ZA 3CFOA 4JD2B 4LC9B 1C1BA 3WXKA 3U9ZA 1XHXA 5F0XA 3PUFA 4GNIA 4FJ8A 3CCLN 3EE8A 1WOQA 4CEFA 3E9PA 3QDKA 2A1RA 3LM2A 5AQKA 3A5OC 4JHDB 4B9QA 1VSMA 4IOCL 2X78A 2W41A 2FF3B 1LAVA 3HM9A 2Q0UA 4FLWA 5BRFA 2HHVA 3RRGA 1EO1A 4OVLA 4JV5K 2P9IB 3ENHA 4DR7K 4KAZA 4FWMA 3L2UA 1A5XA 5M1QA 4XIUA 2HOEA 4J2BA 1RT4A 2FLOA 4H5NA 1RDUA 1SUQA 3QEXA 4JS5A 1VQ4N 4DSFA 3LPTA 1OH5A 1J5OA 3RR7A 4IKFA 2P9UB 1JLEA 3VENA 1BIUA 4RW8A 2P9NA 2XRIA 3J7YP 3EEQA 4GY2B 3WNEA 4IG0A 3NH1A 1H1VA 4EAHD 3WNFA 4YOYA 1LWEA 4YOUA 1BIZA 3CJCA 1S72N 2D1KA 4BRDA 4IO9L 3L6QA 5GIPA 4B3MK 3N4PA 3CMAN 3R8EA 4B3SK 3OW2M 2G8IA 3E66A 1QQOA 2P9PB 1JL2A 4NXMK 5KQDA 4CGFA 4BGBA 4KHNA 1N36K 4N47A 4M3XA 3O9QA 5C10A 4KH5A 3U8XA 3TAFA 2O8DB 5HP1A 1ESVA 4DTPA 2YKMA 5C15A 3HM8A 2UUAK 3OYKA 1VSFA 2E1ZA 1BCOA 1Q9YA 3H3OB 1ATNA 1B92A 4CEZA 5C2FA 3VQ8A 5LL6Z 2RHKA 3NF9A 3MAQA 3CI5A 2XY7A 3KTQA 3VOVA 5GAGP 2P9LA 2RKIA 4PHTX 4E7KA 3HL8A 3GG4A 4NYNA 4F4KA 1BI4B 3NBPA 3CERA 5CYQA 3IMXA 3L2VA 4WCEL 1QE1A 1JLQA 2FF6A 5FPNA 3RMDA 4H0TB 3HOSA 3D0PA 2IGIA 2OYQA 1UOCA 1GLFO 1WSHA 5ADXA 5GINA 3VQ9A 3ZSRA 2EHGA 3H3NO 3U4LA 4CJ3A 1YJ9N 3QMLA 3QEWA 3AA2A 3MMVA 2Z1GA 1BDGA 2I5JA 3D2EB 3CHWA 2YV0X 1VRUA 2E8AA 3EKSA 2HNYA 3AVGA 1ZXOA 3QETA 4Z0UA 1TL3A 3PY8A 4HUEA 3MCAB 4BR0A 1C1AA 4H5VA 3JYTA 1SKSA 3P5JA 2G8VA 2GV9A 1UAXA 1TYQB 2BH1A 1DKGD 4MFBA 3ZSQA 4ID5A 4B1UB 1JLBA 1XUPO 3M3ZA 3K9JA 3O9SA 2DFHA 3BY5A 3S9HA 2FBVA 3SJHA 3QIPA 1SKRA 3IFRA 4FLYA 4HTUA 4FJKA 3LP0A 1Q86O 4B1YB 3AVMA 4CW7B 5JVGL 4BRIA 1C6VA 4AM6A 4M3YA 2D0OA 4K25A 2NLXA 4CHOA 3VF4A 2Q2RA 3RMCA 4BVOA 1HKGA 5EXWA 1B9DA 3THYA 3WEEA 1ZC6A 2NUBA 3AA5X 3S41A 3C65A 4QAGA 1HPZA 4BRGA 4H0YB 1VQ8N 5AZIB 1BISA 2HBMA 5AQMA 4PKGA 1QSYA 1KVAA 2VCPA 3ALYA 2JLEA 4E7IA 1VSJA 3DXKA 2Z1IA 2WOMA 4CBUA 4E3SA 5FRNA 1QVFM 1UA1A 2O8CB 1BQNA 1P90A 1C0GA 5CY4A 4WYBA 4DTMA 3VMFB 3PIOL 2YJFA 5HRSA 1NOYA 2BTFA 4KREA 4FVUA 5TKWA 4DR2K 3ZSXA 1QS4A 1NBWA 3OYEA 4M63C 4DU1A 4CJ4A 1QZ6A 4CHPA 3ZSVA 3BZCA 4CZEA 1T44A 1Z05A 4A2AA 5MLCQ 4DQIA 3CG7A 3ZSZA 3GBTA 2FBTA 3SMPA 1A5WA 3R6MA 3NF7A 3TTCA 5J2QA 1KD1O 3MWPA 1RBUA 3K0SA 4MO5A 1KVBA 4KHYA 5EOYA 4Q5VA 4JAXA 3FFIA 4FJ5A 3SJJA 5C24A 4J2AA 2VWKA 1UWBA 4KHPK 3CQ8A 2F4VK 4IJNA 4JLHA 1HJRA 2BANA 4FLZA 3VQPA 1TKXA 2O4IA 4FJHA 3WQUA 5SZTA 4JKGA 4W5TA 1HNXK 2NRZA 2P5OA 1IJJA 1BOTO 1HQEA 4R5PA 3NGZA 4B9LA 3ZYYX 2E88A 3K59A 1JCEA 3AVNA 4ILGB 2WBNA 1JXEA 1NJYA 2E2NA 5C42A 4OGEA 2UUCK 5BRDA 4LY7A 2HBLA 4LF8K 3QO9A 2UXCK 2YNHA 1WAFA 4Z4GA 2HW3A 4IJAA 1IKVA 4WFAL 1FJGK 4CFAA 1ZBIA 4FWPA 4E7LA 3CETA 1NKCA 4FWQA 3UB5A 4LF4K 5ADXH 3ULEA 3AV9A 3U9DA 3OYCA 5AQUA 4A61A 5KGWA 3H1QA 3L4QA 3VQQA 3DWLA 4BVPA 4G1QA 2WUSA 3THXA 2UU9K 1V4TA 3AGRA 1ASUA 2HBJA 3D2FB 3FFKB 4ZHRA 3WXJA 1XNRK 3DXMA 3L4IA 2FSNA 3C6HA 4JKDA 2P51A 3NVKA 3ZSYA 4B8AB 1T6CA 5KTQA 4DR3K 1JLAA 2ASOA 3C7NA 3WNGA 1IH7A 2ITMA 3KIOA 2O8BA 3C0BA 3P4IA 3A8YA 3HPGA 5FROA 3NCIA 3HI0A 2QW9A 3FR0A 3MXIA 5M1FA 1KC8O 4KFBA 1L3UA 3BDPA 4M3TA 4BRAA 3CF5L 5J2MA 4BR4A 3QNOA 4H03B 1OH7A 3Q7BA 3VQBA 3TSUA 5I3UA 3E9LA 4BR5A 1V4SA 4M42A 1VSKA 1RT6A 1T7PA 4JS4A 1U45A 1JLFA 1RTJA 5DMRA 4N5SA 1NGBA 5EVZA 5I42A 3VGLA 4JI3K 3I0RA 3VN5A 4FWSA 3O5BA 3KKRA 1WSJA 3PX6A 1VHXA 1BUPA 2V7YA 5C2DA 3PO5A 3AVJA 1IG9A 3QESA 5BPNA 2DFEA 1MWMA 5AQIA 3O6WA 3L2WA 1VSIA 5TKYA 4FOEA 4OKJA 4IOAL 2YJEA 2G8HA 3F2KA 1L3VA 2FC0A 4JK8A 4A57A 1VQ5N 4LF5K 3C6TA 3L3VA 4BRFA 1ITGA 4DTJA 1S1UA 4A2BA 3ZT4A 3TAEA 4BR9A 4FLUA 4NB4A 3NFAA 4RW7A 2VYPA 3H08A 3MN5A 3AO5A 3R3LA 4B08A 2E2QA 4WFBL 3DI6A 3B8AX 2CH6A 4X64K 3CM6A 4WF9L 3OYAA 2YHBA 5JS2A 4CJRA 3LDLA 3MEEA 3V9XA 1CXUA 3AGKA 4R79A 1GOBA 1RT3A 2JGUA 1C0FA 2IIRA 3AVCA 5KPRA 1G99A 4C8MA 4BRHA 3NH2A 1K9MO 4E7JA 1MWKA 1WBDA 4CJWA 3SNNA 1XC3A 1SV5A 2HNDA 2EX3A 3VEVA 4FYDA 3C95A 1J5EK 3K58A 2HHHK 4BC2A 4I9QA 4E1JA 2WFBA 4JI1K 3MXJA 4GV6A 3OYDA 3CJAA 3V4IA 4G9ZA 3FZKA 1W2BM 3GE1A 4YOWA 3ISNC 3DRSA 2NNWA 4CHYA 3S3NA 4EZ6A 2FSKA 3LDPA 2P9NB 3OS2A 2QWRA 3CM5A 3IKMA 3KLFA 1YAGA 3SCXA 1KRPA 2ZM6K 1OH8A 4ELVA 5CZ1A 3AO2A 3DRRA 4BG8A 4GKKK 3K5LA 3OTOK 3MX5A 1GOAA 4IZ9A 5AZJA 3TAGA 1TL1A 5JS1A 3O9UA 4YORA 3OBWA 4QCLA 3LL3A 4CI6A 2YHYA 4RW4A 4FCYA 1S1XA 4LSNA 4DU3A 4KI6A 4UQGA 5F2RA 4DTNA 4M3RA 4K8ZA 4B9UA 4FJXA 2W6KA 4YHHK 3R1XA 4IDHA 3SZ2A 4LH4A 2IDOA 1JCFA 1Z6RA 3MK6A 4CZFA 5HLFA 4Q0BA 3QNNA 2GWKA 3VTHA 2QWPA 1N33K 3DLHA 1IO2A 4RW9A 1GOCA 1IKYA 4NYFA 5J2NA 4JI2K 2AA4A 1NGJA 3T1HK 4CF2A 3LZIA 1Q7YO 4HWIA 3M5RA 1FW6A 3L2RA 4LF9K 4LD0A 3CIPA 5K14A 1BCMA 2QWNA 4DG1A 3ZX0A 2X6SA 2ZE2A 4I7FA 3BF3A 2DPNA 5KQ8A 1KAZA 4OKKA 3P1GA 3AO1A 3V6DA 1KFSA 3PIPL 2HHWA 2HF3A 4MDAA 4RWTA 4DR4K 4BQZA 4CEDA 2HVIA 2WONA 3EZ5A 3KK1A 1JLCA 3VQAA 2ZF5O 1NKEA 4JKEA 4LH5A 2ZGZA 2NRXA 4C8KA 3A0IX 3DLRA 4CFCA 2O8EB 3G71N 3F9MA 3G10A 3QB0A 5HROA 1M90O 2E6LA 5BR9A 3T3FA 1VQLN 3CJ7A 1SQKA 2HSTA 1VSEA 2FSJA 3DMJA 4K43A 4O8KA 3VQCA 1RDDA 3VF2A 3FZMA 1SS6A 4ID1A 3O3FA 3J80O 1NU0A 5JLFA 4CEEA 4CF8A 4PQUA 2XY8A 3W0LA 4JI8K 3ZX2A 4FL9A 5HL7L 1DLOA 3CJBA 3KK2A 1IV0A 3CCQN 4CBWA 4CFDA 4M7XA 2OPPA 3IS9A 1NMDA 4I6MA 4B9VA 2PZSA 3J7ZO 1S6PA 3PSFA 1IBKK 4O0IA 3R9PA 4BRKA 4NLBA 3V1QA 1ILYA 2PFUA 5LMUK 2ZJPL 1W9HA 2ASPA 3KLEA 3VEOA 1BWFO 3G0ZA 4CZMA 1NGCA 3THYB 5H1SQ 2PYLA 4MLEA 3VQ6A 1I94K 3ENOA 3CMEN 4C8NA 4GVEA 4M7YA 4EFHA 4FK0A 1TKZA 2IVNA 3A5NC 2O8FB 2GX9A 4JKHA 3T1YK 3P39A 3DXKB 2DTUA 1KCFA 3FZLA 5HRPA 1U4BA 1K8KA 4CJFA 5HRNA 3CFRA 3U6FA 1YXQA 1O13A 4DF4A 4FLTA 3OS0A 4AHTA 3RMBA 4IDKA 1X9MA 2HF4A 1D9FA 4WFNL 2D5RA 3CYMA 1C0UA 3F9KA 4Y0WA 4FW1A 1NJWA 1U2VA 4DMNA 1TKTA 4CGHA 1ZBSA 5T7BA 3TPQA 3DLLL 1EKEA 3MN6A 5M1PA 3AARA 4E0DA 2GWJA 4JI6K 5JVHL 4KO0A 1F21A 5C12A 3TAPA 4CZKA 4AHSA 1JXBA 3HJFA 2LSNA 1VQKN 3IAYA 4A59A 2BGGA 2ZD1A 4W5OA 3CC7N 3TSPA 2HHUA 1RBSA 3NGYA 2IC3A 2P9KA 1RBVA 1WSGA 3KJVA 4JKGB 3ZEUB 3EZWA 5LMNK 3OBYA 3LP1A 4DS4A 3TANA 2A3ZA 3A2FA 3NF8A 3V9UA 1S1TA 4F3TA 1KTQA 2ZQBA 1KAXA 2VG5A 3O3HA 4FJNA 4B9SA 4CIGA 1T8EA 4WQ4C 4ICLA 1S5JA 4FO0A 2B4JA 4BWMA 4JD2A 3MXMA 3HZ6A 1WAJA 2RE2A 2VGMA 5FPEA 1I39A 3O9RA 3ZX3A 1YHQN 1ZBFA 4M45A 1C0MA 3OYMA 1EX4A 1ATRA 3HXMA 4A5AA 5BPLA 4FOIA 4MLHA 2GEMA 4JHDA 1NGIA 2DY4A 4I2QA 5EX5A 4JKBA 1NK7A 4XH1A 4DQSA 1VRTA 1WSEA 4OKEA 3PLAA 5AQHA 3MCPA 4FJGA 3AVFA 4DQQA 3QINA 4KH6A 1TUUA 4B1ZA 4KKOA 3LZJA 4FZXC 2P9IA 2I7PA 3EN9A 4IEEA 3CXCM 1YVNA 2ATQA 4NCGA 4OPKA 3U3YA 4DSIA 4JEPA 4N56A 3OJSA 3K9KA 1RTIA 2YX6A 1X9JA 5J2PA 5CR4A 3DLBA 4BG9A 2P9UA 2V7ZA 1LCUA 1B9FA 3UKUB 4YY3K 4E1MA 2V51B 3PO4A 4Y1DA 1IKWA 5KRSA 2OTJN 4KHUA 1T6DA 2O8BB 5BN9A 1KQSM 4IFEA 2Z1JA 4V19S 4DTXA 1J53A 3LM9A 5AQSA 3CCEN 3LALA 1TVRA 1VSDA 1TUYA 4AHCA 4BE0A 4DFMA 2PYJA 3OY9A 3BZKA 2P9PA 2P1JA 2Q3SA 1NMNA 1WUAA 1M1KO 1NGFA 3J8AA 3M8QA 1VQ9N 1HJOA 1TAQA 1S3XA 3WXMB 3DOKA 1RT1A 1YUWA 1NK8A 4Z4FA 1LAWA 1JKHA 2O8DA 4J8FA 4C1NK 4DFJA 3P31A 2UXDK 5CZ2A 2HHQA 4DV6K 4BRNA 4JKAA 3KHYA 3FZFA 4DSJA 2P9SB 4KBOA 3O1BA 3CPWM 3UKRB 1VQ7N 2ZGYA 5HRRA 2KZZA 2PBDA 3WT0A 1P8ZA 4OJRA 3HP6A 1DT9A 1QZ5A 1BI4A 4ZTJA 3H45C 2YHAA 3E01A 5JLHA 2QKBA 2OA8A 3EL2A 2CGKA 1L3SA 3DLEA 4GVMA 2NRHA 2GTDA 2YNFA 1NM1A 3HSTB 1XWLA 3O1WA 1WSFA 2HNZA 1K73O 4CERA 4C8OA 1RCHA 3AAPA 3KLHA 2F9WA 1NGGA 3RR8A 3D2EA 5KPTA 5FPMA 1RDCA 3PV8A 3D7EO 3WXLA 2AP1A 2UUBK 2KHOA 3AVHA 3K5NA 1J9AA 3UIQA 4Z4CA 3IUCA 4BACA 3ASMA 3VQ5A 3T69A 2KFZA 3AVKA 2FXUA 3DYAA 4EHUA 2VG6A 5IT9O 1RNHA 1TV6A 4KTZA 2G8FA 4CBXA 1IKXA
chains in the Genus database with same CATH topology
2O4GA 1LW0A 3OJUA 1LW2A 4JRPA 3OS1A 3MXJA 4KV8A 3AVAA 4CJKA 3L2UA 5CYMA 4CGIA 4I9LA 3OYDA 1A5XA 3V4IA 4M3UA 3VQ4A 4XIUA 4J2BA 1RT4A 4FW2A 3ISNC 3DRSA 3LANA 1SUQA 3QEXA 1UA0A 1U48A 4CHYA 3ZSWA 4GW6A 3LPTA 4JS5A 4DSFA 3S3NA 1J5OA 2KW4A 3RR7A 4EZ6A 3KK3A 4IKFA 1FXXA 1JLEA 3OS2A 3L2QA 1BIUA 3ZCMA 1R0AA 3OYHA 4RW8A 2XRIA 3CM5A 3KLFA 3S3MA 3LP2A 1RBTA 3ZT3A 3SCXA 3KKSA 1KRPA 4Z4IA 1RTDA 4O0JA 3HT3A 1L5UA 5CZ1A 3AO2A 3VQDA 3WNEA 4ELVA 4IG0A 3DRRA 3NH1A 3K5LA 1CXQA 1GOAA 3WNFA 4DFKA 1CZBA 4O5BA 1LWEA 4WE1A 1TL1A 3TAGA 1QHTA 2KZMA 5JS1A 1BIZA 4QCLA 4CHQA 1KVCA 4RW4A 4E7HA 3EYZA 3M8RA 1S1XA 4LSNA 4FCYA 4DU3A 2G8KA 3TWHA 4KI6A 4UQGA 4DTNA 4LSLA 4M3RA 4K8ZA 3OYNA 3BGRA 4B9UA 1HYVA 4FJXA 1MU2A 3SZ2A 2G8IA 3MEGA 1ZBHA 4BDZA 4LH4A 2IDOA 1JL2A 5HLFA 4CJ5A 4CGFA 4Q0BA 3QNNA 4KHNA 3JSMA 4N47A 3LAMA 4M3XA 1BQMA 4OLBA 3K5MA 3DLHA 4FZYA 1IO2A 4RW9A 3VA0A 2KTQA 4EP5A 4W5RA 1GOCA 1S1WA 4CF0A 3TAFA 4CF1A 5EU7A 1IKYA 4NYFA 5HP1A 4DTPA 3MECA 2YKMA 2F8TA 2HHTA 5J2NA 3HPHA 4PUOA 3SQ0A 1LWCA 4HUGA 4CGGA 3O4QA 3OYKA 4CF2A 3M8SA 3LZIA 1NK9A 2DFFA 1VSFA 4E89A 4DSKA 3I0SA 3L2RA 1BCOA 1Z26A 1Q9YA 4ELUA 2HVHA 4W5NA 4LD0A 4FXDA 1TAUA 1B92A 5K14A 4CEZA 1BCMA 4DG1A 4FLVA 3VQ8A 1QSSA 4KB1A 3NF9A 3LWLA 1U04A 3MAQA 2X6SA 2ZE2A 2D0AA 2HB5A 2XY7A 1VSLA 4I7FA 3KTQA 4HUFA 1VK0A 4AH9A 4KI4A 4J2EA 2X74A 4OKKA 2RKIA 3P1GA 4AHUA 4FVMA 3AO1A 3V6DA 1KFSA 4E7KA 1FKOA 1WN7A 3HL8A 2G8WA 2HHWA 4DQRA 4NYNA 3QERA 3SQ4A 1BI4B 3NBPA 4F4KA 1HYZA 5CYQA 3L2VA 4CEDA 2HVIA 1QE1A 2WONA 3K2PA 3EZ5A 1JLQA 3RMDA 3KK1A 1JLCA 3VQAA 1T03A 1NKEA 2OPRA 4PWDA 4LH5A 4CK1A 3SUNA 3D0PA 2F96A 2IGIA 2OYQA 1UOCA 1WSHA 3B6PA 3QEIA 4C8KA 3NHGA 3VQ9A 3ZSRA 2EHGA 4CJ3A 1S6QA 2XO7A 1ZBUA 4CFCA 3DLRA 2PY5A 3QEWA 3OYBA 2XY6A 3AA2A 3TR8A 1YTUA 3V81A 2Z1GA 3G10A 1BHLA 5HROA 3TAQA 1LV5A 1QTMA 2I5JA 4C8LA 4L8RB 2E6LA 3ZT0A 2QK9A 2YV0X 3QLHA 1J54A 1VRUA 3OVNA 3NE6A 3T3FA 2HNYA 3AVGA 5HBMA 3QETA 2Z1HA 1VSEA 1NKBA 3DMJA 1EXQA 3VQCA 4Z0UA 4FJJA 1TL3A 3PY8A 1HQUA 1RDDA 2Y1IA 4FZZA 4HUEA 4ID1A 3O3FA 4CE9A 4CESA 1C1AA 4CEEA 4CF8A 3JYTA 2XY8A 3EY1A 4FK4A 4PQUA 4DU4A 4NCBA 1W0HA 3P5JA 1SKSA 2G8VA 2GV9A 1UAXA 4I2PA 4HHTA 1TK0A 4DLEA 4MFBA 3ZSQA 4ID5A 1DLOA 3KD5E 1RTHA 1JLBA 4ZTFA 3SPYA 4CEQA 3OYJA 3KK2A 3V9WA 1CLQA 1Z25A 1ZBLA 4KRFA 3IG1A 4CGJA 2DFHA 3S9HA 2FBVA 4CHZA 3QIPA 4CFDA 5KRTA 1SKRA 1NK6A 4CJTA 2OPPA 4FLYA 4HTUA 3IS9A 4B9NA 4FJKA 3RMAA 1L3TA 4B9VA 3LP0A 2PZSA 5J1EA 1S6PA 3AVMA 2FBXA 1RT7A 4O0IA 1C6VA 3T19A 3V1QA 1EP4A 1S9GA 4M3YA 3LP3A 4CJLA 3OYIA 2F8SA 3OYLA 1W9HA 3AO4A 2BDPA 1HYSA 3KLEA 3AVLA 4DFPA 1NK5A 4DWIA 4CHOA 2XY5A 3RMCA 4KHSA 3G0ZA 4IBNA 4BWJA 5KGXA 2PYLA 1B9DA 1RDAA 4FK2A 3DLKA 2NUBA 1KLNA 3VQ6A 4FJIA 3AA5X 4W5QA 4QAGA 1HPZA 4C8NA 4CEOA 4FK0A 2QKKA 1BISA 1TKZA 4CEAA 4KPYA 5DK5A 4CEBA 5D3GA 4AHRA 4Z4HA 2BE2A 1QSYA 1K6YA 1KVAA 4BDYA 3ALYA 1N5YA 2JLEA 4E7IA 2DTUA 1KCFA 1VSJA 1RT2A 5HRPA 2Z1IA 4OGCA 1U4BA 2IAJA 2WOMA 4CJFA 5HRNA 3CFRA 2RN2A 3U6FA 4CJQA 1S9EA 4E3SA 5FRNA 1UA1A 4BDPA 1BQNA 2E4LA 5CY4A 4FLTA 4DTMA 4DF4A 3AVBA 1S1VA 3QIOA 3OS0A 4AHTA 4YNQA 1WSIA 3RMBA 1DTTA 5HRSA 2W42A 1NOYA 4KREA 4IDKA 1X9MA 1D9FA 4CJSA 3NH0A 3V9SA 1FKPA 3ZSXA 1QS4A 2D5RA 3OYEA 3CYMA 4DU1A 1C0UA 1JL1A 4CJ4A 3SQ1A 3S3OA 4CHPA 3F9KA 3ZSVA 4FW1A 1NJWA 4DTRA 4DMNA 4F2SA 1TKTA 3P83D 4CGHA 4CJEA 5SWMA 1NK0A 3C94A 4DQIA 3CG7A 4OLAA 3ZSZA 2FBTA 4CJPA 4J2DA 5T7BA 3HVRA 1A5WA 1EKEA 4E0DA 4O4GA 3NF7A 5J2QA 3NGIA 2YNIA 4KO0A 1F21A 2AJQA 1RBUA 4JRQA 4H4OA 1FK9A 3VQ7A 1KVBA 4KHYA 3HP9A 4Q5VA 3FFIA 3TAPA 4F3OA 2ITGA 4IFVA 4FJ5A 2P5GA 4AHSA 1CZ9A 1JXBA 2LSNA 3SJJA 3HJFA 5C24A 1X9SA 3LWMA 3IAYA 4J2AA 2VWKA 1KFDA 3PX4A 1UWBA 3HPOA 2BGGA 2ZD1A 4W5OA 3AVIA 3OYGA 2E6MA 4CHNA 3ZT2A 3CQ8A 1NJZA 4KHWA 4EZ9A 2HHUA 1RBSA 1HJRA 3NGYA 2BANA 2IC3A 4JLHA 3F73A 4CGDA 4QOZB 4FLZA 3QEPA 1RBVA 1WSGA 3D45A 3VQPA 4TSXA 3KJVA 3DOLA 1TKXA 3SQ2A 3SPZA 3TI0A 4FJHA 2O4IA 5SZTA 4DQPA 2OZMA 3LP1A 4FM2A 4DS4A 2YNGA 4PA1A 2A1SA 4W5TA 3TANA 3A2FA 1HMVA 3NF8A 4KTWA 3WNHA 3V9UA 1S1TA 3MEDA 1ZYQA 4F3TA 1KTQA 2ZQBA 3K57A 2HMIA 2P5OA 3DRPA 2FBYA 4MQ3A 2YKNA 1HQEA 2VG5A 4R5PA 3HVTA 3O3HA 4ELTA 4FJNA 1EETA 3O3GA 4B9SA 4CIGA 3NGZA 1YT3A 1T8EA 1N6QA 1VSHA 3OYFA 4ICLA 4E19A 4B9LA 1T05A 1S5JA 2B4JA 3V1OA 3K59A 4BWMA 4BE2A 3AVNA 2Y1JA 3MXMA 1ASVA 3RTVA 3QEVA 4DF8A 3ZSOA 1KSPA 1JXEA 4GMJB 4OPJA 1NJYA 2RPIA 1WAJA 5C42A 4OGEA 4HCBA 2GUIA 4FJ7A 1I39A 1RBRA 4LY7A 1ZBFA 1ASWA 4M45A 1C0MA 3OYMA 1EX4A 4H4MA 3AA4A 3HXMA 3QO9A 1QSLA 5C25A 2YNHA 1SKWA 1O1WA 1WAFA 4Z4GA 2HW3A 1IKVA 3LAKA 4RG8A 3SV4A 4Y1CA 4O55A 3KD1E 4CFAA 4F2RA 3V9ZA 1ZBIA 4E7LA 1SL1A 1NKCA 2DY4A 4I2QA 4FLXA 1SL2A 3ZT1A 1NK7A 3ITHA 4CIFA 4DQSA 1VRTA 1D5AA 1QQCA 3T1AA 1WSEA 4OKEA 1U47A 3RWUA 1NOZA 4KAZA 3AVFA 3AV9A 4FJGA 2QXFA 4DQQA 1RDBA 3QINA 4CIEA 3OYCA 4B9MA 4F8RA 3K5OA 3V1RA 4KKOA 3LZJA 4FJMA 2KQ2A 1C1CA 4AILC 4FZXC 4N76A 4N41A 5KGWA 3SYZA 3VQQA 4AHVA 4G1QA 4NCGA 2ATQA 3C6UA 4CK2A 4E1NA 4OPKA 3ULDA 3SUPA 1X9WA 3U3YA 4DSIA 4K8XA 2D0BA 1ASUA 1Q8IA 4N56A 3OJSA 3L8BA 4DSEA 4ZHRA 2B5JA 2D0CA 3U3GA 1RTIA 2IOCA 4DS5A 5J2PA 1TK5A 4IG3A 3SUOA 3DLBA 1REVA 5FDLA 3B6OA 1B9FA 2P51A 4CJUA 4M41A 4E1MA 3PO4A 4Y1DA 1IKWA 4HCCA 3ZSYA 4B8AB 2OPSA 5KRSA 1NJXA 2OPQA 5KTQA 3I8DA 4KHUA 2GBZA 1JLAA 2B6AA 1HRHA 1IH7A 1KLMA 1WNSA 3WNGA 3KIOA 4RW6A 1RILA 1RT5A 3KLGA 3HPGA 5FROA 1C0TA 3NCIA 3MXIA 1LWFA 3TAMA 4KFBA 1L3UA 1NK4A 3BDPA 4FJLA 2Z1JA 4M3TA 4DTXA 1J53A 3HK2A 1XHZA 4B8CA 5J2MA 2HHXA 4HVJA 3QNOA 4KB0A 4IFYA 3IRXA 3LALA 4M3ZA 1TVRA 1VSDA 3VQBA 4AHCA 4BE0A 5I3UA 4Z4EA 1Y97A 4DFMA 2PYJA 3OY9A 4FJ9A 4FM1A 4M42A 2P1JA 2Q3SA 1A5VA 1VSKA 1RT6A 2RF2A 4DLGA 4JS4A 1T7PA 4M3WA 3M8QA 1U45A 1BGXT 1JLFA 1RTJA 1TAQA 1X1PA 3DOKA 4H8KA 5DMRA 1RT1A 3DLGA 5KI6A 3SUQA 1NK8A 4Z4FA 1LAWA 4CECA 4N5SA 4CJVA 1HNVA 4KHQA 4PY5A 1JKHA 3HO1A 4B9TA 3AO3A 1D8YA 4DFJA 5I42A 4B3OA 3I0RA 3VN5A 4CK3A 3KKRA 4CFBA 1WSJA 3PX6A 5CZ2A 2HHQA 2VG7A 3DM2A 1HNIA 3LDSA 4CCHA 2IS3A 2XHBA 4DSJA 3PO5A 3AVJA 1DTQA 1IG9A 3QESA 2ETJA 2DFEA 1WLJA 4DTUA 3THVA 2G8UA 4EP4A 5FRMA 4DTSA 2VWJA 3NF6A 3L2WA 2HHSA 1VSIA 5HRRA 2KZZA 3M8PA 1YTAA 4OKJA 3HYFA 2G8HA 1BL3A 2KFNA 4OJRA 3HP6A 1L3VA 3L3UA 4NCAA 1JLGA 2FC0A 4DSLA 4O44A 4FM0A 3SI6A 4CF9A 2OZSA 3C6TA 3O4NA 1BI4A 3L3VA 4ZTJA 1ITGA 4DTJA 1TGOA 3RRHA 3PX0A 1S1UA 3NAEA 2YHAA 3ZT4A 3E01A 1SL0A 4YFUA 3CFOA 2OA8A 2QKBA 1C1BA 5E41A 3TAEA 1D9DA 4FLUA 1L3SA 3DLEA 4GVMA 1XC9A 2YNFA 1TK8A 3NFAA 4RW7A 1XHXA 3HSTB 3H08A 1XWLA 3PUFA 3AA3A 3AO5A 1WSFA 4FJ8A 4B08A 1TKDA 2HNZA 3DI6A 4BE1A 4CERA 4CEFA 4C8OA 1RCHA 3CM6A 3OYAA 2YHBA 3KLHA 1XI1A 2A1RA 3CFPA 1Q9XA 1G15A 1I3AA 3RR8A 5JS2A 3LPUA 3NDKA 4CJRA 1VSMA 2X6NA 1RDCA 3MEEA 3VQEA 3V9XA 1CXUA 2X78A 3PV8A 1GOBA 1RT3A 2JGUA 3TARA 3AVCA 3SV3A 1LAVA 3HM9A 3AVHA 4C8MA 1YVUA 3NH2A 3K5NA 4E7JA 1U49A 4CJWA 1J9AA 4FLWA 3SNNA 2HNDA 1SV5A 3KLIA 2EX3A 2HHVA 3RRGA 3C95A 3UIQA 4Z4CA 4KTQA 4FYDA 4BACA 3ASMA 4OVLA 3VQ5A 3K58A 3VA3A 2KFZA 3AVKA 4I9QA 4DTOA 3DYAA 2VG6A 1RNHA 1TV6A 4KTZA 2R7YA 2G8FA 3TABA 1IKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O4G A;  1LW0 A;  3OJU A;  1LW2 A;  4JRP A;  3OS1 A;  3MXJ A;  4KV8 A;  3AVA A;  4CJK A;  3L2U A;  5CYM A;  4CGI A;  4I9L A;  3OYD A;  1A5X A;  3V4I A;  4M3U A;  3VQ4 A;  4XIU A;  4J2B A;  1RT4 A;  4FW2 A;  3ISN C;  3DRS A;  3LAN A;  1SUQ A;  3QEX A;  1UA0 A;  1U48 A;  4CHY A;  3ZSW A;  4GW6 A;  3LPT A;  4JS5 A;  4DSF A;  3S3N A;  1J5O A;  2KW4 A;  3RR7 A;  4EZ6 A;  3KK3 A;  4IKF A;  1FXX A;  1JLE A;  3OS2 A;  3L2Q A;  1BIU A;  3ZCM A;  1R0A A;  3OYH A;  4RW8 A;  2XRI A;  3CM5 A;  3KLF A;  3S3M A;  3LP2 A;  1RBT A;  3ZT3 A;  3SCX A;  3KKS A;  1KRP A;  4Z4I A;  1RTD A;  4O0J A;  3HT3 A;  1L5U A;  5CZ1 A;  3AO2 A;  3VQD A;  3WNE A;  4ELV A;  4IG0 A;  3DRR A;  3NH1 A;  3K5L A;  1CXQ A;  1GOA A;  3WNF A;  4DFK A;  1CZB A;  4O5B A;  1LWE A;  4WE1 A;  1TL1 A;  3TAG A;  1QHT A;  2KZM A;  5JS1 A;  1BIZ A;  4QCL A;  4CHQ A;  1KVC A;  4RW4 A;  4E7H A;  3EYZ A;  3M8R A;  1S1X A;  4LSN A;  4FCY A;  4DU3 A;  2G8K A;  3TWH A;  4KI6 A;  4UQG A;  4DTN A;  4LSL A;  4M3R A;  4K8Z A;  3OYN A;  3BGR A;  4B9U A;  1HYV A;  4FJX A;  1MU2 A;  3SZ2 A;  2G8I A;  3MEG A;  1ZBH A;  4BDZ A;  4LH4 A;  2IDO A;  1JL2 A;  5HLF A;  4CJ5 A;  4CGF A;  4Q0B A;  3QNN A;  4KHN A;  3JSM A;  4N47 A;  3LAM A;  4M3X A;  1BQM A;  4OLB A;  3K5M A;  3DLH A;  4FZY A;  1IO2 A;  4RW9 A;  3VA0 A;  2KTQ A;  4EP5 A;  4W5R A;  1GOC A;  1S1W A;  4CF0 A;  3TAF A;  4CF1 A;  5EU7 A;  1IKY A;  4NYF A;  5HP1 A;  4DTP A;  3MEC A;  2YKM A;  2F8T A;  2HHT A;  5J2N A;  3HPH A;  4PUO A;  3SQ0 A;  1LWC A;  4HUG A;  4CGG A;  3O4Q A;  3OYK A;  4CF2 A;  3M8S A;  3LZI A;  1NK9 A;  2DFF A;  1VSF A;  4E89 A;  4DSK A;  3I0S A;  3L2R A;  1BCO A;  1Z26 A;  1Q9Y A;  4ELU A;  2HVH A;  4W5N A;  4LD0 A;  4FXD A;  1TAU A;  1B92 A;  5K14 A;  4CEZ A;  1BCM A;  4DG1 A;  4FLV A;  3VQ8 A;  1QSS A;  4KB1 A;  3NF9 A;  3LWL A;  1U04 A;  3MAQ A;  2X6S A;  2ZE2 A;  2D0A A;  2HB5 A;  2XY7 A;  1VSL A;  4I7F A;  3KTQ A;  4HUF A;  1VK0 A;  4AH9 A;  4KI4 A;  4J2E A;  2X74 A;  4OKK A;  2RKI A;  3P1G A;  4AHU A;  4FVM A;  3AO1 A;  3V6D A;  1KFS A;  4E7K A;  1FKO A;  1WN7 A;  3HL8 A;  2G8W A;  2HHW A;  4DQR A;  4NYN A;  3QER A;  3SQ4 A;  1BI4 B;  3NBP A;  4F4K A;  1HYZ A;  5CYQ A;  3L2V A;  4CED A;  2HVI A;  1QE1 A;  2WON A;  3K2P A;  3EZ5 A;  1JLQ A;  3RMD A;  3KK1 A;  1JLC A;  3VQA A;  1T03 A;  1NKE A;  2OPR A;  4PWD A;  4LH5 A;  4CK1 A;  3SUN A;  3D0P A;  2F96 A;  2IGI A;  2OYQ A;  1UOC A;  1WSH A;  3B6P A;  3QEI A;  4C8K A;  3NHG A;  3VQ9 A;  3ZSR A;  2EHG A;  4CJ3 A;  1S6Q A;  2XO7 A;  1ZBU A;  4CFC A;  3DLR A;  2PY5 A;  3QEW A;  3OYB A;  2XY6 A;  3AA2 A;  3TR8 A;  1YTU A;  3V81 A;  2Z1G A;  3G10 A;  1BHL A;  5HRO A;  3TAQ A;  1LV5 A;  1QTM A;  2I5J A;  4C8L A;  4L8R B;  2E6L A;  3ZT0 A;  2QK9 A;  2YV0 X;  3QLH A;  1J54 A;  1VRU A;  3OVN A;  3NE6 A;  3T3F A;  2HNY A;  3AVG A;  5HBM A;  3QET A;  2Z1H A;  1VSE A;  1NKB A;  3DMJ A;  1EXQ A;  3VQC A;  4Z0U A;  4FJJ A;  1TL3 A;  3PY8 A;  1HQU A;  1RDD A;  2Y1I A;  4FZZ A;  4HUE A;  4ID1 A;  3O3F A;  4CE9 A;  4CES A;  1C1A A;  4CEE A;  4CF8 A;  3JYT A;  2XY8 A;  3EY1 A;  4FK4 A;  4PQU A;  4DU4 A;  4NCB A;  1W0H A;  3P5J A;  1SKS A;  2G8V A;  2GV9 A;  1UAX A;  4I2P A;  4HHT A;  1TK0 A;  4DLE A;  4MFB A;  3ZSQ A;  4ID5 A;  1DLO A;  3KD5 E;  1RTH A;  1JLB A;  4ZTF A;  3SPY A;  4CEQ A;  3OYJ A;  3KK2 A;  3V9W A;  1CLQ A;  1Z25 A;  1ZBL A;  4KRF A;  3IG1 A;  4CGJ A;  2DFH A;  3S9H A;  2FBV A;  4CHZ A;  3QIP A;  4CFD A;  5KRT A;  1SKR A;  1NK6 A;  4CJT A;  2OPP A;  4FLY A;  4HTU A;  3IS9 A;  4B9N A;  4FJK A;  3RMA A;  1L3T A;  4B9V A;  3LP0 A;  2PZS A;  5J1E A;  1S6P A;  3AVM A;  2FBX A;  1RT7 A;  4O0I A;  1C6V A;  3T19 A;  3V1Q A;  1EP4 A;  1S9G A;  4M3Y A;  3LP3 A;  4CJL A;  3OYI A;  2F8S A;  3OYL A;  1W9H A;  3AO4 A;  2BDP A;  1HYS A;  3KLE A;  3AVL A;  4DFP A;  1NK5 A;  4DWI A;  4CHO A;  2XY5 A;  3RMC A;  4KHS A;  3G0Z A;  4IBN A;  4BWJ A;  5KGX A;  2PYL A;  1B9D A;  1RDA A;  4FK2 A;  3DLK A;  2NUB A;  1KLN A;  3VQ6 A;  4FJI A;  3AA5 X;  4W5Q A;  4QAG A;  1HPZ A;  4C8N A;  4CEO A;  4FK0 A;  2QKK A;  1BIS A;  1TKZ A;  4CEA A;  4KPY A;  5DK5 A;  4CEB A;  5D3G A;  4AHR A;  4Z4H A;  2BE2 A;  1QSY A;  1K6Y A;  1KVA A;  4BDY A;  3ALY A;  1N5Y A;  2JLE A;  4E7I A;  2DTU A;  1KCF A;  1VSJ A;  1RT2 A;  5HRP A;  2Z1I A;  4OGC A;  1U4B A;  2IAJ A;  2WOM A;  4CJF A;  5HRN A;  3CFR A;  2RN2 A;  3U6F A;  4CJQ A;  1S9E A;  4E3S A;  5FRN A;  1UA1 A;  4BDP A;  1BQN A;  2E4L A;  5CY4 A;  4FLT A;  4DTM A;  4DF4 A;  3AVB A;  1S1V A;  3QIO A;  3OS0 A;  4AHT A;  4YNQ A;  1WSI A;  3RMB A;  1DTT A;  5HRS A;  2W42 A;  1NOY A;  4KRE A;  4IDK A;  1X9M A;  1D9F A;  4CJS A;  3NH0 A;  3V9S A;  1FKP A;  3ZSX A;  1QS4 A;  2D5R A;  3OYE A;  3CYM A;  4DU1 A;  1C0U A;  1JL1 A;  4CJ4 A;  3SQ1 A;  3S3O A;  4CHP A;  3F9K A;  3ZSV A;  4FW1 A;  1NJW A;  4DTR A;  4DMN A;  4F2S A;  1TKT A;  3P83 D;  4CGH A;  4CJE A;  5SWM A;  1NK0 A;  3C94 A;  4DQI A;  3CG7 A;  4OLA A;  3ZSZ A;  2FBT A;  4CJP A;  4J2D A;  5T7B A;  3HVR A;  1A5W A;  1EKE A;  4E0D A;  4O4G A;  3NF7 A;  5J2Q A;  3NGI A;  2YNI A;  4KO0 A;  1F21 A;  2AJQ A;  1RBU A;  4JRQ A;  4H4O A;  1FK9 A;  3VQ7 A;  1KVB A;  4KHY A;  3HP9 A;  4Q5V A;  3FFI A;  3TAP A;  4F3O A;  2ITG A;  4IFV A;  4FJ5 A;  2P5G A;  4AHS A;  1CZ9 A;  1JXB A;  2LSN A;  3SJJ A;  3HJF A;  5C24 A;  1X9S A;  3LWM A;  3IAY A;  4J2A A;  2VWK A;  1KFD A;  3PX4 A;  1UWB A;  3HPO A;  2BGG A;  2ZD1 A;  4W5O A;  3AVI A;  3OYG A;  2E6M A;  4CHN A;  3ZT2 A;  3CQ8 A;  1NJZ A;  4KHW A;  4EZ9 A;  2HHU A;  1RBS A;  1HJR A;  3NGY A;  2BAN A;  2IC3 A;  4JLH A;  3F73 A;  4CGD A;  4QOZ B;  4FLZ A;  3QEP A;  1RBV A;  1WSG A;  3D45 A;  3VQP A;  4TSX A;  3KJV A;  3DOL A;  1TKX A;  3SQ2 A;  3SPZ A;  3TI0 A;  4FJH A;  2O4I A;  5SZT A;  4DQP A;  2OZM A;  3LP1 A;  4FM2 A;  4DS4 A;  2YNG A;  4PA1 A;  2A1S A;  4W5T A;  3TAN A;  3A2F A;  1HMV A;  3NF8 A;  4KTW A;  3WNH A;  3V9U A;  1S1T A;  3MED A;  1ZYQ A;  4F3T A;  1KTQ A;  2ZQB A;  3K57 A;  2HMI A;  2P5O A;  3DRP A;  2FBY A;  4MQ3 A;  2YKN A;  1HQE A;  2VG5 A;  4R5P A;  3HVT A;  3O3H A;  4ELT A;  4FJN A;  1EET A;  3O3G A;  4B9S A;  4CIG A;  3NGZ A;  1YT3 A;  1T8E A;  1N6Q A;  1VSH A;  3OYF A;  4ICL A;  4E19 A;  4B9L A;  1T05 A;  1S5J A;  2B4J A;  3V1O A;  3K59 A;  4BWM A;  4BE2 A;  3AVN A;  2Y1J A;  3MXM A;  1ASV A;  3RTV A;  3QEV A;  4DF8 A;  3ZSO A;  1KSP A;  1JXE A;  4GMJ B;  4OPJ A;  1NJY A;  2RPI A;  1WAJ A;  5C42 A;  4OGE A;  4HCB A;  2GUI A;  4FJ7 A;  1I39 A;  1RBR A;  4LY7 A;  1ZBF A;  1ASW A;  4M45 A;  1C0M A;  3OYM A;  1EX4 A;  4H4M A;  3AA4 A;  3HXM A;  3QO9 A;  1QSL A;  5C25 A;  2YNH A;  1SKW A;  1O1W A;  1WAF A;  4Z4G A;  2HW3 A;  1IKV A;  3LAK A;  4RG8 A;  3SV4 A;  4Y1C A;  4O55 A;  3KD1 E;  4CFA A;  4F2R A;  3V9Z A;  1ZBI A;  4E7L A;  1SL1 A;  1NKC A;  2DY4 A;  4I2Q A;  4FLX A;  1SL2 A;  3ZT1 A;  1NK7 A;  3ITH A;  4CIF A;  4DQS A;  1VRT A;  1D5A A;  1QQC A;  3T1A A;  1WSE A;  4OKE A;  1U47 A;  3RWU A;  1NOZ A;  4KAZ A;  3AVF A;  3AV9 A;  4FJG A;  2QXF A;  4DQQ A;  1RDB A;  3QIN A;  4CIE A;  3OYC A;  4B9M A;  4F8R A;  3K5O A;  3V1R A;  4KKO A;  3LZJ A;  4FJM A;  2KQ2 A;  1C1C A;  4AIL C;  4FZX C;  4N76 A;  4N41 A;  5KGW A;  3SYZ A;  3VQQ A;  4AHV A;  4G1Q A;  4NCG A;  2ATQ A;  3C6U A;  4CK2 A;  4E1N A;  4OPK A;  3ULD A;  3SUP A;  1X9W A;  3U3Y A;  4DSI A;  4K8X A;  2D0B A;  1ASU A;  1Q8I A;  4N56 A;  3OJS A;  3L8B A;  4DSE A;  4ZHR A;  2B5J A;  2D0C A;  3U3G A;  1RTI A;  2IOC A;  4DS5 A;  5J2P A;  1TK5 A;  4IG3 A;  3SUO A;  3DLB A;  1REV A;  5FDL A;  3B6O A;  1B9F A;  2P51 A;  4CJU A;  4M41 A;  4E1M A;  3PO4 A;  4Y1D A;  1IKW A;  4HCC A;  3ZSY A;  4B8A B;  2OPS A;  5KRS A;  1NJX A;  2OPQ A;  5KTQ A;  3I8D A;  4KHU A;  2GBZ A;  1JLA A;  2B6A A;  1HRH A;  1IH7 A;  1KLM A;  1WNS A;  3WNG A;  3KIO A;  4RW6 A;  1RIL A;  1RT5 A;  3KLG A;  3HPG A;  5FRO A;  1C0T A;  3NCI A;  3MXI A;  1LWF A;  3TAM A;  4KFB A;  1L3U A;  1NK4 A;  3BDP A;  4FJL A;  2Z1J A;  4M3T A;  4DTX A;  1J53 A;  3HK2 A;  1XHZ A;  4B8C A;  5J2M A;  2HHX A;  4HVJ A;  3QNO A;  4KB0 A;  4IFY A;  3IRX A;  3LAL A;  4M3Z A;  1TVR A;  1VSD A;  3VQB A;  4AHC A;  4BE0 A;  5I3U A;  4Z4E A;  1Y97 A;  4DFM A;  2PYJ A;  3OY9 A;  4FJ9 A;  4FM1 A;  4M42 A;  2P1J A;  2Q3S A;  1A5V A;  1VSK A;  1RT6 A;  2RF2 A;  4DLG A;  4JS4 A;  1T7P A;  4M3W A;  3M8Q A;  1U45 A;  1BGX T;  1JLF A;  1RTJ A;  1TAQ A;  1X1P A;  3DOK A;  4H8K A;  5DMR A;  1RT1 A;  3DLG A;  5KI6 A;  3SUQ A;  1NK8 A;  4Z4F A;  1LAW A;  4CEC A;  4N5S A;  4CJV A;  1HNV A;  4KHQ A;  4PY5 A;  1JKH A;  3HO1 A;  4B9T A;  3AO3 A;  1D8Y A;  4DFJ A;  5I42 A;  4B3O A;  3I0R A;  3VN5 A;  4CK3 A;  3KKR A;  4CFB A;  1WSJ A;  3PX6 A;  5CZ2 A;  2HHQ A;  2VG7 A;  3DM2 A;  1HNI A;  3LDS A;  4CCH A;  2IS3 A;  2XHB A;  4DSJ A;  3PO5 A;  3AVJ A;  1DTQ A;  1IG9 A;  3QES A;  2ETJ A;  2DFE A;  1WLJ A;  4DTU A;  3THV A;  2G8U A;  4EP4 A;  5FRM A;  4DTS A;  2VWJ A;  3NF6 A;  3L2W A;  2HHS A;  1VSI A;  5HRR A;  2KZZ A;  3M8P A;  1YTA A;  4OKJ A;  3HYF A;  2G8H A;  1BL3 A;  2KFN A;  4OJR A;  3HP6 A;  1L3V A;  3L3U A;  4NCA A;  1JLG A;  2FC0 A;  4DSL A;  4O44 A;  4FM0 A;  3SI6 A;  4CF9 A;  2OZS A;  3C6T A;  3O4N A;  1BI4 A;  3L3V A;  4ZTJ A;  1ITG A;  4DTJ A;  1TGO A;  3RRH A;  3PX0 A;  1S1U A;  3NAE A;  2YHA A;  3ZT4 A;  3E01 A;  1SL0 A;  4YFU A;  3CFO A;  2OA8 A;  2QKB A;  1C1B A;  5E41 A;  3TAE A;  1D9D A;  4FLU A;  1L3S A;  3DLE A;  4GVM A;  1XC9 A;  2YNF A;  1TK8 A;  3NFA A;  4RW7 A;  1XHX A;  3HST B;  3H08 A;  1XWL A;  3PUF A;  3AA3 A;  3AO5 A;  1WSF A;  4FJ8 A;  4B08 A;  1TKD A;  2HNZ A;  3DI6 A;  4BE1 A;  4CER A;  4CEF A;  4C8O A;  1RCH A;  3CM6 A;  3OYA A;  2YHB A;  3KLH A;  1XI1 A;  2A1R A;  3CFP A;  1Q9X A;  1G15 A;  1I3A A;  3RR8 A;  5JS2 A;  3LPU A;  3NDK A;  4CJR A;  1VSM A;  2X6N A;  1RDC A;  3MEE A;  3VQE A;  3V9X A;  1CXU A;  2X78 A;  3PV8 A;  1GOB A;  1RT3 A;  2JGU A;  3TAR A;  3AVC A;  3SV3 A;  1LAV A;  3HM9 A;  3AVH A;  4C8M A;  1YVU A;  3NH2 A;  3K5N A;  4E7J A;  1U49 A;  4CJW A;  1J9A A;  4FLW A;  3SNN A;  2HND A;  1SV5 A;  3KLI A;  2EX3 A;  2HHV A;  3RRG A;  3C95 A;  3UIQ A;  4Z4C A;  4KTQ A;  4FYD A;  4BAC A;  3ASM A;  4OVL A;  3VQ5 A;  3K58 A;  3VA3 A;  2KFZ A;  3AVK A;  4I9Q A;  4DTO A;  3DYA A;  2VG6 A;  1RNH A;  1TV6 A;  4KTZ A;  2R7Y A;  2G8F A;  3TAB A;  1IKX A; 
#chains in the Genus database with same CATH topology
 3BEX A;  3OJU A;  1LW2 A;  4JRP A;  4DV5 K;  5CYM A;  4I9L A;  3VQ4 A;  4FW2 A;  4JN4 A;  5AQW A;  1R59 O;  2EWS A;  3ZSW A;  2KW4 A;  4X62 K;  1QQM A;  1BO5 O;  3LP2 A;  1RBT A;  3VTI A;  3ZT3 A;  3KKS A;  4Z4I A;  4O0J A;  3HT3 A;  3MN9 A;  1CXQ A;  4DFK A;  1CZB A;  4LFB K;  2Q1N A;  3M6G A;  2W40 A;  1QHT A;  3QFP A;  1KVC A;  4E7H A;  4B3R K;  3EYZ A;  3M8R A;  2G8K A;  4LSL A;  3CCR N;  4JK7 A;  3BGR A;  1VQM N;  1MU2 A;  2VWB A;  3MEG A;  4BDZ A;  1WBB A;  3JSM A;  3LAM A;  3HSC A;  4H5W A;  2WTU A;  4OLB A;  3K5M A;  4FZY A;  4A62 A;  2VQF K;  4GV3 A;  1S1W A;  2O8C A;  4QS8 A;  5AR0 A;  5EU7 A;  2F8T A;  4B1W B;  3J7A P;  1NGD A;  3RSE A;  3HRG A;  3HPH A;  4PUO A;  4IEI A;  4HUG A;  4CGG A;  3O4Q A;  4DR1 K;  3M8S A;  4DV4 K;  1NK9 A;  2DFF A;  5BRE A;  4DSK A;  2A6A A;  3I0S A;  1RFQ A;  2Q31 A;  4AF1 A;  4FXD A;  4BRQ A;  1XQS C;  3GDQ A;  4F9O A;  4FLV A;  4XH5 A;  2D0A A;  1VSL A;  1YJW N;  4B3O A;  4J2E A;  2X74 A;  4DKW A;  4AHU A;  1LOT B;  4FVM A;  4BRL A;  1FKO A;  1WN7 A;  2G8W A;  3QER A;  4CD3 A;  3K2P A;  4DV0 K;  3RVC A;  2OPR A;  4PWD A;  1GLB G;  4CK1 A;  5LY3 A;  1XMQ K;  3NHG A;  2PY5 A;  2QM1 A;  2XY6 A;  3W3D A;  2VGN A;  1BHL A;  1LV5 A;  1QTM A;  3TTD A;  4L8R B;  3VES A;  3ZT0 A;  2QK9 A;  3OVN A;  3GOI A;  1VQO N;  5E26 A;  2QWL A;  4JI4 K;  5HBM A;  4DV3 K;  3H1V X;  4ISG A;  4BGA A;  1HNW K;  1HQU A;  3SLC A;  4AQY K;  2Y1I A;  3G25 A;  4CE9 A;  5JMV A;  4CZH A;  3EY1 A;  4FK4 A;  4DU4 A;  4NCB A;  4JK9 A;  4I2P A;  5HOO A;  4HHT A;  3D6R A;  3MX2 A;  3SPY A;  4CEQ A;  2QWQ A;  1CLQ A;  3IG1 A;  4CGJ A;  1NG9 A;  1NK6 A;  4CJT A;  5A2Q O;  1VQP N;  4B9N A;  3RMA A;  1L3T A;  4DUZ K;  3HTV A;  5J1E A;  2FBX A;  3MWT A;  1HR0 K;  1S9G A;  3LP3 A;  4CJL A;  2F8S A;  3AO4 A;  1E4G T;  2BDP A;  4OO1 J;  4NO7 A;  1NK5 A;  2XY5 A;  4HTL A;  4BWJ A;  2UXB K;  4BRO A;  5KGX A;  1YJN N;  4FK2 A;  2D0P A;  5KPZ A;  4W5Q A;  1GLL O;  3D2F A;  4CEO A;  3VPZ A;  5DK5 A;  4AHR A;  4Z4H A;  1K6Y A;  3LDO A;  4BDY A;  1BA1 A;  5AQY A;  1U6Z A;  4OGC A;  3ZET A;  4JYA K;  2RN2 A;  4CJQ A;  5AQT A;  1S9E A;  2HMP A;  1KXP A;  3MN7 A;  4BDP A;  2E4L A;  5LJW A;  3NMU A;  3AVB A;  1S1V A;  3QIO A;  2W42 A;  3CCS N;  4CJS A;  4H0P A;  1FKP A;  3SQ1 A;  3S3O A;  3CD6 N;  4DTR A;  4F2S A;  4X65 K;  5BN8 A;  3P83 D;  4CJE A;  4J2D A;  3CC4 N;  3FGU A;  3C6A A;  2YNI A;  4GKJ K;  2P9L B;  3VQ7 A;  3HP9 A;  5AQO A;  2BUP A;  4BC5 A;  2ITG A;  2P5G A;  5IWA K;  4DHY A;  1X9S A;  3LWM A;  1KFD A;  3PX4 A;  3HPO A;  3AVI A;  2VQE K;  1NJZ A;  4L3Q A;  4CHN A;  4EZ9 A;  2P9K B;  4CGD A;  4QOZ B;  2JWL A;  3QEP A;  4NCA A;  3D45 A;  4TSX A;  3SQ2 A;  3TI0 A;  1WB9 A;  3CJ1 A;  4DQP A;  3TU5 A;  4PL8 A;  2OZM A;  3VGM A;  4FM2 A;  2YNG A;  4PA1 A;  3SK3 A;  5M1O A;  2OTL N;  3DRP A;  2FBY A;  4MQ3 A;  2YKN A;  3THW A;  3HVT A;  3I8B A;  4ELT A;  1EET A;  1N6Q A;  3I33 A;  3OYF A;  3TTF A;  5GAH P;  5FLX O;  1ASV A;  3RTV A;  3QEV A;  3ZSO A;  1KSP A;  1GLE G;  4GMJ B;  2RPI A;  2QWM A;  3WUH A;  3LDQ A;  4FJ7 A;  2ZJQ L;  1ASW A;  4LF6 K;  1J6Z A;  3ATV A;  1QSL A;  5C25 A;  1SKW A;  1O1W A;  3LAK A;  3O80 A;  3JXU A;  2D4W A;  4DUY K;  3SV4 A;  4DV7 K;  4O8U A;  4IXC A;  4JI0 K;  4F2R A;  2F9T A;  3A5M C;  3ITH A;  3OA9 A;  2JWK A;  4K42 A;  3T1A A;  1D5A A;  1QQC A;  3RWU A;  3HO1 A;  1U47 A;  1NOZ A;  2QXF A;  4CD1 A;  3CCM N;  4CIE A;  4B9M A;  3K5O A;  1Q81 O;  3V1R A;  5M1N A;  2KQ2 A;  4AIL C;  4N76 A;  4N41 A;  4OPH A;  3LDN A;  3CJ9 A;  4AHV A;  3P38 A;  4CK2 A;  3ULD A;  3SUP A;  3WEE B;  1X9W A;  1Q82 O;  4BY9 C;  3EE9 A;  3L8B A;  2B5J A;  2D0C A;  3U3G A;  1TK5 A;  2QA4 N;  3SUO A;  3E1Y A;  3WXI A;  1REV A;  4YOV A;  1VQ6 N;  4CJU A;  4M41 A;  1HPM A;  2KLA A;  2OPS A;  2QWO A;  1W97 L;  2YCH A;  2B6A A;  1HRH A;  1KLM A;  1WNS A;  4RW6 A;  4BRM A;  4BC4 A;  4NXN K;  3KLG A;  4H0V B;  3JAM O;  1C0T A;  3SBT A;  3VEY A;  4WQ5 C;  1NK4 A;  4FJL A;  1HKC A;  4HVJ A;  1HUX A;  4IFY A;  1IG8 A;  4Z4E A;  1EWQ A;  4PL7 A;  1A5V A;  2RF2 A;  4M3W A;  1X1P A;  4O5F A;  3SUQ A;  3DLG A;  4CEC A;  3VF6 A;  4CJV A;  4KHQ A;  3AO3 A;  5CE3 A;  2NRV A;  4CK3 A;  2WC9 A;  4CFB A;  3BUZ B;  4JI7 K;  1NGH A;  5I9E B;  4A5B A;  4IO8 A;  3VGK A;  3LDS A;  1YIJ N;  1BG3 A;  2IS3 A;  4H5T A;  4CCH A;  1SAZ A;  5JIC A;  1DTQ A;  3QBX A;  4ILJ A;  4C23 A;  4EP4 A;  4DV1 K;  4DTS A;  1SZ2 A;  2Q97 A;  4YOX A;  1YTA A;  3HYF A;  1BL3 A;  1OH6 A;  1RGI A;  4DSL A;  4O44 A;  3SI6 A;  3O4N A;  4QS7 A;  4DR6 K;  4B1V A;  4LFA K;  1TGO A;  3HOT A;  3PX0 A;  4DV2 K;  3NAE A;  5ELZ A;  1SL0 A;  4YFU A;  5E41 A;  1D9D A;  1E4F T;  3CCU N;  1TK8 A;  1XC9 A;  4YDU C;  3AA3 A;  2A42 A;  2NZT A;  1TKD A;  5E84 A;  4JKC A;  4BE1 A;  1MDU B;  1YF5 L;  2O8E A;  4DQ8 A;  4Z94 A;  1XI1 A;  2KKZ A;  4CZL A;  3CFP A;  1Q9X A;  2GUP A;  4LF7 K;  1G15 A;  1I3A A;  3LPU A;  3NDK A;  3SBG A;  2X6N A;  3VQE A;  4EIA A;  1RDW X;  5M1K A;  3TAR A;  3WQT A;  1IBL K;  4BR7 A;  3SV3 A;  1YVU A;  1U49 A;  4NLC A;  1HKB A;  3QBW A;  2E5L K;  2UYT A;  3ULE B;  3KLI A;  4KTQ A;  3KWG A;  3VA3 A;  1T3V A;  4DTO A;  4WQ5 A;  5AFU H;  3VER A;  2R7Y A;  2YHW A;  3TAB A;  4B8C A;  2O4G A;  1LW0 A;  3OS1 A;  3THX B;  4KV8 A;  4CJK A;  3AVA A;  4YOT A;  4CGI A;  4XEI A;  4M3U A;  1BU6 O;  4FWL A;  3DXM B;  3LAN A;  1UA0 A;  1NGE A;  1U48 A;  4GW6 A;  3KK3 A;  1FXX A;  3L2Q A;  1R0A A;  3ZCM A;  3OYH A;  3S3M A;  1RTD A;  1L5U A;  3C7N B;  3VQD A;  3BP8 A;  2QXL A;  1NWK A;  4O5B A;  2NRR A;  4WE1 A;  2CH5 A;  3QFU A;  2KZM A;  3KK7 A;  1HLU A;  4X66 K;  3CQX A;  4CHQ A;  3TSQ A;  3TWH A;  2CGJ A;  3OYN A;  1QVG M;  1HYV A;  4C1N I;  2A41 A;  1ZBH A;  4H5R A;  5C0Y A;  2O8F A;  4MDB A;  4DCH A;  4BQL A;  4RCH A;  4CJ5 A;  1ATS A;  3HBT A;  1GLD G;  2GEL A;  3AY9 A;  1BQM A;  2I7N A;  3JS6 A;  4WQ4 A;  4JI5 K;  3VA0 A;  2KTQ A;  4EP5 A;  4W5R A;  4CF0 A;  4CF1 A;  3VEW A;  3RSE B;  1KAY A;  2HHT A;  3MEC A;  4FWK A;  2Q36 A;  4YDU A;  3SQ0 A;  1LWC A;  2QEX N;  2QTD A;  4FPA A;  4E89 A;  4BRE A;  1Z26 A;  4BR2 A;  4ELU A;  1JCG A;  2W6L A;  2HVH A;  4KH4 A;  4W5N A;  1TAU A;  1QSS A;  3SMS A;  1GLJ O;  4KB1 A;  3LWL A;  1U04 A;  2HB5 A;  4CZG A;  2IVO A;  4HUF A;  1VK0 A;  4AH9 A;  1DEJ A;  4KI4 A;  4PKI A;  3I55 N;  4DQR A;  3SQ4 A;  4MO4 A;  1HYZ A;  1T03 A;  3ID8 A;  3Q7C A;  3SUN A;  2F96 A;  3GL1 A;  5EY4 A;  3B6P A;  3QEI A;  1S6Q A;  2XO7 A;  1ZBU A;  3ZEU A;  3J81 O;  1Q18 A;  3OYB A;  3TR8 A;  1YTU A;  3V81 A;  3TAQ A;  1NGA A;  4C8L A;  3QLH A;  1J54 A;  2IVP A;  3NE6 A;  3UE5 A;  2Z1H A;  2NRT A;  1NKB A;  1EXQ A;  2NRW A;  4FJJ A;  3I56 N;  4AM7 A;  4BC3 A;  4FZZ A;  4PKH A;  3QIC A;  1MA9 B;  4CES A;  1JJ2 M;  1W0H A;  2E2P A;  3A5L C;  1TK0 A;  4DLE A;  4CVN E;  1TYQ A;  5B8H A;  3KD5 E;  1RTH A;  4ZTF A;  3OYJ A;  3V9W A;  1Z25 A;  3FE1 A;  1ZBL A;  4KRF A;  4CHZ A;  5KRT A;  3AAQ A;  3CQY A;  3CPE A;  1X3N A;  1N8R O;  1RT7 A;  4BRP A;  3G4S N;  1S22 A;  3T19 A;  1EP4 A;  3KVG A;  4FWO A;  2CGL A;  3OYI A;  3OYL A;  1HYS A;  3AVL A;  4DFP A;  4DWI A;  4KHS A;  4ISE A;  4IBN A;  5AZJ B;  3FZH A;  1RDA A;  4QS9 A;  3DLK A;  1KLN A;  4FJI A;  1D4X A;  2YI1 A;  5AQR A;  5AQN A;  5AQJ A;  2QKK A;  4KPY A;  4CEA A;  5FPD A;  1K8A O;  3MDQ A;  5AZI A;  4CEB A;  5D3G A;  5DM7 L;  2BE2 A;  3FLC O;  3UKU A;  2H3G X;  5AQZ A;  3IDH A;  5BRH A;  1N5Y A;  1XNQ K;  2E20 A;  2J4R A;  3ZET B;  1RT2 A;  2A5X A;  2IAJ A;  3ATU A;  2HBK A;  2ZWH A;  1HNZ K;  3PSI A;  4YNQ A;  1WSI A;  1EQY A;  1DTT A;  5BPM A;  1GLA G;  4BRC A;  3NH0 A;  3V9S A;  1OVQ A;  1JL1 A;  5AQG A;  1BA0 A;  4FWN A;  5SWM A;  2PAV A;  1YIT N;  1NK0 A;  3C94 A;  1Y64 A;  4OLA A;  3G6E N;  3O8M A;  4CJP A;  2QI2 A;  5GAD P;  3HVR A;  3DAW A;  4O4G A;  3VEX A;  4FPB A;  3NGI A;  1E3M A;  4DB3 A;  2AJQ A;  4JRQ A;  4H4O A;  1FK9 A;  1N32 K;  4CJ7 A;  5GAE P;  5GIO A;  5CHI A;  4F3O A;  4IFV A;  1XMO K;  4ISF A;  1CZ9 A;  3L0Q A;  1QQN A;  1QHA A;  2ZJR L;  2P9S A;  3OYG A;  2E6M A;  3ZT2 A;  4KHW A;  3UKR A;  3F73 A;  4CZJ A;  3N4Q A;  3DOL A;  4RTF D;  3SPZ A;  2E2O A;  1VAZ A;  2A1S A;  1HMV A;  4KTW A;  3WNH A;  3MED A;  1ZYQ A;  5AQF A;  3K57 A;  2HMI A;  3THW B;  2Q0R A;  2F7T A;  3O3G A;  1YT3 A;  3CCV N;  1NLV A;  1VSH A;  4E19 A;  3E9O A;  1T05 A;  3V1O A;  4BE2 A;  2Y1J A;  1DGK N;  3ID6 A;  4DF8 A;  1X3M A;  4OPJ A;  4B3T K;  3H46 O;  2A40 A;  4HCB A;  2GUI A;  3O08 A;  1RBR A;  5F1X A;  4H4M A;  3AA4 A;  3ZLJ A;  4JNE A;  2OAN A;  4RG8 A;  3O9T A;  4Y1C A;  4O55 A;  3KD1 E;  3V9Z A;  1SL1 A;  4I6M B;  4FLX A;  1SL2 A;  5AQV A;  3ZT1 A;  4GV9 A;  4CIF A;  1VQN N;  3SAF A;  1RDB A;  4FSV A;  4F8R A;  5DM6 L;  4FJM A;  1C1C A;  3SYZ A;  2V52 B;  1CZA N;  3SAG A;  3O4W A;  5AQL A;  3C6U A;  4E1N A;  2ASM A;  4K8X A;  2D0B A;  1YI2 N;  1Q8I A;  4DSE A;  3ENB A;  4UY8 O;  2IOC A;  4DS5 A;  4IG3 A;  4OPA A;  4K41 A;  4ILH A;  4B1X B;  3KWI A;  5FDL A;  3B6O A;  4HCC A;  1NJX A;  2OPQ A;  3I8D A;  2GBZ A;  1K8K B;  5AQP A;  1RIL A;  1RT5 A;  1W7A A;  3F5T A;  1NNE A;  5BR8 K;  1LWF A;  3TAM A;  3EKU A;  4OX9 K;  5AQX A;  3OHR A;  3HK2 A;  3VEZ A;  1XHZ A;  2HHX A;  4KB0 A;  3CC2 N;  3IRX A;  4M3Z A;  4H0X B;  1U2V B;  1Y97 A;  2OCE A;  4LFC K;  4IWV A;  3CCJ N;  4FJ9 A;  4FM1 A;  5AJ3 K;  4DLG A;  3EO3 A;  5AQQ A;  1BGX T;  1NJI O;  3M1F A;  4H8K A;  5KI6 A;  4CZI A;  3BF1 A;  1OVY A;  1HNV A;  4PY5 A;  4B9T A;  3DJC A;  1OKJ A;  1D8Y A;  4K0K K;  2VG7 A;  3DM2 A;  1HNI A;  4FWR A;  2XHB A;  2ETJ A;  2YHX A;  4H0O A;  1WLJ A;  4U7B A;  4DTU A;  3THV A;  2G8U A;  5FRM A;  1N34 K;  3VET A;  2VWJ A;  3NF6 A;  2HHS A;  1IBM K;  4JKF A;  4EHT A;  3M8P A;  1EWR A;  4XH4 A;  5AFU A;  2KFN A;  3H6E A;  3L3U A;  1JLG A;  3KZB A;  4FM0 A;  4CF9 A;  3SAH A;  2OZS A;  5LJV A;  4U67 L;  1GLC G;  3RRH A;  3NVM A;  4IOX A;  1HX1 A;  2E1Y A;  4DR5 K;  3T7Z A;  3CFO A;  4JD2 B;  4LC9 B;  1C1B A;  3WXK A;  3U9Z A;  1XHX A;  5F0X A;  3PUF A;  4GNI A;  4FJ8 A;  3CCL N;  3EE8 A;  1WOQ A;  4CEF A;  3E9P A;  3QDK A;  2A1R A;  3LM2 A;  5AQK A;  3A5O C;  4JHD B;  4B9Q A;  1VSM A;  4IOC L;  2X78 A;  2W41 A;  2FF3 B;  1LAV A;  3HM9 A;  2Q0U A;  4FLW A;  5BRF A;  2HHV A;  3RRG A;  1EO1 A;  4OVL A;  4JV5 K;  2P9I B;  3ENH A;  4DR7 K;  4KAZ A;  4FWM A;  3L2U A;  1A5X A;  5M1Q A;  4XIU A;  2HOE A;  4J2B A;  1RT4 A;  2FLO A;  4H5N A;  1RDU A;  1SUQ A;  3QEX A;  4JS5 A;  1VQ4 N;  4DSF A;  3LPT A;  1OH5 A;  1J5O A;  3RR7 A;  4IKF A;  2P9U B;  1JLE A;  3VEN A;  1BIU A;  4RW8 A;  2P9N A;  2XRI A;  3J7Y P;  3EEQ A;  4GY2 B;  3WNE A;  4IG0 A;  3NH1 A;  1H1V A;  4EAH D;  3WNF A;  4YOY A;  1LWE A;  4YOU A;  1BIZ A;  3CJC A;  1S72 N;  2D1K A;  4BRD A;  4IO9 L;  3L6Q A;  5GIP A;  4B3M K;  3N4P A;  3CMA N;  3R8E A;  4B3S K;  3OW2 M;  2G8I A;  3E66 A;  1QQO A;  2P9P B;  1JL2 A;  4NXM K;  5KQD A;  4CGF A;  4BGB A;  4KHN A;  1N36 K;  4N47 A;  4M3X A;  3O9Q A;  5C10 A;  4KH5 A;  3U8X A;  3TAF A;  2O8D B;  5HP1 A;  1ESV A;  4DTP A;  2YKM A;  5C15 A;  3HM8 A;  2UUA K;  3OYK A;  1VSF A;  2E1Z A;  1BCO A;  1Q9Y A;  3H3O B;  1ATN A;  1B92 A;  4CEZ A;  5C2F A;  3VQ8 A;  5LL6 Z;  2RHK A;  3NF9 A;  3MAQ A;  3CI5 A;  2XY7 A;  3KTQ A;  3VOV A;  5GAG P;  2P9L A;  2RKI A;  4PHT X;  4E7K A;  3HL8 A;  3GG4 A;  4NYN A;  4F4K A;  1BI4 B;  3NBP A;  3CER A;  5CYQ A;  3IMX A;  3L2V A;  4WCE L;  1QE1 A;  1JLQ A;  2FF6 A;  5FPN A;  3RMD A;  4H0T B;  3HOS A;  3D0P A;  2IGI A;  2OYQ A;  1UOC A;  1GLF O;  1WSH A;  5ADX A;  5GIN A;  3VQ9 A;  3ZSR A;  2EHG A;  3H3N O;  3U4L A;  4CJ3 A;  1YJ9 N;  3QML A;  3QEW A;  3AA2 A;  3MMV A;  2Z1G A;  1BDG A;  2I5J A;  3D2E B;  3CHW A;  2YV0 X;  1VRU A;  2E8A A;  3EKS A;  2HNY A;  3AVG A;  1ZXO A;  3QET A;  4Z0U A;  1TL3 A;  3PY8 A;  4HUE A;  3MCA B;  4BR0 A;  1C1A A;  4H5V A;  3JYT A;  1SKS A;  3P5J A;  2G8V A;  2GV9 A;  1UAX A;  1TYQ B;  2BH1 A;  1DKG D;  4MFB A;  3ZSQ A;  4ID5 A;  4B1U B;  1JLB A;  1XUP O;  3M3Z A;  3K9J A;  3O9S A;  2DFH A;  3BY5 A;  3S9H A;  2FBV A;  3SJH A;  3QIP A;  1SKR A;  3IFR A;  4FLY A;  4HTU A;  4FJK A;  3LP0 A;  1Q86 O;  4B1Y B;  3AVM A;  4CW7 B;  5JVG L;  4BRI A;  1C6V A;  4AM6 A;  4M3Y A;  2D0O A;  4K25 A;  2NLX A;  4CHO A;  3VF4 A;  2Q2R A;  3RMC A;  4BVO A;  1HKG A;  5EXW A;  1B9D A;  3THY A;  3WEE A;  1ZC6 A;  2NUB A;  3AA5 X;  3S41 A;  3C65 A;  4QAG A;  1HPZ A;  4BRG A;  4H0Y B;  1VQ8 N;  5AZI B;  1BIS A;  2HBM A;  5AQM A;  4PKG A;  1QSY A;  1KVA A;  2VCP A;  3ALY A;  2JLE A;  4E7I A;  1VSJ A;  3DXK A;  2Z1I A;  2WOM A;  4CBU A;  4E3S A;  5FRN A;  1QVF M;  1UA1 A;  2O8C B;  1BQN A;  1P90 A;  1C0G A;  5CY4 A;  4WYB A;  4DTM A;  3VMF B;  3PIO L;  2YJF A;  5HRS A;  1NOY A;  2BTF A;  4KRE A;  4FVU A;  5TKW A;  4DR2 K;  3ZSX A;  1QS4 A;  1NBW A;  3OYE A;  4M63 C;  4DU1 A;  4CJ4 A;  1QZ6 A;  4CHP A;  3ZSV A;  3BZC A;  4CZE A;  1T44 A;  1Z05 A;  4A2A A;  5MLC Q;  4DQI A;  3CG7 A;  3ZSZ A;  3GBT A;  2FBT A;  3SMP A;  1A5W A;  3R6M A;  3NF7 A;  3TTC A;  5J2Q A;  1KD1 O;  3MWP A;  1RBU A;  3K0S A;  4MO5 A;  1KVB A;  4KHY A;  5EOY A;  4Q5V A;  4JAX A;  3FFI A;  4FJ5 A;  3SJJ A;  5C24 A;  4J2A A;  2VWK A;  1UWB A;  4KHP K;  3CQ8 A;  2F4V K;  4IJN A;  4JLH A;  1HJR A;  2BAN A;  4FLZ A;  3VQP A;  1TKX A;  2O4I A;  4FJH A;  3WQU A;  5SZT A;  4JKG A;  4W5T A;  1HNX K;  2NRZ A;  2P5O A;  1IJJ A;  1BOT O;  1HQE A;  4R5P A;  3NGZ A;  4B9L A;  3ZYY X;  2E88 A;  3K59 A;  1JCE A;  3AVN A;  4ILG B;  2WBN A;  1JXE A;  1NJY A;  2E2N A;  5C42 A;  4OGE A;  2UUC K;  5BRD A;  4LY7 A;  2HBL A;  4LF8 K;  3QO9 A;  2UXC K;  2YNH A;  1WAF A;  4Z4G A;  2HW3 A;  4IJA A;  1IKV A;  4WFA L;  1FJG K;  4CFA A;  1ZBI A;  4FWP A;  4E7L A;  3CET A;  1NKC A;  4FWQ A;  3UB5 A;  4LF4 K;  5ADX H;  3ULE A;  3AV9 A;  3U9D A;  3OYC A;  5AQU A;  4A61 A;  5KGW A;  3H1Q A;  3L4Q A;  3VQQ A;  3DWL A;  4BVP A;  4G1Q A;  2WUS A;  3THX A;  2UU9 K;  1V4T A;  3AGR A;  1ASU A;  2HBJ A;  3D2F B;  3FFK B;  4ZHR A;  3WXJ A;  1XNR K;  3DXM A;  3L4I A;  2FSN A;  3C6H A;  4JKD A;  2P51 A;  3NVK A;  3ZSY A;  4B8A B;  1T6C A;  5KTQ A;  4DR3 K;  1JLA A;  2ASO A;  3C7N A;  3WNG A;  1IH7 A;  2ITM A;  3KIO A;  2O8B A;  3C0B A;  3P4I A;  3A8Y A;  3HPG A;  5FRO A;  3NCI A;  3HI0 A;  2QW9 A;  3FR0 A;  3MXI A;  5M1F A;  1KC8 O;  4KFB A;  1L3U A;  3BDP A;  4M3T A;  4BRA A;  3CF5 L;  5J2M A;  4BR4 A;  3QNO A;  4H03 B;  1OH7 A;  3Q7B A;  3VQB A;  3TSU A;  5I3U A;  3E9L A;  4BR5 A;  1V4S A;  4M42 A;  1VSK A;  1RT6 A;  1T7P A;  4JS4 A;  1U45 A;  1JLF A;  1RTJ A;  5DMR A;  4N5S A;  1NGB A;  5EVZ A;  5I42 A;  3VGL A;  4JI3 K;  3I0R A;  3VN5 A;  4FWS A;  3O5B A;  3KKR A;  1WSJ A;  3PX6 A;  1VHX A;  1BUP A;  2V7Y A;  5C2D A;  3PO5 A;  3AVJ A;  1IG9 A;  3QES A;  5BPN A;  2DFE A;  1MWM A;  5AQI A;  3O6W A;  3L2W A;  1VSI A;  5TKY A;  4FOE A;  4OKJ A;  4IOA L;  2YJE A;  2G8H A;  3F2K A;  1L3V A;  2FC0 A;  4JK8 A;  4A57 A;  1VQ5 N;  4LF5 K;  3C6T A;  3L3V A;  4BRF A;  1ITG A;  4DTJ A;  1S1U A;  4A2B A;  3ZT4 A;  3TAE A;  4BR9 A;  4FLU A;  4NB4 A;  3NFA A;  4RW7 A;  2VYP A;  3H08 A;  3MN5 A;  3AO5 A;  3R3L A;  4B08 A;  2E2Q A;  4WFB L;  3DI6 A;  3B8A X;  2CH6 A;  4X64 K;  3CM6 A;  4WF9 L;  3OYA A;  2YHB A;  5JS2 A;  4CJR A;  3LDL A;  3MEE A;  3V9X A;  1CXU A;  3AGK A;  4R79 A;  1GOB A;  1RT3 A;  2JGU A;  1C0F A;  2IIR A;  3AVC A;  5KPR A;  1G99 A;  4C8M A;  4BRH A;  3NH2 A;  1K9M O;  4E7J A;  1MWK A;  1WBD A;  4CJW A;  3SNN A;  1XC3 A;  1SV5 A;  2HND A;  2EX3 A;  3VEV A;  4FYD A;  3C95 A;  1J5E K;  3K58 A;  2HHH K;  4BC2 A;  4I9Q A;  4E1J A;  2WFB A;  4JI1 K;  3MXJ A;  4GV6 A;  3OYD A;  3CJA A;  3V4I A;  4G9Z A;  3FZK A;  1W2B M;  3GE1 A;  4YOW A;  3ISN C;  3DRS A;  2NNW A;  4CHY A;  3S3N A;  4EZ6 A;  2FSK A;  3LDP A;  2P9N B;  3OS2 A;  2QWR A;  3CM5 A;  3IKM A;  3KLF A;  1YAG A;  3SCX A;  1KRP A;  2ZM6 K;  1OH8 A;  4ELV A;  5CZ1 A;  3AO2 A;  3DRR A;  4BG8 A;  4GKK K;  3K5L A;  3OTO K;  3MX5 A;  1GOA A;  4IZ9 A;  5AZJ A;  3TAG A;  1TL1 A;  5JS1 A;  3O9U A;  4YOR A;  3OBW A;  4QCL A;  3LL3 A;  4CI6 A;  2YHY A;  4RW4 A;  4FCY A;  1S1X A;  4LSN A;  4DU3 A;  4KI6 A;  4UQG A;  5F2R A;  4DTN A;  4M3R A;  4K8Z A;  4B9U A;  4FJX A;  2W6K A;  4YHH K;  3R1X A;  4IDH A;  3SZ2 A;  4LH4 A;  2IDO A;  1JCF A;  1Z6R A;  3MK6 A;  4CZF A;  5HLF A;  4Q0B A;  3QNN A;  2GWK A;  3VTH A;  2QWP A;  1N33 K;  3DLH A;  1IO2 A;  4RW9 A;  1GOC A;  1IKY A;  4NYF A;  5J2N A;  4JI2 K;  2AA4 A;  1NGJ A;  3T1H K;  4CF2 A;  3LZI A;  1Q7Y O;  4HWI A;  3M5R A;  1FW6 A;  3L2R A;  4LF9 K;  4LD0 A;  3CIP A;  5K14 A;  1BCM A;  2QWN A;  4DG1 A;  3ZX0 A;  2X6S A;  2ZE2 A;  4I7F A;  3BF3 A;  2DPN A;  5KQ8 A;  1KAZ A;  4OKK A;  3P1G A;  3AO1 A;  3V6D A;  1KFS A;  3PIP L;  2HHW A;  2HF3 A;  4MDA A;  4RWT A;  4DR4 K;  4BQZ A;  4CED A;  2HVI A;  2WON A;  3EZ5 A;  3KK1 A;  1JLC A;  3VQA A;  2ZF5 O;  1NKE A;  4JKE A;  4LH5 A;  2ZGZ A;  2NRX A;  4C8K A;  3A0I X;  3DLR A;  4CFC A;  2O8E B;  3G71 N;  3F9M A;  3G10 A;  3QB0 A;  5HRO A;  1M90 O;  2E6L A;  5BR9 A;  3T3F A;  1VQL N;  3CJ7 A;  1SQK A;  2HST A;  1VSE A;  2FSJ A;  3DMJ A;  4K43 A;  4O8K A;  3VQC A;  1RDD A;  3VF2 A;  3FZM A;  1SS6 A;  4ID1 A;  3O3F A;  3J80 O;  1NU0 A;  5JLF A;  4CEE A;  4CF8 A;  4PQU A;  2XY8 A;  3W0L A;  4JI8 K;  3ZX2 A;  4FL9 A;  5HL7 L;  1DLO A;  3CJB A;  3KK2 A;  1IV0 A;  3CCQ N;  4CBW A;  4CFD A;  4M7X A;  2OPP A;  3IS9 A;  1NMD A;  4I6M A;  4B9V A;  2PZS A;  3J7Z O;  1S6P A;  3PSF A;  1IBK K;  4O0I A;  3R9P A;  4BRK A;  4NLB A;  3V1Q A;  1ILY A;  2PFU A;  5LMU K;  2ZJP L;  1W9H A;  2ASP A;  3KLE A;  3VEO A;  1BWF O;  3G0Z A;  4CZM A;  1NGC A;  3THY B;  5H1S Q;  2PYL A;  4MLE A;  3VQ6 A;  1I94 K;  3ENO A;  3CME N;  4C8N A;  4GVE A;  4M7Y A;  4EFH A;  4FK0 A;  1TKZ A;  2IVN A;  3A5N C;  2O8F B;  2GX9 A;  4JKH A;  3T1Y K;  3P39 A;  3DXK B;  2DTU A;  1KCF A;  3FZL A;  5HRP A;  1U4B A;  1K8K A;  4CJF A;  5HRN A;  3CFR A;  3U6F A;  1YXQ A;  1O13 A;  4DF4 A;  4FLT A;  3OS0 A;  4AHT A;  3RMB A;  4IDK A;  1X9M A;  2HF4 A;  1D9F A;  4WFN L;  2D5R A;  3CYM A;  1C0U A;  3F9K A;  4Y0W A;  4FW1 A;  1NJW A;  1U2V A;  4DMN A;  1TKT A;  4CGH A;  1ZBS A;  5T7B A;  3TPQ A;  3DLL L;  1EKE A;  3MN6 A;  5M1P A;  3AAR A;  4E0D A;  2GWJ A;  4JI6 K;  5JVH L;  4KO0 A;  1F21 A;  5C12 A;  3TAP A;  4CZK A;  4AHS A;  1JXB A;  3HJF A;  2LSN A;  1VQK N;  3IAY A;  4A59 A;  2BGG A;  2ZD1 A;  4W5O A;  3CC7 N;  3TSP A;  2HHU A;  1RBS A;  3NGY A;  2IC3 A;  2P9K A;  1RBV A;  1WSG A;  3KJV A;  4JKG B;  3ZEU B;  3EZW A;  5LMN K;  3OBY A;  3LP1 A;  4DS4 A;  3TAN A;  2A3Z A;  3A2F A;  3NF8 A;  3V9U A;  1S1T A;  4F3T A;  1KTQ A;  2ZQB A;  1KAX A;  2VG5 A;  3O3H A;  4FJN A;  4B9S A;  4CIG A;  1T8E A;  4WQ4 C;  4ICL A;  1S5J A;  4FO0 A;  2B4J A;  4BWM A;  4JD2 A;  3MXM A;  3HZ6 A;  1WAJ A;  2RE2 A;  2VGM A;  5FPE A;  1I39 A;  3O9R A;  3ZX3 A;  1YHQ N;  1ZBF A;  4M45 A;  1C0M A;  3OYM A;  1EX4 A;  1ATR A;  3HXM A;  4A5A A;  5BPL A;  4FOI A;  4MLH A;  2GEM A;  4JHD A;  1NGI A;  2DY4 A;  4I2Q A;  5EX5 A;  4JKB A;  1NK7 A;  4XH1 A;  4DQS A;  1VRT A;  1WSE A;  4OKE A;  3PLA A;  5AQH A;  3MCP A;  4FJG A;  3AVF A;  4DQQ A;  3QIN A;  4KH6 A;  1TUU A;  4B1Z A;  4KKO A;  3LZJ A;  4FZX C;  2P9I A;  2I7P A;  3EN9 A;  4IEE A;  3CXC M;  1YVN A;  2ATQ A;  4NCG A;  4OPK A;  3U3Y A;  4DSI A;  4JEP A;  4N56 A;  3OJS A;  3K9K A;  1RTI A;  2YX6 A;  1X9J A;  5J2P A;  5CR4 A;  3DLB A;  4BG9 A;  2P9U A;  2V7Z A;  1LCU A;  1B9F A;  3UKU B;  4YY3 K;  4E1M A;  2V51 B;  3PO4 A;  4Y1D A;  1IKW A;  5KRS A;  2OTJ N;  4KHU A;  1T6D A;  2O8B B;  5BN9 A;  1KQS M;  4IFE A;  2Z1J A;  4V19 S;  4DTX A;  1J53 A;  3LM9 A;  5AQS A;  3CCE N;  3LAL A;  1TVR A;  1VSD A;  1TUY A;  4AHC A;  4BE0 A;  4DFM A;  2PYJ A;  3OY9 A;  3BZK A;  2P9P A;  2P1J A;  2Q3S A;  1NMN A;  1WUA A;  1M1K O;  1NGF A;  3J8A A;  3M8Q A;  1VQ9 N;  1HJO A;  1TAQ A;  1S3X A;  3WXM B;  3DOK A;  1RT1 A;  1YUW A;  1NK8 A;  4Z4F A;  1LAW A;  1JKH A;  2O8D A;  4J8F A;  4C1N K;  4DFJ A;  3P31 A;  2UXD K;  5CZ2 A;  2HHQ A;  4DV6 K;  4BRN A;  4JKA A;  3KHY A;  3FZF A;  4DSJ A;  2P9S B;  4KBO A;  3O1B A;  3CPW M;  3UKR B;  1VQ7 N;  2ZGY A;  5HRR A;  2KZZ A;  2PBD A;  3WT0 A;  1P8Z A;  4OJR A;  3HP6 A;  1DT9 A;  1QZ5 A;  1BI4 A;  4ZTJ A;  3H45 C;  2YHA A;  3E01 A;  5JLH A;  2QKB A;  2OA8 A;  3EL2 A;  2CGK A;  1L3S A;  3DLE A;  4GVM A;  2NRH A;  2GTD A;  2YNF A;  1NM1 A;  3HST B;  1XWL A;  3O1W A;  1WSF A;  2HNZ A;  1K73 O;  4CER A;  4C8O A;  1RCH A;  3AAP A;  3KLH A;  2F9W A;  1NGG A;  3RR8 A;  3D2E A;  5KPT A;  5FPM A;  1RDC A;  3PV8 A;  3D7E O;  3WXL A;  2AP1 A;  2UUB K;  2KHO A;  3AVH A;  3K5N A;  1J9A A;  3UIQ A;  4Z4C A;  3IUC A;  4BAC A;  3ASM A;  3VQ5 A;  3T69 A;  2KFZ A;  3AVK A;  2FXU A;  3DYA A;  4EHU A;  2VG6 A;  5IT9 O;  1RNH A;  1TV6 A;  4KTZ A;  2G8F A;  4CBX A;  1IKX A; 
#chains in the Genus database with same CATH homology
 2O4G A;  1LW0 A;  3OJU A;  1LW2 A;  4JRP A;  3OS1 A;  3MXJ A;  4KV8 A;  3AVA A;  4CJK A;  3L2U A;  5CYM A;  4CGI A;  4I9L A;  3OYD A;  1A5X A;  3V4I A;  4M3U A;  3VQ4 A;  4XIU A;  4J2B A;  1RT4 A;  4FW2 A;  3ISN C;  3DRS A;  3LAN A;  1SUQ A;  3QEX A;  1UA0 A;  1U48 A;  4CHY A;  3ZSW A;  4GW6 A;  3LPT A;  4JS5 A;  4DSF A;  3S3N A;  1J5O A;  2KW4 A;  3RR7 A;  4EZ6 A;  3KK3 A;  4IKF A;  1FXX A;  1JLE A;  3OS2 A;  3L2Q A;  1BIU A;  3ZCM A;  1R0A A;  3OYH A;  4RW8 A;  2XRI A;  3CM5 A;  3KLF A;  3S3M A;  3LP2 A;  1RBT A;  3ZT3 A;  3SCX A;  3KKS A;  1KRP A;  4Z4I A;  1RTD A;  4O0J A;  3HT3 A;  1L5U A;  5CZ1 A;  3AO2 A;  3VQD A;  3WNE A;  4ELV A;  4IG0 A;  3DRR A;  3NH1 A;  3K5L A;  1CXQ A;  1GOA A;  3WNF A;  4DFK A;  1CZB A;  4O5B A;  1LWE A;  4WE1 A;  1TL1 A;  3TAG A;  1QHT A;  2KZM A;  5JS1 A;  1BIZ A;  4QCL A;  4CHQ A;  1KVC A;  4RW4 A;  4E7H A;  3EYZ A;  3M8R A;  1S1X A;  4LSN A;  4FCY A;  4DU3 A;  2G8K A;  3TWH A;  4KI6 A;  4UQG A;  4DTN A;  4LSL A;  4M3R A;  4K8Z A;  3OYN A;  3BGR A;  4B9U A;  1HYV A;  4FJX A;  1MU2 A;  3SZ2 A;  2G8I A;  3MEG A;  1ZBH A;  4BDZ A;  4LH4 A;  2IDO A;  1JL2 A;  5HLF A;  4CJ5 A;  4CGF A;  4Q0B A;  3QNN A;  4KHN A;  3JSM A;  4N47 A;  3LAM A;  4M3X A;  1BQM A;  4OLB A;  3K5M A;  3DLH A;  4FZY A;  1IO2 A;  4RW9 A;  3VA0 A;  2KTQ A;  4EP5 A;  4W5R A;  1GOC A;  1S1W A;  4CF0 A;  3TAF A;  4CF1 A;  5EU7 A;  1IKY A;  4NYF A;  5HP1 A;  4DTP A;  3MEC A;  2YKM A;  2F8T A;  2HHT A;  5J2N A;  3HPH A;  4PUO A;  3SQ0 A;  1LWC A;  4HUG A;  4CGG A;  3O4Q A;  3OYK A;  4CF2 A;  3M8S A;  3LZI A;  1NK9 A;  2DFF A;  1VSF A;  4E89 A;  4DSK A;  3I0S A;  3L2R A;  1BCO A;  1Z26 A;  1Q9Y A;  4ELU A;  2HVH A;  4W5N A;  4LD0 A;  4FXD A;  1TAU A;  1B92 A;  5K14 A;  4CEZ A;  1BCM A;  4DG1 A;  4FLV A;  3VQ8 A;  1QSS A;  4KB1 A;  3NF9 A;  3LWL A;  1U04 A;  3MAQ A;  2X6S A;  2ZE2 A;  2D0A A;  2HB5 A;  2XY7 A;  1VSL A;  4I7F A;  3KTQ A;  4HUF A;  1VK0 A;  4AH9 A;  4KI4 A;  4J2E A;  2X74 A;  4OKK A;  2RKI A;  3P1G A;  4AHU A;  4FVM A;  3AO1 A;  3V6D A;  1KFS A;  4E7K A;  1FKO A;  1WN7 A;  3HL8 A;  2G8W A;  2HHW A;  4DQR A;  4NYN A;  3QER A;  3SQ4 A;  1BI4 B;  3NBP A;  4F4K A;  1HYZ A;  5CYQ A;  3L2V A;  4CED A;  2HVI A;  1QE1 A;  2WON A;  3K2P A;  3EZ5 A;  1JLQ A;  3RMD A;  3KK1 A;  1JLC A;  3VQA A;  1T03 A;  1NKE A;  2OPR A;  4PWD A;  4LH5 A;  4CK1 A;  3SUN A;  3D0P A;  2F96 A;  2IGI A;  2OYQ A;  1UOC A;  1WSH A;  3B6P A;  3QEI A;  4C8K A;  3NHG A;  3VQ9 A;  3ZSR A;  2EHG A;  4CJ3 A;  1S6Q A;  2XO7 A;  1ZBU A;  4CFC A;  3DLR A;  2PY5 A;  3QEW A;  3OYB A;  2XY6 A;  3AA2 A;  3TR8 A;  1YTU A;  3V81 A;  2Z1G A;  3G10 A;  1BHL A;  5HRO A;  3TAQ A;  1LV5 A;  1QTM A;  2I5J A;  4C8L A;  4L8R B;  2E6L A;  3ZT0 A;  2QK9 A;  2YV0 X;  3QLH A;  1J54 A;  1VRU A;  3OVN A;  3NE6 A;  3T3F A;  2HNY A;  3AVG A;  5HBM A;  3QET A;  2Z1H A;  1VSE A;  1NKB A;  3DMJ A;  1EXQ A;  3VQC A;  4Z0U A;  4FJJ A;  1TL3 A;  3PY8 A;  1HQU A;  1RDD A;  2Y1I A;  4FZZ A;  4HUE A;  4ID1 A;  3O3F A;  4CE9 A;  4CES A;  1C1A A;  4CEE A;  4CF8 A;  3JYT A;  2XY8 A;  3EY1 A;  4FK4 A;  4PQU A;  4DU4 A;  4NCB A;  1W0H A;  3P5J A;  1SKS A;  2G8V A;  2GV9 A;  1UAX A;  4I2P A;  4HHT A;  1TK0 A;  4DLE A;  4MFB A;  3ZSQ A;  4ID5 A;  1DLO A;  3KD5 E;  1RTH A;  1JLB A;  4ZTF A;  3SPY A;  4CEQ A;  3OYJ A;  3KK2 A;  3V9W A;  1CLQ A;  1Z25 A;  1ZBL A;  4KRF A;  3IG1 A;  4CGJ A;  2DFH A;  3S9H A;  2FBV A;  4CHZ A;  3QIP A;  4CFD A;  5KRT A;  1SKR A;  1NK6 A;  4CJT A;  2OPP A;  4FLY A;  4HTU A;  3IS9 A;  4B9N A;  4FJK A;  3RMA A;  1L3T A;  4B9V A;  3LP0 A;  2PZS A;  5J1E A;  1S6P A;  3AVM A;  2FBX A;  1RT7 A;  4O0I A;  1C6V A;  3T19 A;  3V1Q A;  1EP4 A;  1S9G A;  4M3Y A;  3LP3 A;  4CJL A;  3OYI A;  2F8S A;  3OYL A;  1W9H A;  3AO4 A;  2BDP A;  1HYS A;  3KLE A;  3AVL A;  4DFP A;  1NK5 A;  4DWI A;  4CHO A;  2XY5 A;  3RMC A;  4KHS A;  3G0Z A;  4IBN A;  4BWJ A;  5KGX A;  2PYL A;  1B9D A;  1RDA A;  4FK2 A;  3DLK A;  2NUB A;  1KLN A;  3VQ6 A;  4FJI A;  3AA5 X;  4W5Q A;  4QAG A;  1HPZ A;  4C8N A;  4CEO A;  4FK0 A;  2QKK A;  1BIS A;  1TKZ A;  4CEA A;  4KPY A;  5DK5 A;  4CEB A;  5D3G A;  4AHR A;  4Z4H A;  2BE2 A;  1QSY A;  1K6Y A;  1KVA A;  4BDY A;  3ALY A;  1N5Y A;  2JLE A;  4E7I A;  2DTU A;  1KCF A;  1VSJ A;  1RT2 A;  5HRP A;  2Z1I A;  4OGC A;  1U4B A;  2IAJ A;  2WOM A;  4CJF A;  5HRN A;  3CFR A;  2RN2 A;  3U6F A;  4CJQ A;  1S9E A;  4E3S A;  5FRN A;  1UA1 A;  4BDP A;  1BQN A;  2E4L A;  5CY4 A;  4FLT A;  4DTM A;  4DF4 A;  3AVB A;  1S1V A;  3QIO A;  3OS0 A;  4AHT A;  4YNQ A;  1WSI A;  3RMB A;  1DTT A;  5HRS A;  2W42 A;  1NOY A;  4KRE A;  4IDK A;  1X9M A;  1D9F A;  4CJS A;  3NH0 A;  3V9S A;  1FKP A;  3ZSX A;  1QS4 A;  2D5R A;  3OYE A;  3CYM A;  4DU1 A;  1C0U A;  1JL1 A;  4CJ4 A;  3SQ1 A;  3S3O A;  4CHP A;  3F9K A;  3ZSV A;  4FW1 A;  1NJW A;  4DTR A;  4DMN A;  4F2S A;  1TKT A;  3P83 D;  4CGH A;  4CJE A;  5SWM A;  1NK0 A;  3C94 A;  4DQI A;  3CG7 A;  4OLA A;  3ZSZ A;  2FBT A;  4CJP A;  4J2D A;  5T7B A;  3HVR A;  1A5W A;  1EKE A;  4E0D A;  4O4G A;  3NF7 A;  5J2Q A;  3NGI A;  2YNI A;  4KO0 A;  1F21 A;  2AJQ A;  1RBU A;  4JRQ A;  4H4O A;  1FK9 A;  3VQ7 A;  1KVB A;  4KHY A;  3HP9 A;  4Q5V A;  3FFI A;  3TAP A;  4F3O A;  2ITG A;  4IFV A;  4FJ5 A;  2P5G A;  4AHS A;  1CZ9 A;  1JXB A;  2LSN A;  3SJJ A;  3HJF A;  5C24 A;  1X9S A;  3LWM A;  3IAY A;  4J2A A;  2VWK A;  1KFD A;  3PX4 A;  1UWB A;  3HPO A;  2BGG A;  2ZD1 A;  4W5O A;  3AVI A;  3OYG A;  2E6M A;  4CHN A;  3ZT2 A;  3CQ8 A;  1NJZ A;  4KHW A;  4EZ9 A;  2HHU A;  1RBS A;  1HJR A;  3NGY A;  2BAN A;  2IC3 A;  4JLH A;  3F73 A;  4CGD A;  4QOZ B;  4FLZ A;  3QEP A;  1RBV A;  1WSG A;  3D45 A;  3VQP A;  4TSX A;  3KJV A;  3DOL A;  1TKX A;  3SQ2 A;  3SPZ A;  3TI0 A;  4FJH A;  2O4I A;  5SZT A;  4DQP A;  2OZM A;  3LP1 A;  4FM2 A;  4DS4 A;  2YNG A;  4PA1 A;  2A1S A;  4W5T A;  3TAN A;  3A2F A;  1HMV A;  3NF8 A;  4KTW A;  3WNH A;  3V9U A;  1S1T A;  3MED A;  1ZYQ A;  4F3T A;  1KTQ A;  2ZQB A;  3K57 A;  2HMI A;  2P5O A;  3DRP A;  2FBY A;  4MQ3 A;  2YKN A;  1HQE A;  2VG5 A;  4R5P A;  3HVT A;  3O3H A;  4ELT A;  4FJN A;  1EET A;  3O3G A;  4B9S A;  4CIG A;  3NGZ A;  1YT3 A;  1T8E A;  1N6Q A;  1VSH A;  3OYF A;  4ICL A;  4E19 A;  4B9L A;  1T05 A;  1S5J A;  2B4J A;  3V1O A;  3K59 A;  4BWM A;  4BE2 A;  3AVN A;  2Y1J A;  3MXM A;  1ASV A;  3RTV A;  3QEV A;  4DF8 A;  3ZSO A;  1KSP A;  1JXE A;  4GMJ B;  4OPJ A;  1NJY A;  2RPI A;  1WAJ A;  5C42 A;  4OGE A;  4HCB A;  2GUI A;  4FJ7 A;  1I39 A;  1RBR A;  4LY7 A;  1ZBF A;  1ASW A;  4M45 A;  1C0M A;  3OYM A;  1EX4 A;  4H4M A;  3AA4 A;  3HXM A;  3QO9 A;  1QSL A;  5C25 A;  2YNH A;  1SKW A;  1O1W A;  1WAF A;  4Z4G A;  2HW3 A;  1IKV A;  3LAK A;  4RG8 A;  3SV4 A;  4Y1C A;  4O55 A;  3KD1 E;  4CFA A;  4F2R A;  3V9Z A;  1ZBI A;  4E7L A;  1SL1 A;  1NKC A;  2DY4 A;  4I2Q A;  4FLX A;  1SL2 A;  3ZT1 A;  1NK7 A;  3ITH A;  4CIF A;  4DQS A;  1VRT A;  1D5A A;  1QQC A;  3T1A A;  1WSE A;  4OKE A;  1U47 A;  3RWU A;  1NOZ A;  4KAZ A;  3AVF A;  3AV9 A;  4FJG A;  2QXF A;  4DQQ A;  1RDB A;  3QIN A;  4CIE A;  3OYC A;  4B9M A;  4F8R A;  3K5O A;  3V1R A;  4KKO A;  3LZJ A;  4FJM A;  2KQ2 A;  1C1C A;  4AIL C;  4FZX C;  4N76 A;  4N41 A;  5KGW A;  3SYZ A;  3VQQ A;  4AHV A;  4G1Q A;  4NCG A;  2ATQ A;  3C6U A;  4CK2 A;  4E1N A;  4OPK A;  3ULD A;  3SUP A;  1X9W A;  3U3Y A;  4DSI A;  4K8X A;  2D0B A;  1ASU A;  1Q8I A;  4N56 A;  3OJS A;  3L8B A;  4DSE A;  4ZHR A;  2B5J A;  2D0C A;  3U3G A;  1RTI A;  2IOC A;  4DS5 A;  5J2P A;  1TK5 A;  4IG3 A;  3SUO A;  3DLB A;  1REV A;  5FDL A;  3B6O A;  1B9F A;  2P51 A;  4CJU A;  4M41 A;  4E1M A;  3PO4 A;  4Y1D A;  1IKW A;  4HCC A;  3ZSY A;  4B8A B;  2OPS A;  5KRS A;  1NJX A;  2OPQ A;  5KTQ A;  3I8D A;  4KHU A;  2GBZ A;  1JLA A;  2B6A A;  1HRH A;  1IH7 A;  1KLM A;  1WNS A;  3WNG A;  3KIO A;  4RW6 A;  1RIL A;  1RT5 A;  3KLG A;  3HPG A;  5FRO A;  1C0T A;  3NCI A;  3MXI A;  1LWF A;  3TAM A;  4KFB A;  1L3U A;  1NK4 A;  3BDP A;  4FJL A;  2Z1J A;  4M3T A;  4DTX A;  1J53 A;  3HK2 A;  1XHZ A;  4B8C A;  5J2M A;  2HHX A;  4HVJ A;  3QNO A;  4KB0 A;  4IFY A;  3IRX A;  3LAL A;  4M3Z A;  1TVR A;  1VSD A;  3VQB A;  4AHC A;  4BE0 A;  5I3U A;  4Z4E A;  1Y97 A;  4DFM A;  2PYJ A;  3OY9 A;  4FJ9 A;  4FM1 A;  4M42 A;  2P1J A;  2Q3S A;  1A5V A;  1VSK A;  1RT6 A;  2RF2 A;  4DLG A;  4JS4 A;  1T7P A;  4M3W A;  3M8Q A;  1U45 A;  1BGX T;  1JLF A;  1RTJ A;  1TAQ A;  1X1P A;  3DOK A;  4H8K A;  5DMR A;  1RT1 A;  3DLG A;  5KI6 A;  3SUQ A;  1NK8 A;  4Z4F A;  1LAW A;  4CEC A;  4N5S A;  4CJV A;  1HNV A;  4KHQ A;  4PY5 A;  1JKH A;  3HO1 A;  4B9T A;  3AO3 A;  1D8Y A;  4DFJ A;  5I42 A;  4B3O A;  3I0R A;  3VN5 A;  4CK3 A;  3KKR A;  4CFB A;  1WSJ A;  3PX6 A;  5CZ2 A;  2HHQ A;  2VG7 A;  3DM2 A;  1HNI A;  3LDS A;  4CCH A;  2IS3 A;  2XHB A;  4DSJ A;  3PO5 A;  3AVJ A;  1DTQ A;  1IG9 A;  3QES A;  2ETJ A;  2DFE A;  1WLJ A;  4DTU A;  3THV A;  2G8U A;  4EP4 A;  5FRM A;  4DTS A;  2VWJ A;  3NF6 A;  3L2W A;  2HHS A;  1VSI A;  5HRR A;  2KZZ A;  3M8P A;  1YTA A;  4OKJ A;  3HYF A;  2G8H A;  1BL3 A;  2KFN A;  4OJR A;  3HP6 A;  1L3V A;  3L3U A;  4NCA A;  1JLG A;  2FC0 A;  4DSL A;  4O44 A;  4FM0 A;  3SI6 A;  4CF9 A;  2OZS A;  3C6T A;  3O4N A;  1BI4 A;  3L3V A;  4ZTJ A;  1ITG A;  4DTJ A;  1TGO A;  3RRH A;  3PX0 A;  1S1U A;  3NAE A;  2YHA A;  3ZT4 A;  3E01 A;  1SL0 A;  4YFU A;  3CFO A;  2OA8 A;  2QKB A;  1C1B A;  5E41 A;  3TAE A;  1D9D A;  4FLU A;  1L3S A;  3DLE A;  4GVM A;  1XC9 A;  2YNF A;  1TK8 A;  3NFA A;  4RW7 A;  1XHX A;  3HST B;  3H08 A;  1XWL A;  3PUF A;  3AA3 A;  3AO5 A;  1WSF A;  4FJ8 A;  4B08 A;  1TKD A;  2HNZ A;  3DI6 A;  4BE1 A;  4CER A;  4CEF A;  4C8O A;  1RCH A;  3CM6 A;  3OYA A;  2YHB A;  3KLH A;  1XI1 A;  2A1R A;  3CFP A;  1Q9X A;  1G15 A;  1I3A A;  3RR8 A;  5JS2 A;  3LPU A;  3NDK A;  4CJR A;  1VSM A;  2X6N A;  1RDC A;  3MEE A;  3VQE A;  3V9X A;  1CXU A;  2X78 A;  3PV8 A;  1GOB A;  1RT3 A;  2JGU A;  3TAR A;  3AVC A;  3SV3 A;  1LAV A;  3HM9 A;  3AVH A;  4C8M A;  1YVU A;  3NH2 A;  3K5N A;  4E7J A;  1U49 A;  4CJW A;  1J9A A;  4FLW A;  3SNN A;  2HND A;  1SV5 A;  3KLI A;  2EX3 A;  2HHV A;  3RRG A;  3C95 A;  3UIQ A;  4Z4C A;  4KTQ A;  4FYD A;  4BAC A;  3ASM A;  4OVL A;  3VQ5 A;  3K58 A;  3VA3 A;  2KFZ A;  3AVK A;  4I9Q A;  4DTO A;  3DYA A;  2VG6 A;  1RNH A;  1TV6 A;  4KTZ A;  2R7Y A;  2G8F A;  3TAB A;  1IKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...