4CJTA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
154
structure length
150
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 58
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjtA00
3V9UA 3OY9A 1TL3A 4KRFA 3QEVA 3PUFA 4DSJA 4IG0A 3KD1E 2EHGA 1DTTA 3TAMA 4EP4A 3KLIA 3VN5A 4EP5A 3K58A 3AVAA 4DTXA 4BE2A 4AHUA 3D0PA 5T7BA 3O4QA 4CHYA 3DOKA 4CGFA 3KLGA 4B9LA 3A2FA 3DRSA 4Y1DA 2HHXA 1J9AA 1LWFA 2QXFA 2RPIA 1HYZA 4CJUA 4FLTA 1ZBIA 3AVKA 4M45A 4DTJA 1S1VA 1SKWA 3P5JA 1RTJA 1IKYA 3NF7A 4CJ3A 4DTRA 4J2AA 1WSFA 1RBUA 3D45A 4R5PA 4ELVA 4E7KA 4DTOA 4CF0A 1NJXA 2KFNA 3CFOA 4FLVA 1RDCA 2GUIA 4OKJA 3I8DA 5HLFA 4KHSA 2DTUA 4FJIA 4CE9A 3HPOA 3AVNA 3VA3A 4CHPA 4E0DA 3K5OA 3VQ7A 1GOBA 1U45A 4JS4A 4W5RA 3LWLA 4CEEA 4CJVA 2XY5A 3AA2A 5KGWA 2PYLA 3OJUA 3V1OA 1KVCA 1TKZA 4I2PA 3V1QA 3OYFA 4DTSA 4FM0A 2OA8A 2FBYA 2HHWA 5D3GA 4FYDA 2HVIA 1ASUA 1A5VA 5DK5A 5KRTA 3LP1A 3RMDA 4FJ7A 4DTUA 4AILC 1WSIA 3PX6A 4AH9A 2B6AA 1C1BA 3L2VA 4E19A 1TV6A 3P1GA 3SI6A 3ZSRA 4LH4A 1QTMA 2PZSA 5HRNA 3RWUA 4FZXC 1YVUA 2X6SA 1ASWA 2Q3SA 1QSLA 4FJ5A 2AJQA 1BI4B 2D5RA 4OPJA 3PO5A 3KLHA 1S5JA 2HHQA 3ULDA 2Z1JA 4Z4CA 1YTAA 4PWDA 1RNHA 4QCLA 2B4JA 3WNHA 3BGRA 1LW0A 1HNIA 4C8MA 4AHVA 4DTPA 3VQ9A 2P5GA 1LV5A 2FC0A 4JS5A 1WN7A 1B9FA 3SV4A 3IAYA 1L5UA 1VSMA 3OVNA 3ZSVA 3P83D 4FK4A 3NGIA 4CJ4A 5KRSA 4Z4HA 4KREA 3OYGA 4IFVA 1ITGA 3DRPA 4CF2A 1JLAA 1JLGA 2D0AA 3KKSA 1HRHA 4CEQA 4DMNA 4HUGA 3TAGA 4DQPA 3DM2A 4FW1A 5KGXA 3K5LA 4DF8A 2BE2A 1HQEA 3VQEA 4BE0A 3QEXA 3ZT0A 3CFPA 4B9VA 1NK5A 1VSFA 4RW6A 4CFCA 4ID5A 4HHTA 3LALA 4KTWA 3K57A 1JLCA 2HW3A 3V9ZA 3RTVA 4JRPA 4CEZA 1N5YA 3HPHA 3ZSWA 2OPSA 1GOAA 4BDPA 1WAJA 2IAJA 5SWMA 4KPYA 3AVGA 1JXEA 1Y97A 4E7HA 4DSFA 2X78A 3F9KA 1VSKA 2KW4A 3O3GA 4YNQA 3SQ2A 1IH7A 4O44A 2KZMA 1TK5A 3HK2A 2IGIA 2WONA 2IC3A 3KK3A 4M41A 3HVRA 3DI6A 1C6VA 1MU2A 2XO7A 1KSPA 4CJQA 2IOCA 4KFBA 4O5BA 1UWBA 4B8AB 3NH2A 3SCXA 4K8XA 4F3TA 2YNGA 4CFDA 3K59A 4FXDA 2HB5A 3NFAA 1RDAA 4B08A 1HMVA 2PY5A 3IRXA 4C8NA 4J2DA 1HQUA 3LPUA 5I42A 1ZBFA 4TSXA 1RTIA 4KHNA 2BGGA 4C8KA 2G8VA 1WNSA 1R0AA 3HL8A 1T03A 2A1RA 4J2EA 4FLXA 3SPZA 4CHZA 4M3RA 4OGEA 2RN2A 3ZSZA 5HP1A 3RRHA 4E7IA 1U48A 1QSYA 3S9HA 4E1NA 3O4NA 1L3VA 4B9TA 4FM1A 1HJRA 2P51A 3NF9A 3VQQA 3C95A 3ZSOA 2DFHA 4Z4GA 2IDOA 1BGXT 1W9HA 3L8BA 4DQSA 1EP4A 3EZ5A 1XI1A 1T7PA 4B8CA 4DWIA 3MXJA 4DSEA 1X9MA 1NOZA 4CHQA 2YHAA 1J54A 3AVHA 4H4OA 3G0ZA 2B5JA 3HYFA 3OYBA 3HXMA 4Q5VA 3LZIA 4Z0UA 3G10A 5HROA 1ZYQA 1RTHA 4XIUA 3CYMA 2E4LA 3RMAA 4M3ZA 4BDYA 2VWJA 1RT6A 4B9SA 3AVMA 1U04A 1FKPA 3AO3A 2Z1IA 4G1QA 3VQ4A 4AHCA 5HRSA 2XHBA 1WSGA 4OJRA 3ZT3A 5SZTA 1L3UA 2F8SA 2HHUA 1D5AA 2YNHA 3VQBA 3KKRA 3KK1A 1RT5A 2HHTA 1RT3A 3NHGA 4DLEA 4M3YA 4HVJA 4BWJA 4CF1A 1KRPA 1FK9A 3RR8A 1HPZA 3PX0A 4CHNA 2ATQA 2E6LA 5EU7A 4CK3A 3T3FA 1U4BA 4PY5A 3CG7A 4C8OA 5JS1A 1SKRA 1NK6A 4FLZA 3KD5E 3B6PA 1VSLA 1JLFA 4RW8A 4FJJA 1BI4A 1UOCA 4CF8A 3QNNA 1VRTA 3C6TA 3OYNA 3L2WA 2RF2A 3IS9A 1SKSA 3L3VA 2YKNA 4L8RB 2G8IA 4RW4A 2JGUA 2OPRA 4OKKA 5HRRA 4DTMA 2P5OA 4FK0A 4O0IA 1ZBHA 4CESA 4CJKA 4IFYA 1A5XA 1BIUA 2I5JA 4FVMA 3AA4A 4FLUA 1LW2A 3TWHA 4B9UA 3QETA 3QEPA 4CCHA 3M8QA 1U49A 3K5MA 3PX4A 4E1MA 3NH1A 3MEEA 3SUNA 1J5OA 3AO1A 3SNNA 5CZ2A 5J1EA 3T1AA 4DF4A 2OZMA 4NCAA 3U3YA 3K5NA 3AV9A 4CGGA 4CJPA 4CJWA 3KJVA 4FK2A 4M3TA 3MAQA 1B9DA 1EXQA 4B9MA 1SL0A 4KTQA 4FZZA 4Z4IA 3NE6A 3NDKA 4DLGA 2O4GA 5I3UA 4AHRA 1ZBUA 2P1JA 4LH5A 4CEBA 4M42A 4EZ6A 2YKMA 1DTQA 1VSDA 2BANA 4KKOA 3OS1A 2DFEA 3HPGA 4DSIA 3CM5A 4ZTFA 3V1RA 4CGIA 4IDKA 3MEGA 1DLOA 3OS0A 4ICLA 5E41A 4LD0A 4FJMA 3AA3A 3OS2A 2FBXA 3K2PA 4CFBA 1N6QA 1TKTA 4CEOA 4DQQA 3DMJA 1TK8A 4KO0A 1S6QA 4CJFA 4I7FA 4CJLA 4K8ZA 3HO1A 4CECA 4F4KA 4HTUA 4HUEA 2KZZA 1C0MA 1NK0A 1RDDA 1TL1A 1W0HA 4M3XA 2OPPA 3WNFA 5CY4A 1I39A 1RTDA 4W5NA 1QS4A 4DU4A 1KFDA 4AHTA 4Z4EA 1BL3A 4OGCA 2DY4A 4MQ3A 4W5OA 2HNZA 1IKXA 1LAVA 4PQUA 4NYNA 1JL1A 3NH0A 3CM6A 4OPKA 2HHVA 4CK2A 1BIZA 1SL1A 1D9FA 1WSHA 3AO2A 4M3UA 1BHLA 3VQ5A 1UA0A 1J53A 2QK9A 3AVCA 2ETJA 4RW7A 3HJFA 3OYMA 4KAZA 2NUBA 2OPQA 4QOZB 3WNGA 2Y1JA 4ZTJA 4KB1A 4KI6A 1CZBA 3RMBA 4LY7A 3KLFA 4O4GA 1RT7A 3L3UA 3LAMA 4YFUA 1L3SA 3TAFA 3SQ1A 1NKBA 2E6MA 4O55A 3I0SA 4BWMA 4CIGA 4EZ9A 4E7JA 5KTQA 1RBVA 1VRUA 3U3GA 1FKOA 4QAGA 3MXIA 1RT4A 1WSJA 4OVLA 3OYLA 3SPYA 1KTQA 4FJGA 2HNYA 1TAUA 1HYVA 3NF6A 3AVJA 4JRQA 2G8HA 4CERA 1NOYA 4KB0A 3ZT2A 1BCOA 3SV3A 4BACA 2KQ2A 4FCYA 4FJKA 4IG3A 4BDZA 4ZHRA 5J2NA 3AVIA 3PY8A 1CZ9A 1X1PA 3ASMA 3DLBA 1S1TA 3H08A 3TARA 1NJZA 1NKCA 2O4IA 2YNIA 5KI6A 4DFKA 4OLBA 2G8UA 4LSNA 4E7LA 5J2MA 5CYQA 2X74A 1K6YA 2VG7A 3CFRA 1C1AA 4GW6A 4FJXA 4KHWA 3TAQA 1Z25A 5C42A 1TKDA 1IG9A 2WOMA 5C24A 4DQIA 3DLHA 4F2RA 1Z26A 4C8LA 2PYJA 4CJ5A 1CXQA 2GBZA 3RMCA 1WSEA 3HM9A 2Y1IA 1NKEA 3KK2A 4Z4FA 1B92A 3LDSA 4KHYA 3WNEA 2HVHA 1T05A 1C1CA 5K14A 4F8RA 1JLBA 3M8PA 1TVRA 1D9DA 3V9XA 3SUPA 1VSIA 2G8WA 1Q9XA 1RBTA 1ASVA 3MEDA 3SQ4A 3E01A 1TAQA 3NGYA 1IKWA 3QEIA 1F21A 2Z1GA 4N76A 1EX4A 1C0TA 1TK0A 1S6PA 1EKEA 1SV5A 3B6OA 4CF9A 3OYIA 1XWLA 4FLWA 1X9WA 2HHSA 3LZJA 3NAEA 3TABA 4I9LA 2F8TA 3VQPA 1RILA 4CJEA 4LSLA 1S9GA 5CYMA 3L2RA 3VQ6A 1KFSA 1KVAA 1S1UA 2KTQA 2Z1HA 3V4IA 2A1SA 3NF8A 1NK8A 3NCIA 4FM2A 4FJNA 3AA5X 3LPTA 1I3AA 3HP9A 1KVBA 4IBNA 4CFAA 3SUQA 1JL2A 3QIPA 4CGHA 4DSLA 3HT3A 3QERA 3MXMA 3C6UA 3ZT4A 1GOCA 3RR7A 4NCBA 2G8KA 1RT1A 3DLKA 4NCGA 5FRMA 1WLJA 2VG5A 2EX3A 4CIEA 4CEDA 2D0CA 3ZSYA 4E3SA 5C25A 3OJSA 1S1WA 3PV8A 3V81A 1ZBLA 3O3FA 3ISNC 3AO5A 3ZSXA 4CJRA 1CXUA 3DRRA 2ZE2A 3HSTB 1QQCA 2XY7A 1FXXA 1BCMA 4OKEA 1JXBA 1VK0A 4KHUA 3DLGA 4DG1A 3LP2A 3OYDA 3AVFA 4KTZA 3QNOA 4ELTA 2IS3A 4DU1A 1A5WA 4H4MA 4CJSA 2D0BA 4RW9A 1JKHA 3QO9A 3O3HA 1U47A 1S9EA 4CK1A 4O0JA 4IKFA 4N41A 3OYCA 3QIOA 4KI4A 1BISA 3AVLA 3DLRA 4I2QA 2ITGA 4CEFA 4I9QA 3QEWA 4E89A 4CIFA 1UA1A 3TI0A 1CLQA 4CGDA 3DOLA 3TR8A 4OLAA 3LANA 1SL2A 3NGZA 2YNFA 3KTQA 1Q8IA 3TAEA 5HRPA 4HCCA 3F73A 3MECA 3ZCMA 3U6FA 3SYZA 4KHQA 3OYEA 3TAPA 1RCHA 5HBMA 1RBSA 3VA0A 2XRIA 3C94A 4M3WA 1QHTA 4KV8A 3L2QA 2W42A 2YV0X 3EY1A 3BDPA 5FRNA 1XC9A 3SQ0A 1XHXA 1S1XA 1EETA 4B3OA 3FFIA 4DFJA 4CHOA 2VG6A 1LWCA 3ZT1A 4GMJB 3SUOA 3IG1A 3T19A 1YT3A 5FROA 3S3MA 1BQNA 2ZQBA 4Q0BA 1HYSA 2FBVA 3V9WA 1REVA 4W5QA 2G8FA 5JS2A 2X6NA 4N5SA 1NJYA 1XHZA 2F96A 2GV9A 1HNVA 3KIOA 5J2QA 1KCFA 1WAFA 2LSNA 3DLEA 3ITHA 3LP3A 3M8SA 4B9NA 4F2SA 4DS4A 1KLNA 2OYQA 4FW2A 3ZSQA 3S3OA 1TGOA 1JLEA 1LAWA 3AVBA 4NYFA 3JYTA 1L3TA 4FJHA 3OYAA 4FJ9A 4DSKA 4ID1A 3VQCA 4PA1A 4CJTA 1VSEA 5CZ1A 3RRGA 4JLHA 4DQRA 5FDLA 2R7YA 1X9SA 1NJWA 1VSHA 2HNDA 3THVA 2KFZA 4DS5A 1T8EA 2ZD1A 1Q9YA 2QKBA 3I0RA 1RT2A 3TANA 4ELUA 4HUFA 1O1WA 4AHSA 4DFMA 1TKXA 3EYZA 2OZSA 1NK4A 4FZYA 3S3NA 1BQMA 2RKIA 3DYAA 5DMRA 4UQGA 4BE1A 2XY6A 3PO4A 4W5TA 2QKKA 1VSJA 4CGJA 3SJJA 1NK7A 1RBRA 4WE1A 1G15A 4FLYA 3ALYA 2FBTA 4N47A 4CEAA 1JLQA 2VWKA 3M8RA 4DTNA 3UIQA 3HVTA 1LWEA 4RG8A 1SUQA 3LP0A 4PUOA 3SZ2A 3VQ8A 3HP6A 3V6DA 3JSMA 3NBPA 4FJLA 4GVMA 5J2PA 4Y1CA 1C0UA 2DFFA 3OYKA 3KLEA 1IKVA 1UAXA 4DFPA 3QINA 3L2UA 1QSSA 4FJ8A 2XY8A 3VQDA 2JLEA 4N56A 1KLMA 3OYHA 3OYJA 4DU3A 4F3OA 4HCBA 3LWMA 1D8YA 4H8KA 2BDPA 1IO2A 1YTUA 4MFBA 3QLHA 3V9SA 4J2BA 3LAKA 3VQAA 3CQ8A 3QESA 1NK9A 2HMIA 2YHBA 1RDBA 1QE1A 3AO4A
chains in the Genus database with same CATH superfamily
4FPBA 4KRFA 5KQ8A 4JI1K 4DTXA 3TAMA 4EP4A 3KLIA 3VN5A 4EP5A 3AVAA 3PSFA 4CGFA 4Y1DA 2HHXA 2GEMA 3CC4N 4V19S 3AVKA 3TTDA 1SKWA 3P5JA 3C6HA 3VERA 4CJ3A 3D45A 3M1FA 3D2EA 4CF0A 4BVOA 1NJXA 3PIPL 2GUIA 5HLFA 2DTUA 2YCHA 4JAXA 1KAXA 1U45A 4JS4A 4IDHA 2OANA 1VQNN 3L4QA 2AP1A 2E88A 1KVCA 4I2PA 3V1QA 2OA8A 2FBYA 4DR3K 2HHWA 5D3GA 1ASUA 1A5VA 1MWKA 4JHDB 3SBTA 3QFPA 5KRTA 3RMDA 4ISEA 4LF5K 4DTUA 1GLLO 3BZKA 4AH9A 1QTMA 3ZSRA 4LH4A 4J2BA 2Q3SA 1BI4B 4OPJA 4DV3K 3PO5A 3ULDA 2KHOA 4UY8O 1MA9B 2VQFK 4QCLA 3BGRA 4DV4K 4AHVA 1LV5A 2FC0A 4FOIA 4BR4A 2HF3A 3CQYA 4Z4HA 4IFVA 4CF2A 3TAGA 3M5RA 4DQPA 4FW1A 4H0XB 2QWOA 4B3TK 2D0OA 3ZT0A 3H45C 1VSFA 1Z05A 4LF6K 2A41A 3LALA 2HW3A 3VF4A 2IVNA 1ATNA 1N5YA 3PLAA 2NRWA 4PKHA 4JKHA 4H5RA 5SWMA 5FPDA 4DSFA 2A6AA 3F9KA 2P9SA 1YJNN 5BPNA 4IFEA 1QVGM 1IH7A 4O44A 1TK5A 3HK2A 2WONA 1QQOA 1VQMN 1MU2A 2QWMA 3L4IA 1YVNA 4K8XA 3NFAA 1RDAA 1HKCA 3O6WA 5BPMA 3CJBA 3IRXA 1IBLK 4C8NA 3LPUA 1HKBA 3K9KA 3HL8A 4FWMA 1QHAA 3I8BA 3FFKB 4MLEA 4OGEA 3I55N 4YOYA 1QSYA 2FF6A 2V52B 3RRHA 1U48A 3O4NA 4O5FA 4FM1A 4BVPA 3NF9A 3C7NB 3A8YA 4K41A 1W9HA 4DQSA 1T7PA 4B8CA 4DWIA 1NGCA 3MXJA 4LF4K 1NOZA 3AVHA 3HXMA 1RTHA 3CYMA 3RMAA 4BDYA 1TYQB 3AVMA 2Z1IA 2XHBA 3AO3A 3K0SA 1WSGA 1L3UA 3AY9A 5AZIB 2YNHA 3VQBA 3KK1A 4CZEA 1RT3A 3NHGA 4DLEA 4BWJA 4CF1A 1OH5A 1FK9A 5AR0A 3PX0A 5BN8A 5EU7A 4FLZA 3WXLA 4RCHA 3P4IA 4FJJA 3RWUA 3QNNA 4FJ8A 1SKSA 3L3VA 2YKNA 1VQKN 4RW4A 2JGUA 4OKKA 2P5OA 4O0IA 3A5OC 3M3ZA 2IVPA 4B9UA 4IZ9A 3H1QA 3LM2A 5JLHA 1J5OA 5FPNA 3SNNA 1K9MO 4B9MA 4CBXA 4KTQA 4C23A 3WXJA 3NDKA 3C6AA 1ZBUA 3EN9A 1E3MA 4AM6A 5GAEP 1DTQA 3MN6A 4XEIA 2BANA 4KKOA 5AQXA 5LJWA 3CM5A 2D1KA 3OS0A 4LD0A 4WQ4A 4YOXA 4JI2K 1TK8A 5EOYA 3HO1A 4CECA 4F4KA 4HTUA 2KZZA 1C0MA 1RDDA 2P9KB 3AGRA 5TKWA 3WNFA 5C0YA 4W5NA 4OO1J 4DKWA 1LCUA 4W5OA 2HNZA 3T1YK 3A5LC 1NG9A 4CK2A 1SL1A 1YAGA 4M3UA 4E1JA 5CE3A 2QK9A 4RW7A 4QOZB 3E9OA 2Y1JA 2RHKA 4KB1A 3CERA 1VQON 1DEJA 5JICA 4O4GA 1L3SA 3DAWA 2E6MA 4O55A 1VRUA 1FKOA 3OYLA 2HNYA 3OW2M 3CQXA 4JK8A 1NOYA 3ZT2A 4IG3A 3PY8A 2CGLA 1ATSA 1XQSC 4IJNA 2O4IA 4OLBA 3VETA 4LSNA 4E7LA 5J2MA 2X74A 1K6YA 3CFRA 4FJXA 3TAQA 1S22A 1Z25A 1TKDA 5C24A 3R9PA 1OVYA 4F2RA 2PYJA 4CJ5A 2GBZA 3FR0A 2HVHA 3LDSA 1KAYA 1EQYA 1T05A 1C1CA 5K14A 2P9SB 1JLBA 4F8RA 3T7ZA 4JKBA 3S41A 1Q9XA 1RBTA 3WXKA 2FSNA 1ASVA 4CZLA 3NGYA 1IKWA 3QEIA 1C0TA 1SV5A 3OYIA 3B6OA 3SBGA 1HR0K 5F2RA 4I9LA 2F8TA 4EHTA 4KBOA 5CYMA 2KKZA 3ZLJA 2Z1HA 3V4IA 3EEQA 4JV5K 4BQZA 2P9PA 4FJNA 4BG8A 3LPTA 1I3AA 1DKGD 4CFAA 3LDLA 3HT3A 3MXMA 4WFBL 1GOCA 3EL2A 4BRPA 1YJWN 4BY9C 4NCGA 5FRMA 3P38A 1WLJA 1U2VA 4AM7A 1S1WA 2Q0UA 3AO5A 4CJRA 1CXUA 3DRRA 2GWKA 1QQCA 1FXXA 1XMQK 3HRGA 1VK0A 1DT9A 4KHUA 3DLGA 4DG1A 2IS3A 2CH5A 4DV6K 1DGKN 2IIRA 4CK1A 4N41A 4GV3A 4KI4A 3DLRA 3AVLA 4DR7K 4CIFA 3ZYYX 1CLQA 3SAHA 1NGDA 3NGZA 3CI5A 5HRPA 1YUWA 3U6FA 4KHQA 4BRNA 3OYEA 1QHTA 3L2QA 2OTLN 2ZGZA 3SMSA 2W42A 3WUHA 2YV0X 3P31A 5FRNA 1XC9A 3VGLA 4CHOA 1LWCA 4GMJB 3IG1A 4CD1A 1ZBSA 5FROA 1YT3A 3BF1A 2QWQA 3CCQN 4A2AA 3MN5A 5JS2A 2X6NA 3O80A 2W40A 4B1XB 3M8SA 3DLEA 4BRAA 4F2SA 1JJ2M 3FGUA 4FW2A 2ZJQL 4CZKA 1JLEA 1LAWA 3AVBA 1L3TA 4B1ZA 1I94K 4PA1A 3NMUA 1TUYA 5FDLA 1NGGA 4JKDA 3TSPA 3THVA 2KFZA 1RT2A 3UE5A 4FWOA 3SAGA 1TKXA 1NK4A 5AQPA 2RKIA 3DYAA 3PO4A 1BA0A 4UQGA 3DXKA 2FXUA 4W5TA 5LMUK 1WB9A 4CZFA 3W3DA 4J8FA 3ALYA 2FBTA 4CEAA 3M8RA 1JLQA 4KHPK 4X62K 1SUQA 3JSMA 3NBPA 3O4WA 1HX1A 4ISGA 3WT0A 5J2PA 5AQQA 1OH8A 3OYKA 4DFPA 2XY8A 4IWVA 1KLMA 4HCBA 3G4SN 3LWMA 1D8YA 1KXPA 4DQ8A 3THWA 3OBWA 4H0YB 4CZIA 3AO4A 4Z4EA 1VQPN 3PUFA 4DSJA 4IG0A 1JCGA 4BR9A 1DTTA 4DV7K 3A5NC 4AHUA 4CHYA 3DOKA 4MO5A 4X66K 3A2FA 3DRSA 2QXFA 5AQLA 1OH7A 4BR7A 1BO5O 4M45A 3NF7A 4H03B 3O9QA 4DTRA 3GL1A 4J2AA 4R5PA 4E7KA 2W41A 3CFOA 4FLVA 4OKJA 3VTHA 2E2NA 2UUCK 2V7ZA 4FJIA 2Q97A 4WFAL 3VA3A 1GLFO 1BG3A 4E0DA 3K5OA 1GOBA 3VF6A 3CCSN 3LWLA 3EE8A 3AA2A 4OX9K 4PKGA 3THYA 5HOOA 3HBTA 4A2BA 3LP1A 3GBTA 3PX6A 2B6AA 2GTDA 3THXA 1TV6A 2P9PB 3WQTA 1YVUA 2X6SA 1ASWA 1YITN 1QSLA 4FJ5A 3KLHA 2HHQA 3QBWA 3CC2N 1QZ5A 4PWDA 1EWQA 2B4JA 3EKUA 3WNHA 1VQ6N 1HNIA 4C8MA 2W6LA 5BREA 4BREA 1U2VB 3SV4A 3B8AX 1YJ9N 1L5UA 1VSMA 3OVNA 3ZSVA 3P83D 3GG4A 3NGIA 5AQSA 3OYGA 1ITGA 1JLGA 2P9LA 1HRHA 1K8AO 3Q7BA 5KGXA 3K5LA 3I56N 3VQEA 3CFPA 2CGJA 1CZAN 4CFCA 5IT9O 3K57A 3CJ7A 3ZEUA 2ZGYA 2DPNA 3VF2A 2NRHA 3ZSWA 2OPSA 1GOAA 4BDPA 3H6EA 1WAJA 3QB0A 2E2OA 4KPYA 4E7HA 2X78A 4B3MK 4A62A 4YNQA 3SQ2A 3TTFA 2IGIA 2IC3A 4M41A 3HVRA 3DI6A 3LDPA 1ZXOA 2NRRA 1SQKA 2IOCA 4CJQA 4O5BA 4B8AB 3NH2A 4JKGA 4CW7B 3FZHA 4CFDA 4B08A 1WOQA 4BRCA 1ZBFA 4TSXA 2AA4A 2A1RA 3KK7A 3KVGA 3QMLA 3TTCA 4CHZA 4M3RA 2BH1A 3CCEN 2GX9A 2HBMA 3S9HA 4XH5A 1L3VA 2WBNA 2P51A 3ZSOA 4YDUA 3IUCA 2DFHA 4L3QA 4B1WB 1XI1A 3L8BA 1X9JA 3DXKB 3L6QA 1X9MA 1J54A 3OYBA 4FWSA 4Z0UA 3G10A 4XIUA 2E4LA 2VWJA 1XUPO 2ASPA 1FKPA 4G1QA 5HRSA 3ZT3A 2FLOA 2HHUA 1LOTB 4BRHA 3KKRA 4LFBK 1RT5A 2HHTA 1N34K 4PHTX 4IXCA 4K25A 2ATQA 3T3FA 4CK3A 1U4BA 5JS1A 3KD5E 4FWPA 3C6TA 3L2WA 3IS9A 2UXCK 5HRRA 2QXLA 4IFYA 2I5JA 3AA4A 3QETA 2WC9A 3PX4A 3NH1A 3M6GA 2BTFA 1X3NA 3CETA 3T1AA 3UKRA 3K5NA 4CGGA 3KJVA 4M3TA 1B9DA 1EXQA 2J4RA 1S72N 5AQKA 4BQLA 4DLGA 3CPEA 2O4GA 4BR5A 4AHRA 4EZ6A 1VSDA 5FPMA 3CCLN 5AQJA 3OS1A 4DR2K 3HPGA 4DSIA 4JI7K 3KWIA 4ZTFA 3J7ZO 5MLCQ 3AA3A 1V4TA 4CFBA 4CEOA 4NLCA 4LC9B 1NK0A 4DUYK 3THYB 5CY4A 3HTVA 2EWSA 2DY4A 3E66A 4YOWA 5AQUA 3THXB 3F2KA 1LAVA 4PQUA 1JL1A 1YXQA 4OPKA 1BIZA 4LF7K 1D9FA 3AO2A 1K8KA 2PBDA 1J53A 3E1YA 3OYMA 1IJJA 4DR6K 4WQ4C 4U7BA 3RMBA 5FLXO 4LY7A 3L3UA 3VENA 4YFUA 1NKBA 4CIGA 4E7JA 5KTQA 1RBVA 3MXIA 4QAGA 4OPHA 3MN7A 3SPYA 4OVLA 1KTQA 5BRFA 1HNWK 3NF6A 3EO3A 4JRQA 4CERA 2F9TA 3ZX2A 1BCOA 3SV3A 4FO0A 4FCYA 4BDZA 3AVIA 3CCRN 5AQVA 1X1PA 3DLBA 1Q7YO 3H08A 4B3RK 5AQHA 5AJ3K 3ZEUB 2G8UA 5DM7L 5CYQA 2VG7A 4KHWA 4HWIA 1IG9A 2WOMA 3DLHA 1CXQA 2P9IA 1WSEA 3OA9A 4F9OA 4YOUA 3HM9A 3R8EA 1NKEA 3O1WA 2O8BA 3CHWA 2NRZA 5B8HA 1JCFA 1TVRA 4FWQA 3SUPA 3FLCO 2WTUA 3MEDA 5KPRA 3E01A 1TAQA 2E8AA 4JEPA 3N4QA 2Z1GA 1G99A 4CF9A 4FLWA 1XWLA 1NNEA 2F7TA 3TABA 4A57A 4LSLA 3L2RA 1KFSA 3VQ6A 1RFQA 5AQYA 1NMDA 2F4VK 3VEWA 4IOAL 3AA5X 3CCMN 5F1XA 3BY5A 1KVBA 4PL8A 4IBNA 4DSLA 4CZJA 3C6UA 3RR7A 3ENBA 4LF8K 3FE1A 5M1OA 3DLKA 5JVHL 4CIEA 4CEDA 3H1VX 3WXIA 4JI4K 3OJSA 3ZSXA 3MX5A 2E2QA 4A5BA 2VGNA 3HSTB 4JI6K 3EE9A 4ELTA 2UU9K 4KTZA 4DU1A 3HSCA 1IBKK 3D2EB 1A5WA 4H4MA 1U47A 4RW9A 4HTLA 3ULEA 4WQ5A 3HOSA 4MDAA 3J7YP 1BISA 2ITGA 2HBLA 2Q2RA 3VGMA 3TI0A 3TR8A 4A5AA 3LANA 1Q8IA 3TAEA 4JKCA 4HCCA 3SYZA 1BU6O 4RTFD 1RCHA 2Q31A 4KV8A 1GLCG 3IMXA 1Y64A 4H5VA 3G71N 1KD1O 3EY1A 3SQ0A 1EETA 2E1ZA 1J5EK 4KH4A 2FBVA 3V9WA 4W5QA 2G8FA 5LY3A 5ELZA 3ID6A 1XHZA 5J2QA 3ITHA 3LP3A 3QFUA 2ZF5O 1KLNA 2OYQA 4LFCK 1NMNA 2HBJA 4FJ9A 5GAGP 4DSKA 4ID1A 3VQCA 1BUPA 1NJWA 3MK6A 1T8EA 2QKBA 5DM6L 3CF5L 3S3NA 1N8RO 1NGIA 3VEYA 3D2FA 3O8MA 3O08A 3CJ9A 1NK7A 1RBRA 1KC8O 1NGAA 1RDUA 4RG8A 1W2BM 4JK9A 3FZKA 3SZ2A 4MO4A 3ATUA 4YOTA 1K8KB 1XMOK 5A2QO 1IKVA 1UAXA 2YHXA 3L2UA 5M1QA 2JLEA 1IO2A 1SS6A 4MFBA 1WBBA 4U67L 2GELA 1YI2N 4DR5K 4BGBA 1J6ZA 4CCHA 2RN2A 4RWTA 3V9UA 1NGJA 1E4FT 1Z6RA 3KD1E 2EHGA 3K58A 4KHYA 3U9ZA 4BE2A 3D0PA 4BC5A 3O4QA 5T7BA 4O8UA 4O8KA 3KLGA 4B9LA 2WFBA 2OTJN 1J9AA 3I33A 1HNZK 3IKMA 4CJUA 4FLTA 3DJCA 3OTOK 4FWNA 1S1VA 1VQ5N 2VGMA 1RTJA 5HL7L 4H5NA 3C0BA 1RBUA 2P9IB 4KHSA 1W7AA 2O8BB 4CE9A 3HPOA 4NLBA 3VQ7A 4W5RA 4CEEA 4CJVA 1SAZA 1H1VA 2PYLA 3TU5A 3V1OA 1TKZA 4DTSA 3AARA 5AQZA 4FM0A 1XC3A 5M1KA 4EFHA 4FJ7A 4JI3K 3KHYA 3L2VA 2QW9A 1ILYA 5C2FA 4E19A 3P1GA 2PZSA 5HRNA 4EAHD 2AJQA 1EWRA 2D5RA 1VQ9N 1S5JA 2Z1JA 4Z4CA 2E20A 1YTAA 3VTIA 4H5WA 4BRMA 2D4WA 5I9EB 1LW0A 4IO8A 2FF3B 1GLBG 5IWAK 3K9JA 4JS5A 1WN7A 3IAYA 5BRHA 4FWRA 4CJ4A 5KRSA 4KREA 3DRPA 1JLAA 4HUGA 4CEQA 5AFUA 3DM2A 1GLEG 2VQEK 4BE0A 4B9VA 4RW6A 3ULEB 4HHTA 4KTWA 1JLCA 3V9ZA 3J80O 1NGHA 4K43A 4JNEA 3AVGA 1JXEA 3BZCA 3ENHA 3NVKA 4B9QA 1VSKA 3D6RA 3ENOA 3O3GA 3RSEA 4YHHK 2HBKA 1NGBA 3KK3A 1C6VA 1KSPA 4DR1K 1UWBA 2ASMA 3SCXA 4F3TA 2YNGA 4CI6A 3K59A 1FW6A 4FXDA 1QZ6A 1HMVA 1HUXA 2BUPA 3G25A 4B1VA 2PY5A 1S3XA 4G9ZA 4KHNA 1RTIA 4C8KA 2G8VA 1R0AA 1T03A 4J2EA 3A0IX 1IBMK 3TSUA 5C2DA 4DV0K 4E7IA 1JCEA 4KH6A 4QS7A 3CMEN 5GAHP 4NO7A 3VQQA 3C95A 2IDOA 1EP4A 3D2FB 4CHQA 2B5JA 3HYFA 5EXWA 4Q5VA 4X65K 5HROA 1ZYQA 2HOEA 1P8ZA 4M3ZA 3VPZA 3CCVN 1D5AA 4JI0K 4JHDA 3G6EN 5EY4A 4BRLA 1KRPA 1E4GT 2WUSA 4CHNA 2E6LA 4PY5A 4YDUC 3EZWA 3CG7A 3KWGA 4C8OA 1SKRA 1NK6A 2O8CA 4RW8A 1BI4A 1UOCA 4IEEA 2G8IA 2P9UA 4L8RB 3J81O 4DTMA 1GLAG 5LJVA 2ZJPL 1A5XA 3CCUN 1BIUA 4DCHA 3TWHA 4NXNK 3QEPA 1U49A 3K5MA 3MEEA 3SUNA 2UYTA 3AO1A 4EIAA 2NRTA 5CZ2A 4DF4A 1VQ7N 2OZMA 4NCAA 4FK2A 3AV9A 4CJWA 3MAQA 3UKUA 4FWKA 3QDKA 3CCJN 1SL0A 4FZZA 4Z4IA 3U8XA 4LH5A 4M42A 1MDUB 2YKMA 5C10A 4FWLA 4CGIA 4IDKA 4KH5A 1VAZA 1NM1A 2NLXA 4M7XA 4Z94A 5E41A 3K2PA 1TKTA 1X3MA 4CJFA 4I7FA 4K8ZA 4QS9A 1W0HA 2F9WA 3SMPA 3D7EO 1I39A 4PKIA 3L0QA 4CZHA 1NU0A 4YY3K 1VQLN 1YF5L 3IFRA 2NRXA 1WSHA 1BHLA 3VQ5A 1UA0A 3AVCA 2ETJA 4KAZA 3WNGA 4ZTJA 3JAMO 1CZBA 2ZWHA 3LAMA 2NZTA 3SQ1A 5H1SQ 3C65A 3I0SA 2E1YA 4EZ9A 3U3GA 3RVCA 2ZJRL 2UXDK 1TAUA 1C0FA 4FJGA 4CBWA 3AVJA 2G8HA 1T44A 3BP8A 4KB0A 4YORA 4BACA 2KQ2A 4FJKA 3J7AP 2IVOA 4ZHRA 5J2NA 3ASMA 2RE2A 4PL7A 4CZGA 5TKYA 1NJZA 1NKCA 5KI6A 4DFKA 1HLUA 3MWTA 4BGAA 4CVNE 1C1AA 4GW6A 5F0XA 4B1UB 3CJCA 3EKSA 4WYBA 4C1NK 1B92A 3KK2A 3V9XA 3U4LA 2G8WA 3RSEB 3QBXA 2QM1A 4BRQA 5C12A 3T69A 1F21A 1EX4A 1TK0A 1S6PA 5AQFA 5KPZA 1X9WA 2UUAK 3LZJA 3VQPA 1RILA 5GIPA 1KVAA 4DR4K 1S1UA 1NK8A 4FM2A 3SK3A 1N32K 3THWB 2ITMA 4DUZK 3QERA 1M90O 5AFUH 3ZT4A 4NCBA 4BRGA 1RT1A 2P9NA 3CXCM 2VG5A 2EX3A 2D0CA 3ZSYA 4E3SA 3O9RA 1N33K 3PV8A 3V81A 1ZBLA 3PIOL 2ZE2A 3DWLA 2QI2A 2XY7A 1BCMA 4OKEA 1JXBA 3QNOA 3AVFA 2P9KA 3AGKA 4CJSA 2D0BA 1JKHA 4BR0A 4I6MA 1S9EA 5LL6Z 4O0JA 4IKFA 4C1NI 1WBDA 1WUAA 4I9QA 3QEWA 1UA1A 2YNFA 3KTQA 2O8CB 3F73A 3MECA 3ZCMA 3WXMB 2P9UB 3TAPA 3VEXA 1RBSA 5AQGA 3C94A 4M3WA 3U9DA 4IOCL 5KPTA 2YI1A 2QWRA 3ATVA 1XHXA 4JK7A 3MWPA 4DFJA 1NWKA 3ZT1A 1BOTO 4H0PA 3S3MA 1BQNA 4WQ5C 4Q0BA 1HYSA 2V51B 1NJYA 1P90A 3UKUB 4N5SA 2F96A 2GV9A 5BR8K 1FJGK 4B9NA 4JKEA 3O1BA 4DS4A 3S3OA 3OYAA 2CGKA 2OCEA 3RRGA 1VSEA 5CZ1A 1X9SA 2ZM6K 3VGKA 4DS5A 2ZD1A 3I0RA 3O5BA 3TANA 3J8AA 1O1WA 3DLLL 4DFMA 2OZSA 2P9LB 4DB3A 4BE1A 5DMRA 2XY6A 2QKKA 4LF9K 3AAPA 5BPLA 4FLYA 4ILHA 4N47A 2VWKA 3SJHA 4DTNA 3HVTA 1LWEA 3LP0A 1BDGA 2Q36A 5AZJA 4K0KK 1ZC6A 4GVMA 5ADXA 1C0UA 1ESVA 3KLEA 3QINA 4F3OA 3OYHA 2HSTA 1Q86O 5AQIA 4H8KA 1HPMA 1YTUA 3LAKA 3VQAA 3CQ8A 5GIOA 3QESA 4JKGB 1NK9A 1OH6A 2YHBA 2HMIA 1QE1A 4R79A 4H5TA 3FZMA 3OY9A 1TL3A 3CC7N 3QEVA 4IOXA 4QS8A 1T6CA 3HM8A 4BRFA 5HP1A 5AQRA 1Q81O 3R3LA 1LWFA 2RPIA 4GV9A 1HYZA 3F9MA 2QWLA 1ZBIA 4DTJA 1IKYA 4JKFA 1WSFA 4ELVA 4DTOA 2KFNA 4CD3A 1YIJN 1RDCA 3I8DA 3F5TA 2QWPA 3AVNA 4BC4A 4JN4A 1Q18A 4CHPA 1C0GA 4FVUA 2XY5A 5KGWA 3OJUA 3OYFA 2YJEA 4FYDA 2HVIA 5DK5A 1YHQN 3ZX0A 1SZ2A 4AILC 1WSIA 5AQOA 1NGEA 1C1BA 1ATRA 3SI6A 4FZXC 2A42A 2KLAA 3ZX3A 5FPEA 2A40A 2NNWA 3WEEA 1RNHA 2P9NB 4FSVA 4WFNL 4DTPA 3VQ9A 2P5GA 5JVGL 1B9FA 4CJ7A 4FK4A 3UKRB 1U6ZA 1W97L 2D0AA 3KKSA 4H0TB 2CH6A 4DMNA 4ILJA 1BA1A 4DF8A 2BE2A 1HQEA 4DV5K 3QEXA 1NK5A 4ID5A 3MCPA 4I6MB 2D0PA 3MN9A 5CHIA 3RTVA 4JRPA 2YHWA 4CEZA 4DHYA 3HPHA 1KQSM 3GOIA 3CJ1A 2IAJA 2JWLA 2GWJA 1Y97A 2PAVA 5EX5A 2KW4A 1IV0A 4MLHA 3QICA 2E2PA 3CMAN 2KZMA 3GDQA 1NJIO 2XO7A 4KFBA 3FZLA 5M1NA 2HB5A 4M7YA 1N36K 4J2DA 1HQUA 5I42A 2BGGA 4JI8K 1HNXK 1WNSA 3CPWM 3VEZA 2HMPA 5M1FA 4FLXA 4GY2B 3SPZA 1Q82O 3VMFB 3ZSZA 2UXBK 4LFAK 4E1NA 4B9TA 3MCAB 1HJRA 4AF1A 3HZ6A 2O8EA 2QWNA 4Z4GA 1BGXT 3EZ5A 3SLCA 4IO9L 2O8FA 4DSEA 2YHAA 4H4OA 3G0ZA 3LZIA 2VCPA 5EVZA 1RT6A 4B9SA 3KZBA 1U04A 4AHCA 3VQ4A 5BRDA 4N76A 5SZTA 4OJRA 5AZJB 2Q0RA 2V7YA 2F8SA 3A5MC 4M3YA 5BR9A 4HVJA 3RR8A 1HPZA 3DXMA 3ID8A 4BRIA 3B6PA 1VSLA 1JLFA 3TSQA 4CF8A 1T6DA 1VRTA 3OYNA 1IG8A 2RF2A 2OPRA 1ZBHA 5JMVA 4FK0A 4CESA 4CJKA 4FVMA 4JI5K 4FLUA 1LW2A 5AQMA 3MDQA 1XNRK 1MWMA 3M8QA 3BF3A 3H3OB 4E1MA 3T1HK 4JD2A 5J1EA 5GINA 3U3YA 4CJPA 1RDWX 3WQUA 3CIPA 3NE6A 5AQNA 5I3UA 4ILGB 2P1JA 3E9LA 4CEBA 4NB4A 4X64K 3VOVA 3R6MA 5E84A 2DFEA 3VESA 4DV2K 2A3ZA 4XH4A 3V1RA 4A61A 3MEGA 1DLOA 3LDNA 4ICLA 5BN9A 4FJMA 3OS2A 2FBXA 3AAQA 1N6QA 4DQQA 4K42A 3ZETA 3DMJA 4BR2A 2HHHK 4KO0A 1S6QA 4CJLA 5ADXH 2O8DA 4HUEA 1O13A 1TL1A 4M3XA 2OPPA 4GKKK 1RTDA 1QS4A 4DU4A 1KFDA 4AHTA 4AQYK 1BL3A 4OGCA 4MQ3A 3JXUA 2ASOA 1IKXA 2YX6A 3O9TA 1EO1A 4NYNA 3NH0A 3CM6A 2HHVA 2GUPA 4BROA 3HJFA 4GV6A 2NUBA 2OPQA 4CBUA 3WEEB 4CZMA 4KI6A 5LMNK 3KLFA 1RT7A 4WF9L 3JS6A 3N4PA 3TAFA 4BWMA 2VWBA 5JLFA 3SAFA 4IEIA 1QQMA 1RT4A 1WSJA 1HYVA 1T3VA 2A5XA 4ISFA 3HOTA 3R1XA 2QEXN 3H46O 2JWKA 2QA4N 4B1YB 1CZ9A 3H3NO 1S1TA 1NGFA 3TARA 2YNIA 1NLVA 3UB5A 5C42A 4DQIA 1Z26A 3BUZB 4C8LA 3LL3A 3RMCA 2Y1IA 4Z4FA 2VYPA 3WNEA 3MMVA 2Q1NA 3M8PA 1D9DA 1VSIA 4BG9A 4XH1A 3PSIA 3SQ4A 4OPAA 2HHSA 1EKEA 2FSJA 3NAEA 4EHUA 4MDBA 5E26A 2H3GX 4CJEA 4A59A 1S9GA 1BWFO 3FZFA 2KTQA 2E5LK 2A1SA 4M63C 3NF8A 3NCIA 2YHYA 3HP9A 3SUQA 1JL2A 3QIPA 4CGHA 4H0VB 3HI0A 5AQWA 2G8KA 2O8EB 2NRVA 4WCEL 1GLDG 5C25A 2O8FB 2HF4A 3O3FA 3ISNC 4GKJK 1D4XA 1V4SA 2PFUA 3LP2A 3OYDA 2I7NA 3TPQA 1NBWA 3QO9A 3O3HA 1OKJA 4GNIA 4BC2A 5KQDA 3P39A 4BC3A 3QIOA 3OYCA 4I2QA 1M1KO 4CEFA 3DXMB 4E89A 2QTDA 4CGDA 3DOLA 4OLAA 1SL2A 3LDQA 1KAZA 4GVEA 4NXMK 4BRKA 3MX2A 1GLJO 5HBMA 3VA0A 1HKGA 2XRIA 5AQTA 3O9UA 3BDPA 4YOVA 1S1XA 3IDHA 4B3OA 3FFIA 3SUOA 2VG6A 3BEXA 3Q7CA 1RGIA 4DV1K 3T19A 4JD2B 2ZQBA 3LDOA 1REVA 3CJAA 1XNQK 3KIOA 1HNVA 1KCFA 1WAFA 2LSNA 2UUBK 1QQNA 5M1PA 3ZSQA 1TGOA 4NYFA 5CR4A 3JYTA 4FJHA 1HJOA 4BRDA 1QVFM 4CJTA 4JLHA 4DQRA 4H0OA 2R7YA 3NVMA 1VSHA 2HNDA 1OVQA 2W6KA 1Q9YA 1K73O 3C7NA 4ELUA 4HUFA 4AHSA 3EYZA 3ZETB 4FZYA 1BQMA 2FSKA 1TUUA 2O8DB 1VSJA 2YJFA 4CGJA 5C15A 3SJJA 4WE1A 3VEVA 1G15A 3E9PA 4FL9A 3VEOA 3UIQA 4JKAA 1TYQA 1VQ8N 4PUOA 3LM9A 3VQ8A 3HP6A 3V6DA 3CD6N 5AZIA 3O9SA 3GE1A 4FJLA 4FPAA 4Y1CA 4IJAA 2DFFA 2I7PA 1VHXA 1QSSA 3OBYA 3VQDA 4DU3A 4N56A 3OYJA 3OHRA 2BDPA 1R59O 3QLHA 3V9SA 5GADP 3W0LA 1VQ4N 4Y0WA 4B3SK 1RDBA 4JYAK 4FOEA
chains in the Genus database with same CATH topology
3V9UA 3OY9A 1TL3A 4KRFA 3QEVA 3PUFA 4DSJA 4IG0A 3KD1E 2EHGA 1DTTA 3TAMA 4EP4A 3KLIA 3VN5A 4EP5A 3K58A 3AVAA 4DTXA 4BE2A 4AHUA 3D0PA 5T7BA 3O4QA 4CHYA 3DOKA 4CGFA 3KLGA 4B9LA 3A2FA 3DRSA 4Y1DA 2HHXA 1J9AA 1LWFA 2QXFA 2RPIA 1HYZA 4CJUA 4FLTA 1ZBIA 3AVKA 4M45A 4DTJA 1S1VA 1SKWA 3P5JA 1RTJA 1IKYA 3NF7A 4CJ3A 4DTRA 4J2AA 1WSFA 1RBUA 3D45A 4R5PA 4ELVA 4E7KA 4DTOA 4CF0A 1NJXA 2KFNA 3CFOA 4FLVA 1RDCA 2GUIA 4OKJA 3I8DA 5HLFA 4KHSA 2DTUA 4FJIA 4CE9A 3HPOA 3AVNA 3VA3A 4CHPA 4E0DA 3K5OA 3VQ7A 1GOBA 1U45A 4JS4A 4W5RA 3LWLA 4CEEA 4CJVA 2XY5A 3AA2A 5KGWA 2PYLA 3OJUA 3V1OA 1KVCA 1TKZA 4I2PA 3V1QA 3OYFA 4DTSA 4FM0A 2OA8A 2FBYA 2HHWA 5D3GA 4FYDA 2HVIA 1ASUA 1A5VA 5DK5A 5KRTA 3LP1A 3RMDA 4FJ7A 4DTUA 4AILC 1WSIA 3PX6A 4AH9A 2B6AA 1C1BA 3L2VA 4E19A 1TV6A 3P1GA 3SI6A 3ZSRA 4LH4A 1QTMA 2PZSA 5HRNA 3RWUA 4FZXC 1YVUA 2X6SA 1ASWA 2Q3SA 1QSLA 4FJ5A 2AJQA 1BI4B 2D5RA 4OPJA 3PO5A 3KLHA 1S5JA 2HHQA 3ULDA 2Z1JA 4Z4CA 1YTAA 4PWDA 1RNHA 4QCLA 2B4JA 3WNHA 3BGRA 1LW0A 1HNIA 4C8MA 4AHVA 4DTPA 3VQ9A 2P5GA 1LV5A 2FC0A 4JS5A 1WN7A 1B9FA 3SV4A 3IAYA 1L5UA 1VSMA 3OVNA 3ZSVA 3P83D 4FK4A 3NGIA 4CJ4A 5KRSA 4Z4HA 4KREA 3OYGA 4IFVA 1ITGA 3DRPA 4CF2A 1JLAA 1JLGA 2D0AA 3KKSA 1HRHA 4CEQA 4DMNA 4HUGA 3TAGA 4DQPA 3DM2A 4FW1A 5KGXA 3K5LA 4DF8A 2BE2A 1HQEA 3VQEA 4BE0A 3QEXA 3ZT0A 3CFPA 4B9VA 1NK5A 1VSFA 4RW6A 4CFCA 4ID5A 4HHTA 3LALA 4KTWA 3K57A 1JLCA 2HW3A 3V9ZA 3RTVA 4JRPA 4CEZA 1N5YA 3HPHA 3ZSWA 2OPSA 1GOAA 4BDPA 1WAJA 2IAJA 5SWMA 4KPYA 3AVGA 1JXEA 1Y97A 4E7HA 4DSFA 2X78A 3F9KA 1VSKA 2KW4A 3O3GA 4YNQA 3SQ2A 1IH7A 4O44A 2KZMA 1TK5A 3HK2A 2IGIA 2WONA 2IC3A 3KK3A 4M41A 3HVRA 3DI6A 1C6VA 1MU2A 2XO7A 1KSPA 4CJQA 2IOCA 4KFBA 4O5BA 1UWBA 4B8AB 3NH2A 3SCXA 4K8XA 4F3TA 2YNGA 4CFDA 3K59A 4FXDA 2HB5A 3NFAA 1RDAA 4B08A 1HMVA 2PY5A 3IRXA 4C8NA 4J2DA 1HQUA 3LPUA 5I42A 1ZBFA 4TSXA 1RTIA 4KHNA 2BGGA 4C8KA 2G8VA 1WNSA 1R0AA 3HL8A 1T03A 2A1RA 4J2EA 4FLXA 3SPZA 4CHZA 4M3RA 4OGEA 2RN2A 3ZSZA 5HP1A 3RRHA 4E7IA 1U48A 1QSYA 3S9HA 4E1NA 3O4NA 1L3VA 4B9TA 4FM1A 1HJRA 2P51A 3NF9A 3VQQA 3C95A 3ZSOA 2DFHA 4Z4GA 2IDOA 1BGXT 1W9HA 3L8BA 4DQSA 1EP4A 3EZ5A 1XI1A 1T7PA 4B8CA 4DWIA 3MXJA 4DSEA 1X9MA 1NOZA 4CHQA 2YHAA 1J54A 3AVHA 4H4OA 3G0ZA 2B5JA 3HYFA 3OYBA 3HXMA 4Q5VA 3LZIA 4Z0UA 3G10A 5HROA 1ZYQA 1RTHA 4XIUA 3CYMA 2E4LA 3RMAA 4M3ZA 4BDYA 2VWJA 1RT6A 4B9SA 3AVMA 1U04A 1FKPA 3AO3A 2Z1IA 4G1QA 3VQ4A 4AHCA 5HRSA 2XHBA 1WSGA 4OJRA 3ZT3A 5SZTA 1L3UA 2F8SA 2HHUA 1D5AA 2YNHA 3VQBA 3KKRA 3KK1A 1RT5A 2HHTA 1RT3A 3NHGA 4DLEA 4M3YA 4HVJA 4BWJA 4CF1A 1KRPA 1FK9A 3RR8A 1HPZA 3PX0A 4CHNA 2ATQA 2E6LA 5EU7A 4CK3A 3T3FA 1U4BA 4PY5A 3CG7A 4C8OA 5JS1A 1SKRA 1NK6A 4FLZA 3KD5E 3B6PA 1VSLA 1JLFA 4RW8A 4FJJA 1BI4A 1UOCA 4CF8A 3QNNA 1VRTA 3C6TA 3OYNA 3L2WA 2RF2A 3IS9A 1SKSA 3L3VA 2YKNA 4L8RB 2G8IA 4RW4A 2JGUA 2OPRA 4OKKA 5HRRA 4DTMA 2P5OA 4FK0A 4O0IA 1ZBHA 4CESA 4CJKA 4IFYA 1A5XA 1BIUA 2I5JA 4FVMA 3AA4A 4FLUA 1LW2A 3TWHA 4B9UA 3QETA 3QEPA 4CCHA 3M8QA 1U49A 3K5MA 3PX4A 4E1MA 3NH1A 3MEEA 3SUNA 1J5OA 3AO1A 3SNNA 5CZ2A 5J1EA 3T1AA 4DF4A 2OZMA 4NCAA 3U3YA 3K5NA 3AV9A 4CGGA 4CJPA 4CJWA 3KJVA 4FK2A 4M3TA 3MAQA 1B9DA 1EXQA 4B9MA 1SL0A 4KTQA 4FZZA 4Z4IA 3NE6A 3NDKA 4DLGA 2O4GA 5I3UA 4AHRA 1ZBUA 2P1JA 4LH5A 4CEBA 4M42A 4EZ6A 2YKMA 1DTQA 1VSDA 2BANA 4KKOA 3OS1A 2DFEA 3HPGA 4DSIA 3CM5A 4ZTFA 3V1RA 4CGIA 4IDKA 3MEGA 1DLOA 3OS0A 4ICLA 5E41A 4LD0A 4FJMA 3AA3A 3OS2A 2FBXA 3K2PA 4CFBA 1N6QA 1TKTA 4CEOA 4DQQA 3DMJA 1TK8A 4KO0A 1S6QA 4CJFA 4I7FA 4CJLA 4K8ZA 3HO1A 4CECA 4F4KA 4HTUA 4HUEA 2KZZA 1C0MA 1NK0A 1RDDA 1TL1A 1W0HA 4M3XA 2OPPA 3WNFA 5CY4A 1I39A 1RTDA 4W5NA 1QS4A 4DU4A 1KFDA 4AHTA 4Z4EA 1BL3A 4OGCA 2DY4A 4MQ3A 4W5OA 2HNZA 1IKXA 1LAVA 4PQUA 4NYNA 1JL1A 3NH0A 3CM6A 4OPKA 2HHVA 4CK2A 1BIZA 1SL1A 1D9FA 1WSHA 3AO2A 4M3UA 1BHLA 3VQ5A 1UA0A 1J53A 2QK9A 3AVCA 2ETJA 4RW7A 3HJFA 3OYMA 4KAZA 2NUBA 2OPQA 4QOZB 3WNGA 2Y1JA 4ZTJA 4KB1A 4KI6A 1CZBA 3RMBA 4LY7A 3KLFA 4O4GA 1RT7A 3L3UA 3LAMA 4YFUA 1L3SA 3TAFA 3SQ1A 1NKBA 2E6MA 4O55A 3I0SA 4BWMA 4CIGA 4EZ9A 4E7JA 5KTQA 1RBVA 1VRUA 3U3GA 1FKOA 4QAGA 3MXIA 1RT4A 1WSJA 4OVLA 3OYLA 3SPYA 1KTQA 4FJGA 2HNYA 1TAUA 1HYVA 3NF6A 3AVJA 4JRQA 2G8HA 4CERA 1NOYA 4KB0A 3ZT2A 1BCOA 3SV3A 4BACA 2KQ2A 4FCYA 4FJKA 4IG3A 4BDZA 4ZHRA 5J2NA 3AVIA 3PY8A 1CZ9A 1X1PA 3ASMA 3DLBA 1S1TA 3H08A 3TARA 1NJZA 1NKCA 2O4IA 2YNIA 5KI6A 4DFKA 4OLBA 2G8UA 4LSNA 4E7LA 5J2MA 5CYQA 2X74A 1K6YA 2VG7A 3CFRA 1C1AA 4GW6A 4FJXA 4KHWA 3TAQA 1Z25A 5C42A 1TKDA 1IG9A 2WOMA 5C24A 4DQIA 3DLHA 4F2RA 1Z26A 4C8LA 2PYJA 4CJ5A 1CXQA 2GBZA 3RMCA 1WSEA 3HM9A 2Y1IA 1NKEA 3KK2A 4Z4FA 1B92A 3LDSA 4KHYA 3WNEA 2HVHA 1T05A 1C1CA 5K14A 4F8RA 1JLBA 3M8PA 1TVRA 1D9DA 3V9XA 3SUPA 1VSIA 2G8WA 1Q9XA 1RBTA 1ASVA 3MEDA 3SQ4A 3E01A 1TAQA 3NGYA 1IKWA 3QEIA 1F21A 2Z1GA 4N76A 1EX4A 1C0TA 1TK0A 1S6PA 1EKEA 1SV5A 3B6OA 4CF9A 3OYIA 1XWLA 4FLWA 1X9WA 2HHSA 3LZJA 3NAEA 3TABA 4I9LA 2F8TA 3VQPA 1RILA 4CJEA 4LSLA 1S9GA 5CYMA 3L2RA 3VQ6A 1KFSA 1KVAA 1S1UA 2KTQA 2Z1HA 3V4IA 2A1SA 3NF8A 1NK8A 3NCIA 4FM2A 4FJNA 3AA5X 3LPTA 1I3AA 3HP9A 1KVBA 4IBNA 4CFAA 3SUQA 1JL2A 3QIPA 4CGHA 4DSLA 3HT3A 3QERA 3MXMA 3C6UA 3ZT4A 1GOCA 3RR7A 4NCBA 2G8KA 1RT1A 3DLKA 4NCGA 5FRMA 1WLJA 2VG5A 2EX3A 4CIEA 4CEDA 2D0CA 3ZSYA 4E3SA 5C25A 3OJSA 1S1WA 3PV8A 3V81A 1ZBLA 3O3FA 3ISNC 3AO5A 3ZSXA 4CJRA 1CXUA 3DRRA 2ZE2A 3HSTB 1QQCA 2XY7A 1FXXA 1BCMA 4OKEA 1JXBA 1VK0A 4KHUA 3DLGA 4DG1A 3LP2A 3OYDA 3AVFA 4KTZA 3QNOA 4ELTA 2IS3A 4DU1A 1A5WA 4H4MA 4CJSA 2D0BA 4RW9A 1JKHA 3QO9A 3O3HA 1U47A 1S9EA 4CK1A 4O0JA 4IKFA 4N41A 3OYCA 3QIOA 4KI4A 1BISA 3AVLA 3DLRA 4I2QA 2ITGA 4CEFA 4I9QA 3QEWA 4E89A 4CIFA 1UA1A 3TI0A 1CLQA 4CGDA 3DOLA 3TR8A 4OLAA 3LANA 1SL2A 3NGZA 2YNFA 3KTQA 1Q8IA 3TAEA 5HRPA 4HCCA 3F73A 3MECA 3ZCMA 3U6FA 3SYZA 4KHQA 3OYEA 3TAPA 1RCHA 5HBMA 1RBSA 3VA0A 2XRIA 3C94A 4M3WA 1QHTA 4KV8A 3L2QA 2W42A 2YV0X 3EY1A 3BDPA 5FRNA 1XC9A 3SQ0A 1XHXA 1S1XA 1EETA 4B3OA 3FFIA 4DFJA 4CHOA 2VG6A 1LWCA 3ZT1A 4GMJB 3SUOA 3IG1A 3T19A 1YT3A 5FROA 3S3MA 1BQNA 2ZQBA 4Q0BA 1HYSA 2FBVA 3V9WA 1REVA 4W5QA 2G8FA 5JS2A 2X6NA 4N5SA 1NJYA 1XHZA 2F96A 2GV9A 1HNVA 3KIOA 5J2QA 1KCFA 1WAFA 2LSNA 3DLEA 3ITHA 3LP3A 3M8SA 4B9NA 4F2SA 4DS4A 1KLNA 2OYQA 4FW2A 3ZSQA 3S3OA 1TGOA 1JLEA 1LAWA 3AVBA 4NYFA 3JYTA 1L3TA 4FJHA 3OYAA 4FJ9A 4DSKA 4ID1A 3VQCA 4PA1A 4CJTA 1VSEA 5CZ1A 3RRGA 4JLHA 4DQRA 5FDLA 2R7YA 1X9SA 1NJWA 1VSHA 2HNDA 3THVA 2KFZA 4DS5A 1T8EA 2ZD1A 1Q9YA 2QKBA 3I0RA 1RT2A 3TANA 4ELUA 4HUFA 1O1WA 4AHSA 4DFMA 1TKXA 3EYZA 2OZSA 1NK4A 4FZYA 3S3NA 1BQMA 2RKIA 3DYAA 5DMRA 4UQGA 4BE1A 2XY6A 3PO4A 4W5TA 2QKKA 1VSJA 4CGJA 3SJJA 1NK7A 1RBRA 4WE1A 1G15A 4FLYA 3ALYA 2FBTA 4N47A 4CEAA 1JLQA 2VWKA 3M8RA 4DTNA 3UIQA 3HVTA 1LWEA 4RG8A 1SUQA 3LP0A 4PUOA 3SZ2A 3VQ8A 3HP6A 3V6DA 3JSMA 3NBPA 4FJLA 4GVMA 5J2PA 4Y1CA 1C0UA 2DFFA 3OYKA 3KLEA 1IKVA 1UAXA 4DFPA 3QINA 3L2UA 1QSSA 4FJ8A 2XY8A 3VQDA 2JLEA 4N56A 1KLMA 3OYHA 3OYJA 4DU3A 4F3OA 4HCBA 3LWMA 1D8YA 4H8KA 2BDPA 1IO2A 1YTUA 4MFBA 3QLHA 3V9SA 4J2BA 3LAKA 3VQAA 3CQ8A 3QESA 1NK9A 2HMIA 2YHBA 1RDBA 1QE1A 3AO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V9U A;  3OY9 A;  1TL3 A;  4KRF A;  3QEV A;  3PUF A;  4DSJ A;  4IG0 A;  3KD1 E;  2EHG A;  1DTT A;  3TAM A;  4EP4 A;  3KLI A;  3VN5 A;  4EP5 A;  3K58 A;  3AVA A;  4DTX A;  4BE2 A;  4AHU A;  3D0P A;  5T7B A;  3O4Q A;  4CHY A;  3DOK A;  4CGF A;  3KLG A;  4B9L A;  3A2F A;  3DRS A;  4Y1D A;  2HHX A;  1J9A A;  1LWF A;  2QXF A;  2RPI A;  1HYZ A;  4CJU A;  4FLT A;  1ZBI A;  3AVK A;  4M45 A;  4DTJ A;  1S1V A;  1SKW A;  3P5J A;  1RTJ A;  1IKY A;  3NF7 A;  4CJ3 A;  4DTR A;  4J2A A;  1WSF A;  1RBU A;  3D45 A;  4R5P A;  4ELV A;  4E7K A;  4DTO A;  4CF0 A;  1NJX A;  2KFN A;  3CFO A;  4FLV A;  1RDC A;  2GUI A;  4OKJ A;  3I8D A;  5HLF A;  4KHS A;  2DTU A;  4FJI A;  4CE9 A;  3HPO A;  3AVN A;  3VA3 A;  4CHP A;  4E0D A;  3K5O A;  3VQ7 A;  1GOB A;  1U45 A;  4JS4 A;  4W5R A;  3LWL A;  4CEE A;  4CJV A;  2XY5 A;  3AA2 A;  5KGW A;  2PYL A;  3OJU A;  3V1O A;  1KVC A;  1TKZ A;  4I2P A;  3V1Q A;  3OYF A;  4DTS A;  4FM0 A;  2OA8 A;  2FBY A;  2HHW A;  5D3G A;  4FYD A;  2HVI A;  1ASU A;  1A5V A;  5DK5 A;  5KRT A;  3LP1 A;  3RMD A;  4FJ7 A;  4DTU A;  4AIL C;  1WSI A;  3PX6 A;  4AH9 A;  2B6A A;  1C1B A;  3L2V A;  4E19 A;  1TV6 A;  3P1G A;  3SI6 A;  3ZSR A;  4LH4 A;  1QTM A;  2PZS A;  5HRN A;  3RWU A;  4FZX C;  1YVU A;  2X6S A;  1ASW A;  2Q3S A;  1QSL A;  4FJ5 A;  2AJQ A;  1BI4 B;  2D5R A;  4OPJ A;  3PO5 A;  3KLH A;  1S5J A;  2HHQ A;  3ULD A;  2Z1J A;  4Z4C A;  1YTA A;  4PWD A;  1RNH A;  4QCL A;  2B4J A;  3WNH A;  3BGR A;  1LW0 A;  1HNI A;  4C8M A;  4AHV A;  4DTP A;  3VQ9 A;  2P5G A;  1LV5 A;  2FC0 A;  4JS5 A;  1WN7 A;  1B9F A;  3SV4 A;  3IAY A;  1L5U A;  1VSM A;  3OVN A;  3ZSV A;  3P83 D;  4FK4 A;  3NGI A;  4CJ4 A;  5KRS A;  4Z4H A;  4KRE A;  3OYG A;  4IFV A;  1ITG A;  3DRP A;  4CF2 A;  1JLA A;  1JLG A;  2D0A A;  3KKS A;  1HRH A;  4CEQ A;  4DMN A;  4HUG A;  3TAG A;  4DQP A;  3DM2 A;  4FW1 A;  5KGX A;  3K5L A;  4DF8 A;  2BE2 A;  1HQE A;  3VQE A;  4BE0 A;  3QEX A;  3ZT0 A;  3CFP A;  4B9V A;  1NK5 A;  1VSF A;  4RW6 A;  4CFC A;  4ID5 A;  4HHT A;  3LAL A;  4KTW A;  3K57 A;  1JLC A;  2HW3 A;  3V9Z A;  3RTV A;  4JRP A;  4CEZ A;  1N5Y A;  3HPH A;  3ZSW A;  2OPS A;  1GOA A;  4BDP A;  1WAJ A;  2IAJ A;  5SWM A;  4KPY A;  3AVG A;  1JXE A;  1Y97 A;  4E7H A;  4DSF A;  2X78 A;  3F9K A;  1VSK A;  2KW4 A;  3O3G A;  4YNQ A;  3SQ2 A;  1IH7 A;  4O44 A;  2KZM A;  1TK5 A;  3HK2 A;  2IGI A;  2WON A;  2IC3 A;  3KK3 A;  4M41 A;  3HVR A;  3DI6 A;  1C6V A;  1MU2 A;  2XO7 A;  1KSP A;  4CJQ A;  2IOC A;  4KFB A;  4O5B A;  1UWB A;  4B8A B;  3NH2 A;  3SCX A;  4K8X A;  4F3T A;  2YNG A;  4CFD A;  3K59 A;  4FXD A;  2HB5 A;  3NFA A;  1RDA A;  4B08 A;  1HMV A;  2PY5 A;  3IRX A;  4C8N A;  4J2D A;  1HQU A;  3LPU A;  5I42 A;  1ZBF A;  4TSX A;  1RTI A;  4KHN A;  2BGG A;  4C8K A;  2G8V A;  1WNS A;  1R0A A;  3HL8 A;  1T03 A;  2A1R A;  4J2E A;  4FLX A;  3SPZ A;  4CHZ A;  4M3R A;  4OGE A;  2RN2 A;  3ZSZ A;  5HP1 A;  3RRH A;  4E7I A;  1U48 A;  1QSY A;  3S9H A;  4E1N A;  3O4N A;  1L3V A;  4B9T A;  4FM1 A;  1HJR A;  2P51 A;  3NF9 A;  3VQQ A;  3C95 A;  3ZSO A;  2DFH A;  4Z4G A;  2IDO A;  1BGX T;  1W9H A;  3L8B A;  4DQS A;  1EP4 A;  3EZ5 A;  1XI1 A;  1T7P A;  4B8C A;  4DWI A;  3MXJ A;  4DSE A;  1X9M A;  1NOZ A;  4CHQ A;  2YHA A;  1J54 A;  3AVH A;  4H4O A;  3G0Z A;  2B5J A;  3HYF A;  3OYB A;  3HXM A;  4Q5V A;  3LZI A;  4Z0U A;  3G10 A;  5HRO A;  1ZYQ A;  1RTH A;  4XIU A;  3CYM A;  2E4L A;  3RMA A;  4M3Z A;  4BDY A;  2VWJ A;  1RT6 A;  4B9S A;  3AVM A;  1U04 A;  1FKP A;  3AO3 A;  2Z1I A;  4G1Q A;  3VQ4 A;  4AHC A;  5HRS A;  2XHB A;  1WSG A;  4OJR A;  3ZT3 A;  5SZT A;  1L3U A;  2F8S A;  2HHU A;  1D5A A;  2YNH A;  3VQB A;  3KKR A;  3KK1 A;  1RT5 A;  2HHT A;  1RT3 A;  3NHG A;  4DLE A;  4M3Y A;  4HVJ A;  4BWJ A;  4CF1 A;  1KRP A;  1FK9 A;  3RR8 A;  1HPZ A;  3PX0 A;  4CHN A;  2ATQ A;  2E6L A;  5EU7 A;  4CK3 A;  3T3F A;  1U4B A;  4PY5 A;  3CG7 A;  4C8O A;  5JS1 A;  1SKR A;  1NK6 A;  4FLZ A;  3KD5 E;  3B6P A;  1VSL A;  1JLF A;  4RW8 A;  4FJJ A;  1BI4 A;  1UOC A;  4CF8 A;  3QNN A;  1VRT A;  3C6T A;  3OYN A;  3L2W A;  2RF2 A;  3IS9 A;  1SKS A;  3L3V A;  2YKN A;  4L8R B;  2G8I A;  4RW4 A;  2JGU A;  2OPR A;  4OKK A;  5HRR A;  4DTM A;  2P5O A;  4FK0 A;  4O0I A;  1ZBH A;  4CES A;  4CJK A;  4IFY A;  1A5X A;  1BIU A;  2I5J A;  4FVM A;  3AA4 A;  4FLU A;  1LW2 A;  3TWH A;  4B9U A;  3QET A;  3QEP A;  4CCH A;  3M8Q A;  1U49 A;  3K5M A;  3PX4 A;  4E1M A;  3NH1 A;  3MEE A;  3SUN A;  1J5O A;  3AO1 A;  3SNN A;  5CZ2 A;  5J1E A;  3T1A A;  4DF4 A;  2OZM A;  4NCA A;  3U3Y A;  3K5N A;  3AV9 A;  4CGG A;  4CJP A;  4CJW A;  3KJV A;  4FK2 A;  4M3T A;  3MAQ A;  1B9D A;  1EXQ A;  4B9M A;  1SL0 A;  4KTQ A;  4FZZ A;  4Z4I A;  3NE6 A;  3NDK A;  4DLG A;  2O4G A;  5I3U A;  4AHR A;  1ZBU A;  2P1J A;  4LH5 A;  4CEB A;  4M42 A;  4EZ6 A;  2YKM A;  1DTQ A;  1VSD A;  2BAN A;  4KKO A;  3OS1 A;  2DFE A;  3HPG A;  4DSI A;  3CM5 A;  4ZTF A;  3V1R A;  4CGI A;  4IDK A;  3MEG A;  1DLO A;  3OS0 A;  4ICL A;  5E41 A;  4LD0 A;  4FJM A;  3AA3 A;  3OS2 A;  2FBX A;  3K2P A;  4CFB A;  1N6Q A;  1TKT A;  4CEO A;  4DQQ A;  3DMJ A;  1TK8 A;  4KO0 A;  1S6Q A;  4CJF A;  4I7F A;  4CJL A;  4K8Z A;  3HO1 A;  4CEC A;  4F4K A;  4HTU A;  4HUE A;  2KZZ A;  1C0M A;  1NK0 A;  1RDD A;  1TL1 A;  1W0H A;  4M3X A;  2OPP A;  3WNF A;  5CY4 A;  1I39 A;  1RTD A;  4W5N A;  1QS4 A;  4DU4 A;  1KFD A;  4AHT A;  4Z4E A;  1BL3 A;  4OGC A;  2DY4 A;  4MQ3 A;  4W5O A;  2HNZ A;  1IKX A;  1LAV A;  4PQU A;  4NYN A;  1JL1 A;  3NH0 A;  3CM6 A;  4OPK A;  2HHV A;  4CK2 A;  1BIZ A;  1SL1 A;  1D9F A;  1WSH A;  3AO2 A;  4M3U A;  1BHL A;  3VQ5 A;  1UA0 A;  1J53 A;  2QK9 A;  3AVC A;  2ETJ A;  4RW7 A;  3HJF A;  3OYM A;  4KAZ A;  2NUB A;  2OPQ A;  4QOZ B;  3WNG A;  2Y1J A;  4ZTJ A;  4KB1 A;  4KI6 A;  1CZB A;  3RMB A;  4LY7 A;  3KLF A;  4O4G A;  1RT7 A;  3L3U A;  3LAM A;  4YFU A;  1L3S A;  3TAF A;  3SQ1 A;  1NKB A;  2E6M A;  4O55 A;  3I0S A;  4BWM A;  4CIG A;  4EZ9 A;  4E7J A;  5KTQ A;  1RBV A;  1VRU A;  3U3G A;  1FKO A;  4QAG A;  3MXI A;  1RT4 A;  1WSJ A;  4OVL A;  3OYL A;  3SPY A;  1KTQ A;  4FJG A;  2HNY A;  1TAU A;  1HYV A;  3NF6 A;  3AVJ A;  4JRQ A;  2G8H A;  4CER A;  1NOY A;  4KB0 A;  3ZT2 A;  1BCO A;  3SV3 A;  4BAC A;  2KQ2 A;  4FCY A;  4FJK A;  4IG3 A;  4BDZ A;  4ZHR A;  5J2N A;  3AVI A;  3PY8 A;  1CZ9 A;  1X1P A;  3ASM A;  3DLB A;  1S1T A;  3H08 A;  3TAR A;  1NJZ A;  1NKC A;  2O4I A;  2YNI A;  5KI6 A;  4DFK A;  4OLB A;  2G8U A;  4LSN A;  4E7L A;  5J2M A;  5CYQ A;  2X74 A;  1K6Y A;  2VG7 A;  3CFR A;  1C1A A;  4GW6 A;  4FJX A;  4KHW A;  3TAQ A;  1Z25 A;  5C42 A;  1TKD A;  1IG9 A;  2WOM A;  5C24 A;  4DQI A;  3DLH A;  4F2R A;  1Z26 A;  4C8L A;  2PYJ A;  4CJ5 A;  1CXQ A;  2GBZ A;  3RMC A;  1WSE A;  3HM9 A;  2Y1I A;  1NKE A;  3KK2 A;  4Z4F A;  1B92 A;  3LDS A;  4KHY A;  3WNE A;  2HVH A;  1T05 A;  1C1C A;  5K14 A;  4F8R A;  1JLB A;  3M8P A;  1TVR A;  1D9D A;  3V9X A;  3SUP A;  1VSI A;  2G8W A;  1Q9X A;  1RBT A;  1ASV A;  3MED A;  3SQ4 A;  3E01 A;  1TAQ A;  3NGY A;  1IKW A;  3QEI A;  1F21 A;  2Z1G A;  4N76 A;  1EX4 A;  1C0T A;  1TK0 A;  1S6P A;  1EKE A;  1SV5 A;  3B6O A;  4CF9 A;  3OYI A;  1XWL A;  4FLW A;  1X9W A;  2HHS A;  3LZJ A;  3NAE A;  3TAB A;  4I9L A;  2F8T A;  3VQP A;  1RIL A;  4CJE A;  4LSL A;  1S9G A;  5CYM A;  3L2R A;  3VQ6 A;  1KFS A;  1KVA A;  1S1U A;  2KTQ A;  2Z1H A;  3V4I A;  2A1S A;  3NF8 A;  1NK8 A;  3NCI A;  4FM2 A;  4FJN A;  3AA5 X;  3LPT A;  1I3A A;  3HP9 A;  1KVB A;  4IBN A;  4CFA A;  3SUQ A;  1JL2 A;  3QIP A;  4CGH A;  4DSL A;  3HT3 A;  3QER A;  3MXM A;  3C6U A;  3ZT4 A;  1GOC A;  3RR7 A;  4NCB A;  2G8K A;  1RT1 A;  3DLK A;  4NCG A;  5FRM A;  1WLJ A;  2VG5 A;  2EX3 A;  4CIE A;  4CED A;  2D0C A;  3ZSY A;  4E3S A;  5C25 A;  3OJS A;  1S1W A;  3PV8 A;  3V81 A;  1ZBL A;  3O3F A;  3ISN C;  3AO5 A;  3ZSX A;  4CJR A;  1CXU A;  3DRR A;  2ZE2 A;  3HST B;  1QQC A;  2XY7 A;  1FXX A;  1BCM A;  4OKE A;  1JXB A;  1VK0 A;  4KHU A;  3DLG A;  4DG1 A;  3LP2 A;  3OYD A;  3AVF A;  4KTZ A;  3QNO A;  4ELT A;  2IS3 A;  4DU1 A;  1A5W A;  4H4M A;  4CJS A;  2D0B A;  4RW9 A;  1JKH A;  3QO9 A;  3O3H A;  1U47 A;  1S9E A;  4CK1 A;  4O0J A;  4IKF A;  4N41 A;  3OYC A;  3QIO A;  4KI4 A;  1BIS A;  3AVL A;  3DLR A;  4I2Q A;  2ITG A;  4CEF A;  4I9Q A;  3QEW A;  4E89 A;  4CIF A;  1UA1 A;  3TI0 A;  1CLQ A;  4CGD A;  3DOL A;  3TR8 A;  4OLA A;  3LAN A;  1SL2 A;  3NGZ A;  2YNF A;  3KTQ A;  1Q8I A;  3TAE A;  5HRP A;  4HCC A;  3F73 A;  3MEC A;  3ZCM A;  3U6F A;  3SYZ A;  4KHQ A;  3OYE A;  3TAP A;  1RCH A;  5HBM A;  1RBS A;  3VA0 A;  2XRI A;  3C94 A;  4M3W A;  1QHT A;  4KV8 A;  3L2Q A;  2W42 A;  2YV0 X;  3EY1 A;  3BDP A;  5FRN A;  1XC9 A;  3SQ0 A;  1XHX A;  1S1X A;  1EET A;  4B3O A;  3FFI A;  4DFJ A;  4CHO A;  2VG6 A;  1LWC A;  3ZT1 A;  4GMJ B;  3SUO A;  3IG1 A;  3T19 A;  1YT3 A;  5FRO A;  3S3M A;  1BQN A;  2ZQB A;  4Q0B A;  1HYS A;  2FBV A;  3V9W A;  1REV A;  4W5Q A;  2G8F A;  5JS2 A;  2X6N A;  4N5S A;  1NJY A;  1XHZ A;  2F96 A;  2GV9 A;  1HNV A;  3KIO A;  5J2Q A;  1KCF A;  1WAF A;  2LSN A;  3DLE A;  3ITH A;  3LP3 A;  3M8S A;  4B9N A;  4F2S A;  4DS4 A;  1KLN A;  2OYQ A;  4FW2 A;  3ZSQ A;  3S3O A;  1TGO A;  1JLE A;  1LAW A;  3AVB A;  4NYF A;  3JYT A;  1L3T A;  4FJH A;  3OYA A;  4FJ9 A;  4DSK A;  4ID1 A;  3VQC A;  4PA1 A;  4CJT A;  1VSE A;  5CZ1 A;  3RRG A;  4JLH A;  4DQR A;  5FDL A;  2R7Y A;  1X9S A;  1NJW A;  1VSH A;  2HND A;  3THV A;  2KFZ A;  4DS5 A;  1T8E A;  2ZD1 A;  1Q9Y A;  2QKB A;  3I0R A;  1RT2 A;  3TAN A;  4ELU A;  4HUF A;  1O1W A;  4AHS A;  4DFM A;  1TKX A;  3EYZ A;  2OZS A;  1NK4 A;  4FZY A;  3S3N A;  1BQM A;  2RKI A;  3DYA A;  5DMR A;  4UQG A;  4BE1 A;  2XY6 A;  3PO4 A;  4W5T A;  2QKK A;  1VSJ A;  4CGJ A;  3SJJ A;  1NK7 A;  1RBR A;  4WE1 A;  1G15 A;  4FLY A;  3ALY A;  2FBT A;  4N47 A;  4CEA A;  1JLQ A;  2VWK A;  3M8R A;  4DTN A;  3UIQ A;  3HVT A;  1LWE A;  4RG8 A;  1SUQ A;  3LP0 A;  4PUO A;  3SZ2 A;  3VQ8 A;  3HP6 A;  3V6D A;  3JSM A;  3NBP A;  4FJL A;  4GVM A;  5J2P A;  4Y1C A;  1C0U A;  2DFF A;  3OYK A;  3KLE A;  1IKV A;  1UAX A;  4DFP A;  3QIN A;  3L2U A;  1QSS A;  4FJ8 A;  2XY8 A;  3VQD A;  2JLE A;  4N56 A;  1KLM A;  3OYH A;  3OYJ A;  4DU3 A;  4F3O A;  4HCB A;  3LWM A;  1D8Y A;  4H8K A;  2BDP A;  1IO2 A;  1YTU A;  4MFB A;  3QLH A;  3V9S A;  4J2B A;  3LAK A;  3VQA A;  3CQ8 A;  3QES A;  1NK9 A;  2HMI A;  2YHB A;  1RDB A;  1QE1 A;  3AO4 A; 
#chains in the Genus database with same CATH topology
 4FPB A;  4KRF A;  5KQ8 A;  4JI1 K;  4DTX A;  3TAM A;  4EP4 A;  3KLI A;  3VN5 A;  4EP5 A;  3AVA A;  3PSF A;  4CGF A;  4Y1D A;  2HHX A;  2GEM A;  3CC4 N;  4V19 S;  3AVK A;  3TTD A;  1SKW A;  3P5J A;  3C6H A;  3VER A;  4CJ3 A;  3D45 A;  3M1F A;  3D2E A;  4CF0 A;  4BVO A;  1NJX A;  3PIP L;  2GUI A;  5HLF A;  2DTU A;  2YCH A;  4JAX A;  1KAX A;  1U45 A;  4JS4 A;  4IDH A;  2OAN A;  1VQN N;  3L4Q A;  2AP1 A;  2E88 A;  1KVC A;  4I2P A;  3V1Q A;  2OA8 A;  2FBY A;  4DR3 K;  2HHW A;  5D3G A;  1ASU A;  1A5V A;  1MWK A;  4JHD B;  3SBT A;  3QFP A;  5KRT A;  3RMD A;  4ISE A;  4LF5 K;  4DTU A;  1GLL O;  3BZK A;  4AH9 A;  1QTM A;  3ZSR A;  4LH4 A;  4J2B A;  2Q3S A;  1BI4 B;  4OPJ A;  4DV3 K;  3PO5 A;  3ULD A;  2KHO A;  4UY8 O;  1MA9 B;  2VQF K;  4QCL A;  3BGR A;  4DV4 K;  4AHV A;  1LV5 A;  2FC0 A;  4FOI A;  4BR4 A;  2HF3 A;  3CQY A;  4Z4H A;  4IFV A;  4CF2 A;  3TAG A;  3M5R A;  4DQP A;  4FW1 A;  4H0X B;  2QWO A;  4B3T K;  2D0O A;  3ZT0 A;  3H45 C;  1VSF A;  1Z05 A;  4LF6 K;  2A41 A;  3LAL A;  2HW3 A;  3VF4 A;  2IVN A;  1ATN A;  1N5Y A;  3PLA A;  2NRW A;  4PKH A;  4JKH A;  4H5R A;  5SWM A;  5FPD A;  4DSF A;  2A6A A;  3F9K A;  2P9S A;  1YJN N;  5BPN A;  4IFE A;  1QVG M;  1IH7 A;  4O44 A;  1TK5 A;  3HK2 A;  2WON A;  1QQO A;  1VQM N;  1MU2 A;  2QWM A;  3L4I A;  1YVN A;  4K8X A;  3NFA A;  1RDA A;  1HKC A;  3O6W A;  5BPM A;  3CJB A;  3IRX A;  1IBL K;  4C8N A;  3LPU A;  1HKB A;  3K9K A;  3HL8 A;  4FWM A;  1QHA A;  3I8B A;  3FFK B;  4MLE A;  4OGE A;  3I55 N;  4YOY A;  1QSY A;  2FF6 A;  2V52 B;  3RRH A;  1U48 A;  3O4N A;  4O5F A;  4FM1 A;  4BVP A;  3NF9 A;  3C7N B;  3A8Y A;  4K41 A;  1W9H A;  4DQS A;  1T7P A;  4B8C A;  4DWI A;  1NGC A;  3MXJ A;  4LF4 K;  1NOZ A;  3AVH A;  3HXM A;  1RTH A;  3CYM A;  3RMA A;  4BDY A;  1TYQ B;  3AVM A;  2Z1I A;  2XHB A;  3AO3 A;  3K0S A;  1WSG A;  1L3U A;  3AY9 A;  5AZI B;  2YNH A;  3VQB A;  3KK1 A;  4CZE A;  1RT3 A;  3NHG A;  4DLE A;  4BWJ A;  4CF1 A;  1OH5 A;  1FK9 A;  5AR0 A;  3PX0 A;  5BN8 A;  5EU7 A;  4FLZ A;  3WXL A;  4RCH A;  3P4I A;  4FJJ A;  3RWU A;  3QNN A;  4FJ8 A;  1SKS A;  3L3V A;  2YKN A;  1VQK N;  4RW4 A;  2JGU A;  4OKK A;  2P5O A;  4O0I A;  3A5O C;  3M3Z A;  2IVP A;  4B9U A;  4IZ9 A;  3H1Q A;  3LM2 A;  5JLH A;  1J5O A;  5FPN A;  3SNN A;  1K9M O;  4B9M A;  4CBX A;  4KTQ A;  4C23 A;  3WXJ A;  3NDK A;  3C6A A;  1ZBU A;  3EN9 A;  1E3M A;  4AM6 A;  5GAE P;  1DTQ A;  3MN6 A;  4XEI A;  2BAN A;  4KKO A;  5AQX A;  5LJW A;  3CM5 A;  2D1K A;  3OS0 A;  4LD0 A;  4WQ4 A;  4YOX A;  4JI2 K;  1TK8 A;  5EOY A;  3HO1 A;  4CEC A;  4F4K A;  4HTU A;  2KZZ A;  1C0M A;  1RDD A;  2P9K B;  3AGR A;  5TKW A;  3WNF A;  5C0Y A;  4W5N A;  4OO1 J;  4DKW A;  1LCU A;  4W5O A;  2HNZ A;  3T1Y K;  3A5L C;  1NG9 A;  4CK2 A;  1SL1 A;  1YAG A;  4M3U A;  4E1J A;  5CE3 A;  2QK9 A;  4RW7 A;  4QOZ B;  3E9O A;  2Y1J A;  2RHK A;  4KB1 A;  3CER A;  1VQO N;  1DEJ A;  5JIC A;  4O4G A;  1L3S A;  3DAW A;  2E6M A;  4O55 A;  1VRU A;  1FKO A;  3OYL A;  2HNY A;  3OW2 M;  3CQX A;  4JK8 A;  1NOY A;  3ZT2 A;  4IG3 A;  3PY8 A;  2CGL A;  1ATS A;  1XQS C;  4IJN A;  2O4I A;  4OLB A;  3VET A;  4LSN A;  4E7L A;  5J2M A;  2X74 A;  1K6Y A;  3CFR A;  4FJX A;  3TAQ A;  1S22 A;  1Z25 A;  1TKD A;  5C24 A;  3R9P A;  1OVY A;  4F2R A;  2PYJ A;  4CJ5 A;  2GBZ A;  3FR0 A;  2HVH A;  3LDS A;  1KAY A;  1EQY A;  1T05 A;  1C1C A;  5K14 A;  2P9S B;  1JLB A;  4F8R A;  3T7Z A;  4JKB A;  3S41 A;  1Q9X A;  1RBT A;  3WXK A;  2FSN A;  1ASV A;  4CZL A;  3NGY A;  1IKW A;  3QEI A;  1C0T A;  1SV5 A;  3OYI A;  3B6O A;  3SBG A;  1HR0 K;  5F2R A;  4I9L A;  2F8T A;  4EHT A;  4KBO A;  5CYM A;  2KKZ A;  3ZLJ A;  2Z1H A;  3V4I A;  3EEQ A;  4JV5 K;  4BQZ A;  2P9P A;  4FJN A;  4BG8 A;  3LPT A;  1I3A A;  1DKG D;  4CFA A;  3LDL A;  3HT3 A;  3MXM A;  4WFB L;  1GOC A;  3EL2 A;  4BRP A;  1YJW N;  4BY9 C;  4NCG A;  5FRM A;  3P38 A;  1WLJ A;  1U2V A;  4AM7 A;  1S1W A;  2Q0U A;  3AO5 A;  4CJR A;  1CXU A;  3DRR A;  2GWK A;  1QQC A;  1FXX A;  1XMQ K;  3HRG A;  1VK0 A;  1DT9 A;  4KHU A;  3DLG A;  4DG1 A;  2IS3 A;  2CH5 A;  4DV6 K;  1DGK N;  2IIR A;  4CK1 A;  4N41 A;  4GV3 A;  4KI4 A;  3DLR A;  3AVL A;  4DR7 K;  4CIF A;  3ZYY X;  1CLQ A;  3SAH A;  1NGD A;  3NGZ A;  3CI5 A;  5HRP A;  1YUW A;  3U6F A;  4KHQ A;  4BRN A;  3OYE A;  1QHT A;  3L2Q A;  2OTL N;  2ZGZ A;  3SMS A;  2W42 A;  3WUH A;  2YV0 X;  3P31 A;  5FRN A;  1XC9 A;  3VGL A;  4CHO A;  1LWC A;  4GMJ B;  3IG1 A;  4CD1 A;  1ZBS A;  5FRO A;  1YT3 A;  3BF1 A;  2QWQ A;  3CCQ N;  4A2A A;  3MN5 A;  5JS2 A;  2X6N A;  3O80 A;  2W40 A;  4B1X B;  3M8S A;  3DLE A;  4BRA A;  4F2S A;  1JJ2 M;  3FGU A;  4FW2 A;  2ZJQ L;  4CZK A;  1JLE A;  1LAW A;  3AVB A;  1L3T A;  4B1Z A;  1I94 K;  4PA1 A;  3NMU A;  1TUY A;  5FDL A;  1NGG A;  4JKD A;  3TSP A;  3THV A;  2KFZ A;  1RT2 A;  3UE5 A;  4FWO A;  3SAG A;  1TKX A;  1NK4 A;  5AQP A;  2RKI A;  3DYA A;  3PO4 A;  1BA0 A;  4UQG A;  3DXK A;  2FXU A;  4W5T A;  5LMU K;  1WB9 A;  4CZF A;  3W3D A;  4J8F A;  3ALY A;  2FBT A;  4CEA A;  3M8R A;  1JLQ A;  4KHP K;  4X62 K;  1SUQ A;  3JSM A;  3NBP A;  3O4W A;  1HX1 A;  4ISG A;  3WT0 A;  5J2P A;  5AQQ A;  1OH8 A;  3OYK A;  4DFP A;  2XY8 A;  4IWV A;  1KLM A;  4HCB A;  3G4S N;  3LWM A;  1D8Y A;  1KXP A;  4DQ8 A;  3THW A;  3OBW A;  4H0Y B;  4CZI A;  3AO4 A;  4Z4E A;  1VQP N;  3PUF A;  4DSJ A;  4IG0 A;  1JCG A;  4BR9 A;  1DTT A;  4DV7 K;  3A5N C;  4AHU A;  4CHY A;  3DOK A;  4MO5 A;  4X66 K;  3A2F A;  3DRS A;  2QXF A;  5AQL A;  1OH7 A;  4BR7 A;  1BO5 O;  4M45 A;  3NF7 A;  4H03 B;  3O9Q A;  4DTR A;  3GL1 A;  4J2A A;  4R5P A;  4E7K A;  2W41 A;  3CFO A;  4FLV A;  4OKJ A;  3VTH A;  2E2N A;  2UUC K;  2V7Z A;  4FJI A;  2Q97 A;  4WFA L;  3VA3 A;  1GLF O;  1BG3 A;  4E0D A;  3K5O A;  1GOB A;  3VF6 A;  3CCS N;  3LWL A;  3EE8 A;  3AA2 A;  4OX9 K;  4PKG A;  3THY A;  5HOO A;  3HBT A;  4A2B A;  3LP1 A;  3GBT A;  3PX6 A;  2B6A A;  2GTD A;  3THX A;  1TV6 A;  2P9P B;  3WQT A;  1YVU A;  2X6S A;  1ASW A;  1YIT N;  1QSL A;  4FJ5 A;  3KLH A;  2HHQ A;  3QBW A;  3CC2 N;  1QZ5 A;  4PWD A;  1EWQ A;  2B4J A;  3EKU A;  3WNH A;  1VQ6 N;  1HNI A;  4C8M A;  2W6L A;  5BRE A;  4BRE A;  1U2V B;  3SV4 A;  3B8A X;  1YJ9 N;  1L5U A;  1VSM A;  3OVN A;  3ZSV A;  3P83 D;  3GG4 A;  3NGI A;  5AQS A;  3OYG A;  1ITG A;  1JLG A;  2P9L A;  1HRH A;  1K8A O;  3Q7B A;  5KGX A;  3K5L A;  3I56 N;  3VQE A;  3CFP A;  2CGJ A;  1CZA N;  4CFC A;  5IT9 O;  3K57 A;  3CJ7 A;  3ZEU A;  2ZGY A;  2DPN A;  3VF2 A;  2NRH A;  3ZSW A;  2OPS A;  1GOA A;  4BDP A;  3H6E A;  1WAJ A;  3QB0 A;  2E2O A;  4KPY A;  4E7H A;  2X78 A;  4B3M K;  4A62 A;  4YNQ A;  3SQ2 A;  3TTF A;  2IGI A;  2IC3 A;  4M41 A;  3HVR A;  3DI6 A;  3LDP A;  1ZXO A;  2NRR A;  1SQK A;  2IOC A;  4CJQ A;  4O5B A;  4B8A B;  3NH2 A;  4JKG A;  4CW7 B;  3FZH A;  4CFD A;  4B08 A;  1WOQ A;  4BRC A;  1ZBF A;  4TSX A;  2AA4 A;  2A1R A;  3KK7 A;  3KVG A;  3QML A;  3TTC A;  4CHZ A;  4M3R A;  2BH1 A;  3CCE N;  2GX9 A;  2HBM A;  3S9H A;  4XH5 A;  1L3V A;  2WBN A;  2P51 A;  3ZSO A;  4YDU A;  3IUC A;  2DFH A;  4L3Q A;  4B1W B;  1XI1 A;  3L8B A;  1X9J A;  3DXK B;  3L6Q A;  1X9M A;  1J54 A;  3OYB A;  4FWS A;  4Z0U A;  3G10 A;  4XIU A;  2E4L A;  2VWJ A;  1XUP O;  2ASP A;  1FKP A;  4G1Q A;  5HRS A;  3ZT3 A;  2FLO A;  2HHU A;  1LOT B;  4BRH A;  3KKR A;  4LFB K;  1RT5 A;  2HHT A;  1N34 K;  4PHT X;  4IXC A;  4K25 A;  2ATQ A;  3T3F A;  4CK3 A;  1U4B A;  5JS1 A;  3KD5 E;  4FWP A;  3C6T A;  3L2W A;  3IS9 A;  2UXC K;  5HRR A;  2QXL A;  4IFY A;  2I5J A;  3AA4 A;  3QET A;  2WC9 A;  3PX4 A;  3NH1 A;  3M6G A;  2BTF A;  1X3N A;  3CET A;  3T1A A;  3UKR A;  3K5N A;  4CGG A;  3KJV A;  4M3T A;  1B9D A;  1EXQ A;  2J4R A;  1S72 N;  5AQK A;  4BQL A;  4DLG A;  3CPE A;  2O4G A;  4BR5 A;  4AHR A;  4EZ6 A;  1VSD A;  5FPM A;  3CCL N;  5AQJ A;  3OS1 A;  4DR2 K;  3HPG A;  4DSI A;  4JI7 K;  3KWI A;  4ZTF A;  3J7Z O;  5MLC Q;  3AA3 A;  1V4T A;  4CFB A;  4CEO A;  4NLC A;  4LC9 B;  1NK0 A;  4DUY K;  3THY B;  5CY4 A;  3HTV A;  2EWS A;  2DY4 A;  3E66 A;  4YOW A;  5AQU A;  3THX B;  3F2K A;  1LAV A;  4PQU A;  1JL1 A;  1YXQ A;  4OPK A;  1BIZ A;  4LF7 K;  1D9F A;  3AO2 A;  1K8K A;  2PBD A;  1J53 A;  3E1Y A;  3OYM A;  1IJJ A;  4DR6 K;  4WQ4 C;  4U7B A;  3RMB A;  5FLX O;  4LY7 A;  3L3U A;  3VEN A;  4YFU A;  1NKB A;  4CIG A;  4E7J A;  5KTQ A;  1RBV A;  3MXI A;  4QAG A;  4OPH A;  3MN7 A;  3SPY A;  4OVL A;  1KTQ A;  5BRF A;  1HNW K;  3NF6 A;  3EO3 A;  4JRQ A;  4CER A;  2F9T A;  3ZX2 A;  1BCO A;  3SV3 A;  4FO0 A;  4FCY A;  4BDZ A;  3AVI A;  3CCR N;  5AQV A;  1X1P A;  3DLB A;  1Q7Y O;  3H08 A;  4B3R K;  5AQH A;  5AJ3 K;  3ZEU B;  2G8U A;  5DM7 L;  5CYQ A;  2VG7 A;  4KHW A;  4HWI A;  1IG9 A;  2WOM A;  3DLH A;  1CXQ A;  2P9I A;  1WSE A;  3OA9 A;  4F9O A;  4YOU A;  3HM9 A;  3R8E A;  1NKE A;  3O1W A;  2O8B A;  3CHW A;  2NRZ A;  5B8H A;  1JCF A;  1TVR A;  4FWQ A;  3SUP A;  3FLC O;  2WTU A;  3MED A;  5KPR A;  3E01 A;  1TAQ A;  2E8A A;  4JEP A;  3N4Q A;  2Z1G A;  1G99 A;  4CF9 A;  4FLW A;  1XWL A;  1NNE A;  2F7T A;  3TAB A;  4A57 A;  4LSL A;  3L2R A;  1KFS A;  3VQ6 A;  1RFQ A;  5AQY A;  1NMD A;  2F4V K;  3VEW A;  4IOA L;  3AA5 X;  3CCM N;  5F1X A;  3BY5 A;  1KVB A;  4PL8 A;  4IBN A;  4DSL A;  4CZJ A;  3C6U A;  3RR7 A;  3ENB A;  4LF8 K;  3FE1 A;  5M1O A;  3DLK A;  5JVH L;  4CIE A;  4CED A;  3H1V X;  3WXI A;  4JI4 K;  3OJS A;  3ZSX A;  3MX5 A;  2E2Q A;  4A5B A;  2VGN A;  3HST B;  4JI6 K;  3EE9 A;  4ELT A;  2UU9 K;  4KTZ A;  4DU1 A;  3HSC A;  1IBK K;  3D2E B;  1A5W A;  4H4M A;  1U47 A;  4RW9 A;  4HTL A;  3ULE A;  4WQ5 A;  3HOS A;  4MDA A;  3J7Y P;  1BIS A;  2ITG A;  2HBL A;  2Q2R A;  3VGM A;  3TI0 A;  3TR8 A;  4A5A A;  3LAN A;  1Q8I A;  3TAE A;  4JKC A;  4HCC A;  3SYZ A;  1BU6 O;  4RTF D;  1RCH A;  2Q31 A;  4KV8 A;  1GLC G;  3IMX A;  1Y64 A;  4H5V A;  3G71 N;  1KD1 O;  3EY1 A;  3SQ0 A;  1EET A;  2E1Z A;  1J5E K;  4KH4 A;  2FBV A;  3V9W A;  4W5Q A;  2G8F A;  5LY3 A;  5ELZ A;  3ID6 A;  1XHZ A;  5J2Q A;  3ITH A;  3LP3 A;  3QFU A;  2ZF5 O;  1KLN A;  2OYQ A;  4LFC K;  1NMN A;  2HBJ A;  4FJ9 A;  5GAG P;  4DSK A;  4ID1 A;  3VQC A;  1BUP A;  1NJW A;  3MK6 A;  1T8E A;  2QKB A;  5DM6 L;  3CF5 L;  3S3N A;  1N8R O;  1NGI A;  3VEY A;  3D2F A;  3O8M A;  3O08 A;  3CJ9 A;  1NK7 A;  1RBR A;  1KC8 O;  1NGA A;  1RDU A;  4RG8 A;  1W2B M;  4JK9 A;  3FZK A;  3SZ2 A;  4MO4 A;  3ATU A;  4YOT A;  1K8K B;  1XMO K;  5A2Q O;  1IKV A;  1UAX A;  2YHX A;  3L2U A;  5M1Q A;  2JLE A;  1IO2 A;  1SS6 A;  4MFB A;  1WBB A;  4U67 L;  2GEL A;  1YI2 N;  4DR5 K;  4BGB A;  1J6Z A;  4CCH A;  2RN2 A;  4RWT A;  3V9U A;  1NGJ A;  1E4F T;  1Z6R A;  3KD1 E;  2EHG A;  3K58 A;  4KHY A;  3U9Z A;  4BE2 A;  3D0P A;  4BC5 A;  3O4Q A;  5T7B A;  4O8U A;  4O8K A;  3KLG A;  4B9L A;  2WFB A;  2OTJ N;  1J9A A;  3I33 A;  1HNZ K;  3IKM A;  4CJU A;  4FLT A;  3DJC A;  3OTO K;  4FWN A;  1S1V A;  1VQ5 N;  2VGM A;  1RTJ A;  5HL7 L;  4H5N A;  3C0B A;  1RBU A;  2P9I B;  4KHS A;  1W7A A;  2O8B B;  4CE9 A;  3HPO A;  4NLB A;  3VQ7 A;  4W5R A;  4CEE A;  4CJV A;  1SAZ A;  1H1V A;  2PYL A;  3TU5 A;  3V1O A;  1TKZ A;  4DTS A;  3AAR A;  5AQZ A;  4FM0 A;  1XC3 A;  5M1K A;  4EFH A;  4FJ7 A;  4JI3 K;  3KHY A;  3L2V A;  2QW9 A;  1ILY A;  5C2F A;  4E19 A;  3P1G A;  2PZS A;  5HRN A;  4EAH D;  2AJQ A;  1EWR A;  2D5R A;  1VQ9 N;  1S5J A;  2Z1J A;  4Z4C A;  2E20 A;  1YTA A;  3VTI A;  4H5W A;  4BRM A;  2D4W A;  5I9E B;  1LW0 A;  4IO8 A;  2FF3 B;  1GLB G;  5IWA K;  3K9J A;  4JS5 A;  1WN7 A;  3IAY A;  5BRH A;  4FWR A;  4CJ4 A;  5KRS A;  4KRE A;  3DRP A;  1JLA A;  4HUG A;  4CEQ A;  5AFU A;  3DM2 A;  1GLE G;  2VQE K;  4BE0 A;  4B9V A;  4RW6 A;  3ULE B;  4HHT A;  4KTW A;  1JLC A;  3V9Z A;  3J80 O;  1NGH A;  4K43 A;  4JNE A;  3AVG A;  1JXE A;  3BZC A;  3ENH A;  3NVK A;  4B9Q A;  1VSK A;  3D6R A;  3ENO A;  3O3G A;  3RSE A;  4YHH K;  2HBK A;  1NGB A;  3KK3 A;  1C6V A;  1KSP A;  4DR1 K;  1UWB A;  2ASM A;  3SCX A;  4F3T A;  2YNG A;  4CI6 A;  3K59 A;  1FW6 A;  4FXD A;  1QZ6 A;  1HMV A;  1HUX A;  2BUP A;  3G25 A;  4B1V A;  2PY5 A;  1S3X A;  4G9Z A;  4KHN A;  1RTI A;  4C8K A;  2G8V A;  1R0A A;  1T03 A;  4J2E A;  3A0I X;  1IBM K;  3TSU A;  5C2D A;  4DV0 K;  4E7I A;  1JCE A;  4KH6 A;  4QS7 A;  3CME N;  5GAH P;  4NO7 A;  3VQQ A;  3C95 A;  2IDO A;  1EP4 A;  3D2F B;  4CHQ A;  2B5J A;  3HYF A;  5EXW A;  4Q5V A;  4X65 K;  5HRO A;  1ZYQ A;  2HOE A;  1P8Z A;  4M3Z A;  3VPZ A;  3CCV N;  1D5A A;  4JI0 K;  4JHD A;  3G6E N;  5EY4 A;  4BRL A;  1KRP A;  1E4G T;  2WUS A;  4CHN A;  2E6L A;  4PY5 A;  4YDU C;  3EZW A;  3CG7 A;  3KWG A;  4C8O A;  1SKR A;  1NK6 A;  2O8C A;  4RW8 A;  1BI4 A;  1UOC A;  4IEE A;  2G8I A;  2P9U A;  4L8R B;  3J81 O;  4DTM A;  1GLA G;  5LJV A;  2ZJP L;  1A5X A;  3CCU N;  1BIU A;  4DCH A;  3TWH A;  4NXN K;  3QEP A;  1U49 A;  3K5M A;  3MEE A;  3SUN A;  2UYT A;  3AO1 A;  4EIA A;  2NRT A;  5CZ2 A;  4DF4 A;  1VQ7 N;  2OZM A;  4NCA A;  4FK2 A;  3AV9 A;  4CJW A;  3MAQ A;  3UKU A;  4FWK A;  3QDK A;  3CCJ N;  1SL0 A;  4FZZ A;  4Z4I A;  3U8X A;  4LH5 A;  4M42 A;  1MDU B;  2YKM A;  5C10 A;  4FWL A;  4CGI A;  4IDK A;  4KH5 A;  1VAZ A;  1NM1 A;  2NLX A;  4M7X A;  4Z94 A;  5E41 A;  3K2P A;  1TKT A;  1X3M A;  4CJF A;  4I7F A;  4K8Z A;  4QS9 A;  1W0H A;  2F9W A;  3SMP A;  3D7E O;  1I39 A;  4PKI A;  3L0Q A;  4CZH A;  1NU0 A;  4YY3 K;  1VQL N;  1YF5 L;  3IFR A;  2NRX A;  1WSH A;  1BHL A;  3VQ5 A;  1UA0 A;  3AVC A;  2ETJ A;  4KAZ A;  3WNG A;  4ZTJ A;  3JAM O;  1CZB A;  2ZWH A;  3LAM A;  2NZT A;  3SQ1 A;  5H1S Q;  3C65 A;  3I0S A;  2E1Y A;  4EZ9 A;  3U3G A;  3RVC A;  2ZJR L;  2UXD K;  1TAU A;  1C0F A;  4FJG A;  4CBW A;  3AVJ A;  2G8H A;  1T44 A;  3BP8 A;  4KB0 A;  4YOR A;  4BAC A;  2KQ2 A;  4FJK A;  3J7A P;  2IVO A;  4ZHR A;  5J2N A;  3ASM A;  2RE2 A;  4PL7 A;  4CZG A;  5TKY A;  1NJZ A;  1NKC A;  5KI6 A;  4DFK A;  1HLU A;  3MWT A;  4BGA A;  4CVN E;  1C1A A;  4GW6 A;  5F0X A;  4B1U B;  3CJC A;  3EKS A;  4WYB A;  4C1N K;  1B92 A;  3KK2 A;  3V9X A;  3U4L A;  2G8W A;  3RSE B;  3QBX A;  2QM1 A;  4BRQ A;  5C12 A;  3T69 A;  1F21 A;  1EX4 A;  1TK0 A;  1S6P A;  5AQF A;  5KPZ A;  1X9W A;  2UUA K;  3LZJ A;  3VQP A;  1RIL A;  5GIP A;  1KVA A;  4DR4 K;  1S1U A;  1NK8 A;  4FM2 A;  3SK3 A;  1N32 K;  3THW B;  2ITM A;  4DUZ K;  3QER A;  1M90 O;  5AFU H;  3ZT4 A;  4NCB A;  4BRG A;  1RT1 A;  2P9N A;  3CXC M;  2VG5 A;  2EX3 A;  2D0C A;  3ZSY A;  4E3S A;  3O9R A;  1N33 K;  3PV8 A;  3V81 A;  1ZBL A;  3PIO L;  2ZE2 A;  3DWL A;  2QI2 A;  2XY7 A;  1BCM A;  4OKE A;  1JXB A;  3QNO A;  3AVF A;  2P9K A;  3AGK A;  4CJS A;  2D0B A;  1JKH A;  4BR0 A;  4I6M A;  1S9E A;  5LL6 Z;  4O0J A;  4IKF A;  4C1N I;  1WBD A;  1WUA A;  4I9Q A;  3QEW A;  1UA1 A;  2YNF A;  3KTQ A;  2O8C B;  3F73 A;  3MEC A;  3ZCM A;  3WXM B;  2P9U B;  3TAP A;  3VEX A;  1RBS A;  5AQG A;  3C94 A;  4M3W A;  3U9D A;  4IOC L;  5KPT A;  2YI1 A;  2QWR A;  3ATV A;  1XHX A;  4JK7 A;  3MWP A;  4DFJ A;  1NWK A;  3ZT1 A;  1BOT O;  4H0P A;  3S3M A;  1BQN A;  4WQ5 C;  4Q0B A;  1HYS A;  2V51 B;  1NJY A;  1P90 A;  3UKU B;  4N5S A;  2F96 A;  2GV9 A;  5BR8 K;  1FJG K;  4B9N A;  4JKE A;  3O1B A;  4DS4 A;  3S3O A;  3OYA A;  2CGK A;  2OCE A;  3RRG A;  1VSE A;  5CZ1 A;  1X9S A;  2ZM6 K;  3VGK A;  4DS5 A;  2ZD1 A;  3I0R A;  3O5B A;  3TAN A;  3J8A A;  1O1W A;  3DLL L;  4DFM A;  2OZS A;  2P9L B;  4DB3 A;  4BE1 A;  5DMR A;  2XY6 A;  2QKK A;  4LF9 K;  3AAP A;  5BPL A;  4FLY A;  4ILH A;  4N47 A;  2VWK A;  3SJH A;  4DTN A;  3HVT A;  1LWE A;  3LP0 A;  1BDG A;  2Q36 A;  5AZJ A;  4K0K K;  1ZC6 A;  4GVM A;  5ADX A;  1C0U A;  1ESV A;  3KLE A;  3QIN A;  4F3O A;  3OYH A;  2HST A;  1Q86 O;  5AQI A;  4H8K A;  1HPM A;  1YTU A;  3LAK A;  3VQA A;  3CQ8 A;  5GIO A;  3QES A;  4JKG B;  1NK9 A;  1OH6 A;  2YHB A;  2HMI A;  1QE1 A;  4R79 A;  4H5T A;  3FZM A;  3OY9 A;  1TL3 A;  3CC7 N;  3QEV A;  4IOX A;  4QS8 A;  1T6C A;  3HM8 A;  4BRF A;  5HP1 A;  5AQR A;  1Q81 O;  3R3L A;  1LWF A;  2RPI A;  4GV9 A;  1HYZ A;  3F9M A;  2QWL A;  1ZBI A;  4DTJ A;  1IKY A;  4JKF A;  1WSF A;  4ELV A;  4DTO A;  2KFN A;  4CD3 A;  1YIJ N;  1RDC A;  3I8D A;  3F5T A;  2QWP A;  3AVN A;  4BC4 A;  4JN4 A;  1Q18 A;  4CHP A;  1C0G A;  4FVU A;  2XY5 A;  5KGW A;  3OJU A;  3OYF A;  2YJE A;  4FYD A;  2HVI A;  5DK5 A;  1YHQ N;  3ZX0 A;  1SZ2 A;  4AIL C;  1WSI A;  5AQO A;  1NGE A;  1C1B A;  1ATR A;  3SI6 A;  4FZX C;  2A42 A;  2KLA A;  3ZX3 A;  5FPE A;  2A40 A;  2NNW A;  3WEE A;  1RNH A;  2P9N B;  4FSV A;  4WFN L;  4DTP A;  3VQ9 A;  2P5G A;  5JVG L;  1B9F A;  4CJ7 A;  4FK4 A;  3UKR B;  1U6Z A;  1W97 L;  2D0A A;  3KKS A;  4H0T B;  2CH6 A;  4DMN A;  4ILJ A;  1BA1 A;  4DF8 A;  2BE2 A;  1HQE A;  4DV5 K;  3QEX A;  1NK5 A;  4ID5 A;  3MCP A;  4I6M B;  2D0P A;  3MN9 A;  5CHI A;  3RTV A;  4JRP A;  2YHW A;  4CEZ A;  4DHY A;  3HPH A;  1KQS M;  3GOI A;  3CJ1 A;  2IAJ A;  2JWL A;  2GWJ A;  1Y97 A;  2PAV A;  5EX5 A;  2KW4 A;  1IV0 A;  4MLH A;  3QIC A;  2E2P A;  3CMA N;  2KZM A;  3GDQ A;  1NJI O;  2XO7 A;  4KFB A;  3FZL A;  5M1N A;  2HB5 A;  4M7Y A;  1N36 K;  4J2D A;  1HQU A;  5I42 A;  2BGG A;  4JI8 K;  1HNX K;  1WNS A;  3CPW M;  3VEZ A;  2HMP A;  5M1F A;  4FLX A;  4GY2 B;  3SPZ A;  1Q82 O;  3VMF B;  3ZSZ A;  2UXB K;  4LFA K;  4E1N A;  4B9T A;  3MCA B;  1HJR A;  4AF1 A;  3HZ6 A;  2O8E A;  2QWN A;  4Z4G A;  1BGX T;  3EZ5 A;  3SLC A;  4IO9 L;  2O8F A;  4DSE A;  2YHA A;  4H4O A;  3G0Z A;  3LZI A;  2VCP A;  5EVZ A;  1RT6 A;  4B9S A;  3KZB A;  1U04 A;  4AHC A;  3VQ4 A;  5BRD A;  4N76 A;  5SZT A;  4OJR A;  5AZJ B;  2Q0R A;  2V7Y A;  2F8S A;  3A5M C;  4M3Y A;  5BR9 A;  4HVJ A;  3RR8 A;  1HPZ A;  3DXM A;  3ID8 A;  4BRI A;  3B6P A;  1VSL A;  1JLF A;  3TSQ A;  4CF8 A;  1T6D A;  1VRT A;  3OYN A;  1IG8 A;  2RF2 A;  2OPR A;  1ZBH A;  5JMV A;  4FK0 A;  4CES A;  4CJK A;  4FVM A;  4JI5 K;  4FLU A;  1LW2 A;  5AQM A;  3MDQ A;  1XNR K;  1MWM A;  3M8Q A;  3BF3 A;  3H3O B;  4E1M A;  3T1H K;  4JD2 A;  5J1E A;  5GIN A;  3U3Y A;  4CJP A;  1RDW X;  3WQU A;  3CIP A;  3NE6 A;  5AQN A;  5I3U A;  4ILG B;  2P1J A;  3E9L A;  4CEB A;  4NB4 A;  4X64 K;  3VOV A;  3R6M A;  5E84 A;  2DFE A;  3VES A;  4DV2 K;  2A3Z A;  4XH4 A;  3V1R A;  4A61 A;  3MEG A;  1DLO A;  3LDN A;  4ICL A;  5BN9 A;  4FJM A;  3OS2 A;  2FBX A;  3AAQ A;  1N6Q A;  4DQQ A;  4K42 A;  3ZET A;  3DMJ A;  4BR2 A;  2HHH K;  4KO0 A;  1S6Q A;  4CJL A;  5ADX H;  2O8D A;  4HUE A;  1O13 A;  1TL1 A;  4M3X A;  2OPP A;  4GKK K;  1RTD A;  1QS4 A;  4DU4 A;  1KFD A;  4AHT A;  4AQY K;  1BL3 A;  4OGC A;  4MQ3 A;  3JXU A;  2ASO A;  1IKX A;  2YX6 A;  3O9T A;  1EO1 A;  4NYN A;  3NH0 A;  3CM6 A;  2HHV A;  2GUP A;  4BRO A;  3HJF A;  4GV6 A;  2NUB A;  2OPQ A;  4CBU A;  3WEE B;  4CZM A;  4KI6 A;  5LMN K;  3KLF A;  1RT7 A;  4WF9 L;  3JS6 A;  3N4P A;  3TAF A;  4BWM A;  2VWB A;  5JLF A;  3SAF A;  4IEI A;  1QQM A;  1RT4 A;  1WSJ A;  1HYV A;  1T3V A;  2A5X A;  4ISF A;  3HOT A;  3R1X A;  2QEX N;  3H46 O;  2JWK A;  2QA4 N;  4B1Y B;  1CZ9 A;  3H3N O;  1S1T A;  1NGF A;  3TAR A;  2YNI A;  1NLV A;  3UB5 A;  5C42 A;  4DQI A;  1Z26 A;  3BUZ B;  4C8L A;  3LL3 A;  3RMC A;  2Y1I A;  4Z4F A;  2VYP A;  3WNE A;  3MMV A;  2Q1N A;  3M8P A;  1D9D A;  1VSI A;  4BG9 A;  4XH1 A;  3PSI A;  3SQ4 A;  4OPA A;  2HHS A;  1EKE A;  2FSJ A;  3NAE A;  4EHU A;  4MDB A;  5E26 A;  2H3G X;  4CJE A;  4A59 A;  1S9G A;  1BWF O;  3FZF A;  2KTQ A;  2E5L K;  2A1S A;  4M63 C;  3NF8 A;  3NCI A;  2YHY A;  3HP9 A;  3SUQ A;  1JL2 A;  3QIP A;  4CGH A;  4H0V B;  3HI0 A;  5AQW A;  2G8K A;  2O8E B;  2NRV A;  4WCE L;  1GLD G;  5C25 A;  2O8F B;  2HF4 A;  3O3F A;  3ISN C;  4GKJ K;  1D4X A;  1V4S A;  2PFU A;  3LP2 A;  3OYD A;  2I7N A;  3TPQ A;  1NBW A;  3QO9 A;  3O3H A;  1OKJ A;  4GNI A;  4BC2 A;  5KQD A;  3P39 A;  4BC3 A;  3QIO A;  3OYC A;  4I2Q A;  1M1K O;  4CEF A;  3DXM B;  4E89 A;  2QTD A;  4CGD A;  3DOL A;  4OLA A;  1SL2 A;  3LDQ A;  1KAZ A;  4GVE A;  4NXM K;  4BRK A;  3MX2 A;  1GLJ O;  5HBM A;  3VA0 A;  1HKG A;  2XRI A;  5AQT A;  3O9U A;  3BDP A;  4YOV A;  1S1X A;  3IDH A;  4B3O A;  3FFI A;  3SUO A;  2VG6 A;  3BEX A;  3Q7C A;  1RGI A;  4DV1 K;  3T19 A;  4JD2 B;  2ZQB A;  3LDO A;  1REV A;  3CJA A;  1XNQ K;  3KIO A;  1HNV A;  1KCF A;  1WAF A;  2LSN A;  2UUB K;  1QQN A;  5M1P A;  3ZSQ A;  1TGO A;  4NYF A;  5CR4 A;  3JYT A;  4FJH A;  1HJO A;  4BRD A;  1QVF M;  4CJT A;  4JLH A;  4DQR A;  4H0O A;  2R7Y A;  3NVM A;  1VSH A;  2HND A;  1OVQ A;  2W6K A;  1Q9Y A;  1K73 O;  3C7N A;  4ELU A;  4HUF A;  4AHS A;  3EYZ A;  3ZET B;  4FZY A;  1BQM A;  2FSK A;  1TUU A;  2O8D B;  1VSJ A;  2YJF A;  4CGJ A;  5C15 A;  3SJJ A;  4WE1 A;  3VEV A;  1G15 A;  3E9P A;  4FL9 A;  3VEO A;  3UIQ A;  4JKA A;  1TYQ A;  1VQ8 N;  4PUO A;  3LM9 A;  3VQ8 A;  3HP6 A;  3V6D A;  3CD6 N;  5AZI A;  3O9S A;  3GE1 A;  4FJL A;  4FPA A;  4Y1C A;  4IJA A;  2DFF A;  2I7P A;  1VHX A;  1QSS A;  3OBY A;  3VQD A;  4DU3 A;  4N56 A;  3OYJ A;  3OHR A;  2BDP A;  1R59 O;  3QLH A;  3V9S A;  5GAD P;  3W0L A;  1VQ4 N;  4Y0W A;  4B3S K;  1RDB A;  4JYA K;  4FOE A; 
#chains in the Genus database with same CATH homology
 3V9U A;  3OY9 A;  1TL3 A;  4KRF A;  3QEV A;  3PUF A;  4DSJ A;  4IG0 A;  3KD1 E;  2EHG A;  1DTT A;  3TAM A;  4EP4 A;  3KLI A;  3VN5 A;  4EP5 A;  3K58 A;  3AVA A;  4DTX A;  4BE2 A;  4AHU A;  3D0P A;  5T7B A;  3O4Q A;  4CHY A;  3DOK A;  4CGF A;  3KLG A;  4B9L A;  3A2F A;  3DRS A;  4Y1D A;  2HHX A;  1J9A A;  1LWF A;  2QXF A;  2RPI A;  1HYZ A;  4CJU A;  4FLT A;  1ZBI A;  3AVK A;  4M45 A;  4DTJ A;  1S1V A;  1SKW A;  3P5J A;  1RTJ A;  1IKY A;  3NF7 A;  4CJ3 A;  4DTR A;  4J2A A;  1WSF A;  1RBU A;  3D45 A;  4R5P A;  4ELV A;  4E7K A;  4DTO A;  4CF0 A;  1NJX A;  2KFN A;  3CFO A;  4FLV A;  1RDC A;  2GUI A;  4OKJ A;  3I8D A;  5HLF A;  4KHS A;  2DTU A;  4FJI A;  4CE9 A;  3HPO A;  3AVN A;  3VA3 A;  4CHP A;  4E0D A;  3K5O A;  3VQ7 A;  1GOB A;  1U45 A;  4JS4 A;  4W5R A;  3LWL A;  4CEE A;  4CJV A;  2XY5 A;  3AA2 A;  5KGW A;  2PYL A;  3OJU A;  3V1O A;  1KVC A;  1TKZ A;  4I2P A;  3V1Q A;  3OYF A;  4DTS A;  4FM0 A;  2OA8 A;  2FBY A;  2HHW A;  5D3G A;  4FYD A;  2HVI A;  1ASU A;  1A5V A;  5DK5 A;  5KRT A;  3LP1 A;  3RMD A;  4FJ7 A;  4DTU A;  4AIL C;  1WSI A;  3PX6 A;  4AH9 A;  2B6A A;  1C1B A;  3L2V A;  4E19 A;  1TV6 A;  3P1G A;  3SI6 A;  3ZSR A;  4LH4 A;  1QTM A;  2PZS A;  5HRN A;  3RWU A;  4FZX C;  1YVU A;  2X6S A;  1ASW A;  2Q3S A;  1QSL A;  4FJ5 A;  2AJQ A;  1BI4 B;  2D5R A;  4OPJ A;  3PO5 A;  3KLH A;  1S5J A;  2HHQ A;  3ULD A;  2Z1J A;  4Z4C A;  1YTA A;  4PWD A;  1RNH A;  4QCL A;  2B4J A;  3WNH A;  3BGR A;  1LW0 A;  1HNI A;  4C8M A;  4AHV A;  4DTP A;  3VQ9 A;  2P5G A;  1LV5 A;  2FC0 A;  4JS5 A;  1WN7 A;  1B9F A;  3SV4 A;  3IAY A;  1L5U A;  1VSM A;  3OVN A;  3ZSV A;  3P83 D;  4FK4 A;  3NGI A;  4CJ4 A;  5KRS A;  4Z4H A;  4KRE A;  3OYG A;  4IFV A;  1ITG A;  3DRP A;  4CF2 A;  1JLA A;  1JLG A;  2D0A A;  3KKS A;  1HRH A;  4CEQ A;  4DMN A;  4HUG A;  3TAG A;  4DQP A;  3DM2 A;  4FW1 A;  5KGX A;  3K5L A;  4DF8 A;  2BE2 A;  1HQE A;  3VQE A;  4BE0 A;  3QEX A;  3ZT0 A;  3CFP A;  4B9V A;  1NK5 A;  1VSF A;  4RW6 A;  4CFC A;  4ID5 A;  4HHT A;  3LAL A;  4KTW A;  3K57 A;  1JLC A;  2HW3 A;  3V9Z A;  3RTV A;  4JRP A;  4CEZ A;  1N5Y A;  3HPH A;  3ZSW A;  2OPS A;  1GOA A;  4BDP A;  1WAJ A;  2IAJ A;  5SWM A;  4KPY A;  3AVG A;  1JXE A;  1Y97 A;  4E7H A;  4DSF A;  2X78 A;  3F9K A;  1VSK A;  2KW4 A;  3O3G A;  4YNQ A;  3SQ2 A;  1IH7 A;  4O44 A;  2KZM A;  1TK5 A;  3HK2 A;  2IGI A;  2WON A;  2IC3 A;  3KK3 A;  4M41 A;  3HVR A;  3DI6 A;  1C6V A;  1MU2 A;  2XO7 A;  1KSP A;  4CJQ A;  2IOC A;  4KFB A;  4O5B A;  1UWB A;  4B8A B;  3NH2 A;  3SCX A;  4K8X A;  4F3T A;  2YNG A;  4CFD A;  3K59 A;  4FXD A;  2HB5 A;  3NFA A;  1RDA A;  4B08 A;  1HMV A;  2PY5 A;  3IRX A;  4C8N A;  4J2D A;  1HQU A;  3LPU A;  5I42 A;  1ZBF A;  4TSX A;  1RTI A;  4KHN A;  2BGG A;  4C8K A;  2G8V A;  1WNS A;  1R0A A;  3HL8 A;  1T03 A;  2A1R A;  4J2E A;  4FLX A;  3SPZ A;  4CHZ A;  4M3R A;  4OGE A;  2RN2 A;  3ZSZ A;  5HP1 A;  3RRH A;  4E7I A;  1U48 A;  1QSY A;  3S9H A;  4E1N A;  3O4N A;  1L3V A;  4B9T A;  4FM1 A;  1HJR A;  2P51 A;  3NF9 A;  3VQQ A;  3C95 A;  3ZSO A;  2DFH A;  4Z4G A;  2IDO A;  1BGX T;  1W9H A;  3L8B A;  4DQS A;  1EP4 A;  3EZ5 A;  1XI1 A;  1T7P A;  4B8C A;  4DWI A;  3MXJ A;  4DSE A;  1X9M A;  1NOZ A;  4CHQ A;  2YHA A;  1J54 A;  3AVH A;  4H4O A;  3G0Z A;  2B5J A;  3HYF A;  3OYB A;  3HXM A;  4Q5V A;  3LZI A;  4Z0U A;  3G10 A;  5HRO A;  1ZYQ A;  1RTH A;  4XIU A;  3CYM A;  2E4L A;  3RMA A;  4M3Z A;  4BDY A;  2VWJ A;  1RT6 A;  4B9S A;  3AVM A;  1U04 A;  1FKP A;  3AO3 A;  2Z1I A;  4G1Q A;  3VQ4 A;  4AHC A;  5HRS A;  2XHB A;  1WSG A;  4OJR A;  3ZT3 A;  5SZT A;  1L3U A;  2F8S A;  2HHU A;  1D5A A;  2YNH A;  3VQB A;  3KKR A;  3KK1 A;  1RT5 A;  2HHT A;  1RT3 A;  3NHG A;  4DLE A;  4M3Y A;  4HVJ A;  4BWJ A;  4CF1 A;  1KRP A;  1FK9 A;  3RR8 A;  1HPZ A;  3PX0 A;  4CHN A;  2ATQ A;  2E6L A;  5EU7 A;  4CK3 A;  3T3F A;  1U4B A;  4PY5 A;  3CG7 A;  4C8O A;  5JS1 A;  1SKR A;  1NK6 A;  4FLZ A;  3KD5 E;  3B6P A;  1VSL A;  1JLF A;  4RW8 A;  4FJJ A;  1BI4 A;  1UOC A;  4CF8 A;  3QNN A;  1VRT A;  3C6T A;  3OYN A;  3L2W A;  2RF2 A;  3IS9 A;  1SKS A;  3L3V A;  2YKN A;  4L8R B;  2G8I A;  4RW4 A;  2JGU A;  2OPR A;  4OKK A;  5HRR A;  4DTM A;  2P5O A;  4FK0 A;  4O0I A;  1ZBH A;  4CES A;  4CJK A;  4IFY A;  1A5X A;  1BIU A;  2I5J A;  4FVM A;  3AA4 A;  4FLU A;  1LW2 A;  3TWH A;  4B9U A;  3QET A;  3QEP A;  4CCH A;  3M8Q A;  1U49 A;  3K5M A;  3PX4 A;  4E1M A;  3NH1 A;  3MEE A;  3SUN A;  1J5O A;  3AO1 A;  3SNN A;  5CZ2 A;  5J1E A;  3T1A A;  4DF4 A;  2OZM A;  4NCA A;  3U3Y A;  3K5N A;  3AV9 A;  4CGG A;  4CJP A;  4CJW A;  3KJV A;  4FK2 A;  4M3T A;  3MAQ A;  1B9D A;  1EXQ A;  4B9M A;  1SL0 A;  4KTQ A;  4FZZ A;  4Z4I A;  3NE6 A;  3NDK A;  4DLG A;  2O4G A;  5I3U A;  4AHR A;  1ZBU A;  2P1J A;  4LH5 A;  4CEB A;  4M42 A;  4EZ6 A;  2YKM A;  1DTQ A;  1VSD A;  2BAN A;  4KKO A;  3OS1 A;  2DFE A;  3HPG A;  4DSI A;  3CM5 A;  4ZTF A;  3V1R A;  4CGI A;  4IDK A;  3MEG A;  1DLO A;  3OS0 A;  4ICL A;  5E41 A;  4LD0 A;  4FJM A;  3AA3 A;  3OS2 A;  2FBX A;  3K2P A;  4CFB A;  1N6Q A;  1TKT A;  4CEO A;  4DQQ A;  3DMJ A;  1TK8 A;  4KO0 A;  1S6Q A;  4CJF A;  4I7F A;  4CJL A;  4K8Z A;  3HO1 A;  4CEC A;  4F4K A;  4HTU A;  4HUE A;  2KZZ A;  1C0M A;  1NK0 A;  1RDD A;  1TL1 A;  1W0H A;  4M3X A;  2OPP A;  3WNF A;  5CY4 A;  1I39 A;  1RTD A;  4W5N A;  1QS4 A;  4DU4 A;  1KFD A;  4AHT A;  4Z4E A;  1BL3 A;  4OGC A;  2DY4 A;  4MQ3 A;  4W5O A;  2HNZ A;  1IKX A;  1LAV A;  4PQU A;  4NYN A;  1JL1 A;  3NH0 A;  3CM6 A;  4OPK A;  2HHV A;  4CK2 A;  1BIZ A;  1SL1 A;  1D9F A;  1WSH A;  3AO2 A;  4M3U A;  1BHL A;  3VQ5 A;  1UA0 A;  1J53 A;  2QK9 A;  3AVC A;  2ETJ A;  4RW7 A;  3HJF A;  3OYM A;  4KAZ A;  2NUB A;  2OPQ A;  4QOZ B;  3WNG A;  2Y1J A;  4ZTJ A;  4KB1 A;  4KI6 A;  1CZB A;  3RMB A;  4LY7 A;  3KLF A;  4O4G A;  1RT7 A;  3L3U A;  3LAM A;  4YFU A;  1L3S A;  3TAF A;  3SQ1 A;  1NKB A;  2E6M A;  4O55 A;  3I0S A;  4BWM A;  4CIG A;  4EZ9 A;  4E7J A;  5KTQ A;  1RBV A;  1VRU A;  3U3G A;  1FKO A;  4QAG A;  3MXI A;  1RT4 A;  1WSJ A;  4OVL A;  3OYL A;  3SPY A;  1KTQ A;  4FJG A;  2HNY A;  1TAU A;  1HYV A;  3NF6 A;  3AVJ A;  4JRQ A;  2G8H A;  4CER A;  1NOY A;  4KB0 A;  3ZT2 A;  1BCO A;  3SV3 A;  4BAC A;  2KQ2 A;  4FCY A;  4FJK A;  4IG3 A;  4BDZ A;  4ZHR A;  5J2N A;  3AVI A;  3PY8 A;  1CZ9 A;  1X1P A;  3ASM A;  3DLB A;  1S1T A;  3H08 A;  3TAR A;  1NJZ A;  1NKC A;  2O4I A;  2YNI A;  5KI6 A;  4DFK A;  4OLB A;  2G8U A;  4LSN A;  4E7L A;  5J2M A;  5CYQ A;  2X74 A;  1K6Y A;  2VG7 A;  3CFR A;  1C1A A;  4GW6 A;  4FJX A;  4KHW A;  3TAQ A;  1Z25 A;  5C42 A;  1TKD A;  1IG9 A;  2WOM A;  5C24 A;  4DQI A;  3DLH A;  4F2R A;  1Z26 A;  4C8L A;  2PYJ A;  4CJ5 A;  1CXQ A;  2GBZ A;  3RMC A;  1WSE A;  3HM9 A;  2Y1I A;  1NKE A;  3KK2 A;  4Z4F A;  1B92 A;  3LDS A;  4KHY A;  3WNE A;  2HVH A;  1T05 A;  1C1C A;  5K14 A;  4F8R A;  1JLB A;  3M8P A;  1TVR A;  1D9D A;  3V9X A;  3SUP A;  1VSI A;  2G8W A;  1Q9X A;  1RBT A;  1ASV A;  3MED A;  3SQ4 A;  3E01 A;  1TAQ A;  3NGY A;  1IKW A;  3QEI A;  1F21 A;  2Z1G A;  4N76 A;  1EX4 A;  1C0T A;  1TK0 A;  1S6P A;  1EKE A;  1SV5 A;  3B6O A;  4CF9 A;  3OYI A;  1XWL A;  4FLW A;  1X9W A;  2HHS A;  3LZJ A;  3NAE A;  3TAB A;  4I9L A;  2F8T A;  3VQP A;  1RIL A;  4CJE A;  4LSL A;  1S9G A;  5CYM A;  3L2R A;  3VQ6 A;  1KFS A;  1KVA A;  1S1U A;  2KTQ A;  2Z1H A;  3V4I A;  2A1S A;  3NF8 A;  1NK8 A;  3NCI A;  4FM2 A;  4FJN A;  3AA5 X;  3LPT A;  1I3A A;  3HP9 A;  1KVB A;  4IBN A;  4CFA A;  3SUQ A;  1JL2 A;  3QIP A;  4CGH A;  4DSL A;  3HT3 A;  3QER A;  3MXM A;  3C6U A;  3ZT4 A;  1GOC A;  3RR7 A;  4NCB A;  2G8K A;  1RT1 A;  3DLK A;  4NCG A;  5FRM A;  1WLJ A;  2VG5 A;  2EX3 A;  4CIE A;  4CED A;  2D0C A;  3ZSY A;  4E3S A;  5C25 A;  3OJS A;  1S1W A;  3PV8 A;  3V81 A;  1ZBL A;  3O3F A;  3ISN C;  3AO5 A;  3ZSX A;  4CJR A;  1CXU A;  3DRR A;  2ZE2 A;  3HST B;  1QQC A;  2XY7 A;  1FXX A;  1BCM A;  4OKE A;  1JXB A;  1VK0 A;  4KHU A;  3DLG A;  4DG1 A;  3LP2 A;  3OYD A;  3AVF A;  4KTZ A;  3QNO A;  4ELT A;  2IS3 A;  4DU1 A;  1A5W A;  4H4M A;  4CJS A;  2D0B A;  4RW9 A;  1JKH A;  3QO9 A;  3O3H A;  1U47 A;  1S9E A;  4CK1 A;  4O0J A;  4IKF A;  4N41 A;  3OYC A;  3QIO A;  4KI4 A;  1BIS A;  3AVL A;  3DLR A;  4I2Q A;  2ITG A;  4CEF A;  4I9Q A;  3QEW A;  4E89 A;  4CIF A;  1UA1 A;  3TI0 A;  1CLQ A;  4CGD A;  3DOL A;  3TR8 A;  4OLA A;  3LAN A;  1SL2 A;  3NGZ A;  2YNF A;  3KTQ A;  1Q8I A;  3TAE A;  5HRP A;  4HCC A;  3F73 A;  3MEC A;  3ZCM A;  3U6F A;  3SYZ A;  4KHQ A;  3OYE A;  3TAP A;  1RCH A;  5HBM A;  1RBS A;  3VA0 A;  2XRI A;  3C94 A;  4M3W A;  1QHT A;  4KV8 A;  3L2Q A;  2W42 A;  2YV0 X;  3EY1 A;  3BDP A;  5FRN A;  1XC9 A;  3SQ0 A;  1XHX A;  1S1X A;  1EET A;  4B3O A;  3FFI A;  4DFJ A;  4CHO A;  2VG6 A;  1LWC A;  3ZT1 A;  4GMJ B;  3SUO A;  3IG1 A;  3T19 A;  1YT3 A;  5FRO A;  3S3M A;  1BQN A;  2ZQB A;  4Q0B A;  1HYS A;  2FBV A;  3V9W A;  1REV A;  4W5Q A;  2G8F A;  5JS2 A;  2X6N A;  4N5S A;  1NJY A;  1XHZ A;  2F96 A;  2GV9 A;  1HNV A;  3KIO A;  5J2Q A;  1KCF A;  1WAF A;  2LSN A;  3DLE A;  3ITH A;  3LP3 A;  3M8S A;  4B9N A;  4F2S A;  4DS4 A;  1KLN A;  2OYQ A;  4FW2 A;  3ZSQ A;  3S3O A;  1TGO A;  1JLE A;  1LAW A;  3AVB A;  4NYF A;  3JYT A;  1L3T A;  4FJH A;  3OYA A;  4FJ9 A;  4DSK A;  4ID1 A;  3VQC A;  4PA1 A;  4CJT A;  1VSE A;  5CZ1 A;  3RRG A;  4JLH A;  4DQR A;  5FDL A;  2R7Y A;  1X9S A;  1NJW A;  1VSH A;  2HND A;  3THV A;  2KFZ A;  4DS5 A;  1T8E A;  2ZD1 A;  1Q9Y A;  2QKB A;  3I0R A;  1RT2 A;  3TAN A;  4ELU A;  4HUF A;  1O1W A;  4AHS A;  4DFM A;  1TKX A;  3EYZ A;  2OZS A;  1NK4 A;  4FZY A;  3S3N A;  1BQM A;  2RKI A;  3DYA A;  5DMR A;  4UQG A;  4BE1 A;  2XY6 A;  3PO4 A;  4W5T A;  2QKK A;  1VSJ A;  4CGJ A;  3SJJ A;  1NK7 A;  1RBR A;  4WE1 A;  1G15 A;  4FLY A;  3ALY A;  2FBT A;  4N47 A;  4CEA A;  1JLQ A;  2VWK A;  3M8R A;  4DTN A;  3UIQ A;  3HVT A;  1LWE A;  4RG8 A;  1SUQ A;  3LP0 A;  4PUO A;  3SZ2 A;  3VQ8 A;  3HP6 A;  3V6D A;  3JSM A;  3NBP A;  4FJL A;  4GVM A;  5J2P A;  4Y1C A;  1C0U A;  2DFF A;  3OYK A;  3KLE A;  1IKV A;  1UAX A;  4DFP A;  3QIN A;  3L2U A;  1QSS A;  4FJ8 A;  2XY8 A;  3VQD A;  2JLE A;  4N56 A;  1KLM A;  3OYH A;  3OYJ A;  4DU3 A;  4F3O A;  4HCB A;  3LWM A;  1D8Y A;  4H8K A;  2BDP A;  1IO2 A;  1YTU A;  4MFB A;  3QLH A;  3V9S A;  4J2B A;  3LAK A;  3VQA A;  3CQ8 A;  3QES A;  1NK9 A;  2HMI A;  2YHB A;  1RDB A;  1QE1 A;  3AO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...