4CJUA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
molecule tags Transferase
source organism Human immunodeficiency virus 1
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjuA00
1T8EA 1RT3A 3ZSQA 1RTJA 2HNDA 1LWEA 4KAZA 3AA3A 3RR7A 1RT7A 4FLTA 4I9QA 2D5RA 3SPZA 3EZ5A 3OS2A 2XY6A 5J2PA 1C1BA 1G15A 1RT5A 3QIPA 4GW6A 2IGIA 2JLEA 5JS2A 4CGHA 3BDPA 1WAFA 4ID1A 4CFBA 1L3VA 1KSPA 1T05A 3C95A 1L3TA 3DLGA 4FZXC 1O1WA 3VQAA 2ZQBA 3OYBA 1RTDA 4JS4A 2PZSA 1RDCA 3TAMA 3KTQA 3AA4A 3LPUA 4I2QA 1NK9A 1EKEA 4OGEA 1WNSA 2F8TA 2A1SA 3K57A 3DLEA 4FJGA 4EZ6A 3SQ0A 4KPYA 4M41A 2G8UA 2RPIA 3O3FA 4F3OA 1TKXA 4FK4A 3NH2A 1CXQA 1GOAA 2IC3A 4NYNA 4C8NA 1JL2A 1GOCA 4FLXA 4F4KA 4G1QA 2GUIA 4CECA 5HRPA 1MU2A 3L2QA 1C0TA 4CK3A 3HXMA 1TKZA 3T3FA 3V9UA 2IS3A 4KI4A 3ZT0A 4E7IA 4KHSA 4TSXA 1IKVA 1W9HA 1BQMA 2XY5A 1TL1A 1S6PA 1SV5A 4KB0A 1YTAA 4UQGA 1JLBA 5E41A 3JSMA 1VSKA 2QKKA 4DQPA 3SUQA 2GV9A 4K8XA 3KK1A 4CJRA 4PUOA 4BWMA 4PQUA 5DK5A 4CEDA 1J53A 4N56A 1S1VA 2ATQA 3SV3A 2IDOA 2WONA 3RWUA 2KZZA 3AVGA 2VG7A 3TAGA 1SKWA 1IKWA 1LV5A 1VSHA 4IFYA 2D0BA 2G8WA 4KHQA 4B3OA 3OY9A 4DWIA 3S3OA 3NGIA 4E89A 4DTSA 2D0AA 4GMJB 4YNQA 3C6UA 3NF7A 2HHWA 5FROA 1SUQA 2FBVA 1LW2A 4W5TA 5I42A 1QSLA 5FRNA 4LY7A 3PO5A 3CM5A 3WNHA 3TANA 3SNNA 4DU1A 5J1EA 2BANA 3TAFA 2X78A 2NUBA 3G0ZA 5K14A 1RDAA 2VG6A 3TWHA 1L5UA 3DOKA 5HBMA 3ZSRA 4CEFA 4DSFA 3HL8A 1KCFA 3P5JA 4CGJA 3V81A 4H8KA 1IKYA 4CGGA 1DTTA 2E6MA 2YHBA 1U04A 1C6VA 4ZHRA 2XHBA 4ELTA 3AVKA 1KTQA 3ZSXA 4DU4A 4MFBA 4DLGA 4FJ5A 1I3AA 4HVJA 4BDYA 3LP2A 3AVFA 1NJXA 2Z1JA 3O3GA 4OGCA 3DI6A 2Z1HA 4AILC 5JS1A 4CESA 4B9UA 4Z4FA 4CFDA 4RW6A 5SZTA 3RMDA 4FZZA 3VQ6A 3NBPA 4CJPA 3QINA 2Y1JA 3OYDA 3K58A 1FKOA 4CF1A 5HRNA 2OPPA 4E7KA 4Z4EA 1VSFA 4O5BA 3VQCA 3V1QA 4N5SA 1NK0A 3OS0A 3L2WA 4FLZA 5J2MA 4C8KA 4F8RA 3HSTB 3PX0A 2ITGA 1VSJA 1HJRA 1JLAA 2ZE2A 4CGFA 3DLHA 2BGGA 1U49A 1RBRA 4C8OA 4Z4IA 1WAJA 3TI0A 4DQSA 3FFIA 5KRTA 4NCBA 3M8SA 3HP9A 5T7BA 1HNVA 4DSLA 1QHTA 4FM1A 3OYIA 3LP3A 4M3RA 4FLUA 4CFAA 3L3VA 3AVNA 1S1WA 3M8RA 3HM9A 2O4GA 3HPHA 4Z4GA 4HCCA 3LZIA 1W0HA 1ASWA 4DG1A 1RT4A 1Y97A 4HUFA 4CJ5A 1B9DA 2PYJA 1S1TA 3IRXA 2RKIA 3AV9A 4CJ3A 3NCIA 3PV8A 1WLJA 4E1NA 2OYQA 3AVIA 3F73A 3HYFA 4EP4A 5EU7A 3L8BA 3LALA 4CEBA 3KKSA 3NHGA 4O55A 4JRQA 3LAMA 3KLEA 3IAYA 4B9VA 1KLNA 4B8AB 4DTOA 3DOLA 3CM6A 4DLEA 3TAPA 4RW4A 1TK8A 1TAUA 1U48A 4ELUA 3HJFA 3C94A 2P5OA 4ELVA 4DS5A 3KK3A 3SUPA 1U45A 1QSSA 4RW9A 1ZBFA 4BWJA 4CJVA 3NGZA 4FJLA 5KI6A 1WSFA 2XY7A 3IG1A 3D0PA 4DFKA 2A1RA 4OKJA 3CFOA 1QTMA 1BHLA 4Y1CA 3I8DA 4JLHA 4OLAA 1S1UA 2FBTA 1BCOA 2YNHA 3QIOA 1ZBUA 2G8IA 3HVTA 3K5MA 3V9SA 4KO0A 2OPRA 1HQUA 3AO2A 2XO7A 3VQQA 4E19A 1BISA 1TAQA 1HYSA 3O4QA 3G10A 5HRRA 3AVHA 1QSYA 4KTQA 4OKKA 4Z4HA 1S6QA 4N47A 5CZ1A 1CXUA 1WSGA 4CF2A 4BE1A 4M3UA 1RILA 3DMJA 2EX3A 1J5OA 3VQ9A 1VSDA 2KQ2A 3NF6A 3TR8A 4NYFA 4CJFA 3KLFA 3VA0A 1JLQA 1A5WA 4O44A 3I0RA 2AJQA 1JLCA 2KFNA 1LAWA 4CERA 4FYDA 4BDPA 3U6FA 3AO5A 1RDBA 1RBUA 4LSNA 1TK0A 3ALYA 1CZBA 4CF0A 4CJ4A 1NK8A 4RW8A 3SZ2A 3OYEA 4PY5A 4ZTFA 2I5JA 2W42A 1BI4B 3QESA 4J2AA 2DTUA 4QOZB 3AVLA 2RF2A 1RDDA 5D3GA 2F8SA 4DQIA 4FJ8A 4DTXA 3NDKA 4BE2A 4DS4A 1D5AA 4KI6A 2Z1GA 2ZD1A 1D9DA 3LDSA 4CE9A 1IH7A 3VQPA 4DTNA 1NK5A 1N6QA 4W5NA 3V9ZA 4Y1DA 4AHRA 4W5OA 2DFFA 1VSMA 3LP1A 3QEWA 1X9SA 1CLQA 2HB5A 2E4LA 1IO2A 3NAEA 3QEVA 1VRTA 1SKSA 3CYMA 4CCHA 4KRFA 4KB1A 3VQ4A 3L2RA 1XHXA 4J2BA 4I7FA 4IFVA 3NF8A 1BL3A 1HYZA 3NGYA 3T19A 1TK5A 1HQEA 2RN2A 1QQCA 3AVJA 4H4MA 2VG5A 4KKOA 1TKDA 4Z4CA 4YFUA 3WNGA 3VQ5A 5KGXA 4CF8A 1ZBHA 2HHXA 1QE1A 1S9EA 1JXBA 3VQBA 4ZTJA 2PYLA 1RNHA 2KW4A 4DTRA 2DFEA 3IS9A 1T7PA 1VSEA 3LAKA 3V9WA 1VSIA 4OVLA 5SWMA 1EX4A 3ZCMA 2B4JA 4N76A 1C1CA 4CJSA 4E7HA 3QNNA 5KRSA 4CHOA 4CGIA 3S3NA 1HRHA 2GBZA 1ZBLA 3PX4A 4LSLA 4DSIA 1C0UA 1S5JA 4L8RB 3NE6A 4BE0A 3SI6A 4KV8A 4B9MA 4OPKA 4CJKA 1C0MA 1RBTA 4CJQA 4CK1A 3OYMA 3OYNA 3MXIA 3ZT2A 3OJSA 3AVMA 2HHUA 3U3GA 1TVRA 3VN5A 4M3XA 3ZSOA 1C1AA 1S1XA 1Q9YA 3EYZA 1HPZA 1VRUA 4FM2A 3AA2A 3BGRA 4I2PA 4CJTA 1XI1A 4M45A 3HPOA 2OA8A 3HVRA 1ZYQA 4DMNA 1JLEA 2B6AA 2HNZA 4CJUA 1Z26A 3K59A 1EXQA 2VWJA 4DTUA 3KKRA 3HK2A 3DLKA 4C8LA 1IKXA 4CGDA 1FKPA 3CFPA 4DFPA 4HTUA 3SCXA 2HHSA 3DYAA 1NK6A 2KFZA 4IBNA 2B5JA 1JLGA 3NF9A 3PX6A 3P83D 3DRRA 1B9FA 1BCMA 1RCHA 4PWDA 3TABA 4OKEA 2PY5A 1A5XA 4XIUA 3K5LA 1CZ9A 4F2SA 3K5OA 1WSJA 4EP5A 3QO9A 3VA3A 1KFDA 4IDKA 2IOCA 4CHNA 4CHPA 3ZT3A 3UIQA 2JGUA 4CIEA 3QLHA 3WNFA 3ASMA 1NJZA 2F96A 3KLGA 1WSHA 4N41A 3MEGA 3OYJA 1VSLA 3AVCA 4CJWA 3B6OA 5J2QA 3QEXA 3KJVA 3V6DA 1TKTA 1NKCA 2HMIA 4DU3A 4DQRA 2D0CA 2EHGA 4NCGA 2FC0A 3O3HA 1L3SA 3SQ2A 4DFMA 5KTQA 4E7JA 4K8ZA 4CIFA 4FM0A 4E1MA 4EZ9A 1VK0A 1KRPA 2LSNA 3M8QA 3PO4A 1REVA 1UWBA 2WOMA 3O4NA 4RW7A 2Q3SA 1JXEA 3KLIA 3KK2A 2IAJA 1Q8IA 4FJJA 3SQ1A 3L3UA 2KTQA 4C8MA 1LWCA 4PA1A 5DMRA 3NH1A 4HUGA 2QKBA 4FJIA 2E6LA 3RMAA 4CJEA 3RMBA 3K5NA 1NOYA 4DSEA 1Q9XA 1YTUA 2Z1IA 1BIZA 2X6NA 3AO4A 4B9TA 1BIUA 3DRPA 2VWKA 4KHYA 3TAEA 4CIGA 1HMVA 3LZJA 2FBXA 4B9NA 1IG9A 3HO1A 4DSJA 4JS5A 4RG8A 4Q5VA 1NOZA 4QAGA 1NJYA 5CYMA 2YHAA 4GVMA 3OYKA 3THVA 4M3YA 1XHZA 4HUEA 1D8YA 4B9LA 1R0AA 3QEPA 2YNFA 4KHWA 3QNOA 4B9SA 3V1OA 4FJ7A 4J2DA 3TARA 4FJNA 4IG0A 5FDLA 3AA5X 4KREA 3DRSA 3LWLA 4IKFA 1UA0A 3KD5E 1EP4A 3WNEA 4H4OA 5HROA 5HLFA 3OJUA 2R7YA 4W5QA 3JYTA 5J2NA 4FW2A 3L2VA 2OZSA 4CFCA 2G8KA 3KLHA 1JKHA 4FJHA 1LWFA 1DLOA 1X1PA 4FJXA 4FJMA 1NK4A 1TV6A 3RRGA 4FLYA 3M8PA 4CEZA 2HVHA 1QS4A 4KFBA 3DLRA 5FRMA 1SL2A 3V4IA 2XRIA 4E3SA 3NFAA 1J9AA 1UA1A 2X6SA 3QEIA 4DTPA 1KVAA 4KHUA 4FLWA 2G8HA 3ISNC 2YV0X 1RTHA 4DTMA 3AO3A 3RMCA 1XC9A 4AHCA 2YNGA 4DTJA 2QK9A 4FXDA 2YNIA 3KIOA 4E0DA 1L3UA 1LAVA 4NCAA 2P1JA 3ZSZA 3SPYA 3K2PA 3HPGA 1UAXA 1BQNA 4CK2A 3QERA 1NJWA 1SL0A 4I9LA 4AHSA 4CEOA 1DTQA 2XY8A 4LH5A 4OLBA 4B8CA 1RBSA 4AHVA 1J54A 5C42A 3T1AA 4FK0A 3TAQA 1RTIA 4CHZA 3AVAA 4DF4A 3MXJA 3F9KA 4FJ9A 1RT1A 3LP0A 3QETA 1ITGA 1D9FA 3ZSWA 3HP6A 4KTWA 1Z25A 1RT6A 1U4BA 1ASUA 1YT3A 4WE1A 3VQDA 1XWLA 4FJKA 1KVBA 4E7LA 4JRPA 2KZMA 3ULDA 4AH9A 4CHQA 3H08A 4OPJA 5KGWA 1SKRA 4DQQA 4M3TA 3AO1A 1YVUA 1X9WA 4O0IA 4DSKA 2O4IA 1T03A 2HVIA 3SQ4A 1N5YA 4O4GA 3MXMA 4QCLA 2DY4A 1S9GA 4ICLA 1WN7A 3L2UA 3U3YA 3OS1A 3ZSYA 4CHYA 3OYAA 4FW1A 3HT3A 1LW0A 1ASVA 3LWMA 1X9MA 1KFSA 5C25A 3KD1E 3I0SA 4FK2A 2OPQA 3P1GA 3SUOA 2YKNA 3SJJA 3V1RA 4HCBA 1BGXT 3OYLA 4Q0BA 4J2EA 3MEEA 4CF9A 2HHQA 2HHVA 2X74A 3ZSVA 4FZYA 4MQ3A 4BDZA 3RRHA 4HHTA 1BI4A 4M3ZA 1K6YA 4BACA 3LANA 3EY1A 3SV4A 2ETJA 1RT2A 4O0JA 1JLFA 1WSIA 4IG3A 5HP1A 4CEEA 4AHTA 1FXXA 3OYHA 3ZT4A 2FBYA 3OYGA 1KVCA 4F3TA 4CEAA 1U47A 4R5PA 4CJLA 3OYFA 5HRSA 1A5VA 4DFJA 1KLMA 1HNIA 1GOBA 1WSEA 3PY8A 5CY4A 1I39A 3B6PA 3SUNA 5CYQA 5CZ2A 3CFRA 2YKMA 2OPSA 4KTZA 4FLVA 2HW3A 3E01A 4FVMA 2G8FA 4FCYA 1EETA 3V9XA 4CEQA 5I3UA 3DM2A 1TL3A 3S3MA 1NK7A 1ZBIA 3ITHA 1SL1A 3NH0A 3MAQA 1TGOA 2BE2A 4M3WA 2HNYA 3OYCA 1RBVA 3CG7A 3LPTA 3OVNA 1HYVA 3RR8A 4F2RA 4KHNA 4AHUA 1B92A 4B08A 3SYZA 1UOCA 4LH4A 3VQEA 2BDPA 1FK9A 1NKBA 4W5RA 2P51A 3MEDA 1JL1A 3VQ7A 3RTVA 4ID5A 2Y1IA 2P5GA 2DFHA 3A2FA 2QXFA 3C6TA 3PUFA 3CQ8A 1NKEA 2OZMA 2HHTA 3ZT1A 3D45A 2G8VA 3S9HA 4M42A 5C24A 1F21A 3VQ8A 4DF8A 3DLBA 3AVBA 4Z0UA 3MECA 4OJRA 4LD0A
chains in the Genus database with same CATH superfamily
2GELA 4C1NK 2HNDA 1LWEA 1H1VA 1U2VB 3QB0A 1IV0A 4CD3A 3EZ5A 1CZAN 3U8XA 1BWFO 3P31A 5AQOA 4CZIA 1TYQB 3BDPA 1NNEA 1S3XA 1KSPA 3PLAA 1T05A 1YI2N 4EAHD 3LPUA 2NRXA 5AQSA 5AQUA 1WNSA 2F8TA 3EKSA 4BROA 4MLHA 1U6ZA 4FJGA 3OBWA 5BRHA 4KPYA 3O3FA 4GV3A 3EEQA 1TKXA 3IDHA 3QDKA 4H0VB 1GOAA 4G1QA 4YOVA 4BR4A 1K8KB 4CK3A 3HXMA 4NXMK 2KKZA 3WEEB 1IKVA 1S6PA 3KZBA 4YHHK 3BF1A 1NGDA 1HR0K 4DQPA 1VQKN 3SUQA 2ZGYA 3KK1A 4JKHA 4PUOA 3E1YA 2QI2A 2IDOA 1SKWA 4B3OA 4IFYA 5LJVA 3DLLL 4YORA 5BPNA 3VEOA 4GMJB 1WB9A 1N34K 4A59A 4BG9A 3JXUA 3NF7A 2FBVA 4W5TA 1VQ9N 4LY7A 2AP1A 2Q31A 3CM5A 3GE1A 4YOUA 4DU1A 1N36K 4BRNA 1EWRA 1T6CA 4BQZA 4H5NA 1OH7A 3I56N 5HBMA 2CGKA 4CGJA 1Q82O 1M1KO 1WUAA 2E6MA 1U04A 3IUCA 1C6VA 4FWMA 2GX9A 3AVKA 4DLGA 2P9LA 4JAXA 2E2PA 4BDYA 2Z1JA 4OGCA 3MX2A 5M1FA 5JS1A 2P9NB 4RW6A 3RMDA 3THXA 3QINA 3DXMA 4CZMA 2Y1JA 1OVYA 3K58A 4CF1A 5HRNA 1DGKN 1VSFA 3VQCA 4FLZA 3OA9A 4F8RA 3HSTB 2A5XA 3PX0A 2ITGA 2BGGA 1U49A 5LY3A 3CIPA 3ZX2A 4DV6K 2VYPA 4XH1A 3C65A 5T7BA 1QHTA 2W6LA 3BZCA 3LP3A 1I94K 3O9UA 3O5BA 2P9UB 3CJ7A 1S1WA 3P38A 4JI5K 3HPHA 3LZIA 1XNQK 1W0HA 4DG1A 2QWNA 1RT4A 3O08A 5AQWA 4CVNE 4O5FA 1B9DA 4R79A 1S1TA 2O8FB 3F73A 3HYFA 4KAZA 4CEBA 3LAMA 3KLEA 3CCJN 4IXCA 4BQLA 3DOLA 4DTOA 1C0GA 3CCVN 2P5OA 3L4IA 3SUPA 4BWJA 1ZBFA 1ILYA 3WXIA 3MN9A 3D0PA 5KPZA 4DFKA 3LL3A 5GAHP 3CFOA 4Y1CA 4OLAA 2FBTA 1BCOA 4KO0A 3O6WA 3AO2A 1TYQA 3O4QA 4WQ5C 1IBMK 3CMEN 4Z4HA 3SAHA 3R1XA 1C0FA 4CF2A 3U4LA 4BE1A 3ZYYX 5KPRA 3NF6A 3VA0A 4JKGB 3LDQA 4FL9A 5AQMA 4CERA 3DXMB 4CZEA 3U6FA 4EFHA 4LSNA 1CZBA 2HSTA 4B1UB 1NK8A 3SAGA 4RW8A 1HLUA 3CCEN 2I5JA 2W42A 5BPMA 3QESA 2F9TA 3CCLN 2RF2A 2UXCK 3KVGA 3G25A 4CE9A 1N6QA 1NK5A 4W5NA 4Y1DA 4AHRA 4W5OA 3F9MA 1X9SA 3HTVA 4WFBL 1K8KA 5EX5A 2O8CB 4J2BA 3NF8A 1TK5A 1HQEA 2RN2A 3SMSA 4KKOA 4Z4CA 4YFUA 3WNGA 3VQ5A 3UKUA 5KGXA 1JXBA 3VQBA 2ZM6K 1RNHA 3TPQA 4EHTA 4DTRA 4JKBA 4K0KK 2P9LB 1VSEA 3FE1A 5IWAK 1C1CA 3QNNA 3H45C 3JS6A 2FLOA 4BRDA 4LF4K 3S3NA 3SMPA 2GBZA 4LSLA 5BN9A 2JWLA 1C0MA 4CJQA 4CK1A 2UXDK 3ZT2A 3OJSA 2HHUA 1W2BM 3TTFA 3U3GA 3G6EN 5AQVA 1T44A 1C1AA 4FM2A 3F2KA 4GKJK 1ZYQA 1VQ7N 4DMNA 2HNZA 2VWJA 3HK2A 1M90O 4C8LA 1FKPA 3CFPA 2HHSA 3DYAA 1NK6A 3PX6A 3P83D 3DRRA 1RCHA 1BU6O 4PL7A 4EP5A 1WSJA 4DHYA 3VA3A 1KFDA 4CHNA 3UIQA 1NGAA 3H3OB 3VEWA 4B3RK 3MEGA 2WUSA 3AVCA 3B6OA 4M7YA 3QEXA 4DU3A 4DQRA 5M1NA 1L3SA 3CCMN 2E1YA 1VQLN 4JKCA 1NLVA 4E7JA 1D4XA 4E1MA 4F9OA 1VK0A 2LSNA 2P9UA 5EOYA 2Q3SA 2IAJA 3CPEA 1HNZK 3D2EA 4PA1A 3SJHA 2QKBA 3GBTA 4OPAA 4FJIA 4JKEA 3K5NA 4FPAA 4B9TA 1BIUA 5AQNA 4Q5VA 1JCFA 2F4VK 2YHAA 4M3YA 4FWNA 3OYKA 3QNOA 1QVGM 4B3TK 3O8MA 1Q81O 5FDLA 4IEIA 4KREA 1UA0A 4H4OA 3OJUA 4W5QA 4CZKA 4FW2A 4U67L 4CFCA 5JLFA 4C1NI 4IZ9A 4BR5A 4JKGA 1GLFO 4FJXA 4EHUA 3M3ZA 2HVHA 3SAFA 1SL2A 5AZJA 4DR3K 2O8BB 5HL7L 4XEIA 4FLWA 1RTHA 4A62A 3RMCA 1OH6A 2YNGA 2QK9A 5AR0A 4AM6A 4RCHA 2ZJPL 3SPYA 3HPGA 2QXLA 3MX5A 1NJWA 4I9LA 3ATVA 1XQSC 2XY8A 2J4RA 5KPTA 5C42A 2FXUA 3TAQA 4DKWA 3ULEA 1NJIO 1D9FA 1KAYA 4LF9K 4BRIA 3E9PA 1RT6A 4FWOA 1U4BA 1ASUA 2QW9A 1XWLA 3KHYA 1KVBA 3H1VX 4AF1A 4AH9A 4CHQA 1SKRA 5KGWA 1YVUA 1T03A 2QEXN 1NGGA 1N5YA 4LF5K 1X3MA 3L2UA 3HZ6A 4H0TB 4RWTA 3LWMA 3KD1E 1LW0A 1ASVA 3R8EA 1X9MA 1VHXA 3P1GA 4DUYK 3SUOA 5TKWA 4CF9A 4FZYA 3ZSVA 4V19S 1Q86O 3H46O 2O8DA 1RT2A 1JLFA 1X9JA 4AHTA 3OYGA 2FBYA 5JMVA 4CEAA 3EE8A 4R5PA 1XMOK 3OYFA 5HRSA 1WSEA 5CZ2A 4MO5A 3CFRA 3M6GA 1SQKA 4CEQA 4B9QA 5GAEP 1MDUB 3S3MA 1SL1A 3MAQA 1IG8A 3OVNA 3RR8A 1HYVA 1MA9B 4AHUA 4B08A 1FK9A 3MEDA 2Y1IA 1VQMN 3VEVA 3ZT1A 3D45A 4JI0K 5C24A 3VQ8A 2W40A 3VF4A 4GV6A 4CHOA 4LD0A 1ZC6A 2A41A 1YJWN 1YXQA 3W3DA 4FLTA 5J2PA 1C1BA 3QIPA 1N8RO 4ID1A 4ISGA 4CFBA 1K9MO 1GLDG 5FPMA 1IJJA 3C95A 1L3TA 1O1WA 1EWQA 3KTQA 1RDCA 3TAMA 4NLBA 1NK9A 1EKEA 5AZIB 2A1SA 4QS8A 1NU0A 4MO4A 3A0IX 3SQ0A 1YAGA 4M41A 2CH6A 2G8UA 4F3OA 2PAVA 4DQ8A 3NH2A 2D0PA 1KQSM 5CR4A 2IC3A 4NYNA 1JL2A 4FLXA 4CECA 4KI4A 3V9UA 2IS3A 3ZT0A 2WBNA 4G9ZA 5M1PA 4KB0A 2CGLA 4JK9A 4JKDA 3JSMA 2QKKA 3C6HA 4CEDA 4MDAA 2ATQA 1R59O 4B1VA 4YNQA 3C6UA 3G4SN 1SUQA 5I42A 1LW2A 5FRNA 4CJ7A 4GVEA 4A2AA 3TANA 2X78A 1EQYA 5K14A 3ZETB 3M1FA 3DOKA 3CC2N 4H5VA 3HL8A 4H8KA 1MWKA 4CGGA 3BY5A 1WBBA 5F0XA 2XHBA 4ELTA 1RGIA 3PIPL 4MFBA 4HVJA 3VGMA 3LP2A 4CBUA 2A40A 5E26A 4B9UA 3VQ6A 1MWMA 2NZTA 3K0SA 1WBDA 5MLCQ 2KHOA 3OYDA 3ID8A 4N5SA 1NK0A 3OS0A 5J2MA 3ENOA 5B8HA 1JLAA 4CGFA 2UUCK 3WEEA 3DWLA 4Z4IA 1WAJA 3FFIA 1LCUA 3QMLA 3D2FB 3HP9A 1BA1A 1Q18A 4NLCA 3C0BA 2YHWA 1IBLK 3H3NO 4LC9B 4CFAA 3HM9A 3NVMA 4Z4GA 2P9KB 4HCCA 3VTIA 3HOTA 4HUFA 4DB3A 3UKRA 3NCIA 3PV8A 3J80O 4JHDB 4E1NA 3A5OC 2OYQA 4EP4A 5BPLA 4WQ4C 3LALA 5M1OA 3KKSA 3IAYA 4O55A 4LF8K 2P9NA 4B8AB 3CM6A 2P9SA 3C94A 5DM7L 4ELVA 4WF9L 3KK3A 3CJBA 3NGZA 4FJLA 5KI6A 4OKJA 1YJNN 1BHLA 4JLHA 1XUPO 3QIOA 2YNHA 1ZBUA 2G8IA 3K5MA 2OPRA 1HQUA 4H5WA 2P9SB 4E19A 3VENA 1TAQA 3AVHA 3E9OA 1CXUA 2D4WA 2GUPA 3LDPA 4J8FA 4DV1K 3DMJA 4X62K 2EX3A 1J5OA 1VSDA 4CJFA 1JLQA 1A5WA 1JLCA 1IBKK 1LAWA 3AGKA 4BDPA 1RDBA 4CF0A 4KH6A 1VQ4N 4YY3K 4ZTFA 4J2AA 4QOZB 4FWKA 4DR1K 4JI2K 5D3GA 4FJ8A 2F8SA 4NXNK 4KI6A 1D5AA 3THYB 2NNWA 2ZD1A 1D9DA 1YVNA 4K41A 1IH7A 4DTNA 3O80A 1VSMA 3UKUB 3QEWA 1CLQA 2DPNA 3CQYA 3F5TA 2HB5A 3M5RA 1IO2A 3QEVA 4KRFA 2VGNA 3EO3A 5AFUA 1QQCA 4H4MA 2VG5A 4FO0A 2HHWA 2DFEA 3KWIA 3V9WA 4OVLA 2B4JA 5KRSA 2UU9K 4CBXA 1ZBLA 3PX4A 1ATRA 4CZFA 3SI6A 4KV8A 3Q7BA 4B9MA 4CJKA 1RBTA 3VPZA 3OYMA 2O8EA 3ID6A 4DV7K 1TVRA 4M3XA 4K43A 3EYZA 1HPZA 1VRUA 3AA2A 3C7NA 2CH5A 2FSNA 1KAXA 4FOIA 4JN4A 4QS7A 4DTUA 2NRHA 3SLCA 4DFPA 2KFZA 3TSPA 3SCXA 4JYAK 3E9LA 3H1QA 3RVCA 1B9FA 3J7ZO 2PY5A 4BRLA 2QA4N 1YJ9N 4IOAL 2ZJQL 3TSUA 4CHPA 3ZT3A 3VESA 3VGLA 5AQYA 3QLHA 3ASMA 1TUUA 2F96A 3KLGA 1VSLA 2I7PA 3HSCA 3LM9A 2UUAK 5J2QA 2Q36A 4WFNL 2O8CA 3KJVA 3V6DA 1TKTA 3DXKA 2HMIA 1OKJA 2FC0A 4DR6K 4DFMA 2P9IA 5KTQA 4K8ZA 4BRAA 3J8AA 1KRPA 1KC8O 1UWBA 3O4NA 3KK2A 1JXEA 1Q8IA 1VAZA 3L3UA 4HWIA 4C8MA 3IFRA 4UY8O 4CD1A 1LWCA 4HUGA 1ATNA 2BTFA 2ASPA 4CJEA 3C7NB 1YTUA 3LZJA 2FBXA 3WXJA 3A5MC 4QS9A 2E2NA 3A5NC 4DSJA 4JS5A 4RG8A 1NOZA 4QAGA 5CYMA 4M63C 5JLHA 1XHZA 4HUEA 2QWMA 1D8YA 1R0AA 2YNFA 4KHWA 4B9SA 3V1OA 4YOWA 3TARA 4IG0A 1KXPA 3AA5X 4X64K 3DRSA 5LL6Z 3KD5E 3WNEA 2V51B 3JYTA 5J2NA 3PIOL 3VEZA 1TUYA 3KLHA 3THWB 2G8KA 4FJHA 4LFCK 1DLOA 1X1PA 2QWOA 3RRGA 4FLYA 1QS4A 3V4IA 2XRIA 2X6SA 5AQJA 2YV0X 1XC9A 2ASMA 1HNWK 4FXDA 2P1JA 4H0OA 1BQNA 2E1ZA 1VQNN 2GEMA 4CW7B 4OLBA 4AHVA 1P8ZA 2VGMA 1SAZA 3T1AA 3AVAA 3QICA 3F9KA 3VERA 3ZSWA 1NGFA 2H3GX 5FLXO 4WE1A 4DCHA 5JVGL 1DEJA 3B8AX 3O1WA 4JI8K 2O4IA 4O0IA 4DSKA 2ZF5O 3SQ4A 1VQ8N 3MXMA 4ICLA 1WN7A 3ZSYA 4FSVA 3I0SA 4FK2A 2OPQA 4WCEL 3SJJA 5AQZA 2HHQA 3MEEA 2RE2A 4YDUA 3FZKA 4JD2A 1WSIA 1NGIA 1FXXA 3LDOA 4BREA 4CJLA 4ILJA 3RSEA 2IVPA 2GWJA 1I39A 3K9KA 3A8YA 5CYQA 4B1WB 4FLVA 4FVMA 3V9XA 5I3UA 1DKGD 1ZBIA 1TL3A 4XH4A 2P9KA 4A5BA 5ADXH 3OYCA 1JCGA 1RBVA 4BRCA 5EVZA 4IFEA 1B92A 3SYZA 1UOCA 5KQ8A 4W5RA 2P51A 3RTVA 3CQ8A 2QXFA 2QTDA 3PUFA 1NKEA 2G8VA 1F21A 2A6AA 4BRMA 2OCEA 3MECA 3S41A 4E0DA 1T8EA 1J5EK 1RT3A 1RTJA 4BC4A 3AA3A 4I6MA 3OS2A 2XY6A 3DXKB 2FSJA 4JKAA 2E5LK 4GW6A 2JLEA 5JS2A 1WAFA 1O13A 3MDQA 1L3VA 1NWKA 4JK8A 1G99A 3QBWA 3DLGA 4FZXC 3MCPA 3VQAA 2ZQBA 3OYBA 1RTDA 3AA4A 2HF4A 4FWPA 1GLLO 5M1KA 3K57A 2WTUA 4E1JA 3DLEA 3OHRA 4AM7A 4C8NA 2O8BA 4F4KA 4BVOA 2GUIA 5C0YA 5HRPA 1MU2A 4KHQA 3H6EA 3W0LA 5GAGP 2XY5A 1TL1A 1YTAA 1BO5O 2HBKA 3GL1A 3C6AA 5DK5A 1J53A 4N56A 1S1VA 3SV3A 3RWUA 3AVGA 3TAGA 2D1KA 1IKWA 1VSHA 2D0BA 4DWIA 3S3OA 3NGIA 4E89A 2D0AA 3WT0A 4NB4A 4DV5K 5FROA 3CJCA 1QSLA 3WNHA 3SNNA 2CGJA 2BANA 3TAFA 3U9DA 5AQKA 3TWHA 1L5UA 3OW2M 2NRWA 4DSFA 1N32K 4FWQA 2A3ZA 3V81A 1QVFM 3O9SA 3PSIA 1P90A 2HBJA 3AGRA 2E20A 1V4SA 2YHBA 4ZHRA 2ZWHA 1I3AA 3O9RA 1YHQN 5M1QA 1NJXA 3O3GA 3P39A 3L4QA 3DI6A 2W41A 2Z1HA 3FR0A 4CESA 4Z4FA 4LFBK 3NBPA 5E84A 4CJPA 3VOVA 1DT9A 1RFQA 4JK7A 4E7KA 1KAZA 4OO1J 4O5BA 3V1QA 4CZGA 4DR2K 4H0XB 4A5AA 1HJRA 2ZE2A 3DLHA 3TTDA 1RBRA 5AQRA 1YITN 3TI0A 5BRDA 5JICA 4NCBA 3L0QA 4FPBA 1ZBSA 4JI3K 3VMFB 1YF5L 3UB5A 3N4PA 4JD2B 4FLUA 3L3VA 3AVNA 5AQGA 3M8RA 2O4GA 4BC2A 1ASWA 4IJAA 4CJ5A 2PYJA 2RKIA 1WLJA 4YOYA 3T7ZA 4FCYA 5EU7A 1SZ2A 3NHGA 4FVUA 1TAUA 4ELUA 3HJFA 4DS5A 1U45A 1QSSA 4CJVA 2HOEA 5BR8K 3IG1A 2A1RA 1J6ZA 4HTLA 1S1UA 1V4TA 2XO7A 3GG4A 2E8AA 3VQQA 4ILHA 1BISA 5CHIA 3FLCO 4DR4K 4KTQA 1S6QA 1ESVA 5CZ1A 1WSGA 2YI1A 1RILA 3SBTA 5LJWA 3VQ9A 3TR8A 4NYFA 3ZEUA 3KLFA 3VEXA 3I0RA 2AJQA 3MWTA 2KFNA 4FYDA 3FFKB 3AO5A 5I9EB 3ALYA 4GY2B 4CJ4A 3TU5A 2V7YA 1T3VA 3WQTA 5CE3A 4WFAL 5AJ3K 3CC7N 4DQIA 3NDKA 4KH4A 5C15A 3LDSA 3RSEB 4CZJA 3CETA 4BR0A 2DFFA 3LP1A 2NLXA 1VRTA 1SKSA 3CYMA 4CCHA 4NO7A 4X66K 3FZFA 1BL3A 1HYZA 1Z05A 3NGYA 1HNXK 3AVJA 2UUBK 3NMUA 1TKDA 2EWSA 4FWLA 4RTFD 2HHXA 2YX6A 4ZTJA 1YUWA 1T7PA 1W7AA 3LAKA 3QFUA 4E7HA 5F2RA 3ZLJA 2W6KA 1X3NA 1HRHA 2P9IB 4BC5A 4L8RB 1C0UA 3NE6A 3EZWA 4OPKA 3OYNA 3MXIA 3CD6N 4BGBA 3AVMA 1BG3A 5AQTA 3ZSOA 1S1XA 4CZHA 4DUZK 1Q9YA 4CJTA 3BGRA 4I2PA 3T69A 4M45A 3HPOA 3HVRA 4PKGA 2B6AA 4JI6K 1Z26A 1EXQA 3DLKA 1ZXOA 4IDHA 4IBNA 3NF9A 1BCMA 4PWDA 3TABA 3K5LA 4BG8A 2ITMA 3WUHA 1XMQK 4JEPA 4PL8A 2JGUA 3MN5A 5AFUH 3MWPA 5AZJB 2Q0UA 4B1XB 1NJZA 4N41A 4EIAA 4I6MB 4CJWA 1QQNA 1WOQA 4DR5K 1NKCA 3PSFA 2EHGA 1GLAG 3O3HA 3O9TA 5AQQA 3NVKA 2F7TA 2IVOA 2NRZA 3A5LC 1HX1A 3EN9A 2UXBK 3PO4A 2IIRA 3D6RA 4YOTA 4DR7K 2F9WA 3SQ1A 2VQEK 4B3SK 3NH1A 2E6LA 3RMAA 3RMBA 5ELZA 1NOYA 1XC3A 3T1YK 1Q9XA 2Z1IA 1HJOA 3AO4A 3DRPA 3UKRB 2E2QA 2PFUA 1HMVA 4C23A 1U2VA 4H5TA 3FZHA 5AZIA 4B1YB 2PBDA 3AAQA 3THVA 4U7BA 4OPHA 1GLEG 4B9LA 4FJ7A 4J2DA 4IOXA 1HPMA 3BZKA 4Z94A 3LWLA 4JKFA 4BR7A 5HROA 5HLFA 3L2VA 1JKHA 5FPEA 1NGEA 4PKHA 4FJMA 4K25A 3M8PA 3DLRA 3R9PA 1OH5A 1UA1A 3QEIA 4FWRA 1KVAA 4DTPA 5AQLA 3ISNC 1JJ2M 1QZ5A 3AO3A 4DTMA 1FW6A 4AHCA 1GLJO 4DTJA 2YNIA 3DJCA 1LAVA 3U9ZA 3ZSZA 3QERA 5KQDA 1RDUA 2YHXA 1RBSA 2ZGZA 1J54A 4FK0A 4H5RA 2E2OA 4CHZA 1RTIA 3R3LA 2QWRA 4FJ9A 4FOEA 3LP0A 5AQFA 3QETA 1Z25A 3AARA 5C2FA 3VQDA 5EXWA 4E7LA 4JRPA 2KZMA 3ULDA 4M3TA 4OPJA 4DQQA 1LOTB 3CF5L 4M7XA 3ZETA 4QCLA 1E4FT 1S9GA 1QQOA 4CHYA 3OYAA 4FW1A 4O8KA 3HT3A 3THXB 3HRGA 1NMNA 3CXCM 3HI0A 4H0YB 3Q7CA 2ZJRL 3V1RA 4Q0BA 1BGXT 3OYLA 1HKGA 4J2EA 2HHVA 4MQ3A 4BDZA 4HHTA 1BI4A 1K6YA 3SV4A 3EY1A 1BA0A 2ETJA 4O0JA 3CC4N 4IG3A 5HP1A 4ILGB 3ZT4A 4IEEA 1KVCA 4H0PA 1U47A 1A5VA 5AQIA 1KLMA 5F1XA 2HBMA 1HNIA 1GOBA 3FGUA 3B6PA 4BGAA 1XNRK 3SUNA 2YKMA 3GOIA 2HW3A 4KBOA 3E01A 2GTDA 3ZEUB 4Y0WA 1NG9A 3DM2A 2IVNA 3WXLA 1NK7A 5BRFA 3UE5A 3NH0A 1TGOA 2BE2A 4M3WA 4F2RA 3CJ9A 3OTOK 3I33A 3VQEA 2V7ZA 1T6DA 1JL1A 4ID5A 2DFHA 1BDGA 2HHTA 1NBWA 3VETA 3AVBA 3CQXA 3MCAB 4OJRA 2GWKA 3AAPA 3ZSQA 3RR7A 1RT7A 4I9QA 2D5RA 1OH8A 3SPZA 2HF3A 3CCUN 2BH1A 2QWPA 1G15A 1RT5A 2IGIA 4CGHA 2PZSA 2Q0RA 5AQHA 4JS4A 4FWSA 4I2QA 4DV4K 4B3MK 3JAMO 4OGEA 4BRPA 4PHTX 4EZ6A 5JVHL 4DV0K 2RPIA 2ASOA 4FK4A 1CXQA 1GOCA 2QWQA 3HBTA 3N4QA 3L2QA 1C0TA 3T3FA 1TKZA 3D7EO 4KHSA 4E7IA 4TSXA 2O8DB 1W9HA 1BQMA 1SV5A 2HMPA 4UQGA 1JLBA 5E41A 1VSKA 3KWGA 2GV9A 4K8XA 4CJRA 5FPDA 4BWMA 4PQUA 4KHPK 4ISEA 2WONA 4XH5A 2KZZA 2VG7A 1LV5A 3TTCA 2G8WA 3OY9A 4DTSA 3ENBA 3IKMA 3PO5A 2YJFA 5J1EA 1HUXA 2NUBA 2D0OA 3G0ZA 1RDAA 2I7NA 2VG6A 4IJNA 3ZSRA 4CEFA 1KCFA 3P5JA 1IKYA 3CCQN 1DTTA 2YHYA 1KTQA 3ZSXA 4DU4A 4FJ5A 3AVFA 3HM8A 4AILC 4CFDA 5SZTA 2Q2RA 4FZZA 3J7YP 5EY4A 1NGHA 1FKOA 5LMUK 2OPPA 4Z4EA 3CCRN 3L2WA 4YDUC 4C8KA 1VSJA 3E66A 2A42A 4C8OA 4DQSA 5KRTA 3THYA 2FF6A 3M8SA 3EKUA 1HNVA 4DSLA 4IOCL 4FM1A 2VQFK 3OYIA 4B1ZA 4M3RA 1VQ5N 2JWKA 1YIJN 3D2FA 1HKBA 1BOTO 2KLAA 1Y97A 3IRXA 4CJ3A 2Q1NA 3AV9A 4OX9K 4BRKA 3AVIA 4LF6K 4O8UA 3L8BA 4JRQA 1Z6RA 4BR2A 3QBXA 1KD1O 4B9VA 5A2QO 1KLNA 4DLEA 3TAPA 4RW4A 1TK8A 3ENHA 1U48A 3FZLA 3WXMB 1Q7YO 3O1BA 4RW9A 3FZMA 1WSFA 2XY7A 3QFPA 1QTMA 3ZX3A 3I8DA 3D2EB 5BREA 3HVTA 3V9SA 4MDBA 1HYSA 3TSQA 3G10A 5HRRA 1NGCA 3T1HK 1QSYA 4OKKA 4N47A 3VF6A 4M3UA 3HOSA 3LDLA 3AY9A 2OTJN 2KQ2A 3MN6A 4JNEA 5TKYA 4O44A 4BY9C 2QWLA 1RBUA 1TK0A 2E88A 3EE9A 4X65K 3OYEA 3SZ2A 4PY5A 1BI4B 2P9PA 3P4IA 2DTUA 3AVLA 2O8FA 1RDDA 2FF3B 3ULEB 3CI5A 4DTXA 4BE2A 4DS4A 2Z1GA 1NGBA 3VQPA 3SK3A 3V9ZA 5ADXA 2V52B 1K8AO 2E4LA 3NAEA 1K73O 4KB1A 3VQ4A 3L2RA 1XHXA 4I7FA 2WFBA 4IFVA 1RDWX 3T19A 2OTLN 1JCEA 4BRGA 3CCSN 1ZBHA 4CF8A 3CJ1A 1QE1A 1S9EA 2PYLA 2KW4A 1ATSA 3IS9A 1VSIA 1W97L 5SWMA 1EX4A 3ZCMA 1QQMA 4H03B 4N76A 4CJSA 4BC3A 4CGIA 4ISFA 4DSIA 1S5JA 5GIOA 4BE0A 3BEXA 5AQPA 1S72N 4IWVA 3VN5A 3IMXA 3LM2A 1XI1A 2OA8A 1EO1A 2AA4A 1VQPN 1JLEA 4GV9A 3K59A 4CJUA 4JI4K 3KKRA 1IKXA 4CGDA 4HTUA 2B5JA 1JLGA 1QHAA 3WXKA 1BUPA 3THWA 1VQON 4OKEA 1A5XA 4XIUA 4LF7K 1CZ9A 4F2SA 2VWBA 3K5OA 4BRHA 2OANA 3QO9A 4CI6A 4IDKA 2IOCA 5H1SQ 3ZX0A 4CIEA 1S22A 4MLEA 3CHWA 5LMNK 3WNFA 2HBLA 1WSHA 5BR9A 3OYJA 1GLCG 5AQXA 3WQUA 3GDQA 1GLBG 4K42A 2D0CA 4NCGA 3SQ2A 4CZLA 4CIFA 4WQ5A 4FM0A 4EZ9A 3M8QA 1REVA 2WOMA 4RW7A 3KLIA 5GINA 4FJJA 2YJEA 5GADP 3MK6A 2WC9A 2KTQA 5DMRA 3EL2A 2FSKA 4IO9L 4DSEA 1BIZA 2X6NA 4JI7K 2VWKA 4KHYA 3TAEA 1QZ6A 3CERA 4DV2K 4CIGA 4LFAK 4B9NA 1FJGK 1IG9A 4KH5A 3HO1A 3VF2A 4DV3K 1NJYA 5FPNA 4GVMA 3KK7A 3QEPA 3ATUA 2YCHA 3I55N 4FJNA 1HKCA 3VTHA 4IKFA 1EP4A 2BUPA 1NMDA 2R7YA 3VEYA 4GKKK 5C2DA 2OZSA 2QM1A 1LWFA 1Y64A 2RHKA 1NK4A 1TV6A 4CEZA 4KFBA 4BRFA 5FRMA 3VGKA 4E3SA 3NFAA 2NRVA 1J9AA 4YOXA 4KHUA 3J7AP 2G8HA 2VCPA 2HHHK 3CMAN 3KIOA 3SBGA 3BUZB 1L3UA 4NCAA 5C12A 3CJAA 3K2PA 4CK2A 1UAXA 1SL0A 4AHSA 4CEOA 1DTQA 4LH5A 4B8CA 3CPWM 2P9PB 3O4WA 3K9JA 1NGJA 2Q97A 4DF4A 3MXJA 2NRTA 1RT1A 5DM6L 1ITGA 3HP6A 4KTWA 1YT3A 4FJKA 4BVPA 4WYBA 4JHDA 3H08A 3AO1A 1X9WA 2HVIA 4O4GA 2DY4A 1VQ6N 3U3YA 3OS1A 5BN8A 4AQYK 1KFSA 4A2BA 1SS6A 5C25A 3BP8A 2YKNA 4HCBA 4L3QA 2X74A 3MN7A 5IT9O 3RRHA 4M3ZA 4BACA 3LANA 4CEEA 2UYTA 3OYHA 4A61A 3O9QA 4F3TA 2O8EB 1E3MA 4DFJA 4JI1K 3J81O 4A57A 3PY8A 5CY4A 3BF3A 5GIPA 4JV5K 3G71N 2OPSA 4KTZA 2G8FA 3I8BA 3R6MA 1EETA 1E4GT 3ITHA 1NM1A 3LDNA 4BR9A 2HNYA 3LPTA 3CG7A 3L6QA 4KHNA 5C10A 2BDPA 1OVQA 4BRQA 4LH4A 1N33K 3OBYA 1NKBA 2NRRA 3VQ7A 4IO8A 5HOOA 2P5GA 3A2FA 3C6TA 2OZMA 3DAWA 4WQ4A 3S9HA 4M42A 4CBWA 4GNIA 3MMVA 4PKIA 4DF8A 3DLBA 4Z0UA
chains in the Genus database with same CATH topology
1T8EA 1RT3A 3ZSQA 1RTJA 2HNDA 1LWEA 4KAZA 3AA3A 3RR7A 1RT7A 4FLTA 4I9QA 2D5RA 3SPZA 3EZ5A 3OS2A 2XY6A 5J2PA 1C1BA 1G15A 1RT5A 3QIPA 4GW6A 2IGIA 2JLEA 5JS2A 4CGHA 3BDPA 1WAFA 4ID1A 4CFBA 1L3VA 1KSPA 1T05A 3C95A 1L3TA 3DLGA 4FZXC 1O1WA 3VQAA 2ZQBA 3OYBA 1RTDA 4JS4A 2PZSA 1RDCA 3TAMA 3KTQA 3AA4A 3LPUA 4I2QA 1NK9A 1EKEA 4OGEA 1WNSA 2F8TA 2A1SA 3K57A 3DLEA 4FJGA 4EZ6A 3SQ0A 4KPYA 4M41A 2G8UA 2RPIA 3O3FA 4F3OA 1TKXA 4FK4A 3NH2A 1CXQA 1GOAA 2IC3A 4NYNA 4C8NA 1JL2A 1GOCA 4FLXA 4F4KA 4G1QA 2GUIA 4CECA 5HRPA 1MU2A 3L2QA 1C0TA 4CK3A 3HXMA 1TKZA 3T3FA 3V9UA 2IS3A 4KI4A 3ZT0A 4E7IA 4KHSA 4TSXA 1IKVA 1W9HA 1BQMA 2XY5A 1TL1A 1S6PA 1SV5A 4KB0A 1YTAA 4UQGA 1JLBA 5E41A 3JSMA 1VSKA 2QKKA 4DQPA 3SUQA 2GV9A 4K8XA 3KK1A 4CJRA 4PUOA 4BWMA 4PQUA 5DK5A 4CEDA 1J53A 4N56A 1S1VA 2ATQA 3SV3A 2IDOA 2WONA 3RWUA 2KZZA 3AVGA 2VG7A 3TAGA 1SKWA 1IKWA 1LV5A 1VSHA 4IFYA 2D0BA 2G8WA 4KHQA 4B3OA 3OY9A 4DWIA 3S3OA 3NGIA 4E89A 4DTSA 2D0AA 4GMJB 4YNQA 3C6UA 3NF7A 2HHWA 5FROA 1SUQA 2FBVA 1LW2A 4W5TA 5I42A 1QSLA 5FRNA 4LY7A 3PO5A 3CM5A 3WNHA 3TANA 3SNNA 4DU1A 5J1EA 2BANA 3TAFA 2X78A 2NUBA 3G0ZA 5K14A 1RDAA 2VG6A 3TWHA 1L5UA 3DOKA 5HBMA 3ZSRA 4CEFA 4DSFA 3HL8A 1KCFA 3P5JA 4CGJA 3V81A 4H8KA 1IKYA 4CGGA 1DTTA 2E6MA 2YHBA 1U04A 1C6VA 4ZHRA 2XHBA 4ELTA 3AVKA 1KTQA 3ZSXA 4DU4A 4MFBA 4DLGA 4FJ5A 1I3AA 4HVJA 4BDYA 3LP2A 3AVFA 1NJXA 2Z1JA 3O3GA 4OGCA 3DI6A 2Z1HA 4AILC 5JS1A 4CESA 4B9UA 4Z4FA 4CFDA 4RW6A 5SZTA 3RMDA 4FZZA 3VQ6A 3NBPA 4CJPA 3QINA 2Y1JA 3OYDA 3K58A 1FKOA 4CF1A 5HRNA 2OPPA 4E7KA 4Z4EA 1VSFA 4O5BA 3VQCA 3V1QA 4N5SA 1NK0A 3OS0A 3L2WA 4FLZA 5J2MA 4C8KA 4F8RA 3HSTB 3PX0A 2ITGA 1VSJA 1HJRA 1JLAA 2ZE2A 4CGFA 3DLHA 2BGGA 1U49A 1RBRA 4C8OA 4Z4IA 1WAJA 3TI0A 4DQSA 3FFIA 5KRTA 4NCBA 3M8SA 3HP9A 5T7BA 1HNVA 4DSLA 1QHTA 4FM1A 3OYIA 3LP3A 4M3RA 4FLUA 4CFAA 3L3VA 3AVNA 1S1WA 3M8RA 3HM9A 2O4GA 3HPHA 4Z4GA 4HCCA 3LZIA 1W0HA 1ASWA 4DG1A 1RT4A 1Y97A 4HUFA 4CJ5A 1B9DA 2PYJA 1S1TA 3IRXA 2RKIA 3AV9A 4CJ3A 3NCIA 3PV8A 1WLJA 4E1NA 2OYQA 3AVIA 3F73A 3HYFA 4EP4A 5EU7A 3L8BA 3LALA 4CEBA 3KKSA 3NHGA 4O55A 4JRQA 3LAMA 3KLEA 3IAYA 4B9VA 1KLNA 4B8AB 4DTOA 3DOLA 3CM6A 4DLEA 3TAPA 4RW4A 1TK8A 1TAUA 1U48A 4ELUA 3HJFA 3C94A 2P5OA 4ELVA 4DS5A 3KK3A 3SUPA 1U45A 1QSSA 4RW9A 1ZBFA 4BWJA 4CJVA 3NGZA 4FJLA 5KI6A 1WSFA 2XY7A 3IG1A 3D0PA 4DFKA 2A1RA 4OKJA 3CFOA 1QTMA 1BHLA 4Y1CA 3I8DA 4JLHA 4OLAA 1S1UA 2FBTA 1BCOA 2YNHA 3QIOA 1ZBUA 2G8IA 3HVTA 3K5MA 3V9SA 4KO0A 2OPRA 1HQUA 3AO2A 2XO7A 3VQQA 4E19A 1BISA 1TAQA 1HYSA 3O4QA 3G10A 5HRRA 3AVHA 1QSYA 4KTQA 4OKKA 4Z4HA 1S6QA 4N47A 5CZ1A 1CXUA 1WSGA 4CF2A 4BE1A 4M3UA 1RILA 3DMJA 2EX3A 1J5OA 3VQ9A 1VSDA 2KQ2A 3NF6A 3TR8A 4NYFA 4CJFA 3KLFA 3VA0A 1JLQA 1A5WA 4O44A 3I0RA 2AJQA 1JLCA 2KFNA 1LAWA 4CERA 4FYDA 4BDPA 3U6FA 3AO5A 1RDBA 1RBUA 4LSNA 1TK0A 3ALYA 1CZBA 4CF0A 4CJ4A 1NK8A 4RW8A 3SZ2A 3OYEA 4PY5A 4ZTFA 2I5JA 2W42A 1BI4B 3QESA 4J2AA 2DTUA 4QOZB 3AVLA 2RF2A 1RDDA 5D3GA 2F8SA 4DQIA 4FJ8A 4DTXA 3NDKA 4BE2A 4DS4A 1D5AA 4KI6A 2Z1GA 2ZD1A 1D9DA 3LDSA 4CE9A 1IH7A 3VQPA 4DTNA 1NK5A 1N6QA 4W5NA 3V9ZA 4Y1DA 4AHRA 4W5OA 2DFFA 1VSMA 3LP1A 3QEWA 1X9SA 1CLQA 2HB5A 2E4LA 1IO2A 3NAEA 3QEVA 1VRTA 1SKSA 3CYMA 4CCHA 4KRFA 4KB1A 3VQ4A 3L2RA 1XHXA 4J2BA 4I7FA 4IFVA 3NF8A 1BL3A 1HYZA 3NGYA 3T19A 1TK5A 1HQEA 2RN2A 1QQCA 3AVJA 4H4MA 2VG5A 4KKOA 1TKDA 4Z4CA 4YFUA 3WNGA 3VQ5A 5KGXA 4CF8A 1ZBHA 2HHXA 1QE1A 1S9EA 1JXBA 3VQBA 4ZTJA 2PYLA 1RNHA 2KW4A 4DTRA 2DFEA 3IS9A 1T7PA 1VSEA 3LAKA 3V9WA 1VSIA 4OVLA 5SWMA 1EX4A 3ZCMA 2B4JA 4N76A 1C1CA 4CJSA 4E7HA 3QNNA 5KRSA 4CHOA 4CGIA 3S3NA 1HRHA 2GBZA 1ZBLA 3PX4A 4LSLA 4DSIA 1C0UA 1S5JA 4L8RB 3NE6A 4BE0A 3SI6A 4KV8A 4B9MA 4OPKA 4CJKA 1C0MA 1RBTA 4CJQA 4CK1A 3OYMA 3OYNA 3MXIA 3ZT2A 3OJSA 3AVMA 2HHUA 3U3GA 1TVRA 3VN5A 4M3XA 3ZSOA 1C1AA 1S1XA 1Q9YA 3EYZA 1HPZA 1VRUA 4FM2A 3AA2A 3BGRA 4I2PA 4CJTA 1XI1A 4M45A 3HPOA 2OA8A 3HVRA 1ZYQA 4DMNA 1JLEA 2B6AA 2HNZA 4CJUA 1Z26A 3K59A 1EXQA 2VWJA 4DTUA 3KKRA 3HK2A 3DLKA 4C8LA 1IKXA 4CGDA 1FKPA 3CFPA 4DFPA 4HTUA 3SCXA 2HHSA 3DYAA 1NK6A 2KFZA 4IBNA 2B5JA 1JLGA 3NF9A 3PX6A 3P83D 3DRRA 1B9FA 1BCMA 1RCHA 4PWDA 3TABA 4OKEA 2PY5A 1A5XA 4XIUA 3K5LA 1CZ9A 4F2SA 3K5OA 1WSJA 4EP5A 3QO9A 3VA3A 1KFDA 4IDKA 2IOCA 4CHNA 4CHPA 3ZT3A 3UIQA 2JGUA 4CIEA 3QLHA 3WNFA 3ASMA 1NJZA 2F96A 3KLGA 1WSHA 4N41A 3MEGA 3OYJA 1VSLA 3AVCA 4CJWA 3B6OA 5J2QA 3QEXA 3KJVA 3V6DA 1TKTA 1NKCA 2HMIA 4DU3A 4DQRA 2D0CA 2EHGA 4NCGA 2FC0A 3O3HA 1L3SA 3SQ2A 4DFMA 5KTQA 4E7JA 4K8ZA 4CIFA 4FM0A 4E1MA 4EZ9A 1VK0A 1KRPA 2LSNA 3M8QA 3PO4A 1REVA 1UWBA 2WOMA 3O4NA 4RW7A 2Q3SA 1JXEA 3KLIA 3KK2A 2IAJA 1Q8IA 4FJJA 3SQ1A 3L3UA 2KTQA 4C8MA 1LWCA 4PA1A 5DMRA 3NH1A 4HUGA 2QKBA 4FJIA 2E6LA 3RMAA 4CJEA 3RMBA 3K5NA 1NOYA 4DSEA 1Q9XA 1YTUA 2Z1IA 1BIZA 2X6NA 3AO4A 4B9TA 1BIUA 3DRPA 2VWKA 4KHYA 3TAEA 4CIGA 1HMVA 3LZJA 2FBXA 4B9NA 1IG9A 3HO1A 4DSJA 4JS5A 4RG8A 4Q5VA 1NOZA 4QAGA 1NJYA 5CYMA 2YHAA 4GVMA 3OYKA 3THVA 4M3YA 1XHZA 4HUEA 1D8YA 4B9LA 1R0AA 3QEPA 2YNFA 4KHWA 3QNOA 4B9SA 3V1OA 4FJ7A 4J2DA 3TARA 4FJNA 4IG0A 5FDLA 3AA5X 4KREA 3DRSA 3LWLA 4IKFA 1UA0A 3KD5E 1EP4A 3WNEA 4H4OA 5HROA 5HLFA 3OJUA 2R7YA 4W5QA 3JYTA 5J2NA 4FW2A 3L2VA 2OZSA 4CFCA 2G8KA 3KLHA 1JKHA 4FJHA 1LWFA 1DLOA 1X1PA 4FJXA 4FJMA 1NK4A 1TV6A 3RRGA 4FLYA 3M8PA 4CEZA 2HVHA 1QS4A 4KFBA 3DLRA 5FRMA 1SL2A 3V4IA 2XRIA 4E3SA 3NFAA 1J9AA 1UA1A 2X6SA 3QEIA 4DTPA 1KVAA 4KHUA 4FLWA 2G8HA 3ISNC 2YV0X 1RTHA 4DTMA 3AO3A 3RMCA 1XC9A 4AHCA 2YNGA 4DTJA 2QK9A 4FXDA 2YNIA 3KIOA 4E0DA 1L3UA 1LAVA 4NCAA 2P1JA 3ZSZA 3SPYA 3K2PA 3HPGA 1UAXA 1BQNA 4CK2A 3QERA 1NJWA 1SL0A 4I9LA 4AHSA 4CEOA 1DTQA 2XY8A 4LH5A 4OLBA 4B8CA 1RBSA 4AHVA 1J54A 5C42A 3T1AA 4FK0A 3TAQA 1RTIA 4CHZA 3AVAA 4DF4A 3MXJA 3F9KA 4FJ9A 1RT1A 3LP0A 3QETA 1ITGA 1D9FA 3ZSWA 3HP6A 4KTWA 1Z25A 1RT6A 1U4BA 1ASUA 1YT3A 4WE1A 3VQDA 1XWLA 4FJKA 1KVBA 4E7LA 4JRPA 2KZMA 3ULDA 4AH9A 4CHQA 3H08A 4OPJA 5KGWA 1SKRA 4DQQA 4M3TA 3AO1A 1YVUA 1X9WA 4O0IA 4DSKA 2O4IA 1T03A 2HVIA 3SQ4A 1N5YA 4O4GA 3MXMA 4QCLA 2DY4A 1S9GA 4ICLA 1WN7A 3L2UA 3U3YA 3OS1A 3ZSYA 4CHYA 3OYAA 4FW1A 3HT3A 1LW0A 1ASVA 3LWMA 1X9MA 1KFSA 5C25A 3KD1E 3I0SA 4FK2A 2OPQA 3P1GA 3SUOA 2YKNA 3SJJA 3V1RA 4HCBA 1BGXT 3OYLA 4Q0BA 4J2EA 3MEEA 4CF9A 2HHQA 2HHVA 2X74A 3ZSVA 4FZYA 4MQ3A 4BDZA 3RRHA 4HHTA 1BI4A 4M3ZA 1K6YA 4BACA 3LANA 3EY1A 3SV4A 2ETJA 1RT2A 4O0JA 1JLFA 1WSIA 4IG3A 5HP1A 4CEEA 4AHTA 1FXXA 3OYHA 3ZT4A 2FBYA 3OYGA 1KVCA 4F3TA 4CEAA 1U47A 4R5PA 4CJLA 3OYFA 5HRSA 1A5VA 4DFJA 1KLMA 1HNIA 1GOBA 1WSEA 3PY8A 5CY4A 1I39A 3B6PA 3SUNA 5CYQA 5CZ2A 3CFRA 2YKMA 2OPSA 4KTZA 4FLVA 2HW3A 3E01A 4FVMA 2G8FA 4FCYA 1EETA 3V9XA 4CEQA 5I3UA 3DM2A 1TL3A 3S3MA 1NK7A 1ZBIA 3ITHA 1SL1A 3NH0A 3MAQA 1TGOA 2BE2A 4M3WA 2HNYA 3OYCA 1RBVA 3CG7A 3LPTA 3OVNA 1HYVA 3RR8A 4F2RA 4KHNA 4AHUA 1B92A 4B08A 3SYZA 1UOCA 4LH4A 3VQEA 2BDPA 1FK9A 1NKBA 4W5RA 2P51A 3MEDA 1JL1A 3VQ7A 3RTVA 4ID5A 2Y1IA 2P5GA 2DFHA 3A2FA 2QXFA 3C6TA 3PUFA 3CQ8A 1NKEA 2OZMA 2HHTA 3ZT1A 3D45A 2G8VA 3S9HA 4M42A 5C24A 1F21A 3VQ8A 4DF8A 3DLBA 3AVBA 4Z0UA 3MECA 4OJRA 4LD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T8E A;  1RT3 A;  3ZSQ A;  1RTJ A;  2HND A;  1LWE A;  4KAZ A;  3AA3 A;  3RR7 A;  1RT7 A;  4FLT A;  4I9Q A;  2D5R A;  3SPZ A;  3EZ5 A;  3OS2 A;  2XY6 A;  5J2P A;  1C1B A;  1G15 A;  1RT5 A;  3QIP A;  4GW6 A;  2IGI A;  2JLE A;  5JS2 A;  4CGH A;  3BDP A;  1WAF A;  4ID1 A;  4CFB A;  1L3V A;  1KSP A;  1T05 A;  3C95 A;  1L3T A;  3DLG A;  4FZX C;  1O1W A;  3VQA A;  2ZQB A;  3OYB A;  1RTD A;  4JS4 A;  2PZS A;  1RDC A;  3TAM A;  3KTQ A;  3AA4 A;  3LPU A;  4I2Q A;  1NK9 A;  1EKE A;  4OGE A;  1WNS A;  2F8T A;  2A1S A;  3K57 A;  3DLE A;  4FJG A;  4EZ6 A;  3SQ0 A;  4KPY A;  4M41 A;  2G8U A;  2RPI A;  3O3F A;  4F3O A;  1TKX A;  4FK4 A;  3NH2 A;  1CXQ A;  1GOA A;  2IC3 A;  4NYN A;  4C8N A;  1JL2 A;  1GOC A;  4FLX A;  4F4K A;  4G1Q A;  2GUI A;  4CEC A;  5HRP A;  1MU2 A;  3L2Q A;  1C0T A;  4CK3 A;  3HXM A;  1TKZ A;  3T3F A;  3V9U A;  2IS3 A;  4KI4 A;  3ZT0 A;  4E7I A;  4KHS A;  4TSX A;  1IKV A;  1W9H A;  1BQM A;  2XY5 A;  1TL1 A;  1S6P A;  1SV5 A;  4KB0 A;  1YTA A;  4UQG A;  1JLB A;  5E41 A;  3JSM A;  1VSK A;  2QKK A;  4DQP A;  3SUQ A;  2GV9 A;  4K8X A;  3KK1 A;  4CJR A;  4PUO A;  4BWM A;  4PQU A;  5DK5 A;  4CED A;  1J53 A;  4N56 A;  1S1V A;  2ATQ A;  3SV3 A;  2IDO A;  2WON A;  3RWU A;  2KZZ A;  3AVG A;  2VG7 A;  3TAG A;  1SKW A;  1IKW A;  1LV5 A;  1VSH A;  4IFY A;  2D0B A;  2G8W A;  4KHQ A;  4B3O A;  3OY9 A;  4DWI A;  3S3O A;  3NGI A;  4E89 A;  4DTS A;  2D0A A;  4GMJ B;  4YNQ A;  3C6U A;  3NF7 A;  2HHW A;  5FRO A;  1SUQ A;  2FBV A;  1LW2 A;  4W5T A;  5I42 A;  1QSL A;  5FRN A;  4LY7 A;  3PO5 A;  3CM5 A;  3WNH A;  3TAN A;  3SNN A;  4DU1 A;  5J1E A;  2BAN A;  3TAF A;  2X78 A;  2NUB A;  3G0Z A;  5K14 A;  1RDA A;  2VG6 A;  3TWH A;  1L5U A;  3DOK A;  5HBM A;  3ZSR A;  4CEF A;  4DSF A;  3HL8 A;  1KCF A;  3P5J A;  4CGJ A;  3V81 A;  4H8K A;  1IKY A;  4CGG A;  1DTT A;  2E6M A;  2YHB A;  1U04 A;  1C6V A;  4ZHR A;  2XHB A;  4ELT A;  3AVK A;  1KTQ A;  3ZSX A;  4DU4 A;  4MFB A;  4DLG A;  4FJ5 A;  1I3A A;  4HVJ A;  4BDY A;  3LP2 A;  3AVF A;  1NJX A;  2Z1J A;  3O3G A;  4OGC A;  3DI6 A;  2Z1H A;  4AIL C;  5JS1 A;  4CES A;  4B9U A;  4Z4F A;  4CFD A;  4RW6 A;  5SZT A;  3RMD A;  4FZZ A;  3VQ6 A;  3NBP A;  4CJP A;  3QIN A;  2Y1J A;  3OYD A;  3K58 A;  1FKO A;  4CF1 A;  5HRN A;  2OPP A;  4E7K A;  4Z4E A;  1VSF A;  4O5B A;  3VQC A;  3V1Q A;  4N5S A;  1NK0 A;  3OS0 A;  3L2W A;  4FLZ A;  5J2M A;  4C8K A;  4F8R A;  3HST B;  3PX0 A;  2ITG A;  1VSJ A;  1HJR A;  1JLA A;  2ZE2 A;  4CGF A;  3DLH A;  2BGG A;  1U49 A;  1RBR A;  4C8O A;  4Z4I A;  1WAJ A;  3TI0 A;  4DQS A;  3FFI A;  5KRT A;  4NCB A;  3M8S A;  3HP9 A;  5T7B A;  1HNV A;  4DSL A;  1QHT A;  4FM1 A;  3OYI A;  3LP3 A;  4M3R A;  4FLU A;  4CFA A;  3L3V A;  3AVN A;  1S1W A;  3M8R A;  3HM9 A;  2O4G A;  3HPH A;  4Z4G A;  4HCC A;  3LZI A;  1W0H A;  1ASW A;  4DG1 A;  1RT4 A;  1Y97 A;  4HUF A;  4CJ5 A;  1B9D A;  2PYJ A;  1S1T A;  3IRX A;  2RKI A;  3AV9 A;  4CJ3 A;  3NCI A;  3PV8 A;  1WLJ A;  4E1N A;  2OYQ A;  3AVI A;  3F73 A;  3HYF A;  4EP4 A;  5EU7 A;  3L8B A;  3LAL A;  4CEB A;  3KKS A;  3NHG A;  4O55 A;  4JRQ A;  3LAM A;  3KLE A;  3IAY A;  4B9V A;  1KLN A;  4B8A B;  4DTO A;  3DOL A;  3CM6 A;  4DLE A;  3TAP A;  4RW4 A;  1TK8 A;  1TAU A;  1U48 A;  4ELU A;  3HJF A;  3C94 A;  2P5O A;  4ELV A;  4DS5 A;  3KK3 A;  3SUP A;  1U45 A;  1QSS A;  4RW9 A;  1ZBF A;  4BWJ A;  4CJV A;  3NGZ A;  4FJL A;  5KI6 A;  1WSF A;  2XY7 A;  3IG1 A;  3D0P A;  4DFK A;  2A1R A;  4OKJ A;  3CFO A;  1QTM A;  1BHL A;  4Y1C A;  3I8D A;  4JLH A;  4OLA A;  1S1U A;  2FBT A;  1BCO A;  2YNH A;  3QIO A;  1ZBU A;  2G8I A;  3HVT A;  3K5M A;  3V9S A;  4KO0 A;  2OPR A;  1HQU A;  3AO2 A;  2XO7 A;  3VQQ A;  4E19 A;  1BIS A;  1TAQ A;  1HYS A;  3O4Q A;  3G10 A;  5HRR A;  3AVH A;  1QSY A;  4KTQ A;  4OKK A;  4Z4H A;  1S6Q A;  4N47 A;  5CZ1 A;  1CXU A;  1WSG A;  4CF2 A;  4BE1 A;  4M3U A;  1RIL A;  3DMJ A;  2EX3 A;  1J5O A;  3VQ9 A;  1VSD A;  2KQ2 A;  3NF6 A;  3TR8 A;  4NYF A;  4CJF A;  3KLF A;  3VA0 A;  1JLQ A;  1A5W A;  4O44 A;  3I0R A;  2AJQ A;  1JLC A;  2KFN A;  1LAW A;  4CER A;  4FYD A;  4BDP A;  3U6F A;  3AO5 A;  1RDB A;  1RBU A;  4LSN A;  1TK0 A;  3ALY A;  1CZB A;  4CF0 A;  4CJ4 A;  1NK8 A;  4RW8 A;  3SZ2 A;  3OYE A;  4PY5 A;  4ZTF A;  2I5J A;  2W42 A;  1BI4 B;  3QES A;  4J2A A;  2DTU A;  4QOZ B;  3AVL A;  2RF2 A;  1RDD A;  5D3G A;  2F8S A;  4DQI A;  4FJ8 A;  4DTX A;  3NDK A;  4BE2 A;  4DS4 A;  1D5A A;  4KI6 A;  2Z1G A;  2ZD1 A;  1D9D A;  3LDS A;  4CE9 A;  1IH7 A;  3VQP A;  4DTN A;  1NK5 A;  1N6Q A;  4W5N A;  3V9Z A;  4Y1D A;  4AHR A;  4W5O A;  2DFF A;  1VSM A;  3LP1 A;  3QEW A;  1X9S A;  1CLQ A;  2HB5 A;  2E4L A;  1IO2 A;  3NAE A;  3QEV A;  1VRT A;  1SKS A;  3CYM A;  4CCH A;  4KRF A;  4KB1 A;  3VQ4 A;  3L2R A;  1XHX A;  4J2B A;  4I7F A;  4IFV A;  3NF8 A;  1BL3 A;  1HYZ A;  3NGY A;  3T19 A;  1TK5 A;  1HQE A;  2RN2 A;  1QQC A;  3AVJ A;  4H4M A;  2VG5 A;  4KKO A;  1TKD A;  4Z4C A;  4YFU A;  3WNG A;  3VQ5 A;  5KGX A;  4CF8 A;  1ZBH A;  2HHX A;  1QE1 A;  1S9E A;  1JXB A;  3VQB A;  4ZTJ A;  2PYL A;  1RNH A;  2KW4 A;  4DTR A;  2DFE A;  3IS9 A;  1T7P A;  1VSE A;  3LAK A;  3V9W A;  1VSI A;  4OVL A;  5SWM A;  1EX4 A;  3ZCM A;  2B4J A;  4N76 A;  1C1C A;  4CJS A;  4E7H A;  3QNN A;  5KRS A;  4CHO A;  4CGI A;  3S3N A;  1HRH A;  2GBZ A;  1ZBL A;  3PX4 A;  4LSL A;  4DSI A;  1C0U A;  1S5J A;  4L8R B;  3NE6 A;  4BE0 A;  3SI6 A;  4KV8 A;  4B9M A;  4OPK A;  4CJK A;  1C0M A;  1RBT A;  4CJQ A;  4CK1 A;  3OYM A;  3OYN A;  3MXI A;  3ZT2 A;  3OJS A;  3AVM A;  2HHU A;  3U3G A;  1TVR A;  3VN5 A;  4M3X A;  3ZSO A;  1C1A A;  1S1X A;  1Q9Y A;  3EYZ A;  1HPZ A;  1VRU A;  4FM2 A;  3AA2 A;  3BGR A;  4I2P A;  4CJT A;  1XI1 A;  4M45 A;  3HPO A;  2OA8 A;  3HVR A;  1ZYQ A;  4DMN A;  1JLE A;  2B6A A;  2HNZ A;  4CJU A;  1Z26 A;  3K59 A;  1EXQ A;  2VWJ A;  4DTU A;  3KKR A;  3HK2 A;  3DLK A;  4C8L A;  1IKX A;  4CGD A;  1FKP A;  3CFP A;  4DFP A;  4HTU A;  3SCX A;  2HHS A;  3DYA A;  1NK6 A;  2KFZ A;  4IBN A;  2B5J A;  1JLG A;  3NF9 A;  3PX6 A;  3P83 D;  3DRR A;  1B9F A;  1BCM A;  1RCH A;  4PWD A;  3TAB A;  4OKE A;  2PY5 A;  1A5X A;  4XIU A;  3K5L A;  1CZ9 A;  4F2S A;  3K5O A;  1WSJ A;  4EP5 A;  3QO9 A;  3VA3 A;  1KFD A;  4IDK A;  2IOC A;  4CHN A;  4CHP A;  3ZT3 A;  3UIQ A;  2JGU A;  4CIE A;  3QLH A;  3WNF A;  3ASM A;  1NJZ A;  2F96 A;  3KLG A;  1WSH A;  4N41 A;  3MEG A;  3OYJ A;  1VSL A;  3AVC A;  4CJW A;  3B6O A;  5J2Q A;  3QEX A;  3KJV A;  3V6D A;  1TKT A;  1NKC A;  2HMI A;  4DU3 A;  4DQR A;  2D0C A;  2EHG A;  4NCG A;  2FC0 A;  3O3H A;  1L3S A;  3SQ2 A;  4DFM A;  5KTQ A;  4E7J A;  4K8Z A;  4CIF A;  4FM0 A;  4E1M A;  4EZ9 A;  1VK0 A;  1KRP A;  2LSN A;  3M8Q A;  3PO4 A;  1REV A;  1UWB A;  2WOM A;  3O4N A;  4RW7 A;  2Q3S A;  1JXE A;  3KLI A;  3KK2 A;  2IAJ A;  1Q8I A;  4FJJ A;  3SQ1 A;  3L3U A;  2KTQ A;  4C8M A;  1LWC A;  4PA1 A;  5DMR A;  3NH1 A;  4HUG A;  2QKB A;  4FJI A;  2E6L A;  3RMA A;  4CJE A;  3RMB A;  3K5N A;  1NOY A;  4DSE A;  1Q9X A;  1YTU A;  2Z1I A;  1BIZ A;  2X6N A;  3AO4 A;  4B9T A;  1BIU A;  3DRP A;  2VWK A;  4KHY A;  3TAE A;  4CIG A;  1HMV A;  3LZJ A;  2FBX A;  4B9N A;  1IG9 A;  3HO1 A;  4DSJ A;  4JS5 A;  4RG8 A;  4Q5V A;  1NOZ A;  4QAG A;  1NJY A;  5CYM A;  2YHA A;  4GVM A;  3OYK A;  3THV A;  4M3Y A;  1XHZ A;  4HUE A;  1D8Y A;  4B9L A;  1R0A A;  3QEP A;  2YNF A;  4KHW A;  3QNO A;  4B9S A;  3V1O A;  4FJ7 A;  4J2D A;  3TAR A;  4FJN A;  4IG0 A;  5FDL A;  3AA5 X;  4KRE A;  3DRS A;  3LWL A;  4IKF A;  1UA0 A;  3KD5 E;  1EP4 A;  3WNE A;  4H4O A;  5HRO A;  5HLF A;  3OJU A;  2R7Y A;  4W5Q A;  3JYT A;  5J2N A;  4FW2 A;  3L2V A;  2OZS A;  4CFC A;  2G8K A;  3KLH A;  1JKH A;  4FJH A;  1LWF A;  1DLO A;  1X1P A;  4FJX A;  4FJM A;  1NK4 A;  1TV6 A;  3RRG A;  4FLY A;  3M8P A;  4CEZ A;  2HVH A;  1QS4 A;  4KFB A;  3DLR A;  5FRM A;  1SL2 A;  3V4I A;  2XRI A;  4E3S A;  3NFA A;  1J9A A;  1UA1 A;  2X6S A;  3QEI A;  4DTP A;  1KVA A;  4KHU A;  4FLW A;  2G8H A;  3ISN C;  2YV0 X;  1RTH A;  4DTM A;  3AO3 A;  3RMC A;  1XC9 A;  4AHC A;  2YNG A;  4DTJ A;  2QK9 A;  4FXD A;  2YNI A;  3KIO A;  4E0D A;  1L3U A;  1LAV A;  4NCA A;  2P1J A;  3ZSZ A;  3SPY A;  3K2P A;  3HPG A;  1UAX A;  1BQN A;  4CK2 A;  3QER A;  1NJW A;  1SL0 A;  4I9L A;  4AHS A;  4CEO A;  1DTQ A;  2XY8 A;  4LH5 A;  4OLB A;  4B8C A;  1RBS A;  4AHV A;  1J54 A;  5C42 A;  3T1A A;  4FK0 A;  3TAQ A;  1RTI A;  4CHZ A;  3AVA A;  4DF4 A;  3MXJ A;  3F9K A;  4FJ9 A;  1RT1 A;  3LP0 A;  3QET A;  1ITG A;  1D9F A;  3ZSW A;  3HP6 A;  4KTW A;  1Z25 A;  1RT6 A;  1U4B A;  1ASU A;  1YT3 A;  4WE1 A;  3VQD A;  1XWL A;  4FJK A;  1KVB A;  4E7L A;  4JRP A;  2KZM A;  3ULD A;  4AH9 A;  4CHQ A;  3H08 A;  4OPJ A;  5KGW A;  1SKR A;  4DQQ A;  4M3T A;  3AO1 A;  1YVU A;  1X9W A;  4O0I A;  4DSK A;  2O4I A;  1T03 A;  2HVI A;  3SQ4 A;  1N5Y A;  4O4G A;  3MXM A;  4QCL A;  2DY4 A;  1S9G A;  4ICL A;  1WN7 A;  3L2U A;  3U3Y A;  3OS1 A;  3ZSY A;  4CHY A;  3OYA A;  4FW1 A;  3HT3 A;  1LW0 A;  1ASV A;  3LWM A;  1X9M A;  1KFS A;  5C25 A;  3KD1 E;  3I0S A;  4FK2 A;  2OPQ A;  3P1G A;  3SUO A;  2YKN A;  3SJJ A;  3V1R A;  4HCB A;  1BGX T;  3OYL A;  4Q0B A;  4J2E A;  3MEE A;  4CF9 A;  2HHQ A;  2HHV A;  2X74 A;  3ZSV A;  4FZY A;  4MQ3 A;  4BDZ A;  3RRH A;  4HHT A;  1BI4 A;  4M3Z A;  1K6Y A;  4BAC A;  3LAN A;  3EY1 A;  3SV4 A;  2ETJ A;  1RT2 A;  4O0J A;  1JLF A;  1WSI A;  4IG3 A;  5HP1 A;  4CEE A;  4AHT A;  1FXX A;  3OYH A;  3ZT4 A;  2FBY A;  3OYG A;  1KVC A;  4F3T A;  4CEA A;  1U47 A;  4R5P A;  4CJL A;  3OYF A;  5HRS A;  1A5V A;  4DFJ A;  1KLM A;  1HNI A;  1GOB A;  1WSE A;  3PY8 A;  5CY4 A;  1I39 A;  3B6P A;  3SUN A;  5CYQ A;  5CZ2 A;  3CFR A;  2YKM A;  2OPS A;  4KTZ A;  4FLV A;  2HW3 A;  3E01 A;  4FVM A;  2G8F A;  4FCY A;  1EET A;  3V9X A;  4CEQ A;  5I3U A;  3DM2 A;  1TL3 A;  3S3M A;  1NK7 A;  1ZBI A;  3ITH A;  1SL1 A;  3NH0 A;  3MAQ A;  1TGO A;  2BE2 A;  4M3W A;  2HNY A;  3OYC A;  1RBV A;  3CG7 A;  3LPT A;  3OVN A;  1HYV A;  3RR8 A;  4F2R A;  4KHN A;  4AHU A;  1B92 A;  4B08 A;  3SYZ A;  1UOC A;  4LH4 A;  3VQE A;  2BDP A;  1FK9 A;  1NKB A;  4W5R A;  2P51 A;  3MED A;  1JL1 A;  3VQ7 A;  3RTV A;  4ID5 A;  2Y1I A;  2P5G A;  2DFH A;  3A2F A;  2QXF A;  3C6T A;  3PUF A;  3CQ8 A;  1NKE A;  2OZM A;  2HHT A;  3ZT1 A;  3D45 A;  2G8V A;  3S9H A;  4M42 A;  5C24 A;  1F21 A;  3VQ8 A;  4DF8 A;  3DLB A;  3AVB A;  4Z0U A;  3MEC A;  4OJR A;  4LD0 A; 
#chains in the Genus database with same CATH topology
 2GEL A;  4C1N K;  2HND A;  1LWE A;  1H1V A;  1U2V B;  3QB0 A;  1IV0 A;  4CD3 A;  3EZ5 A;  1CZA N;  3U8X A;  1BWF O;  3P31 A;  5AQO A;  4CZI A;  1TYQ B;  3BDP A;  1NNE A;  1S3X A;  1KSP A;  3PLA A;  1T05 A;  1YI2 N;  4EAH D;  3LPU A;  2NRX A;  5AQS A;  5AQU A;  1WNS A;  2F8T A;  3EKS A;  4BRO A;  4MLH A;  1U6Z A;  4FJG A;  3OBW A;  5BRH A;  4KPY A;  3O3F A;  4GV3 A;  3EEQ A;  1TKX A;  3IDH A;  3QDK A;  4H0V B;  1GOA A;  4G1Q A;  4YOV A;  4BR4 A;  1K8K B;  4CK3 A;  3HXM A;  4NXM K;  2KKZ A;  3WEE B;  1IKV A;  1S6P A;  3KZB A;  4YHH K;  3BF1 A;  1NGD A;  1HR0 K;  4DQP A;  1VQK N;  3SUQ A;  2ZGY A;  3KK1 A;  4JKH A;  4PUO A;  3E1Y A;  2QI2 A;  2IDO A;  1SKW A;  4B3O A;  4IFY A;  5LJV A;  3DLL L;  4YOR A;  5BPN A;  3VEO A;  4GMJ B;  1WB9 A;  1N34 K;  4A59 A;  4BG9 A;  3JXU A;  3NF7 A;  2FBV A;  4W5T A;  1VQ9 N;  4LY7 A;  2AP1 A;  2Q31 A;  3CM5 A;  3GE1 A;  4YOU A;  4DU1 A;  1N36 K;  4BRN A;  1EWR A;  1T6C A;  4BQZ A;  4H5N A;  1OH7 A;  3I56 N;  5HBM A;  2CGK A;  4CGJ A;  1Q82 O;  1M1K O;  1WUA A;  2E6M A;  1U04 A;  3IUC A;  1C6V A;  4FWM A;  2GX9 A;  3AVK A;  4DLG A;  2P9L A;  4JAX A;  2E2P A;  4BDY A;  2Z1J A;  4OGC A;  3MX2 A;  5M1F A;  5JS1 A;  2P9N B;  4RW6 A;  3RMD A;  3THX A;  3QIN A;  3DXM A;  4CZM A;  2Y1J A;  1OVY A;  3K58 A;  4CF1 A;  5HRN A;  1DGK N;  1VSF A;  3VQC A;  4FLZ A;  3OA9 A;  4F8R A;  3HST B;  2A5X A;  3PX0 A;  2ITG A;  2BGG A;  1U49 A;  5LY3 A;  3CIP A;  3ZX2 A;  4DV6 K;  2VYP A;  4XH1 A;  3C65 A;  5T7B A;  1QHT A;  2W6L A;  3BZC A;  3LP3 A;  1I94 K;  3O9U A;  3O5B A;  2P9U B;  3CJ7 A;  1S1W A;  3P38 A;  4JI5 K;  3HPH A;  3LZI A;  1XNQ K;  1W0H A;  4DG1 A;  2QWN A;  1RT4 A;  3O08 A;  5AQW A;  4CVN E;  4O5F A;  1B9D A;  4R79 A;  1S1T A;  2O8F B;  3F73 A;  3HYF A;  4KAZ A;  4CEB A;  3LAM A;  3KLE A;  3CCJ N;  4IXC A;  4BQL A;  3DOL A;  4DTO A;  1C0G A;  3CCV N;  2P5O A;  3L4I A;  3SUP A;  4BWJ A;  1ZBF A;  1ILY A;  3WXI A;  3MN9 A;  3D0P A;  5KPZ A;  4DFK A;  3LL3 A;  5GAH P;  3CFO A;  4Y1C A;  4OLA A;  2FBT A;  1BCO A;  4KO0 A;  3O6W A;  3AO2 A;  1TYQ A;  3O4Q A;  4WQ5 C;  1IBM K;  3CME N;  4Z4H A;  3SAH A;  3R1X A;  1C0F A;  4CF2 A;  3U4L A;  4BE1 A;  3ZYY X;  5KPR A;  3NF6 A;  3VA0 A;  4JKG B;  3LDQ A;  4FL9 A;  5AQM A;  4CER A;  3DXM B;  4CZE A;  3U6F A;  4EFH A;  4LSN A;  1CZB A;  2HST A;  4B1U B;  1NK8 A;  3SAG A;  4RW8 A;  1HLU A;  3CCE N;  2I5J A;  2W42 A;  5BPM A;  3QES A;  2F9T A;  3CCL N;  2RF2 A;  2UXC K;  3KVG A;  3G25 A;  4CE9 A;  1N6Q A;  1NK5 A;  4W5N A;  4Y1D A;  4AHR A;  4W5O A;  3F9M A;  1X9S A;  3HTV A;  4WFB L;  1K8K A;  5EX5 A;  2O8C B;  4J2B A;  3NF8 A;  1TK5 A;  1HQE A;  2RN2 A;  3SMS A;  4KKO A;  4Z4C A;  4YFU A;  3WNG A;  3VQ5 A;  3UKU A;  5KGX A;  1JXB A;  3VQB A;  2ZM6 K;  1RNH A;  3TPQ A;  4EHT A;  4DTR A;  4JKB A;  4K0K K;  2P9L B;  1VSE A;  3FE1 A;  5IWA K;  1C1C A;  3QNN A;  3H45 C;  3JS6 A;  2FLO A;  4BRD A;  4LF4 K;  3S3N A;  3SMP A;  2GBZ A;  4LSL A;  5BN9 A;  2JWL A;  1C0M A;  4CJQ A;  4CK1 A;  2UXD K;  3ZT2 A;  3OJS A;  2HHU A;  1W2B M;  3TTF A;  3U3G A;  3G6E N;  5AQV A;  1T44 A;  1C1A A;  4FM2 A;  3F2K A;  4GKJ K;  1ZYQ A;  1VQ7 N;  4DMN A;  2HNZ A;  2VWJ A;  3HK2 A;  1M90 O;  4C8L A;  1FKP A;  3CFP A;  2HHS A;  3DYA A;  1NK6 A;  3PX6 A;  3P83 D;  3DRR A;  1RCH A;  1BU6 O;  4PL7 A;  4EP5 A;  1WSJ A;  4DHY A;  3VA3 A;  1KFD A;  4CHN A;  3UIQ A;  1NGA A;  3H3O B;  3VEW A;  4B3R K;  3MEG A;  2WUS A;  3AVC A;  3B6O A;  4M7Y A;  3QEX A;  4DU3 A;  4DQR A;  5M1N A;  1L3S A;  3CCM N;  2E1Y A;  1VQL N;  4JKC A;  1NLV A;  4E7J A;  1D4X A;  4E1M A;  4F9O A;  1VK0 A;  2LSN A;  2P9U A;  5EOY A;  2Q3S A;  2IAJ A;  3CPE A;  1HNZ K;  3D2E A;  4PA1 A;  3SJH A;  2QKB A;  3GBT A;  4OPA A;  4FJI A;  4JKE A;  3K5N A;  4FPA A;  4B9T A;  1BIU A;  5AQN A;  4Q5V A;  1JCF A;  2F4V K;  2YHA A;  4M3Y A;  4FWN A;  3OYK A;  3QNO A;  1QVG M;  4B3T K;  3O8M A;  1Q81 O;  5FDL A;  4IEI A;  4KRE A;  1UA0 A;  4H4O A;  3OJU A;  4W5Q A;  4CZK A;  4FW2 A;  4U67 L;  4CFC A;  5JLF A;  4C1N I;  4IZ9 A;  4BR5 A;  4JKG A;  1GLF O;  4FJX A;  4EHU A;  3M3Z A;  2HVH A;  3SAF A;  1SL2 A;  5AZJ A;  4DR3 K;  2O8B B;  5HL7 L;  4XEI A;  4FLW A;  1RTH A;  4A62 A;  3RMC A;  1OH6 A;  2YNG A;  2QK9 A;  5AR0 A;  4AM6 A;  4RCH A;  2ZJP L;  3SPY A;  3HPG A;  2QXL A;  3MX5 A;  1NJW A;  4I9L A;  3ATV A;  1XQS C;  2XY8 A;  2J4R A;  5KPT A;  5C42 A;  2FXU A;  3TAQ A;  4DKW A;  3ULE A;  1NJI O;  1D9F A;  1KAY A;  4LF9 K;  4BRI A;  3E9P A;  1RT6 A;  4FWO A;  1U4B A;  1ASU A;  2QW9 A;  1XWL A;  3KHY A;  1KVB A;  3H1V X;  4AF1 A;  4AH9 A;  4CHQ A;  1SKR A;  5KGW A;  1YVU A;  1T03 A;  2QEX N;  1NGG A;  1N5Y A;  4LF5 K;  1X3M A;  3L2U A;  3HZ6 A;  4H0T B;  4RWT A;  3LWM A;  3KD1 E;  1LW0 A;  1ASV A;  3R8E A;  1X9M A;  1VHX A;  3P1G A;  4DUY K;  3SUO A;  5TKW A;  4CF9 A;  4FZY A;  3ZSV A;  4V19 S;  1Q86 O;  3H46 O;  2O8D A;  1RT2 A;  1JLF A;  1X9J A;  4AHT A;  3OYG A;  2FBY A;  5JMV A;  4CEA A;  3EE8 A;  4R5P A;  1XMO K;  3OYF A;  5HRS A;  1WSE A;  5CZ2 A;  4MO5 A;  3CFR A;  3M6G A;  1SQK A;  4CEQ A;  4B9Q A;  5GAE P;  1MDU B;  3S3M A;  1SL1 A;  3MAQ A;  1IG8 A;  3OVN A;  3RR8 A;  1HYV A;  1MA9 B;  4AHU A;  4B08 A;  1FK9 A;  3MED A;  2Y1I A;  1VQM N;  3VEV A;  3ZT1 A;  3D45 A;  4JI0 K;  5C24 A;  3VQ8 A;  2W40 A;  3VF4 A;  4GV6 A;  4CHO A;  4LD0 A;  1ZC6 A;  2A41 A;  1YJW N;  1YXQ A;  3W3D A;  4FLT A;  5J2P A;  1C1B A;  3QIP A;  1N8R O;  4ID1 A;  4ISG A;  4CFB A;  1K9M O;  1GLD G;  5FPM A;  1IJJ A;  3C95 A;  1L3T A;  1O1W A;  1EWQ A;  3KTQ A;  1RDC A;  3TAM A;  4NLB A;  1NK9 A;  1EKE A;  5AZI B;  2A1S A;  4QS8 A;  1NU0 A;  4MO4 A;  3A0I X;  3SQ0 A;  1YAG A;  4M41 A;  2CH6 A;  2G8U A;  4F3O A;  2PAV A;  4DQ8 A;  3NH2 A;  2D0P A;  1KQS M;  5CR4 A;  2IC3 A;  4NYN A;  1JL2 A;  4FLX A;  4CEC A;  4KI4 A;  3V9U A;  2IS3 A;  3ZT0 A;  2WBN A;  4G9Z A;  5M1P A;  4KB0 A;  2CGL A;  4JK9 A;  4JKD A;  3JSM A;  2QKK A;  3C6H A;  4CED A;  4MDA A;  2ATQ A;  1R59 O;  4B1V A;  4YNQ A;  3C6U A;  3G4S N;  1SUQ A;  5I42 A;  1LW2 A;  5FRN A;  4CJ7 A;  4GVE A;  4A2A A;  3TAN A;  2X78 A;  1EQY A;  5K14 A;  3ZET B;  3M1F A;  3DOK A;  3CC2 N;  4H5V A;  3HL8 A;  4H8K A;  1MWK A;  4CGG A;  3BY5 A;  1WBB A;  5F0X A;  2XHB A;  4ELT A;  1RGI A;  3PIP L;  4MFB A;  4HVJ A;  3VGM A;  3LP2 A;  4CBU A;  2A40 A;  5E26 A;  4B9U A;  3VQ6 A;  1MWM A;  2NZT A;  3K0S A;  1WBD A;  5MLC Q;  2KHO A;  3OYD A;  3ID8 A;  4N5S A;  1NK0 A;  3OS0 A;  5J2M A;  3ENO A;  5B8H A;  1JLA A;  4CGF A;  2UUC K;  3WEE A;  3DWL A;  4Z4I A;  1WAJ A;  3FFI A;  1LCU A;  3QML A;  3D2F B;  3HP9 A;  1BA1 A;  1Q18 A;  4NLC A;  3C0B A;  2YHW A;  1IBL K;  3H3N O;  4LC9 B;  4CFA A;  3HM9 A;  3NVM A;  4Z4G A;  2P9K B;  4HCC A;  3VTI A;  3HOT A;  4HUF A;  4DB3 A;  3UKR A;  3NCI A;  3PV8 A;  3J80 O;  4JHD B;  4E1N A;  3A5O C;  2OYQ A;  4EP4 A;  5BPL A;  4WQ4 C;  3LAL A;  5M1O A;  3KKS A;  3IAY A;  4O55 A;  4LF8 K;  2P9N A;  4B8A B;  3CM6 A;  2P9S A;  3C94 A;  5DM7 L;  4ELV A;  4WF9 L;  3KK3 A;  3CJB A;  3NGZ A;  4FJL A;  5KI6 A;  4OKJ A;  1YJN N;  1BHL A;  4JLH A;  1XUP O;  3QIO A;  2YNH A;  1ZBU A;  2G8I A;  3K5M A;  2OPR A;  1HQU A;  4H5W A;  2P9S B;  4E19 A;  3VEN A;  1TAQ A;  3AVH A;  3E9O A;  1CXU A;  2D4W A;  2GUP A;  3LDP A;  4J8F A;  4DV1 K;  3DMJ A;  4X62 K;  2EX3 A;  1J5O A;  1VSD A;  4CJF A;  1JLQ A;  1A5W A;  1JLC A;  1IBK K;  1LAW A;  3AGK A;  4BDP A;  1RDB A;  4CF0 A;  4KH6 A;  1VQ4 N;  4YY3 K;  4ZTF A;  4J2A A;  4QOZ B;  4FWK A;  4DR1 K;  4JI2 K;  5D3G A;  4FJ8 A;  2F8S A;  4NXN K;  4KI6 A;  1D5A A;  3THY B;  2NNW A;  2ZD1 A;  1D9D A;  1YVN A;  4K41 A;  1IH7 A;  4DTN A;  3O80 A;  1VSM A;  3UKU B;  3QEW A;  1CLQ A;  2DPN A;  3CQY A;  3F5T A;  2HB5 A;  3M5R A;  1IO2 A;  3QEV A;  4KRF A;  2VGN A;  3EO3 A;  5AFU A;  1QQC A;  4H4M A;  2VG5 A;  4FO0 A;  2HHW A;  2DFE A;  3KWI A;  3V9W A;  4OVL A;  2B4J A;  5KRS A;  2UU9 K;  4CBX A;  1ZBL A;  3PX4 A;  1ATR A;  4CZF A;  3SI6 A;  4KV8 A;  3Q7B A;  4B9M A;  4CJK A;  1RBT A;  3VPZ A;  3OYM A;  2O8E A;  3ID6 A;  4DV7 K;  1TVR A;  4M3X A;  4K43 A;  3EYZ A;  1HPZ A;  1VRU A;  3AA2 A;  3C7N A;  2CH5 A;  2FSN A;  1KAX A;  4FOI A;  4JN4 A;  4QS7 A;  4DTU A;  2NRH A;  3SLC A;  4DFP A;  2KFZ A;  3TSP A;  3SCX A;  4JYA K;  3E9L A;  3H1Q A;  3RVC A;  1B9F A;  3J7Z O;  2PY5 A;  4BRL A;  2QA4 N;  1YJ9 N;  4IOA L;  2ZJQ L;  3TSU A;  4CHP A;  3ZT3 A;  3VES A;  3VGL A;  5AQY A;  3QLH A;  3ASM A;  1TUU A;  2F96 A;  3KLG A;  1VSL A;  2I7P A;  3HSC A;  3LM9 A;  2UUA K;  5J2Q A;  2Q36 A;  4WFN L;  2O8C A;  3KJV A;  3V6D A;  1TKT A;  3DXK A;  2HMI A;  1OKJ A;  2FC0 A;  4DR6 K;  4DFM A;  2P9I A;  5KTQ A;  4K8Z A;  4BRA A;  3J8A A;  1KRP A;  1KC8 O;  1UWB A;  3O4N A;  3KK2 A;  1JXE A;  1Q8I A;  1VAZ A;  3L3U A;  4HWI A;  4C8M A;  3IFR A;  4UY8 O;  4CD1 A;  1LWC A;  4HUG A;  1ATN A;  2BTF A;  2ASP A;  4CJE A;  3C7N B;  1YTU A;  3LZJ A;  2FBX A;  3WXJ A;  3A5M C;  4QS9 A;  2E2N A;  3A5N C;  4DSJ A;  4JS5 A;  4RG8 A;  1NOZ A;  4QAG A;  5CYM A;  4M63 C;  5JLH A;  1XHZ A;  4HUE A;  2QWM A;  1D8Y A;  1R0A A;  2YNF A;  4KHW A;  4B9S A;  3V1O A;  4YOW A;  3TAR A;  4IG0 A;  1KXP A;  3AA5 X;  4X64 K;  3DRS A;  5LL6 Z;  3KD5 E;  3WNE A;  2V51 B;  3JYT A;  5J2N A;  3PIO L;  3VEZ A;  1TUY A;  3KLH A;  3THW B;  2G8K A;  4FJH A;  4LFC K;  1DLO A;  1X1P A;  2QWO A;  3RRG A;  4FLY A;  1QS4 A;  3V4I A;  2XRI A;  2X6S A;  5AQJ A;  2YV0 X;  1XC9 A;  2ASM A;  1HNW K;  4FXD A;  2P1J A;  4H0O A;  1BQN A;  2E1Z A;  1VQN N;  2GEM A;  4CW7 B;  4OLB A;  4AHV A;  1P8Z A;  2VGM A;  1SAZ A;  3T1A A;  3AVA A;  3QIC A;  3F9K A;  3VER A;  3ZSW A;  1NGF A;  2H3G X;  5FLX O;  4WE1 A;  4DCH A;  5JVG L;  1DEJ A;  3B8A X;  3O1W A;  4JI8 K;  2O4I A;  4O0I A;  4DSK A;  2ZF5 O;  3SQ4 A;  1VQ8 N;  3MXM A;  4ICL A;  1WN7 A;  3ZSY A;  4FSV A;  3I0S A;  4FK2 A;  2OPQ A;  4WCE L;  3SJJ A;  5AQZ A;  2HHQ A;  3MEE A;  2RE2 A;  4YDU A;  3FZK A;  4JD2 A;  1WSI A;  1NGI A;  1FXX A;  3LDO A;  4BRE A;  4CJL A;  4ILJ A;  3RSE A;  2IVP A;  2GWJ A;  1I39 A;  3K9K A;  3A8Y A;  5CYQ A;  4B1W B;  4FLV A;  4FVM A;  3V9X A;  5I3U A;  1DKG D;  1ZBI A;  1TL3 A;  4XH4 A;  2P9K A;  4A5B A;  5ADX H;  3OYC A;  1JCG A;  1RBV A;  4BRC A;  5EVZ A;  4IFE A;  1B92 A;  3SYZ A;  1UOC A;  5KQ8 A;  4W5R A;  2P51 A;  3RTV A;  3CQ8 A;  2QXF A;  2QTD A;  3PUF A;  1NKE A;  2G8V A;  1F21 A;  2A6A A;  4BRM A;  2OCE A;  3MEC A;  3S41 A;  4E0D A;  1T8E A;  1J5E K;  1RT3 A;  1RTJ A;  4BC4 A;  3AA3 A;  4I6M A;  3OS2 A;  2XY6 A;  3DXK B;  2FSJ A;  4JKA A;  2E5L K;  4GW6 A;  2JLE A;  5JS2 A;  1WAF A;  1O13 A;  3MDQ A;  1L3V A;  1NWK A;  4JK8 A;  1G99 A;  3QBW A;  3DLG A;  4FZX C;  3MCP A;  3VQA A;  2ZQB A;  3OYB A;  1RTD A;  3AA4 A;  2HF4 A;  4FWP A;  1GLL O;  5M1K A;  3K57 A;  2WTU A;  4E1J A;  3DLE A;  3OHR A;  4AM7 A;  4C8N A;  2O8B A;  4F4K A;  4BVO A;  2GUI A;  5C0Y A;  5HRP A;  1MU2 A;  4KHQ A;  3H6E A;  3W0L A;  5GAG P;  2XY5 A;  1TL1 A;  1YTA A;  1BO5 O;  2HBK A;  3GL1 A;  3C6A A;  5DK5 A;  1J53 A;  4N56 A;  1S1V A;  3SV3 A;  3RWU A;  3AVG A;  3TAG A;  2D1K A;  1IKW A;  1VSH A;  2D0B A;  4DWI A;  3S3O A;  3NGI A;  4E89 A;  2D0A A;  3WT0 A;  4NB4 A;  4DV5 K;  5FRO A;  3CJC A;  1QSL A;  3WNH A;  3SNN A;  2CGJ A;  2BAN A;  3TAF A;  3U9D A;  5AQK A;  3TWH A;  1L5U A;  3OW2 M;  2NRW A;  4DSF A;  1N32 K;  4FWQ A;  2A3Z A;  3V81 A;  1QVF M;  3O9S A;  3PSI A;  1P90 A;  2HBJ A;  3AGR A;  2E20 A;  1V4S A;  2YHB A;  4ZHR A;  2ZWH A;  1I3A A;  3O9R A;  1YHQ N;  5M1Q A;  1NJX A;  3O3G A;  3P39 A;  3L4Q A;  3DI6 A;  2W41 A;  2Z1H A;  3FR0 A;  4CES A;  4Z4F A;  4LFB K;  3NBP A;  5E84 A;  4CJP A;  3VOV A;  1DT9 A;  1RFQ A;  4JK7 A;  4E7K A;  1KAZ A;  4OO1 J;  4O5B A;  3V1Q A;  4CZG A;  4DR2 K;  4H0X B;  4A5A A;  1HJR A;  2ZE2 A;  3DLH A;  3TTD A;  1RBR A;  5AQR A;  1YIT N;  3TI0 A;  5BRD A;  5JIC A;  4NCB A;  3L0Q A;  4FPB A;  1ZBS A;  4JI3 K;  3VMF B;  1YF5 L;  3UB5 A;  3N4P A;  4JD2 B;  4FLU A;  3L3V A;  3AVN A;  5AQG A;  3M8R A;  2O4G A;  4BC2 A;  1ASW A;  4IJA A;  4CJ5 A;  2PYJ A;  2RKI A;  1WLJ A;  4YOY A;  3T7Z A;  4FCY A;  5EU7 A;  1SZ2 A;  3NHG A;  4FVU A;  1TAU A;  4ELU A;  3HJF A;  4DS5 A;  1U45 A;  1QSS A;  4CJV A;  2HOE A;  5BR8 K;  3IG1 A;  2A1R A;  1J6Z A;  4HTL A;  1S1U A;  1V4T A;  2XO7 A;  3GG4 A;  2E8A A;  3VQQ A;  4ILH A;  1BIS A;  5CHI A;  3FLC O;  4DR4 K;  4KTQ A;  1S6Q A;  1ESV A;  5CZ1 A;  1WSG A;  2YI1 A;  1RIL A;  3SBT A;  5LJW A;  3VQ9 A;  3TR8 A;  4NYF A;  3ZEU A;  3KLF A;  3VEX A;  3I0R A;  2AJQ A;  3MWT A;  2KFN A;  4FYD A;  3FFK B;  3AO5 A;  5I9E B;  3ALY A;  4GY2 B;  4CJ4 A;  3TU5 A;  2V7Y A;  1T3V A;  3WQT A;  5CE3 A;  4WFA L;  5AJ3 K;  3CC7 N;  4DQI A;  3NDK A;  4KH4 A;  5C15 A;  3LDS A;  3RSE B;  4CZJ A;  3CET A;  4BR0 A;  2DFF A;  3LP1 A;  2NLX A;  1VRT A;  1SKS A;  3CYM A;  4CCH A;  4NO7 A;  4X66 K;  3FZF A;  1BL3 A;  1HYZ A;  1Z05 A;  3NGY A;  1HNX K;  3AVJ A;  2UUB K;  3NMU A;  1TKD A;  2EWS A;  4FWL A;  4RTF D;  2HHX A;  2YX6 A;  4ZTJ A;  1YUW A;  1T7P A;  1W7A A;  3LAK A;  3QFU A;  4E7H A;  5F2R A;  3ZLJ A;  2W6K A;  1X3N A;  1HRH A;  2P9I B;  4BC5 A;  4L8R B;  1C0U A;  3NE6 A;  3EZW A;  4OPK A;  3OYN A;  3MXI A;  3CD6 N;  4BGB A;  3AVM A;  1BG3 A;  5AQT A;  3ZSO A;  1S1X A;  4CZH A;  4DUZ K;  1Q9Y A;  4CJT A;  3BGR A;  4I2P A;  3T69 A;  4M45 A;  3HPO A;  3HVR A;  4PKG A;  2B6A A;  4JI6 K;  1Z26 A;  1EXQ A;  3DLK A;  1ZXO A;  4IDH A;  4IBN A;  3NF9 A;  1BCM A;  4PWD A;  3TAB A;  3K5L A;  4BG8 A;  2ITM A;  3WUH A;  1XMQ K;  4JEP A;  4PL8 A;  2JGU A;  3MN5 A;  5AFU H;  3MWP A;  5AZJ B;  2Q0U A;  4B1X B;  1NJZ A;  4N41 A;  4EIA A;  4I6M B;  4CJW A;  1QQN A;  1WOQ A;  4DR5 K;  1NKC A;  3PSF A;  2EHG A;  1GLA G;  3O3H A;  3O9T A;  5AQQ A;  3NVK A;  2F7T A;  2IVO A;  2NRZ A;  3A5L C;  1HX1 A;  3EN9 A;  2UXB K;  3PO4 A;  2IIR A;  3D6R A;  4YOT A;  4DR7 K;  2F9W A;  3SQ1 A;  2VQE K;  4B3S K;  3NH1 A;  2E6L A;  3RMA A;  3RMB A;  5ELZ A;  1NOY A;  1XC3 A;  3T1Y K;  1Q9X A;  2Z1I A;  1HJO A;  3AO4 A;  3DRP A;  3UKR B;  2E2Q A;  2PFU A;  1HMV A;  4C23 A;  1U2V A;  4H5T A;  3FZH A;  5AZI A;  4B1Y B;  2PBD A;  3AAQ A;  3THV A;  4U7B A;  4OPH A;  1GLE G;  4B9L A;  4FJ7 A;  4J2D A;  4IOX A;  1HPM A;  3BZK A;  4Z94 A;  3LWL A;  4JKF A;  4BR7 A;  5HRO A;  5HLF A;  3L2V A;  1JKH A;  5FPE A;  1NGE A;  4PKH A;  4FJM A;  4K25 A;  3M8P A;  3DLR A;  3R9P A;  1OH5 A;  1UA1 A;  3QEI A;  4FWR A;  1KVA A;  4DTP A;  5AQL A;  3ISN C;  1JJ2 M;  1QZ5 A;  3AO3 A;  4DTM A;  1FW6 A;  4AHC A;  1GLJ O;  4DTJ A;  2YNI A;  3DJC A;  1LAV A;  3U9Z A;  3ZSZ A;  3QER A;  5KQD A;  1RDU A;  2YHX A;  1RBS A;  2ZGZ A;  1J54 A;  4FK0 A;  4H5R A;  2E2O A;  4CHZ A;  1RTI A;  3R3L A;  2QWR A;  4FJ9 A;  4FOE A;  3LP0 A;  5AQF A;  3QET A;  1Z25 A;  3AAR A;  5C2F A;  3VQD A;  5EXW A;  4E7L A;  4JRP A;  2KZM A;  3ULD A;  4M3T A;  4OPJ A;  4DQQ A;  1LOT B;  3CF5 L;  4M7X A;  3ZET A;  4QCL A;  1E4F T;  1S9G A;  1QQO A;  4CHY A;  3OYA A;  4FW1 A;  4O8K A;  3HT3 A;  3THX B;  3HRG A;  1NMN A;  3CXC M;  3HI0 A;  4H0Y B;  3Q7C A;  2ZJR L;  3V1R A;  4Q0B A;  1BGX T;  3OYL A;  1HKG A;  4J2E A;  2HHV A;  4MQ3 A;  4BDZ A;  4HHT A;  1BI4 A;  1K6Y A;  3SV4 A;  3EY1 A;  1BA0 A;  2ETJ A;  4O0J A;  3CC4 N;  4IG3 A;  5HP1 A;  4ILG B;  3ZT4 A;  4IEE A;  1KVC A;  4H0P A;  1U47 A;  1A5V A;  5AQI A;  1KLM A;  5F1X A;  2HBM A;  1HNI A;  1GOB A;  3FGU A;  3B6P A;  4BGA A;  1XNR K;  3SUN A;  2YKM A;  3GOI A;  2HW3 A;  4KBO A;  3E01 A;  2GTD A;  3ZEU B;  4Y0W A;  1NG9 A;  3DM2 A;  2IVN A;  3WXL A;  1NK7 A;  5BRF A;  3UE5 A;  3NH0 A;  1TGO A;  2BE2 A;  4M3W A;  4F2R A;  3CJ9 A;  3OTO K;  3I33 A;  3VQE A;  2V7Z A;  1T6D A;  1JL1 A;  4ID5 A;  2DFH A;  1BDG A;  2HHT A;  1NBW A;  3VET A;  3AVB A;  3CQX A;  3MCA B;  4OJR A;  2GWK A;  3AAP A;  3ZSQ A;  3RR7 A;  1RT7 A;  4I9Q A;  2D5R A;  1OH8 A;  3SPZ A;  2HF3 A;  3CCU N;  2BH1 A;  2QWP A;  1G15 A;  1RT5 A;  2IGI A;  4CGH A;  2PZS A;  2Q0R A;  5AQH A;  4JS4 A;  4FWS A;  4I2Q A;  4DV4 K;  4B3M K;  3JAM O;  4OGE A;  4BRP A;  4PHT X;  4EZ6 A;  5JVH L;  4DV0 K;  2RPI A;  2ASO A;  4FK4 A;  1CXQ A;  1GOC A;  2QWQ A;  3HBT A;  3N4Q A;  3L2Q A;  1C0T A;  3T3F A;  1TKZ A;  3D7E O;  4KHS A;  4E7I A;  4TSX A;  2O8D B;  1W9H A;  1BQM A;  1SV5 A;  2HMP A;  4UQG A;  1JLB A;  5E41 A;  1VSK A;  3KWG A;  2GV9 A;  4K8X A;  4CJR A;  5FPD A;  4BWM A;  4PQU A;  4KHP K;  4ISE A;  2WON A;  4XH5 A;  2KZZ A;  2VG7 A;  1LV5 A;  3TTC A;  2G8W A;  3OY9 A;  4DTS A;  3ENB A;  3IKM A;  3PO5 A;  2YJF A;  5J1E A;  1HUX A;  2NUB A;  2D0O A;  3G0Z A;  1RDA A;  2I7N A;  2VG6 A;  4IJN A;  3ZSR A;  4CEF A;  1KCF A;  3P5J A;  1IKY A;  3CCQ N;  1DTT A;  2YHY A;  1KTQ A;  3ZSX A;  4DU4 A;  4FJ5 A;  3AVF A;  3HM8 A;  4AIL C;  4CFD A;  5SZT A;  2Q2R A;  4FZZ A;  3J7Y P;  5EY4 A;  1NGH A;  1FKO A;  5LMU K;  2OPP A;  4Z4E A;  3CCR N;  3L2W A;  4YDU C;  4C8K A;  1VSJ A;  3E66 A;  2A42 A;  4C8O A;  4DQS A;  5KRT A;  3THY A;  2FF6 A;  3M8S A;  3EKU A;  1HNV A;  4DSL A;  4IOC L;  4FM1 A;  2VQF K;  3OYI A;  4B1Z A;  4M3R A;  1VQ5 N;  2JWK A;  1YIJ N;  3D2F A;  1HKB A;  1BOT O;  2KLA A;  1Y97 A;  3IRX A;  4CJ3 A;  2Q1N A;  3AV9 A;  4OX9 K;  4BRK A;  3AVI A;  4LF6 K;  4O8U A;  3L8B A;  4JRQ A;  1Z6R A;  4BR2 A;  3QBX A;  1KD1 O;  4B9V A;  5A2Q O;  1KLN A;  4DLE A;  3TAP A;  4RW4 A;  1TK8 A;  3ENH A;  1U48 A;  3FZL A;  3WXM B;  1Q7Y O;  3O1B A;  4RW9 A;  3FZM A;  1WSF A;  2XY7 A;  3QFP A;  1QTM A;  3ZX3 A;  3I8D A;  3D2E B;  5BRE A;  3HVT A;  3V9S A;  4MDB A;  1HYS A;  3TSQ A;  3G10 A;  5HRR A;  1NGC A;  3T1H K;  1QSY A;  4OKK A;  4N47 A;  3VF6 A;  4M3U A;  3HOS A;  3LDL A;  3AY9 A;  2OTJ N;  2KQ2 A;  3MN6 A;  4JNE A;  5TKY A;  4O44 A;  4BY9 C;  2QWL A;  1RBU A;  1TK0 A;  2E88 A;  3EE9 A;  4X65 K;  3OYE A;  3SZ2 A;  4PY5 A;  1BI4 B;  2P9P A;  3P4I A;  2DTU A;  3AVL A;  2O8F A;  1RDD A;  2FF3 B;  3ULE B;  3CI5 A;  4DTX A;  4BE2 A;  4DS4 A;  2Z1G A;  1NGB A;  3VQP A;  3SK3 A;  3V9Z A;  5ADX A;  2V52 B;  1K8A O;  2E4L A;  3NAE A;  1K73 O;  4KB1 A;  3VQ4 A;  3L2R A;  1XHX A;  4I7F A;  2WFB A;  4IFV A;  1RDW X;  3T19 A;  2OTL N;  1JCE A;  4BRG A;  3CCS N;  1ZBH A;  4CF8 A;  3CJ1 A;  1QE1 A;  1S9E A;  2PYL A;  2KW4 A;  1ATS A;  3IS9 A;  1VSI A;  1W97 L;  5SWM A;  1EX4 A;  3ZCM A;  1QQM A;  4H03 B;  4N76 A;  4CJS A;  4BC3 A;  4CGI A;  4ISF A;  4DSI A;  1S5J A;  5GIO A;  4BE0 A;  3BEX A;  5AQP A;  1S72 N;  4IWV A;  3VN5 A;  3IMX A;  3LM2 A;  1XI1 A;  2OA8 A;  1EO1 A;  2AA4 A;  1VQP N;  1JLE A;  4GV9 A;  3K59 A;  4CJU A;  4JI4 K;  3KKR A;  1IKX A;  4CGD A;  4HTU A;  2B5J A;  1JLG A;  1QHA A;  3WXK A;  1BUP A;  3THW A;  1VQO N;  4OKE A;  1A5X A;  4XIU A;  4LF7 K;  1CZ9 A;  4F2S A;  2VWB A;  3K5O A;  4BRH A;  2OAN A;  3QO9 A;  4CI6 A;  4IDK A;  2IOC A;  5H1S Q;  3ZX0 A;  4CIE A;  1S22 A;  4MLE A;  3CHW A;  5LMN K;  3WNF A;  2HBL A;  1WSH A;  5BR9 A;  3OYJ A;  1GLC G;  5AQX A;  3WQU A;  3GDQ A;  1GLB G;  4K42 A;  2D0C A;  4NCG A;  3SQ2 A;  4CZL A;  4CIF A;  4WQ5 A;  4FM0 A;  4EZ9 A;  3M8Q A;  1REV A;  2WOM A;  4RW7 A;  3KLI A;  5GIN A;  4FJJ A;  2YJE A;  5GAD P;  3MK6 A;  2WC9 A;  2KTQ A;  5DMR A;  3EL2 A;  2FSK A;  4IO9 L;  4DSE A;  1BIZ A;  2X6N A;  4JI7 K;  2VWK A;  4KHY A;  3TAE A;  1QZ6 A;  3CER A;  4DV2 K;  4CIG A;  4LFA K;  4B9N A;  1FJG K;  1IG9 A;  4KH5 A;  3HO1 A;  3VF2 A;  4DV3 K;  1NJY A;  5FPN A;  4GVM A;  3KK7 A;  3QEP A;  3ATU A;  2YCH A;  3I55 N;  4FJN A;  1HKC A;  3VTH A;  4IKF A;  1EP4 A;  2BUP A;  1NMD A;  2R7Y A;  3VEY A;  4GKK K;  5C2D A;  2OZS A;  2QM1 A;  1LWF A;  1Y64 A;  2RHK A;  1NK4 A;  1TV6 A;  4CEZ A;  4KFB A;  4BRF A;  5FRM A;  3VGK A;  4E3S A;  3NFA A;  2NRV A;  1J9A A;  4YOX A;  4KHU A;  3J7A P;  2G8H A;  2VCP A;  2HHH K;  3CMA N;  3KIO A;  3SBG A;  3BUZ B;  1L3U A;  4NCA A;  5C12 A;  3CJA A;  3K2P A;  4CK2 A;  1UAX A;  1SL0 A;  4AHS A;  4CEO A;  1DTQ A;  4LH5 A;  4B8C A;  3CPW M;  2P9P B;  3O4W A;  3K9J A;  1NGJ A;  2Q97 A;  4DF4 A;  3MXJ A;  2NRT A;  1RT1 A;  5DM6 L;  1ITG A;  3HP6 A;  4KTW A;  1YT3 A;  4FJK A;  4BVP A;  4WYB A;  4JHD A;  3H08 A;  3AO1 A;  1X9W A;  2HVI A;  4O4G A;  2DY4 A;  1VQ6 N;  3U3Y A;  3OS1 A;  5BN8 A;  4AQY K;  1KFS A;  4A2B A;  1SS6 A;  5C25 A;  3BP8 A;  2YKN A;  4HCB A;  4L3Q A;  2X74 A;  3MN7 A;  5IT9 O;  3RRH A;  4M3Z A;  4BAC A;  3LAN A;  4CEE A;  2UYT A;  3OYH A;  4A61 A;  3O9Q A;  4F3T A;  2O8E B;  1E3M A;  4DFJ A;  4JI1 K;  3J81 O;  4A57 A;  3PY8 A;  5CY4 A;  3BF3 A;  5GIP A;  4JV5 K;  3G71 N;  2OPS A;  4KTZ A;  2G8F A;  3I8B A;  3R6M A;  1EET A;  1E4G T;  3ITH A;  1NM1 A;  3LDN A;  4BR9 A;  2HNY A;  3LPT A;  3CG7 A;  3L6Q A;  4KHN A;  5C10 A;  2BDP A;  1OVQ A;  4BRQ A;  4LH4 A;  1N33 K;  3OBY A;  1NKB A;  2NRR A;  3VQ7 A;  4IO8 A;  5HOO A;  2P5G A;  3A2F A;  3C6T A;  2OZM A;  3DAW A;  4WQ4 A;  3S9H A;  4M42 A;  4CBW A;  4GNI A;  3MMV A;  4PKI A;  4DF8 A;  3DLB A;  4Z0U A; 
#chains in the Genus database with same CATH homology
 1T8E A;  1RT3 A;  3ZSQ A;  1RTJ A;  2HND A;  1LWE A;  4KAZ A;  3AA3 A;  3RR7 A;  1RT7 A;  4FLT A;  4I9Q A;  2D5R A;  3SPZ A;  3EZ5 A;  3OS2 A;  2XY6 A;  5J2P A;  1C1B A;  1G15 A;  1RT5 A;  3QIP A;  4GW6 A;  2IGI A;  2JLE A;  5JS2 A;  4CGH A;  3BDP A;  1WAF A;  4ID1 A;  4CFB A;  1L3V A;  1KSP A;  1T05 A;  3C95 A;  1L3T A;  3DLG A;  4FZX C;  1O1W A;  3VQA A;  2ZQB A;  3OYB A;  1RTD A;  4JS4 A;  2PZS A;  1RDC A;  3TAM A;  3KTQ A;  3AA4 A;  3LPU A;  4I2Q A;  1NK9 A;  1EKE A;  4OGE A;  1WNS A;  2F8T A;  2A1S A;  3K57 A;  3DLE A;  4FJG A;  4EZ6 A;  3SQ0 A;  4KPY A;  4M41 A;  2G8U A;  2RPI A;  3O3F A;  4F3O A;  1TKX A;  4FK4 A;  3NH2 A;  1CXQ A;  1GOA A;  2IC3 A;  4NYN A;  4C8N A;  1JL2 A;  1GOC A;  4FLX A;  4F4K A;  4G1Q A;  2GUI A;  4CEC A;  5HRP A;  1MU2 A;  3L2Q A;  1C0T A;  4CK3 A;  3HXM A;  1TKZ A;  3T3F A;  3V9U A;  2IS3 A;  4KI4 A;  3ZT0 A;  4E7I A;  4KHS A;  4TSX A;  1IKV A;  1W9H A;  1BQM A;  2XY5 A;  1TL1 A;  1S6P A;  1SV5 A;  4KB0 A;  1YTA A;  4UQG A;  1JLB A;  5E41 A;  3JSM A;  1VSK A;  2QKK A;  4DQP A;  3SUQ A;  2GV9 A;  4K8X A;  3KK1 A;  4CJR A;  4PUO A;  4BWM A;  4PQU A;  5DK5 A;  4CED A;  1J53 A;  4N56 A;  1S1V A;  2ATQ A;  3SV3 A;  2IDO A;  2WON A;  3RWU A;  2KZZ A;  3AVG A;  2VG7 A;  3TAG A;  1SKW A;  1IKW A;  1LV5 A;  1VSH A;  4IFY A;  2D0B A;  2G8W A;  4KHQ A;  4B3O A;  3OY9 A;  4DWI A;  3S3O A;  3NGI A;  4E89 A;  4DTS A;  2D0A A;  4GMJ B;  4YNQ A;  3C6U A;  3NF7 A;  2HHW A;  5FRO A;  1SUQ A;  2FBV A;  1LW2 A;  4W5T A;  5I42 A;  1QSL A;  5FRN A;  4LY7 A;  3PO5 A;  3CM5 A;  3WNH A;  3TAN A;  3SNN A;  4DU1 A;  5J1E A;  2BAN A;  3TAF A;  2X78 A;  2NUB A;  3G0Z A;  5K14 A;  1RDA A;  2VG6 A;  3TWH A;  1L5U A;  3DOK A;  5HBM A;  3ZSR A;  4CEF A;  4DSF A;  3HL8 A;  1KCF A;  3P5J A;  4CGJ A;  3V81 A;  4H8K A;  1IKY A;  4CGG A;  1DTT A;  2E6M A;  2YHB A;  1U04 A;  1C6V A;  4ZHR A;  2XHB A;  4ELT A;  3AVK A;  1KTQ A;  3ZSX A;  4DU4 A;  4MFB A;  4DLG A;  4FJ5 A;  1I3A A;  4HVJ A;  4BDY A;  3LP2 A;  3AVF A;  1NJX A;  2Z1J A;  3O3G A;  4OGC A;  3DI6 A;  2Z1H A;  4AIL C;  5JS1 A;  4CES A;  4B9U A;  4Z4F A;  4CFD A;  4RW6 A;  5SZT A;  3RMD A;  4FZZ A;  3VQ6 A;  3NBP A;  4CJP A;  3QIN A;  2Y1J A;  3OYD A;  3K58 A;  1FKO A;  4CF1 A;  5HRN A;  2OPP A;  4E7K A;  4Z4E A;  1VSF A;  4O5B A;  3VQC A;  3V1Q A;  4N5S A;  1NK0 A;  3OS0 A;  3L2W A;  4FLZ A;  5J2M A;  4C8K A;  4F8R A;  3HST B;  3PX0 A;  2ITG A;  1VSJ A;  1HJR A;  1JLA A;  2ZE2 A;  4CGF A;  3DLH A;  2BGG A;  1U49 A;  1RBR A;  4C8O A;  4Z4I A;  1WAJ A;  3TI0 A;  4DQS A;  3FFI A;  5KRT A;  4NCB A;  3M8S A;  3HP9 A;  5T7B A;  1HNV A;  4DSL A;  1QHT A;  4FM1 A;  3OYI A;  3LP3 A;  4M3R A;  4FLU A;  4CFA A;  3L3V A;  3AVN A;  1S1W A;  3M8R A;  3HM9 A;  2O4G A;  3HPH A;  4Z4G A;  4HCC A;  3LZI A;  1W0H A;  1ASW A;  4DG1 A;  1RT4 A;  1Y97 A;  4HUF A;  4CJ5 A;  1B9D A;  2PYJ A;  1S1T A;  3IRX A;  2RKI A;  3AV9 A;  4CJ3 A;  3NCI A;  3PV8 A;  1WLJ A;  4E1N A;  2OYQ A;  3AVI A;  3F73 A;  3HYF A;  4EP4 A;  5EU7 A;  3L8B A;  3LAL A;  4CEB A;  3KKS A;  3NHG A;  4O55 A;  4JRQ A;  3LAM A;  3KLE A;  3IAY A;  4B9V A;  1KLN A;  4B8A B;  4DTO A;  3DOL A;  3CM6 A;  4DLE A;  3TAP A;  4RW4 A;  1TK8 A;  1TAU A;  1U48 A;  4ELU A;  3HJF A;  3C94 A;  2P5O A;  4ELV A;  4DS5 A;  3KK3 A;  3SUP A;  1U45 A;  1QSS A;  4RW9 A;  1ZBF A;  4BWJ A;  4CJV A;  3NGZ A;  4FJL A;  5KI6 A;  1WSF A;  2XY7 A;  3IG1 A;  3D0P A;  4DFK A;  2A1R A;  4OKJ A;  3CFO A;  1QTM A;  1BHL A;  4Y1C A;  3I8D A;  4JLH A;  4OLA A;  1S1U A;  2FBT A;  1BCO A;  2YNH A;  3QIO A;  1ZBU A;  2G8I A;  3HVT A;  3K5M A;  3V9S A;  4KO0 A;  2OPR A;  1HQU A;  3AO2 A;  2XO7 A;  3VQQ A;  4E19 A;  1BIS A;  1TAQ A;  1HYS A;  3O4Q A;  3G10 A;  5HRR A;  3AVH A;  1QSY A;  4KTQ A;  4OKK A;  4Z4H A;  1S6Q A;  4N47 A;  5CZ1 A;  1CXU A;  1WSG A;  4CF2 A;  4BE1 A;  4M3U A;  1RIL A;  3DMJ A;  2EX3 A;  1J5O A;  3VQ9 A;  1VSD A;  2KQ2 A;  3NF6 A;  3TR8 A;  4NYF A;  4CJF A;  3KLF A;  3VA0 A;  1JLQ A;  1A5W A;  4O44 A;  3I0R A;  2AJQ A;  1JLC A;  2KFN A;  1LAW A;  4CER A;  4FYD A;  4BDP A;  3U6F A;  3AO5 A;  1RDB A;  1RBU A;  4LSN A;  1TK0 A;  3ALY A;  1CZB A;  4CF0 A;  4CJ4 A;  1NK8 A;  4RW8 A;  3SZ2 A;  3OYE A;  4PY5 A;  4ZTF A;  2I5J A;  2W42 A;  1BI4 B;  3QES A;  4J2A A;  2DTU A;  4QOZ B;  3AVL A;  2RF2 A;  1RDD A;  5D3G A;  2F8S A;  4DQI A;  4FJ8 A;  4DTX A;  3NDK A;  4BE2 A;  4DS4 A;  1D5A A;  4KI6 A;  2Z1G A;  2ZD1 A;  1D9D A;  3LDS A;  4CE9 A;  1IH7 A;  3VQP A;  4DTN A;  1NK5 A;  1N6Q A;  4W5N A;  3V9Z A;  4Y1D A;  4AHR A;  4W5O A;  2DFF A;  1VSM A;  3LP1 A;  3QEW A;  1X9S A;  1CLQ A;  2HB5 A;  2E4L A;  1IO2 A;  3NAE A;  3QEV A;  1VRT A;  1SKS A;  3CYM A;  4CCH A;  4KRF A;  4KB1 A;  3VQ4 A;  3L2R A;  1XHX A;  4J2B A;  4I7F A;  4IFV A;  3NF8 A;  1BL3 A;  1HYZ A;  3NGY A;  3T19 A;  1TK5 A;  1HQE A;  2RN2 A;  1QQC A;  3AVJ A;  4H4M A;  2VG5 A;  4KKO A;  1TKD A;  4Z4C A;  4YFU A;  3WNG A;  3VQ5 A;  5KGX A;  4CF8 A;  1ZBH A;  2HHX A;  1QE1 A;  1S9E A;  1JXB A;  3VQB A;  4ZTJ A;  2PYL A;  1RNH A;  2KW4 A;  4DTR A;  2DFE A;  3IS9 A;  1T7P A;  1VSE A;  3LAK A;  3V9W A;  1VSI A;  4OVL A;  5SWM A;  1EX4 A;  3ZCM A;  2B4J A;  4N76 A;  1C1C A;  4CJS A;  4E7H A;  3QNN A;  5KRS A;  4CHO A;  4CGI A;  3S3N A;  1HRH A;  2GBZ A;  1ZBL A;  3PX4 A;  4LSL A;  4DSI A;  1C0U A;  1S5J A;  4L8R B;  3NE6 A;  4BE0 A;  3SI6 A;  4KV8 A;  4B9M A;  4OPK A;  4CJK A;  1C0M A;  1RBT A;  4CJQ A;  4CK1 A;  3OYM A;  3OYN A;  3MXI A;  3ZT2 A;  3OJS A;  3AVM A;  2HHU A;  3U3G A;  1TVR A;  3VN5 A;  4M3X A;  3ZSO A;  1C1A A;  1S1X A;  1Q9Y A;  3EYZ A;  1HPZ A;  1VRU A;  4FM2 A;  3AA2 A;  3BGR A;  4I2P A;  4CJT A;  1XI1 A;  4M45 A;  3HPO A;  2OA8 A;  3HVR A;  1ZYQ A;  4DMN A;  1JLE A;  2B6A A;  2HNZ A;  4CJU A;  1Z26 A;  3K59 A;  1EXQ A;  2VWJ A;  4DTU A;  3KKR A;  3HK2 A;  3DLK A;  4C8L A;  1IKX A;  4CGD A;  1FKP A;  3CFP A;  4DFP A;  4HTU A;  3SCX A;  2HHS A;  3DYA A;  1NK6 A;  2KFZ A;  4IBN A;  2B5J A;  1JLG A;  3NF9 A;  3PX6 A;  3P83 D;  3DRR A;  1B9F A;  1BCM A;  1RCH A;  4PWD A;  3TAB A;  4OKE A;  2PY5 A;  1A5X A;  4XIU A;  3K5L A;  1CZ9 A;  4F2S A;  3K5O A;  1WSJ A;  4EP5 A;  3QO9 A;  3VA3 A;  1KFD A;  4IDK A;  2IOC A;  4CHN A;  4CHP A;  3ZT3 A;  3UIQ A;  2JGU A;  4CIE A;  3QLH A;  3WNF A;  3ASM A;  1NJZ A;  2F96 A;  3KLG A;  1WSH A;  4N41 A;  3MEG A;  3OYJ A;  1VSL A;  3AVC A;  4CJW A;  3B6O A;  5J2Q A;  3QEX A;  3KJV A;  3V6D A;  1TKT A;  1NKC A;  2HMI A;  4DU3 A;  4DQR A;  2D0C A;  2EHG A;  4NCG A;  2FC0 A;  3O3H A;  1L3S A;  3SQ2 A;  4DFM A;  5KTQ A;  4E7J A;  4K8Z A;  4CIF A;  4FM0 A;  4E1M A;  4EZ9 A;  1VK0 A;  1KRP A;  2LSN A;  3M8Q A;  3PO4 A;  1REV A;  1UWB A;  2WOM A;  3O4N A;  4RW7 A;  2Q3S A;  1JXE A;  3KLI A;  3KK2 A;  2IAJ A;  1Q8I A;  4FJJ A;  3SQ1 A;  3L3U A;  2KTQ A;  4C8M A;  1LWC A;  4PA1 A;  5DMR A;  3NH1 A;  4HUG A;  2QKB A;  4FJI A;  2E6L A;  3RMA A;  4CJE A;  3RMB A;  3K5N A;  1NOY A;  4DSE A;  1Q9X A;  1YTU A;  2Z1I A;  1BIZ A;  2X6N A;  3AO4 A;  4B9T A;  1BIU A;  3DRP A;  2VWK A;  4KHY A;  3TAE A;  4CIG A;  1HMV A;  3LZJ A;  2FBX A;  4B9N A;  1IG9 A;  3HO1 A;  4DSJ A;  4JS5 A;  4RG8 A;  4Q5V A;  1NOZ A;  4QAG A;  1NJY A;  5CYM A;  2YHA A;  4GVM A;  3OYK A;  3THV A;  4M3Y A;  1XHZ A;  4HUE A;  1D8Y A;  4B9L A;  1R0A A;  3QEP A;  2YNF A;  4KHW A;  3QNO A;  4B9S A;  3V1O A;  4FJ7 A;  4J2D A;  3TAR A;  4FJN A;  4IG0 A;  5FDL A;  3AA5 X;  4KRE A;  3DRS A;  3LWL A;  4IKF A;  1UA0 A;  3KD5 E;  1EP4 A;  3WNE A;  4H4O A;  5HRO A;  5HLF A;  3OJU A;  2R7Y A;  4W5Q A;  3JYT A;  5J2N A;  4FW2 A;  3L2V A;  2OZS A;  4CFC A;  2G8K A;  3KLH A;  1JKH A;  4FJH A;  1LWF A;  1DLO A;  1X1P A;  4FJX A;  4FJM A;  1NK4 A;  1TV6 A;  3RRG A;  4FLY A;  3M8P A;  4CEZ A;  2HVH A;  1QS4 A;  4KFB A;  3DLR A;  5FRM A;  1SL2 A;  3V4I A;  2XRI A;  4E3S A;  3NFA A;  1J9A A;  1UA1 A;  2X6S A;  3QEI A;  4DTP A;  1KVA A;  4KHU A;  4FLW A;  2G8H A;  3ISN C;  2YV0 X;  1RTH A;  4DTM A;  3AO3 A;  3RMC A;  1XC9 A;  4AHC A;  2YNG A;  4DTJ A;  2QK9 A;  4FXD A;  2YNI A;  3KIO A;  4E0D A;  1L3U A;  1LAV A;  4NCA A;  2P1J A;  3ZSZ A;  3SPY A;  3K2P A;  3HPG A;  1UAX A;  1BQN A;  4CK2 A;  3QER A;  1NJW A;  1SL0 A;  4I9L A;  4AHS A;  4CEO A;  1DTQ A;  2XY8 A;  4LH5 A;  4OLB A;  4B8C A;  1RBS A;  4AHV A;  1J54 A;  5C42 A;  3T1A A;  4FK0 A;  3TAQ A;  1RTI A;  4CHZ A;  3AVA A;  4DF4 A;  3MXJ A;  3F9K A;  4FJ9 A;  1RT1 A;  3LP0 A;  3QET A;  1ITG A;  1D9F A;  3ZSW A;  3HP6 A;  4KTW A;  1Z25 A;  1RT6 A;  1U4B A;  1ASU A;  1YT3 A;  4WE1 A;  3VQD A;  1XWL A;  4FJK A;  1KVB A;  4E7L A;  4JRP A;  2KZM A;  3ULD A;  4AH9 A;  4CHQ A;  3H08 A;  4OPJ A;  5KGW A;  1SKR A;  4DQQ A;  4M3T A;  3AO1 A;  1YVU A;  1X9W A;  4O0I A;  4DSK A;  2O4I A;  1T03 A;  2HVI A;  3SQ4 A;  1N5Y A;  4O4G A;  3MXM A;  4QCL A;  2DY4 A;  1S9G A;  4ICL A;  1WN7 A;  3L2U A;  3U3Y A;  3OS1 A;  3ZSY A;  4CHY A;  3OYA A;  4FW1 A;  3HT3 A;  1LW0 A;  1ASV A;  3LWM A;  1X9M A;  1KFS A;  5C25 A;  3KD1 E;  3I0S A;  4FK2 A;  2OPQ A;  3P1G A;  3SUO A;  2YKN A;  3SJJ A;  3V1R A;  4HCB A;  1BGX T;  3OYL A;  4Q0B A;  4J2E A;  3MEE A;  4CF9 A;  2HHQ A;  2HHV A;  2X74 A;  3ZSV A;  4FZY A;  4MQ3 A;  4BDZ A;  3RRH A;  4HHT A;  1BI4 A;  4M3Z A;  1K6Y A;  4BAC A;  3LAN A;  3EY1 A;  3SV4 A;  2ETJ A;  1RT2 A;  4O0J A;  1JLF A;  1WSI A;  4IG3 A;  5HP1 A;  4CEE A;  4AHT A;  1FXX A;  3OYH A;  3ZT4 A;  2FBY A;  3OYG A;  1KVC A;  4F3T A;  4CEA A;  1U47 A;  4R5P A;  4CJL A;  3OYF A;  5HRS A;  1A5V A;  4DFJ A;  1KLM A;  1HNI A;  1GOB A;  1WSE A;  3PY8 A;  5CY4 A;  1I39 A;  3B6P A;  3SUN A;  5CYQ A;  5CZ2 A;  3CFR A;  2YKM A;  2OPS A;  4KTZ A;  4FLV A;  2HW3 A;  3E01 A;  4FVM A;  2G8F A;  4FCY A;  1EET A;  3V9X A;  4CEQ A;  5I3U A;  3DM2 A;  1TL3 A;  3S3M A;  1NK7 A;  1ZBI A;  3ITH A;  1SL1 A;  3NH0 A;  3MAQ A;  1TGO A;  2BE2 A;  4M3W A;  2HNY A;  3OYC A;  1RBV A;  3CG7 A;  3LPT A;  3OVN A;  1HYV A;  3RR8 A;  4F2R A;  4KHN A;  4AHU A;  1B92 A;  4B08 A;  3SYZ A;  1UOC A;  4LH4 A;  3VQE A;  2BDP A;  1FK9 A;  1NKB A;  4W5R A;  2P51 A;  3MED A;  1JL1 A;  3VQ7 A;  3RTV A;  4ID5 A;  2Y1I A;  2P5G A;  2DFH A;  3A2F A;  2QXF A;  3C6T A;  3PUF A;  3CQ8 A;  1NKE A;  2OZM A;  2HHT A;  3ZT1 A;  3D45 A;  2G8V A;  3S9H A;  4M42 A;  5C24 A;  1F21 A;  3VQ8 A;  4DF8 A;  3DLB A;  3AVB A;  4Z0U A;  3MEC A;  4OJR A;  4LD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...