4CJUA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjuA00
2D0BA 4OLAA 4IDKA 1T7PA 1VSMA 1SKSA 4O55A 2Z1GA 4M42A 4DTJA 3VA3A 4BE1A 1EETA 4KHNA 4KHWA 1S1TA 3MEGA 4I2QA 4PA1A 4CGIA 1B92A 4DS5A 1HPZA 1QHTA 3AO3A 1RT2A 4NCGA 1TK0A 1N6QA 5KRTA 1CLQA 3KJVA 4FLWA 4FXDA 1BCOA 4I9LA 4CF8A 1ITGA 3LWMA 4M3TA 3UIQA 1X9WA 3NAEA 5J2PA 1I39A 2YHAA 4OVLA 4OGCA 3V9UA 1D9DA 1S1UA 2KFNA 2KFZA 3I8DA 5KGWA 3HVTA 3ISNC 2RN2A 1J9AA 1IH7A 3LP0A 3VQ4A 4Z4HA 1S1WA 3TAGA 1RDAA 3MXJA 3DRRA 3V1QA 2WONA 2ATQA 1IKXA 1MU2A 2E6LA 4IFYA 3C94A 3P5JA 3VQ9A 4CJVA 3HP9A 4C8MA 5J2QA 4FLZA 1L3UA 3OY9A 4DTUA 1XHXA 3QESA 3SQ2A 2XRIA 3L2VA 4RW7A 5J2NA 4PY5A 3AVBA 1JXEA 3OVNA 4DTNA 1YTUA 1RTIA 3T1AA 4LD0A 4E7KA 2QKKA 3SYZA 4AHVA 2A1RA 1TL3A 4LY7A 1BIZA 4DSFA 4KREA 3QINA 3NF8A 4DQRA 2PY5A 4CEZA 4KPYA 3K5NA 1TKTA 4CIFA 2P5OA 4FW1A 5EU7A 2G8HA 3ZCMA 3KLFA 1WSFA 1BL3A 4FYDA 1WSJA 2PYLA 4J2EA 4DSKA 4W5RA 1GOBA 3SV4A 4KO0A 3OYJA 1LV5A 2KZZA 5CYQA 5E41A 1JXBA 3I0RA 3VQPA 4CEAA 4DFJA 1WAFA 3QNNA 4ELVA 5FRMA 1LWCA 3DLRA 4H8KA 1A5WA 3PY8A 4CEEA 4Q5VA 1S1XA 2YNIA 3VQCA 2QXFA 3PX0A 4CF1A 1TK5A 1HNIA 4CHYA 2HHWA 1HQEA 3HO1A 1LWFA 1WNSA 2I5JA 4CJLA 1RBSA 4CGHA 1BCMA 2FBXA 4CK3A 3TARA 1EKEA 1I3AA 4EP4A 4CFCA 1SL2A 4HCCA 1T05A 3V9ZA 3B6PA 1LW2A 2A1SA 1B9DA 4IG3A 4OPKA 4BDYA 4DU1A 4MQ3A 3CFRA 3NGYA 4KKOA 3KKRA 3HL8A 3AVHA 3QEXA 1U4BA 3VQQA 1EP4A 4CJ3A 3SUOA 4B08A 3VA0A 3NHGA 1FKPA 2OA8A 3NCIA 4FJIA 2XY7A 3ZT2A 4AH9A 3ZT4A 4E89A 3NDKA 4CFDA 3OYMA 1ZBHA 4CHOA 3F73A 3V1OA 4DQSA 1IKVA 3ASMA 2PZSA 4DSEA 1IO2A 1VSJA 3AVLA 2ZE2A 4QAGA 1FXXA 3NF6A 3OS1A 4L8RB 5JS2A 1YVUA 3OYDA 3SZ2A 1JL2A 4FJ5A 5T7BA 3WNEA 3OYCA 5C25A 4F4KA 1DTTA 4DLGA 2XY6A 2YNGA 4GMJB 2D0AA 3LAMA 1ZBUA 1BIUA 1SL1A 4JRPA 1ZBFA 4CEBA 1VK0A 3HXMA 2HB5A 3AVMA 3O3FA 1KTQA 4BWMA 4DQIA 2HHXA 1RTDA 4F2RA 5CZ1A 4F3TA 1JL1A 4QOZB 4CGFA 3HJFA 4CJRA 3AO2A 1S6QA 4Z4IA 1J54A 1FKOA 1BQNA 4RW9A 1Z26A 3CM6A 1KVBA 3PX4A 3SUNA 1R0AA 5HRSA 3DLGA 4C8LA 2B5JA 1KFDA 4KV8A 4FZYA 1NOYA 1ZBIA 3M8SA 2OPQA 2FBTA 4I7FA 4JS4A 4DF8A 1D8YA 4RW6A 5HRNA 2P5GA 4ELTA 1S1VA 4FJKA 4F8RA 4HUEA 5D3GA 2E4LA 4DQQA 3L3UA 3WNHA 4Y1DA 4OPJA 3KK1A 1U04A 1RTHA 1HRHA 1L3VA 4CJ4A 3QETA 2G8IA 4W5NA 1IKYA 4CJEA 1X9SA 3RR7A 4N47A 4BDPA 3OS0A 2DY4A 3LP2A 1HQUA 4G1QA 3MXIA 4YFUA 3NGZA 3AVFA 4ZTJA 4C8NA 4E0DA 4CK1A 1UA0A 2Z1JA 4DMNA 5C24A 1L3TA 1NK8A 4CJPA 3RTVA 4N76A 4DU3A 2PYJA 4IBNA 2Y1JA 3WNFA 1RILA 4CESA 4DTOA 3T19A 3KLHA 3AVIA 3OYNA 1U47A 4ID5A 3AO4A 3U3GA 3M8RA 3NGIA 1S6PA 3TABA 4W5TA 3L2RA 3PO4A 4M3RA 4DF4A 3QO9A 1NKBA 1C6VA 3KLEA 3EYZA 2OPPA 1RTJA 2KTQA 4FCYA 1YTAA 4DLEA 1C1AA 1J53A 3V9WA 4JRQA 3SJJA 4M3WA 3LDSA 4FK2A 2LSNA 1TV6A 3S3NA 1W0HA 1RDDA 3NE6A 1U45A 2OZMA 1ASWA 2YHBA 2X6SA 4KTWA 4KTZA 1N5YA 2OPSA 4FK4A 1JLQA 2DTUA 3OJSA 3HPGA 1HYVA 2VG5A 4JS5A 2O4IA 3A2FA 4CHPA 4FZXC 3DLKA 3AA4A 2YKNA 3SCXA 4F2SA 4W5OA 3MECA 4EZ6A 5HBMA 4RG8A 4NCAA 3S3MA 3QNOA 1VSEA 4OJRA 2IGIA 3DOKA 3TAPA 4FJNA 4FJ9A 1NK4A 2D0CA 4CJFA 1LW0A 1JLAA 2FBYA 1WN7A 2KW4A 2FBVA 2XY8A 4HUFA 2XHBA 1TK8A 2BDPA 1TAUA 1SKRA 2EHGA 3CM5A 4Y1CA 4M45A 4FLVA 3QEIA 1CXQA 3OYGA 2G8UA 4B9TA 3G0ZA 3OYIA 2HHVA 3O4QA 3QIOA 2JGUA 3HK2A 4I9QA 5FRNA 4CK2A 4GW6A 4Z4EA 3MAQA 3PX6A 3OYFA 1C1CA 1QSYA 2D5RA 4KI6A 4FZZA 4J2DA 5SWMA 4M3UA 4DTSA 3VQBA 3LPUA 4LSNA 5FROA 4DTMA 1B9FA 4ICLA 1GOCA 3NH1A 1VSKA 2ETJA 3DLBA 3HT3A 4CCHA 3RMCA 1S5JA 4E7IA 3TANA 1RT4A 4KHUA 3VQDA 4OKKA 3I0SA 4FVMA 1ASVA 4E19A 3AA5X 1L5UA 4CHZA 3CFOA 4LH5A 4M3YA 4Z4FA 1NJYA 3TAMA 4B9NA 1WLJA 4FK0A 2GBZA 1F21A 2EX3A 4KHSA 4FJXA 1JLEA 3OS2A 1JLGA 2BE2A 3S9HA 1ZYQA 3V6DA 1RBUA 4CJKA 3NFAA 4FJMA 2W42A 3M8QA 2HVHA 3SV3A 5K14A 4AHSA 5HLFA 1KSPA 1RT6A 2YV0X 2B6AA 3B6OA 1WSEA 3OJUA 4CERA 2HNZA 4NCBA 4B3OA 4DTXA 2Y1IA 4CHQA 3RWUA 3PO5A 4J2AA 3LWLA 1CZ9A 1TGOA 2HMIA 3DYAA 1NK5A 1NJWA 1VSLA 4ELUA 4F3OA 5CY4A 1NK0A 4BACA 2RKIA 4CE9A 1EX4A 5JS1A 2DFEA 4CECA 3HP6A 5KI6A 4DTPA 4FLXA 4R5PA 4FJLA 2FC0A 1JLCA 1QS4A 1KVCA 3NBPA 3VQ7A 4DFPA 2Z1HA 4AHUA 2XO7A 1WSGA 2IC3A 4O44A 1SL0A 4KHYA 2HHUA 3K5MA 1JKHA 3C6TA 4FLUA 1NKCA 4CJ5A 1RCHA 4KAZA 2F8TA 3BDPA 2E6MA 3TR8A 3NH2A 1NK6A 1A5XA 1UAXA 4HHTA 3KD5E 1IKWA 1BHLA 2DFFA 4CJQA 5DK5A 3TAEA 3VQEA 4FJJA 4CJTA 4AILC 1Q9YA 2AJQA 4KRFA 3C95A 2DFHA 4JLHA 1C0MA 1FK9A 4WE1A 3ZSWA 2X74A 4FJ7A 4OLBA 4CEOA 1LAVA 4DSIA 3O3GA 3LALA 4GVMA 3VN5A 3QEPA 4QCLA 4CIEA 2B4JA 4CFBA 1NJXA 5CZ2A 1NOZA 1RT1A 1HYZA 3L2UA 1VRUA 1HMVA 3JYTA 2WOMA 3RMAA 5I3UA 1Z25A 1BQMA 4OGEA 4CF2A 1HYSA 3SI6A 1RBRA 3TAQA 4Q0BA 3CYMA 1KCFA 4Z4CA 4E3SA 4B8CA 2VG7A 4H4OA 3VQ8A 4N56A 3KTQA 1G15A 4DFKA 4BE0A 3ALYA 2ZD1A 3ZSOA 1C0TA 3KK3A 4CJWA 4KB0A 4HVJA 2G8WA 4O4GA 4E1MA 3AVCA 1Q8IA 1TAQA 3AVNA 1KFSA 1RT3A 4W5QA 1EXQA 2HNDA 1WSHA 4BE2A 3V4IA 4FW2A 3IS9A 4Z4GA 3U6FA 1TKZA 1D5AA 3ZSXA 3KK2A 3AO1A 3HSTB 4MFBA 2IOCA 1LAWA 1KRPA 3CG7A 4CHNA 3OYBA 1C1BA 1RDCA 1Y97A 3DLEA 3ZSQA 3CQ8A 2P51A 2RPIA 2ZQBA 4CF0A 4B9SA 4K8XA 1RBTA 3AVGA 4FM0A 1TKDA 2XY5A 1HJRA 3SQ0A 4ID1A 4CEFA 5DMRA 3ZSVA 3D0PA 3AVKA 1DLOA 1JLBA 3HPHA 1KVAA 3OYKA 3QLHA 3L2WA 3QIPA 4FLTA 1ZBLA 3U3YA 4DSJA 3THVA 1XC9A 2IDOA 3OYAA 1XWLA 5KRSA 3JSMA 1QTMA 2F8SA 5CYMA 1T03A 3O3HA 4DFMA 1WAJA 3RMDA 4CF9A 1TVRA 3RRHA 1SV5A 3PV8A 4EP5A 2OZSA 3SPYA 4CFAA 4CGDA 1JLFA 5KTQA 3SQ4A 1QE1A 4RW8A 1U49A 3V9XA 3TAFA 3AV9A 4BWJA 3LZIA 4M3XA 3NF9A 4M3ZA 1O1WA 4B9MA 2BANA 4TSXA 3LPTA 2QK9A 4HTUA 4O0IA 3DRPA 4IG0A 3DOLA 3QEWA 1UWBA 2HHQA 2BGGA 4UQGA 4AHRA 2YNHA 2JLEA 2HHTA 1YT3A 1DTQA 3NF7A 3IRXA 3LANA 3RRGA 4I2PA 3SQ1A 3MEDA 4E7HA 3DRSA 5J2MA 3DMJA 3HYFA 3SUPA 3F9KA 3QERA 4B9VA 1QQCA 3P1GA 4CJSA 4CGGA 3ULDA 2KQ2A 4DU4A 3RR8A 4KTQA 1CZBA 2F96A 4KI4A 3V81A 3VQAA 3PUFA 4E7LA 4E1NA 3KLGA 3EY1A 5HP1A 3AVAA 3K59A 2Z1IA 5FDLA 4DG1A 5HRRA 1BI4A 3VQ5A 3ZSRA 4M41A 1TKXA 1VSDA 4E7JA 2YNFA 2HW3A 4CGJA 3IAYA 3L3VA 4KFBA 3L8BA 3NH0A 4PUOA 1ASUA 4FJ8A 3SNNA 4C8OA 3DI6A 3IG1A 2VG6A 3KIOA 2GV9A 3TI0A 2G8KA 3V1RA 1SUQA 1VRTA 4LH4A 4J2BA 3SUQA 2G8FA 1SKWA 3QEVA 1KLNA 4FLYA 3OYLA 3H08A 4DS4A 4HCBA 5KGXA 3AA3A 3BGRA 3K58A 1L3SA 4FM2A 1BGXT 1RNHA 5I42A 4KHQA 2O4GA 3E01A 1CXUA 1K6YA 3P83D 1HNVA 2Q3SA 2IS3A 4CJUA 3VQ6A 3ZT1A 3K57A 1NK9A 3D45A 2KZMA 4PQUA 3K5OA 1UOCA 4N5SA 3KKSA 3KD1E 4K8ZA 3AVJA 3AA2A 3L2QA 4LSLA 3ZSYA 4H4MA 3HM9A 4DSLA 1RDBA 1RT7A 2NUBA 4YNQA 5C42A 1J5OA 1BI4B 3OYEA 4B9LA 3HPOA 1QSLA 5SZTA 3WNGA 4IFVA 3G10A 2P1JA 1QSSA 4XIUA 1Q9XA 4Z0UA 3EZ5A 4KB1A 1RT5A 2HNYA 4B8AB 1U48A 1LWEA 2QKBA 3K2PA 4NYFA 4O5BA 3LP3A 3MXMA 1XI1A 1NK7A 4DQPA 3DM2A 3LP1A 4FJHA 3M8PA 3MEEA 4NYNA 3CFPA 3TWHA 4HUGA 1S9GA 4RW4A 3SPZA 4C8KA 4EZ9A 3KLIA 4OKEA 3V9SA 4ZTFA 4DTRA 1IG9A 1VSHA 1BISA 1W9HA 1T8EA 3RMBA 1VSIA 2HHSA 1XHZA 3DLHA 2IAJA 3S3OA 3ZSZA 3AO5A 1WSIA 1NKEA 3ZT0A 4CIGA 1S9EA 4AHCA 4FM1A 1VSFA 2X6NA 1X1PA 2X78A 1REVA 2RF2A 5J1EA 3OYHA 1TL1A 1UA1A 3K5LA 5HRPA 3T3FA 4FJGA 1D9FA 4N41A 1GOAA 3C6UA 4CEDA 2OYQA 3O4NA 2G8VA 4IKFA 2OPRA 2ITGA 1A5VA 2R7YA 3FFIA 1NJZA 4AHTA 2VWKA 3LZJA 3HVRA 4CEQA 1RBVA 4PWDA 3LAKA 2YKMA 2VWJA 4B9UA 2GUIA 5HROA 4BDZA 4DWIA 4OKJA 4ZHRA 4O0JA 3ZT3A 1X9MA 2HVIA 1C0UA 1KLMA 3ITHA
chains in the Genus database with same CATH superfamily
4OLAA 5HL7L 4BG9A 2Z1GA 2GX9A 1HR0K 1EETA 3HRGA 4KHNA 1Z05A 2Q0UA 1W7AA 4YY3K 4CGIA 1IG8A 1B92A 1QHTA 3AO3A 3SLCA 1YI2N 1TK0A 5KRTA 1YF5L 5CHIA 1R59O 4FXDA 1BCOA 4CF8A 3LWMA 4M3TA 4DV4K 3ENOA 2YHAA 3OW2M 3VQ4A 1D8YA 2RN2A 3G4SN 2NLXA 3K9JA 3A5LC 5KQ8A 3V1QA 2ATQA 2E6LA 4IFYA 5AQGA 3C94A 5AZIB 4BRKA 3HP9A 4C8MA 4BGAA 1L3UA 1J6ZA 1XHXA 3QESA 5J2NA 4RW7A 3R8EA 2E1YA 5AQTA 3AVBA 5GIOA 4CBUA 3MWPA 1YITN 5JMVA 3MN7A 4CIFA 2P5OA 4FW1A 3ZCMA 3VPZA 4FYDA 1HUXA 2IVPA 1JXBA 2HBMA 4DFJA 3HBTA 2A40A 1U2VB 1WAFA 3M1FA 4ELVA 1LWCA 1A5WA 3PY8A 4CEEA 4Q5VA 1S1XA 3THYA 2QM1A 4YORA 3AGKA 5A2QO 4CHYA 1ZBSA 1WNSA 4B9QA 4CJLA 1X3MA 3TSQA 2FBXA 3G6EN 1T05A 4H0OA 4YOYA 1B9DA 4IG3A 2YI1A 3LDQA 5AQYA 3NGYA 1KD1O 3VQQA 2V7YA 2GUPA 3VA0A 1NGDA 2ZJPL 4RTFD 4PKHA 3CCEN 3W3DA 3O5BA 4IEEA 3THWA 4FJIA 2KLAA 1IBLK 4AM7A 5M1PA 5AQOA 3OYMA 3V1OA 5M1KA 2O8BA 2PZSA 1VSJA 5C0YA 4DV5K 2ZE2A 3M6GA 5ADXA 3CCUN 1YVUA 1JL2A 4IWVA 4A59A 3OYCA 5C25A 4F4KA 2D0AA 3LAMA 3VEVA 4JRPA 2HB5A 5AQZA 3VF6A 2HHXA 4H0VB 1YXQA 3VETA 4O8KA 1RTDA 2ASOA 3CPWM 1GLDG 4Z4IA 1FKOA 2YHWA 4RCHA 3DLLL 3PX4A 5HRSA 3DLGA 1ZBIA 3M8SA 4B3MK 4YDUA 4FJKA 4RW6A 5GIPA 1RDWX 4BR4A 1S1VA 4CJ7A 2P5GA 4HUEA 3L3UA 1HRHA 4N47A 4H0YB 4FPBA 1OKJA 5LJWA 4X64K 4YFUA 3NGZA 4B1UB 4CK1A 1BUPA 5C24A 1L3TA 2WC9A 1NK8A 3CC2N 4IBNA 4CZKA 2Y1JA 3WNFA 3BZCA 4CESA 2WTUA 3VGKA 3AVIA 3AO4A 3U3GA 4JKGB 1K73O 3QFPA 5AQIA 3T1HK 4X62K 1NKBA 2OPPA 4FCYA 1RDDA 1U45A 1ASWA 3PIPL 2O8DB 2VG5A 3AA4A 4ISGA 4W5OA 4BRPA 5HBMA 3VF2A 3S3MA 3QNOA 3CD6N 1VSEA 4K25A 2D0CA 4IJNA 2BDPA 1KAZA 1SKRA 1NU0A 4M45A 3G0ZA 4BC2A 3OYIA 3O80A 2ZJQL 3LDNA 5FRNA 3SJHA 2YJFA 3J8AA 3MN5A 3PX6A 2FXUA 5FPMA 1QSYA 4EHTA 4M3UA 4DTSA 5AR0A 5LMNK 4DR7K 3CC7N 1GOCA 4DR4K 4DV6K 1XUPO 4E7IA 5AQVA 2E2QA 4OKKA 1L5UA 2CGKA 3AA5X 3EE8A 4CHZA 4LH5A 3T69A 1GLAG 3IKMA 4FK0A 2GBZA 2H3GX 5I9EB 3S9HA 3CJCA 2W42A 4AHSA 1KSPA 4WYBA 2B6AA 3VF4A 1WSEA 3OJUA 4CBWA 1IV0A 5KPZA 4DTXA 2Y1IA 1GLBG 3CJAA 3BZKA 3LM2A 5CY4A 4FWQA 5JS1A 2DFEA 5KI6A 4R5PA 2I7NA 3EO3A 2FC0A 4A57A 1NM1A 2XO7A 3C6AA 1WSGA 1SL0A 5AZJB 2HF3A 2KHOA 1JKHA 1VHXA 4UY8O 3CCLN 2E6MA 3BY5A 4OPAA 1NK6A 4HHTA 3KD5E 1IKWA 1BHLA 5DK5A 4CJTA 1IBMK 5GADP 5KPTA 4KRFA 3C95A 3FZFA 1EQYA 4WE1A 3ZSWA 5BR9A 2X74A 4FJ7A 4OLBA 3G71N 4DSIA 3LALA 4GVMA 3VN5A 3JYTA 1TUYA 4CZHA 3ZETB 1NGBA 3TAQA 3GL1A 3J7YP 3CYMA 4E3SA 4DUYK 4N56A 3KTQA 3WXIA 1VQ9N 4CJWA 3BF1A 4HVJA 3MMVA 4BC4A 3AVNA 5B8HA 2YHXA 1EXQA 4BE2A 1X3NA 4BQLA 3A0IX 3U6FA 1D5AA 3ZSXA 3KK2A 4LF8K 2IOCA 1LAWA 1DKGD 4JHDB 4I6MB 1C1BA 1RDCA 2UUBK 2P51A 4CF0A 2P9UB 3AVGA 3VGMA 2XY5A 5DMRA 2E2NA 4DV3K 4C23A 3OYKA 3AAPA 3U3YA 3OYAA 1XWLA 4BRGA 5JLFA 3NVMA 1WAJA 1FW6A 3RMDA 4CF9A 2OZSA 5EVZA 3SPYA 2GWKA 3AV9A 4BWJA 5M1NA 2BANA 3LPTA 4WCEL 2GWJA 2HBJA 3C65A 1UWBA 2HHQA 4UQGA 4JI5K 3O1WA 1YT3A 3LANA 4I2PA 3ID6A 5H1SQ 5J2MA 2O8BB 3E9LA 3F9KA 4B9VA 1QQCA 3RR8A 4CZMA 4E1NA 5HP1A 3TPQA 4JKHA 3IDHA 5HRRA 1BI4A 1HNZK 3VQ5A 4M41A 5BN9A 2UXDK 3IAYA 1HKGA 4FOIA 3IG1A 4CD1A 1VRTA 4BG8A 1SKWA 5LY3A 3CCMN 3H08A 4DS4A 4HCBA 2O8DA 3AA3A 3BGRA 3K58A 4B1YB 1KQSM 2Q0RA 3QFUA 4M7YA 1RNHA 4FM2A 4DR2K 3CCSN 4U67L 1K6YA 4BR7A 4YOWA 4WFBL 1HNVA 2E2PA 2IS3A 1XNQK 3ZT1A 2ZGZA 5JLHA 4N5SA 3KKSA 3WXKA 1Q81O 3KD1E 3A8YA 3AVJA 3L4QA 3ZSYA 3HM9A 4DSLA 1RDBA 1RT7A 4PL8A 2PAVA 2UXCK 5AQKA 4IOAL 3TU5A 5M1QA 2QKBA 4PL7A 4JKCA 4NYFA 3H3NO 4DQPA 4JI6K 4FJHA 5GINA 3I55N 5CR4A 4H03B 1S9GA 4C8KA 3ATUA 4FVUA 3NMUA 3RMBA 3H1VX 1K9MO 4OO1J 1XHZA 3MN9A 3S41A 1NKEA 5D3GA 3ZT0A 2Q97A 1X1PA 5J1EA 1REVA 3K5LA 4FJGA 1D9FA 3C6UA 1M90O 3L6QA 1XNRK 2G8VA 2OPRA 1Q86O 3LZJA 5BREA 4PWDA 4YDUC 4BDZA 4JI7K 4O0JA 3Q7CA 2P9PB 1SKSA 4M42A 4BE1A 5JVGL 4KHWA 4BR9A 3DXMB 4H5VA 2CH5A 1QZ6A 4B1XB 3KJVA 4ILGB 4MLEA 5J2PA 2ZWHA 3V9UA 1XMQK 1S1UA 2KFZA 1T44A 5KGWA 1J9AA 3MN6A 1RDAA 3MXJA 2WONA 1QVFM 3D2FB 1IKXA 1MU2A 1O13A 4PKGA 3VQ9A 4CJVA 4H5RA 3SQ2A 2XRIA 3SMSA 4PY5A 5GAGP 3OVNA 4DTNA 3KVGA 4E7KA 2OTLN 2Q31A 4LY7A 4DSFA 3QINA 1YUWA 5AQJA 2G8HA 4B3TK 1BL3A 1NMNA 2JWLA 4W5RA 4KO0A 3ID8A 3VQPA 1XC3A 4H8KA 1T6DA 4Z94A 2YNIA 3PX0A 1HQEA 1YJWN 1BCMA 2CGJA 4DV2K 1SL2A 4EP4A 1I3AA 1M1KO 4CFCA 1I94K 2W6LA 1DEJA 2F4VK 3GDQA 4OPKA 2NRWA 5GAHP 4JI8K 3MK6A 3KKRA 3HL8A 3AVHA 1WOQA 3QEXA 1EP4A 2E1ZA 1ZXOA 3SUOA 4B08A 3NHGA 1MWKA 4IJAA 3NCIA 2A41A 3ZT2A 4AH9A 3G25A 1BA0A 1ZBHA 3QB0A 4CHOA 1IKVA 3ASMA 3UKUA 4C1NK 3CMEN 4JI3K 3NF6A 2QI2A 3OS1A 2VQEK 3O9RA 5AQXA 3CJ1A 4JHDA 3ZX3A 4BRMA 4GMJB 5FPEA 1BIUA 1VQON 1SL1A 3VTIA 1BA1A 3GE1A 4DQIA 1C0FA 4QOZB 4CGFA 1WBDA 4CJRA 4K0KK 3AO2A 2O8CB 5AJ3K 1BQNA 4RW9A 3CM6A 1R0AA 4C8LA 3O6WA 3TSPA 1KFDA 4KV8A 4B1ZA 4DF8A 3WEEB 3CCRN 1N8RO 3HOTA 3WNHA 4Y1DA 3QETA 4W5NA 1X9SA 4WQ5A 4BDPA 3HTVA 3RVCA 4ZTJA 4E0DA 2Z1JA 3CJ7A 1ESVA 2PYJA 4BRDA 1QZ5A 3IMXA 1ATRA 2VWBA 4B3SK 1E3MA 2HBKA 3T19A 3L0QA 4HWIA 3M8RA 3NGIA 4OX9K 1S6PA 3TABA 4ILHA 1RFQA 1VAZA 4DF4A 1C6VA 1RTJA 3WXJA 1YTAA 4DLEA 4JRQA 1OVQA 2UUCK 1TV6A 4KTZA 4FK4A 1N5YA 2OPSA 1JLQA 3VEZA 2DTUA 3HPGA 1HYVA 4JS5A 3THXA 1Y64A 4FZXC 2YKNA 4F2SA 4JI1K 1VQPN 3QBXA 2IGIA 5LJVA 3J80O 4FJ9A 1NK4A 1E4FT 3UB5A 2FBYA 4HUFA 2XHBA 2CH6A 2FF6A 2CGLA 4NB4A 1TAUA 2EHGA 3CHWA 3CM5A 4Y1CA 2JGUA 4I9QA 1MDUB 4GW6A 4FWKA 3MAQA 4Z4EA 1XQSC 4KI6A 1NGIA 3VQBA 5FROA 4H0XB 1IBKK 3DLBA 1VSKA 4CCHA 1S5JA 4BROA 4IO8A 1RT4A 2D0PA 4KHUA 3VQDA 4E19A 2A5XA 2WUSA 4Z4FA 5AQUA 1F21A 4CD3A 3OS2A 1JLGA 1OH6A 1NNEA 3SV3A 2NRTA 3B6OA 4B3OA 4NCBA 4X65K 2QWOA 4CHQA 3PO5A 4DQ8A 3LWLA 4BRCA 3DYAA 3CJ9A 3OBYA 3WXLA 1NK5A 3O8MA 4ELUA 1NK0A 5AQRA 5AFUH 4BRFA 4BR2A 2ASPA 2O8CA 3MWTA 4FJLA 5BPMA 3HI0A 1U6ZA 2YX6A 1JLCA 2FSKA 1KVCA 4LF9K 2Z1HA 4AHUA 5M1FA 1KAXA 3VOVA 1EO1A 2HHUA 4FLUA 1NMDA 5IT9O 4L3QA 3H6EA 3BDPA 2V51B 3C7NA 5AFUA 2DFFA 4CJQA 4FJJA 3E9OA 2QXLA 1V4TA 1EWRA 5AQQA 4ILJA 3GBTA 4WFAL 1C0GA 2PFUA 4K41A 3H1QA 3CCJN 1YIJN 4CFBA 4BREA 4KB0A 3C7NB 5I3UA 4JKDA 3SI6A 1RBRA 4GNIA 4BC5A 5BRDA 4Q0BA 1KCFA 4Z4CA 2VG7A 3TTCA 4H4OA 3VQ8A 4X66K 4DFKA 5E84A 3ALYA 3EKSA 2P9KB 3ZSOA 1C0TA 3F2KA 3KK3A 1BOTO 4E1MA 1Q8IA 1TAQA 3WUHA 1RT3A 4A2BA 4JD2A 1W2BM 4FWLA 3HSTB 4MFBA 1H1VA 3A5MC 2JWKA 3SAGA 3CG7A 3O9UA 4BRQA 4CHNA 3ZSQA 1Y97A 2ZQBA 3Q7BA 4RWTA 1VQMN 2UUAK 3WXMB 1KVAA 3QLHA 4KH5A 1ZBLA 4DSJA 3THVA 1QTMA 2F8SA 5CYMA 1T03A 4DFMA 4YOXA 1TVRA 2P9NA 4LFBK 5IWAK 4CGDA 1QE1A 1U49A 2ITMA 3NF9A 3DXKA 4B9MA 4TSXA 4HTUA 4O0IA 1E4GT 3FZKA 4FWSA 4IG0A 3QEWA 4DR1K 2YNHA 2JLEA 2HHTA 3IRXA 3SQ1A 3MEDA 3DMJA 2ZGYA 4JK7A 3QERA 4KTQA 3P1GA 4CGGA 3H45C 4KI4A 5BRFA 4E7LA 3U8XA 3AVAA 5FDLA 3MDQA 4FWPA 3ZSRA 4E7JA 3R6MA 3MX2A 4FJ8A 2NRRA 2A3ZA 4AM6A 4EAHD 2G8KA 3V1RA 3MX5A 1KLNA 4FLYA 3CETA 4DV7K 4F9OA 2RE2A 1N32K 1BDGA 4KHQA 2O4GA 2IVOA 3E01A 1CXUA 1K8KA 5MLCQ 4LF4K 3SAFA 3VQ6A 3ZX2A 2KZMA 3C6HA 4K8ZA 3AA2A 3L2QA 2NRHA 1P8ZA 3GOIA 4H4MA 5JVHL 1YAGA 4YNQA 2OTJN 2V52B 4YHHK 4B9LA 1QSLA 5SZTA 1MWMA 3WNGA 3JXUA 4XIUA 2HNYA 4O5BA 3CCQN 3LP3A 1NK7A 4O5FA 3DM2A 3EN9A 3LP1A 4EIAA 3M8PA 3OA9A 4MDBA 2FF3B 4NYNA 4OKEA 4ZTFA 4DTRA 2BUPA 2FSJA 2P9NB 1VSIA 2HHSA 4DV1K 2F8TA 4BR5A 1VSFA 3OYHA 2A6AA 1TL1A 1UA1A 3O08A 2FSNA 3AGRA 4JK8A 2ITGA 2R7YA 3BUZB 4WQ5C 1GLLO 4CEQA 2YKMA 2VWJA 5EXWA 5HROA 3ZT3A 2HVIA 1T3VA 2E5LK 1BG3A 3CMAN 5TKYA 3ZLJA 2D0BA 1T7PA 4O55A 1HLUA 4DTJA 3VA3A 4BRLA 4DHYA 3MEGA 4PA1A 1HPZA 4WFNL 1U2VA 1RT2A 4KH6A 1CLQA 4FLWA 4I9LA 1ITGA 3NAEA 1I39A 4OVLA 4OGCA 1D9DA 5DM7L 3LP0A 4Z4HA 4JI4K 1K8AO 3P5JA 1QQMA 2ASMA 4FLZA 4XH5A 4IOXA 4DTUA 1ATNA 3KWIA 1JXEA 1YTUA 1VQKN 5AZIA 1RTIA 3SYZA 4DKWA 1TL3A 2IIRA 1BIZA 4A5BA 4DQRA 3K5NA 1TKTA 4AF1A 1WSFA 1EWQA 2PYLA 4DSKA 5AQLA 1GOBA 2W40A 3OYJA 5CYQA 5FRMA 2YCHA 3I0RA 4CEAA 3WQTA 4JNEA 2KKZA 3ZEUB 3TTFA 3ZETA 4CZLA 4JKFA 4CK3A 3TARA 4HCCA 1EKEA 3FZMA 3V9ZA 3B6PA 5M1OA 4MQ3A 3CFRA 1S22A 1U4BA 4CJ3A 1FKPA 3JAMO 5ADXH 2HMPA 4JKGA 3O4WA 1WBBA 1GLJO 3ZT4A 4E89A 1CZAN 4CFDA 2FLOA 4JK9A 4K43A 4GV6A 4DR6K 1XMOK 5GAEP 4DSEA 1IO2A 1GLFO 2QWMA 4XH4A 2GEMA 1FXXA 3OYDA 3SZ2A 4FJ5A 3H3OB 4BGBA 3SAHA 4DLGA 2XY6A 2YNGA 4QS7A 1ZBUA 2I7PA 5ELZA 3HXMA 1SQKA 3AVMA 2QWRA 5CZ1A 4F2RA 4GKKK 1YJ9N 3HJFA 4JI0K 1J54A 2DY4A 4FWOA 3U9DA 1Z26A 4GVEA 1KVBA 4A2AA 2NRVA 4FZYA 2B5JA 3DJCA 4I7FA 2FBTA 4ELTA 4LC9B 4F8RA 2E4LA 4DQQA 2QW9A 1U04A 1RTHA 2G8IA 1IKYA 3RR7A 3OS0A 2ZM6K 3LP2A 4GV3A 4G1QA 3MXIA 3AVFA 1G99A 1UA0A 4MO5A 3EZWA 4BQZA 4N76A 3LDOA 1RILA 2QTDA 3THXB 3KLHA 3OYNA 1U47A 4GKJK 3THWB 2YHYA 3PO4A 4M3RA 3EYZA 3J81O 2P9IA 1C1AA 3ENBA 3V9WA 4ISEA 4B1WB 2LSNA 4B1VA 1N33K 3F5TA 1ILYA 4M7XA 1NJIO 4MO4A 3T7ZA 3VTHA 3OJSA 4FL9A 3OHRA 3A2FA 4LF5K 3SCXA 3NVKA 3MECA 4RG8A 2O8EA 4OJRA 3DAWA 3K9KA 3DOKA 5KPRA 3RSEB 3TAPA 4FJNA 4CJFA 5TKWA 1LW0A 2FBVA 1TK8A 4BC3A 4FLVA 3C0BA 4NXMK 4JI2K 4B9TA 1YVNA 2O8FA 4EHUA 1VQ4N 3O4QA 3HK2A 3ZX0A 2NRZA 3LDPA 4CK2A 2F9WA 3OYFA 2D5RA 4H0PA 5SWMA 3FGUA 4G9ZA 4LSNA 4DTMA 3P31A 4ICLA 2YJEA 3AY9A 1NBWA 2ETJA 3HT3A 3HM8A 3RMCA 3AAQA 4KBOA 1ASVA 3CFOA 4M3YA 1NJYA 3TAMA 3M5RA 3T1YK 4I6MA 4HTLA 4FWMA 1KXPA 2EX3A 4FJXA 1JLEA 2BE2A 1ZYQA 3V6DA 3J7AP 3NFAA 2HVHA 3HSCA 1RT6A 2YV0X 4QS8A 2HF4A 4WF9L 1NGEA 2HNZA 3GG4A 4J2AA 1CZ9A 2HMIA 4F3OA 3SMPA 2RKIA 4CE9A 1EX4A 1P90A 4CECA 4DCHA 1NGFA 4CZEA 1SAZA 4KHYA 3D6RA 5BR8K 4BVPA 3C6TA 4KAZA 2O8EB 2BTFA 3ZEUA 5FLXO 3CI5A 1A5XA 2HSTA 4CI6A 3TAEA 3VQEA 3U9ZA 4H0TB 1N36K 3DXKB 4YOUA 4CEOA 3CJBA 1NWKA 2AA4A 3RSEA 3O3GA 2WBNA 3QEPA 3R3LA 4QCLA 1NG9A 4CIEA 1NJXA 5CZ2A 3L2UA 3RMAA 1HMVA 1Z25A 4OGEA 4CF2A 2P9IB 1BU6O 4LF7K 1QQOA 4IDHA 4JN4A 4EFHA 2QWLA 1G15A 3D2FA 4BE0A 2ZD1A 4CVNE 4MLHA 3CPEA 1VQ7N 2G8WA 4O4GA 4WQ4C 1RGIA 3THYB 1KFSA 4W5QA 3V4IA 1WSHA 4FW2A 4Z4GA 2P9KA 3CERA 1TKZA 4XH1A 4QS9A 3AO1A 3R1XA 5AQFA 1BWFO 3SBGA 3CQ8A 4E1JA 2RPIA 4B9SA 4JD2B 1T6CA 1RBTA 2E20A 1JJ2M 3ZYYX 4FM0A 1TKDA 3LM9A 1HJRA 3UE5A 5BPNA 3D0PA 4A61A 1JLBA 3O1BA 3ULEA 1GLEG 2IDOA 4FOEA 3DWLA 2D4WA 3RRHA 1SV5A 2OCEA 1JLFA 1GLCG 1VQ8N 3V9XA 3TAFA 2VGNA 1S72N 3LZIA 3WT0A 4M3XA 4IZ9A 4M3ZA 1O1WA 3H46O 2QK9A 4IO9L 2E88A 2BGGA 4AHRA 5EX5A 4E7HA 3HYFA 3SUPA 4CJSA 3ULDA 3TTDA 1OH7A 3KWGA 1CZBA 3V81A 3PUFA 3I8BA 3EY1A 3FZHA 2Z1IA 4DG1A 4IFEA 1TKXA 1VSDA 2YNFA 4PHTX 4BR0A 4CGJA 1WB9A 2HW3A 3L3VA 3L8BA 4PUOA 1X9JA 3DI6A 2VG6A 5JICA 3J7ZO 3SUQA 2G8FA 1NLVA 3IFRA 3OYLA 3EEQA 3L4IA 3P38A 4JKAA 1BGXT 1N34K 2F9TA 3P83D 3K57A 3D45A 5EY4A 1NGAA 3K5OA 4LSLA 5HOOA 4CZFA 2HOEA 4YOTA 1J5OA 3HPOA 1ATSA 4Z0UA 3EZ5A 4KB1A 3E66A 1U48A 4GY2B 2BH1A 4Y0WA 2J4RA 5EOYA 3TWHA 4EZ9A 3KLIA 1VSHA 1BISA 4JV5K 3DLHA 1VQLN 4CIGA 1S9EA 4FM1A 2RF2A 5HRPA 3T3FA 1GOAA 4CEDA 3O9QA 4V19S 3O4NA 1OVYA 1A5VA 3FFIA 2HBLA 4JKBA 3EE9A 3HVRA 3LAKA 4B9UA 3FLCO 2P9UA 4NO7A 4FO0A 4H5TA 1KLMA 4KHPK 4IDKA 1VSMA 5AQMA 3P39A 5AQHA 3R9PA 1S1TA 3VESA 4DR5K 3PSFA 4I2QA 1S3XA 1V4SA 3AARA 4DS5A 3QBWA 4NCGA 3M3ZA 1DGKN 3QMLA 3N4QA 3FR0A 2Q36A 3UIQA 4BVOA 1X9WA 2KFNA 1NGGA 3I8DA 2F7TA 3HVTA 3ISNC 3TAGA 1IH7A 1S1WA 4DR3K 3VEXA 5C10A 3DRRA 5J2QA 4FWNA 2UXBK 3OY9A 3L2VA 3LDLA 4BRIA 4JYAK 1LOTB 4J8FA 3OBWA 3T1AA 4LD0A 3I56N 2QKKA 3EL2A 1RDUA 4AHVA 3UKRA 2A1RA 5AQPA 4KREA 4IXCA 4CW7B 3NF8A 2PY5A 4CEZA 4KPYA 5EU7A 4NLCA 3KLFA 2PBDA 1WSJA 4J2EA 3SV4A 1LV5A 4FSVA 2KZZA 5E41A 3QNNA 1HJOA 2VYPA 3DLRA 1HKBA 3VQCA 2QXFA 4NLBA 4CF1A 1TK5A 1HNIA 2HHWA 3HO1A 3IUCA 1LWFA 2I5JA 5F2RA 1RBSA 4CGHA 1LW2A 2A1SA 4BDYA 4DU1A 3I33A 4KKOA 3VEWA 2Q2RA 1HX1A 1SZ2A 3OTOK 3BF3A 2OA8A 2VQFK 2XY7A 2O8FB 3NDKA 2VCPA 2W6KA 5AQNA 3F73A 3U4LA 3CQYA 4DQSA 3AVLA 1Q82O 5LMUK 4QAGA 4L8RB 1TYQA 5JS2A 1KC8O 2OANA 5T7BA 3WNEA 1Q18A 4DB3A 1DTTA 1NGCA 3CIPA 5BRHA 1ZBFA 2A42A 5C2DA 4CEBA 1VK0A 1OH8A 3O3FA 1KTQA 4BWMA 2NRXA 3VERA 4MDAA 1JL1A 4F3TA 3FZLA 1S6QA 3SUNA 3VEYA 2P9SA 1NOYA 4JS4A 2OPQA 3CF5L 5HRNA 2QWQA 3JS6A 4OPJA 3KK1A 1L3VA 3HOSA 4CJ4A 4CJEA 3KZBA 1HQUA 4M63C 3PIOL 3VGLA 4C8NA 1YHQN 4DMNA 4CJPA 3RTVA 4DU3A 3VENA 1TUUA 4LFAK 3CCVN 2QEXN 4DTOA 1TYQB 1HNXK 3ATVA 5DM6L 4H5NA 4ID5A 3E9PA 4WQ4A 4BRAA 4W5TA 3L2RA 3DXMA 3QO9A 3KLEA 2KTQA 1J53A 3SJJA 4M3WA 3LDSA 4FK2A 3BEXA 1JCGA 3S3NA 1W0HA 4LFCK 3NE6A 2OZMA 3QICA 2YHBA 2X6SA 4KTWA 2O4IA 5CE3A 4CHPA 1QQNA 3DLKA 1K8KB 4EZ6A 4NCAA 1DT9A 5E26A 5FPDA 1JLAA 1JCFA 1WN7A 2KW4A 2XY8A 4DV0K 2V7ZA 2G8UA 3QEIA 1CXQA 3OYGA 4LF6K 2HHVA 3QIOA 3UKRB 5FPNA 3WQUA 1BO5O 1C1CA 1HNWK 3ULEB 4FZZA 4J2DA 5LL6Z 3LPUA 1B9FA 3NH1A 4BRHA 3TANA 1Q7YO 1WUAA 3I0SA 4FVMA 2VGMA 4H5WA 4B9NA 4BY9C 1WLJA 3VEOA 3D2EB 4CBXA 3LL3A 3FE1A 2IVNA 4KHSA 1SS6A 1RBUA 4CJKA 4FJMA 3M8QA 2P9SB 5K14A 4NXNK 5HLFA 4AQYK 2GELA 2QWPA 4CERA 5BPLA 3RWUA 1TGOA 4XEIA 1NJWA 1QVGM 1VSLA 4JEPA 2QWNA 4BACA 3HP6A 4DTPA 4FLXA 3MCAB 1QS4A 4DFPA 3NBPA 3VQ7A 4O8UA 1HKCA 2IC3A 4O44A 4FWRA 1KAYA 3K5MA 1NKCA 4CJ5A 1RCHA 3B8AX 3TR8A 3NH2A 5AQSA 1UAXA 3N4PA 3O9TA 4IEIA 4AILC 2UYTA 1Q9YA 2AJQA 2DFHA 4JLHA 1C0MA 1FK9A 5AQWA 2AP1A 1LAVA 2P9PA 4PKIA 2B4JA 1NOZA 1RT1A 1HYZA 2Q1NA 1VRUA 2WOMA 3EKUA 4A5AA 1BQMA 1VQ6N 1HYSA 3O9SA 5BN8A 2GTDA 5KQDA 4B8CA 3MCPA 1JCEA 4BRNA 4OPHA 3CXCM 3AVCA 1NGJA 1VQNN 2HNDA 4YOVA 3A5OC 3IS9A 3P4IA 1MA9B 1KRPA 3OYBA 3D2EA 3DLEA 3D7EO 4A62A 4K8XA 3PLAA 3ENHA 3WEEA 3SQ0A 4ID1A 4CEFA 3ZSVA 4B3RK 3AVKA 1DLOA 3HPHA 4ISFA 3L2WA 3QIPA 4FLTA 2E2OA 1XC9A 3KHYA 5KRSA 3JSMA 1J5EK 3O3HA 2RHKA 3QDKA 2NZTA 2QA4N 1IJJA 3PV8A 4EP5A 5F0XA 1YJNN 4CFAA 3SQ4A 5KTQA 5C2FA 3SBTA 4RW8A 5C15A 5AZJA 3DRPA 1NGHA 2UU9K 3DOLA 4FPAA 2HHHK 2E8AA 1DTQA 3NF7A 3RRGA 3DRSA 2NNWA 3UKUB 1VQ5N 4DU4A 2KQ2A 2F96A 3VQAA 3A5NC 4CZGA 4JKEA 3KLGA 1D4XA 3K59A 3CC4N 4DUZK 2ZJRL 2WFBA 4KFBA 3NH0A 1ASUA 3SNNA 4C8OA 3KIOA 3TI0A 2GV9A 1SUQA 4LH4A 4J2BA 5F1XA 1OH5A 3QEVA 3W0LA 5KGXA 1L3SA 4CZJA 3PSIA 2W41A 5I42A 2D1KA 4C1NI 4CJUA 2Q3SA 1NK9A 1W97L 4R79A 4PQUA 3HZ6A 1UOCA 2P9LB 1Z6RA 4IOCL 1ZC6A 2NUBA 5C42A 1LCUA 1BI4B 3OYEA 3CQXA 3F9MA 4IFVA 3G10A 2P1JA 1QSSA 1Q9XA 2ZF5O 1RT5A 4B8AB 1LWEA 3K2PA 3K0SA 3MXMA 1XI1A 2DPNA 3TSUA 2EWSA 1HPMA 3MEEA 3CFPA 4JAXA 2P9LA 4HUGA 4RW4A 3SPZA 3V9SA 1IG9A 3FFKB 3E1YA 1W9HA 1T8EA 1FJGK 3KK7A 4GV9A 2IAJA 3S3OA 2D0OA 3ZSZA 3AO5A 1WSIA 4AHCA 2X78A 2X6NA 1N6QA 4N41A 1QHAA 4KH4A 4U7BA 3BP8A 2OYQA 3VMFB 4IKFA 1NJZA 4AHTA 2VWKA 3SK3A 5C12A 1RBVA 2GUIA 4DWIA 4K42A 4OKJA 4CZIA 4ZHRA 1X9MA 1C0UA 3ITHA
chains in the Genus database with same CATH topology
2D0BA 4OLAA 4IDKA 1T7PA 1VSMA 1SKSA 4O55A 2Z1GA 4M42A 4DTJA 3VA3A 4BE1A 1EETA 4KHNA 4KHWA 1S1TA 3MEGA 4I2QA 4PA1A 4CGIA 1B92A 4DS5A 1HPZA 1QHTA 3AO3A 1RT2A 4NCGA 1TK0A 1N6QA 5KRTA 1CLQA 3KJVA 4FLWA 4FXDA 1BCOA 4I9LA 4CF8A 1ITGA 3LWMA 4M3TA 3UIQA 1X9WA 3NAEA 5J2PA 1I39A 2YHAA 4OVLA 4OGCA 3V9UA 1D9DA 1S1UA 2KFNA 2KFZA 3I8DA 5KGWA 3HVTA 3ISNC 2RN2A 1J9AA 1IH7A 3LP0A 3VQ4A 4Z4HA 1S1WA 3TAGA 1RDAA 3MXJA 3DRRA 3V1QA 2WONA 2ATQA 1IKXA 1MU2A 2E6LA 4IFYA 3C94A 3P5JA 3VQ9A 4CJVA 3HP9A 4C8MA 5J2QA 4FLZA 1L3UA 3OY9A 4DTUA 1XHXA 3QESA 3SQ2A 2XRIA 3L2VA 4RW7A 5J2NA 4PY5A 3AVBA 1JXEA 3OVNA 4DTNA 1YTUA 1RTIA 3T1AA 4LD0A 4E7KA 2QKKA 3SYZA 4AHVA 2A1RA 1TL3A 4LY7A 1BIZA 4DSFA 4KREA 3QINA 3NF8A 4DQRA 2PY5A 4CEZA 4KPYA 3K5NA 1TKTA 4CIFA 2P5OA 4FW1A 5EU7A 2G8HA 3ZCMA 3KLFA 1WSFA 1BL3A 4FYDA 1WSJA 2PYLA 4J2EA 4DSKA 4W5RA 1GOBA 3SV4A 4KO0A 3OYJA 1LV5A 2KZZA 5CYQA 5E41A 1JXBA 3I0RA 3VQPA 4CEAA 4DFJA 1WAFA 3QNNA 4ELVA 5FRMA 1LWCA 3DLRA 4H8KA 1A5WA 3PY8A 4CEEA 4Q5VA 1S1XA 2YNIA 3VQCA 2QXFA 3PX0A 4CF1A 1TK5A 1HNIA 4CHYA 2HHWA 1HQEA 3HO1A 1LWFA 1WNSA 2I5JA 4CJLA 1RBSA 4CGHA 1BCMA 2FBXA 4CK3A 3TARA 1EKEA 1I3AA 4EP4A 4CFCA 1SL2A 4HCCA 1T05A 3V9ZA 3B6PA 1LW2A 2A1SA 1B9DA 4IG3A 4OPKA 4BDYA 4DU1A 4MQ3A 3CFRA 3NGYA 4KKOA 3KKRA 3HL8A 3AVHA 3QEXA 1U4BA 3VQQA 1EP4A 4CJ3A 3SUOA 4B08A 3VA0A 3NHGA 1FKPA 2OA8A 3NCIA 4FJIA 2XY7A 3ZT2A 4AH9A 3ZT4A 4E89A 3NDKA 4CFDA 3OYMA 1ZBHA 4CHOA 3F73A 3V1OA 4DQSA 1IKVA 3ASMA 2PZSA 4DSEA 1IO2A 1VSJA 3AVLA 2ZE2A 4QAGA 1FXXA 3NF6A 3OS1A 4L8RB 5JS2A 1YVUA 3OYDA 3SZ2A 1JL2A 4FJ5A 5T7BA 3WNEA 3OYCA 5C25A 4F4KA 1DTTA 4DLGA 2XY6A 2YNGA 4GMJB 2D0AA 3LAMA 1ZBUA 1BIUA 1SL1A 4JRPA 1ZBFA 4CEBA 1VK0A 3HXMA 2HB5A 3AVMA 3O3FA 1KTQA 4BWMA 4DQIA 2HHXA 1RTDA 4F2RA 5CZ1A 4F3TA 1JL1A 4QOZB 4CGFA 3HJFA 4CJRA 3AO2A 1S6QA 4Z4IA 1J54A 1FKOA 1BQNA 4RW9A 1Z26A 3CM6A 1KVBA 3PX4A 3SUNA 1R0AA 5HRSA 3DLGA 4C8LA 2B5JA 1KFDA 4KV8A 4FZYA 1NOYA 1ZBIA 3M8SA 2OPQA 2FBTA 4I7FA 4JS4A 4DF8A 1D8YA 4RW6A 5HRNA 2P5GA 4ELTA 1S1VA 4FJKA 4F8RA 4HUEA 5D3GA 2E4LA 4DQQA 3L3UA 3WNHA 4Y1DA 4OPJA 3KK1A 1U04A 1RTHA 1HRHA 1L3VA 4CJ4A 3QETA 2G8IA 4W5NA 1IKYA 4CJEA 1X9SA 3RR7A 4N47A 4BDPA 3OS0A 2DY4A 3LP2A 1HQUA 4G1QA 3MXIA 4YFUA 3NGZA 3AVFA 4ZTJA 4C8NA 4E0DA 4CK1A 1UA0A 2Z1JA 4DMNA 5C24A 1L3TA 1NK8A 4CJPA 3RTVA 4N76A 4DU3A 2PYJA 4IBNA 2Y1JA 3WNFA 1RILA 4CESA 4DTOA 3T19A 3KLHA 3AVIA 3OYNA 1U47A 4ID5A 3AO4A 3U3GA 3M8RA 3NGIA 1S6PA 3TABA 4W5TA 3L2RA 3PO4A 4M3RA 4DF4A 3QO9A 1NKBA 1C6VA 3KLEA 3EYZA 2OPPA 1RTJA 2KTQA 4FCYA 1YTAA 4DLEA 1C1AA 1J53A 3V9WA 4JRQA 3SJJA 4M3WA 3LDSA 4FK2A 2LSNA 1TV6A 3S3NA 1W0HA 1RDDA 3NE6A 1U45A 2OZMA 1ASWA 2YHBA 2X6SA 4KTWA 4KTZA 1N5YA 2OPSA 4FK4A 1JLQA 2DTUA 3OJSA 3HPGA 1HYVA 2VG5A 4JS5A 2O4IA 3A2FA 4CHPA 4FZXC 3DLKA 3AA4A 2YKNA 3SCXA 4F2SA 4W5OA 3MECA 4EZ6A 5HBMA 4RG8A 4NCAA 3S3MA 3QNOA 1VSEA 4OJRA 2IGIA 3DOKA 3TAPA 4FJNA 4FJ9A 1NK4A 2D0CA 4CJFA 1LW0A 1JLAA 2FBYA 1WN7A 2KW4A 2FBVA 2XY8A 4HUFA 2XHBA 1TK8A 2BDPA 1TAUA 1SKRA 2EHGA 3CM5A 4Y1CA 4M45A 4FLVA 3QEIA 1CXQA 3OYGA 2G8UA 4B9TA 3G0ZA 3OYIA 2HHVA 3O4QA 3QIOA 2JGUA 3HK2A 4I9QA 5FRNA 4CK2A 4GW6A 4Z4EA 3MAQA 3PX6A 3OYFA 1C1CA 1QSYA 2D5RA 4KI6A 4FZZA 4J2DA 5SWMA 4M3UA 4DTSA 3VQBA 3LPUA 4LSNA 5FROA 4DTMA 1B9FA 4ICLA 1GOCA 3NH1A 1VSKA 2ETJA 3DLBA 3HT3A 4CCHA 3RMCA 1S5JA 4E7IA 3TANA 1RT4A 4KHUA 3VQDA 4OKKA 3I0SA 4FVMA 1ASVA 4E19A 3AA5X 1L5UA 4CHZA 3CFOA 4LH5A 4M3YA 4Z4FA 1NJYA 3TAMA 4B9NA 1WLJA 4FK0A 2GBZA 1F21A 2EX3A 4KHSA 4FJXA 1JLEA 3OS2A 1JLGA 2BE2A 3S9HA 1ZYQA 3V6DA 1RBUA 4CJKA 3NFAA 4FJMA 2W42A 3M8QA 2HVHA 3SV3A 5K14A 4AHSA 5HLFA 1KSPA 1RT6A 2YV0X 2B6AA 3B6OA 1WSEA 3OJUA 4CERA 2HNZA 4NCBA 4B3OA 4DTXA 2Y1IA 4CHQA 3RWUA 3PO5A 4J2AA 3LWLA 1CZ9A 1TGOA 2HMIA 3DYAA 1NK5A 1NJWA 1VSLA 4ELUA 4F3OA 5CY4A 1NK0A 4BACA 2RKIA 4CE9A 1EX4A 5JS1A 2DFEA 4CECA 3HP6A 5KI6A 4DTPA 4FLXA 4R5PA 4FJLA 2FC0A 1JLCA 1QS4A 1KVCA 3NBPA 3VQ7A 4DFPA 2Z1HA 4AHUA 2XO7A 1WSGA 2IC3A 4O44A 1SL0A 4KHYA 2HHUA 3K5MA 1JKHA 3C6TA 4FLUA 1NKCA 4CJ5A 1RCHA 4KAZA 2F8TA 3BDPA 2E6MA 3TR8A 3NH2A 1NK6A 1A5XA 1UAXA 4HHTA 3KD5E 1IKWA 1BHLA 2DFFA 4CJQA 5DK5A 3TAEA 3VQEA 4FJJA 4CJTA 4AILC 1Q9YA 2AJQA 4KRFA 3C95A 2DFHA 4JLHA 1C0MA 1FK9A 4WE1A 3ZSWA 2X74A 4FJ7A 4OLBA 4CEOA 1LAVA 4DSIA 3O3GA 3LALA 4GVMA 3VN5A 3QEPA 4QCLA 4CIEA 2B4JA 4CFBA 1NJXA 5CZ2A 1NOZA 1RT1A 1HYZA 3L2UA 1VRUA 1HMVA 3JYTA 2WOMA 3RMAA 5I3UA 1Z25A 1BQMA 4OGEA 4CF2A 1HYSA 3SI6A 1RBRA 3TAQA 4Q0BA 3CYMA 1KCFA 4Z4CA 4E3SA 4B8CA 2VG7A 4H4OA 3VQ8A 4N56A 3KTQA 1G15A 4DFKA 4BE0A 3ALYA 2ZD1A 3ZSOA 1C0TA 3KK3A 4CJWA 4KB0A 4HVJA 2G8WA 4O4GA 4E1MA 3AVCA 1Q8IA 1TAQA 3AVNA 1KFSA 1RT3A 4W5QA 1EXQA 2HNDA 1WSHA 4BE2A 3V4IA 4FW2A 3IS9A 4Z4GA 3U6FA 1TKZA 1D5AA 3ZSXA 3KK2A 3AO1A 3HSTB 4MFBA 2IOCA 1LAWA 1KRPA 3CG7A 4CHNA 3OYBA 1C1BA 1RDCA 1Y97A 3DLEA 3ZSQA 3CQ8A 2P51A 2RPIA 2ZQBA 4CF0A 4B9SA 4K8XA 1RBTA 3AVGA 4FM0A 1TKDA 2XY5A 1HJRA 3SQ0A 4ID1A 4CEFA 5DMRA 3ZSVA 3D0PA 3AVKA 1DLOA 1JLBA 3HPHA 1KVAA 3OYKA 3QLHA 3L2WA 3QIPA 4FLTA 1ZBLA 3U3YA 4DSJA 3THVA 1XC9A 2IDOA 3OYAA 1XWLA 5KRSA 3JSMA 1QTMA 2F8SA 5CYMA 1T03A 3O3HA 4DFMA 1WAJA 3RMDA 4CF9A 1TVRA 3RRHA 1SV5A 3PV8A 4EP5A 2OZSA 3SPYA 4CFAA 4CGDA 1JLFA 5KTQA 3SQ4A 1QE1A 4RW8A 1U49A 3V9XA 3TAFA 3AV9A 4BWJA 3LZIA 4M3XA 3NF9A 4M3ZA 1O1WA 4B9MA 2BANA 4TSXA 3LPTA 2QK9A 4HTUA 4O0IA 3DRPA 4IG0A 3DOLA 3QEWA 1UWBA 2HHQA 2BGGA 4UQGA 4AHRA 2YNHA 2JLEA 2HHTA 1YT3A 1DTQA 3NF7A 3IRXA 3LANA 3RRGA 4I2PA 3SQ1A 3MEDA 4E7HA 3DRSA 5J2MA 3DMJA 3HYFA 3SUPA 3F9KA 3QERA 4B9VA 1QQCA 3P1GA 4CJSA 4CGGA 3ULDA 2KQ2A 4DU4A 3RR8A 4KTQA 1CZBA 2F96A 4KI4A 3V81A 3VQAA 3PUFA 4E7LA 4E1NA 3KLGA 3EY1A 5HP1A 3AVAA 3K59A 2Z1IA 5FDLA 4DG1A 5HRRA 1BI4A 3VQ5A 3ZSRA 4M41A 1TKXA 1VSDA 4E7JA 2YNFA 2HW3A 4CGJA 3IAYA 3L3VA 4KFBA 3L8BA 3NH0A 4PUOA 1ASUA 4FJ8A 3SNNA 4C8OA 3DI6A 3IG1A 2VG6A 3KIOA 2GV9A 3TI0A 2G8KA 3V1RA 1SUQA 1VRTA 4LH4A 4J2BA 3SUQA 2G8FA 1SKWA 3QEVA 1KLNA 4FLYA 3OYLA 3H08A 4DS4A 4HCBA 5KGXA 3AA3A 3BGRA 3K58A 1L3SA 4FM2A 1BGXT 1RNHA 5I42A 4KHQA 2O4GA 3E01A 1CXUA 1K6YA 3P83D 1HNVA 2Q3SA 2IS3A 4CJUA 3VQ6A 3ZT1A 3K57A 1NK9A 3D45A 2KZMA 4PQUA 3K5OA 1UOCA 4N5SA 3KKSA 3KD1E 4K8ZA 3AVJA 3AA2A 3L2QA 4LSLA 3ZSYA 4H4MA 3HM9A 4DSLA 1RDBA 1RT7A 2NUBA 4YNQA 5C42A 1J5OA 1BI4B 3OYEA 4B9LA 3HPOA 1QSLA 5SZTA 3WNGA 4IFVA 3G10A 2P1JA 1QSSA 4XIUA 1Q9XA 4Z0UA 3EZ5A 4KB1A 1RT5A 2HNYA 4B8AB 1U48A 1LWEA 2QKBA 3K2PA 4NYFA 4O5BA 3LP3A 3MXMA 1XI1A 1NK7A 4DQPA 3DM2A 3LP1A 4FJHA 3M8PA 3MEEA 4NYNA 3CFPA 3TWHA 4HUGA 1S9GA 4RW4A 3SPZA 4C8KA 4EZ9A 3KLIA 4OKEA 3V9SA 4ZTFA 4DTRA 1IG9A 1VSHA 1BISA 1W9HA 1T8EA 3RMBA 1VSIA 2HHSA 1XHZA 3DLHA 2IAJA 3S3OA 3ZSZA 3AO5A 1WSIA 1NKEA 3ZT0A 4CIGA 1S9EA 4AHCA 4FM1A 1VSFA 2X6NA 1X1PA 2X78A 1REVA 2RF2A 5J1EA 3OYHA 1TL1A 1UA1A 3K5LA 5HRPA 3T3FA 4FJGA 1D9FA 4N41A 1GOAA 3C6UA 4CEDA 2OYQA 3O4NA 2G8VA 4IKFA 2OPRA 2ITGA 1A5VA 2R7YA 3FFIA 1NJZA 4AHTA 2VWKA 3LZJA 3HVRA 4CEQA 1RBVA 4PWDA 3LAKA 2YKMA 2VWJA 4B9UA 2GUIA 5HROA 4BDZA 4DWIA 4OKJA 4ZHRA 4O0JA 3ZT3A 1X9MA 2HVIA 1C0UA 1KLMA 3ITHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0B A;  4OLA A;  4IDK A;  1T7P A;  1VSM A;  1SKS A;  4O55 A;  2Z1G A;  4M42 A;  4DTJ A;  3VA3 A;  4BE1 A;  1EET A;  4KHN A;  4KHW A;  1S1T A;  3MEG A;  4I2Q A;  4PA1 A;  4CGI A;  1B92 A;  4DS5 A;  1HPZ A;  1QHT A;  3AO3 A;  1RT2 A;  4NCG A;  1TK0 A;  1N6Q A;  5KRT A;  1CLQ A;  3KJV A;  4FLW A;  4FXD A;  1BCO A;  4I9L A;  4CF8 A;  1ITG A;  3LWM A;  4M3T A;  3UIQ A;  1X9W A;  3NAE A;  5J2P A;  1I39 A;  2YHA A;  4OVL A;  4OGC A;  3V9U A;  1D9D A;  1S1U A;  2KFN A;  2KFZ A;  3I8D A;  5KGW A;  3HVT A;  3ISN C;  2RN2 A;  1J9A A;  1IH7 A;  3LP0 A;  3VQ4 A;  4Z4H A;  1S1W A;  3TAG A;  1RDA A;  3MXJ A;  3DRR A;  3V1Q A;  2WON A;  2ATQ A;  1IKX A;  1MU2 A;  2E6L A;  4IFY A;  3C94 A;  3P5J A;  3VQ9 A;  4CJV A;  3HP9 A;  4C8M A;  5J2Q A;  4FLZ A;  1L3U A;  3OY9 A;  4DTU A;  1XHX A;  3QES A;  3SQ2 A;  2XRI A;  3L2V A;  4RW7 A;  5J2N A;  4PY5 A;  3AVB A;  1JXE A;  3OVN A;  4DTN A;  1YTU A;  1RTI A;  3T1A A;  4LD0 A;  4E7K A;  2QKK A;  3SYZ A;  4AHV A;  2A1R A;  1TL3 A;  4LY7 A;  1BIZ A;  4DSF A;  4KRE A;  3QIN A;  3NF8 A;  4DQR A;  2PY5 A;  4CEZ A;  4KPY A;  3K5N A;  1TKT A;  4CIF A;  2P5O A;  4FW1 A;  5EU7 A;  2G8H A;  3ZCM A;  3KLF A;  1WSF A;  1BL3 A;  4FYD A;  1WSJ A;  2PYL A;  4J2E A;  4DSK A;  4W5R A;  1GOB A;  3SV4 A;  4KO0 A;  3OYJ A;  1LV5 A;  2KZZ A;  5CYQ A;  5E41 A;  1JXB A;  3I0R A;  3VQP A;  4CEA A;  4DFJ A;  1WAF A;  3QNN A;  4ELV A;  5FRM A;  1LWC A;  3DLR A;  4H8K A;  1A5W A;  3PY8 A;  4CEE A;  4Q5V A;  1S1X A;  2YNI A;  3VQC A;  2QXF A;  3PX0 A;  4CF1 A;  1TK5 A;  1HNI A;  4CHY A;  2HHW A;  1HQE A;  3HO1 A;  1LWF A;  1WNS A;  2I5J A;  4CJL A;  1RBS A;  4CGH A;  1BCM A;  2FBX A;  4CK3 A;  3TAR A;  1EKE A;  1I3A A;  4EP4 A;  4CFC A;  1SL2 A;  4HCC A;  1T05 A;  3V9Z A;  3B6P A;  1LW2 A;  2A1S A;  1B9D A;  4IG3 A;  4OPK A;  4BDY A;  4DU1 A;  4MQ3 A;  3CFR A;  3NGY A;  4KKO A;  3KKR A;  3HL8 A;  3AVH A;  3QEX A;  1U4B A;  3VQQ A;  1EP4 A;  4CJ3 A;  3SUO A;  4B08 A;  3VA0 A;  3NHG A;  1FKP A;  2OA8 A;  3NCI A;  4FJI A;  2XY7 A;  3ZT2 A;  4AH9 A;  3ZT4 A;  4E89 A;  3NDK A;  4CFD A;  3OYM A;  1ZBH A;  4CHO A;  3F73 A;  3V1O A;  4DQS A;  1IKV A;  3ASM A;  2PZS A;  4DSE A;  1IO2 A;  1VSJ A;  3AVL A;  2ZE2 A;  4QAG A;  1FXX A;  3NF6 A;  3OS1 A;  4L8R B;  5JS2 A;  1YVU A;  3OYD A;  3SZ2 A;  1JL2 A;  4FJ5 A;  5T7B A;  3WNE A;  3OYC A;  5C25 A;  4F4K A;  1DTT A;  4DLG A;  2XY6 A;  2YNG A;  4GMJ B;  2D0A A;  3LAM A;  1ZBU A;  1BIU A;  1SL1 A;  4JRP A;  1ZBF A;  4CEB A;  1VK0 A;  3HXM A;  2HB5 A;  3AVM A;  3O3F A;  1KTQ A;  4BWM A;  4DQI A;  2HHX A;  1RTD A;  4F2R A;  5CZ1 A;  4F3T A;  1JL1 A;  4QOZ B;  4CGF A;  3HJF A;  4CJR A;  3AO2 A;  1S6Q A;  4Z4I A;  1J54 A;  1FKO A;  1BQN A;  4RW9 A;  1Z26 A;  3CM6 A;  1KVB A;  3PX4 A;  3SUN A;  1R0A A;  5HRS A;  3DLG A;  4C8L A;  2B5J A;  1KFD A;  4KV8 A;  4FZY A;  1NOY A;  1ZBI A;  3M8S A;  2OPQ A;  2FBT A;  4I7F A;  4JS4 A;  4DF8 A;  1D8Y A;  4RW6 A;  5HRN A;  2P5G A;  4ELT A;  1S1V A;  4FJK A;  4F8R A;  4HUE A;  5D3G A;  2E4L A;  4DQQ A;  3L3U A;  3WNH A;  4Y1D A;  4OPJ A;  3KK1 A;  1U04 A;  1RTH A;  1HRH A;  1L3V A;  4CJ4 A;  3QET A;  2G8I A;  4W5N A;  1IKY A;  4CJE A;  1X9S A;  3RR7 A;  4N47 A;  4BDP A;  3OS0 A;  2DY4 A;  3LP2 A;  1HQU A;  4G1Q A;  3MXI A;  4YFU A;  3NGZ A;  3AVF A;  4ZTJ A;  4C8N A;  4E0D A;  4CK1 A;  1UA0 A;  2Z1J A;  4DMN A;  5C24 A;  1L3T A;  1NK8 A;  4CJP A;  3RTV A;  4N76 A;  4DU3 A;  2PYJ A;  4IBN A;  2Y1J A;  3WNF A;  1RIL A;  4CES A;  4DTO A;  3T19 A;  3KLH A;  3AVI A;  3OYN A;  1U47 A;  4ID5 A;  3AO4 A;  3U3G A;  3M8R A;  3NGI A;  1S6P A;  3TAB A;  4W5T A;  3L2R A;  3PO4 A;  4M3R A;  4DF4 A;  3QO9 A;  1NKB A;  1C6V A;  3KLE A;  3EYZ A;  2OPP A;  1RTJ A;  2KTQ A;  4FCY A;  1YTA A;  4DLE A;  1C1A A;  1J53 A;  3V9W A;  4JRQ A;  3SJJ A;  4M3W A;  3LDS A;  4FK2 A;  2LSN A;  1TV6 A;  3S3N A;  1W0H A;  1RDD A;  3NE6 A;  1U45 A;  2OZM A;  1ASW A;  2YHB A;  2X6S A;  4KTW A;  4KTZ A;  1N5Y A;  2OPS A;  4FK4 A;  1JLQ A;  2DTU A;  3OJS A;  3HPG A;  1HYV A;  2VG5 A;  4JS5 A;  2O4I A;  3A2F A;  4CHP A;  4FZX C;  3DLK A;  3AA4 A;  2YKN A;  3SCX A;  4F2S A;  4W5O A;  3MEC A;  4EZ6 A;  5HBM A;  4RG8 A;  4NCA A;  3S3M A;  3QNO A;  1VSE A;  4OJR A;  2IGI A;  3DOK A;  3TAP A;  4FJN A;  4FJ9 A;  1NK4 A;  2D0C A;  4CJF A;  1LW0 A;  1JLA A;  2FBY A;  1WN7 A;  2KW4 A;  2FBV A;  2XY8 A;  4HUF A;  2XHB A;  1TK8 A;  2BDP A;  1TAU A;  1SKR A;  2EHG A;  3CM5 A;  4Y1C A;  4M45 A;  4FLV A;  3QEI A;  1CXQ A;  3OYG A;  2G8U A;  4B9T A;  3G0Z A;  3OYI A;  2HHV A;  3O4Q A;  3QIO A;  2JGU A;  3HK2 A;  4I9Q A;  5FRN A;  4CK2 A;  4GW6 A;  4Z4E A;  3MAQ A;  3PX6 A;  3OYF A;  1C1C A;  1QSY A;  2D5R A;  4KI6 A;  4FZZ A;  4J2D A;  5SWM A;  4M3U A;  4DTS A;  3VQB A;  3LPU A;  4LSN A;  5FRO A;  4DTM A;  1B9F A;  4ICL A;  1GOC A;  3NH1 A;  1VSK A;  2ETJ A;  3DLB A;  3HT3 A;  4CCH A;  3RMC A;  1S5J A;  4E7I A;  3TAN A;  1RT4 A;  4KHU A;  3VQD A;  4OKK A;  3I0S A;  4FVM A;  1ASV A;  4E19 A;  3AA5 X;  1L5U A;  4CHZ A;  3CFO A;  4LH5 A;  4M3Y A;  4Z4F A;  1NJY A;  3TAM A;  4B9N A;  1WLJ A;  4FK0 A;  2GBZ A;  1F21 A;  2EX3 A;  4KHS A;  4FJX A;  1JLE A;  3OS2 A;  1JLG A;  2BE2 A;  3S9H A;  1ZYQ A;  3V6D A;  1RBU A;  4CJK A;  3NFA A;  4FJM A;  2W42 A;  3M8Q A;  2HVH A;  3SV3 A;  5K14 A;  4AHS A;  5HLF A;  1KSP A;  1RT6 A;  2YV0 X;  2B6A A;  3B6O A;  1WSE A;  3OJU A;  4CER A;  2HNZ A;  4NCB A;  4B3O A;  4DTX A;  2Y1I A;  4CHQ A;  3RWU A;  3PO5 A;  4J2A A;  3LWL A;  1CZ9 A;  1TGO A;  2HMI A;  3DYA A;  1NK5 A;  1NJW A;  1VSL A;  4ELU A;  4F3O A;  5CY4 A;  1NK0 A;  4BAC A;  2RKI A;  4CE9 A;  1EX4 A;  5JS1 A;  2DFE A;  4CEC A;  3HP6 A;  5KI6 A;  4DTP A;  4FLX A;  4R5P A;  4FJL A;  2FC0 A;  1JLC A;  1QS4 A;  1KVC A;  3NBP A;  3VQ7 A;  4DFP A;  2Z1H A;  4AHU A;  2XO7 A;  1WSG A;  2IC3 A;  4O44 A;  1SL0 A;  4KHY A;  2HHU A;  3K5M A;  1JKH A;  3C6T A;  4FLU A;  1NKC A;  4CJ5 A;  1RCH A;  4KAZ A;  2F8T A;  3BDP A;  2E6M A;  3TR8 A;  3NH2 A;  1NK6 A;  1A5X A;  1UAX A;  4HHT A;  3KD5 E;  1IKW A;  1BHL A;  2DFF A;  4CJQ A;  5DK5 A;  3TAE A;  3VQE A;  4FJJ A;  4CJT A;  4AIL C;  1Q9Y A;  2AJQ A;  4KRF A;  3C95 A;  2DFH A;  4JLH A;  1C0M A;  1FK9 A;  4WE1 A;  3ZSW A;  2X74 A;  4FJ7 A;  4OLB A;  4CEO A;  1LAV A;  4DSI A;  3O3G A;  3LAL A;  4GVM A;  3VN5 A;  3QEP A;  4QCL A;  4CIE A;  2B4J A;  4CFB A;  1NJX A;  5CZ2 A;  1NOZ A;  1RT1 A;  1HYZ A;  3L2U A;  1VRU A;  1HMV A;  3JYT A;  2WOM A;  3RMA A;  5I3U A;  1Z25 A;  1BQM A;  4OGE A;  4CF2 A;  1HYS A;  3SI6 A;  1RBR A;  3TAQ A;  4Q0B A;  3CYM A;  1KCF A;  4Z4C A;  4E3S A;  4B8C A;  2VG7 A;  4H4O A;  3VQ8 A;  4N56 A;  3KTQ A;  1G15 A;  4DFK A;  4BE0 A;  3ALY A;  2ZD1 A;  3ZSO A;  1C0T A;  3KK3 A;  4CJW A;  4KB0 A;  4HVJ A;  2G8W A;  4O4G A;  4E1M A;  3AVC A;  1Q8I A;  1TAQ A;  3AVN A;  1KFS A;  1RT3 A;  4W5Q A;  1EXQ A;  2HND A;  1WSH A;  4BE2 A;  3V4I A;  4FW2 A;  3IS9 A;  4Z4G A;  3U6F A;  1TKZ A;  1D5A A;  3ZSX A;  3KK2 A;  3AO1 A;  3HST B;  4MFB A;  2IOC A;  1LAW A;  1KRP A;  3CG7 A;  4CHN A;  3OYB A;  1C1B A;  1RDC A;  1Y97 A;  3DLE A;  3ZSQ A;  3CQ8 A;  2P51 A;  2RPI A;  2ZQB A;  4CF0 A;  4B9S A;  4K8X A;  1RBT A;  3AVG A;  4FM0 A;  1TKD A;  2XY5 A;  1HJR A;  3SQ0 A;  4ID1 A;  4CEF A;  5DMR A;  3ZSV A;  3D0P A;  3AVK A;  1DLO A;  1JLB A;  3HPH A;  1KVA A;  3OYK A;  3QLH A;  3L2W A;  3QIP A;  4FLT A;  1ZBL A;  3U3Y A;  4DSJ A;  3THV A;  1XC9 A;  2IDO A;  3OYA A;  1XWL A;  5KRS A;  3JSM A;  1QTM A;  2F8S A;  5CYM A;  1T03 A;  3O3H A;  4DFM A;  1WAJ A;  3RMD A;  4CF9 A;  1TVR A;  3RRH A;  1SV5 A;  3PV8 A;  4EP5 A;  2OZS A;  3SPY A;  4CFA A;  4CGD A;  1JLF A;  5KTQ A;  3SQ4 A;  1QE1 A;  4RW8 A;  1U49 A;  3V9X A;  3TAF A;  3AV9 A;  4BWJ A;  3LZI A;  4M3X A;  3NF9 A;  4M3Z A;  1O1W A;  4B9M A;  2BAN A;  4TSX A;  3LPT A;  2QK9 A;  4HTU A;  4O0I A;  3DRP A;  4IG0 A;  3DOL A;  3QEW A;  1UWB A;  2HHQ A;  2BGG A;  4UQG A;  4AHR A;  2YNH A;  2JLE A;  2HHT A;  1YT3 A;  1DTQ A;  3NF7 A;  3IRX A;  3LAN A;  3RRG A;  4I2P A;  3SQ1 A;  3MED A;  4E7H A;  3DRS A;  5J2M A;  3DMJ A;  3HYF A;  3SUP A;  3F9K A;  3QER A;  4B9V A;  1QQC A;  3P1G A;  4CJS A;  4CGG A;  3ULD A;  2KQ2 A;  4DU4 A;  3RR8 A;  4KTQ A;  1CZB A;  2F96 A;  4KI4 A;  3V81 A;  3VQA A;  3PUF A;  4E7L A;  4E1N A;  3KLG A;  3EY1 A;  5HP1 A;  3AVA A;  3K59 A;  2Z1I A;  5FDL A;  4DG1 A;  5HRR A;  1BI4 A;  3VQ5 A;  3ZSR A;  4M41 A;  1TKX A;  1VSD A;  4E7J A;  2YNF A;  2HW3 A;  4CGJ A;  3IAY A;  3L3V A;  4KFB A;  3L8B A;  3NH0 A;  4PUO A;  1ASU A;  4FJ8 A;  3SNN A;  4C8O A;  3DI6 A;  3IG1 A;  2VG6 A;  3KIO A;  2GV9 A;  3TI0 A;  2G8K A;  3V1R A;  1SUQ A;  1VRT A;  4LH4 A;  4J2B A;  3SUQ A;  2G8F A;  1SKW A;  3QEV A;  1KLN A;  4FLY A;  3OYL A;  3H08 A;  4DS4 A;  4HCB A;  5KGX A;  3AA3 A;  3BGR A;  3K58 A;  1L3S A;  4FM2 A;  1BGX T;  1RNH A;  5I42 A;  4KHQ A;  2O4G A;  3E01 A;  1CXU A;  1K6Y A;  3P83 D;  1HNV A;  2Q3S A;  2IS3 A;  4CJU A;  3VQ6 A;  3ZT1 A;  3K57 A;  1NK9 A;  3D45 A;  2KZM A;  4PQU A;  3K5O A;  1UOC A;  4N5S A;  3KKS A;  3KD1 E;  4K8Z A;  3AVJ A;  3AA2 A;  3L2Q A;  4LSL A;  3ZSY A;  4H4M A;  3HM9 A;  4DSL A;  1RDB A;  1RT7 A;  2NUB A;  4YNQ A;  5C42 A;  1J5O A;  1BI4 B;  3OYE A;  4B9L A;  3HPO A;  1QSL A;  5SZT A;  3WNG A;  4IFV A;  3G10 A;  2P1J A;  1QSS A;  4XIU A;  1Q9X A;  4Z0U A;  3EZ5 A;  4KB1 A;  1RT5 A;  2HNY A;  4B8A B;  1U48 A;  1LWE A;  2QKB A;  3K2P A;  4NYF A;  4O5B A;  3LP3 A;  3MXM A;  1XI1 A;  1NK7 A;  4DQP A;  3DM2 A;  3LP1 A;  4FJH A;  3M8P A;  3MEE A;  4NYN A;  3CFP A;  3TWH A;  4HUG A;  1S9G A;  4RW4 A;  3SPZ A;  4C8K A;  4EZ9 A;  3KLI A;  4OKE A;  3V9S A;  4ZTF A;  4DTR A;  1IG9 A;  1VSH A;  1BIS A;  1W9H A;  1T8E A;  3RMB A;  1VSI A;  2HHS A;  1XHZ A;  3DLH A;  2IAJ A;  3S3O A;  3ZSZ A;  3AO5 A;  1WSI A;  1NKE A;  3ZT0 A;  4CIG A;  1S9E A;  4AHC A;  4FM1 A;  1VSF A;  2X6N A;  1X1P A;  2X78 A;  1REV A;  2RF2 A;  5J1E A;  3OYH A;  1TL1 A;  1UA1 A;  3K5L A;  5HRP A;  3T3F A;  4FJG A;  1D9F A;  4N41 A;  1GOA A;  3C6U A;  4CED A;  2OYQ A;  3O4N A;  2G8V A;  4IKF A;  2OPR A;  2ITG A;  1A5V A;  2R7Y A;  3FFI A;  1NJZ A;  4AHT A;  2VWK A;  3LZJ A;  3HVR A;  4CEQ A;  1RBV A;  4PWD A;  3LAK A;  2YKM A;  2VWJ A;  4B9U A;  2GUI A;  5HRO A;  4BDZ A;  4DWI A;  4OKJ A;  4ZHR A;  4O0J A;  3ZT3 A;  1X9M A;  2HVI A;  1C0U A;  1KLM A;  3ITH A; 
#chains in the Genus database with same CATH topology
 4OLA A;  5HL7 L;  4BG9 A;  2Z1G A;  2GX9 A;  1HR0 K;  1EET A;  3HRG A;  4KHN A;  1Z05 A;  2Q0U A;  1W7A A;  4YY3 K;  4CGI A;  1IG8 A;  1B92 A;  1QHT A;  3AO3 A;  3SLC A;  1YI2 N;  1TK0 A;  5KRT A;  1YF5 L;  5CHI A;  1R59 O;  4FXD A;  1BCO A;  4CF8 A;  3LWM A;  4M3T A;  4DV4 K;  3ENO A;  2YHA A;  3OW2 M;  3VQ4 A;  1D8Y A;  2RN2 A;  3G4S N;  2NLX A;  3K9J A;  3A5L C;  5KQ8 A;  3V1Q A;  2ATQ A;  2E6L A;  4IFY A;  5AQG A;  3C94 A;  5AZI B;  4BRK A;  3HP9 A;  4C8M A;  4BGA A;  1L3U A;  1J6Z A;  1XHX A;  3QES A;  5J2N A;  4RW7 A;  3R8E A;  2E1Y A;  5AQT A;  3AVB A;  5GIO A;  4CBU A;  3MWP A;  1YIT N;  5JMV A;  3MN7 A;  4CIF A;  2P5O A;  4FW1 A;  3ZCM A;  3VPZ A;  4FYD A;  1HUX A;  2IVP A;  1JXB A;  2HBM A;  4DFJ A;  3HBT A;  2A40 A;  1U2V B;  1WAF A;  3M1F A;  4ELV A;  1LWC A;  1A5W A;  3PY8 A;  4CEE A;  4Q5V A;  1S1X A;  3THY A;  2QM1 A;  4YOR A;  3AGK A;  5A2Q O;  4CHY A;  1ZBS A;  1WNS A;  4B9Q A;  4CJL A;  1X3M A;  3TSQ A;  2FBX A;  3G6E N;  1T05 A;  4H0O A;  4YOY A;  1B9D A;  4IG3 A;  2YI1 A;  3LDQ A;  5AQY A;  3NGY A;  1KD1 O;  3VQQ A;  2V7Y A;  2GUP A;  3VA0 A;  1NGD A;  2ZJP L;  4RTF D;  4PKH A;  3CCE N;  3W3D A;  3O5B A;  4IEE A;  3THW A;  4FJI A;  2KLA A;  1IBL K;  4AM7 A;  5M1P A;  5AQO A;  3OYM A;  3V1O A;  5M1K A;  2O8B A;  2PZS A;  1VSJ A;  5C0Y A;  4DV5 K;  2ZE2 A;  3M6G A;  5ADX A;  3CCU N;  1YVU A;  1JL2 A;  4IWV A;  4A59 A;  3OYC A;  5C25 A;  4F4K A;  2D0A A;  3LAM A;  3VEV A;  4JRP A;  2HB5 A;  5AQZ A;  3VF6 A;  2HHX A;  4H0V B;  1YXQ A;  3VET A;  4O8K A;  1RTD A;  2ASO A;  3CPW M;  1GLD G;  4Z4I A;  1FKO A;  2YHW A;  4RCH A;  3DLL L;  3PX4 A;  5HRS A;  3DLG A;  1ZBI A;  3M8S A;  4B3M K;  4YDU A;  4FJK A;  4RW6 A;  5GIP A;  1RDW X;  4BR4 A;  1S1V A;  4CJ7 A;  2P5G A;  4HUE A;  3L3U A;  1HRH A;  4N47 A;  4H0Y B;  4FPB A;  1OKJ A;  5LJW A;  4X64 K;  4YFU A;  3NGZ A;  4B1U B;  4CK1 A;  1BUP A;  5C24 A;  1L3T A;  2WC9 A;  1NK8 A;  3CC2 N;  4IBN A;  4CZK A;  2Y1J A;  3WNF A;  3BZC A;  4CES A;  2WTU A;  3VGK A;  3AVI A;  3AO4 A;  3U3G A;  4JKG B;  1K73 O;  3QFP A;  5AQI A;  3T1H K;  4X62 K;  1NKB A;  2OPP A;  4FCY A;  1RDD A;  1U45 A;  1ASW A;  3PIP L;  2O8D B;  2VG5 A;  3AA4 A;  4ISG A;  4W5O A;  4BRP A;  5HBM A;  3VF2 A;  3S3M A;  3QNO A;  3CD6 N;  1VSE A;  4K25 A;  2D0C A;  4IJN A;  2BDP A;  1KAZ A;  1SKR A;  1NU0 A;  4M45 A;  3G0Z A;  4BC2 A;  3OYI A;  3O80 A;  2ZJQ L;  3LDN A;  5FRN A;  3SJH A;  2YJF A;  3J8A A;  3MN5 A;  3PX6 A;  2FXU A;  5FPM A;  1QSY A;  4EHT A;  4M3U A;  4DTS A;  5AR0 A;  5LMN K;  4DR7 K;  3CC7 N;  1GOC A;  4DR4 K;  4DV6 K;  1XUP O;  4E7I A;  5AQV A;  2E2Q A;  4OKK A;  1L5U A;  2CGK A;  3AA5 X;  3EE8 A;  4CHZ A;  4LH5 A;  3T69 A;  1GLA G;  3IKM A;  4FK0 A;  2GBZ A;  2H3G X;  5I9E B;  3S9H A;  3CJC A;  2W42 A;  4AHS A;  1KSP A;  4WYB A;  2B6A A;  3VF4 A;  1WSE A;  3OJU A;  4CBW A;  1IV0 A;  5KPZ A;  4DTX A;  2Y1I A;  1GLB G;  3CJA A;  3BZK A;  3LM2 A;  5CY4 A;  4FWQ A;  5JS1 A;  2DFE A;  5KI6 A;  4R5P A;  2I7N A;  3EO3 A;  2FC0 A;  4A57 A;  1NM1 A;  2XO7 A;  3C6A A;  1WSG A;  1SL0 A;  5AZJ B;  2HF3 A;  2KHO A;  1JKH A;  1VHX A;  4UY8 O;  3CCL N;  2E6M A;  3BY5 A;  4OPA A;  1NK6 A;  4HHT A;  3KD5 E;  1IKW A;  1BHL A;  5DK5 A;  4CJT A;  1IBM K;  5GAD P;  5KPT A;  4KRF A;  3C95 A;  3FZF A;  1EQY A;  4WE1 A;  3ZSW A;  5BR9 A;  2X74 A;  4FJ7 A;  4OLB A;  3G71 N;  4DSI A;  3LAL A;  4GVM A;  3VN5 A;  3JYT A;  1TUY A;  4CZH A;  3ZET B;  1NGB A;  3TAQ A;  3GL1 A;  3J7Y P;  3CYM A;  4E3S A;  4DUY K;  4N56 A;  3KTQ A;  3WXI A;  1VQ9 N;  4CJW A;  3BF1 A;  4HVJ A;  3MMV A;  4BC4 A;  3AVN A;  5B8H A;  2YHX A;  1EXQ A;  4BE2 A;  1X3N A;  4BQL A;  3A0I X;  3U6F A;  1D5A A;  3ZSX A;  3KK2 A;  4LF8 K;  2IOC A;  1LAW A;  1DKG D;  4JHD B;  4I6M B;  1C1B A;  1RDC A;  2UUB K;  2P51 A;  4CF0 A;  2P9U B;  3AVG A;  3VGM A;  2XY5 A;  5DMR A;  2E2N A;  4DV3 K;  4C23 A;  3OYK A;  3AAP A;  3U3Y A;  3OYA A;  1XWL A;  4BRG A;  5JLF A;  3NVM A;  1WAJ A;  1FW6 A;  3RMD A;  4CF9 A;  2OZS A;  5EVZ A;  3SPY A;  2GWK A;  3AV9 A;  4BWJ A;  5M1N A;  2BAN A;  3LPT A;  4WCE L;  2GWJ A;  2HBJ A;  3C65 A;  1UWB A;  2HHQ A;  4UQG A;  4JI5 K;  3O1W A;  1YT3 A;  3LAN A;  4I2P A;  3ID6 A;  5H1S Q;  5J2M A;  2O8B B;  3E9L A;  3F9K A;  4B9V A;  1QQC A;  3RR8 A;  4CZM A;  4E1N A;  5HP1 A;  3TPQ A;  4JKH A;  3IDH A;  5HRR A;  1BI4 A;  1HNZ K;  3VQ5 A;  4M41 A;  5BN9 A;  2UXD K;  3IAY A;  1HKG A;  4FOI A;  3IG1 A;  4CD1 A;  1VRT A;  4BG8 A;  1SKW A;  5LY3 A;  3CCM N;  3H08 A;  4DS4 A;  4HCB A;  2O8D A;  3AA3 A;  3BGR A;  3K58 A;  4B1Y B;  1KQS M;  2Q0R A;  3QFU A;  4M7Y A;  1RNH A;  4FM2 A;  4DR2 K;  3CCS N;  4U67 L;  1K6Y A;  4BR7 A;  4YOW A;  4WFB L;  1HNV A;  2E2P A;  2IS3 A;  1XNQ K;  3ZT1 A;  2ZGZ A;  5JLH A;  4N5S A;  3KKS A;  3WXK A;  1Q81 O;  3KD1 E;  3A8Y A;  3AVJ A;  3L4Q A;  3ZSY A;  3HM9 A;  4DSL A;  1RDB A;  1RT7 A;  4PL8 A;  2PAV A;  2UXC K;  5AQK A;  4IOA L;  3TU5 A;  5M1Q A;  2QKB A;  4PL7 A;  4JKC A;  4NYF A;  3H3N O;  4DQP A;  4JI6 K;  4FJH A;  5GIN A;  3I55 N;  5CR4 A;  4H03 B;  1S9G A;  4C8K A;  3ATU A;  4FVU A;  3NMU A;  3RMB A;  3H1V X;  1K9M O;  4OO1 J;  1XHZ A;  3MN9 A;  3S41 A;  1NKE A;  5D3G A;  3ZT0 A;  2Q97 A;  1X1P A;  5J1E A;  1REV A;  3K5L A;  4FJG A;  1D9F A;  3C6U A;  1M90 O;  3L6Q A;  1XNR K;  2G8V A;  2OPR A;  1Q86 O;  3LZJ A;  5BRE A;  4PWD A;  4YDU C;  4BDZ A;  4JI7 K;  4O0J A;  3Q7C A;  2P9P B;  1SKS A;  4M42 A;  4BE1 A;  5JVG L;  4KHW A;  4BR9 A;  3DXM B;  4H5V A;  2CH5 A;  1QZ6 A;  4B1X B;  3KJV A;  4ILG B;  4MLE A;  5J2P A;  2ZWH A;  3V9U A;  1XMQ K;  1S1U A;  2KFZ A;  1T44 A;  5KGW A;  1J9A A;  3MN6 A;  1RDA A;  3MXJ A;  2WON A;  1QVF M;  3D2F B;  1IKX A;  1MU2 A;  1O13 A;  4PKG A;  3VQ9 A;  4CJV A;  4H5R A;  3SQ2 A;  2XRI A;  3SMS A;  4PY5 A;  5GAG P;  3OVN A;  4DTN A;  3KVG A;  4E7K A;  2OTL N;  2Q31 A;  4LY7 A;  4DSF A;  3QIN A;  1YUW A;  5AQJ A;  2G8H A;  4B3T K;  1BL3 A;  1NMN A;  2JWL A;  4W5R A;  4KO0 A;  3ID8 A;  3VQP A;  1XC3 A;  4H8K A;  1T6D A;  4Z94 A;  2YNI A;  3PX0 A;  1HQE A;  1YJW N;  1BCM A;  2CGJ A;  4DV2 K;  1SL2 A;  4EP4 A;  1I3A A;  1M1K O;  4CFC A;  1I94 K;  2W6L A;  1DEJ A;  2F4V K;  3GDQ A;  4OPK A;  2NRW A;  5GAH P;  4JI8 K;  3MK6 A;  3KKR A;  3HL8 A;  3AVH A;  1WOQ A;  3QEX A;  1EP4 A;  2E1Z A;  1ZXO A;  3SUO A;  4B08 A;  3NHG A;  1MWK A;  4IJA A;  3NCI A;  2A41 A;  3ZT2 A;  4AH9 A;  3G25 A;  1BA0 A;  1ZBH A;  3QB0 A;  4CHO A;  1IKV A;  3ASM A;  3UKU A;  4C1N K;  3CME N;  4JI3 K;  3NF6 A;  2QI2 A;  3OS1 A;  2VQE K;  3O9R A;  5AQX A;  3CJ1 A;  4JHD A;  3ZX3 A;  4BRM A;  4GMJ B;  5FPE A;  1BIU A;  1VQO N;  1SL1 A;  3VTI A;  1BA1 A;  3GE1 A;  4DQI A;  1C0F A;  4QOZ B;  4CGF A;  1WBD A;  4CJR A;  4K0K K;  3AO2 A;  2O8C B;  5AJ3 K;  1BQN A;  4RW9 A;  3CM6 A;  1R0A A;  4C8L A;  3O6W A;  3TSP A;  1KFD A;  4KV8 A;  4B1Z A;  4DF8 A;  3WEE B;  3CCR N;  1N8R O;  3HOT A;  3WNH A;  4Y1D A;  3QET A;  4W5N A;  1X9S A;  4WQ5 A;  4BDP A;  3HTV A;  3RVC A;  4ZTJ A;  4E0D A;  2Z1J A;  3CJ7 A;  1ESV A;  2PYJ A;  4BRD A;  1QZ5 A;  3IMX A;  1ATR A;  2VWB A;  4B3S K;  1E3M A;  2HBK A;  3T19 A;  3L0Q A;  4HWI A;  3M8R A;  3NGI A;  4OX9 K;  1S6P A;  3TAB A;  4ILH A;  1RFQ A;  1VAZ A;  4DF4 A;  1C6V A;  1RTJ A;  3WXJ A;  1YTA A;  4DLE A;  4JRQ A;  1OVQ A;  2UUC K;  1TV6 A;  4KTZ A;  4FK4 A;  1N5Y A;  2OPS A;  1JLQ A;  3VEZ A;  2DTU A;  3HPG A;  1HYV A;  4JS5 A;  3THX A;  1Y64 A;  4FZX C;  2YKN A;  4F2S A;  4JI1 K;  1VQP N;  3QBX A;  2IGI A;  5LJV A;  3J80 O;  4FJ9 A;  1NK4 A;  1E4F T;  3UB5 A;  2FBY A;  4HUF A;  2XHB A;  2CH6 A;  2FF6 A;  2CGL A;  4NB4 A;  1TAU A;  2EHG A;  3CHW A;  3CM5 A;  4Y1C A;  2JGU A;  4I9Q A;  1MDU B;  4GW6 A;  4FWK A;  3MAQ A;  4Z4E A;  1XQS C;  4KI6 A;  1NGI A;  3VQB A;  5FRO A;  4H0X B;  1IBK K;  3DLB A;  1VSK A;  4CCH A;  1S5J A;  4BRO A;  4IO8 A;  1RT4 A;  2D0P A;  4KHU A;  3VQD A;  4E19 A;  2A5X A;  2WUS A;  4Z4F A;  5AQU A;  1F21 A;  4CD3 A;  3OS2 A;  1JLG A;  1OH6 A;  1NNE A;  3SV3 A;  2NRT A;  3B6O A;  4B3O A;  4NCB A;  4X65 K;  2QWO A;  4CHQ A;  3PO5 A;  4DQ8 A;  3LWL A;  4BRC A;  3DYA A;  3CJ9 A;  3OBY A;  3WXL A;  1NK5 A;  3O8M A;  4ELU A;  1NK0 A;  5AQR A;  5AFU H;  4BRF A;  4BR2 A;  2ASP A;  2O8C A;  3MWT A;  4FJL A;  5BPM A;  3HI0 A;  1U6Z A;  2YX6 A;  1JLC A;  2FSK A;  1KVC A;  4LF9 K;  2Z1H A;  4AHU A;  5M1F A;  1KAX A;  3VOV A;  1EO1 A;  2HHU A;  4FLU A;  1NMD A;  5IT9 O;  4L3Q A;  3H6E A;  3BDP A;  2V51 B;  3C7N A;  5AFU A;  2DFF A;  4CJQ A;  4FJJ A;  3E9O A;  2QXL A;  1V4T A;  1EWR A;  5AQQ A;  4ILJ A;  3GBT A;  4WFA L;  1C0G A;  2PFU A;  4K41 A;  3H1Q A;  3CCJ N;  1YIJ N;  4CFB A;  4BRE A;  4KB0 A;  3C7N B;  5I3U A;  4JKD A;  3SI6 A;  1RBR A;  4GNI A;  4BC5 A;  5BRD A;  4Q0B A;  1KCF A;  4Z4C A;  2VG7 A;  3TTC A;  4H4O A;  3VQ8 A;  4X66 K;  4DFK A;  5E84 A;  3ALY A;  3EKS A;  2P9K B;  3ZSO A;  1C0T A;  3F2K A;  3KK3 A;  1BOT O;  4E1M A;  1Q8I A;  1TAQ A;  3WUH A;  1RT3 A;  4A2B A;  4JD2 A;  1W2B M;  4FWL A;  3HST B;  4MFB A;  1H1V A;  3A5M C;  2JWK A;  3SAG A;  3CG7 A;  3O9U A;  4BRQ A;  4CHN A;  3ZSQ A;  1Y97 A;  2ZQB A;  3Q7B A;  4RWT A;  1VQM N;  2UUA K;  3WXM B;  1KVA A;  3QLH A;  4KH5 A;  1ZBL A;  4DSJ A;  3THV A;  1QTM A;  2F8S A;  5CYM A;  1T03 A;  4DFM A;  4YOX A;  1TVR A;  2P9N A;  4LFB K;  5IWA K;  4CGD A;  1QE1 A;  1U49 A;  2ITM A;  3NF9 A;  3DXK A;  4B9M A;  4TSX A;  4HTU A;  4O0I A;  1E4G T;  3FZK A;  4FWS A;  4IG0 A;  3QEW A;  4DR1 K;  2YNH A;  2JLE A;  2HHT A;  3IRX A;  3SQ1 A;  3MED A;  3DMJ A;  2ZGY A;  4JK7 A;  3QER A;  4KTQ A;  3P1G A;  4CGG A;  3H45 C;  4KI4 A;  5BRF A;  4E7L A;  3U8X A;  3AVA A;  5FDL A;  3MDQ A;  4FWP A;  3ZSR A;  4E7J A;  3R6M A;  3MX2 A;  4FJ8 A;  2NRR A;  2A3Z A;  4AM6 A;  4EAH D;  2G8K A;  3V1R A;  3MX5 A;  1KLN A;  4FLY A;  3CET A;  4DV7 K;  4F9O A;  2RE2 A;  1N32 K;  1BDG A;  4KHQ A;  2O4G A;  2IVO A;  3E01 A;  1CXU A;  1K8K A;  5MLC Q;  4LF4 K;  3SAF A;  3VQ6 A;  3ZX2 A;  2KZM A;  3C6H A;  4K8Z A;  3AA2 A;  3L2Q A;  2NRH A;  1P8Z A;  3GOI A;  4H4M A;  5JVH L;  1YAG A;  4YNQ A;  2OTJ N;  2V52 B;  4YHH K;  4B9L A;  1QSL A;  5SZT A;  1MWM A;  3WNG A;  3JXU A;  4XIU A;  2HNY A;  4O5B A;  3CCQ N;  3LP3 A;  1NK7 A;  4O5F A;  3DM2 A;  3EN9 A;  3LP1 A;  4EIA A;  3M8P A;  3OA9 A;  4MDB A;  2FF3 B;  4NYN A;  4OKE A;  4ZTF A;  4DTR A;  2BUP A;  2FSJ A;  2P9N B;  1VSI A;  2HHS A;  4DV1 K;  2F8T A;  4BR5 A;  1VSF A;  3OYH A;  2A6A A;  1TL1 A;  1UA1 A;  3O08 A;  2FSN A;  3AGR A;  4JK8 A;  2ITG A;  2R7Y A;  3BUZ B;  4WQ5 C;  1GLL O;  4CEQ A;  2YKM A;  2VWJ A;  5EXW A;  5HRO A;  3ZT3 A;  2HVI A;  1T3V A;  2E5L K;  1BG3 A;  3CMA N;  5TKY A;  3ZLJ A;  2D0B A;  1T7P A;  4O55 A;  1HLU A;  4DTJ A;  3VA3 A;  4BRL A;  4DHY A;  3MEG A;  4PA1 A;  1HPZ A;  4WFN L;  1U2V A;  1RT2 A;  4KH6 A;  1CLQ A;  4FLW A;  4I9L A;  1ITG A;  3NAE A;  1I39 A;  4OVL A;  4OGC A;  1D9D A;  5DM7 L;  3LP0 A;  4Z4H A;  4JI4 K;  1K8A O;  3P5J A;  1QQM A;  2ASM A;  4FLZ A;  4XH5 A;  4IOX A;  4DTU A;  1ATN A;  3KWI A;  1JXE A;  1YTU A;  1VQK N;  5AZI A;  1RTI A;  3SYZ A;  4DKW A;  1TL3 A;  2IIR A;  1BIZ A;  4A5B A;  4DQR A;  3K5N A;  1TKT A;  4AF1 A;  1WSF A;  1EWQ A;  2PYL A;  4DSK A;  5AQL A;  1GOB A;  2W40 A;  3OYJ A;  5CYQ A;  5FRM A;  2YCH A;  3I0R A;  4CEA A;  3WQT A;  4JNE A;  2KKZ A;  3ZEU B;  3TTF A;  3ZET A;  4CZL A;  4JKF A;  4CK3 A;  3TAR A;  4HCC A;  1EKE A;  3FZM A;  3V9Z A;  3B6P A;  5M1O A;  4MQ3 A;  3CFR A;  1S22 A;  1U4B A;  4CJ3 A;  1FKP A;  3JAM O;  5ADX H;  2HMP A;  4JKG A;  3O4W A;  1WBB A;  1GLJ O;  3ZT4 A;  4E89 A;  1CZA N;  4CFD A;  2FLO A;  4JK9 A;  4K43 A;  4GV6 A;  4DR6 K;  1XMO K;  5GAE P;  4DSE A;  1IO2 A;  1GLF O;  2QWM A;  4XH4 A;  2GEM A;  1FXX A;  3OYD A;  3SZ2 A;  4FJ5 A;  3H3O B;  4BGB A;  3SAH A;  4DLG A;  2XY6 A;  2YNG A;  4QS7 A;  1ZBU A;  2I7P A;  5ELZ A;  3HXM A;  1SQK A;  3AVM A;  2QWR A;  5CZ1 A;  4F2R A;  4GKK K;  1YJ9 N;  3HJF A;  4JI0 K;  1J54 A;  2DY4 A;  4FWO A;  3U9D A;  1Z26 A;  4GVE A;  1KVB A;  4A2A A;  2NRV A;  4FZY A;  2B5J A;  3DJC A;  4I7F A;  2FBT A;  4ELT A;  4LC9 B;  4F8R A;  2E4L A;  4DQQ A;  2QW9 A;  1U04 A;  1RTH A;  2G8I A;  1IKY A;  3RR7 A;  3OS0 A;  2ZM6 K;  3LP2 A;  4GV3 A;  4G1Q A;  3MXI A;  3AVF A;  1G99 A;  1UA0 A;  4MO5 A;  3EZW A;  4BQZ A;  4N76 A;  3LDO A;  1RIL A;  2QTD A;  3THX B;  3KLH A;  3OYN A;  1U47 A;  4GKJ K;  3THW B;  2YHY A;  3PO4 A;  4M3R A;  3EYZ A;  3J81 O;  2P9I A;  1C1A A;  3ENB A;  3V9W A;  4ISE A;  4B1W B;  2LSN A;  4B1V A;  1N33 K;  3F5T A;  1ILY A;  4M7X A;  1NJI O;  4MO4 A;  3T7Z A;  3VTH A;  3OJS A;  4FL9 A;  3OHR A;  3A2F A;  4LF5 K;  3SCX A;  3NVK A;  3MEC A;  4RG8 A;  2O8E A;  4OJR A;  3DAW A;  3K9K A;  3DOK A;  5KPR A;  3RSE B;  3TAP A;  4FJN A;  4CJF A;  5TKW A;  1LW0 A;  2FBV A;  1TK8 A;  4BC3 A;  4FLV A;  3C0B A;  4NXM K;  4JI2 K;  4B9T A;  1YVN A;  2O8F A;  4EHU A;  1VQ4 N;  3O4Q A;  3HK2 A;  3ZX0 A;  2NRZ A;  3LDP A;  4CK2 A;  2F9W A;  3OYF A;  2D5R A;  4H0P A;  5SWM A;  3FGU A;  4G9Z A;  4LSN A;  4DTM A;  3P31 A;  4ICL A;  2YJE A;  3AY9 A;  1NBW A;  2ETJ A;  3HT3 A;  3HM8 A;  3RMC A;  3AAQ A;  4KBO A;  1ASV A;  3CFO A;  4M3Y A;  1NJY A;  3TAM A;  3M5R A;  3T1Y K;  4I6M A;  4HTL A;  4FWM A;  1KXP A;  2EX3 A;  4FJX A;  1JLE A;  2BE2 A;  1ZYQ A;  3V6D A;  3J7A P;  3NFA A;  2HVH A;  3HSC A;  1RT6 A;  2YV0 X;  4QS8 A;  2HF4 A;  4WF9 L;  1NGE A;  2HNZ A;  3GG4 A;  4J2A A;  1CZ9 A;  2HMI A;  4F3O A;  3SMP A;  2RKI A;  4CE9 A;  1EX4 A;  1P90 A;  4CEC A;  4DCH A;  1NGF A;  4CZE A;  1SAZ A;  4KHY A;  3D6R A;  5BR8 K;  4BVP A;  3C6T A;  4KAZ A;  2O8E B;  2BTF A;  3ZEU A;  5FLX O;  3CI5 A;  1A5X A;  2HST A;  4CI6 A;  3TAE A;  3VQE A;  3U9Z A;  4H0T B;  1N36 K;  3DXK B;  4YOU A;  4CEO A;  3CJB A;  1NWK A;  2AA4 A;  3RSE A;  3O3G A;  2WBN A;  3QEP A;  3R3L A;  4QCL A;  1NG9 A;  4CIE A;  1NJX A;  5CZ2 A;  3L2U A;  3RMA A;  1HMV A;  1Z25 A;  4OGE A;  4CF2 A;  2P9I B;  1BU6 O;  4LF7 K;  1QQO A;  4IDH A;  4JN4 A;  4EFH A;  2QWL A;  1G15 A;  3D2F A;  4BE0 A;  2ZD1 A;  4CVN E;  4MLH A;  3CPE A;  1VQ7 N;  2G8W A;  4O4G A;  4WQ4 C;  1RGI A;  3THY B;  1KFS A;  4W5Q A;  3V4I A;  1WSH A;  4FW2 A;  4Z4G A;  2P9K A;  3CER A;  1TKZ A;  4XH1 A;  4QS9 A;  3AO1 A;  3R1X A;  5AQF A;  1BWF O;  3SBG A;  3CQ8 A;  4E1J A;  2RPI A;  4B9S A;  4JD2 B;  1T6C A;  1RBT A;  2E20 A;  1JJ2 M;  3ZYY X;  4FM0 A;  1TKD A;  3LM9 A;  1HJR A;  3UE5 A;  5BPN A;  3D0P A;  4A61 A;  1JLB A;  3O1B A;  3ULE A;  1GLE G;  2IDO A;  4FOE A;  3DWL A;  2D4W A;  3RRH A;  1SV5 A;  2OCE A;  1JLF A;  1GLC G;  1VQ8 N;  3V9X A;  3TAF A;  2VGN A;  1S72 N;  3LZI A;  3WT0 A;  4M3X A;  4IZ9 A;  4M3Z A;  1O1W A;  3H46 O;  2QK9 A;  4IO9 L;  2E88 A;  2BGG A;  4AHR A;  5EX5 A;  4E7H A;  3HYF A;  3SUP A;  4CJS A;  3ULD A;  3TTD A;  1OH7 A;  3KWG A;  1CZB A;  3V81 A;  3PUF A;  3I8B A;  3EY1 A;  3FZH A;  2Z1I A;  4DG1 A;  4IFE A;  1TKX A;  1VSD A;  2YNF A;  4PHT X;  4BR0 A;  4CGJ A;  1WB9 A;  2HW3 A;  3L3V A;  3L8B A;  4PUO A;  1X9J A;  3DI6 A;  2VG6 A;  5JIC A;  3J7Z O;  3SUQ A;  2G8F A;  1NLV A;  3IFR A;  3OYL A;  3EEQ A;  3L4I A;  3P38 A;  4JKA A;  1BGX T;  1N34 K;  2F9T A;  3P83 D;  3K57 A;  3D45 A;  5EY4 A;  1NGA A;  3K5O A;  4LSL A;  5HOO A;  4CZF A;  2HOE A;  4YOT A;  1J5O A;  3HPO A;  1ATS A;  4Z0U A;  3EZ5 A;  4KB1 A;  3E66 A;  1U48 A;  4GY2 B;  2BH1 A;  4Y0W A;  2J4R A;  5EOY A;  3TWH A;  4EZ9 A;  3KLI A;  1VSH A;  1BIS A;  4JV5 K;  3DLH A;  1VQL N;  4CIG A;  1S9E A;  4FM1 A;  2RF2 A;  5HRP A;  3T3F A;  1GOA A;  4CED A;  3O9Q A;  4V19 S;  3O4N A;  1OVY A;  1A5V A;  3FFI A;  2HBL A;  4JKB A;  3EE9 A;  3HVR A;  3LAK A;  4B9U A;  3FLC O;  2P9U A;  4NO7 A;  4FO0 A;  4H5T A;  1KLM A;  4KHP K;  4IDK A;  1VSM A;  5AQM A;  3P39 A;  5AQH A;  3R9P A;  1S1T A;  3VES A;  4DR5 K;  3PSF A;  4I2Q A;  1S3X A;  1V4S A;  3AAR A;  4DS5 A;  3QBW A;  4NCG A;  3M3Z A;  1DGK N;  3QML A;  3N4Q A;  3FR0 A;  2Q36 A;  3UIQ A;  4BVO A;  1X9W A;  2KFN A;  1NGG A;  3I8D A;  2F7T A;  3HVT A;  3ISN C;  3TAG A;  1IH7 A;  1S1W A;  4DR3 K;  3VEX A;  5C10 A;  3DRR A;  5J2Q A;  4FWN A;  2UXB K;  3OY9 A;  3L2V A;  3LDL A;  4BRI A;  4JYA K;  1LOT B;  4J8F A;  3OBW A;  3T1A A;  4LD0 A;  3I56 N;  2QKK A;  3EL2 A;  1RDU A;  4AHV A;  3UKR A;  2A1R A;  5AQP A;  4KRE A;  4IXC A;  4CW7 B;  3NF8 A;  2PY5 A;  4CEZ A;  4KPY A;  5EU7 A;  4NLC A;  3KLF A;  2PBD A;  1WSJ A;  4J2E A;  3SV4 A;  1LV5 A;  4FSV A;  2KZZ A;  5E41 A;  3QNN A;  1HJO A;  2VYP A;  3DLR A;  1HKB A;  3VQC A;  2QXF A;  4NLB A;  4CF1 A;  1TK5 A;  1HNI A;  2HHW A;  3HO1 A;  3IUC A;  1LWF A;  2I5J A;  5F2R A;  1RBS A;  4CGH A;  1LW2 A;  2A1S A;  4BDY A;  4DU1 A;  3I33 A;  4KKO A;  3VEW A;  2Q2R A;  1HX1 A;  1SZ2 A;  3OTO K;  3BF3 A;  2OA8 A;  2VQF K;  2XY7 A;  2O8F B;  3NDK A;  2VCP A;  2W6K A;  5AQN A;  3F73 A;  3U4L A;  3CQY A;  4DQS A;  3AVL A;  1Q82 O;  5LMU K;  4QAG A;  4L8R B;  1TYQ A;  5JS2 A;  1KC8 O;  2OAN A;  5T7B A;  3WNE A;  1Q18 A;  4DB3 A;  1DTT A;  1NGC A;  3CIP A;  5BRH A;  1ZBF A;  2A42 A;  5C2D A;  4CEB A;  1VK0 A;  1OH8 A;  3O3F A;  1KTQ A;  4BWM A;  2NRX A;  3VER A;  4MDA A;  1JL1 A;  4F3T A;  3FZL A;  1S6Q A;  3SUN A;  3VEY A;  2P9S A;  1NOY A;  4JS4 A;  2OPQ A;  3CF5 L;  5HRN A;  2QWQ A;  3JS6 A;  4OPJ A;  3KK1 A;  1L3V A;  3HOS A;  4CJ4 A;  4CJE A;  3KZB A;  1HQU A;  4M63 C;  3PIO L;  3VGL A;  4C8N A;  1YHQ N;  4DMN A;  4CJP A;  3RTV A;  4DU3 A;  3VEN A;  1TUU A;  4LFA K;  3CCV N;  2QEX N;  4DTO A;  1TYQ B;  1HNX K;  3ATV A;  5DM6 L;  4H5N A;  4ID5 A;  3E9P A;  4WQ4 A;  4BRA A;  4W5T A;  3L2R A;  3DXM A;  3QO9 A;  3KLE A;  2KTQ A;  1J53 A;  3SJJ A;  4M3W A;  3LDS A;  4FK2 A;  3BEX A;  1JCG A;  3S3N A;  1W0H A;  4LFC K;  3NE6 A;  2OZM A;  3QIC A;  2YHB A;  2X6S A;  4KTW A;  2O4I A;  5CE3 A;  4CHP A;  1QQN A;  3DLK A;  1K8K B;  4EZ6 A;  4NCA A;  1DT9 A;  5E26 A;  5FPD A;  1JLA A;  1JCF A;  1WN7 A;  2KW4 A;  2XY8 A;  4DV0 K;  2V7Z A;  2G8U A;  3QEI A;  1CXQ A;  3OYG A;  4LF6 K;  2HHV A;  3QIO A;  3UKR B;  5FPN A;  3WQU A;  1BO5 O;  1C1C A;  1HNW K;  3ULE B;  4FZZ A;  4J2D A;  5LL6 Z;  3LPU A;  1B9F A;  3NH1 A;  4BRH A;  3TAN A;  1Q7Y O;  1WUA A;  3I0S A;  4FVM A;  2VGM A;  4H5W A;  4B9N A;  4BY9 C;  1WLJ A;  3VEO A;  3D2E B;  4CBX A;  3LL3 A;  3FE1 A;  2IVN A;  4KHS A;  1SS6 A;  1RBU A;  4CJK A;  4FJM A;  3M8Q A;  2P9S B;  5K14 A;  4NXN K;  5HLF A;  4AQY K;  2GEL A;  2QWP A;  4CER A;  5BPL A;  3RWU A;  1TGO A;  4XEI A;  1NJW A;  1QVG M;  1VSL A;  4JEP A;  2QWN A;  4BAC A;  3HP6 A;  4DTP A;  4FLX A;  3MCA B;  1QS4 A;  4DFP A;  3NBP A;  3VQ7 A;  4O8U A;  1HKC A;  2IC3 A;  4O44 A;  4FWR A;  1KAY A;  3K5M A;  1NKC A;  4CJ5 A;  1RCH A;  3B8A X;  3TR8 A;  3NH2 A;  5AQS A;  1UAX A;  3N4P A;  3O9T A;  4IEI A;  4AIL C;  2UYT A;  1Q9Y A;  2AJQ A;  2DFH A;  4JLH A;  1C0M A;  1FK9 A;  5AQW A;  2AP1 A;  1LAV A;  2P9P A;  4PKI A;  2B4J A;  1NOZ A;  1RT1 A;  1HYZ A;  2Q1N A;  1VRU A;  2WOM A;  3EKU A;  4A5A A;  1BQM A;  1VQ6 N;  1HYS A;  3O9S A;  5BN8 A;  2GTD A;  5KQD A;  4B8C A;  3MCP A;  1JCE A;  4BRN A;  4OPH A;  3CXC M;  3AVC A;  1NGJ A;  1VQN N;  2HND A;  4YOV A;  3A5O C;  3IS9 A;  3P4I A;  1MA9 B;  1KRP A;  3OYB A;  3D2E A;  3DLE A;  3D7E O;  4A62 A;  4K8X A;  3PLA A;  3ENH A;  3WEE A;  3SQ0 A;  4ID1 A;  4CEF A;  3ZSV A;  4B3R K;  3AVK A;  1DLO A;  3HPH A;  4ISF A;  3L2W A;  3QIP A;  4FLT A;  2E2O A;  1XC9 A;  3KHY A;  5KRS A;  3JSM A;  1J5E K;  3O3H A;  2RHK A;  3QDK A;  2NZT A;  2QA4 N;  1IJJ A;  3PV8 A;  4EP5 A;  5F0X A;  1YJN N;  4CFA A;  3SQ4 A;  5KTQ A;  5C2F A;  3SBT A;  4RW8 A;  5C15 A;  5AZJ A;  3DRP A;  1NGH A;  2UU9 K;  3DOL A;  4FPA A;  2HHH K;  2E8A A;  1DTQ A;  3NF7 A;  3RRG A;  3DRS A;  2NNW A;  3UKU B;  1VQ5 N;  4DU4 A;  2KQ2 A;  2F96 A;  3VQA A;  3A5N C;  4CZG A;  4JKE A;  3KLG A;  1D4X A;  3K59 A;  3CC4 N;  4DUZ K;  2ZJR L;  2WFB A;  4KFB A;  3NH0 A;  1ASU A;  3SNN A;  4C8O A;  3KIO A;  3TI0 A;  2GV9 A;  1SUQ A;  4LH4 A;  4J2B A;  5F1X A;  1OH5 A;  3QEV A;  3W0L A;  5KGX A;  1L3S A;  4CZJ A;  3PSI A;  2W41 A;  5I42 A;  2D1K A;  4C1N I;  4CJU A;  2Q3S A;  1NK9 A;  1W97 L;  4R79 A;  4PQU A;  3HZ6 A;  1UOC A;  2P9L B;  1Z6R A;  4IOC L;  1ZC6 A;  2NUB A;  5C42 A;  1LCU A;  1BI4 B;  3OYE A;  3CQX A;  3F9M A;  4IFV A;  3G10 A;  2P1J A;  1QSS A;  1Q9X A;  2ZF5 O;  1RT5 A;  4B8A B;  1LWE A;  3K2P A;  3K0S A;  3MXM A;  1XI1 A;  2DPN A;  3TSU A;  2EWS A;  1HPM A;  3MEE A;  3CFP A;  4JAX A;  2P9L A;  4HUG A;  4RW4 A;  3SPZ A;  3V9S A;  1IG9 A;  3FFK B;  3E1Y A;  1W9H A;  1T8E A;  1FJG K;  3KK7 A;  4GV9 A;  2IAJ A;  3S3O A;  2D0O A;  3ZSZ A;  3AO5 A;  1WSI A;  4AHC A;  2X78 A;  2X6N A;  1N6Q A;  4N41 A;  1QHA A;  4KH4 A;  4U7B A;  3BP8 A;  2OYQ A;  3VMF B;  4IKF A;  1NJZ A;  4AHT A;  2VWK A;  3SK3 A;  5C12 A;  1RBV A;  2GUI A;  4DWI A;  4K42 A;  4OKJ A;  4CZI A;  4ZHR A;  1X9M A;  1C0U A;  3ITH A; 
#chains in the Genus database with same CATH homology
 2D0B A;  4OLA A;  4IDK A;  1T7P A;  1VSM A;  1SKS A;  4O55 A;  2Z1G A;  4M42 A;  4DTJ A;  3VA3 A;  4BE1 A;  1EET A;  4KHN A;  4KHW A;  1S1T A;  3MEG A;  4I2Q A;  4PA1 A;  4CGI A;  1B92 A;  4DS5 A;  1HPZ A;  1QHT A;  3AO3 A;  1RT2 A;  4NCG A;  1TK0 A;  1N6Q A;  5KRT A;  1CLQ A;  3KJV A;  4FLW A;  4FXD A;  1BCO A;  4I9L A;  4CF8 A;  1ITG A;  3LWM A;  4M3T A;  3UIQ A;  1X9W A;  3NAE A;  5J2P A;  1I39 A;  2YHA A;  4OVL A;  4OGC A;  3V9U A;  1D9D A;  1S1U A;  2KFN A;  2KFZ A;  3I8D A;  5KGW A;  3HVT A;  3ISN C;  2RN2 A;  1J9A A;  1IH7 A;  3LP0 A;  3VQ4 A;  4Z4H A;  1S1W A;  3TAG A;  1RDA A;  3MXJ A;  3DRR A;  3V1Q A;  2WON A;  2ATQ A;  1IKX A;  1MU2 A;  2E6L A;  4IFY A;  3C94 A;  3P5J A;  3VQ9 A;  4CJV A;  3HP9 A;  4C8M A;  5J2Q A;  4FLZ A;  1L3U A;  3OY9 A;  4DTU A;  1XHX A;  3QES A;  3SQ2 A;  2XRI A;  3L2V A;  4RW7 A;  5J2N A;  4PY5 A;  3AVB A;  1JXE A;  3OVN A;  4DTN A;  1YTU A;  1RTI A;  3T1A A;  4LD0 A;  4E7K A;  2QKK A;  3SYZ A;  4AHV A;  2A1R A;  1TL3 A;  4LY7 A;  1BIZ A;  4DSF A;  4KRE A;  3QIN A;  3NF8 A;  4DQR A;  2PY5 A;  4CEZ A;  4KPY A;  3K5N A;  1TKT A;  4CIF A;  2P5O A;  4FW1 A;  5EU7 A;  2G8H A;  3ZCM A;  3KLF A;  1WSF A;  1BL3 A;  4FYD A;  1WSJ A;  2PYL A;  4J2E A;  4DSK A;  4W5R A;  1GOB A;  3SV4 A;  4KO0 A;  3OYJ A;  1LV5 A;  2KZZ A;  5CYQ A;  5E41 A;  1JXB A;  3I0R A;  3VQP A;  4CEA A;  4DFJ A;  1WAF A;  3QNN A;  4ELV A;  5FRM A;  1LWC A;  3DLR A;  4H8K A;  1A5W A;  3PY8 A;  4CEE A;  4Q5V A;  1S1X A;  2YNI A;  3VQC A;  2QXF A;  3PX0 A;  4CF1 A;  1TK5 A;  1HNI A;  4CHY A;  2HHW A;  1HQE A;  3HO1 A;  1LWF A;  1WNS A;  2I5J A;  4CJL A;  1RBS A;  4CGH A;  1BCM A;  2FBX A;  4CK3 A;  3TAR A;  1EKE A;  1I3A A;  4EP4 A;  4CFC A;  1SL2 A;  4HCC A;  1T05 A;  3V9Z A;  3B6P A;  1LW2 A;  2A1S A;  1B9D A;  4IG3 A;  4OPK A;  4BDY A;  4DU1 A;  4MQ3 A;  3CFR A;  3NGY A;  4KKO A;  3KKR A;  3HL8 A;  3AVH A;  3QEX A;  1U4B A;  3VQQ A;  1EP4 A;  4CJ3 A;  3SUO A;  4B08 A;  3VA0 A;  3NHG A;  1FKP A;  2OA8 A;  3NCI A;  4FJI A;  2XY7 A;  3ZT2 A;  4AH9 A;  3ZT4 A;  4E89 A;  3NDK A;  4CFD A;  3OYM A;  1ZBH A;  4CHO A;  3F73 A;  3V1O A;  4DQS A;  1IKV A;  3ASM A;  2PZS A;  4DSE A;  1IO2 A;  1VSJ A;  3AVL A;  2ZE2 A;  4QAG A;  1FXX A;  3NF6 A;  3OS1 A;  4L8R B;  5JS2 A;  1YVU A;  3OYD A;  3SZ2 A;  1JL2 A;  4FJ5 A;  5T7B A;  3WNE A;  3OYC A;  5C25 A;  4F4K A;  1DTT A;  4DLG A;  2XY6 A;  2YNG A;  4GMJ B;  2D0A A;  3LAM A;  1ZBU A;  1BIU A;  1SL1 A;  4JRP A;  1ZBF A;  4CEB A;  1VK0 A;  3HXM A;  2HB5 A;  3AVM A;  3O3F A;  1KTQ A;  4BWM A;  4DQI A;  2HHX A;  1RTD A;  4F2R A;  5CZ1 A;  4F3T A;  1JL1 A;  4QOZ B;  4CGF A;  3HJF A;  4CJR A;  3AO2 A;  1S6Q A;  4Z4I A;  1J54 A;  1FKO A;  1BQN A;  4RW9 A;  1Z26 A;  3CM6 A;  1KVB A;  3PX4 A;  3SUN A;  1R0A A;  5HRS A;  3DLG A;  4C8L A;  2B5J A;  1KFD A;  4KV8 A;  4FZY A;  1NOY A;  1ZBI A;  3M8S A;  2OPQ A;  2FBT A;  4I7F A;  4JS4 A;  4DF8 A;  1D8Y A;  4RW6 A;  5HRN A;  2P5G A;  4ELT A;  1S1V A;  4FJK A;  4F8R A;  4HUE A;  5D3G A;  2E4L A;  4DQQ A;  3L3U A;  3WNH A;  4Y1D A;  4OPJ A;  3KK1 A;  1U04 A;  1RTH A;  1HRH A;  1L3V A;  4CJ4 A;  3QET A;  2G8I A;  4W5N A;  1IKY A;  4CJE A;  1X9S A;  3RR7 A;  4N47 A;  4BDP A;  3OS0 A;  2DY4 A;  3LP2 A;  1HQU A;  4G1Q A;  3MXI A;  4YFU A;  3NGZ A;  3AVF A;  4ZTJ A;  4C8N A;  4E0D A;  4CK1 A;  1UA0 A;  2Z1J A;  4DMN A;  5C24 A;  1L3T A;  1NK8 A;  4CJP A;  3RTV A;  4N76 A;  4DU3 A;  2PYJ A;  4IBN A;  2Y1J A;  3WNF A;  1RIL A;  4CES A;  4DTO A;  3T19 A;  3KLH A;  3AVI A;  3OYN A;  1U47 A;  4ID5 A;  3AO4 A;  3U3G A;  3M8R A;  3NGI A;  1S6P A;  3TAB A;  4W5T A;  3L2R A;  3PO4 A;  4M3R A;  4DF4 A;  3QO9 A;  1NKB A;  1C6V A;  3KLE A;  3EYZ A;  2OPP A;  1RTJ A;  2KTQ A;  4FCY A;  1YTA A;  4DLE A;  1C1A A;  1J53 A;  3V9W A;  4JRQ A;  3SJJ A;  4M3W A;  3LDS A;  4FK2 A;  2LSN A;  1TV6 A;  3S3N A;  1W0H A;  1RDD A;  3NE6 A;  1U45 A;  2OZM A;  1ASW A;  2YHB A;  2X6S A;  4KTW A;  4KTZ A;  1N5Y A;  2OPS A;  4FK4 A;  1JLQ A;  2DTU A;  3OJS A;  3HPG A;  1HYV A;  2VG5 A;  4JS5 A;  2O4I A;  3A2F A;  4CHP A;  4FZX C;  3DLK A;  3AA4 A;  2YKN A;  3SCX A;  4F2S A;  4W5O A;  3MEC A;  4EZ6 A;  5HBM A;  4RG8 A;  4NCA A;  3S3M A;  3QNO A;  1VSE A;  4OJR A;  2IGI A;  3DOK A;  3TAP A;  4FJN A;  4FJ9 A;  1NK4 A;  2D0C A;  4CJF A;  1LW0 A;  1JLA A;  2FBY A;  1WN7 A;  2KW4 A;  2FBV A;  2XY8 A;  4HUF A;  2XHB A;  1TK8 A;  2BDP A;  1TAU A;  1SKR A;  2EHG A;  3CM5 A;  4Y1C A;  4M45 A;  4FLV A;  3QEI A;  1CXQ A;  3OYG A;  2G8U A;  4B9T A;  3G0Z A;  3OYI A;  2HHV A;  3O4Q A;  3QIO A;  2JGU A;  3HK2 A;  4I9Q A;  5FRN A;  4CK2 A;  4GW6 A;  4Z4E A;  3MAQ A;  3PX6 A;  3OYF A;  1C1C A;  1QSY A;  2D5R A;  4KI6 A;  4FZZ A;  4J2D A;  5SWM A;  4M3U A;  4DTS A;  3VQB A;  3LPU A;  4LSN A;  5FRO A;  4DTM A;  1B9F A;  4ICL A;  1GOC A;  3NH1 A;  1VSK A;  2ETJ A;  3DLB A;  3HT3 A;  4CCH A;  3RMC A;  1S5J A;  4E7I A;  3TAN A;  1RT4 A;  4KHU A;  3VQD A;  4OKK A;  3I0S A;  4FVM A;  1ASV A;  4E19 A;  3AA5 X;  1L5U A;  4CHZ A;  3CFO A;  4LH5 A;  4M3Y A;  4Z4F A;  1NJY A;  3TAM A;  4B9N A;  1WLJ A;  4FK0 A;  2GBZ A;  1F21 A;  2EX3 A;  4KHS A;  4FJX A;  1JLE A;  3OS2 A;  1JLG A;  2BE2 A;  3S9H A;  1ZYQ A;  3V6D A;  1RBU A;  4CJK A;  3NFA A;  4FJM A;  2W42 A;  3M8Q A;  2HVH A;  3SV3 A;  5K14 A;  4AHS A;  5HLF A;  1KSP A;  1RT6 A;  2YV0 X;  2B6A A;  3B6O A;  1WSE A;  3OJU A;  4CER A;  2HNZ A;  4NCB A;  4B3O A;  4DTX A;  2Y1I A;  4CHQ A;  3RWU A;  3PO5 A;  4J2A A;  3LWL A;  1CZ9 A;  1TGO A;  2HMI A;  3DYA A;  1NK5 A;  1NJW A;  1VSL A;  4ELU A;  4F3O A;  5CY4 A;  1NK0 A;  4BAC A;  2RKI A;  4CE9 A;  1EX4 A;  5JS1 A;  2DFE A;  4CEC A;  3HP6 A;  5KI6 A;  4DTP A;  4FLX A;  4R5P A;  4FJL A;  2FC0 A;  1JLC A;  1QS4 A;  1KVC A;  3NBP A;  3VQ7 A;  4DFP A;  2Z1H A;  4AHU A;  2XO7 A;  1WSG A;  2IC3 A;  4O44 A;  1SL0 A;  4KHY A;  2HHU A;  3K5M A;  1JKH A;  3C6T A;  4FLU A;  1NKC A;  4CJ5 A;  1RCH A;  4KAZ A;  2F8T A;  3BDP A;  2E6M A;  3TR8 A;  3NH2 A;  1NK6 A;  1A5X A;  1UAX A;  4HHT A;  3KD5 E;  1IKW A;  1BHL A;  2DFF A;  4CJQ A;  5DK5 A;  3TAE A;  3VQE A;  4FJJ A;  4CJT A;  4AIL C;  1Q9Y A;  2AJQ A;  4KRF A;  3C95 A;  2DFH A;  4JLH A;  1C0M A;  1FK9 A;  4WE1 A;  3ZSW A;  2X74 A;  4FJ7 A;  4OLB A;  4CEO A;  1LAV A;  4DSI A;  3O3G A;  3LAL A;  4GVM A;  3VN5 A;  3QEP A;  4QCL A;  4CIE A;  2B4J A;  4CFB A;  1NJX A;  5CZ2 A;  1NOZ A;  1RT1 A;  1HYZ A;  3L2U A;  1VRU A;  1HMV A;  3JYT A;  2WOM A;  3RMA A;  5I3U A;  1Z25 A;  1BQM A;  4OGE A;  4CF2 A;  1HYS A;  3SI6 A;  1RBR A;  3TAQ A;  4Q0B A;  3CYM A;  1KCF A;  4Z4C A;  4E3S A;  4B8C A;  2VG7 A;  4H4O A;  3VQ8 A;  4N56 A;  3KTQ A;  1G15 A;  4DFK A;  4BE0 A;  3ALY A;  2ZD1 A;  3ZSO A;  1C0T A;  3KK3 A;  4CJW A;  4KB0 A;  4HVJ A;  2G8W A;  4O4G A;  4E1M A;  3AVC A;  1Q8I A;  1TAQ A;  3AVN A;  1KFS A;  1RT3 A;  4W5Q A;  1EXQ A;  2HND A;  1WSH A;  4BE2 A;  3V4I A;  4FW2 A;  3IS9 A;  4Z4G A;  3U6F A;  1TKZ A;  1D5A A;  3ZSX A;  3KK2 A;  3AO1 A;  3HST B;  4MFB A;  2IOC A;  1LAW A;  1KRP A;  3CG7 A;  4CHN A;  3OYB A;  1C1B A;  1RDC A;  1Y97 A;  3DLE A;  3ZSQ A;  3CQ8 A;  2P51 A;  2RPI A;  2ZQB A;  4CF0 A;  4B9S A;  4K8X A;  1RBT A;  3AVG A;  4FM0 A;  1TKD A;  2XY5 A;  1HJR A;  3SQ0 A;  4ID1 A;  4CEF A;  5DMR A;  3ZSV A;  3D0P A;  3AVK A;  1DLO A;  1JLB A;  3HPH A;  1KVA A;  3OYK A;  3QLH A;  3L2W A;  3QIP A;  4FLT A;  1ZBL A;  3U3Y A;  4DSJ A;  3THV A;  1XC9 A;  2IDO A;  3OYA A;  1XWL A;  5KRS A;  3JSM A;  1QTM A;  2F8S A;  5CYM A;  1T03 A;  3O3H A;  4DFM A;  1WAJ A;  3RMD A;  4CF9 A;  1TVR A;  3RRH A;  1SV5 A;  3PV8 A;  4EP5 A;  2OZS A;  3SPY A;  4CFA A;  4CGD A;  1JLF A;  5KTQ A;  3SQ4 A;  1QE1 A;  4RW8 A;  1U49 A;  3V9X A;  3TAF A;  3AV9 A;  4BWJ A;  3LZI A;  4M3X A;  3NF9 A;  4M3Z A;  1O1W A;  4B9M A;  2BAN A;  4TSX A;  3LPT A;  2QK9 A;  4HTU A;  4O0I A;  3DRP A;  4IG0 A;  3DOL A;  3QEW A;  1UWB A;  2HHQ A;  2BGG A;  4UQG A;  4AHR A;  2YNH A;  2JLE A;  2HHT A;  1YT3 A;  1DTQ A;  3NF7 A;  3IRX A;  3LAN A;  3RRG A;  4I2P A;  3SQ1 A;  3MED A;  4E7H A;  3DRS A;  5J2M A;  3DMJ A;  3HYF A;  3SUP A;  3F9K A;  3QER A;  4B9V A;  1QQC A;  3P1G A;  4CJS A;  4CGG A;  3ULD A;  2KQ2 A;  4DU4 A;  3RR8 A;  4KTQ A;  1CZB A;  2F96 A;  4KI4 A;  3V81 A;  3VQA A;  3PUF A;  4E7L A;  4E1N A;  3KLG A;  3EY1 A;  5HP1 A;  3AVA A;  3K59 A;  2Z1I A;  5FDL A;  4DG1 A;  5HRR A;  1BI4 A;  3VQ5 A;  3ZSR A;  4M41 A;  1TKX A;  1VSD A;  4E7J A;  2YNF A;  2HW3 A;  4CGJ A;  3IAY A;  3L3V A;  4KFB A;  3L8B A;  3NH0 A;  4PUO A;  1ASU A;  4FJ8 A;  3SNN A;  4C8O A;  3DI6 A;  3IG1 A;  2VG6 A;  3KIO A;  2GV9 A;  3TI0 A;  2G8K A;  3V1R A;  1SUQ A;  1VRT A;  4LH4 A;  4J2B A;  3SUQ A;  2G8F A;  1SKW A;  3QEV A;  1KLN A;  4FLY A;  3OYL A;  3H08 A;  4DS4 A;  4HCB A;  5KGX A;  3AA3 A;  3BGR A;  3K58 A;  1L3S A;  4FM2 A;  1BGX T;  1RNH A;  5I42 A;  4KHQ A;  2O4G A;  3E01 A;  1CXU A;  1K6Y A;  3P83 D;  1HNV A;  2Q3S A;  2IS3 A;  4CJU A;  3VQ6 A;  3ZT1 A;  3K57 A;  1NK9 A;  3D45 A;  2KZM A;  4PQU A;  3K5O A;  1UOC A;  4N5S A;  3KKS A;  3KD1 E;  4K8Z A;  3AVJ A;  3AA2 A;  3L2Q A;  4LSL A;  3ZSY A;  4H4M A;  3HM9 A;  4DSL A;  1RDB A;  1RT7 A;  2NUB A;  4YNQ A;  5C42 A;  1J5O A;  1BI4 B;  3OYE A;  4B9L A;  3HPO A;  1QSL A;  5SZT A;  3WNG A;  4IFV A;  3G10 A;  2P1J A;  1QSS A;  4XIU A;  1Q9X A;  4Z0U A;  3EZ5 A;  4KB1 A;  1RT5 A;  2HNY A;  4B8A B;  1U48 A;  1LWE A;  2QKB A;  3K2P A;  4NYF A;  4O5B A;  3LP3 A;  3MXM A;  1XI1 A;  1NK7 A;  4DQP A;  3DM2 A;  3LP1 A;  4FJH A;  3M8P A;  3MEE A;  4NYN A;  3CFP A;  3TWH A;  4HUG A;  1S9G A;  4RW4 A;  3SPZ A;  4C8K A;  4EZ9 A;  3KLI A;  4OKE A;  3V9S A;  4ZTF A;  4DTR A;  1IG9 A;  1VSH A;  1BIS A;  1W9H A;  1T8E A;  3RMB A;  1VSI A;  2HHS A;  1XHZ A;  3DLH A;  2IAJ A;  3S3O A;  3ZSZ A;  3AO5 A;  1WSI A;  1NKE A;  3ZT0 A;  4CIG A;  1S9E A;  4AHC A;  4FM1 A;  1VSF A;  2X6N A;  1X1P A;  2X78 A;  1REV A;  2RF2 A;  5J1E A;  3OYH A;  1TL1 A;  1UA1 A;  3K5L A;  5HRP A;  3T3F A;  4FJG A;  1D9F A;  4N41 A;  1GOA A;  3C6U A;  4CED A;  2OYQ A;  3O4N A;  2G8V A;  4IKF A;  2OPR A;  2ITG A;  1A5V A;  2R7Y A;  3FFI A;  1NJZ A;  4AHT A;  2VWK A;  3LZJ A;  3HVR A;  4CEQ A;  1RBV A;  4PWD A;  3LAK A;  2YKM A;  2VWJ A;  4B9U A;  2GUI A;  5HRO A;  4BDZ A;  4DWI A;  4OKJ A;  4ZHR A;  4O0J A;  3ZT3 A;  1X9M A;  2HVI A;  1C0U A;  1KLM A;  3ITH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...