4CJUA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjuA00
1BHLA 2IOCA 3PUFA 4I2PA 4O0IA 2R7YA 3DLKA 3SZ2A 3SQ0A 1N5YA 1C1AA 3LP3A 3NH0A 5J2MA 3ZT1A 3OYAA 3SPYA 4NCBA 1K6YA 3F9KA 3HL8A 1X9MA 3AA3A 2G8FA 3KLIA 1FKOA 2X6NA 2GBZA 1HMVA 4IG3A 5C42A 3ULDA 1LV5A 1GOAA 4DS4A 4PUOA 4CJRA 1HRHA 4CJTA 2IAJA 1JLAA 1BQNA 4CEZA 2WOMA 3L8BA 3SV4A 4H8KA 4CIGA 5J1EA 1X1PA 2ETJA 4HCCA 4M3TA 4PA1A 1LWEA 3KLHA 2D0AA 4CFAA 1NJYA 4FJMA 4W5NA 1RT5A 1IKYA 3O3HA 3VQ8A 3V1QA 3DLBA 1HJRA 1KVCA 2OYQA 3LWMA 4E3SA 4HUGA 3QETA 4CJLA 1BI4A 2P1JA 2ZE2A 1JLFA 5SWMA 3SUQA 2W42A 4KTQA 2AJQA 4N56A 3QEXA 4FLUA 4ID1A 4HCBA 4M3ZA 1JLBA 2LSNA 2HNDA 2G8HA 2B5JA 3K57A 3SUPA 1U4BA 3OYGA 1FK9A 1ZBUA 3QEIA 3SCXA 2HVIA 4M3XA 5KRTA 2G8IA 1HPZA 1LWCA 2OPPA 3AVGA 4HHTA 2HHSA 4FK4A 3TAQA 3NFAA 2FBXA 5HRNA 1IH7A 3TAEA 5CY4A 4FZZA 1RNHA 2RF2A 2X74A 4CGHA 4IG0A 3MEDA 1D5AA 3EZ5A 1ZBHA 2DTUA 4OKEA 3T1AA 5FROA 3V81A 4B9SA 1LWFA 1Y97A 1VSIA 4LH5A 4CJ4A 4FYDA 4KHYA 1QHTA 2EX3A 2XRIA 4RG8A 4DLGA 1T05A 2HMIA 3TAFA 4CGIA 3NH1A 2WONA 3TWHA 1GOCA 4TSXA 1VRTA 1ZBIA 1S1UA 2D0CA 4ELUA 1BISA 3LP1A 4CERA 3V9ZA 2RN2A 4KTWA 2KZZA 3ZT3A 2KQ2A 3F73A 1JXEA 1UOCA 3VQCA 4CJWA 4I2QA 3ZSVA 4FJLA 1S6QA 5J2PA 2D5RA 4Z4IA 2Z1IA 3ZSRA 1NOYA 3LANA 4CESA 3NF7A 4E0DA 4CF0A 4FVMA 5E41A 2Q3SA 2FBVA 3VA0A 1QTMA 5HP1A 1VSHA 5HBMA 2PY5A 5K14A 3QNNA 4CIEA 4OGCA 3DOLA 4DWIA 2F8SA 1IKVA 4CEQA 1D9FA 2G8UA 2XY8A 4RW4A 4FZXC 5KGWA 1YVUA 2KZMA 3V9SA 1RBUA 1BCOA 3AVIA 3I8DA 4CIFA 1VSEA 2XY5A 4B9MA 3C6UA 3I0SA 1RTHA 3RR7A 1BIUA 2BANA 2GUIA 4IBNA 4RW7A 4WE1A 3M8QA 3L2QA 4ELVA 2F96A 1BI4B 1SKSA 5CYQA 1VSKA 4BDZA 4KB0A 1L3SA 4CJSA 3P83D 3QNOA 4KHNA 4FK2A 1TK8A 2QKBA 2VG5A 4CK1A 1ZYQA 1C6VA 3ALYA 3PX4A 4BWJA 2NUBA 3S3NA 4CHZA 4JRPA 1C0MA 3VQ7A 2YNIA 4LSLA 4AILC 4RW9A 1ZBLA 2P51A 4DSIA 1WAJA 1XHXA 3QEWA 4GW6A 4CK3A 2HW3A 1UWBA 3NGIA 4LY7A 2XHBA 3DRSA 4DTOA 3MXIA 3KK1A 4H4OA 2P5OA 3L3VA 3QIOA 4CJQA 2ATQA 3K59A 4CJVA 3PX0A 4FM0A 3B6OA 3PX6A 4KI4A 2YHAA 4CJPA 3OYLA 3RR8A 2E6MA 1U48A 1S9EA 3OYCA 4FM1A 3V1OA 2Z1HA 3JYTA 2QKKA 3SYZA 4Z4GA 1YTAA 3OS0A 3SUNA 3K5OA 4FXDA 4OLBA 4CJEA 3G10A 4GMJB 3O3FA 4MFBA 1WN7A 1TK0A 3RMCA 2O4IA 3IRXA 1RBRA 3P1GA 2XY7A 1Z25A 2VG7A 2BDPA 1NOZA 4KV8A 4CGJA 2HNYA 5HLFA 4BDPA 2YKNA 3NE6A 3V4IA 4DTSA 1XC9A 4DFKA 4C8MA 3VQQA 3AO4A 4R5PA 3DLRA 4W5OA 5SZTA 3OYBA 3DLHA 1DTQA 2A1RA 1T8EA 5KI6A 3HVTA 4FM2A 2DFFA 5D3GA 1EKEA 4IFVA 4DTXA 4KI6A 4O0JA 3QIPA 4FJ9A 4H4MA 4FJ5A 1U49A 1ZBFA 4YNQA 4CEOA 3LP0A 2O4GA 5KTQA 3CFPA 3TAPA 3ZT4A 1KRPA 4KAZA 4DF4A 1SV5A 3VQBA 4Z4CA 2G8VA 3DMJA 1A5XA 1W9HA 4FJ8A 3H08A 3ISNC 4W5TA 3HT3A 1NK7A 4QAGA 3OYDA 3T19A 4DSLA 3AVNA 5FRMA 3ZSWA 4FW2A 4CJKA 2VWJA 2QXFA 4BE0A 4W5RA 1VSJA 1N6QA 4CF2A 1NK8A 4MQ3A 2FBYA 4AHUA 2G8WA 1RDAA 1SKWA 1DTTA 3LWLA 2RKIA 3AV9A 1C1CA 4OGEA 3HJFA 1XWLA 4E7IA 4B9NA 4KHUA 4PWDA 1RCHA 3NGZA 2KFZA 4FJKA 3AVJA 3L2WA 4N76A 4DG1A 3OYKA 2E4LA 4DSFA 1SL0A 1ASVA 4K8ZA 1A5VA 5HRPA 1U47A 3AVBA 4E1MA 3VQPA 1NK6A 4FLVA 3RMDA 4B8AB 3SNNA 2X6SA 1J53A 3KJVA 3NHGA 3SQ4A 3VN5A 1VSLA 3RRHA 3K58A 2HHVA 4CECA 3PV8A 4HUEA 1CXQA 1VRUA 4OVLA 4IDKA 4OPJA 5I42A 1TVRA 3MEEA 3ZSZA 4UQGA 3MAQA 4DQRA 1R0AA 4PQUA 1FXXA 3V9XA 2DY4A 1TL3A 1KTQA 1J5OA 1HQEA 4M3WA 2KW4A 4KFBA 3ZSYA 1L5UA 4CHNA 3QEPA 2PYJA 4FJHA 4DTPA 4KHWA 3HK2A 4DS5A 3CFRA 3ZCMA 1LAWA 3DLEA 4F8RA 1NJXA 2YNGA 1Q9XA 4I9QA 1D8YA 3U6FA 1KFSA 2YHBA 3LPTA 1RT4A 4CF1A 4YFUA 1L3TA 4J2AA 4CEBA 4FLTA 3EYZA 1MU2A 4DQSA 4N41A 4CJ3A 1IKXA 3K5MA 4JS5A 4KREA 3AA5X 1G15A 3TAMA 1YT3A 4QCLA 4CJ5A 4B9TA 5JS2A 4M3UA 4PY5A 1B92A 4O55A 4M42A 1KFDA 4J2EA 2YNHA 4OKKA 4CJFA 1KLMA 2G8KA 1NKEA 1QSSA 4KHSA 2XO7A 2IC3A 3LZIA 3KTQA 1EX4A 3VQEA 3M8SA 3KIOA 3SQ2A 1KLNA 4CCHA 1YTUA 1TAQA 4Z4FA 1WNSA 1S1VA 1ITGA 3ITHA 2E6LA 1TKZA 3OYHA 1REVA 4CE9A 5J2QA 4FJGA 4M3YA 4DF8A 4RW8A 3ZSXA 1RTDA 4G1QA 4Y1DA 3DRPA 4QOZB 4B9VA 2YV0X 3FFIA 1RBSA 4LH4A 4AHVA 3RMAA 4OPKA 1U04A 2IDOA 4M3RA 3OYMA 5I3UA 3S3OA 1NK9A 1SKRA 3AVHA 2JGUA 3LPUA 1JLGA 4CF9A 4J2BA 1J9AA 2KFNA 4M41A 2OZMA 3OY9A 1RT3A 3HP9A 1JLEA 1BIZA 1RDBA 1WAFA 3AO1A 1LW2A 3NF6A 4JLHA 4KKOA 3ZT2A 2OPSA 3L2UA 1IG9A 3BDPA 4NYFA 2VG6A 1HQUA 1Q8IA 1VSFA 4DTRA 1B9DA 3AVFA 4F3TA 3V9WA 3DOKA 1B9FA 4FLWA 2B6AA 4DSKA 3QLHA 3D0PA 3VQ9A 3MXJA 4E19A 3AO3A 3SV3A 1WSIA 3MECA 5EU7A 4NYNA 3L2VA 4DTUA 1J54A 4LSNA 1BQMA 1Q9YA 1ASWA 4CEFA 4Z4EA 1CZ9A 2BE2A 4F3OA 3TR8A 2GV9A 3KKRA 1HYVA 3AVAA 1D9DA 4DTJA 3VA3A 4B3OA 3NCIA 4CF8A 3LAKA 3HO1A 3CFOA 4DQPA 4CHYA 4BACA 3D45A 2I5JA 4AHTA 1L3UA 4CFBA 1S1WA 1TKDA 2HHQA 1W0HA 3KLFA 1ASUA 3AVLA 4EP4A 1JL1A 4CHPA 4DTNA 4DSJA 1RBVA 5KGXA 1UAXA 2IS3A 3HPOA 4DFJA 3O4QA 4C8LA 1WSHA 5JS1A 3KD1E 1JKHA 1HNVA 1RT6A 3P5JA 1TK5A 3RTVA 4F4KA 3HM9A 2XY6A 3VQ6A 2HVHA 1NK0A 3PO5A 1I3AA 1DLOA 3THVA 4KRFA 4E89A 3MEGA 1TGOA 3DLGA 4W5QA 2ITGA 3QO9A 3OS2A 4JS4A 1CLQA 2X78A 2HHXA 4ICLA 4CEDA 1UA1A 3C6TA 5CZ2A 2QK9A 5C24A 4AHSA 4DQQA 3CYMA 4DU4A 4Z4HA 4BE2A 3QERA 1S1XA 3HVRA 4HVJA 1JLQA 3K5NA 1CZBA 1SL1A 4O4GA 2YNFA 2FBTA 3IG1A 1XI1A 3HPGA 3O4NA 5HRSA 3NH2A 3OYJA 1L3VA 1C0UA 1WSJA 3JSMA 4I9LA 1QQCA 4C8NA 3OS1A 4FLZA 4DQIA 1BCMA 1C0TA 3CM5A 4CGGA 3KK3A 1S5JA 3SUOA 1XHZA 2F8TA 5CYMA 1KVBA 4NCGA 3HPHA 4M45A 1EP4A 4DLEA 1SUQA 3HSTB 3V9UA 3ZT0A 3T3FA 3OYEA 3DYAA 4ID5A 1NKBA 4FJJA 2DFEA 4L8RB 3HXMA 4CFCA 1QE1A 4AHRA 1WSFA 3AA2A 3L3UA 3NAEA 1HYZA 1JXBA 3U3GA 2HNZA 2OPRA 4OJRA 3V6DA 1RDDA 1GOBA 3VQDA 2RPIA 3TARA 2OZSA 4FJIA 3NBPA 4CFDA 1QSLA 1T03A 3AO2A 1RDCA 4DU1A 4ZHRA 1QSYA 3A2FA 3CM6A 3SQ1A 4IKFA 1KVAA 1WSEA 3LZJA 4DSEA 4FCYA 3KLEA 3S9HA 3KD5E 4K8XA 1CXUA 1JLCA 3RWUA 1RT2A 2BGGA 3QEVA 4CHOA 5HRRA 1EETA 5HROA 3WNHA 1S9GA 4E1NA 3AA4A 3L2RA 3ASMA 5C25A 3C95A 2D0BA 1BGXT 3VQ4A 4C8KA 4Q0BA 2OPQA 5T7BA 3ZSQA 4ZTFA 3B6PA 3OYIA 3RRGA 3IAYA 2IGIA 3C94A 3VQAA 3HP6A 1I39A 2FC0A 4HTUA 4BDYA 3BGRA 3E01A 4E7KA 1IO2A 3O3GA 2KTQA 5CZ1A 3MXMA 4B9LA 1RILA 1NJZA 3SJJA 4KPYA 3DM2A 4DMNA 3LDSA 4CGFA 4CHQA 1FKPA 2VWKA 4O44A 4Z0UA 3V1RA 4FLYA 2Y1IA 3TABA 3CQ8A 3HYFA 1S6PA 3I0RA 2YKMA 4Y1CA 1BL3A 1QS4A 3IS9A 5J2NA 1NK5A 5FRNA 2EHGA 1KSPA 1TL1A 2PYLA 4JRQA 4AHCA 4CEEA 4E7LA 3CG7A 4FJ7A 4N5SA 5FDLA 4FLXA 2Z1JA 3OJSA 1X9SA 4I7FA 4DTMA 3SPZA 4KO0A 3AVCA 1A5WA 1VSMA 3OJUA 3PY8A 4CEAA 1NK4A 4AH9A 3KKSA 4IFYA 3UIQA 3AVMA 4GVMA 3AVKA 3OYNA 1NKCA 3OVNA 3WNFA 1KCFA 3G0ZA 3ZSOA 4Q5VA 4E7JA 3U3YA 4OKJA 4ELTA 4NCAA 1RBTA 4KHQA 2HHWA 3TAGA 3WNEA 3TI0A 4CK2A 1RTJA 4KTZA 1TKTA 5KRSA 3M8PA 3NF9A 3RMBA 2ZD1A 4EZ6A 1TKXA 3LAMA 4O5BA 1WLJA 3SI6A 2Z1GA 1UA0A 1X9WA 4J2DA 4FW1A 1C1BA 2PZSA 3LALA 2HHUA 3VQ5A 1VSDA 4F2RA 4BWMA 1Z26A 3QESA 1RT7A 3DRRA 1IKWA 4EZ9A 3OYFA 2A1SA 4OLAA 4F2SA 3LP2A 4CJUA 3AO5A 3S3MA 1O1WA 3NDKA 1JL2A 2HB5A 4FJXA 2ZQBA 4BE1A 2HHTA 4N47A 1LW0A 1RT1A 1RTIA 3QINA 4DFPA 3WNGA 1WSGA 4EP5A 1TV6A 3TANA 4B9UA 1NJWA 1HYSA 1F21A 1HNIA 3DI6A 3KK2A 4LD0A 3NF8A 3PO4A 2P5GA 1LAVA 3NGYA 4DFMA 1EXQA 4FZYA 4KB1A 4E7HA 4RW6A 5DMRA 4B8CA 3EY1A 4FJNA 1TAUA 3KLGA 4ZTJA 1SL2A 4DU3A 5DK5A 2B4JA 4XIUA 2DFHA 2Y1JA 3M8RA 3K2PA 4CGDA 4HUFA 2OA8A 3K5LA 1U45A 4FK0A 4C8OA 1S1TA 1VK0A 4B08A 1T7PA 2JLEA
chains in the Genus database with same CATH superfamily
3MDQA 1VQON 4B3SK 2WTUA 3PUFA 2R7YA 4O0IA 2UXCK 3DLKA 3MX2A 3SPYA 4NCBA 1K6YA 4CBXA 3KLIA 3R3LA 4E1JA 5BPLA 4DV0K 4A2AA 1HMVA 4RWTA 1GLLO 2A6AA 3ULDA 1LV5A 3EEQA 1JLAA 4CEZA 5J1EA 2ETJA 4CFAA 4GVEA 5BR8K 4FJMA 5BN9A 4EIAA 3VERA 3DLBA 3BF1A 3BF3A 2QW9A 4HUGA 4CJLA 3VF6A 5FPNA 5SWMA 4ILHA 2YCHA 4B1XB 2LSNA 3E9PA 2QWOA 5M1QA 2G8HA 4JHDB 3K57A 3SUPA 4DR7K 3OYGA 1HJOA 4XEIA 3QEIA 4CZEA 4JKEA 3I55N 3AVGA 3O1WA 1QQOA 4JI4K 2W6LA 5CY4A 4DR1K 5KPTA 1OVQA 2X74A 1D5AA 4WF9L 4B9SA 4XH1A 2XRIA 5AZIA 3TAFA 3UB5A 4YHHK 5C15A 1GOCA 4B1UB 4JV5K 2FLOA 4BRPA 3CC4N 3C6HA 1MDUB 2RN2A 4KTWA 2KZZA 2KQ2A 4U67L 4JI2K 3ZSVA 4WQ5C 2GELA 5J2PA 2D5RA 4KBOA 1YHQN 4JD2B 2E5LK 4DV2K 2PY5A 2J4RA 1J6ZA 3DOLA 4CIEA 1D9FA 1VQNN 3D7EO 3QFUA 5LMNK 4BRFA 1VSEA 1X3MA 1RTHA 1BIUA 4LF6K 4RW7A 3M8QA 2P9IB 3L2QA 5F1XA 1YF5L 5JVGL 4ELVA 2Q1NA 1N34K 1SKSA 4CJSA 5DM6L 3QNOA 5EOYA 4CK1A 1C6VA 3ALYA 4CHZA 2I7PA 2QWMA 2P51A 2V7YA 4DSIA 1XHXA 3QEWA 4GW6A 1UWBA 3NGIA 4LY7A 4JK7A 5AQLA 2P5OA 3HZ6A 2QXLA 3KK1A 3QIOA 3K59A 1WBDA 3B6OA 2YHAA 3ATVA 4CZIA 1X3NA 2E6MA 1U48A 2WC9A 3OS0A 4RTFD 3HRGA 4CJEA 3G10A 2E1ZA 3WXKA 3KWIA 3G71N 5HLFA 5KQ8A 2YKNA 3C7NB 3B8AX 2ITMA 4DFKA 4FVUA 2D0OA 1T8EA 3HVTA 5D3GA 4IFVA 2IIRA 3EE8A 3ZEUA 4DR3K 4YDUC 3THWB 3ZT4A 2G8VA 1C0GA 3DMJA 5ELZA 3U8XA 5FRMA 3FZKA 2VWJA 1NJIO 4BE0A 3CETA 4CF2A 1NK8A 4MQ3A 4AHUA 1OH7A 1RDAA 1SKWA 1DTTA 2RKIA 4BRGA 1XWLA 5AQVA 4BRCA 2KFZA 4JNEA 4GV3A 4DG1A 1SL0A 3BY5A 5M1OA 1NK6A 4ISGA 4FLVA 1XNQK 1HUXA 1GLJO 2X6SA 1J53A 3NHGA 3K58A 3U4LA 4CECA 5LY3A 3MAQA 1FXXA 1TL3A 1NGIA 1HQEA 2QM1A 4IJAA 4KFBA 4CHNA 3QEPA 4IOAL 3CFRA 5BRFA 4F8RA 4I9QA 3MCPA 4FLTA 3EYZA 1OVYA 1MU2A 3CCQN 4CJ3A 3CC2N 1G15A 4CZLA 5AQJA 2D4WA 1TYQB 3LDNA 4B9TA 3BZKA 2P9KA 1DKGD 4OKKA 1QSSA 3A5MC 4AM6A 3ZETB 4YOXA 4Z4FA 3D2EB 1ITGA 2W41A 1KQSM 1WBBA 3OYHA 5J2QA 2P9PB 3GOIA 4K0KK 4DF8A 4RW8A 1RTDA 2ASOA 2VQFK 3VGLA 1RBSA 1NK9A 4OPKA 1U04A 2IDOA 3OYMA 2KFNA 1Q18A 1NGDA 1ZC6A 1N8RO 3O1BA 3AO1A 1LW2A 3NF6A 3ZT2A 3L2UA 5GIPA 3ULEB 3AVFA 3V9WA 3DOKA 1B9FA 4FLWA 4DSKA 4E19A 5IT9O 1W7AA 3SV3A 5AQMA 5BPNA 1HR0K 4LSNA 1BQMA 2IVNA 4CEFA 1CZ9A 4F3OA 5AQOA 3TR8A 1OKJA 3KKRA 2VYPA 4A2BA 1HPMA 3VA3A 3O9TA 4FOIA 3LAKA 5AJ3K 1L3UA 4K43A 3FR0A 1HKGA 3FZLA 4CFBA 2HHQA 3KLFA 1ASUA 4BC3A 2YJEA 1W2BM 1RDUA 2Q31A 4MO4A 3HPOA 3O4QA 4BQLA 1WSHA 4C8LA 5JS1A 4WFNL 5FPMA 1HNVA 1RT6A 3P5JA 1TK5A 3RTVA 2HVHA 1NK0A 3PSFA 3THVA 3T1HK 3AAQA 5H1SQ 3OS2A 2X78A 3CJCA 3KWGA 5BN8A 5AQFA 4EHUA 2QK9A 3SAHA 3CYMA 4ISEA 3L0QA 5BR9A 3AY9A 2VQEK 4BE2A 3QERA 4HVJA 3NVKA 1ZBSA 2ZWHA 4H5WA 3OYJA 1H1VA 1C0UA 3CC7N 1ILYA 3OS1A 1YJ9N 3CCVN 2Q36A 1C0TA 4LF7K 3WEEA 2F8TA 1IV0A 1KVBA 1EP4A 3OYEA 3DYAA 4ID5A 4JKFA 4B1VA 2DFEA 3FE1A 4AHRA 2P9LA 1WSFA 2YX6A 3AA2A 1JXBA 1GOBA 2RPIA 3KLEA 3KD5E 1ZXOA 3RWUA 5HROA 3WNHA 4E1NA 3AA4A 4C1NI 1JCFA 4HWIA 4X66K 5M1FA 3C95A 4Q0BA 5T7BA 2O8CB 5JLHA 3K9JA 4EHTA 1I39A 2FC0A 3TU5A 2KTQA 3MXMA 4BVPA 4CVNE 3MMVA 3O9QA 3SJJA 4KPYA 2O8EB 2FF6A 1E4GT 3THXB 1KD1O 3V1RA 3TSUA 4NO7A 4DQ8A 5LL6Z 5J2NA 4BRAA 4CEEA 1SAZA 5FDLA 2Z1JA 4BR2A 4DTMA 3AVCA 4NXMK 2P9NA 1A5WA 1ATNA 4CEAA 4IFYA 4A59A 4BRMA 3OVNA 3WNFA 1KCFA 3G0ZA 4CZKA 4NCAA 3CERA 3T69A 1P90A 3M8PA 3NF9A 5LMUK 4B1WB 1TKXA 4J2DA 3C6AA 1X9WA 4DR6K 1NGHA 2RE2A 5TKWA 3CCSN 4F2RA 1Z26A 3PSIA 3EKUA 4FOEA 2A1SA 4FPBA 3J7ZO 1XNRK 5KPRA 3S3MA 1O1WA 3NDKA 3UKRB 3H3NO 3JAMO 2HB5A 4N47A 4BC5A 4B9UA 2UUBK 1NJWA 1HYSA 2QWNA 3KK2A 1OH8A 4LD0A 2P5GA 1LAVA 4AM7A 4RW6A 4FJNA 3EY1A 4C23A 5CHIA 3H46O 3KLGA 4HUFA 1BO5O 2G8KA 1T7PA 4BR5A 2JLEA 3A5OC 2CGLA 3VGKA 1E4FT 3NH0A 5J2MA 3OYAA 4K41A 1FKOA 1RFQA 4X65K 2A5XA 4FWPA 3CCJN 5C42A 1GOAA 1HRHA 2FXUA 2IAJA 2ZJRL 1BQNA 2ZJQL 3L8BA 1X1PA 3VEVA 4DR5K 1LWEA 4BG8A 4JKCA 3VEWA 1IKYA 4FSVA 3O3HA 1IBMK 3V1QA 1HJRA 2OYQA 1NLVA 4O8UA 2QA4N 2UXBK 3I56N 4M3ZA 3O6WA 3QB0A 3CIPA 5KRTA 1LWCA 4DUZK 2UYTA 1WOQA 4HHTA 2FBXA 4I6MA 4FZZA 5LJWA 1ZBHA 4YOVA 2ASPA 4ISFA 2DTUA 4OKEA 5FROA 4M63C 4LH5A 3AGKA 1VSIA 3O4WA 4FPAA 4CD1A 4LF8K 1QHTA 4KHYA 1T05A 5M1PA 1OH5A 4JKGA 1S1UA 4ELUA 1BISA 2HBJA 3G6EN 2P9SB 2QTDA 3ZT3A 1UOCA 3VQCA 4FJLA 3WT0A 3ZSRA 1NOYA 3LANA 4CESA 4Y0WA 4FVMA 2Q3SA 2FF3B 3EE9A 2FBVA 4BR7A 3N4PA 3VA0A 5HP1A 1VQ5N 3OA9A 3QNNA 3CJ9A 5EX5A 2QI2A 4DWIA 1IKVA 4BRLA 4RW4A 1YVUA 5JVHL 1RBUA 3EZWA 3I8BA 2VWBA 4CIFA 3ENHA 4XH5A 1MWKA 3RR7A 2PFUA 2BANA 4IBNA 4BR9A 3M1FA 3D6RA 3WXIA 1VSKA 4BDZA 4KHNA 3P83D 2QKBA 1QVFM 3SAGA 1ZYQA 4G9ZA 3PX4A 3OBWA 2NUBA 4JRPA 2YNIA 4RW9A 3CCLN 1K8KA 1ZBLA 2O8DB 4LF5K 4LF4K 3ID8A 2E1YA 3DRSA 2CGJA 4BRHA 3N4QA 1BG3A 4H4OA 3L3VA 3MXIA 3PX6A 4CJVA 4FM0A 2DPNA 3RR8A 1S9EA 3WUHA 4FM1A 3V1OA 2UU9K 3JYTA 2QKKA 3SYZA 2PAVA 4GMJB 2WUSA 2O4IA 1RBRA 3M3ZA 3P1GA 4JI3K 1JCGA 5LJVA 3ENOA 4CGJA 2HNYA 4BDPA 3V4IA 1XC9A 4DTSA 2RHKA 2F9WA 3VQQA 5I9EB 4R5PA 5SZTA 5HOOA 2GUPA 3KZBA 4FM2A 1EKEA 4DTXA 3QIPA 4FJ9A 4H4MA 1U49A 4YNQA 3LP0A 3CFPA 3TAPA 3VETA 5GAEP 3VQBA 4BRQA 4Z4CA 2CH6A 3ISNC 4DV7K 1NK7A 4QAGA 2E2OA 2Q0UA 2QXFA 4MLHA 2FBYA 5AQZA 5AQUA 5FLXO 4B9NA 5ADXA 3NGZA 3OYKA 4DSFA 4K8ZA 5AFUA 4E1MA 1YI2N 2F7TA 3SNNA 4Z94A 5AQKA 1VSLA 3VN5A 3RRHA 2HHVA 3HSCA 4BROA 4OPJA 4IDKA 1TVRA 2YHWA 2AA4A 4A62A 3ZSYA 3C65A 3NMUA 3GE1A 4DTPA 4V19S 1ATSA 3ZCMA 1NJXA 1Q9XA 1D8YA 3IDHA 1KFSA 1RT4A 4YFUA 4J2AA 2GWKA 1VQMN 1Y64A 4N41A 3WXLA 3BEXA 3D2FB 3K5MA 4A61A 3TTFA 4JKHA 3ENBA 1XQSC 1B92A 4WCEL 1KFDA 2YNHA 1KLMA 2XO7A 4OX9K 1X9JA 2OANA 4B1YB 3LZIA 3GBTA 3CPEA 1W97L 4YOYA 1WNSA 1S1VA 3LM9A 4IJNA 1REVA 4M3YA 1U2VB 3ZSXA 4G1QA 3DRPA 1V4SA 4LH4A 4AHVA 3S3OA 2JGUA 1JLGA 2OZMA 3OY9A 3CJAA 3HP9A 1BIZA 1WAFA 3CJ7A 4JLHA 4DV4K 2VG6A 4M7YA 1Q8IA 3IMXA 4PKHA 4F3TA 3QLHA 4JHDA 3E9LA 3VQ9A 1IBLK 5EU7A 3L2VA 4DTUA 3QDKA 3OHRA 2VGNA 4Z4EA 3MN5A 2BE2A 3AVAA 1NM1A 3NCIA 3CFOA 4JI1K 3ZX3A 3W0LA 1S72N 1TKDA 2GX9A 1JL1A 1D4XA 2O8FB 1UAXA 1GLEG 4JKDA 1M90O 5AQIA 3CD6N 3MEGA 1TGOA 2ITGA 4JK8A 3P39A 4GKKK 3MN6A 3C6TA 5CZ2A 4JD2A 4WQ4A 4CI6A 4Z4HA 1S1XA 1SL1A 5C0YA 3FLCO 3H45C 3HPGA 3O4NA 1L3VA 4KH5A 4I9LA 1QQCA 3VEXA 4LC9B 5KPZA 4GY2B 4FWOA 4M45A 2NRTA 4FWNA 4DLEA 3HSTB 2P9IA 3ZT0A 3T3FA 1NKBA 1E3MA 4FJJA 3NVMA 4L8RB 3HTVA 3GDQA 3L3UA 4LFCK 3VQDA 3HM8A 3NBPA 3E66A 4IOXA 4IKFA 3CM6A 4NLCA 1K9MO 1WSEA 3ATUA 5AZJB 4DSEA 4K8XA 2HBKA 3O80A 1CXUA 3QEVA 1S9GA 1N32K 2D0BA 3OYIA 3SMPA 2IGIA 4ILGB 4M7XA 4HTUA 3TSQA 4E7KA 1YVNA 2F9TA 4B9LA 1RILA 1KXPA 5M1KA 1SZ2A 3DM2A 1Z6RA 1FKPA 2VWKA 2Y1IA 3TABA 3MCAB 3HYFA 1S6PA 3C7NA 1QS4A 5FRNA 1NK5A 1TL1A 4JRQA 3VMFB 3PIPL 1XUPO 2NZTA 3OJSA 3CPWM 4I7FA 1GLDG 2P9UA 4HTLA 4WQ5A 4QS8A 1BOTO 4DV1K 4CZHA 3OJUA 3PY8A 4AH9A 1SS6A 3OYNA 3U3YA 4Q5VA 4DV6K 4ELTA 4OKJA 2QWLA 1YXQA 2HHWA 3TAGA 3TI0A 4KTZA 1TKTA 2GEMA 4BREA 2ZD1A 4EZ6A 4O5BA 3SI6A 4BRDA 4FW1A 5TKYA 3S41A 1EWQA 1VSDA 4BWMA 2OTLN 3DLLL 1DT9A 5C2FA 4OLAA 1NMDA 3LP2A 3RSEB 3AO5A 4CJUA 1NGFA 4JEPA 2F4VK 2ZQBA 3CHWA 2HHTA 1LW0A 1RTIA 4AQYK 2YHXA 2NRVA 1HNIA 3DI6A 2CH5A 3NF8A 3EN9A 4KH6A 1XMOK 4NB4A 4CJ7A 2CGKA 2Q0RA 3VPZA 1KAXA 2Y1JA 5KQDA 4CGDA 4FK0A 1EETA 1VK0A 2IOCA 3SZ2A 1Q86O 1C1AA 4DKWA 2G8FA 3A0IX 2X6NA 4IG3A 3FGUA 1C0FA 4CJRA 4PUOA 1NGAA 4CJTA 3ZETA 2WOMA 4CIGA 4HCCA 4M3TA 3KLHA 1JCEA 3O9RA 1NJYA 1KAYA 4W5NA 1RT5A 2P9PA 3VQ8A 4PKIA 3LWMA 4YDUA 3HI0A 1BI4A 2P1JA 2ZE2A 1JLFA 4KTQA 3QEXA 4HCBA 1M1KO 4NLBA 5AQRA 1JLBA 1IG8A 2E88A 1NMNA 4M3XA 2G8IA 1TUUA 2OPPA 1YJNN 1VQLN 4FK4A 4O5FA 2I7NA 1IH7A 1RNHA 2RF2A 1Q7YO 3V81A 2ZGYA 1LWFA 5CE3A 4CJ4A 4FYDA 4H5NA 4DLGA 2HMIA 4CGIA 3NH1A 1VRTA 1ZBIA 2D0CA 2E20A 2QWRA 3LP1A 3V9ZA 3T7ZA 3A5LC 3H1QA 3F73A 1HKCA 1JXEA 4C1NK 1HNWK 5E26A 4H0OA 4H0YB 4Z4IA 2Z1IA 2YJFA 3VEZA 3VF4A 4X62K 5E41A 1TUYA 1K8AO 5K14A 4BGAA 2Q2RA 3DXKB 2XY8A 5KGWA 3WQUA 3V9SA 1BCOA 3I8DA 1K73O 4B9MA 3I0SA 5EY4A 2GUIA 2V51B 4DV5K 3CMEN 4WE1A 2UUCK 4BY9C 3I33A 5CYQA 3ZX2A 4IZ9A 2E2NA 4FK2A 1NGJA 1Q82O 4BWJA 1C0MA 2GTDA 1P8ZA 3VQ7A 4AILC 3AGRA 1S3XA 4CK3A 4FWMA 2XHBA 4CJQA 2ATQA 3PX0A 4KI4A 5M1NA 1EO1A 3THYB 1EQYA 2Z1HA 4DHYA 1YTAA 4FXDA 3K5OA 2JWLA 4B3TK 4MFBA 1WN7A 1TK0A 3O9UA 3IRXA 1VHXA 1NGCA 1Z25A 2VG7A 4GKJK 1VQPN 1T6DA 4C8MA 5B8HA 3AO4A 4W5OA 1WB9A 1U6ZA 4OPHA 3DLHA 2A1RA 3GL1A 3GG4A 3THXA 4O0JA 1VQKN 2OCEA 1KRPA 1SV5A 1W9HA 1A5XA 4BRIA 4FJ8A 1NBWA 1HNXK 3VF2A 3UKUA 2HHHK 3ZSWA 4W5RA 1VSJA 1N6QA 4LFAK 2JWKA 4H0PA 3FZMA 3HJFA 4PWDA 1RCHA 1V4TA 4FJKA 3AVJA 3L2WA 4N76A 2E4LA 1QVGM 1A5VA 1U47A 3AVBA 5JLFA 1RDWX 4B8AB 1KAZA 3SQ4A 3QICA 4HUEA 1CXQA 1VRUA 4OVLA 1VQ8N 4DQRA 4YY3K 2DY4A 4M3WA 1RGIA 3UKRA 3VGMA 3KHYA 2QEXN 4KHWA 3HK2A 1LAWA 2YNGA 1BDGA 1NWKA 3LPTA 1L3TA 4B9QA 5JMVA 4WFBL 4DQSA 4MLEA 4O8KA 4KREA 2AP1A 3TAMA 4OPAA 1YT3A 3IUCA 4QS7A 3M6GA 4CJ5A 4M3UA 5JS2A 3OW2M 5ADXH 2A41A 3LDOA 4KHSA 5AFUH 1GLFO 2IC3A 3R6MA 3VQEA 3M8SA 3BZCA 2H3GX 3SQ2A 1XC3A 1TAQA 4GV6A 1I94K 2BH1A 1TKZA 4FJGA 4CE9A 3WXJA 1BA0A 4PL8A 2W6KA 4Y1DA 1CZAN 4QOZB 3AVHA 3LPUA 3SJHA 4CF9A 4J2BA 1J9AA 1ESVA 3DWLA 3KK7A 5GAHP 1JLEA 1RDBA 4YOUA 3CXCM 5FPDA 1S22A 1FJGK 2HMPA 3HBTA 1OH6A 3CCRN 4B3RK 3DJCA 4DTRA 2Q97A 4GV9A 3MXJA 4CZGA 3AO3A 1WSIA 3MECA 1Q9YA 1ASWA 5AZIB 4J8FA 4YORA 2GV9A 3P38A 2A42A 3ZLJA 1QHAA 2ZM6K 3MK6A 4DTJA 2O8BA 4CF8A 5MLCQ 1HX1A 4DQPA 4A5BA 4CHYA 3D45A 5AQHA 4EP4A 4DTNA 4CHPA 2HBLA 1RBVA 2IS3A 4DFJA 4BG9A 2WFBA 2HSTA 3IKMA 3UE5A 2P9SA 4A5AA 3KD1E 4FWLA 3HM9A 2XY6A 3VQ6A 3PO5A 3EKSA 4E89A 3QO9A 2HBMA 3A8YA 4CEDA 3AARA 4IO8A 4IOCL 3H6EA 3HVRA 3CCEN 1JLQA 3K5NA 4O4GA 2YNFA 2FBTA 4MO5A 3IG1A 1DEJA 4PKGA 1WSJA 4C8NA 4DR2K 4BC2A 1BCMA 1HKBA 1JJ2M 3K0SA 3CM5A 5E84A 4CGGA 3LL3A 1XHZA 4NCGA 3DXMA 2UXDK 3L4IA 1QZ6A 3VOVA 3NAEA 1HYZA 2OPRA 3TARA 4CFDA 1QSLA 4DU1A 4ZHRA 3A2FA 1KVAA 3LZJA 2O8DA 3S9HA 2BGGA 5HRRA 3QBWA 1IJJA 5GIOA 3ASMA 3MN7A 5C25A 4C8KA 1BGXT 3K9KA 4EAHD 4H0VB 4A57A 4ZTFA 3B6PA 1IBKK 3VQAA 3HP6A 3T1YK 4BDYA 3E01A 4PHTX 5CZ1A 5C2DA 4JK9A 4DMNA 4CGFA 4H5RA 3A5NC 4O44A 4CHQA 4FLYA 3ZEUB 3CQ8A 4WYBA 1LOTB 2YKMA 4Y1CA 1BL3A 1BWFO 2EHGA 1KSPA 4AHCA 4FJ7A 4IO9L 3CG7A 4E7LA 4IEEA 4KO0A 4B3MK 1VSMA 3J7YP 1NK4A 3AVMA 1NNEA 2E2QA 4ILJA 4FWKA 1BA1A 3SBTA 1RBTA 1Q81O 4QS9A 3WNEA 4CK2A 5A2QO 5KRSA 3SAFA 3LAMA 3E9OA 1VAZA 1WLJA 2Z1GA 5BRHA 2E2PA 1C1BA 2HHUA 2NNWA 1GLCG 2NLXA 1IKWA 3O08A 4EZ9A 3Q7BA 3LDLA 4CBWA 4FO0A 3VESA 2OTJN 1SQKA 4JKAA 1JL2A 4FJXA 1NU0A 1R59O 4FWQA 3JXUA 3WNGA 4JAXA 4EP5A 3TANA 4BR0A 3CCUN 2IVPA 3NGYA 1EXQA 4FZYA 2BUPA 3QFPA 4E7HA 4B8CA 5DMRA 2KLAA 4WFAL 3LM2A 5C12A 3E1YA 3G25A 3TTCA 2DFHA 4XIUA 2OA8A 3K2PA 4H5VA 4C8OA 2P9KB 1S1TA 4B08A 1HQUA 4JKBA 4DCHA 1BHLA 4I2PA 1N5YA 3M5RA 3SQ0A 3D2FA 5AQSA 3LP3A 3ZT1A 4JYAK 3H3OB 3F9KA 5IWAK 3AAPA 3HL8A 1X9MA 3AA3A 3J8AA 5AR0A 2GBZA 5GINA 4DS4A 2YHYA 2QWQA 2P9UB 3SV4A 4H8KA 2D1KA 4PA1A 2D0AA 2ZF5O 1U2VA 1KVCA 2BTFA 4E3SA 3QETA 4K25A 3SUQA 2AJQA 2W42A 3C0BA 4N56A 4FLUA 4ID1A 4JI6K 4JI8K 1MA9B 3MWPA 2HNDA 4MDBA 5AQTA 2B5JA 3F9MA 1U4BA 1FK9A 1ZBUA 4JI7K 3SCXA 3O5BA 2HVIA 1HPZA 5HL7L 2HHSA 3TAQA 3NFAA 5HRNA 3TAEA 2ASMA 4CGHA 4IG0A 3MEDA 3EZ5A 3T1AA 1Y97A 3OBYA 4LF9K 2EX3A 4QCLA 4RG8A 2WONA 3TWHA 4TSXA 5AQXA 3P31A 2PBDA 4CERA 1MWMA 3SMSA 1O13A 4CJWA 4I2QA 3VEYA 3P4IA 1S6QA 2O8FA 4IFEA 2A40A 4E0DA 3NF7A 4CF0A 3R8EA 1QTMA 1VSHA 3THWA 1VQ7N 5HBMA 1NG9A 4OGCA 4DR4K 2F8SA 4CEQA 2G8UA 4FZXC 1ATRA 1BU6O 2KZMA 3AVIA 1G99A 2XY5A 3U9ZA 3WEEB 3C6UA 3CCMN 2GWJA 2F96A 1BI4B 2P9LB 4KB0A 1L3SA 4BR4A 3PIOL 1TK8A 1N36K 3R1XA 2VG5A 3S3NA 4L3QA 4LSLA 2KKZA 1WAJA 3VEOA 3J81O 2HW3A 2WBNA 5BREA 3R9PA 4DTOA 3W3DA 1T6CA 4X64K 1QQNA 3OYLA 4CJPA 5AZJA 4NXNK 3O9SA 3OYCA 4YOTA 4Z4GA 3SUNA 4OLBA 3O3FA 5JICA 3RMCA 3CQYA 2V52B 2XY7A 2BDPA 1NOZA 4KV8A 3NE6A 1TYQA 1GLAG 3DLRA 3OYBA 1DTQA 5KI6A 2DFFA 4KI6A 4FJ5A 1ZBFA 3WQTA 2P9NB 4CEOA 1T44A 3D2EA 2W40A 2O4GA 5KTQA 1T3VA 3KVGA 4K42A 4KAZA 4FL9A 4DF4A 4H03B 3H08A 4W5TA 3HT3A 3OYDA 3QBXA 3T19A 3CJ1A 4DSLA 3AVNA 4FW2A 4CJKA 1YJWN 2G8WA 2NRXA 2HOEA 3FZHA 3LWLA 4FWSA 1VQ4N 3AV9A 4PL7A 4KHPK 1C1CA 4OGEA 4KHUA 5BPMA 2ZGZA 2KHOA 4E7IA 3JS6A 5GAGP 4CZJA 3EL2A 1ASVA 1LCUA 5HRPA 5GADP 3FFKB 3ULEA 3VQPA 3RMDA 3LDQA 3KJVA 4BRKA 3TSPA 3PV8A 1UA1A 5I42A 3F2KA 3MEEA 3ZSZA 1EWRA 4UQGA 1R0AA 4PQUA 3L6QA 4MDAA 5AQGA 3V9XA 3CMAN 1KTQA 3RSEA 1J5OA 2KW4A 1L5UA 1YUWA 3Q7CA 2PYJA 4FJHA 3U9DA 2NRZA 4DS5A 3DLEA 3U6FA 2YHBA 3SBGA 4CF1A 3QMLA 4CEBA 4CBUA 5AQQA 1IKXA 4JS5A 3AA5X 3TTDA 5EXWA 4BVOA 3OTOK 4PY5A 3VENA 4XH4A 4O55A 4M42A 1DGKN 4J2EA 4CJFA 1NKEA 2HF3A 1J5EK 3KTQA 4F9OA 4JI0K 1EX4A 3KIOA 1KC8O 4DB3A 1KLNA 4CCHA 1YTUA 1VQ6N 5CR4A 5FPEA 3ITHA 1NGEA 2E6LA 1FW6A 3UKUB 4B9VA 2YV0X 3FFIA 3L4QA 3RMAA 4IEIA 4M3RA 2IVOA 5I3UA 1SKRA 4GNIA 3VTHA 4M41A 1RT3A 4KKOA 1IG9A 2OPSA 3BDPA 4U7BA 4NYFA 1VSFA 5AQPA 2A3ZA 1B9DA 4I6MB 3PLAA 2B6AA 3D0PA 3MX5A 4CZFA 5AQYA 4NYNA 4JI5K 1J54A 3MWTA 4IDHA 3VTIA 3IFRA 4JKGB 1HYVA 1NGGA 1D9DA 2ZJPL 4B3OA 2O8CA 3HO1A 4H0XB 4OO1J 3TPQA 4BACA 4KH4A 2I5JA 4AHTA 1S1WA 1W0HA 3DAWA 2VCPA 3AVLA 4LFBK 4DSJA 2FSKA 5KGXA 2O8EA 1JKHA 4F4KA 4UY8O 4BGBA 1I3AA 1DLOA 2UUAK 1N33K 4KRFA 1QZ5A 4W5QA 3DLGA 4JS4A 1CLQA 2HHXA 4ICLA 3CI5A 5C24A 4AHSA 4DQQA 4DU4A 4FWRA 1WUAA 1CZBA 3LDPA 4DV3K 1XI1A 5HRSA 3NH2A 3DXKA 4IXCA 3JSMA 4DQIA 3CQXA 4FLZA 3KK3A 1S5JA 3SUOA 3RVCA 5CYMA 3O8MA 1YITN 3HPHA 1SUQA 3V9UA 3ID6A 1K8KB 3HXMA 4CFCA 1QE1A 4H5TA 3U3GA 2HNZA 3V6DA 4OJRA 4EFHA 1RDDA 2OZSA 4FJIA 2NRWA 3AO2A 1RDCA 1T03A 1QSYA 3SQ1A 3HOSA 5C10A 4FCYA 4R79A 1JLCA 1RT2A 4BQZA 1YIJN 4CHOA 3CF5L 4H0TB 3L2RA 3F5TA 3VQ4A 4BRNA 4CZMA 2O8BB 2OPQA 3ZSQA 3RRGA 3IAYA 3THYA 3C94A 3FZFA 3ZX0A 3BGRA 1IO2A 3O3GA 1NJZA 2NRHA 4YOWA 3EO3A 5AQWA 3LDSA 2D0PA 4Z0UA 2EWSA 3I0RA 3G4SN 3IS9A 2PYLA 3BUZB 1HNZK 3H1VX 3ZYYX 3J7AP 4N5SA 4FLXA 4IWVA 1XMQK 1X9SA 1GLBG 3SPZA 1HLUA 2NRRA 1VQ9N 3MN9A 3KKSA 3UIQA 4GVMA 3AVKA 5DM7L 1NKCA 3J80O 1BUPA 3ZSOA 4E7JA 2E8AA 4KHQA 4B1ZA 1Z05A 1RTJA 2HF4A 4CW7B 3RMBA 4BC4A 4DUYK 1UA0A 1QQMA 3DXMB 3BP8A 2PZSA 2FSJA 3LALA 3WXMB 4JN4A 3VQ5A 4AF1A 2VGMA 3QESA 1RT7A 3DRRA 3SLCA 3OYFA 4F2SA 2QWPA 4CD3A 2FSNA 4BE1A 5EVZA 1RT1A 3QINA 4DFPA 1WSGA 1TV6A 3HOTA 1F21A 3PO4A 4DFMA 5BRDA 4KB1A 1YAGA 5AQNA 5F0XA 4RCHA 1TAUA 2V7ZA 4ZTJA 1SL2A 5F2RA 4DU3A 1NGBA 2B4JA 5DK5A 3M8RA 3SK3A 3K5LA 1U45A 4WQ4C 3CJBA 2YI1A
chains in the Genus database with same CATH topology
1BHLA 2IOCA 3PUFA 4I2PA 4O0IA 2R7YA 3DLKA 3SZ2A 3SQ0A 1N5YA 1C1AA 3LP3A 3NH0A 5J2MA 3ZT1A 3OYAA 3SPYA 4NCBA 1K6YA 3F9KA 3HL8A 1X9MA 3AA3A 2G8FA 3KLIA 1FKOA 2X6NA 2GBZA 1HMVA 4IG3A 5C42A 3ULDA 1LV5A 1GOAA 4DS4A 4PUOA 4CJRA 1HRHA 4CJTA 2IAJA 1JLAA 1BQNA 4CEZA 2WOMA 3L8BA 3SV4A 4H8KA 4CIGA 5J1EA 1X1PA 2ETJA 4HCCA 4M3TA 4PA1A 1LWEA 3KLHA 2D0AA 4CFAA 1NJYA 4FJMA 4W5NA 1RT5A 1IKYA 3O3HA 3VQ8A 3V1QA 3DLBA 1HJRA 1KVCA 2OYQA 3LWMA 4E3SA 4HUGA 3QETA 4CJLA 1BI4A 2P1JA 2ZE2A 1JLFA 5SWMA 3SUQA 2W42A 4KTQA 2AJQA 4N56A 3QEXA 4FLUA 4ID1A 4HCBA 4M3ZA 1JLBA 2LSNA 2HNDA 2G8HA 2B5JA 3K57A 3SUPA 1U4BA 3OYGA 1FK9A 1ZBUA 3QEIA 3SCXA 2HVIA 4M3XA 5KRTA 2G8IA 1HPZA 1LWCA 2OPPA 3AVGA 4HHTA 2HHSA 4FK4A 3TAQA 3NFAA 2FBXA 5HRNA 1IH7A 3TAEA 5CY4A 4FZZA 1RNHA 2RF2A 2X74A 4CGHA 4IG0A 3MEDA 1D5AA 3EZ5A 1ZBHA 2DTUA 4OKEA 3T1AA 5FROA 3V81A 4B9SA 1LWFA 1Y97A 1VSIA 4LH5A 4CJ4A 4FYDA 4KHYA 1QHTA 2EX3A 2XRIA 4RG8A 4DLGA 1T05A 2HMIA 3TAFA 4CGIA 3NH1A 2WONA 3TWHA 1GOCA 4TSXA 1VRTA 1ZBIA 1S1UA 2D0CA 4ELUA 1BISA 3LP1A 4CERA 3V9ZA 2RN2A 4KTWA 2KZZA 3ZT3A 2KQ2A 3F73A 1JXEA 1UOCA 3VQCA 4CJWA 4I2QA 3ZSVA 4FJLA 1S6QA 5J2PA 2D5RA 4Z4IA 2Z1IA 3ZSRA 1NOYA 3LANA 4CESA 3NF7A 4E0DA 4CF0A 4FVMA 5E41A 2Q3SA 2FBVA 3VA0A 1QTMA 5HP1A 1VSHA 5HBMA 2PY5A 5K14A 3QNNA 4CIEA 4OGCA 3DOLA 4DWIA 2F8SA 1IKVA 4CEQA 1D9FA 2G8UA 2XY8A 4RW4A 4FZXC 5KGWA 1YVUA 2KZMA 3V9SA 1RBUA 1BCOA 3AVIA 3I8DA 4CIFA 1VSEA 2XY5A 4B9MA 3C6UA 3I0SA 1RTHA 3RR7A 1BIUA 2BANA 2GUIA 4IBNA 4RW7A 4WE1A 3M8QA 3L2QA 4ELVA 2F96A 1BI4B 1SKSA 5CYQA 1VSKA 4BDZA 4KB0A 1L3SA 4CJSA 3P83D 3QNOA 4KHNA 4FK2A 1TK8A 2QKBA 2VG5A 4CK1A 1ZYQA 1C6VA 3ALYA 3PX4A 4BWJA 2NUBA 3S3NA 4CHZA 4JRPA 1C0MA 3VQ7A 2YNIA 4LSLA 4AILC 4RW9A 1ZBLA 2P51A 4DSIA 1WAJA 1XHXA 3QEWA 4GW6A 4CK3A 2HW3A 1UWBA 3NGIA 4LY7A 2XHBA 3DRSA 4DTOA 3MXIA 3KK1A 4H4OA 2P5OA 3L3VA 3QIOA 4CJQA 2ATQA 3K59A 4CJVA 3PX0A 4FM0A 3B6OA 3PX6A 4KI4A 2YHAA 4CJPA 3OYLA 3RR8A 2E6MA 1U48A 1S9EA 3OYCA 4FM1A 3V1OA 2Z1HA 3JYTA 2QKKA 3SYZA 4Z4GA 1YTAA 3OS0A 3SUNA 3K5OA 4FXDA 4OLBA 4CJEA 3G10A 4GMJB 3O3FA 4MFBA 1WN7A 1TK0A 3RMCA 2O4IA 3IRXA 1RBRA 3P1GA 2XY7A 1Z25A 2VG7A 2BDPA 1NOZA 4KV8A 4CGJA 2HNYA 5HLFA 4BDPA 2YKNA 3NE6A 3V4IA 4DTSA 1XC9A 4DFKA 4C8MA 3VQQA 3AO4A 4R5PA 3DLRA 4W5OA 5SZTA 3OYBA 3DLHA 1DTQA 2A1RA 1T8EA 5KI6A 3HVTA 4FM2A 2DFFA 5D3GA 1EKEA 4IFVA 4DTXA 4KI6A 4O0JA 3QIPA 4FJ9A 4H4MA 4FJ5A 1U49A 1ZBFA 4YNQA 4CEOA 3LP0A 2O4GA 5KTQA 3CFPA 3TAPA 3ZT4A 1KRPA 4KAZA 4DF4A 1SV5A 3VQBA 4Z4CA 2G8VA 3DMJA 1A5XA 1W9HA 4FJ8A 3H08A 3ISNC 4W5TA 3HT3A 1NK7A 4QAGA 3OYDA 3T19A 4DSLA 3AVNA 5FRMA 3ZSWA 4FW2A 4CJKA 2VWJA 2QXFA 4BE0A 4W5RA 1VSJA 1N6QA 4CF2A 1NK8A 4MQ3A 2FBYA 4AHUA 2G8WA 1RDAA 1SKWA 1DTTA 3LWLA 2RKIA 3AV9A 1C1CA 4OGEA 3HJFA 1XWLA 4E7IA 4B9NA 4KHUA 4PWDA 1RCHA 3NGZA 2KFZA 4FJKA 3AVJA 3L2WA 4N76A 4DG1A 3OYKA 2E4LA 4DSFA 1SL0A 1ASVA 4K8ZA 1A5VA 5HRPA 1U47A 3AVBA 4E1MA 3VQPA 1NK6A 4FLVA 3RMDA 4B8AB 3SNNA 2X6SA 1J53A 3KJVA 3NHGA 3SQ4A 3VN5A 1VSLA 3RRHA 3K58A 2HHVA 4CECA 3PV8A 4HUEA 1CXQA 1VRUA 4OVLA 4IDKA 4OPJA 5I42A 1TVRA 3MEEA 3ZSZA 4UQGA 3MAQA 4DQRA 1R0AA 4PQUA 1FXXA 3V9XA 2DY4A 1TL3A 1KTQA 1J5OA 1HQEA 4M3WA 2KW4A 4KFBA 3ZSYA 1L5UA 4CHNA 3QEPA 2PYJA 4FJHA 4DTPA 4KHWA 3HK2A 4DS5A 3CFRA 3ZCMA 1LAWA 3DLEA 4F8RA 1NJXA 2YNGA 1Q9XA 4I9QA 1D8YA 3U6FA 1KFSA 2YHBA 3LPTA 1RT4A 4CF1A 4YFUA 1L3TA 4J2AA 4CEBA 4FLTA 3EYZA 1MU2A 4DQSA 4N41A 4CJ3A 1IKXA 3K5MA 4JS5A 4KREA 3AA5X 1G15A 3TAMA 1YT3A 4QCLA 4CJ5A 4B9TA 5JS2A 4M3UA 4PY5A 1B92A 4O55A 4M42A 1KFDA 4J2EA 2YNHA 4OKKA 4CJFA 1KLMA 2G8KA 1NKEA 1QSSA 4KHSA 2XO7A 2IC3A 3LZIA 3KTQA 1EX4A 3VQEA 3M8SA 3KIOA 3SQ2A 1KLNA 4CCHA 1YTUA 1TAQA 4Z4FA 1WNSA 1S1VA 1ITGA 3ITHA 2E6LA 1TKZA 3OYHA 1REVA 4CE9A 5J2QA 4FJGA 4M3YA 4DF8A 4RW8A 3ZSXA 1RTDA 4G1QA 4Y1DA 3DRPA 4QOZB 4B9VA 2YV0X 3FFIA 1RBSA 4LH4A 4AHVA 3RMAA 4OPKA 1U04A 2IDOA 4M3RA 3OYMA 5I3UA 3S3OA 1NK9A 1SKRA 3AVHA 2JGUA 3LPUA 1JLGA 4CF9A 4J2BA 1J9AA 2KFNA 4M41A 2OZMA 3OY9A 1RT3A 3HP9A 1JLEA 1BIZA 1RDBA 1WAFA 3AO1A 1LW2A 3NF6A 4JLHA 4KKOA 3ZT2A 2OPSA 3L2UA 1IG9A 3BDPA 4NYFA 2VG6A 1HQUA 1Q8IA 1VSFA 4DTRA 1B9DA 3AVFA 4F3TA 3V9WA 3DOKA 1B9FA 4FLWA 2B6AA 4DSKA 3QLHA 3D0PA 3VQ9A 3MXJA 4E19A 3AO3A 3SV3A 1WSIA 3MECA 5EU7A 4NYNA 3L2VA 4DTUA 1J54A 4LSNA 1BQMA 1Q9YA 1ASWA 4CEFA 4Z4EA 1CZ9A 2BE2A 4F3OA 3TR8A 2GV9A 3KKRA 1HYVA 3AVAA 1D9DA 4DTJA 3VA3A 4B3OA 3NCIA 4CF8A 3LAKA 3HO1A 3CFOA 4DQPA 4CHYA 4BACA 3D45A 2I5JA 4AHTA 1L3UA 4CFBA 1S1WA 1TKDA 2HHQA 1W0HA 3KLFA 1ASUA 3AVLA 4EP4A 1JL1A 4CHPA 4DTNA 4DSJA 1RBVA 5KGXA 1UAXA 2IS3A 3HPOA 4DFJA 3O4QA 4C8LA 1WSHA 5JS1A 3KD1E 1JKHA 1HNVA 1RT6A 3P5JA 1TK5A 3RTVA 4F4KA 3HM9A 2XY6A 3VQ6A 2HVHA 1NK0A 3PO5A 1I3AA 1DLOA 3THVA 4KRFA 4E89A 3MEGA 1TGOA 3DLGA 4W5QA 2ITGA 3QO9A 3OS2A 4JS4A 1CLQA 2X78A 2HHXA 4ICLA 4CEDA 1UA1A 3C6TA 5CZ2A 2QK9A 5C24A 4AHSA 4DQQA 3CYMA 4DU4A 4Z4HA 4BE2A 3QERA 1S1XA 3HVRA 4HVJA 1JLQA 3K5NA 1CZBA 1SL1A 4O4GA 2YNFA 2FBTA 3IG1A 1XI1A 3HPGA 3O4NA 5HRSA 3NH2A 3OYJA 1L3VA 1C0UA 1WSJA 3JSMA 4I9LA 1QQCA 4C8NA 3OS1A 4FLZA 4DQIA 1BCMA 1C0TA 3CM5A 4CGGA 3KK3A 1S5JA 3SUOA 1XHZA 2F8TA 5CYMA 1KVBA 4NCGA 3HPHA 4M45A 1EP4A 4DLEA 1SUQA 3HSTB 3V9UA 3ZT0A 3T3FA 3OYEA 3DYAA 4ID5A 1NKBA 4FJJA 2DFEA 4L8RB 3HXMA 4CFCA 1QE1A 4AHRA 1WSFA 3AA2A 3L3UA 3NAEA 1HYZA 1JXBA 3U3GA 2HNZA 2OPRA 4OJRA 3V6DA 1RDDA 1GOBA 3VQDA 2RPIA 3TARA 2OZSA 4FJIA 3NBPA 4CFDA 1QSLA 1T03A 3AO2A 1RDCA 4DU1A 4ZHRA 1QSYA 3A2FA 3CM6A 3SQ1A 4IKFA 1KVAA 1WSEA 3LZJA 4DSEA 4FCYA 3KLEA 3S9HA 3KD5E 4K8XA 1CXUA 1JLCA 3RWUA 1RT2A 2BGGA 3QEVA 4CHOA 5HRRA 1EETA 5HROA 3WNHA 1S9GA 4E1NA 3AA4A 3L2RA 3ASMA 5C25A 3C95A 2D0BA 1BGXT 3VQ4A 4C8KA 4Q0BA 2OPQA 5T7BA 3ZSQA 4ZTFA 3B6PA 3OYIA 3RRGA 3IAYA 2IGIA 3C94A 3VQAA 3HP6A 1I39A 2FC0A 4HTUA 4BDYA 3BGRA 3E01A 4E7KA 1IO2A 3O3GA 2KTQA 5CZ1A 3MXMA 4B9LA 1RILA 1NJZA 3SJJA 4KPYA 3DM2A 4DMNA 3LDSA 4CGFA 4CHQA 1FKPA 2VWKA 4O44A 4Z0UA 3V1RA 4FLYA 2Y1IA 3TABA 3CQ8A 3HYFA 1S6PA 3I0RA 2YKMA 4Y1CA 1BL3A 1QS4A 3IS9A 5J2NA 1NK5A 5FRNA 2EHGA 1KSPA 1TL1A 2PYLA 4JRQA 4AHCA 4CEEA 4E7LA 3CG7A 4FJ7A 4N5SA 5FDLA 4FLXA 2Z1JA 3OJSA 1X9SA 4I7FA 4DTMA 3SPZA 4KO0A 3AVCA 1A5WA 1VSMA 3OJUA 3PY8A 4CEAA 1NK4A 4AH9A 3KKSA 4IFYA 3UIQA 3AVMA 4GVMA 3AVKA 3OYNA 1NKCA 3OVNA 3WNFA 1KCFA 3G0ZA 3ZSOA 4Q5VA 4E7JA 3U3YA 4OKJA 4ELTA 4NCAA 1RBTA 4KHQA 2HHWA 3TAGA 3WNEA 3TI0A 4CK2A 1RTJA 4KTZA 1TKTA 5KRSA 3M8PA 3NF9A 3RMBA 2ZD1A 4EZ6A 1TKXA 3LAMA 4O5BA 1WLJA 3SI6A 2Z1GA 1UA0A 1X9WA 4J2DA 4FW1A 1C1BA 2PZSA 3LALA 2HHUA 3VQ5A 1VSDA 4F2RA 4BWMA 1Z26A 3QESA 1RT7A 3DRRA 1IKWA 4EZ9A 3OYFA 2A1SA 4OLAA 4F2SA 3LP2A 4CJUA 3AO5A 3S3MA 1O1WA 3NDKA 1JL2A 2HB5A 4FJXA 2ZQBA 4BE1A 2HHTA 4N47A 1LW0A 1RT1A 1RTIA 3QINA 4DFPA 3WNGA 1WSGA 4EP5A 1TV6A 3TANA 4B9UA 1NJWA 1HYSA 1F21A 1HNIA 3DI6A 3KK2A 4LD0A 3NF8A 3PO4A 2P5GA 1LAVA 3NGYA 4DFMA 1EXQA 4FZYA 4KB1A 4E7HA 4RW6A 5DMRA 4B8CA 3EY1A 4FJNA 1TAUA 3KLGA 4ZTJA 1SL2A 4DU3A 5DK5A 2B4JA 4XIUA 2DFHA 2Y1JA 3M8RA 3K2PA 4CGDA 4HUFA 2OA8A 3K5LA 1U45A 4FK0A 4C8OA 1S1TA 1VK0A 4B08A 1T7PA 2JLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BHL A;  2IOC A;  3PUF A;  4I2P A;  4O0I A;  2R7Y A;  3DLK A;  3SZ2 A;  3SQ0 A;  1N5Y A;  1C1A A;  3LP3 A;  3NH0 A;  5J2M A;  3ZT1 A;  3OYA A;  3SPY A;  4NCB A;  1K6Y A;  3F9K A;  3HL8 A;  1X9M A;  3AA3 A;  2G8F A;  3KLI A;  1FKO A;  2X6N A;  2GBZ A;  1HMV A;  4IG3 A;  5C42 A;  3ULD A;  1LV5 A;  1GOA A;  4DS4 A;  4PUO A;  4CJR A;  1HRH A;  4CJT A;  2IAJ A;  1JLA A;  1BQN A;  4CEZ A;  2WOM A;  3L8B A;  3SV4 A;  4H8K A;  4CIG A;  5J1E A;  1X1P A;  2ETJ A;  4HCC A;  4M3T A;  4PA1 A;  1LWE A;  3KLH A;  2D0A A;  4CFA A;  1NJY A;  4FJM A;  4W5N A;  1RT5 A;  1IKY A;  3O3H A;  3VQ8 A;  3V1Q A;  3DLB A;  1HJR A;  1KVC A;  2OYQ A;  3LWM A;  4E3S A;  4HUG A;  3QET A;  4CJL A;  1BI4 A;  2P1J A;  2ZE2 A;  1JLF A;  5SWM A;  3SUQ A;  2W42 A;  4KTQ A;  2AJQ A;  4N56 A;  3QEX A;  4FLU A;  4ID1 A;  4HCB A;  4M3Z A;  1JLB A;  2LSN A;  2HND A;  2G8H A;  2B5J A;  3K57 A;  3SUP A;  1U4B A;  3OYG A;  1FK9 A;  1ZBU A;  3QEI A;  3SCX A;  2HVI A;  4M3X A;  5KRT A;  2G8I A;  1HPZ A;  1LWC A;  2OPP A;  3AVG A;  4HHT A;  2HHS A;  4FK4 A;  3TAQ A;  3NFA A;  2FBX A;  5HRN A;  1IH7 A;  3TAE A;  5CY4 A;  4FZZ A;  1RNH A;  2RF2 A;  2X74 A;  4CGH A;  4IG0 A;  3MED A;  1D5A A;  3EZ5 A;  1ZBH A;  2DTU A;  4OKE A;  3T1A A;  5FRO A;  3V81 A;  4B9S A;  1LWF A;  1Y97 A;  1VSI A;  4LH5 A;  4CJ4 A;  4FYD A;  4KHY A;  1QHT A;  2EX3 A;  2XRI A;  4RG8 A;  4DLG A;  1T05 A;  2HMI A;  3TAF A;  4CGI A;  3NH1 A;  2WON A;  3TWH A;  1GOC A;  4TSX A;  1VRT A;  1ZBI A;  1S1U A;  2D0C A;  4ELU A;  1BIS A;  3LP1 A;  4CER A;  3V9Z A;  2RN2 A;  4KTW A;  2KZZ A;  3ZT3 A;  2KQ2 A;  3F73 A;  1JXE A;  1UOC A;  3VQC A;  4CJW A;  4I2Q A;  3ZSV A;  4FJL A;  1S6Q A;  5J2P A;  2D5R A;  4Z4I A;  2Z1I A;  3ZSR A;  1NOY A;  3LAN A;  4CES A;  3NF7 A;  4E0D A;  4CF0 A;  4FVM A;  5E41 A;  2Q3S A;  2FBV A;  3VA0 A;  1QTM A;  5HP1 A;  1VSH A;  5HBM A;  2PY5 A;  5K14 A;  3QNN A;  4CIE A;  4OGC A;  3DOL A;  4DWI A;  2F8S A;  1IKV A;  4CEQ A;  1D9F A;  2G8U A;  2XY8 A;  4RW4 A;  4FZX C;  5KGW A;  1YVU A;  2KZM A;  3V9S A;  1RBU A;  1BCO A;  3AVI A;  3I8D A;  4CIF A;  1VSE A;  2XY5 A;  4B9M A;  3C6U A;  3I0S A;  1RTH A;  3RR7 A;  1BIU A;  2BAN A;  2GUI A;  4IBN A;  4RW7 A;  4WE1 A;  3M8Q A;  3L2Q A;  4ELV A;  2F96 A;  1BI4 B;  1SKS A;  5CYQ A;  1VSK A;  4BDZ A;  4KB0 A;  1L3S A;  4CJS A;  3P83 D;  3QNO A;  4KHN A;  4FK2 A;  1TK8 A;  2QKB A;  2VG5 A;  4CK1 A;  1ZYQ A;  1C6V A;  3ALY A;  3PX4 A;  4BWJ A;  2NUB A;  3S3N A;  4CHZ A;  4JRP A;  1C0M A;  3VQ7 A;  2YNI A;  4LSL A;  4AIL C;  4RW9 A;  1ZBL A;  2P51 A;  4DSI A;  1WAJ A;  1XHX A;  3QEW A;  4GW6 A;  4CK3 A;  2HW3 A;  1UWB A;  3NGI A;  4LY7 A;  2XHB A;  3DRS A;  4DTO A;  3MXI A;  3KK1 A;  4H4O A;  2P5O A;  3L3V A;  3QIO A;  4CJQ A;  2ATQ A;  3K59 A;  4CJV A;  3PX0 A;  4FM0 A;  3B6O A;  3PX6 A;  4KI4 A;  2YHA A;  4CJP A;  3OYL A;  3RR8 A;  2E6M A;  1U48 A;  1S9E A;  3OYC A;  4FM1 A;  3V1O A;  2Z1H A;  3JYT A;  2QKK A;  3SYZ A;  4Z4G A;  1YTA A;  3OS0 A;  3SUN A;  3K5O A;  4FXD A;  4OLB A;  4CJE A;  3G10 A;  4GMJ B;  3O3F A;  4MFB A;  1WN7 A;  1TK0 A;  3RMC A;  2O4I A;  3IRX A;  1RBR A;  3P1G A;  2XY7 A;  1Z25 A;  2VG7 A;  2BDP A;  1NOZ A;  4KV8 A;  4CGJ A;  2HNY A;  5HLF A;  4BDP A;  2YKN A;  3NE6 A;  3V4I A;  4DTS A;  1XC9 A;  4DFK A;  4C8M A;  3VQQ A;  3AO4 A;  4R5P A;  3DLR A;  4W5O A;  5SZT A;  3OYB A;  3DLH A;  1DTQ A;  2A1R A;  1T8E A;  5KI6 A;  3HVT A;  4FM2 A;  2DFF A;  5D3G A;  1EKE A;  4IFV A;  4DTX A;  4KI6 A;  4O0J A;  3QIP A;  4FJ9 A;  4H4M A;  4FJ5 A;  1U49 A;  1ZBF A;  4YNQ A;  4CEO A;  3LP0 A;  2O4G A;  5KTQ A;  3CFP A;  3TAP A;  3ZT4 A;  1KRP A;  4KAZ A;  4DF4 A;  1SV5 A;  3VQB A;  4Z4C A;  2G8V A;  3DMJ A;  1A5X A;  1W9H A;  4FJ8 A;  3H08 A;  3ISN C;  4W5T A;  3HT3 A;  1NK7 A;  4QAG A;  3OYD A;  3T19 A;  4DSL A;  3AVN A;  5FRM A;  3ZSW A;  4FW2 A;  4CJK A;  2VWJ A;  2QXF A;  4BE0 A;  4W5R A;  1VSJ A;  1N6Q A;  4CF2 A;  1NK8 A;  4MQ3 A;  2FBY A;  4AHU A;  2G8W A;  1RDA A;  1SKW A;  1DTT A;  3LWL A;  2RKI A;  3AV9 A;  1C1C A;  4OGE A;  3HJF A;  1XWL A;  4E7I A;  4B9N A;  4KHU A;  4PWD A;  1RCH A;  3NGZ A;  2KFZ A;  4FJK A;  3AVJ A;  3L2W A;  4N76 A;  4DG1 A;  3OYK A;  2E4L A;  4DSF A;  1SL0 A;  1ASV A;  4K8Z A;  1A5V A;  5HRP A;  1U47 A;  3AVB A;  4E1M A;  3VQP A;  1NK6 A;  4FLV A;  3RMD A;  4B8A B;  3SNN A;  2X6S A;  1J53 A;  3KJV A;  3NHG A;  3SQ4 A;  3VN5 A;  1VSL A;  3RRH A;  3K58 A;  2HHV A;  4CEC A;  3PV8 A;  4HUE A;  1CXQ A;  1VRU A;  4OVL A;  4IDK A;  4OPJ A;  5I42 A;  1TVR A;  3MEE A;  3ZSZ A;  4UQG A;  3MAQ A;  4DQR A;  1R0A A;  4PQU A;  1FXX A;  3V9X A;  2DY4 A;  1TL3 A;  1KTQ A;  1J5O A;  1HQE A;  4M3W A;  2KW4 A;  4KFB A;  3ZSY A;  1L5U A;  4CHN A;  3QEP A;  2PYJ A;  4FJH A;  4DTP A;  4KHW A;  3HK2 A;  4DS5 A;  3CFR A;  3ZCM A;  1LAW A;  3DLE A;  4F8R A;  1NJX A;  2YNG A;  1Q9X A;  4I9Q A;  1D8Y A;  3U6F A;  1KFS A;  2YHB A;  3LPT A;  1RT4 A;  4CF1 A;  4YFU A;  1L3T A;  4J2A A;  4CEB A;  4FLT A;  3EYZ A;  1MU2 A;  4DQS A;  4N41 A;  4CJ3 A;  1IKX A;  3K5M A;  4JS5 A;  4KRE A;  3AA5 X;  1G15 A;  3TAM A;  1YT3 A;  4QCL A;  4CJ5 A;  4B9T A;  5JS2 A;  4M3U A;  4PY5 A;  1B92 A;  4O55 A;  4M42 A;  1KFD A;  4J2E A;  2YNH A;  4OKK A;  4CJF A;  1KLM A;  2G8K A;  1NKE A;  1QSS A;  4KHS A;  2XO7 A;  2IC3 A;  3LZI A;  3KTQ A;  1EX4 A;  3VQE A;  3M8S A;  3KIO A;  3SQ2 A;  1KLN A;  4CCH A;  1YTU A;  1TAQ A;  4Z4F A;  1WNS A;  1S1V A;  1ITG A;  3ITH A;  2E6L A;  1TKZ A;  3OYH A;  1REV A;  4CE9 A;  5J2Q A;  4FJG A;  4M3Y A;  4DF8 A;  4RW8 A;  3ZSX A;  1RTD A;  4G1Q A;  4Y1D A;  3DRP A;  4QOZ B;  4B9V A;  2YV0 X;  3FFI A;  1RBS A;  4LH4 A;  4AHV A;  3RMA A;  4OPK A;  1U04 A;  2IDO A;  4M3R A;  3OYM A;  5I3U A;  3S3O A;  1NK9 A;  1SKR A;  3AVH A;  2JGU A;  3LPU A;  1JLG A;  4CF9 A;  4J2B A;  1J9A A;  2KFN A;  4M41 A;  2OZM A;  3OY9 A;  1RT3 A;  3HP9 A;  1JLE A;  1BIZ A;  1RDB A;  1WAF A;  3AO1 A;  1LW2 A;  3NF6 A;  4JLH A;  4KKO A;  3ZT2 A;  2OPS A;  3L2U A;  1IG9 A;  3BDP A;  4NYF A;  2VG6 A;  1HQU A;  1Q8I A;  1VSF A;  4DTR A;  1B9D A;  3AVF A;  4F3T A;  3V9W A;  3DOK A;  1B9F A;  4FLW A;  2B6A A;  4DSK A;  3QLH A;  3D0P A;  3VQ9 A;  3MXJ A;  4E19 A;  3AO3 A;  3SV3 A;  1WSI A;  3MEC A;  5EU7 A;  4NYN A;  3L2V A;  4DTU A;  1J54 A;  4LSN A;  1BQM A;  1Q9Y A;  1ASW A;  4CEF A;  4Z4E A;  1CZ9 A;  2BE2 A;  4F3O A;  3TR8 A;  2GV9 A;  3KKR A;  1HYV A;  3AVA A;  1D9D A;  4DTJ A;  3VA3 A;  4B3O A;  3NCI A;  4CF8 A;  3LAK A;  3HO1 A;  3CFO A;  4DQP A;  4CHY A;  4BAC A;  3D45 A;  2I5J A;  4AHT A;  1L3U A;  4CFB A;  1S1W A;  1TKD A;  2HHQ A;  1W0H A;  3KLF A;  1ASU A;  3AVL A;  4EP4 A;  1JL1 A;  4CHP A;  4DTN A;  4DSJ A;  1RBV A;  5KGX A;  1UAX A;  2IS3 A;  3HPO A;  4DFJ A;  3O4Q A;  4C8L A;  1WSH A;  5JS1 A;  3KD1 E;  1JKH A;  1HNV A;  1RT6 A;  3P5J A;  1TK5 A;  3RTV A;  4F4K A;  3HM9 A;  2XY6 A;  3VQ6 A;  2HVH A;  1NK0 A;  3PO5 A;  1I3A A;  1DLO A;  3THV A;  4KRF A;  4E89 A;  3MEG A;  1TGO A;  3DLG A;  4W5Q A;  2ITG A;  3QO9 A;  3OS2 A;  4JS4 A;  1CLQ A;  2X78 A;  2HHX A;  4ICL A;  4CED A;  1UA1 A;  3C6T A;  5CZ2 A;  2QK9 A;  5C24 A;  4AHS A;  4DQQ A;  3CYM A;  4DU4 A;  4Z4H A;  4BE2 A;  3QER A;  1S1X A;  3HVR A;  4HVJ A;  1JLQ A;  3K5N A;  1CZB A;  1SL1 A;  4O4G A;  2YNF A;  2FBT A;  3IG1 A;  1XI1 A;  3HPG A;  3O4N A;  5HRS A;  3NH2 A;  3OYJ A;  1L3V A;  1C0U A;  1WSJ A;  3JSM A;  4I9L A;  1QQC A;  4C8N A;  3OS1 A;  4FLZ A;  4DQI A;  1BCM A;  1C0T A;  3CM5 A;  4CGG A;  3KK3 A;  1S5J A;  3SUO A;  1XHZ A;  2F8T A;  5CYM A;  1KVB A;  4NCG A;  3HPH A;  4M45 A;  1EP4 A;  4DLE A;  1SUQ A;  3HST B;  3V9U A;  3ZT0 A;  3T3F A;  3OYE A;  3DYA A;  4ID5 A;  1NKB A;  4FJJ A;  2DFE A;  4L8R B;  3HXM A;  4CFC A;  1QE1 A;  4AHR A;  1WSF A;  3AA2 A;  3L3U A;  3NAE A;  1HYZ A;  1JXB A;  3U3G A;  2HNZ A;  2OPR A;  4OJR A;  3V6D A;  1RDD A;  1GOB A;  3VQD A;  2RPI A;  3TAR A;  2OZS A;  4FJI A;  3NBP A;  4CFD A;  1QSL A;  1T03 A;  3AO2 A;  1RDC A;  4DU1 A;  4ZHR A;  1QSY A;  3A2F A;  3CM6 A;  3SQ1 A;  4IKF A;  1KVA A;  1WSE A;  3LZJ A;  4DSE A;  4FCY A;  3KLE A;  3S9H A;  3KD5 E;  4K8X A;  1CXU A;  1JLC A;  3RWU A;  1RT2 A;  2BGG A;  3QEV A;  4CHO A;  5HRR A;  1EET A;  5HRO A;  3WNH A;  1S9G A;  4E1N A;  3AA4 A;  3L2R A;  3ASM A;  5C25 A;  3C95 A;  2D0B A;  1BGX T;  3VQ4 A;  4C8K A;  4Q0B A;  2OPQ A;  5T7B A;  3ZSQ A;  4ZTF A;  3B6P A;  3OYI A;  3RRG A;  3IAY A;  2IGI A;  3C94 A;  3VQA A;  3HP6 A;  1I39 A;  2FC0 A;  4HTU A;  4BDY A;  3BGR A;  3E01 A;  4E7K A;  1IO2 A;  3O3G A;  2KTQ A;  5CZ1 A;  3MXM A;  4B9L A;  1RIL A;  1NJZ A;  3SJJ A;  4KPY A;  3DM2 A;  4DMN A;  3LDS A;  4CGF A;  4CHQ A;  1FKP A;  2VWK A;  4O44 A;  4Z0U A;  3V1R A;  4FLY A;  2Y1I A;  3TAB A;  3CQ8 A;  3HYF A;  1S6P A;  3I0R A;  2YKM A;  4Y1C A;  1BL3 A;  1QS4 A;  3IS9 A;  5J2N A;  1NK5 A;  5FRN A;  2EHG A;  1KSP A;  1TL1 A;  2PYL A;  4JRQ A;  4AHC A;  4CEE A;  4E7L A;  3CG7 A;  4FJ7 A;  4N5S A;  5FDL A;  4FLX A;  2Z1J A;  3OJS A;  1X9S A;  4I7F A;  4DTM A;  3SPZ A;  4KO0 A;  3AVC A;  1A5W A;  1VSM A;  3OJU A;  3PY8 A;  4CEA A;  1NK4 A;  4AH9 A;  3KKS A;  4IFY A;  3UIQ A;  3AVM A;  4GVM A;  3AVK A;  3OYN A;  1NKC A;  3OVN A;  3WNF A;  1KCF A;  3G0Z A;  3ZSO A;  4Q5V A;  4E7J A;  3U3Y A;  4OKJ A;  4ELT A;  4NCA A;  1RBT A;  4KHQ A;  2HHW A;  3TAG A;  3WNE A;  3TI0 A;  4CK2 A;  1RTJ A;  4KTZ A;  1TKT A;  5KRS A;  3M8P A;  3NF9 A;  3RMB A;  2ZD1 A;  4EZ6 A;  1TKX A;  3LAM A;  4O5B A;  1WLJ A;  3SI6 A;  2Z1G A;  1UA0 A;  1X9W A;  4J2D A;  4FW1 A;  1C1B A;  2PZS A;  3LAL A;  2HHU A;  3VQ5 A;  1VSD A;  4F2R A;  4BWM A;  1Z26 A;  3QES A;  1RT7 A;  3DRR A;  1IKW A;  4EZ9 A;  3OYF A;  2A1S A;  4OLA A;  4F2S A;  3LP2 A;  4CJU A;  3AO5 A;  3S3M A;  1O1W A;  3NDK A;  1JL2 A;  2HB5 A;  4FJX A;  2ZQB A;  4BE1 A;  2HHT A;  4N47 A;  1LW0 A;  1RT1 A;  1RTI A;  3QIN A;  4DFP A;  3WNG A;  1WSG A;  4EP5 A;  1TV6 A;  3TAN A;  4B9U A;  1NJW A;  1HYS A;  1F21 A;  1HNI A;  3DI6 A;  3KK2 A;  4LD0 A;  3NF8 A;  3PO4 A;  2P5G A;  1LAV A;  3NGY A;  4DFM A;  1EXQ A;  4FZY A;  4KB1 A;  4E7H A;  4RW6 A;  5DMR A;  4B8C A;  3EY1 A;  4FJN A;  1TAU A;  3KLG A;  4ZTJ A;  1SL2 A;  4DU3 A;  5DK5 A;  2B4J A;  4XIU A;  2DFH A;  2Y1J A;  3M8R A;  3K2P A;  4CGD A;  4HUF A;  2OA8 A;  3K5L A;  1U45 A;  4FK0 A;  4C8O A;  1S1T A;  1VK0 A;  4B08 A;  1T7P A;  2JLE A; 
#chains in the Genus database with same CATH topology
 3MDQ A;  1VQO N;  4B3S K;  2WTU A;  3PUF A;  2R7Y A;  4O0I A;  2UXC K;  3DLK A;  3MX2 A;  3SPY A;  4NCB A;  1K6Y A;  4CBX A;  3KLI A;  3R3L A;  4E1J A;  5BPL A;  4DV0 K;  4A2A A;  1HMV A;  4RWT A;  1GLL O;  2A6A A;  3ULD A;  1LV5 A;  3EEQ A;  1JLA A;  4CEZ A;  5J1E A;  2ETJ A;  4CFA A;  4GVE A;  5BR8 K;  4FJM A;  5BN9 A;  4EIA A;  3VER A;  3DLB A;  3BF1 A;  3BF3 A;  2QW9 A;  4HUG A;  4CJL A;  3VF6 A;  5FPN A;  5SWM A;  4ILH A;  2YCH A;  4B1X B;  2LSN A;  3E9P A;  2QWO A;  5M1Q A;  2G8H A;  4JHD B;  3K57 A;  3SUP A;  4DR7 K;  3OYG A;  1HJO A;  4XEI A;  3QEI A;  4CZE A;  4JKE A;  3I55 N;  3AVG A;  3O1W A;  1QQO A;  4JI4 K;  2W6L A;  5CY4 A;  4DR1 K;  5KPT A;  1OVQ A;  2X74 A;  1D5A A;  4WF9 L;  4B9S A;  4XH1 A;  2XRI A;  5AZI A;  3TAF A;  3UB5 A;  4YHH K;  5C15 A;  1GOC A;  4B1U B;  4JV5 K;  2FLO A;  4BRP A;  3CC4 N;  3C6H A;  1MDU B;  2RN2 A;  4KTW A;  2KZZ A;  2KQ2 A;  4U67 L;  4JI2 K;  3ZSV A;  4WQ5 C;  2GEL A;  5J2P A;  2D5R A;  4KBO A;  1YHQ N;  4JD2 B;  2E5L K;  4DV2 K;  2PY5 A;  2J4R A;  1J6Z A;  3DOL A;  4CIE A;  1D9F A;  1VQN N;  3D7E O;  3QFU A;  5LMN K;  4BRF A;  1VSE A;  1X3M A;  1RTH A;  1BIU A;  4LF6 K;  4RW7 A;  3M8Q A;  2P9I B;  3L2Q A;  5F1X A;  1YF5 L;  5JVG L;  4ELV A;  2Q1N A;  1N34 K;  1SKS A;  4CJS A;  5DM6 L;  3QNO A;  5EOY A;  4CK1 A;  1C6V A;  3ALY A;  4CHZ A;  2I7P A;  2QWM A;  2P51 A;  2V7Y A;  4DSI A;  1XHX A;  3QEW A;  4GW6 A;  1UWB A;  3NGI A;  4LY7 A;  4JK7 A;  5AQL A;  2P5O A;  3HZ6 A;  2QXL A;  3KK1 A;  3QIO A;  3K59 A;  1WBD A;  3B6O A;  2YHA A;  3ATV A;  4CZI A;  1X3N A;  2E6M A;  1U48 A;  2WC9 A;  3OS0 A;  4RTF D;  3HRG A;  4CJE A;  3G10 A;  2E1Z A;  3WXK A;  3KWI A;  3G71 N;  5HLF A;  5KQ8 A;  2YKN A;  3C7N B;  3B8A X;  2ITM A;  4DFK A;  4FVU A;  2D0O A;  1T8E A;  3HVT A;  5D3G A;  4IFV A;  2IIR A;  3EE8 A;  3ZEU A;  4DR3 K;  4YDU C;  3THW B;  3ZT4 A;  2G8V A;  1C0G A;  3DMJ A;  5ELZ A;  3U8X A;  5FRM A;  3FZK A;  2VWJ A;  1NJI O;  4BE0 A;  3CET A;  4CF2 A;  1NK8 A;  4MQ3 A;  4AHU A;  1OH7 A;  1RDA A;  1SKW A;  1DTT A;  2RKI A;  4BRG A;  1XWL A;  5AQV A;  4BRC A;  2KFZ A;  4JNE A;  4GV3 A;  4DG1 A;  1SL0 A;  3BY5 A;  5M1O A;  1NK6 A;  4ISG A;  4FLV A;  1XNQ K;  1HUX A;  1GLJ O;  2X6S A;  1J53 A;  3NHG A;  3K58 A;  3U4L A;  4CEC A;  5LY3 A;  3MAQ A;  1FXX A;  1TL3 A;  1NGI A;  1HQE A;  2QM1 A;  4IJA A;  4KFB A;  4CHN A;  3QEP A;  4IOA L;  3CFR A;  5BRF A;  4F8R A;  4I9Q A;  3MCP A;  4FLT A;  3EYZ A;  1OVY A;  1MU2 A;  3CCQ N;  4CJ3 A;  3CC2 N;  1G15 A;  4CZL A;  5AQJ A;  2D4W A;  1TYQ B;  3LDN A;  4B9T A;  3BZK A;  2P9K A;  1DKG D;  4OKK A;  1QSS A;  3A5M C;  4AM6 A;  3ZET B;  4YOX A;  4Z4F A;  3D2E B;  1ITG A;  2W41 A;  1KQS M;  1WBB A;  3OYH A;  5J2Q A;  2P9P B;  3GOI A;  4K0K K;  4DF8 A;  4RW8 A;  1RTD A;  2ASO A;  2VQF K;  3VGL A;  1RBS A;  1NK9 A;  4OPK A;  1U04 A;  2IDO A;  3OYM A;  2KFN A;  1Q18 A;  1NGD A;  1ZC6 A;  1N8R O;  3O1B A;  3AO1 A;  1LW2 A;  3NF6 A;  3ZT2 A;  3L2U A;  5GIP A;  3ULE B;  3AVF A;  3V9W A;  3DOK A;  1B9F A;  4FLW A;  4DSK A;  4E19 A;  5IT9 O;  1W7A A;  3SV3 A;  5AQM A;  5BPN A;  1HR0 K;  4LSN A;  1BQM A;  2IVN A;  4CEF A;  1CZ9 A;  4F3O A;  5AQO A;  3TR8 A;  1OKJ A;  3KKR A;  2VYP A;  4A2B A;  1HPM A;  3VA3 A;  3O9T A;  4FOI A;  3LAK A;  5AJ3 K;  1L3U A;  4K43 A;  3FR0 A;  1HKG A;  3FZL A;  4CFB A;  2HHQ A;  3KLF A;  1ASU A;  4BC3 A;  2YJE A;  1W2B M;  1RDU A;  2Q31 A;  4MO4 A;  3HPO A;  3O4Q A;  4BQL A;  1WSH A;  4C8L A;  5JS1 A;  4WFN L;  5FPM A;  1HNV A;  1RT6 A;  3P5J A;  1TK5 A;  3RTV A;  2HVH A;  1NK0 A;  3PSF A;  3THV A;  3T1H K;  3AAQ A;  5H1S Q;  3OS2 A;  2X78 A;  3CJC A;  3KWG A;  5BN8 A;  5AQF A;  4EHU A;  2QK9 A;  3SAH A;  3CYM A;  4ISE A;  3L0Q A;  5BR9 A;  3AY9 A;  2VQE K;  4BE2 A;  3QER A;  4HVJ A;  3NVK A;  1ZBS A;  2ZWH A;  4H5W A;  3OYJ A;  1H1V A;  1C0U A;  3CC7 N;  1ILY A;  3OS1 A;  1YJ9 N;  3CCV N;  2Q36 A;  1C0T A;  4LF7 K;  3WEE A;  2F8T A;  1IV0 A;  1KVB A;  1EP4 A;  3OYE A;  3DYA A;  4ID5 A;  4JKF A;  4B1V A;  2DFE A;  3FE1 A;  4AHR A;  2P9L A;  1WSF A;  2YX6 A;  3AA2 A;  1JXB A;  1GOB A;  2RPI A;  3KLE A;  3KD5 E;  1ZXO A;  3RWU A;  5HRO A;  3WNH A;  4E1N A;  3AA4 A;  4C1N I;  1JCF A;  4HWI A;  4X66 K;  5M1F A;  3C95 A;  4Q0B A;  5T7B A;  2O8C B;  5JLH A;  3K9J A;  4EHT A;  1I39 A;  2FC0 A;  3TU5 A;  2KTQ A;  3MXM A;  4BVP A;  4CVN E;  3MMV A;  3O9Q A;  3SJJ A;  4KPY A;  2O8E B;  2FF6 A;  1E4G T;  3THX B;  1KD1 O;  3V1R A;  3TSU A;  4NO7 A;  4DQ8 A;  5LL6 Z;  5J2N A;  4BRA A;  4CEE A;  1SAZ A;  5FDL A;  2Z1J A;  4BR2 A;  4DTM A;  3AVC A;  4NXM K;  2P9N A;  1A5W A;  1ATN A;  4CEA A;  4IFY A;  4A59 A;  4BRM A;  3OVN A;  3WNF A;  1KCF A;  3G0Z A;  4CZK A;  4NCA A;  3CER A;  3T69 A;  1P90 A;  3M8P A;  3NF9 A;  5LMU K;  4B1W B;  1TKX A;  4J2D A;  3C6A A;  1X9W A;  4DR6 K;  1NGH A;  2RE2 A;  5TKW A;  3CCS N;  4F2R A;  1Z26 A;  3PSI A;  3EKU A;  4FOE A;  2A1S A;  4FPB A;  3J7Z O;  1XNR K;  5KPR A;  3S3M A;  1O1W A;  3NDK A;  3UKR B;  3H3N O;  3JAM O;  2HB5 A;  4N47 A;  4BC5 A;  4B9U A;  2UUB K;  1NJW A;  1HYS A;  2QWN A;  3KK2 A;  1OH8 A;  4LD0 A;  2P5G A;  1LAV A;  4AM7 A;  4RW6 A;  4FJN A;  3EY1 A;  4C23 A;  5CHI A;  3H46 O;  3KLG A;  4HUF A;  1BO5 O;  2G8K A;  1T7P A;  4BR5 A;  2JLE A;  3A5O C;  2CGL A;  3VGK A;  1E4F T;  3NH0 A;  5J2M A;  3OYA A;  4K41 A;  1FKO A;  1RFQ A;  4X65 K;  2A5X A;  4FWP A;  3CCJ N;  5C42 A;  1GOA A;  1HRH A;  2FXU A;  2IAJ A;  2ZJR L;  1BQN A;  2ZJQ L;  3L8B A;  1X1P A;  3VEV A;  4DR5 K;  1LWE A;  4BG8 A;  4JKC A;  3VEW A;  1IKY A;  4FSV A;  3O3H A;  1IBM K;  3V1Q A;  1HJR A;  2OYQ A;  1NLV A;  4O8U A;  2QA4 N;  2UXB K;  3I56 N;  4M3Z A;  3O6W A;  3QB0 A;  3CIP A;  5KRT A;  1LWC A;  4DUZ K;  2UYT A;  1WOQ A;  4HHT A;  2FBX A;  4I6M A;  4FZZ A;  5LJW A;  1ZBH A;  4YOV A;  2ASP A;  4ISF A;  2DTU A;  4OKE A;  5FRO A;  4M63 C;  4LH5 A;  3AGK A;  1VSI A;  3O4W A;  4FPA A;  4CD1 A;  4LF8 K;  1QHT A;  4KHY A;  1T05 A;  5M1P A;  1OH5 A;  4JKG A;  1S1U A;  4ELU A;  1BIS A;  2HBJ A;  3G6E N;  2P9S B;  2QTD A;  3ZT3 A;  1UOC A;  3VQC A;  4FJL A;  3WT0 A;  3ZSR A;  1NOY A;  3LAN A;  4CES A;  4Y0W A;  4FVM A;  2Q3S A;  2FF3 B;  3EE9 A;  2FBV A;  4BR7 A;  3N4P A;  3VA0 A;  5HP1 A;  1VQ5 N;  3OA9 A;  3QNN A;  3CJ9 A;  5EX5 A;  2QI2 A;  4DWI A;  1IKV A;  4BRL A;  4RW4 A;  1YVU A;  5JVH L;  1RBU A;  3EZW A;  3I8B A;  2VWB A;  4CIF A;  3ENH A;  4XH5 A;  1MWK A;  3RR7 A;  2PFU A;  2BAN A;  4IBN A;  4BR9 A;  3M1F A;  3D6R A;  3WXI A;  1VSK A;  4BDZ A;  4KHN A;  3P83 D;  2QKB A;  1QVF M;  3SAG A;  1ZYQ A;  4G9Z A;  3PX4 A;  3OBW A;  2NUB A;  4JRP A;  2YNI A;  4RW9 A;  3CCL N;  1K8K A;  1ZBL A;  2O8D B;  4LF5 K;  4LF4 K;  3ID8 A;  2E1Y A;  3DRS A;  2CGJ A;  4BRH A;  3N4Q A;  1BG3 A;  4H4O A;  3L3V A;  3MXI A;  3PX6 A;  4CJV A;  4FM0 A;  2DPN A;  3RR8 A;  1S9E A;  3WUH A;  4FM1 A;  3V1O A;  2UU9 K;  3JYT A;  2QKK A;  3SYZ A;  2PAV A;  4GMJ B;  2WUS A;  2O4I A;  1RBR A;  3M3Z A;  3P1G A;  4JI3 K;  1JCG A;  5LJV A;  3ENO A;  4CGJ A;  2HNY A;  4BDP A;  3V4I A;  1XC9 A;  4DTS A;  2RHK A;  2F9W A;  3VQQ A;  5I9E B;  4R5P A;  5SZT A;  5HOO A;  2GUP A;  3KZB A;  4FM2 A;  1EKE A;  4DTX A;  3QIP A;  4FJ9 A;  4H4M A;  1U49 A;  4YNQ A;  3LP0 A;  3CFP A;  3TAP A;  3VET A;  5GAE P;  3VQB A;  4BRQ A;  4Z4C A;  2CH6 A;  3ISN C;  4DV7 K;  1NK7 A;  4QAG A;  2E2O A;  2Q0U A;  2QXF A;  4MLH A;  2FBY A;  5AQZ A;  5AQU A;  5FLX O;  4B9N A;  5ADX A;  3NGZ A;  3OYK A;  4DSF A;  4K8Z A;  5AFU A;  4E1M A;  1YI2 N;  2F7T A;  3SNN A;  4Z94 A;  5AQK A;  1VSL A;  3VN5 A;  3RRH A;  2HHV A;  3HSC A;  4BRO A;  4OPJ A;  4IDK A;  1TVR A;  2YHW A;  2AA4 A;  4A62 A;  3ZSY A;  3C65 A;  3NMU A;  3GE1 A;  4DTP A;  4V19 S;  1ATS A;  3ZCM A;  1NJX A;  1Q9X A;  1D8Y A;  3IDH A;  1KFS A;  1RT4 A;  4YFU A;  4J2A A;  2GWK A;  1VQM N;  1Y64 A;  4N41 A;  3WXL A;  3BEX A;  3D2F B;  3K5M A;  4A61 A;  3TTF A;  4JKH A;  3ENB A;  1XQS C;  1B92 A;  4WCE L;  1KFD A;  2YNH A;  1KLM A;  2XO7 A;  4OX9 K;  1X9J A;  2OAN A;  4B1Y B;  3LZI A;  3GBT A;  3CPE A;  1W97 L;  4YOY A;  1WNS A;  1S1V A;  3LM9 A;  4IJN A;  1REV A;  4M3Y A;  1U2V B;  3ZSX A;  4G1Q A;  3DRP A;  1V4S A;  4LH4 A;  4AHV A;  3S3O A;  2JGU A;  1JLG A;  2OZM A;  3OY9 A;  3CJA A;  3HP9 A;  1BIZ A;  1WAF A;  3CJ7 A;  4JLH A;  4DV4 K;  2VG6 A;  4M7Y A;  1Q8I A;  3IMX A;  4PKH A;  4F3T A;  3QLH A;  4JHD A;  3E9L A;  3VQ9 A;  1IBL K;  5EU7 A;  3L2V A;  4DTU A;  3QDK A;  3OHR A;  2VGN A;  4Z4E A;  3MN5 A;  2BE2 A;  3AVA A;  1NM1 A;  3NCI A;  3CFO A;  4JI1 K;  3ZX3 A;  3W0L A;  1S72 N;  1TKD A;  2GX9 A;  1JL1 A;  1D4X A;  2O8F B;  1UAX A;  1GLE G;  4JKD A;  1M90 O;  5AQI A;  3CD6 N;  3MEG A;  1TGO A;  2ITG A;  4JK8 A;  3P39 A;  4GKK K;  3MN6 A;  3C6T A;  5CZ2 A;  4JD2 A;  4WQ4 A;  4CI6 A;  4Z4H A;  1S1X A;  1SL1 A;  5C0Y A;  3FLC O;  3H45 C;  3HPG A;  3O4N A;  1L3V A;  4KH5 A;  4I9L A;  1QQC A;  3VEX A;  4LC9 B;  5KPZ A;  4GY2 B;  4FWO A;  4M45 A;  2NRT A;  4FWN A;  4DLE A;  3HST B;  2P9I A;  3ZT0 A;  3T3F A;  1NKB A;  1E3M A;  4FJJ A;  3NVM A;  4L8R B;  3HTV A;  3GDQ A;  3L3U A;  4LFC K;  3VQD A;  3HM8 A;  3NBP A;  3E66 A;  4IOX A;  4IKF A;  3CM6 A;  4NLC A;  1K9M O;  1WSE A;  3ATU A;  5AZJ B;  4DSE A;  4K8X A;  2HBK A;  3O80 A;  1CXU A;  3QEV A;  1S9G A;  1N32 K;  2D0B A;  3OYI A;  3SMP A;  2IGI A;  4ILG B;  4M7X A;  4HTU A;  3TSQ A;  4E7K A;  1YVN A;  2F9T A;  4B9L A;  1RIL A;  1KXP A;  5M1K A;  1SZ2 A;  3DM2 A;  1Z6R A;  1FKP A;  2VWK A;  2Y1I A;  3TAB A;  3MCA B;  3HYF A;  1S6P A;  3C7N A;  1QS4 A;  5FRN A;  1NK5 A;  1TL1 A;  4JRQ A;  3VMF B;  3PIP L;  1XUP O;  2NZT A;  3OJS A;  3CPW M;  4I7F A;  1GLD G;  2P9U A;  4HTL A;  4WQ5 A;  4QS8 A;  1BOT O;  4DV1 K;  4CZH A;  3OJU A;  3PY8 A;  4AH9 A;  1SS6 A;  3OYN A;  3U3Y A;  4Q5V A;  4DV6 K;  4ELT A;  4OKJ A;  2QWL A;  1YXQ A;  2HHW A;  3TAG A;  3TI0 A;  4KTZ A;  1TKT A;  2GEM A;  4BRE A;  2ZD1 A;  4EZ6 A;  4O5B A;  3SI6 A;  4BRD A;  4FW1 A;  5TKY A;  3S41 A;  1EWQ A;  1VSD A;  4BWM A;  2OTL N;  3DLL L;  1DT9 A;  5C2F A;  4OLA A;  1NMD A;  3LP2 A;  3RSE B;  3AO5 A;  4CJU A;  1NGF A;  4JEP A;  2F4V K;  2ZQB A;  3CHW A;  2HHT A;  1LW0 A;  1RTI A;  4AQY K;  2YHX A;  2NRV A;  1HNI A;  3DI6 A;  2CH5 A;  3NF8 A;  3EN9 A;  4KH6 A;  1XMO K;  4NB4 A;  4CJ7 A;  2CGK A;  2Q0R A;  3VPZ A;  1KAX A;  2Y1J A;  5KQD A;  4CGD A;  4FK0 A;  1EET A;  1VK0 A;  2IOC A;  3SZ2 A;  1Q86 O;  1C1A A;  4DKW A;  2G8F A;  3A0I X;  2X6N A;  4IG3 A;  3FGU A;  1C0F A;  4CJR A;  4PUO A;  1NGA A;  4CJT A;  3ZET A;  2WOM A;  4CIG A;  4HCC A;  4M3T A;  3KLH A;  1JCE A;  3O9R A;  1NJY A;  1KAY A;  4W5N A;  1RT5 A;  2P9P A;  3VQ8 A;  4PKI A;  3LWM A;  4YDU A;  3HI0 A;  1BI4 A;  2P1J A;  2ZE2 A;  1JLF A;  4KTQ A;  3QEX A;  4HCB A;  1M1K O;  4NLB A;  5AQR A;  1JLB A;  1IG8 A;  2E88 A;  1NMN A;  4M3X A;  2G8I A;  1TUU A;  2OPP A;  1YJN N;  1VQL N;  4FK4 A;  4O5F A;  2I7N A;  1IH7 A;  1RNH A;  2RF2 A;  1Q7Y O;  3V81 A;  2ZGY A;  1LWF A;  5CE3 A;  4CJ4 A;  4FYD A;  4H5N A;  4DLG A;  2HMI A;  4CGI A;  3NH1 A;  1VRT A;  1ZBI A;  2D0C A;  2E20 A;  2QWR A;  3LP1 A;  3V9Z A;  3T7Z A;  3A5L C;  3H1Q A;  3F73 A;  1HKC A;  1JXE A;  4C1N K;  1HNW K;  5E26 A;  4H0O A;  4H0Y B;  4Z4I A;  2Z1I A;  2YJF A;  3VEZ A;  3VF4 A;  4X62 K;  5E41 A;  1TUY A;  1K8A O;  5K14 A;  4BGA A;  2Q2R A;  3DXK B;  2XY8 A;  5KGW A;  3WQU A;  3V9S A;  1BCO A;  3I8D A;  1K73 O;  4B9M A;  3I0S A;  5EY4 A;  2GUI A;  2V51 B;  4DV5 K;  3CME N;  4WE1 A;  2UUC K;  4BY9 C;  3I33 A;  5CYQ A;  3ZX2 A;  4IZ9 A;  2E2N A;  4FK2 A;  1NGJ A;  1Q82 O;  4BWJ A;  1C0M A;  2GTD A;  1P8Z A;  3VQ7 A;  4AIL C;  3AGR A;  1S3X A;  4CK3 A;  4FWM A;  2XHB A;  4CJQ A;  2ATQ A;  3PX0 A;  4KI4 A;  5M1N A;  1EO1 A;  3THY B;  1EQY A;  2Z1H A;  4DHY A;  1YTA A;  4FXD A;  3K5O A;  2JWL A;  4B3T K;  4MFB A;  1WN7 A;  1TK0 A;  3O9U A;  3IRX A;  1VHX A;  1NGC A;  1Z25 A;  2VG7 A;  4GKJ K;  1VQP N;  1T6D A;  4C8M A;  5B8H A;  3AO4 A;  4W5O A;  1WB9 A;  1U6Z A;  4OPH A;  3DLH A;  2A1R A;  3GL1 A;  3GG4 A;  3THX A;  4O0J A;  1VQK N;  2OCE A;  1KRP A;  1SV5 A;  1W9H A;  1A5X A;  4BRI A;  4FJ8 A;  1NBW A;  1HNX K;  3VF2 A;  3UKU A;  2HHH K;  3ZSW A;  4W5R A;  1VSJ A;  1N6Q A;  4LFA K;  2JWK A;  4H0P A;  3FZM A;  3HJF A;  4PWD A;  1RCH A;  1V4T A;  4FJK A;  3AVJ A;  3L2W A;  4N76 A;  2E4L A;  1QVG M;  1A5V A;  1U47 A;  3AVB A;  5JLF A;  1RDW X;  4B8A B;  1KAZ A;  3SQ4 A;  3QIC A;  4HUE A;  1CXQ A;  1VRU A;  4OVL A;  1VQ8 N;  4DQR A;  4YY3 K;  2DY4 A;  4M3W A;  1RGI A;  3UKR A;  3VGM A;  3KHY A;  2QEX N;  4KHW A;  3HK2 A;  1LAW A;  2YNG A;  1BDG A;  1NWK A;  3LPT A;  1L3T A;  4B9Q A;  5JMV A;  4WFB L;  4DQS A;  4MLE A;  4O8K A;  4KRE A;  2AP1 A;  3TAM A;  4OPA A;  1YT3 A;  3IUC A;  4QS7 A;  3M6G A;  4CJ5 A;  4M3U A;  5JS2 A;  3OW2 M;  5ADX H;  2A41 A;  3LDO A;  4KHS A;  5AFU H;  1GLF O;  2IC3 A;  3R6M A;  3VQE A;  3M8S A;  3BZC A;  2H3G X;  3SQ2 A;  1XC3 A;  1TAQ A;  4GV6 A;  1I94 K;  2BH1 A;  1TKZ A;  4FJG A;  4CE9 A;  3WXJ A;  1BA0 A;  4PL8 A;  2W6K A;  4Y1D A;  1CZA N;  4QOZ B;  3AVH A;  3LPU A;  3SJH A;  4CF9 A;  4J2B A;  1J9A A;  1ESV A;  3DWL A;  3KK7 A;  5GAH P;  1JLE A;  1RDB A;  4YOU A;  3CXC M;  5FPD A;  1S22 A;  1FJG K;  2HMP A;  3HBT A;  1OH6 A;  3CCR N;  4B3R K;  3DJC A;  4DTR A;  2Q97 A;  4GV9 A;  3MXJ A;  4CZG A;  3AO3 A;  1WSI A;  3MEC A;  1Q9Y A;  1ASW A;  5AZI B;  4J8F A;  4YOR A;  2GV9 A;  3P38 A;  2A42 A;  3ZLJ A;  1QHA A;  2ZM6 K;  3MK6 A;  4DTJ A;  2O8B A;  4CF8 A;  5MLC Q;  1HX1 A;  4DQP A;  4A5B A;  4CHY A;  3D45 A;  5AQH A;  4EP4 A;  4DTN A;  4CHP A;  2HBL A;  1RBV A;  2IS3 A;  4DFJ A;  4BG9 A;  2WFB A;  2HST A;  3IKM A;  3UE5 A;  2P9S A;  4A5A A;  3KD1 E;  4FWL A;  3HM9 A;  2XY6 A;  3VQ6 A;  3PO5 A;  3EKS A;  4E89 A;  3QO9 A;  2HBM A;  3A8Y A;  4CED A;  3AAR A;  4IO8 A;  4IOC L;  3H6E A;  3HVR A;  3CCE N;  1JLQ A;  3K5N A;  4O4G A;  2YNF A;  2FBT A;  4MO5 A;  3IG1 A;  1DEJ A;  4PKG A;  1WSJ A;  4C8N A;  4DR2 K;  4BC2 A;  1BCM A;  1HKB A;  1JJ2 M;  3K0S A;  3CM5 A;  5E84 A;  4CGG A;  3LL3 A;  1XHZ A;  4NCG A;  3DXM A;  2UXD K;  3L4I A;  1QZ6 A;  3VOV A;  3NAE A;  1HYZ A;  2OPR A;  3TAR A;  4CFD A;  1QSL A;  4DU1 A;  4ZHR A;  3A2F A;  1KVA A;  3LZJ A;  2O8D A;  3S9H A;  2BGG A;  5HRR A;  3QBW A;  1IJJ A;  5GIO A;  3ASM A;  3MN7 A;  5C25 A;  4C8K A;  1BGX T;  3K9K A;  4EAH D;  4H0V B;  4A57 A;  4ZTF A;  3B6P A;  1IBK K;  3VQA A;  3HP6 A;  3T1Y K;  4BDY A;  3E01 A;  4PHT X;  5CZ1 A;  5C2D A;  4JK9 A;  4DMN A;  4CGF A;  4H5R A;  3A5N C;  4O44 A;  4CHQ A;  4FLY A;  3ZEU B;  3CQ8 A;  4WYB A;  1LOT B;  2YKM A;  4Y1C A;  1BL3 A;  1BWF O;  2EHG A;  1KSP A;  4AHC A;  4FJ7 A;  4IO9 L;  3CG7 A;  4E7L A;  4IEE A;  4KO0 A;  4B3M K;  1VSM A;  3J7Y P;  1NK4 A;  3AVM A;  1NNE A;  2E2Q A;  4ILJ A;  4FWK A;  1BA1 A;  3SBT A;  1RBT A;  1Q81 O;  4QS9 A;  3WNE A;  4CK2 A;  5A2Q O;  5KRS A;  3SAF A;  3LAM A;  3E9O A;  1VAZ A;  1WLJ A;  2Z1G A;  5BRH A;  2E2P A;  1C1B A;  2HHU A;  2NNW A;  1GLC G;  2NLX A;  1IKW A;  3O08 A;  4EZ9 A;  3Q7B A;  3LDL A;  4CBW A;  4FO0 A;  3VES A;  2OTJ N;  1SQK A;  4JKA A;  1JL2 A;  4FJX A;  1NU0 A;  1R59 O;  4FWQ A;  3JXU A;  3WNG A;  4JAX A;  4EP5 A;  3TAN A;  4BR0 A;  3CCU N;  2IVP A;  3NGY A;  1EXQ A;  4FZY A;  2BUP A;  3QFP A;  4E7H A;  4B8C A;  5DMR A;  2KLA A;  4WFA L;  3LM2 A;  5C12 A;  3E1Y A;  3G25 A;  3TTC A;  2DFH A;  4XIU A;  2OA8 A;  3K2P A;  4H5V A;  4C8O A;  2P9K B;  1S1T A;  4B08 A;  1HQU A;  4JKB A;  4DCH A;  1BHL A;  4I2P A;  1N5Y A;  3M5R A;  3SQ0 A;  3D2F A;  5AQS A;  3LP3 A;  3ZT1 A;  4JYA K;  3H3O B;  3F9K A;  5IWA K;  3AAP A;  3HL8 A;  1X9M A;  3AA3 A;  3J8A A;  5AR0 A;  2GBZ A;  5GIN A;  4DS4 A;  2YHY A;  2QWQ A;  2P9U B;  3SV4 A;  4H8K A;  2D1K A;  4PA1 A;  2D0A A;  2ZF5 O;  1U2V A;  1KVC A;  2BTF A;  4E3S A;  3QET A;  4K25 A;  3SUQ A;  2AJQ A;  2W42 A;  3C0B A;  4N56 A;  4FLU A;  4ID1 A;  4JI6 K;  4JI8 K;  1MA9 B;  3MWP A;  2HND A;  4MDB A;  5AQT A;  2B5J A;  3F9M A;  1U4B A;  1FK9 A;  1ZBU A;  4JI7 K;  3SCX A;  3O5B A;  2HVI A;  1HPZ A;  5HL7 L;  2HHS A;  3TAQ A;  3NFA A;  5HRN A;  3TAE A;  2ASM A;  4CGH A;  4IG0 A;  3MED A;  3EZ5 A;  3T1A A;  1Y97 A;  3OBY A;  4LF9 K;  2EX3 A;  4QCL A;  4RG8 A;  2WON A;  3TWH A;  4TSX A;  5AQX A;  3P31 A;  2PBD A;  4CER A;  1MWM A;  3SMS A;  1O13 A;  4CJW A;  4I2Q A;  3VEY A;  3P4I A;  1S6Q A;  2O8F A;  4IFE A;  2A40 A;  4E0D A;  3NF7 A;  4CF0 A;  3R8E A;  1QTM A;  1VSH A;  3THW A;  1VQ7 N;  5HBM A;  1NG9 A;  4OGC A;  4DR4 K;  2F8S A;  4CEQ A;  2G8U A;  4FZX C;  1ATR A;  1BU6 O;  2KZM A;  3AVI A;  1G99 A;  2XY5 A;  3U9Z A;  3WEE B;  3C6U A;  3CCM N;  2GWJ A;  2F96 A;  1BI4 B;  2P9L B;  4KB0 A;  1L3S A;  4BR4 A;  3PIO L;  1TK8 A;  1N36 K;  3R1X A;  2VG5 A;  3S3N A;  4L3Q A;  4LSL A;  2KKZ A;  1WAJ A;  3VEO A;  3J81 O;  2HW3 A;  2WBN A;  5BRE A;  3R9P A;  4DTO A;  3W3D A;  1T6C A;  4X64 K;  1QQN A;  3OYL A;  4CJP A;  5AZJ A;  4NXN K;  3O9S A;  3OYC A;  4YOT A;  4Z4G A;  3SUN A;  4OLB A;  3O3F A;  5JIC A;  3RMC A;  3CQY A;  2V52 B;  2XY7 A;  2BDP A;  1NOZ A;  4KV8 A;  3NE6 A;  1TYQ A;  1GLA G;  3DLR A;  3OYB A;  1DTQ A;  5KI6 A;  2DFF A;  4KI6 A;  4FJ5 A;  1ZBF A;  3WQT A;  2P9N B;  4CEO A;  1T44 A;  3D2E A;  2W40 A;  2O4G A;  5KTQ A;  1T3V A;  3KVG A;  4K42 A;  4KAZ A;  4FL9 A;  4DF4 A;  4H03 B;  3H08 A;  4W5T A;  3HT3 A;  3OYD A;  3QBX A;  3T19 A;  3CJ1 A;  4DSL A;  3AVN A;  4FW2 A;  4CJK A;  1YJW N;  2G8W A;  2NRX A;  2HOE A;  3FZH A;  3LWL A;  4FWS A;  1VQ4 N;  3AV9 A;  4PL7 A;  4KHP K;  1C1C A;  4OGE A;  4KHU A;  5BPM A;  2ZGZ A;  2KHO A;  4E7I A;  3JS6 A;  5GAG P;  4CZJ A;  3EL2 A;  1ASV A;  1LCU A;  5HRP A;  5GAD P;  3FFK B;  3ULE A;  3VQP A;  3RMD A;  3LDQ A;  3KJV A;  4BRK A;  3TSP A;  3PV8 A;  1UA1 A;  5I42 A;  3F2K A;  3MEE A;  3ZSZ A;  1EWR A;  4UQG A;  1R0A A;  4PQU A;  3L6Q A;  4MDA A;  5AQG A;  3V9X A;  3CMA N;  1KTQ A;  3RSE A;  1J5O A;  2KW4 A;  1L5U A;  1YUW A;  3Q7C A;  2PYJ A;  4FJH A;  3U9D A;  2NRZ A;  4DS5 A;  3DLE A;  3U6F A;  2YHB A;  3SBG A;  4CF1 A;  3QML A;  4CEB A;  4CBU A;  5AQQ A;  1IKX A;  4JS5 A;  3AA5 X;  3TTD A;  5EXW A;  4BVO A;  3OTO K;  4PY5 A;  3VEN A;  4XH4 A;  4O55 A;  4M42 A;  1DGK N;  4J2E A;  4CJF A;  1NKE A;  2HF3 A;  1J5E K;  3KTQ A;  4F9O A;  4JI0 K;  1EX4 A;  3KIO A;  1KC8 O;  4DB3 A;  1KLN A;  4CCH A;  1YTU A;  1VQ6 N;  5CR4 A;  5FPE A;  3ITH A;  1NGE A;  2E6L A;  1FW6 A;  3UKU B;  4B9V A;  2YV0 X;  3FFI A;  3L4Q A;  3RMA A;  4IEI A;  4M3R A;  2IVO A;  5I3U A;  1SKR A;  4GNI A;  3VTH A;  4M41 A;  1RT3 A;  4KKO A;  1IG9 A;  2OPS A;  3BDP A;  4U7B A;  4NYF A;  1VSF A;  5AQP A;  2A3Z A;  1B9D A;  4I6M B;  3PLA A;  2B6A A;  3D0P A;  3MX5 A;  4CZF A;  5AQY A;  4NYN A;  4JI5 K;  1J54 A;  3MWT A;  4IDH A;  3VTI A;  3IFR A;  4JKG B;  1HYV A;  1NGG A;  1D9D A;  2ZJP L;  4B3O A;  2O8C A;  3HO1 A;  4H0X B;  4OO1 J;  3TPQ A;  4BAC A;  4KH4 A;  2I5J A;  4AHT A;  1S1W A;  1W0H A;  3DAW A;  2VCP A;  3AVL A;  4LFB K;  4DSJ A;  2FSK A;  5KGX A;  2O8E A;  1JKH A;  4F4K A;  4UY8 O;  4BGB A;  1I3A A;  1DLO A;  2UUA K;  1N33 K;  4KRF A;  1QZ5 A;  4W5Q A;  3DLG A;  4JS4 A;  1CLQ A;  2HHX A;  4ICL A;  3CI5 A;  5C24 A;  4AHS A;  4DQQ A;  4DU4 A;  4FWR A;  1WUA A;  1CZB A;  3LDP A;  4DV3 K;  1XI1 A;  5HRS A;  3NH2 A;  3DXK A;  4IXC A;  3JSM A;  4DQI A;  3CQX A;  4FLZ A;  3KK3 A;  1S5J A;  3SUO A;  3RVC A;  5CYM A;  3O8M A;  1YIT N;  3HPH A;  1SUQ A;  3V9U A;  3ID6 A;  1K8K B;  3HXM A;  4CFC A;  1QE1 A;  4H5T A;  3U3G A;  2HNZ A;  3V6D A;  4OJR A;  4EFH A;  1RDD A;  2OZS A;  4FJI A;  2NRW A;  3AO2 A;  1RDC A;  1T03 A;  1QSY A;  3SQ1 A;  3HOS A;  5C10 A;  4FCY A;  4R79 A;  1JLC A;  1RT2 A;  4BQZ A;  1YIJ N;  4CHO A;  3CF5 L;  4H0T B;  3L2R A;  3F5T A;  3VQ4 A;  4BRN A;  4CZM A;  2O8B B;  2OPQ A;  3ZSQ A;  3RRG A;  3IAY A;  3THY A;  3C94 A;  3FZF A;  3ZX0 A;  3BGR A;  1IO2 A;  3O3G A;  1NJZ A;  2NRH A;  4YOW A;  3EO3 A;  5AQW A;  3LDS A;  2D0P A;  4Z0U A;  2EWS A;  3I0R A;  3G4S N;  3IS9 A;  2PYL A;  3BUZ B;  1HNZ K;  3H1V X;  3ZYY X;  3J7A P;  4N5S A;  4FLX A;  4IWV A;  1XMQ K;  1X9S A;  1GLB G;  3SPZ A;  1HLU A;  2NRR A;  1VQ9 N;  3MN9 A;  3KKS A;  3UIQ A;  4GVM A;  3AVK A;  5DM7 L;  1NKC A;  3J80 O;  1BUP A;  3ZSO A;  4E7J A;  2E8A A;  4KHQ A;  4B1Z A;  1Z05 A;  1RTJ A;  2HF4 A;  4CW7 B;  3RMB A;  4BC4 A;  4DUY K;  1UA0 A;  1QQM A;  3DXM B;  3BP8 A;  2PZS A;  2FSJ A;  3LAL A;  3WXM B;  4JN4 A;  3VQ5 A;  4AF1 A;  2VGM A;  3QES A;  1RT7 A;  3DRR A;  3SLC A;  3OYF A;  4F2S A;  2QWP A;  4CD3 A;  2FSN A;  4BE1 A;  5EVZ A;  1RT1 A;  3QIN A;  4DFP A;  1WSG A;  1TV6 A;  3HOT A;  1F21 A;  3PO4 A;  4DFM A;  5BRD A;  4KB1 A;  1YAG A;  5AQN A;  5F0X A;  4RCH A;  1TAU A;  2V7Z A;  4ZTJ A;  1SL2 A;  5F2R A;  4DU3 A;  1NGB A;  2B4J A;  5DK5 A;  3M8R A;  3SK3 A;  3K5L A;  1U45 A;  4WQ4 C;  3CJB A;  2YI1 A; 
#chains in the Genus database with same CATH homology
 1BHL A;  2IOC A;  3PUF A;  4I2P A;  4O0I A;  2R7Y A;  3DLK A;  3SZ2 A;  3SQ0 A;  1N5Y A;  1C1A A;  3LP3 A;  3NH0 A;  5J2M A;  3ZT1 A;  3OYA A;  3SPY A;  4NCB A;  1K6Y A;  3F9K A;  3HL8 A;  1X9M A;  3AA3 A;  2G8F A;  3KLI A;  1FKO A;  2X6N A;  2GBZ A;  1HMV A;  4IG3 A;  5C42 A;  3ULD A;  1LV5 A;  1GOA A;  4DS4 A;  4PUO A;  4CJR A;  1HRH A;  4CJT A;  2IAJ A;  1JLA A;  1BQN A;  4CEZ A;  2WOM A;  3L8B A;  3SV4 A;  4H8K A;  4CIG A;  5J1E A;  1X1P A;  2ETJ A;  4HCC A;  4M3T A;  4PA1 A;  1LWE A;  3KLH A;  2D0A A;  4CFA A;  1NJY A;  4FJM A;  4W5N A;  1RT5 A;  1IKY A;  3O3H A;  3VQ8 A;  3V1Q A;  3DLB A;  1HJR A;  1KVC A;  2OYQ A;  3LWM A;  4E3S A;  4HUG A;  3QET A;  4CJL A;  1BI4 A;  2P1J A;  2ZE2 A;  1JLF A;  5SWM A;  3SUQ A;  2W42 A;  4KTQ A;  2AJQ A;  4N56 A;  3QEX A;  4FLU A;  4ID1 A;  4HCB A;  4M3Z A;  1JLB A;  2LSN A;  2HND A;  2G8H A;  2B5J A;  3K57 A;  3SUP A;  1U4B A;  3OYG A;  1FK9 A;  1ZBU A;  3QEI A;  3SCX A;  2HVI A;  4M3X A;  5KRT A;  2G8I A;  1HPZ A;  1LWC A;  2OPP A;  3AVG A;  4HHT A;  2HHS A;  4FK4 A;  3TAQ A;  3NFA A;  2FBX A;  5HRN A;  1IH7 A;  3TAE A;  5CY4 A;  4FZZ A;  1RNH A;  2RF2 A;  2X74 A;  4CGH A;  4IG0 A;  3MED A;  1D5A A;  3EZ5 A;  1ZBH A;  2DTU A;  4OKE A;  3T1A A;  5FRO A;  3V81 A;  4B9S A;  1LWF A;  1Y97 A;  1VSI A;  4LH5 A;  4CJ4 A;  4FYD A;  4KHY A;  1QHT A;  2EX3 A;  2XRI A;  4RG8 A;  4DLG A;  1T05 A;  2HMI A;  3TAF A;  4CGI A;  3NH1 A;  2WON A;  3TWH A;  1GOC A;  4TSX A;  1VRT A;  1ZBI A;  1S1U A;  2D0C A;  4ELU A;  1BIS A;  3LP1 A;  4CER A;  3V9Z A;  2RN2 A;  4KTW A;  2KZZ A;  3ZT3 A;  2KQ2 A;  3F73 A;  1JXE A;  1UOC A;  3VQC A;  4CJW A;  4I2Q A;  3ZSV A;  4FJL A;  1S6Q A;  5J2P A;  2D5R A;  4Z4I A;  2Z1I A;  3ZSR A;  1NOY A;  3LAN A;  4CES A;  3NF7 A;  4E0D A;  4CF0 A;  4FVM A;  5E41 A;  2Q3S A;  2FBV A;  3VA0 A;  1QTM A;  5HP1 A;  1VSH A;  5HBM A;  2PY5 A;  5K14 A;  3QNN A;  4CIE A;  4OGC A;  3DOL A;  4DWI A;  2F8S A;  1IKV A;  4CEQ A;  1D9F A;  2G8U A;  2XY8 A;  4RW4 A;  4FZX C;  5KGW A;  1YVU A;  2KZM A;  3V9S A;  1RBU A;  1BCO A;  3AVI A;  3I8D A;  4CIF A;  1VSE A;  2XY5 A;  4B9M A;  3C6U A;  3I0S A;  1RTH A;  3RR7 A;  1BIU A;  2BAN A;  2GUI A;  4IBN A;  4RW7 A;  4WE1 A;  3M8Q A;  3L2Q A;  4ELV A;  2F96 A;  1BI4 B;  1SKS A;  5CYQ A;  1VSK A;  4BDZ A;  4KB0 A;  1L3S A;  4CJS A;  3P83 D;  3QNO A;  4KHN A;  4FK2 A;  1TK8 A;  2QKB A;  2VG5 A;  4CK1 A;  1ZYQ A;  1C6V A;  3ALY A;  3PX4 A;  4BWJ A;  2NUB A;  3S3N A;  4CHZ A;  4JRP A;  1C0M A;  3VQ7 A;  2YNI A;  4LSL A;  4AIL C;  4RW9 A;  1ZBL A;  2P51 A;  4DSI A;  1WAJ A;  1XHX A;  3QEW A;  4GW6 A;  4CK3 A;  2HW3 A;  1UWB A;  3NGI A;  4LY7 A;  2XHB A;  3DRS A;  4DTO A;  3MXI A;  3KK1 A;  4H4O A;  2P5O A;  3L3V A;  3QIO A;  4CJQ A;  2ATQ A;  3K59 A;  4CJV A;  3PX0 A;  4FM0 A;  3B6O A;  3PX6 A;  4KI4 A;  2YHA A;  4CJP A;  3OYL A;  3RR8 A;  2E6M A;  1U48 A;  1S9E A;  3OYC A;  4FM1 A;  3V1O A;  2Z1H A;  3JYT A;  2QKK A;  3SYZ A;  4Z4G A;  1YTA A;  3OS0 A;  3SUN A;  3K5O A;  4FXD A;  4OLB A;  4CJE A;  3G10 A;  4GMJ B;  3O3F A;  4MFB A;  1WN7 A;  1TK0 A;  3RMC A;  2O4I A;  3IRX A;  1RBR A;  3P1G A;  2XY7 A;  1Z25 A;  2VG7 A;  2BDP A;  1NOZ A;  4KV8 A;  4CGJ A;  2HNY A;  5HLF A;  4BDP A;  2YKN A;  3NE6 A;  3V4I A;  4DTS A;  1XC9 A;  4DFK A;  4C8M A;  3VQQ A;  3AO4 A;  4R5P A;  3DLR A;  4W5O A;  5SZT A;  3OYB A;  3DLH A;  1DTQ A;  2A1R A;  1T8E A;  5KI6 A;  3HVT A;  4FM2 A;  2DFF A;  5D3G A;  1EKE A;  4IFV A;  4DTX A;  4KI6 A;  4O0J A;  3QIP A;  4FJ9 A;  4H4M A;  4FJ5 A;  1U49 A;  1ZBF A;  4YNQ A;  4CEO A;  3LP0 A;  2O4G A;  5KTQ A;  3CFP A;  3TAP A;  3ZT4 A;  1KRP A;  4KAZ A;  4DF4 A;  1SV5 A;  3VQB A;  4Z4C A;  2G8V A;  3DMJ A;  1A5X A;  1W9H A;  4FJ8 A;  3H08 A;  3ISN C;  4W5T A;  3HT3 A;  1NK7 A;  4QAG A;  3OYD A;  3T19 A;  4DSL A;  3AVN A;  5FRM A;  3ZSW A;  4FW2 A;  4CJK A;  2VWJ A;  2QXF A;  4BE0 A;  4W5R A;  1VSJ A;  1N6Q A;  4CF2 A;  1NK8 A;  4MQ3 A;  2FBY A;  4AHU A;  2G8W A;  1RDA A;  1SKW A;  1DTT A;  3LWL A;  2RKI A;  3AV9 A;  1C1C A;  4OGE A;  3HJF A;  1XWL A;  4E7I A;  4B9N A;  4KHU A;  4PWD A;  1RCH A;  3NGZ A;  2KFZ A;  4FJK A;  3AVJ A;  3L2W A;  4N76 A;  4DG1 A;  3OYK A;  2E4L A;  4DSF A;  1SL0 A;  1ASV A;  4K8Z A;  1A5V A;  5HRP A;  1U47 A;  3AVB A;  4E1M A;  3VQP A;  1NK6 A;  4FLV A;  3RMD A;  4B8A B;  3SNN A;  2X6S A;  1J53 A;  3KJV A;  3NHG A;  3SQ4 A;  3VN5 A;  1VSL A;  3RRH A;  3K58 A;  2HHV A;  4CEC A;  3PV8 A;  4HUE A;  1CXQ A;  1VRU A;  4OVL A;  4IDK A;  4OPJ A;  5I42 A;  1TVR A;  3MEE A;  3ZSZ A;  4UQG A;  3MAQ A;  4DQR A;  1R0A A;  4PQU A;  1FXX A;  3V9X A;  2DY4 A;  1TL3 A;  1KTQ A;  1J5O A;  1HQE A;  4M3W A;  2KW4 A;  4KFB A;  3ZSY A;  1L5U A;  4CHN A;  3QEP A;  2PYJ A;  4FJH A;  4DTP A;  4KHW A;  3HK2 A;  4DS5 A;  3CFR A;  3ZCM A;  1LAW A;  3DLE A;  4F8R A;  1NJX A;  2YNG A;  1Q9X A;  4I9Q A;  1D8Y A;  3U6F A;  1KFS A;  2YHB A;  3LPT A;  1RT4 A;  4CF1 A;  4YFU A;  1L3T A;  4J2A A;  4CEB A;  4FLT A;  3EYZ A;  1MU2 A;  4DQS A;  4N41 A;  4CJ3 A;  1IKX A;  3K5M A;  4JS5 A;  4KRE A;  3AA5 X;  1G15 A;  3TAM A;  1YT3 A;  4QCL A;  4CJ5 A;  4B9T A;  5JS2 A;  4M3U A;  4PY5 A;  1B92 A;  4O55 A;  4M42 A;  1KFD A;  4J2E A;  2YNH A;  4OKK A;  4CJF A;  1KLM A;  2G8K A;  1NKE A;  1QSS A;  4KHS A;  2XO7 A;  2IC3 A;  3LZI A;  3KTQ A;  1EX4 A;  3VQE A;  3M8S A;  3KIO A;  3SQ2 A;  1KLN A;  4CCH A;  1YTU A;  1TAQ A;  4Z4F A;  1WNS A;  1S1V A;  1ITG A;  3ITH A;  2E6L A;  1TKZ A;  3OYH A;  1REV A;  4CE9 A;  5J2Q A;  4FJG A;  4M3Y A;  4DF8 A;  4RW8 A;  3ZSX A;  1RTD A;  4G1Q A;  4Y1D A;  3DRP A;  4QOZ B;  4B9V A;  2YV0 X;  3FFI A;  1RBS A;  4LH4 A;  4AHV A;  3RMA A;  4OPK A;  1U04 A;  2IDO A;  4M3R A;  3OYM A;  5I3U A;  3S3O A;  1NK9 A;  1SKR A;  3AVH A;  2JGU A;  3LPU A;  1JLG A;  4CF9 A;  4J2B A;  1J9A A;  2KFN A;  4M41 A;  2OZM A;  3OY9 A;  1RT3 A;  3HP9 A;  1JLE A;  1BIZ A;  1RDB A;  1WAF A;  3AO1 A;  1LW2 A;  3NF6 A;  4JLH A;  4KKO A;  3ZT2 A;  2OPS A;  3L2U A;  1IG9 A;  3BDP A;  4NYF A;  2VG6 A;  1HQU A;  1Q8I A;  1VSF A;  4DTR A;  1B9D A;  3AVF A;  4F3T A;  3V9W A;  3DOK A;  1B9F A;  4FLW A;  2B6A A;  4DSK A;  3QLH A;  3D0P A;  3VQ9 A;  3MXJ A;  4E19 A;  3AO3 A;  3SV3 A;  1WSI A;  3MEC A;  5EU7 A;  4NYN A;  3L2V A;  4DTU A;  1J54 A;  4LSN A;  1BQM A;  1Q9Y A;  1ASW A;  4CEF A;  4Z4E A;  1CZ9 A;  2BE2 A;  4F3O A;  3TR8 A;  2GV9 A;  3KKR A;  1HYV A;  3AVA A;  1D9D A;  4DTJ A;  3VA3 A;  4B3O A;  3NCI A;  4CF8 A;  3LAK A;  3HO1 A;  3CFO A;  4DQP A;  4CHY A;  4BAC A;  3D45 A;  2I5J A;  4AHT A;  1L3U A;  4CFB A;  1S1W A;  1TKD A;  2HHQ A;  1W0H A;  3KLF A;  1ASU A;  3AVL A;  4EP4 A;  1JL1 A;  4CHP A;  4DTN A;  4DSJ A;  1RBV A;  5KGX A;  1UAX A;  2IS3 A;  3HPO A;  4DFJ A;  3O4Q A;  4C8L A;  1WSH A;  5JS1 A;  3KD1 E;  1JKH A;  1HNV A;  1RT6 A;  3P5J A;  1TK5 A;  3RTV A;  4F4K A;  3HM9 A;  2XY6 A;  3VQ6 A;  2HVH A;  1NK0 A;  3PO5 A;  1I3A A;  1DLO A;  3THV A;  4KRF A;  4E89 A;  3MEG A;  1TGO A;  3DLG A;  4W5Q A;  2ITG A;  3QO9 A;  3OS2 A;  4JS4 A;  1CLQ A;  2X78 A;  2HHX A;  4ICL A;  4CED A;  1UA1 A;  3C6T A;  5CZ2 A;  2QK9 A;  5C24 A;  4AHS A;  4DQQ A;  3CYM A;  4DU4 A;  4Z4H A;  4BE2 A;  3QER A;  1S1X A;  3HVR A;  4HVJ A;  1JLQ A;  3K5N A;  1CZB A;  1SL1 A;  4O4G A;  2YNF A;  2FBT A;  3IG1 A;  1XI1 A;  3HPG A;  3O4N A;  5HRS A;  3NH2 A;  3OYJ A;  1L3V A;  1C0U A;  1WSJ A;  3JSM A;  4I9L A;  1QQC A;  4C8N A;  3OS1 A;  4FLZ A;  4DQI A;  1BCM A;  1C0T A;  3CM5 A;  4CGG A;  3KK3 A;  1S5J A;  3SUO A;  1XHZ A;  2F8T A;  5CYM A;  1KVB A;  4NCG A;  3HPH A;  4M45 A;  1EP4 A;  4DLE A;  1SUQ A;  3HST B;  3V9U A;  3ZT0 A;  3T3F A;  3OYE A;  3DYA A;  4ID5 A;  1NKB A;  4FJJ A;  2DFE A;  4L8R B;  3HXM A;  4CFC A;  1QE1 A;  4AHR A;  1WSF A;  3AA2 A;  3L3U A;  3NAE A;  1HYZ A;  1JXB A;  3U3G A;  2HNZ A;  2OPR A;  4OJR A;  3V6D A;  1RDD A;  1GOB A;  3VQD A;  2RPI A;  3TAR A;  2OZS A;  4FJI A;  3NBP A;  4CFD A;  1QSL A;  1T03 A;  3AO2 A;  1RDC A;  4DU1 A;  4ZHR A;  1QSY A;  3A2F A;  3CM6 A;  3SQ1 A;  4IKF A;  1KVA A;  1WSE A;  3LZJ A;  4DSE A;  4FCY A;  3KLE A;  3S9H A;  3KD5 E;  4K8X A;  1CXU A;  1JLC A;  3RWU A;  1RT2 A;  2BGG A;  3QEV A;  4CHO A;  5HRR A;  1EET A;  5HRO A;  3WNH A;  1S9G A;  4E1N A;  3AA4 A;  3L2R A;  3ASM A;  5C25 A;  3C95 A;  2D0B A;  1BGX T;  3VQ4 A;  4C8K A;  4Q0B A;  2OPQ A;  5T7B A;  3ZSQ A;  4ZTF A;  3B6P A;  3OYI A;  3RRG A;  3IAY A;  2IGI A;  3C94 A;  3VQA A;  3HP6 A;  1I39 A;  2FC0 A;  4HTU A;  4BDY A;  3BGR A;  3E01 A;  4E7K A;  1IO2 A;  3O3G A;  2KTQ A;  5CZ1 A;  3MXM A;  4B9L A;  1RIL A;  1NJZ A;  3SJJ A;  4KPY A;  3DM2 A;  4DMN A;  3LDS A;  4CGF A;  4CHQ A;  1FKP A;  2VWK A;  4O44 A;  4Z0U A;  3V1R A;  4FLY A;  2Y1I A;  3TAB A;  3CQ8 A;  3HYF A;  1S6P A;  3I0R A;  2YKM A;  4Y1C A;  1BL3 A;  1QS4 A;  3IS9 A;  5J2N A;  1NK5 A;  5FRN A;  2EHG A;  1KSP A;  1TL1 A;  2PYL A;  4JRQ A;  4AHC A;  4CEE A;  4E7L A;  3CG7 A;  4FJ7 A;  4N5S A;  5FDL A;  4FLX A;  2Z1J A;  3OJS A;  1X9S A;  4I7F A;  4DTM A;  3SPZ A;  4KO0 A;  3AVC A;  1A5W A;  1VSM A;  3OJU A;  3PY8 A;  4CEA A;  1NK4 A;  4AH9 A;  3KKS A;  4IFY A;  3UIQ A;  3AVM A;  4GVM A;  3AVK A;  3OYN A;  1NKC A;  3OVN A;  3WNF A;  1KCF A;  3G0Z A;  3ZSO A;  4Q5V A;  4E7J A;  3U3Y A;  4OKJ A;  4ELT A;  4NCA A;  1RBT A;  4KHQ A;  2HHW A;  3TAG A;  3WNE A;  3TI0 A;  4CK2 A;  1RTJ A;  4KTZ A;  1TKT A;  5KRS A;  3M8P A;  3NF9 A;  3RMB A;  2ZD1 A;  4EZ6 A;  1TKX A;  3LAM A;  4O5B A;  1WLJ A;  3SI6 A;  2Z1G A;  1UA0 A;  1X9W A;  4J2D A;  4FW1 A;  1C1B A;  2PZS A;  3LAL A;  2HHU A;  3VQ5 A;  1VSD A;  4F2R A;  4BWM A;  1Z26 A;  3QES A;  1RT7 A;  3DRR A;  1IKW A;  4EZ9 A;  3OYF A;  2A1S A;  4OLA A;  4F2S A;  3LP2 A;  4CJU A;  3AO5 A;  3S3M A;  1O1W A;  3NDK A;  1JL2 A;  2HB5 A;  4FJX A;  2ZQB A;  4BE1 A;  2HHT A;  4N47 A;  1LW0 A;  1RT1 A;  1RTI A;  3QIN A;  4DFP A;  3WNG A;  1WSG A;  4EP5 A;  1TV6 A;  3TAN A;  4B9U A;  1NJW A;  1HYS A;  1F21 A;  1HNI A;  3DI6 A;  3KK2 A;  4LD0 A;  3NF8 A;  3PO4 A;  2P5G A;  1LAV A;  3NGY A;  4DFM A;  1EXQ A;  4FZY A;  4KB1 A;  4E7H A;  4RW6 A;  5DMR A;  4B8C A;  3EY1 A;  4FJN A;  1TAU A;  3KLG A;  4ZTJ A;  1SL2 A;  4DU3 A;  5DK5 A;  2B4J A;  4XIU A;  2DFH A;  2Y1J A;  3M8R A;  3K2P A;  4CGD A;  4HUF A;  2OA8 A;  3K5L A;  1U45 A;  4FK0 A;  4C8O A;  1S1T A;  1VK0 A;  4B08 A;  1T7P A;  2JLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...