4CJUA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjuA00
4F3TA 4B9MA 4BDYA 1VSDA 3G10A 1X9SA 3A2FA 2G8KA 1REVA 2HB5A 4HTUA 4FYDA 1Z25A 3LAMA 1BHLA 3V1RA 2JLEA 1A5XA 3ZT0A 3NHGA 3V6DA 1NJZA 3QNNA 3MECA 1RT7A 3E01A 1SUQA 4GW6A 5K14A 4B9TA 3SCXA 3TWHA 3OY9A 4KB0A 3SUNA 1RCHA 3TARA 5CY4A 2BGGA 4BDZA 4NCGA 1TKDA 4ID5A 2G8FA 5D3GA 4DWIA 1JXBA 3AA4A 3VQPA 3PX6A 2G8VA 4CEAA 2Z1GA 1EXQA 3OS0A 2YV0X 4FM1A 2HHSA 1VSMA 3ZSXA 4CJRA 1U49A 3RTVA 3PX0A 4FM0A 2PYJA 1EETA 4FJ5A 3F73A 4M3RA 4CCHA 4FJHA 3SPYA 3EY1A 2KQ2A 3SYZA 1QS4A 3NH2A 5CYQA 4UQGA 2EHGA 3HVTA 4FVMA 1HRHA 1B9DA 1W9HA 2D0AA 1L3TA 4PWDA 1J53A 1FXXA 4IG0A 3LPTA 3M8QA 3L2RA 3NGZA 3LDSA 1SL1A 4ICLA 4IG3A 4RW6A 3SUOA 5DMRA 1T05A 2NUBA 2DFHA 1YTUA 1KVCA 3KK2A 4DQPA 4F2RA 1CZBA 3V1QA 5SWMA 3OYHA 3TANA 4KTZA 4Z4GA 4FZZA 2O4GA 1TK8A 4CF1A 3NF6A 1BIZA 4BE1A 1WSHA 3O3HA 5J2MA 3V9SA 4FJLA 1C0TA 3L2WA 5FDLA 3TR8A 4F8RA 4RW7A 4KO0A 4B8CA 4NYFA 4M3UA 1C6VA 2KFNA 2XRIA 3HP9A 1L3UA 3WNFA 1JLQA 1GOBA 2Z1IA 4E7JA 3NAEA 2AJQA 1VSIA 3QIPA 4LSLA 4C8NA 2E6MA 4BACA 3ZCMA 3TAEA 1JLBA 4IDKA 4LSNA 1L5UA 1NOYA 4N76A 1QQCA 3HK2A 2ZQBA 1QTMA 4FZYA 3OS1A 4FLTA 4M45A 3VQ8A 3CFPA 4HUEA 3QO9A 1RBTA 1NJWA 2HVHA 4KREA 3CM6A 3M8PA 3MXMA 3KTQA 5KRSA 2JGUA 4OKEA 4DSEA 1U04A 3HXMA 3LALA 2KW4A 3KLEA 4KKOA 3P83D 1C0UA 2PYLA 3O4QA 2HMIA 1X9WA 4DTUA 3OYJA 1RT4A 5E41A 3NBPA 1JXEA 3LP1A 4BE0A 1JLCA 1BGXT 4JS4A 3KLIA 3I0RA 2IC3A 2VG7A 4JRPA 4DQIA 1HQUA 1VRUA 2X78A 3OYAA 1K6YA 1QHTA 2VG5A 3DLEA 4CJUA 2OPPA 4J2DA 4L8RB 4CGDA 4FJJA 3ZT1A 4CFAA 1L3SA 3CM5A 3AVBA 2QXFA 3SZ2A 4CJLA 5C42A 5FRNA 2Q3SA 2KZMA 3H08A 3L3VA 1C1BA 1RTDA 3HPHA 5HROA 3O3FA 1KRPA 3C6TA 3M8RA 1QSYA 2YKMA 4CJTA 3DRSA 1RBSA 1RNHA 4KHUA 2D0BA 1ASWA 1KVBA 4KHWA 4JS5A 2F96A 4Z4FA 3AVKA 3CQ8A 1KTQA 3L2UA 1FKPA 4O55A 3SQ2A 2HHQA 1VSLA 2YNHA 4KTWA 4OVLA 1TKZA 1KLNA 4KI4A 4HUGA 4ID1A 2HHUA 3SUPA 1ZYQA 1IKXA 4FJIA 1YTAA 2LSNA 4CGGA 2R7YA 4DS5A 3AVCA 4FW2A 4BDPA 2WONA 1DLOA 4OKJA 4KTQA 3BGRA 1TAUA 3K57A 4E7KA 4N41A 4YFUA 4DSFA 4CHQA 3O3GA 4CGHA 3DRRA 5CYMA 3KK3A 3OYEA 3NGIA 3ZT4A 3QETA 3TAQA 1U45A 1ITGA 2QKKA 4W5OA 5FRMA 3K2PA 3VA0A 3ZSYA 1L3VA 3ZSRA 1KFSA 2VG6A 3C6UA 4DTRA 2G8IA 2FBXA 4W5QA 3LANA 1YVUA 1WSEA 2F8TA 1VSEA 4RW4A 3HPGA 1FK9A 4B9SA 3AO3A 1VSHA 3QERA 3WNGA 3TAGA 2A1RA 4DTOA 4QCLA 3L2VA 4M3YA 5J1EA 3VQCA 1T03A 3D0PA 1RT2A 4KV8A 3VQ5A 1RBRA 1W0HA 1JLEA 1TK0A 4O0JA 4I7FA 2HNYA 4IFYA 4FM2A 2FBTA 3MXIA 1UAXA 3LP3A 4ZTFA 4CHZA 1T8EA 3LZIA 3SPZA 3DOKA 4CJSA 1LW0A 1WSJA 4CJKA 4J2EA 3AO1A 3NF9A 4CF8A 5HP1A 4F4KA 4LH4A 3I8DA 1LV5A 2BANA 4LD0A 1WNSA 4OLBA 1WLJA 4CE9A 5J2PA 1RT5A 1S1WA 3DLRA 3SV3A 4ZTJA 4Z4EA 3KK1A 4CFDA 2FBYA 4Z4CA 2RPIA 3AVHA 4I2PA 5I42A 1S6QA 4CGIA 4JLHA 4QAGA 1ASVA 4KHYA 4M3WA 4HCCA 2ATQA 3RR7A 4J2BA 1BL3A 1RT6A 2BE2A 4OGCA 4AHSA 2HHTA 4Q5VA 1GOCA 2HNDA 4O44A 1GOAA 3VQBA 1TKXA 1A5VA 4E1MA 4CIFA 1NK6A 1JL1A 3U6FA 3KKSA 1ZBIA 1WN7A 2VWJA 4M42A 1TL3A 3V81A 5C24A 3DLBA 1XWLA 2OPSA 2ZD1A 1X9MA 1D5AA 3LP0A 2G8HA 1C0MA 3MXJA 3HT3A 1SKSA 2IS3A 3ISNC 5CZ1A 3P1GA 3RRHA 1S1UA 3DLHA 1NKBA 1JLAA 3ZSQA 1SKWA 4FJ9A 1LAVA 1ZBLA 4H4MA 4DSIA 4BWMA 4CJPA 4PQUA 3K5MA 3KJVA 1HMVA 3VQ7A 3IG1A 3MEGA 3AVFA 1NJXA 2HVIA 4CF0A 3O4NA 3L3UA 4AHVA 3IRXA 1CXQA 3CYMA 3AO2A 3QIOA 2RN2A 3OYDA 3VQ9A 1BCMA 1VSFA 4HUFA 3LZJA 2HHWA 1LWEA 4NCAA 1XHXA 1YT3A 3TI0A 4FJGA 1UA0A 3ZSZA 4CEOA 3TAFA 4DQRA 3B6PA 3QEIA 4Z0UA 1TVRA 3JYTA 4XIUA 3PX4A 2DFEA 2HW3A 3F9KA 2X6SA 1S1XA 3KLGA 3CFRA 4F2SA 2OZSA 4KPYA 3QLHA 1UOCA 3K59A 2ZE2A 1IG9A 4BE2A 4I9LA 5JS2A 2P5GA 3ZSVA 4DTXA 1S9GA 1Y97A 4CHOA 4FW1A 4CIEA 3KLFA 3T3FA 1Q9YA 1WSGA 5CZ2A 4CEFA 1Q8IA 1TV6A 4DQSA 4IFVA 4FJ7A 1ASUA 1CXUA 2OA8A 4YNQA 3HPOA 4FLXA 4DTMA 3KD5E 1JKHA 4AHTA 3RR8A 3HO1A 1RTHA 4FJ8A 3RMCA 3V9UA 2G8WA 2E4LA 3HSTB 4CF9A 5SZTA 3V9XA 3VQ6A 3OYIA 3U3GA 3NH0A 3IAYA 2F8SA 4PY5A 2KTQA 4CGJA 5HBMA 1NKEA 1UWBA 4B9VA 4Q0BA 4N56A 3I0SA 4N47A 2KFZA 3KLHA 1S1VA 4DU3A 2GBZA 3HVRA 4DU4A 4ELVA 4KRFA 3RMDA 4C8MA 3HL8A 3BDPA 1LW2A 3ZT2A 3OYCA 4CFBA 2B5JA 4GMJB 2B4JA 1RTJA 4DMNA 4M3XA 2PY5A 4I2QA 1KSPA 3QESA 3AV9A 1F21A 1LAWA 3K5NA 4FJKA 3LWLA 4E7LA 1BQNA 1SL2A 3AA3A 2P1JA 3K58A 1HYZA 4M3TA 4FJMA 1RDBA 3TABA 4M41A 5HRSA 1ZBHA 1S1TA 1XI1A 1WSIA 1NKCA 3EZ5A 4B9NA 4DF8A 1JLFA 1RBUA 1SV5A 4FLVA 4Z4HA 3S9HA 3KD1E 5J2NA 2DY4A 3QEPA 3HP6A 4LY7A 4DSKA 2Y1IA 1D9FA 4Y1CA 2OPRA 3AVNA 4RW8A 1EKEA 3AVAA 3UIQA 1S6PA 3SI6A 4CFCA 5EU7A 3VQDA 3MEEA 4CHNA 2XO7A 4O4GA 3HJFA 3ZSWA 3QEVA 4K8ZA 4CHYA 1Z26A 3HYFA 1NK4A 1BIUA 4E1NA 1QSLA 3SV4A 1J54A 1A5WA 2RKIA 1VK0A 3OYMA 4K8XA 3DYAA 1IH7A 4GVMA 5KGWA 1NK0A 5DK5A 3OYLA 3PV8A 3S3OA 1T7PA 3T19A 4KHSA 4CF2A 3OYBA 2WOMA 3QINA 1MU2A 3OJUA 3PY8A 4I9QA 1DTTA 1HPZA 3RMBA 2GUIA 3QEWA 3VQQA 4DLEA 3PO4A 4FK4A 4EZ6A 3U3YA 2DTUA 1KVAA 4CECA 4DFKA 1RTIA 1G15A 4WE1A 4DFMA 3SQ0A 4KB1A 2YNFA 4AHCA 1NK7A 4NYNA 4W5TA 1CZ9A 1U4BA 4B9UA 3AVGA 5HLFA 5FROA 4OPJA 1J9AA 4OGEA 4PUOA 4O5BA 2X74A 4E3SA 1QSSA 2YKNA 3ULDA 1I3AA 4W5NA 2IDOA 3CG7A 4CESA 2HHVA 4DTNA 3NDKA 1UA1A 4AHUA 1N5YA 4IBNA 1WAJA 1FKOA 1XC9A 3C95A 4E7IA 1U47A 4DQQA 2Z1HA 2W42A 1NK9A 4H4OA 3ALYA 3NE6A 2P51A 1CLQA 1R0AA 2QK9A 1B92A 4FLYA 3V9ZA 4CJWA 4CJ4A 1NK5A 1TGOA 4E0DA 2B6AA 3OYKA 4CEZA 4HCBA 4AH9A 4DFJA 4DTPA 2ETJA 4FJNA 1HJRA 4CJEA 3OYFA 1VSKA 2BDPA 3PUFA 3ASMA 4DSLA 1RBVA 4O0IA 1HQEA 1O1WA 4DU1A 4ZHRA 4ELTA 3AA5X 4ELUA 4LH5A 4DLGA 3TAMA 4FLUA 4B8AB 2RF2A 2FBVA 3V9WA 2D5RA 1IKYA 4MFBA 4PA1A 5C25A 1RT3A 3S3MA 1N6QA 2IOCA 3PO5A 4OPKA 4CHPA 1TK5A 4B08A 4BWJA 3DM2A 1QE1A 1C1AA 5HRPA 4FK0A 2EX3A 1DTQA 2ITGA 5KTQA 3CFOA 4EP5A 4DF4A 1RDAA 3DMJA 4E7HA 2PZSA 3DLKA 3QEXA 2A1SA 5T7BA 3MEDA 5HRNA 1RT1A 2I5JA 4JRQA 4CGFA 3DLGA 1NOZA 4AILC 3TAPA 4CJ5A 3OS2A 3SNNA 1IO2A 4EZ9A 4CEDA 3QNOA 1RDCA 2OYQA 3C94A 1JL2A 3DRPA 2Z1JA 4CEQA 3SUQA 1LWCA 4CJVA 4R5PA 1BI4A 4H8KA 1RILA 3B6OA 3L2QA 3S3NA 2QKBA 3NF8A 1BQMA 1C1CA 1WAFA 1LWFA 3K5OA 1X1PA 1HYVA 3RMAA 2HHXA 1SL0A 3JSMA 3V4IA 2OZMA 3WNHA 1Q9XA 1D9DA 3SQ1A 4B9LA 3ZSOA 4CJQA 3MAQA 4FCYA 2XY5A 3G0ZA 3AVJA 1KFDA 4N5SA 1WSFA 4FZXC 4DTSA 4IKFA 1EX4A 3AVLA 3AO4A 3OYGA 4FLWA 4J2AA 2VWKA 4CEEA 4RG8A 3KIOA 3VA3A 4DS4A 3AVMA 3LAKA 3WNEA 3OJSA 3AO5A 4B3OA 1KLMA 2OPQA 4KHQA 1TAQA 1U48A 4KHNA 2D0CA 3EYZA 1JLGA 1BISA 2P5OA 3P5JA 1XHZA 1VRTA 3FFIA 2XY6A 1B9FA 4FLZA 1SKRA 3LP2A 3IS9A 4KI6A 4KAZA 3LPUA 3NFAA 4DSJA 4M3ZA 1EP4A 4C8OA 2Y1JA 4F3OA 4NCBA 3RRGA 3NH1A 4E19A 3VQEA 5J2QA 4FK2A 3DOLA 4CJ3A 3SQ4A 4KFBA 4OJRA 1HNIA 4AHRA 4FXDA 4G1QA 1BI4B 4CK2A 1NJYA 2XHBA 4FJXA 3NGYA 3T1AA 4CK3A 2GV9A 2XY7A 3AA2A 2G8UA 4OLAA 3K5LA 1I39A 4CJFA 2YNGA 3RWUA 2YHBA 3DI6A 4RW9A 3V1OA 1S9EA 4CEBA 4DG1A 2KZZA 2IGIA 5KI6A 3OYNA 1VSJA 2YHAA 3VQ4A 4QOZB 4MQ3A 3L8BA 3THVA 1J5OA 1D8YA 4C8KA 1HYSA 5JS1A 3D45A 4CERA 3NCIA 2HNZA 2X6NA 3HM9A 3AVIA 2FC0A 4DTJA 4W5RA 3M8SA 1TKTA 4HHTA 2DFFA 3KKRA 2YNIA 3OVNA 5KGXA 5HRRA 4Z4IA 1TL1A 1NK8A 3NF7A 3VQAA 4CIGA 3LWMA 4OKKA 2IAJA 4Y1DA 1BCOA 1ZBFA 2XY8A 4C8LA 4TSXA 4EP4A 4HVJA 1IKWA 3ZT3A 1IKVA 1HNVA 1S5JA 3SJJA 3ITHA 4E89A 2E6LA 5I3UA 5KRTA 4CK1A 1KCFA 3VN5A 1RDDA 1ZBUA 4DFPA 2O4IA
chains in the Genus database with same CATH superfamily
1K8AO 4BDYA 1VSDA 1X9SA 2P9UB 3A2FA 1REVA 2HB5A 4J8FA 2JLEA 3ZT0A 1GLEG 1NJZA 2V7YA 3ZETA 1RT7A 1SUQA 2V7ZA 1HNXK 3OY9A 5AQZA 3SUNA 1RCHA 3WXLA 1YF5L 5BN8A 4DWIA 1JXBA 3R3LA 3PX6A 4CEAA 1EXQA 4BR9A 2HHSA 4BRGA 3VEYA 4KH6A 1EETA 5M1NA 3F73A 1YITN 3NH2A 3MK6A 4FVMA 1HRHA 1L3TA 1NGHA 1WBBA 3L2RA 4B9UA 3M8QA 1SL1A 4JNEA 5DMRA 4CZHA 1V4SA 2NUBA 2DFHA 2E8AA 1KVCA 3KK2A 4DQPA 5AQWA 4CF1A 4A57A 4BE1A 3O3HA 1C0TA 3L2WA 5FDLA 3D6RA 2P9NA 4JI5K 4E7JA 4C8NA 4DKWA 4BACA 4B3MK 3ZCMA 3TAEA 1NOYA 4N76A 5C0YA 2HSTA 3CPEA 1BA1A 4FZYA 2OCEA 4FLTA 3CD6N 4M45A 4HUEA 3QO9A 4PKHA 1E4GT 3L4IA 4IWVA 3VGMA 3CHWA 3H1VX 1U04A 3KLEA 3UKRB 4H03B 3CCEN 2WFBA 1S3XA 3T7ZA 4NXMK 5E41A 1BGXT 1T6CA 1K6YA 3DLEA 5AQYA 3WXMB 3CCRN 4FJJA 3ZT1A 1EQYA 4CJLA 4BREA 3C6AA 1BOTO 3M8RA 2QA4N 1HR0K 2YKMA 3BY5A 4KHUA 4GVEA 3U9DA 3ID8A 3AVKA 3P38A 3FZHA 2QW9A 1M1KO 4O55A 3WQUA 5AQSA 4KI4A 2ZJQL 4DR2K 1YAGA 4FJIA 4A62A 1RFQA 2LSNA 4KTQA 4OKJA 1GLFO 4KBOA 4CHQA 3O3GA 3L0QA 5CYMA 5M1FA 3QETA 1Q81O 3K2PA 3ZSYA 1KFSA 3ULEB 3JAMO 4DTRA 5JVGL 5LMNK 4JK8A 5GADP 4RW4A 3AO3A 3WNGA 3CCQN 1RT2A 3OA9A 4KV8A 4BRHA 5BRFA 3JXUA 2E1YA 3FFKB 3MCAB 4O0JA 4I7FA 1YJWN 4IFYA 1TK0A 3DXKA 1UAXA 3LP3A 2GTDA 3EKUA 4CJSA 4JN4A 4CJKA 4J2EA 4CF8A 4LH4A 2HBJA 3R8EA 1WLJA 3MX5A 3I56N 5I42A 1S6QA 4QAGA 2HBLA 2ATQA 1N34K 1NBWA 3GBTA 4FPBA 1GOAA 3VQBA 4CIFA 1A5VA 1NK6A 1JL1A 4I6MB 4IDHA 4M42A 2UU9K 2W6KA 4IOXA 5AQVA 5C24A 3U8XA 3WXIA 5BREA 1XWLA 5AQNA 1D5AA 3MXJA 1NGJA 1SKSA 3P1GA 4BVOA 1SKWA 1JLAA 3ZSQA 3DLHA 1LAVA 4BWMA 3WXKA 1HMVA 1NJXA 5ADXA 4MDAA 3L3UA 5KPRA 2O8BA 3IRXA 3OYDA 3VQ9A 1BCMA 3Q7BA 4IO9L 1VQNN 3CJ7A 4ISFA 3AY9A 3TAFA 4B9QA 3B6PA 3VF4A 4CZIA 3JYTA 2VGNA 2DFEA 2HW3A 3UKUA 1ZC6A 5TKYA 4DR4K 4BE2A 4EFHA 1S9GA 1OH7A 3ZLJA 2W40A 3CQXA 1TV6A 3H45C 4DQSA 3HPOA 4FLXA 3RR8A 3CETA 4ISGA 3HSTB 5HOOA 5GINA 5SZTA 3V9XA 4PY5A 2KTQA 3P39A 1NKEA 1UWBA 1WBDA 3I0SA 2KFZA 4LF8K 4DU4A 4KRFA 3O9SA 2O8CA 4WYBA 4WQ5C 4DUYK 4DMNA 1KSPA 4BGBA 3QESA 3AV9A 3AAPA 5TKWA 2ASPA 3LWLA 1BQNA 4JEPA 1SL2A 1VQ8N 1S1TA 1NKCA 3EZ5A 4DF8A 1RBUA 3TPQA 2NRZA 4Z4HA 3KD1E 5J2NA 2UXBK 4DSKA 1Z6RA 3UIQA 4JD2A 1JCEA 3SI6A 5EU7A 2E2NA 3HJFA 1BIUA 2GEMA 4E1NA 1DT9A 1QSLA 5GAGP 1A5WA 3S3OA 5E84A 3MMVA 2WOMA 1MU2A 3PY8A 2O8DB 3O9RA 2GUIA 1O13A 3VQQA 4EZ6A 3U3YA 5DM7L 2UXCK 4WE1A 1WB9A 1CZ9A 1U4BA 5HLFA 1P8ZA 1Y64A 4O5BA 1QSSA 2YKNA 3DJCA 4CESA 5AZJA 2HHVA 4LF9K 4AHUA 1WAJA 2CH6A 3IUCA 1OKJA 2Z1HA 3ZEUA 4H4OA 2W42A 3ALYA 3CCVN 4CJWA 4E0DA 4CEZA 2I7PA 3CQYA 5F2RA 4DFJA 4FJNA 4DQ8A 4LFBK 3O1BA 3OYFA 3D2EB 4DV1K 2BDPA 5EXWA 4DSLA 1O1WA 3HOTA 2YJFA 4NO7A 2D5RA 1IKYA 4PA1A 1X9JA 4CHPA 1TK5A 4BWJA 2YJEA 4DR1K 3DM2A 1YHQN 1QE1A 4B3RK 1C1AA 5HRPA 4EP5A 1E3MA 3DLKA 2A1SA 3IDHA 3DLGA 4BRIA 4A61A 3FZLA 4IOCL 3THWA 1NGFA 4CEQA 3CC7N 1OVQA 3N4QA 5AZIB 3C0BA 3B6OA 3S3NA 1Q86O 3NF8A 1JCGA 1LWFA 3H6EA 4BC2A 1X1PA 1SL0A 2CGLA 4V19S 4R79A 5F1XA 4Y0WA 3SQ1A 4FCYA 3AVJA 2CH5A 3CMEN 2W41A 4FZXC 4IKFA 3VEXA 4CEEA 4DS4A 3ENBA 1NNEA 2OPQA 4JI1K 2P5OA 1BISA 3O9QA 1VRTA 1ESVA 1B9FA 4FWNA 3IMXA 4JHDB 3LPUA 2A41A 4YOWA 4KAZA 1EP4A 4C8OA 5EOYA 4C23A 5GAEP 4JKGB 4AHRA 3TSPA 2P9SA 1GLAG 4G1QA 5LMUK 4CK3A 4JI2K 2YNGA 3E1YA 3V1OA 4CEBA 4F9OA 1VSJA 3HRGA 3P4IA 1HYSA 4BR5A 4CERA 3AVIA 1VQLN 3MX2A 2DFFA 1P90A 3KKRA 4X65K 5JLFA 3OVNA 5HRRA 5JVHL 3SBTA 1NK8A 4MO5A 4LF4K 4YOUA 4Y1DA 1S72N 2XY8A 4C8LA 3ZT3A 1IKVA 3SJJA 5I3UA 2E6LA 4B1YB 1NGCA 4DFPA 3GE1A 2G8KA 3RVCA 4B1ZA 4HTUA 1Z25A 1KD1O 1MWKA 3V6DA 5JMVA 2P9IB 3U4LA 2P9KB 2E2QA 1R59O 3SCXA 4BRLA 4KB0A 2BGGA 5CY4A 4ID5A 1TYQA 3Q7CA 3GOIA 4DV4K 3O1WA 4FWPA 2G8VA 2Z1GA 2FSJA 2YV0X 4FM1A 3ZSXA 4BG9A 1QVGM 3FR0A 1MA9B 4M3RA 4CCHA 1YXQA 3CJCA 5AQIA 2FF3B 3EY1A 2QEXN 1NM1A 1QS4A 5CYQA 4UQGA 4BR2A 3D2FA 4MDBA 1XMOK 3LPTA 4DR6K 3NGZA 3CC2N 4F2RA 2Q97A 1QHAA 3TANA 2F4VK 4FZZA 4DV7K 5J2MA 3NVKA 3H1QA 4F8RA 3CCLN 2XRIA 2PFUA 3HM8A 4BRAA 3TSQA 1JLQA 1VSIA 1X3NA 2WBNA 4LSLA 4CD1A 1VQ7N 3CCJN 3CC4N 4LFAK 2YHYA 4IDKA 4LSNA 4CBXA 3L4QA 1ZXOA 3G4SN 3HK2A 3TTCA 3P31A 3OS1A 3G71N 3CFPA 1RBTA 2HVHA 4B1VA 3CM6A 3M8PA 5AQTA 4DV2K 3KTQA 4WCEL 4OKEA 3HXMA 3LALA 3VMFB 2PYLA 3O4QA 4GY2B 2QWQA 3OTOK 4DTUA 4H5TA 2D0OA 5M1QA 4QS8A 4BE0A 4JS4A 3ID6A 3KLIA 2IC3A 4JRPA 4C1NI 1IG8A 3CMAN 4CJUA 2OPPA 4J2DA 3BF3A 4CFAA 3L3VA 4MLEA 3WXJA 3KZBA 3C6TA 3DRSA 1RBSA 4MLHA 1ASWA 1KVBA 4KHWA 3MN6A 1FKPA 4GV6A 3ENOA 3SQ2A 2HHQA 5DM6L 1VSLA 4HUGA 2QTDA 1OH6A 3AVCA 4BDPA 2KKZA 3EE8A 1SZ2A 3K57A 4WQ4A 2H3GX 4CGHA 3KK3A 3NGIA 3OYEA 3TAQA 2NRHA 3CJ9A 2HHHK 4W5OA 1T44A 1IBLK 3VA0A 2O8EA 2E88A 2E2OA 4H5RA 3ZSRA 2VG6A 4B3TK 2FBXA 4CI6A 4BC3A 2F8TA 1FK9A 3QERA 2VQEK 1KXPA 1RDWX 4Z94A 3F9MA 4M3YA 1GLBG 1T03A 4M7YA 3VQ5A 3J80O 1RBRA 5BRDA 2P9LB 1JLEA 1U2VA 4DV0K 2HNYA 4FM2A 2FBTA 4CHZA 3SPZA 1WSJA 3AO1A 1WUAA 4AQYK 5HP1A 4F4KA 5FPMA 2BANA 1WNSA 4WFAL 3OW2M 5J2PA 1S1WA 4ZTJA 3KK1A 3E9LA 2FBYA 2FSKA 4CFDA 4Z4CA 2RPIA 4I2PA 2E5LK 2HF4A 4KHYA 4EHUA 2NRTA 4J2BA 5M1OA 4GKJK 1NU0A 4OGCA 2E2PA 2HHTA 1TKXA 3T1YK 1HKBA 2ZGZA 3SAHA 2VWJA 2WTUA 1I94K 1XC3A 2Q2RA 4K0KK 3V81A 1QQNA 3R1XA 4CVNE 1X9MA 1W2BM 5CZ1A 3ISNC 2ZWHA 4RTFD 4FJ9A 4DSIA 4H4MA 3SK3A 4U67L 3K5MA 4K41A 4BROA 3PSIA 2ZF5O 3EKSA 1OH8A 3EE9A 1NMNA 1SAZA 4JKDA 1ATRA 3CYMA 4HWIA 4YDUA 3QBXA 4HUFA 3O80A 4NCAA 4OO1J 2UUBK 4FJGA 4DV6K 3VEVA 4Z0UA 4H0XB 4XIUA 3PX4A 2X6SA 3LDPA 1K8KA 4F2SA 2OZSA 2Q31A 4X64K 3K59A 5JS2A 4KH4A 4CHOA 4CIEA 3T3FA 5AQXA 4XH4A 5CZ2A 1NGBA 4PL8A 2OA8A 5C2DA 1JKHA 1CZAN 3SAGA 3LL3A 3HO1A 3V9UA 2G8WA 4CF9A 1HUXA 3WEEB 3OYIA 3U3GA 3NH0A 3IAYA 1YI2N 4CGJA 5HBMA 3PIPL 2NRVA 1S1VA 4PKGA 3HVRA 4IJAA 3M3ZA 4PHTX 1QZ5A 4ILJA 2B5JA 4GMJB 4CFBA 2P9UA 4M3XA 4I2QA 3THXB 4NB4A 3WQTA 4FJKA 3U9ZA 2IIRA 4M3TA 4M41A 5C15A 3LDQA 1XI1A 5AJ3K 1JLFA 1SV5A 4OPAA 4C1NK 3VEWA 2OPRA 2VQFK 5AFUA 3AVAA 1S6PA 4CFCA 3LDNA 4K8ZA 1M90O 1Z26A 2JWKA 3SV4A 2RKIA 3QB0A 1IH7A 4GVMA 1NK0A 4BRFA 5DK5A 4CF2A 3E9PA 3AGRA 3AARA 1DKGD 4FWLA 1KVAA 4CECA 4DFKA 3NMUA 4KHPK 5KPTA 2UUCK 4NYNA 4W5TA 1W7AA 5BPLA 4BR7A 3AVGA 4OPJA 4OGEA 4PUOA 4YY3K 2X74A 5AR0A 2F9TA 3SAFA 4W5NA 2VYPA 4DTNA 3NDKA 2ZGYA 1UA1A 1U47A 1HNZK 3DLLL 3RSEA 1Z05A 2QK9A 1B92A 1G99A 3OYKA 2ETJA 2QI2A 4JD2B 1SQKA 4JKBA 1VSKA 3ASMA 5AQJA 1W97L 4O0IA 4DU1A 2RF2A 4BY9C 3O9TA 3UKRA 2HOEA 1RT3A 1N6QA 3T69A 3VF6A 2YHXA 1YJ9N 4JKEA 3MDQA 4FWRA 1RT1A 3TAPA 1NOZA 3E9OA 3SNNA 3OS2A 3DXMB 1IO2A 4EZ9A 1RDCA 2OYQA 5KQ8A 2Z1JA 3SUQA 1RGIA 4JI4K 5ELZA 1BI4A 1RILA 4CZEA 5AQUA 3BZCA 1IJJA 1HYVA 3VEZA 3RMAA 1N36K 2OZMA 2NRXA 1Q9XA 3ZSOA 5FPDA 4CJQA 3MAQA 4FWQA 2XY5A 3HI0A 1HNWK 1WSFA 4DTSA 2NLXA 3AVLA 4J2AA 1Q82O 4RG8A 3VA3A 5BPNA 5AQLA 4B3OA 3DAWA 3HOSA 5AQHA 3GDQA 1TAQA 5BPMA 1JLGA 1XHZA 3MCPA 3ULEA 3IS9A 5LY3A 4KI6A 3NFAA 4M3ZA 3VQEA 2IVOA 4CK2A 4BC4A 5AQQA 4OLAA 1T3VA 4BRKA 1ATSA 3K5LA 4CJFA 3HBTA 2KZZA 3DI6A 1GLCG 1S9EA 3O4WA 4DG1A 2O8FB 4MQ3A 3VGKA 3THVA 4C8KA 3D45A 2X6NA 4K43A 5I9EB 2GUPA 4HHTA 3ZYYX 2KHOA 5AFUH 4Z4IA 3BZKA 4TSXA 1IKWA 1HNVA 3FGUA 4E89A 3VN5A 1RDDA 2FSNA 3QINA 1ZBUA 4E7HA 3T1HK 2E1ZA 4B9MA 3G10A 3ZX2A 3LAMA 5E26A 3V1RA 3NHGA 3ATVA 1HKCA 3QNNA 3E01A 4A2BA 1BDGA 4BQLA 3TARA 4BDZA 4NCGA 1TKDA 4O5FA 5LJWA 3VQPA 1BO5O 3OS0A 2P9PB 1VSMA 4CJRA 4M7XA 1U49A 5FPNA 1NMDA 3PX0A 1VQON 3DWLA 1VQ9N 4FJHA 3H3OB 1BA0A 1HKGA 2WC9A 3HVTA 3O5BA 4NXNK 1J53A 1FXXA 4IG0A 1T05A 4BR4A 4ICLA 4IG3A 4RW6A 3SUOA 1JCFA 1YTUA 5ADXH 1VQ4N 5SWMA 3OYHA 4KTZA 4Z4GA 1TK8A 4M63C 3NF6A 1BIZA 1WSHA 3PIOL 4M3UA 3VPZA 4RW7A 4KO0A 4B8CA 4NYFA 1C6VA 3J7YP 3HP9A 4A2AA 4DCHA 3WNFA 2Z1IA 4XH5A 1QQCA 4AM6A 2ZQBA 4O8UA 2D0PA 1QTMA 1KC8O 3VQ8A 1NJWA 3OBYA 4KREA 3MXMA 1BG3A 2JGUA 3GG4A 3OHRA 2NZTA 4WQ4C 2I7NA 2HMIA 1JLCA 3HZ6A 3I0RA 2VG7A 4WF9L 4DQIA 5IT9O 1BWFO 1HQUA 1IBKK 2X78A 1QHTA 2VG5A 3THYA 5EVZA 4L8RB 4CGDA 1NGGA 1L3SA 5FRNA 5C42A 2Q3SA 1VQ5N 2KZMA 3H08A 1DEJA 1C1BA 3HPHA 5HROA 1KRPA 1QSYA 1QVFM 1RNHA 2D0BA 4JS5A 5CE3A 3CQ8A 1KTQA 2O8DA 3SMPA 2YNHA 1MWMA 4KTWA 1TKZA 4OVLA 3C7NB 4ID1A 2HHUA 3SUPA 1ZYQA 1IKXA 3VOVA 1VQ6N 2NNWA 5AQOA 5M1PA 4DS5A 4FW2A 2QWNA 3HTVA 3BGRA 1TAUA 4H5WA 5IWAK 4YFUA 4DSFA 3PSFA 4BQZA 3DRRA 1K73O 1U45A 2QKKA 3I8BA 5FRMA 1L3VA 3C6UA 3WT0A 3G6EN 2G8IA 3LANA 1YVUA 3CCMN 5AQKA 4JK9A 4DHYA 3HPGA 3L2VA 5J1EA 5AQPA 3VQCA 3D0PA 2V51B 1W0HA 4GNIA 3GL1A 3LZIA 3QBWA 3DOKA 1GLLO 5EY4A 2GWJA 4YDUC 1LV5A 3KWGA 4OLBA 4CE9A 1RT5A 2JWLA 3DLRA 3SV3A 1YIJN 4Z4EA 5H1SQ 4CGIA 3K0SA 4CBWA 4JLHA 1ASVA 4HCCA 4LC9B 1ILYA 3RR7A 2BUPA 5AZIA 3MN5A 4AHSA 4Q5VA 1GOCA 2HNDA 4O44A 3KKSA 1WN7A 5F0XA 4G9ZA 4DV5K 4JKCA 3KHYA 3ZETB 2ZD1A 4PL7A 5CHIA 2G8HA 1C0MA 3MN7A 4IZ9A 3UB5A 1NKBA 1Q7YO 1ZBLA 4PQUA 3VENA 3KJVA 4B1UB 3MEGA 3AVFA 4CF0A 3O4NA 4FPAA 4AHVA 1KAYA 3AO2A 3QIOA 1VSFA 3CJBA 2HHWA 1LWEA 2J4RA 2A3ZA 3S41A 1EWRA 3F5TA 4JKGA 4FOEA 4BR0A 4IEEA 3LDOA 3F9KA 1TUUA 3KLGA 3J7ZO 3LDLA 3M5RA 3QLHA 4CW7B 3ZSVA 4DTXA 1Y97A 4NLCA 3KLFA 1WSGA 4IJNA 3VF2A 3K9KA 4IFVA 1ASUA 1CXUA 3CF5L 1GLJO 4YNQA 4DTMA 3KD5E 2P9NB 4JKAA 1RTHA 4H0TB 4FJ8A 3RMCA 2E4LA 4CZLA 3VQ6A 2D4WA 1NG9A 4Q0BA 4N56A 1D4XA 4DU3A 5FPEA 2GBZA 2OANA 3QFUA 3RMDA 4C8MA 3HL8A 3AGKA 3AAQA 1LW2A 3J8AA 1RTJA 5BR9A 4X66K 3J7AP 5LJVA 1RDUA 3JS6A 4E7LA 2P9KA 2P1JA 3K58A 1HYZA 1RDBA 3SLCA 5HRSA 3TABA 1ZBHA 4B9NA 1WSIA 2F7TA 4GV3A 2RE2A 1V4TA 3S9HA 2DY4A 3QEPA 2FXUA 3W3DA 4KH5A 4LY7A 1J6ZA 2Y1IA 1D9FA 4Y1CA 3EL2A 3AVNA 1EKEA 3MEEA 4CHNA 4O4GA 4A5BA 4IEIA 2VCPA 3CERA 2YCHA 3HYFA 4CHYA 5CR4A 1J54A 2UXDK 1VK0A 3DYAA 5KGWA 3OYLA 4KHSA 4GKKK 1NGIA 4BRQA 3QEWA 4FK4A 4DLEA 3PO4A 2F9WA 1RTIA 4RWTA 3CPWM 1G15A 2WUSA 4DFMA 1DGKN 4KB1A 2YNFA 4AHCA 3CXCM 4JI6K 5FROA 2ZJPL 3ULDA 1GLDG 1I3AA 2IDOA 3CG7A 1N5YA 4IBNA 3MWPA 4DQQA 3NE6A 2P51A 1CLQA 1R0AA 1TUYA 4CJ4A 1NK5A 1TGOA 2ASOA 2B6AA 4HCBA 4EAHD 1VHXA 4AH9A 5B8HA 3VERA 1VQMN 1RBVA 3QMLA 4H0OA 4ELTA 4DLGA 4IFEA 3TAMA 4FLUA 1YJNN 2W6LA 3DXKB 5BR8K 5C25A 3H3NO 3ZX3A 4B08A 4IXCA 4H5NA 1JJ2M 4FK0A 1J5EK 1DTQA 4BRNA 5KTQA 3CFOA 3R9PA 5GIOA 1ZBSA 5T7BA 5HRNA 4JRQA 2QWPA 4CGFA 4AILC 3KWIA 1JL2A 5AQFA 1LWCA 2VGMA 4CJVA 4H8KA 3L2QA 2QKBA 3RSEB 1N33K 1C1CA 1NJIO 3K5OA 2HHXA 3JSMA 1S22A 3FZFA 1FJGK 2NRWA 3G0ZA 1KFDA 4E1JA 4N5SA 4NLBA 1EX4A 3AO4A 4JKFA 3EO3A 1HPMA 1IV0A 3WNEA 1MDUB 1KLMA 1XMQK 2QXLA 4CZJA 2O8BB 4X62K 4WFBL 2XY6A 4IO8A 5JLHA 4DSJA 4E19A 5J2QA 3DOLA 4CJ3A 4CBUA 3BEXA 3TTFA 1HNIA 2Q0RA 1BI4B 4FJXA 4YOVA 3O08A 3UKUB 3CJAA 3NGYA 4QS9A 2XY7A 2GV9A 2P9LA 2YHBA 2IGIA 1QQMA 5KI6A 3OYNA 4B1XB 4QOZB 1SS6A 5BN9A 5JS1A 3NCIA 2HNZA 4YORA 2FC0A 4DTJA 5FLXO 3M8SA 1NGDA 2BTFA 2YNIA 4K42A 3LM2A 1TL1A 4WFNL 4CIGA 3R6MA 1ZBFA 4EP4A 4HVJA 3J81O 1S5JA 4CK1A 4BVPA 1KCFA 2O8CB 2QWMA 3FZKA 4F3TA 4JI3K 2ZM6K 5LL6Z 4FYDA 1BHLA 1A5XA 3VTHA 3MECA 4GW6A 4B9TA 5K14A 3FLCO 3TWHA 5A2QO 2G8FA 5D3GA 2QM1A 3AA4A 4EHTA 3CJ1A 2GELA 3RTVA 4FM0A 2PYJA 4FJ5A 4YOXA 3SPYA 2RHKA 2KQ2A 2FF6A 2HBKA 2Q1NA 3SYZA 4ISEA 1NLVA 2EHGA 1W9HA 1B9DA 4PWDA 2D0AA 3LDSA 1XUPO 2PZSA 1X3MA 3B8AX 1CZBA 2OTJN 3V1QA 2QWLA 1NWKA 3NVMA 1WOQA 2O4GA 3O8MA 4H5VA 4CZGA 4FJLA 3G25A 3V9SA 5C2FA 3TR8A 2KFNA 3SMSA 5AZJB 1L3UA 4B1WB 2AJQA 1GOBA 2YHWA 3NAEA 3QIPA 2E6MA 3ZEUB 4DR7K 3WEEA 3WUHA 4LF7K 1JLBA 1L5UA 3A0IX 2GWKA 2IVNA 3TSUA 3OBWA 5BRHA 5KRSA 3IFRA 3CIPA 3M6GA 4DSEA 3THXA 2KW4A 2DPNA 4KKOA 4FL9A 3P83D 1C0UA 4YOYA 1X9WA 3EN9A 4CZFA 3OYJA 1RT4A 4BRPA 3NBPA 1EO1A 1JXEA 2BH1A 3LP1A 3EZWA 1VRUA 3OYAA 3TTDA 3C65A 3THWB 3CM5A 3AVBA 2QXFA 3SZ2A 4BRCA 1FW6A 2E20A 4FSVA 1RTDA 3O3FA 3ATUA 4CJTA 3M1FA 2F96A 2EWSA 4EIAA 4Z4FA 3FE1A 3L2UA 1QQOA 3VEOA 4HTLA 1KLNA 1H1VA 2D1KA 4JAXA 1BU6O 3I55N 1YTAA 4CGGA 2R7YA 2KLAA 2WONA 1DLOA 3E66A 4E7KA 2FLOA 3MN9A 4N41A 5C10A 3ZT4A 2A5XA 1ITGA 3A5LC 5KPZA 4JV5K 4W5QA 1WSEA 1VSEA 4I6MA 3THYB 4B9SA 4FWSA 5EX5A 1LCUA 1VSHA 4DR3K 4ILHA 3TAGA 4DTOA 2A1RA 1K9MO 4QCLA 2P9SB 3HSCA 1T6DA 4A5AA 3MXIA 1EWQA 4ZTFA 1T8EA 2Q36A 1HX1A 1LW0A 5GIPA 3NF9A 4JI0K 3I8DA 3D7EO 3VESA 4LD0A 5HL7L 2NRRA 4DB3A 3AVHA 3DXMA 4M3WA 1N32K 3EEQA 2IVPA 1BL3A 1RT6A 2BE2A 4E1MA 1ZBIA 3A5OC 3U6FA 1TL3A 4LF6K 1ATNA 2ITMA 3DLBA 2OPSA 2AA4A 3ENHA 3LP0A 3A5MC 3HT3A 2IS3A 3RRHA 1S1UA 3O6WA 1TYQB 3CCUN 2A40A 4CJPA 3CCSN 4LF5K 3L6QA 3VQ7A 3IG1A 4O8KA 2HVIA 4OX9K 1CXQA 3TU5A 1YVNA 2RN2A 3IKMA 3BUZB 5MLCQ 3LZJA 3N4PA 4GV9A 4UY8O 1XHXA 1YT3A 3TI0A 1UA0A 3ZSZA 4DV3K 4CEOA 4DQRA 3D2FB 4FWOA 3QEIA 2A42A 4B3SK 1TVRA 3CFRA 1S1XA 4CD3A 3QDKA 4KPYA 1UOCA 1IG9A 2ZE2A 4I9LA 3W0LA 1KAXA 4CJ7A 2P5GA 4FW1A 1Q9YA 2O8FA 4CEFA 1Q8IA 3QFPA 4FJ7A 4BRMA 2PBDA 4AHTA 5AQGA 1YUWA 4DUZK 3SBGA 2F8SA 3QICA 4B9VA 4JI8K 4N47A 3VETA 3KLHA 4ELVA 3ZX0A 5AQMA 3BDPA 3ZT2A 3OYCA 2B4JA 2OTLN 2PY5A 5AQRA 1F21A 1LAWA 3K5NA 5KQDA 4H0VB 1VQPN 1NGAA 3AA3A 3PLAA 1XQSC 4FJMA 2HMPA 3KVGA 3O9UA 4FLVA 2AP1A 4QS7A 3HP6A 4JYAK 2P9PA 3FZMA 4RW8A 3D2EA 3VQDA 2XO7A 4LFCK 4XEIA 4FWMA 3ZSWA 4FOIA 3QEVA 1NK4A 5C12A 3OYMA 4K8XA 3CI5A 1XNRK 1KAZA 3PV8A 1T7PA 3T19A 4YHHK 4I9QA 3OYBA 1Q18A 4K25A 3OJUA 1DTTA 1HPZA 3RMBA 3A5NC 2DTUA 1HLUA 2PAVA 3H46O 4FWKA 3SQ0A 1NK7A 4WQ5A 2CGJA 2YX6A 5GAHP 1J9AA 4E3SA 4CZMA 3A8YA 1LOTB 1BUPA 3SJHA 1FKOA 2Q0UA 3C95A 4E7IA 1XC9A 1NK9A 2O8EB 1OH5A 4XH1A 3MWTA 4FLYA 3V9ZA 3C6HA 4DTPA 1HJRA 4CJEA 4JK7A 3PUFA 4AF1A 1HQEA 4ZHRA 2QWOA 3AA5X 4LH5A 4ELUA 1U2VB 4B8AB 2UUAK 2FBVA 3V9WA 4MFBA 3S3MA 2A6AA 5JICA 2IOCA 3PO5A 4OPKA 1C0GA 4H0YB 1NGEA 2ASMA 3KK7A 2HF3A 2EX3A 2ITGA 4DF4A 1RDAA 1VAZA 3DMJA 3QEXA 3MEDA 4JHDA 2I5JA 4L3QA 4BG8A 4CJ5A 4JKHA 4H0PA 4CEDA 2UYTA 3QNOA 1XNQK 3C94A 1VQKN 3DRPA 4FO0A 4A59A 4R5PA 4IOAL 1BQMA 2GX9A 1WAFA 3K9JA 4RCHA 1IBMK 4PKIA 4OPHA 4DR5K 3V4IA 4JI7K 3WNHA 1D9DA 1E4FT 4B9LA 3C7NA 3BP8A 1KQSM 3OYGA 4FLWA 2VWKA 2V52B 1U6ZA 3KIOA 3AVMA 3LAKA 3OJSA 3AO5A 4KHQA 4KHNA 1U48A 2D0CA 3EYZA 3LM9A 3P5JA 3FFIA 4FLZA 1SKRA 3LP2A 2Y1JA 4F3OA 4NCBA 3RRGA 3NH1A 4BGAA 4FK2A 3SQ4A 4KFBA 4OJRA 2HBMA 2CGKA 4FXDA 2P9IA 3BF1A 4BRDA 3VTIA 2XHBA 1NJYA 3T1AA 1K8KB 2G8UA 3AA2A 3UE5A 1I39A 4CZKA 2ZJRL 3RWUA 4RW9A 4MO4A 4BC5A 1OVYA 2YHAA 3VQ4A 4AM7A 3L8BA 1D8YA 1J5OA 2VWBA 3HM9A 4W5RA 4YOTA 1TKTA 1QZ6A 5KGXA 3NF7A 4U7BA 1HJOA 4ILGB 3VQAA 3LWMA 4OKKA 2IAJA 3VGLA 1N8RO 1BCOA 2YI1A 3F2KA 1C0FA 2QWRA 5M1KA 3ITHA 4FVUA 5KRTA 3I33A 2O4IA
chains in the Genus database with same CATH topology
4F3TA 4B9MA 4BDYA 1VSDA 3G10A 1X9SA 3A2FA 2G8KA 1REVA 2HB5A 4HTUA 4FYDA 1Z25A 3LAMA 1BHLA 3V1RA 2JLEA 1A5XA 3ZT0A 3NHGA 3V6DA 1NJZA 3QNNA 3MECA 1RT7A 3E01A 1SUQA 4GW6A 5K14A 4B9TA 3SCXA 3TWHA 3OY9A 4KB0A 3SUNA 1RCHA 3TARA 5CY4A 2BGGA 4BDZA 4NCGA 1TKDA 4ID5A 2G8FA 5D3GA 4DWIA 1JXBA 3AA4A 3VQPA 3PX6A 2G8VA 4CEAA 2Z1GA 1EXQA 3OS0A 2YV0X 4FM1A 2HHSA 1VSMA 3ZSXA 4CJRA 1U49A 3RTVA 3PX0A 4FM0A 2PYJA 1EETA 4FJ5A 3F73A 4M3RA 4CCHA 4FJHA 3SPYA 3EY1A 2KQ2A 3SYZA 1QS4A 3NH2A 5CYQA 4UQGA 2EHGA 3HVTA 4FVMA 1HRHA 1B9DA 1W9HA 2D0AA 1L3TA 4PWDA 1J53A 1FXXA 4IG0A 3LPTA 3M8QA 3L2RA 3NGZA 3LDSA 1SL1A 4ICLA 4IG3A 4RW6A 3SUOA 5DMRA 1T05A 2NUBA 2DFHA 1YTUA 1KVCA 3KK2A 4DQPA 4F2RA 1CZBA 3V1QA 5SWMA 3OYHA 3TANA 4KTZA 4Z4GA 4FZZA 2O4GA 1TK8A 4CF1A 3NF6A 1BIZA 4BE1A 1WSHA 3O3HA 5J2MA 3V9SA 4FJLA 1C0TA 3L2WA 5FDLA 3TR8A 4F8RA 4RW7A 4KO0A 4B8CA 4NYFA 4M3UA 1C6VA 2KFNA 2XRIA 3HP9A 1L3UA 3WNFA 1JLQA 1GOBA 2Z1IA 4E7JA 3NAEA 2AJQA 1VSIA 3QIPA 4LSLA 4C8NA 2E6MA 4BACA 3ZCMA 3TAEA 1JLBA 4IDKA 4LSNA 1L5UA 1NOYA 4N76A 1QQCA 3HK2A 2ZQBA 1QTMA 4FZYA 3OS1A 4FLTA 4M45A 3VQ8A 3CFPA 4HUEA 3QO9A 1RBTA 1NJWA 2HVHA 4KREA 3CM6A 3M8PA 3MXMA 3KTQA 5KRSA 2JGUA 4OKEA 4DSEA 1U04A 3HXMA 3LALA 2KW4A 3KLEA 4KKOA 3P83D 1C0UA 2PYLA 3O4QA 2HMIA 1X9WA 4DTUA 3OYJA 1RT4A 5E41A 3NBPA 1JXEA 3LP1A 4BE0A 1JLCA 1BGXT 4JS4A 3KLIA 3I0RA 2IC3A 2VG7A 4JRPA 4DQIA 1HQUA 1VRUA 2X78A 3OYAA 1K6YA 1QHTA 2VG5A 3DLEA 4CJUA 2OPPA 4J2DA 4L8RB 4CGDA 4FJJA 3ZT1A 4CFAA 1L3SA 3CM5A 3AVBA 2QXFA 3SZ2A 4CJLA 5C42A 5FRNA 2Q3SA 2KZMA 3H08A 3L3VA 1C1BA 1RTDA 3HPHA 5HROA 3O3FA 1KRPA 3C6TA 3M8RA 1QSYA 2YKMA 4CJTA 3DRSA 1RBSA 1RNHA 4KHUA 2D0BA 1ASWA 1KVBA 4KHWA 4JS5A 2F96A 4Z4FA 3AVKA 3CQ8A 1KTQA 3L2UA 1FKPA 4O55A 3SQ2A 2HHQA 1VSLA 2YNHA 4KTWA 4OVLA 1TKZA 1KLNA 4KI4A 4HUGA 4ID1A 2HHUA 3SUPA 1ZYQA 1IKXA 4FJIA 1YTAA 2LSNA 4CGGA 2R7YA 4DS5A 3AVCA 4FW2A 4BDPA 2WONA 1DLOA 4OKJA 4KTQA 3BGRA 1TAUA 3K57A 4E7KA 4N41A 4YFUA 4DSFA 4CHQA 3O3GA 4CGHA 3DRRA 5CYMA 3KK3A 3OYEA 3NGIA 3ZT4A 3QETA 3TAQA 1U45A 1ITGA 2QKKA 4W5OA 5FRMA 3K2PA 3VA0A 3ZSYA 1L3VA 3ZSRA 1KFSA 2VG6A 3C6UA 4DTRA 2G8IA 2FBXA 4W5QA 3LANA 1YVUA 1WSEA 2F8TA 1VSEA 4RW4A 3HPGA 1FK9A 4B9SA 3AO3A 1VSHA 3QERA 3WNGA 3TAGA 2A1RA 4DTOA 4QCLA 3L2VA 4M3YA 5J1EA 3VQCA 1T03A 3D0PA 1RT2A 4KV8A 3VQ5A 1RBRA 1W0HA 1JLEA 1TK0A 4O0JA 4I7FA 2HNYA 4IFYA 4FM2A 2FBTA 3MXIA 1UAXA 3LP3A 4ZTFA 4CHZA 1T8EA 3LZIA 3SPZA 3DOKA 4CJSA 1LW0A 1WSJA 4CJKA 4J2EA 3AO1A 3NF9A 4CF8A 5HP1A 4F4KA 4LH4A 3I8DA 1LV5A 2BANA 4LD0A 1WNSA 4OLBA 1WLJA 4CE9A 5J2PA 1RT5A 1S1WA 3DLRA 3SV3A 4ZTJA 4Z4EA 3KK1A 4CFDA 2FBYA 4Z4CA 2RPIA 3AVHA 4I2PA 5I42A 1S6QA 4CGIA 4JLHA 4QAGA 1ASVA 4KHYA 4M3WA 4HCCA 2ATQA 3RR7A 4J2BA 1BL3A 1RT6A 2BE2A 4OGCA 4AHSA 2HHTA 4Q5VA 1GOCA 2HNDA 4O44A 1GOAA 3VQBA 1TKXA 1A5VA 4E1MA 4CIFA 1NK6A 1JL1A 3U6FA 3KKSA 1ZBIA 1WN7A 2VWJA 4M42A 1TL3A 3V81A 5C24A 3DLBA 1XWLA 2OPSA 2ZD1A 1X9MA 1D5AA 3LP0A 2G8HA 1C0MA 3MXJA 3HT3A 1SKSA 2IS3A 3ISNC 5CZ1A 3P1GA 3RRHA 1S1UA 3DLHA 1NKBA 1JLAA 3ZSQA 1SKWA 4FJ9A 1LAVA 1ZBLA 4H4MA 4DSIA 4BWMA 4CJPA 4PQUA 3K5MA 3KJVA 1HMVA 3VQ7A 3IG1A 3MEGA 3AVFA 1NJXA 2HVIA 4CF0A 3O4NA 3L3UA 4AHVA 3IRXA 1CXQA 3CYMA 3AO2A 3QIOA 2RN2A 3OYDA 3VQ9A 1BCMA 1VSFA 4HUFA 3LZJA 2HHWA 1LWEA 4NCAA 1XHXA 1YT3A 3TI0A 4FJGA 1UA0A 3ZSZA 4CEOA 3TAFA 4DQRA 3B6PA 3QEIA 4Z0UA 1TVRA 3JYTA 4XIUA 3PX4A 2DFEA 2HW3A 3F9KA 2X6SA 1S1XA 3KLGA 3CFRA 4F2SA 2OZSA 4KPYA 3QLHA 1UOCA 3K59A 2ZE2A 1IG9A 4BE2A 4I9LA 5JS2A 2P5GA 3ZSVA 4DTXA 1S9GA 1Y97A 4CHOA 4FW1A 4CIEA 3KLFA 3T3FA 1Q9YA 1WSGA 5CZ2A 4CEFA 1Q8IA 1TV6A 4DQSA 4IFVA 4FJ7A 1ASUA 1CXUA 2OA8A 4YNQA 3HPOA 4FLXA 4DTMA 3KD5E 1JKHA 4AHTA 3RR8A 3HO1A 1RTHA 4FJ8A 3RMCA 3V9UA 2G8WA 2E4LA 3HSTB 4CF9A 5SZTA 3V9XA 3VQ6A 3OYIA 3U3GA 3NH0A 3IAYA 2F8SA 4PY5A 2KTQA 4CGJA 5HBMA 1NKEA 1UWBA 4B9VA 4Q0BA 4N56A 3I0SA 4N47A 2KFZA 3KLHA 1S1VA 4DU3A 2GBZA 3HVRA 4DU4A 4ELVA 4KRFA 3RMDA 4C8MA 3HL8A 3BDPA 1LW2A 3ZT2A 3OYCA 4CFBA 2B5JA 4GMJB 2B4JA 1RTJA 4DMNA 4M3XA 2PY5A 4I2QA 1KSPA 3QESA 3AV9A 1F21A 1LAWA 3K5NA 4FJKA 3LWLA 4E7LA 1BQNA 1SL2A 3AA3A 2P1JA 3K58A 1HYZA 4M3TA 4FJMA 1RDBA 3TABA 4M41A 5HRSA 1ZBHA 1S1TA 1XI1A 1WSIA 1NKCA 3EZ5A 4B9NA 4DF8A 1JLFA 1RBUA 1SV5A 4FLVA 4Z4HA 3S9HA 3KD1E 5J2NA 2DY4A 3QEPA 3HP6A 4LY7A 4DSKA 2Y1IA 1D9FA 4Y1CA 2OPRA 3AVNA 4RW8A 1EKEA 3AVAA 3UIQA 1S6PA 3SI6A 4CFCA 5EU7A 3VQDA 3MEEA 4CHNA 2XO7A 4O4GA 3HJFA 3ZSWA 3QEVA 4K8ZA 4CHYA 1Z26A 3HYFA 1NK4A 1BIUA 4E1NA 1QSLA 3SV4A 1J54A 1A5WA 2RKIA 1VK0A 3OYMA 4K8XA 3DYAA 1IH7A 4GVMA 5KGWA 1NK0A 5DK5A 3OYLA 3PV8A 3S3OA 1T7PA 3T19A 4KHSA 4CF2A 3OYBA 2WOMA 3QINA 1MU2A 3OJUA 3PY8A 4I9QA 1DTTA 1HPZA 3RMBA 2GUIA 3QEWA 3VQQA 4DLEA 3PO4A 4FK4A 4EZ6A 3U3YA 2DTUA 1KVAA 4CECA 4DFKA 1RTIA 1G15A 4WE1A 4DFMA 3SQ0A 4KB1A 2YNFA 4AHCA 1NK7A 4NYNA 4W5TA 1CZ9A 1U4BA 4B9UA 3AVGA 5HLFA 5FROA 4OPJA 1J9AA 4OGEA 4PUOA 4O5BA 2X74A 4E3SA 1QSSA 2YKNA 3ULDA 1I3AA 4W5NA 2IDOA 3CG7A 4CESA 2HHVA 4DTNA 3NDKA 1UA1A 4AHUA 1N5YA 4IBNA 1WAJA 1FKOA 1XC9A 3C95A 4E7IA 1U47A 4DQQA 2Z1HA 2W42A 1NK9A 4H4OA 3ALYA 3NE6A 2P51A 1CLQA 1R0AA 2QK9A 1B92A 4FLYA 3V9ZA 4CJWA 4CJ4A 1NK5A 1TGOA 4E0DA 2B6AA 3OYKA 4CEZA 4HCBA 4AH9A 4DFJA 4DTPA 2ETJA 4FJNA 1HJRA 4CJEA 3OYFA 1VSKA 2BDPA 3PUFA 3ASMA 4DSLA 1RBVA 4O0IA 1HQEA 1O1WA 4DU1A 4ZHRA 4ELTA 3AA5X 4ELUA 4LH5A 4DLGA 3TAMA 4FLUA 4B8AB 2RF2A 2FBVA 3V9WA 2D5RA 1IKYA 4MFBA 4PA1A 5C25A 1RT3A 3S3MA 1N6QA 2IOCA 3PO5A 4OPKA 4CHPA 1TK5A 4B08A 4BWJA 3DM2A 1QE1A 1C1AA 5HRPA 4FK0A 2EX3A 1DTQA 2ITGA 5KTQA 3CFOA 4EP5A 4DF4A 1RDAA 3DMJA 4E7HA 2PZSA 3DLKA 3QEXA 2A1SA 5T7BA 3MEDA 5HRNA 1RT1A 2I5JA 4JRQA 4CGFA 3DLGA 1NOZA 4AILC 3TAPA 4CJ5A 3OS2A 3SNNA 1IO2A 4EZ9A 4CEDA 3QNOA 1RDCA 2OYQA 3C94A 1JL2A 3DRPA 2Z1JA 4CEQA 3SUQA 1LWCA 4CJVA 4R5PA 1BI4A 4H8KA 1RILA 3B6OA 3L2QA 3S3NA 2QKBA 3NF8A 1BQMA 1C1CA 1WAFA 1LWFA 3K5OA 1X1PA 1HYVA 3RMAA 2HHXA 1SL0A 3JSMA 3V4IA 2OZMA 3WNHA 1Q9XA 1D9DA 3SQ1A 4B9LA 3ZSOA 4CJQA 3MAQA 4FCYA 2XY5A 3G0ZA 3AVJA 1KFDA 4N5SA 1WSFA 4FZXC 4DTSA 4IKFA 1EX4A 3AVLA 3AO4A 3OYGA 4FLWA 4J2AA 2VWKA 4CEEA 4RG8A 3KIOA 3VA3A 4DS4A 3AVMA 3LAKA 3WNEA 3OJSA 3AO5A 4B3OA 1KLMA 2OPQA 4KHQA 1TAQA 1U48A 4KHNA 2D0CA 3EYZA 1JLGA 1BISA 2P5OA 3P5JA 1XHZA 1VRTA 3FFIA 2XY6A 1B9FA 4FLZA 1SKRA 3LP2A 3IS9A 4KI6A 4KAZA 3LPUA 3NFAA 4DSJA 4M3ZA 1EP4A 4C8OA 2Y1JA 4F3OA 4NCBA 3RRGA 3NH1A 4E19A 3VQEA 5J2QA 4FK2A 3DOLA 4CJ3A 3SQ4A 4KFBA 4OJRA 1HNIA 4AHRA 4FXDA 4G1QA 1BI4B 4CK2A 1NJYA 2XHBA 4FJXA 3NGYA 3T1AA 4CK3A 2GV9A 2XY7A 3AA2A 2G8UA 4OLAA 3K5LA 1I39A 4CJFA 2YNGA 3RWUA 2YHBA 3DI6A 4RW9A 3V1OA 1S9EA 4CEBA 4DG1A 2KZZA 2IGIA 5KI6A 3OYNA 1VSJA 2YHAA 3VQ4A 4QOZB 4MQ3A 3L8BA 3THVA 1J5OA 1D8YA 4C8KA 1HYSA 5JS1A 3D45A 4CERA 3NCIA 2HNZA 2X6NA 3HM9A 3AVIA 2FC0A 4DTJA 4W5RA 3M8SA 1TKTA 4HHTA 2DFFA 3KKRA 2YNIA 3OVNA 5KGXA 5HRRA 4Z4IA 1TL1A 1NK8A 3NF7A 3VQAA 4CIGA 3LWMA 4OKKA 2IAJA 4Y1DA 1BCOA 1ZBFA 2XY8A 4C8LA 4TSXA 4EP4A 4HVJA 1IKWA 3ZT3A 1IKVA 1HNVA 1S5JA 3SJJA 3ITHA 4E89A 2E6LA 5I3UA 5KRTA 4CK1A 1KCFA 3VN5A 1RDDA 1ZBUA 4DFPA 2O4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F3T A;  4B9M A;  4BDY A;  1VSD A;  3G10 A;  1X9S A;  3A2F A;  2G8K A;  1REV A;  2HB5 A;  4HTU A;  4FYD A;  1Z25 A;  3LAM A;  1BHL A;  3V1R A;  2JLE A;  1A5X A;  3ZT0 A;  3NHG A;  3V6D A;  1NJZ A;  3QNN A;  3MEC A;  1RT7 A;  3E01 A;  1SUQ A;  4GW6 A;  5K14 A;  4B9T A;  3SCX A;  3TWH A;  3OY9 A;  4KB0 A;  3SUN A;  1RCH A;  3TAR A;  5CY4 A;  2BGG A;  4BDZ A;  4NCG A;  1TKD A;  4ID5 A;  2G8F A;  5D3G A;  4DWI A;  1JXB A;  3AA4 A;  3VQP A;  3PX6 A;  2G8V A;  4CEA A;  2Z1G A;  1EXQ A;  3OS0 A;  2YV0 X;  4FM1 A;  2HHS A;  1VSM A;  3ZSX A;  4CJR A;  1U49 A;  3RTV A;  3PX0 A;  4FM0 A;  2PYJ A;  1EET A;  4FJ5 A;  3F73 A;  4M3R A;  4CCH A;  4FJH A;  3SPY A;  3EY1 A;  2KQ2 A;  3SYZ A;  1QS4 A;  3NH2 A;  5CYQ A;  4UQG A;  2EHG A;  3HVT A;  4FVM A;  1HRH A;  1B9D A;  1W9H A;  2D0A A;  1L3T A;  4PWD A;  1J53 A;  1FXX A;  4IG0 A;  3LPT A;  3M8Q A;  3L2R A;  3NGZ A;  3LDS A;  1SL1 A;  4ICL A;  4IG3 A;  4RW6 A;  3SUO A;  5DMR A;  1T05 A;  2NUB A;  2DFH A;  1YTU A;  1KVC A;  3KK2 A;  4DQP A;  4F2R A;  1CZB A;  3V1Q A;  5SWM A;  3OYH A;  3TAN A;  4KTZ A;  4Z4G A;  4FZZ A;  2O4G A;  1TK8 A;  4CF1 A;  3NF6 A;  1BIZ A;  4BE1 A;  1WSH A;  3O3H A;  5J2M A;  3V9S A;  4FJL A;  1C0T A;  3L2W A;  5FDL A;  3TR8 A;  4F8R A;  4RW7 A;  4KO0 A;  4B8C A;  4NYF A;  4M3U A;  1C6V A;  2KFN A;  2XRI A;  3HP9 A;  1L3U A;  3WNF A;  1JLQ A;  1GOB A;  2Z1I A;  4E7J A;  3NAE A;  2AJQ A;  1VSI A;  3QIP A;  4LSL A;  4C8N A;  2E6M A;  4BAC A;  3ZCM A;  3TAE A;  1JLB A;  4IDK A;  4LSN A;  1L5U A;  1NOY A;  4N76 A;  1QQC A;  3HK2 A;  2ZQB A;  1QTM A;  4FZY A;  3OS1 A;  4FLT A;  4M45 A;  3VQ8 A;  3CFP A;  4HUE A;  3QO9 A;  1RBT A;  1NJW A;  2HVH A;  4KRE A;  3CM6 A;  3M8P A;  3MXM A;  3KTQ A;  5KRS A;  2JGU A;  4OKE A;  4DSE A;  1U04 A;  3HXM A;  3LAL A;  2KW4 A;  3KLE A;  4KKO A;  3P83 D;  1C0U A;  2PYL A;  3O4Q A;  2HMI A;  1X9W A;  4DTU A;  3OYJ A;  1RT4 A;  5E41 A;  3NBP A;  1JXE A;  3LP1 A;  4BE0 A;  1JLC A;  1BGX T;  4JS4 A;  3KLI A;  3I0R A;  2IC3 A;  2VG7 A;  4JRP A;  4DQI A;  1HQU A;  1VRU A;  2X78 A;  3OYA A;  1K6Y A;  1QHT A;  2VG5 A;  3DLE A;  4CJU A;  2OPP A;  4J2D A;  4L8R B;  4CGD A;  4FJJ A;  3ZT1 A;  4CFA A;  1L3S A;  3CM5 A;  3AVB A;  2QXF A;  3SZ2 A;  4CJL A;  5C42 A;  5FRN A;  2Q3S A;  2KZM A;  3H08 A;  3L3V A;  1C1B A;  1RTD A;  3HPH A;  5HRO A;  3O3F A;  1KRP A;  3C6T A;  3M8R A;  1QSY A;  2YKM A;  4CJT A;  3DRS A;  1RBS A;  1RNH A;  4KHU A;  2D0B A;  1ASW A;  1KVB A;  4KHW A;  4JS5 A;  2F96 A;  4Z4F A;  3AVK A;  3CQ8 A;  1KTQ A;  3L2U A;  1FKP A;  4O55 A;  3SQ2 A;  2HHQ A;  1VSL A;  2YNH A;  4KTW A;  4OVL A;  1TKZ A;  1KLN A;  4KI4 A;  4HUG A;  4ID1 A;  2HHU A;  3SUP A;  1ZYQ A;  1IKX A;  4FJI A;  1YTA A;  2LSN A;  4CGG A;  2R7Y A;  4DS5 A;  3AVC A;  4FW2 A;  4BDP A;  2WON A;  1DLO A;  4OKJ A;  4KTQ A;  3BGR A;  1TAU A;  3K57 A;  4E7K A;  4N41 A;  4YFU A;  4DSF A;  4CHQ A;  3O3G A;  4CGH A;  3DRR A;  5CYM A;  3KK3 A;  3OYE A;  3NGI A;  3ZT4 A;  3QET A;  3TAQ A;  1U45 A;  1ITG A;  2QKK A;  4W5O A;  5FRM A;  3K2P A;  3VA0 A;  3ZSY A;  1L3V A;  3ZSR A;  1KFS A;  2VG6 A;  3C6U A;  4DTR A;  2G8I A;  2FBX A;  4W5Q A;  3LAN A;  1YVU A;  1WSE A;  2F8T A;  1VSE A;  4RW4 A;  3HPG A;  1FK9 A;  4B9S A;  3AO3 A;  1VSH A;  3QER A;  3WNG A;  3TAG A;  2A1R A;  4DTO A;  4QCL A;  3L2V A;  4M3Y A;  5J1E A;  3VQC A;  1T03 A;  3D0P A;  1RT2 A;  4KV8 A;  3VQ5 A;  1RBR A;  1W0H A;  1JLE A;  1TK0 A;  4O0J A;  4I7F A;  2HNY A;  4IFY A;  4FM2 A;  2FBT A;  3MXI A;  1UAX A;  3LP3 A;  4ZTF A;  4CHZ A;  1T8E A;  3LZI A;  3SPZ A;  3DOK A;  4CJS A;  1LW0 A;  1WSJ A;  4CJK A;  4J2E A;  3AO1 A;  3NF9 A;  4CF8 A;  5HP1 A;  4F4K A;  4LH4 A;  3I8D A;  1LV5 A;  2BAN A;  4LD0 A;  1WNS A;  4OLB A;  1WLJ A;  4CE9 A;  5J2P A;  1RT5 A;  1S1W A;  3DLR A;  3SV3 A;  4ZTJ A;  4Z4E A;  3KK1 A;  4CFD A;  2FBY A;  4Z4C A;  2RPI A;  3AVH A;  4I2P A;  5I42 A;  1S6Q A;  4CGI A;  4JLH A;  4QAG A;  1ASV A;  4KHY A;  4M3W A;  4HCC A;  2ATQ A;  3RR7 A;  4J2B A;  1BL3 A;  1RT6 A;  2BE2 A;  4OGC A;  4AHS A;  2HHT A;  4Q5V A;  1GOC A;  2HND A;  4O44 A;  1GOA A;  3VQB A;  1TKX A;  1A5V A;  4E1M A;  4CIF A;  1NK6 A;  1JL1 A;  3U6F A;  3KKS A;  1ZBI A;  1WN7 A;  2VWJ A;  4M42 A;  1TL3 A;  3V81 A;  5C24 A;  3DLB A;  1XWL A;  2OPS A;  2ZD1 A;  1X9M A;  1D5A A;  3LP0 A;  2G8H A;  1C0M A;  3MXJ A;  3HT3 A;  1SKS A;  2IS3 A;  3ISN C;  5CZ1 A;  3P1G A;  3RRH A;  1S1U A;  3DLH A;  1NKB A;  1JLA A;  3ZSQ A;  1SKW A;  4FJ9 A;  1LAV A;  1ZBL A;  4H4M A;  4DSI A;  4BWM A;  4CJP A;  4PQU A;  3K5M A;  3KJV A;  1HMV A;  3VQ7 A;  3IG1 A;  3MEG A;  3AVF A;  1NJX A;  2HVI A;  4CF0 A;  3O4N A;  3L3U A;  4AHV A;  3IRX A;  1CXQ A;  3CYM A;  3AO2 A;  3QIO A;  2RN2 A;  3OYD A;  3VQ9 A;  1BCM A;  1VSF A;  4HUF A;  3LZJ A;  2HHW A;  1LWE A;  4NCA A;  1XHX A;  1YT3 A;  3TI0 A;  4FJG A;  1UA0 A;  3ZSZ A;  4CEO A;  3TAF A;  4DQR A;  3B6P A;  3QEI A;  4Z0U A;  1TVR A;  3JYT A;  4XIU A;  3PX4 A;  2DFE A;  2HW3 A;  3F9K A;  2X6S A;  1S1X A;  3KLG A;  3CFR A;  4F2S A;  2OZS A;  4KPY A;  3QLH A;  1UOC A;  3K59 A;  2ZE2 A;  1IG9 A;  4BE2 A;  4I9L A;  5JS2 A;  2P5G A;  3ZSV A;  4DTX A;  1S9G A;  1Y97 A;  4CHO A;  4FW1 A;  4CIE A;  3KLF A;  3T3F A;  1Q9Y A;  1WSG A;  5CZ2 A;  4CEF A;  1Q8I A;  1TV6 A;  4DQS A;  4IFV A;  4FJ7 A;  1ASU A;  1CXU A;  2OA8 A;  4YNQ A;  3HPO A;  4FLX A;  4DTM A;  3KD5 E;  1JKH A;  4AHT A;  3RR8 A;  3HO1 A;  1RTH A;  4FJ8 A;  3RMC A;  3V9U A;  2G8W A;  2E4L A;  3HST B;  4CF9 A;  5SZT A;  3V9X A;  3VQ6 A;  3OYI A;  3U3G A;  3NH0 A;  3IAY A;  2F8S A;  4PY5 A;  2KTQ A;  4CGJ A;  5HBM A;  1NKE A;  1UWB A;  4B9V A;  4Q0B A;  4N56 A;  3I0S A;  4N47 A;  2KFZ A;  3KLH A;  1S1V A;  4DU3 A;  2GBZ A;  3HVR A;  4DU4 A;  4ELV A;  4KRF A;  3RMD A;  4C8M A;  3HL8 A;  3BDP A;  1LW2 A;  3ZT2 A;  3OYC A;  4CFB A;  2B5J A;  4GMJ B;  2B4J A;  1RTJ A;  4DMN A;  4M3X A;  2PY5 A;  4I2Q A;  1KSP A;  3QES A;  3AV9 A;  1F21 A;  1LAW A;  3K5N A;  4FJK A;  3LWL A;  4E7L A;  1BQN A;  1SL2 A;  3AA3 A;  2P1J A;  3K58 A;  1HYZ A;  4M3T A;  4FJM A;  1RDB A;  3TAB A;  4M41 A;  5HRS A;  1ZBH A;  1S1T A;  1XI1 A;  1WSI A;  1NKC A;  3EZ5 A;  4B9N A;  4DF8 A;  1JLF A;  1RBU A;  1SV5 A;  4FLV A;  4Z4H A;  3S9H A;  3KD1 E;  5J2N A;  2DY4 A;  3QEP A;  3HP6 A;  4LY7 A;  4DSK A;  2Y1I A;  1D9F A;  4Y1C A;  2OPR A;  3AVN A;  4RW8 A;  1EKE A;  3AVA A;  3UIQ A;  1S6P A;  3SI6 A;  4CFC A;  5EU7 A;  3VQD A;  3MEE A;  4CHN A;  2XO7 A;  4O4G A;  3HJF A;  3ZSW A;  3QEV A;  4K8Z A;  4CHY A;  1Z26 A;  3HYF A;  1NK4 A;  1BIU A;  4E1N A;  1QSL A;  3SV4 A;  1J54 A;  1A5W A;  2RKI A;  1VK0 A;  3OYM A;  4K8X A;  3DYA A;  1IH7 A;  4GVM A;  5KGW A;  1NK0 A;  5DK5 A;  3OYL A;  3PV8 A;  3S3O A;  1T7P A;  3T19 A;  4KHS A;  4CF2 A;  3OYB A;  2WOM A;  3QIN A;  1MU2 A;  3OJU A;  3PY8 A;  4I9Q A;  1DTT A;  1HPZ A;  3RMB A;  2GUI A;  3QEW A;  3VQQ A;  4DLE A;  3PO4 A;  4FK4 A;  4EZ6 A;  3U3Y A;  2DTU A;  1KVA A;  4CEC A;  4DFK A;  1RTI A;  1G15 A;  4WE1 A;  4DFM A;  3SQ0 A;  4KB1 A;  2YNF A;  4AHC A;  1NK7 A;  4NYN A;  4W5T A;  1CZ9 A;  1U4B A;  4B9U A;  3AVG A;  5HLF A;  5FRO A;  4OPJ A;  1J9A A;  4OGE A;  4PUO A;  4O5B A;  2X74 A;  4E3S A;  1QSS A;  2YKN A;  3ULD A;  1I3A A;  4W5N A;  2IDO A;  3CG7 A;  4CES A;  2HHV A;  4DTN A;  3NDK A;  1UA1 A;  4AHU A;  1N5Y A;  4IBN A;  1WAJ A;  1FKO A;  1XC9 A;  3C95 A;  4E7I A;  1U47 A;  4DQQ A;  2Z1H A;  2W42 A;  1NK9 A;  4H4O A;  3ALY A;  3NE6 A;  2P51 A;  1CLQ A;  1R0A A;  2QK9 A;  1B92 A;  4FLY A;  3V9Z A;  4CJW A;  4CJ4 A;  1NK5 A;  1TGO A;  4E0D A;  2B6A A;  3OYK A;  4CEZ A;  4HCB A;  4AH9 A;  4DFJ A;  4DTP A;  2ETJ A;  4FJN A;  1HJR A;  4CJE A;  3OYF A;  1VSK A;  2BDP A;  3PUF A;  3ASM A;  4DSL A;  1RBV A;  4O0I A;  1HQE A;  1O1W A;  4DU1 A;  4ZHR A;  4ELT A;  3AA5 X;  4ELU A;  4LH5 A;  4DLG A;  3TAM A;  4FLU A;  4B8A B;  2RF2 A;  2FBV A;  3V9W A;  2D5R A;  1IKY A;  4MFB A;  4PA1 A;  5C25 A;  1RT3 A;  3S3M A;  1N6Q A;  2IOC A;  3PO5 A;  4OPK A;  4CHP A;  1TK5 A;  4B08 A;  4BWJ A;  3DM2 A;  1QE1 A;  1C1A A;  5HRP A;  4FK0 A;  2EX3 A;  1DTQ A;  2ITG A;  5KTQ A;  3CFO A;  4EP5 A;  4DF4 A;  1RDA A;  3DMJ A;  4E7H A;  2PZS A;  3DLK A;  3QEX A;  2A1S A;  5T7B A;  3MED A;  5HRN A;  1RT1 A;  2I5J A;  4JRQ A;  4CGF A;  3DLG A;  1NOZ A;  4AIL C;  3TAP A;  4CJ5 A;  3OS2 A;  3SNN A;  1IO2 A;  4EZ9 A;  4CED A;  3QNO A;  1RDC A;  2OYQ A;  3C94 A;  1JL2 A;  3DRP A;  2Z1J A;  4CEQ A;  3SUQ A;  1LWC A;  4CJV A;  4R5P A;  1BI4 A;  4H8K A;  1RIL A;  3B6O A;  3L2Q A;  3S3N A;  2QKB A;  3NF8 A;  1BQM A;  1C1C A;  1WAF A;  1LWF A;  3K5O A;  1X1P A;  1HYV A;  3RMA A;  2HHX A;  1SL0 A;  3JSM A;  3V4I A;  2OZM A;  3WNH A;  1Q9X A;  1D9D A;  3SQ1 A;  4B9L A;  3ZSO A;  4CJQ A;  3MAQ A;  4FCY A;  2XY5 A;  3G0Z A;  3AVJ A;  1KFD A;  4N5S A;  1WSF A;  4FZX C;  4DTS A;  4IKF A;  1EX4 A;  3AVL A;  3AO4 A;  3OYG A;  4FLW A;  4J2A A;  2VWK A;  4CEE A;  4RG8 A;  3KIO A;  3VA3 A;  4DS4 A;  3AVM A;  3LAK A;  3WNE A;  3OJS A;  3AO5 A;  4B3O A;  1KLM A;  2OPQ A;  4KHQ A;  1TAQ A;  1U48 A;  4KHN A;  2D0C A;  3EYZ A;  1JLG A;  1BIS A;  2P5O A;  3P5J A;  1XHZ A;  1VRT A;  3FFI A;  2XY6 A;  1B9F A;  4FLZ A;  1SKR A;  3LP2 A;  3IS9 A;  4KI6 A;  4KAZ A;  3LPU A;  3NFA A;  4DSJ A;  4M3Z A;  1EP4 A;  4C8O A;  2Y1J A;  4F3O A;  4NCB A;  3RRG A;  3NH1 A;  4E19 A;  3VQE A;  5J2Q A;  4FK2 A;  3DOL A;  4CJ3 A;  3SQ4 A;  4KFB A;  4OJR A;  1HNI A;  4AHR A;  4FXD A;  4G1Q A;  1BI4 B;  4CK2 A;  1NJY A;  2XHB A;  4FJX A;  3NGY A;  3T1A A;  4CK3 A;  2GV9 A;  2XY7 A;  3AA2 A;  2G8U A;  4OLA A;  3K5L A;  1I39 A;  4CJF A;  2YNG A;  3RWU A;  2YHB A;  3DI6 A;  4RW9 A;  3V1O A;  1S9E A;  4CEB A;  4DG1 A;  2KZZ A;  2IGI A;  5KI6 A;  3OYN A;  1VSJ A;  2YHA A;  3VQ4 A;  4QOZ B;  4MQ3 A;  3L8B A;  3THV A;  1J5O A;  1D8Y A;  4C8K A;  1HYS A;  5JS1 A;  3D45 A;  4CER A;  3NCI A;  2HNZ A;  2X6N A;  3HM9 A;  3AVI A;  2FC0 A;  4DTJ A;  4W5R A;  3M8S A;  1TKT A;  4HHT A;  2DFF A;  3KKR A;  2YNI A;  3OVN A;  5KGX A;  5HRR A;  4Z4I A;  1TL1 A;  1NK8 A;  3NF7 A;  3VQA A;  4CIG A;  3LWM A;  4OKK A;  2IAJ A;  4Y1D A;  1BCO A;  1ZBF A;  2XY8 A;  4C8L A;  4TSX A;  4EP4 A;  4HVJ A;  1IKW A;  3ZT3 A;  1IKV A;  1HNV A;  1S5J A;  3SJJ A;  3ITH A;  4E89 A;  2E6L A;  5I3U A;  5KRT A;  4CK1 A;  1KCF A;  3VN5 A;  1RDD A;  1ZBU A;  4DFP A;  2O4I A; 
#chains in the Genus database with same CATH topology
 1K8A O;  4BDY A;  1VSD A;  1X9S A;  2P9U B;  3A2F A;  1REV A;  2HB5 A;  4J8F A;  2JLE A;  3ZT0 A;  1GLE G;  1NJZ A;  2V7Y A;  3ZET A;  1RT7 A;  1SUQ A;  2V7Z A;  1HNX K;  3OY9 A;  5AQZ A;  3SUN A;  1RCH A;  3WXL A;  1YF5 L;  5BN8 A;  4DWI A;  1JXB A;  3R3L A;  3PX6 A;  4CEA A;  1EXQ A;  4BR9 A;  2HHS A;  4BRG A;  3VEY A;  4KH6 A;  1EET A;  5M1N A;  3F73 A;  1YIT N;  3NH2 A;  3MK6 A;  4FVM A;  1HRH A;  1L3T A;  1NGH A;  1WBB A;  3L2R A;  4B9U A;  3M8Q A;  1SL1 A;  4JNE A;  5DMR A;  4CZH A;  1V4S A;  2NUB A;  2DFH A;  2E8A A;  1KVC A;  3KK2 A;  4DQP A;  5AQW A;  4CF1 A;  4A57 A;  4BE1 A;  3O3H A;  1C0T A;  3L2W A;  5FDL A;  3D6R A;  2P9N A;  4JI5 K;  4E7J A;  4C8N A;  4DKW A;  4BAC A;  4B3M K;  3ZCM A;  3TAE A;  1NOY A;  4N76 A;  5C0Y A;  2HST A;  3CPE A;  1BA1 A;  4FZY A;  2OCE A;  4FLT A;  3CD6 N;  4M45 A;  4HUE A;  3QO9 A;  4PKH A;  1E4G T;  3L4I A;  4IWV A;  3VGM A;  3CHW A;  3H1V X;  1U04 A;  3KLE A;  3UKR B;  4H03 B;  3CCE N;  2WFB A;  1S3X A;  3T7Z A;  4NXM K;  5E41 A;  1BGX T;  1T6C A;  1K6Y A;  3DLE A;  5AQY A;  3WXM B;  3CCR N;  4FJJ A;  3ZT1 A;  1EQY A;  4CJL A;  4BRE A;  3C6A A;  1BOT O;  3M8R A;  2QA4 N;  1HR0 K;  2YKM A;  3BY5 A;  4KHU A;  4GVE A;  3U9D A;  3ID8 A;  3AVK A;  3P38 A;  3FZH A;  2QW9 A;  1M1K O;  4O55 A;  3WQU A;  5AQS A;  4KI4 A;  2ZJQ L;  4DR2 K;  1YAG A;  4FJI A;  4A62 A;  1RFQ A;  2LSN A;  4KTQ A;  4OKJ A;  1GLF O;  4KBO A;  4CHQ A;  3O3G A;  3L0Q A;  5CYM A;  5M1F A;  3QET A;  1Q81 O;  3K2P A;  3ZSY A;  1KFS A;  3ULE B;  3JAM O;  4DTR A;  5JVG L;  5LMN K;  4JK8 A;  5GAD P;  4RW4 A;  3AO3 A;  3WNG A;  3CCQ N;  1RT2 A;  3OA9 A;  4KV8 A;  4BRH A;  5BRF A;  3JXU A;  2E1Y A;  3FFK B;  3MCA B;  4O0J A;  4I7F A;  1YJW N;  4IFY A;  1TK0 A;  3DXK A;  1UAX A;  3LP3 A;  2GTD A;  3EKU A;  4CJS A;  4JN4 A;  4CJK A;  4J2E A;  4CF8 A;  4LH4 A;  2HBJ A;  3R8E A;  1WLJ A;  3MX5 A;  3I56 N;  5I42 A;  1S6Q A;  4QAG A;  2HBL A;  2ATQ A;  1N34 K;  1NBW A;  3GBT A;  4FPB A;  1GOA A;  3VQB A;  4CIF A;  1A5V A;  1NK6 A;  1JL1 A;  4I6M B;  4IDH A;  4M42 A;  2UU9 K;  2W6K A;  4IOX A;  5AQV A;  5C24 A;  3U8X A;  3WXI A;  5BRE A;  1XWL A;  5AQN A;  1D5A A;  3MXJ A;  1NGJ A;  1SKS A;  3P1G A;  4BVO A;  1SKW A;  1JLA A;  3ZSQ A;  3DLH A;  1LAV A;  4BWM A;  3WXK A;  1HMV A;  1NJX A;  5ADX A;  4MDA A;  3L3U A;  5KPR A;  2O8B A;  3IRX A;  3OYD A;  3VQ9 A;  1BCM A;  3Q7B A;  4IO9 L;  1VQN N;  3CJ7 A;  4ISF A;  3AY9 A;  3TAF A;  4B9Q A;  3B6P A;  3VF4 A;  4CZI A;  3JYT A;  2VGN A;  2DFE A;  2HW3 A;  3UKU A;  1ZC6 A;  5TKY A;  4DR4 K;  4BE2 A;  4EFH A;  1S9G A;  1OH7 A;  3ZLJ A;  2W40 A;  3CQX A;  1TV6 A;  3H45 C;  4DQS A;  3HPO A;  4FLX A;  3RR8 A;  3CET A;  4ISG A;  3HST B;  5HOO A;  5GIN A;  5SZT A;  3V9X A;  4PY5 A;  2KTQ A;  3P39 A;  1NKE A;  1UWB A;  1WBD A;  3I0S A;  2KFZ A;  4LF8 K;  4DU4 A;  4KRF A;  3O9S A;  2O8C A;  4WYB A;  4WQ5 C;  4DUY K;  4DMN A;  1KSP A;  4BGB A;  3QES A;  3AV9 A;  3AAP A;  5TKW A;  2ASP A;  3LWL A;  1BQN A;  4JEP A;  1SL2 A;  1VQ8 N;  1S1T A;  1NKC A;  3EZ5 A;  4DF8 A;  1RBU A;  3TPQ A;  2NRZ A;  4Z4H A;  3KD1 E;  5J2N A;  2UXB K;  4DSK A;  1Z6R A;  3UIQ A;  4JD2 A;  1JCE A;  3SI6 A;  5EU7 A;  2E2N A;  3HJF A;  1BIU A;  2GEM A;  4E1N A;  1DT9 A;  1QSL A;  5GAG P;  1A5W A;  3S3O A;  5E84 A;  3MMV A;  2WOM A;  1MU2 A;  3PY8 A;  2O8D B;  3O9R A;  2GUI A;  1O13 A;  3VQQ A;  4EZ6 A;  3U3Y A;  5DM7 L;  2UXC K;  4WE1 A;  1WB9 A;  1CZ9 A;  1U4B A;  5HLF A;  1P8Z A;  1Y64 A;  4O5B A;  1QSS A;  2YKN A;  3DJC A;  4CES A;  5AZJ A;  2HHV A;  4LF9 K;  4AHU A;  1WAJ A;  2CH6 A;  3IUC A;  1OKJ A;  2Z1H A;  3ZEU A;  4H4O A;  2W42 A;  3ALY A;  3CCV N;  4CJW A;  4E0D A;  4CEZ A;  2I7P A;  3CQY A;  5F2R A;  4DFJ A;  4FJN A;  4DQ8 A;  4LFB K;  3O1B A;  3OYF A;  3D2E B;  4DV1 K;  2BDP A;  5EXW A;  4DSL A;  1O1W A;  3HOT A;  2YJF A;  4NO7 A;  2D5R A;  1IKY A;  4PA1 A;  1X9J A;  4CHP A;  1TK5 A;  4BWJ A;  2YJE A;  4DR1 K;  3DM2 A;  1YHQ N;  1QE1 A;  4B3R K;  1C1A A;  5HRP A;  4EP5 A;  1E3M A;  3DLK A;  2A1S A;  3IDH A;  3DLG A;  4BRI A;  4A61 A;  3FZL A;  4IOC L;  3THW A;  1NGF A;  4CEQ A;  3CC7 N;  1OVQ A;  3N4Q A;  5AZI B;  3C0B A;  3B6O A;  3S3N A;  1Q86 O;  3NF8 A;  1JCG A;  1LWF A;  3H6E A;  4BC2 A;  1X1P A;  1SL0 A;  2CGL A;  4V19 S;  4R79 A;  5F1X A;  4Y0W A;  3SQ1 A;  4FCY A;  3AVJ A;  2CH5 A;  3CME N;  2W41 A;  4FZX C;  4IKF A;  3VEX A;  4CEE A;  4DS4 A;  3ENB A;  1NNE A;  2OPQ A;  4JI1 K;  2P5O A;  1BIS A;  3O9Q A;  1VRT A;  1ESV A;  1B9F A;  4FWN A;  3IMX A;  4JHD B;  3LPU A;  2A41 A;  4YOW A;  4KAZ A;  1EP4 A;  4C8O A;  5EOY A;  4C23 A;  5GAE P;  4JKG B;  4AHR A;  3TSP A;  2P9S A;  1GLA G;  4G1Q A;  5LMU K;  4CK3 A;  4JI2 K;  2YNG A;  3E1Y A;  3V1O A;  4CEB A;  4F9O A;  1VSJ A;  3HRG A;  3P4I A;  1HYS A;  4BR5 A;  4CER A;  3AVI A;  1VQL N;  3MX2 A;  2DFF A;  1P90 A;  3KKR A;  4X65 K;  5JLF A;  3OVN A;  5HRR A;  5JVH L;  3SBT A;  1NK8 A;  4MO5 A;  4LF4 K;  4YOU A;  4Y1D A;  1S72 N;  2XY8 A;  4C8L A;  3ZT3 A;  1IKV A;  3SJJ A;  5I3U A;  2E6L A;  4B1Y B;  1NGC A;  4DFP A;  3GE1 A;  2G8K A;  3RVC A;  4B1Z A;  4HTU A;  1Z25 A;  1KD1 O;  1MWK A;  3V6D A;  5JMV A;  2P9I B;  3U4L A;  2P9K B;  2E2Q A;  1R59 O;  3SCX A;  4BRL A;  4KB0 A;  2BGG A;  5CY4 A;  4ID5 A;  1TYQ A;  3Q7C A;  3GOI A;  4DV4 K;  3O1W A;  4FWP A;  2G8V A;  2Z1G A;  2FSJ A;  2YV0 X;  4FM1 A;  3ZSX A;  4BG9 A;  1QVG M;  3FR0 A;  1MA9 B;  4M3R A;  4CCH A;  1YXQ A;  3CJC A;  5AQI A;  2FF3 B;  3EY1 A;  2QEX N;  1NM1 A;  1QS4 A;  5CYQ A;  4UQG A;  4BR2 A;  3D2F A;  4MDB A;  1XMO K;  3LPT A;  4DR6 K;  3NGZ A;  3CC2 N;  4F2R A;  2Q97 A;  1QHA A;  3TAN A;  2F4V K;  4FZZ A;  4DV7 K;  5J2M A;  3NVK A;  3H1Q A;  4F8R A;  3CCL N;  2XRI A;  2PFU A;  3HM8 A;  4BRA A;  3TSQ A;  1JLQ A;  1VSI A;  1X3N A;  2WBN A;  4LSL A;  4CD1 A;  1VQ7 N;  3CCJ N;  3CC4 N;  4LFA K;  2YHY A;  4IDK A;  4LSN A;  4CBX A;  3L4Q A;  1ZXO A;  3G4S N;  3HK2 A;  3TTC A;  3P31 A;  3OS1 A;  3G71 N;  3CFP A;  1RBT A;  2HVH A;  4B1V A;  3CM6 A;  3M8P A;  5AQT A;  4DV2 K;  3KTQ A;  4WCE L;  4OKE A;  3HXM A;  3LAL A;  3VMF B;  2PYL A;  3O4Q A;  4GY2 B;  2QWQ A;  3OTO K;  4DTU A;  4H5T A;  2D0O A;  5M1Q A;  4QS8 A;  4BE0 A;  4JS4 A;  3ID6 A;  3KLI A;  2IC3 A;  4JRP A;  4C1N I;  1IG8 A;  3CMA N;  4CJU A;  2OPP A;  4J2D A;  3BF3 A;  4CFA A;  3L3V A;  4MLE A;  3WXJ A;  3KZB A;  3C6T A;  3DRS A;  1RBS A;  4MLH A;  1ASW A;  1KVB A;  4KHW A;  3MN6 A;  1FKP A;  4GV6 A;  3ENO A;  3SQ2 A;  2HHQ A;  5DM6 L;  1VSL A;  4HUG A;  2QTD A;  1OH6 A;  3AVC A;  4BDP A;  2KKZ A;  3EE8 A;  1SZ2 A;  3K57 A;  4WQ4 A;  2H3G X;  4CGH A;  3KK3 A;  3NGI A;  3OYE A;  3TAQ A;  2NRH A;  3CJ9 A;  2HHH K;  4W5O A;  1T44 A;  1IBL K;  3VA0 A;  2O8E A;  2E88 A;  2E2O A;  4H5R A;  3ZSR A;  2VG6 A;  4B3T K;  2FBX A;  4CI6 A;  4BC3 A;  2F8T A;  1FK9 A;  3QER A;  2VQE K;  1KXP A;  1RDW X;  4Z94 A;  3F9M A;  4M3Y A;  1GLB G;  1T03 A;  4M7Y A;  3VQ5 A;  3J80 O;  1RBR A;  5BRD A;  2P9L B;  1JLE A;  1U2V A;  4DV0 K;  2HNY A;  4FM2 A;  2FBT A;  4CHZ A;  3SPZ A;  1WSJ A;  3AO1 A;  1WUA A;  4AQY K;  5HP1 A;  4F4K A;  5FPM A;  2BAN A;  1WNS A;  4WFA L;  3OW2 M;  5J2P A;  1S1W A;  4ZTJ A;  3KK1 A;  3E9L A;  2FBY A;  2FSK A;  4CFD A;  4Z4C A;  2RPI A;  4I2P A;  2E5L K;  2HF4 A;  4KHY A;  4EHU A;  2NRT A;  4J2B A;  5M1O A;  4GKJ K;  1NU0 A;  4OGC A;  2E2P A;  2HHT A;  1TKX A;  3T1Y K;  1HKB A;  2ZGZ A;  3SAH A;  2VWJ A;  2WTU A;  1I94 K;  1XC3 A;  2Q2R A;  4K0K K;  3V81 A;  1QQN A;  3R1X A;  4CVN E;  1X9M A;  1W2B M;  5CZ1 A;  3ISN C;  2ZWH A;  4RTF D;  4FJ9 A;  4DSI A;  4H4M A;  3SK3 A;  4U67 L;  3K5M A;  4K41 A;  4BRO A;  3PSI A;  2ZF5 O;  3EKS A;  1OH8 A;  3EE9 A;  1NMN A;  1SAZ A;  4JKD A;  1ATR A;  3CYM A;  4HWI A;  4YDU A;  3QBX A;  4HUF A;  3O80 A;  4NCA A;  4OO1 J;  2UUB K;  4FJG A;  4DV6 K;  3VEV A;  4Z0U A;  4H0X B;  4XIU A;  3PX4 A;  2X6S A;  3LDP A;  1K8K A;  4F2S A;  2OZS A;  2Q31 A;  4X64 K;  3K59 A;  5JS2 A;  4KH4 A;  4CHO A;  4CIE A;  3T3F A;  5AQX A;  4XH4 A;  5CZ2 A;  1NGB A;  4PL8 A;  2OA8 A;  5C2D A;  1JKH A;  1CZA N;  3SAG A;  3LL3 A;  3HO1 A;  3V9U A;  2G8W A;  4CF9 A;  1HUX A;  3WEE B;  3OYI A;  3U3G A;  3NH0 A;  3IAY A;  1YI2 N;  4CGJ A;  5HBM A;  3PIP L;  2NRV A;  1S1V A;  4PKG A;  3HVR A;  4IJA A;  3M3Z A;  4PHT X;  1QZ5 A;  4ILJ A;  2B5J A;  4GMJ B;  4CFB A;  2P9U A;  4M3X A;  4I2Q A;  3THX B;  4NB4 A;  3WQT A;  4FJK A;  3U9Z A;  2IIR A;  4M3T A;  4M41 A;  5C15 A;  3LDQ A;  1XI1 A;  5AJ3 K;  1JLF A;  1SV5 A;  4OPA A;  4C1N K;  3VEW A;  2OPR A;  2VQF K;  5AFU A;  3AVA A;  1S6P A;  4CFC A;  3LDN A;  4K8Z A;  1M90 O;  1Z26 A;  2JWK A;  3SV4 A;  2RKI A;  3QB0 A;  1IH7 A;  4GVM A;  1NK0 A;  4BRF A;  5DK5 A;  4CF2 A;  3E9P A;  3AGR A;  3AAR A;  1DKG D;  4FWL A;  1KVA A;  4CEC A;  4DFK A;  3NMU A;  4KHP K;  5KPT A;  2UUC K;  4NYN A;  4W5T A;  1W7A A;  5BPL A;  4BR7 A;  3AVG A;  4OPJ A;  4OGE A;  4PUO A;  4YY3 K;  2X74 A;  5AR0 A;  2F9T A;  3SAF A;  4W5N A;  2VYP A;  4DTN A;  3NDK A;  2ZGY A;  1UA1 A;  1U47 A;  1HNZ K;  3DLL L;  3RSE A;  1Z05 A;  2QK9 A;  1B92 A;  1G99 A;  3OYK A;  2ETJ A;  2QI2 A;  4JD2 B;  1SQK A;  4JKB A;  1VSK A;  3ASM A;  5AQJ A;  1W97 L;  4O0I A;  4DU1 A;  2RF2 A;  4BY9 C;  3O9T A;  3UKR A;  2HOE A;  1RT3 A;  1N6Q A;  3T69 A;  3VF6 A;  2YHX A;  1YJ9 N;  4JKE A;  3MDQ A;  4FWR A;  1RT1 A;  3TAP A;  1NOZ A;  3E9O A;  3SNN A;  3OS2 A;  3DXM B;  1IO2 A;  4EZ9 A;  1RDC A;  2OYQ A;  5KQ8 A;  2Z1J A;  3SUQ A;  1RGI A;  4JI4 K;  5ELZ A;  1BI4 A;  1RIL A;  4CZE A;  5AQU A;  3BZC A;  1IJJ A;  1HYV A;  3VEZ A;  3RMA A;  1N36 K;  2OZM A;  2NRX A;  1Q9X A;  3ZSO A;  5FPD A;  4CJQ A;  3MAQ A;  4FWQ A;  2XY5 A;  3HI0 A;  1HNW K;  1WSF A;  4DTS A;  2NLX A;  3AVL A;  4J2A A;  1Q82 O;  4RG8 A;  3VA3 A;  5BPN A;  5AQL A;  4B3O A;  3DAW A;  3HOS A;  5AQH A;  3GDQ A;  1TAQ A;  5BPM A;  1JLG A;  1XHZ A;  3MCP A;  3ULE A;  3IS9 A;  5LY3 A;  4KI6 A;  3NFA A;  4M3Z A;  3VQE A;  2IVO A;  4CK2 A;  4BC4 A;  5AQQ A;  4OLA A;  1T3V A;  4BRK A;  1ATS A;  3K5L A;  4CJF A;  3HBT A;  2KZZ A;  3DI6 A;  1GLC G;  1S9E A;  3O4W A;  4DG1 A;  2O8F B;  4MQ3 A;  3VGK A;  3THV A;  4C8K A;  3D45 A;  2X6N A;  4K43 A;  5I9E B;  2GUP A;  4HHT A;  3ZYY X;  2KHO A;  5AFU H;  4Z4I A;  3BZK A;  4TSX A;  1IKW A;  1HNV A;  3FGU A;  4E89 A;  3VN5 A;  1RDD A;  2FSN A;  3QIN A;  1ZBU A;  4E7H A;  3T1H K;  2E1Z A;  4B9M A;  3G10 A;  3ZX2 A;  3LAM A;  5E26 A;  3V1R A;  3NHG A;  3ATV A;  1HKC A;  3QNN A;  3E01 A;  4A2B A;  1BDG A;  4BQL A;  3TAR A;  4BDZ A;  4NCG A;  1TKD A;  4O5F A;  5LJW A;  3VQP A;  1BO5 O;  3OS0 A;  2P9P B;  1VSM A;  4CJR A;  4M7X A;  1U49 A;  5FPN A;  1NMD A;  3PX0 A;  1VQO N;  3DWL A;  1VQ9 N;  4FJH A;  3H3O B;  1BA0 A;  1HKG A;  2WC9 A;  3HVT A;  3O5B A;  4NXN K;  1J53 A;  1FXX A;  4IG0 A;  1T05 A;  4BR4 A;  4ICL A;  4IG3 A;  4RW6 A;  3SUO A;  1JCF A;  1YTU A;  5ADX H;  1VQ4 N;  5SWM A;  3OYH A;  4KTZ A;  4Z4G A;  1TK8 A;  4M63 C;  3NF6 A;  1BIZ A;  1WSH A;  3PIO L;  4M3U A;  3VPZ A;  4RW7 A;  4KO0 A;  4B8C A;  4NYF A;  1C6V A;  3J7Y P;  3HP9 A;  4A2A A;  4DCH A;  3WNF A;  2Z1I A;  4XH5 A;  1QQC A;  4AM6 A;  2ZQB A;  4O8U A;  2D0P A;  1QTM A;  1KC8 O;  3VQ8 A;  1NJW A;  3OBY A;  4KRE A;  3MXM A;  1BG3 A;  2JGU A;  3GG4 A;  3OHR A;  2NZT A;  4WQ4 C;  2I7N A;  2HMI A;  1JLC A;  3HZ6 A;  3I0R A;  2VG7 A;  4WF9 L;  4DQI A;  5IT9 O;  1BWF O;  1HQU A;  1IBK K;  2X78 A;  1QHT A;  2VG5 A;  3THY A;  5EVZ A;  4L8R B;  4CGD A;  1NGG A;  1L3S A;  5FRN A;  5C42 A;  2Q3S A;  1VQ5 N;  2KZM A;  3H08 A;  1DEJ A;  1C1B A;  3HPH A;  5HRO A;  1KRP A;  1QSY A;  1QVF M;  1RNH A;  2D0B A;  4JS5 A;  5CE3 A;  3CQ8 A;  1KTQ A;  2O8D A;  3SMP A;  2YNH A;  1MWM A;  4KTW A;  1TKZ A;  4OVL A;  3C7N B;  4ID1 A;  2HHU A;  3SUP A;  1ZYQ A;  1IKX A;  3VOV A;  1VQ6 N;  2NNW A;  5AQO A;  5M1P A;  4DS5 A;  4FW2 A;  2QWN A;  3HTV A;  3BGR A;  1TAU A;  4H5W A;  5IWA K;  4YFU A;  4DSF A;  3PSF A;  4BQZ A;  3DRR A;  1K73 O;  1U45 A;  2QKK A;  3I8B A;  5FRM A;  1L3V A;  3C6U A;  3WT0 A;  3G6E N;  2G8I A;  3LAN A;  1YVU A;  3CCM N;  5AQK A;  4JK9 A;  4DHY A;  3HPG A;  3L2V A;  5J1E A;  5AQP A;  3VQC A;  3D0P A;  2V51 B;  1W0H A;  4GNI A;  3GL1 A;  3LZI A;  3QBW A;  3DOK A;  1GLL O;  5EY4 A;  2GWJ A;  4YDU C;  1LV5 A;  3KWG A;  4OLB A;  4CE9 A;  1RT5 A;  2JWL A;  3DLR A;  3SV3 A;  1YIJ N;  4Z4E A;  5H1S Q;  4CGI A;  3K0S A;  4CBW A;  4JLH A;  1ASV A;  4HCC A;  4LC9 B;  1ILY A;  3RR7 A;  2BUP A;  5AZI A;  3MN5 A;  4AHS A;  4Q5V A;  1GOC A;  2HND A;  4O44 A;  3KKS A;  1WN7 A;  5F0X A;  4G9Z A;  4DV5 K;  4JKC A;  3KHY A;  3ZET B;  2ZD1 A;  4PL7 A;  5CHI A;  2G8H A;  1C0M A;  3MN7 A;  4IZ9 A;  3UB5 A;  1NKB A;  1Q7Y O;  1ZBL A;  4PQU A;  3VEN A;  3KJV A;  4B1U B;  3MEG A;  3AVF A;  4CF0 A;  3O4N A;  4FPA A;  4AHV A;  1KAY A;  3AO2 A;  3QIO A;  1VSF A;  3CJB A;  2HHW A;  1LWE A;  2J4R A;  2A3Z A;  3S41 A;  1EWR A;  3F5T A;  4JKG A;  4FOE A;  4BR0 A;  4IEE A;  3LDO A;  3F9K A;  1TUU A;  3KLG A;  3J7Z O;  3LDL A;  3M5R A;  3QLH A;  4CW7 B;  3ZSV A;  4DTX A;  1Y97 A;  4NLC A;  3KLF A;  1WSG A;  4IJN A;  3VF2 A;  3K9K A;  4IFV A;  1ASU A;  1CXU A;  3CF5 L;  1GLJ O;  4YNQ A;  4DTM A;  3KD5 E;  2P9N B;  4JKA A;  1RTH A;  4H0T B;  4FJ8 A;  3RMC A;  2E4L A;  4CZL A;  3VQ6 A;  2D4W A;  1NG9 A;  4Q0B A;  4N56 A;  1D4X A;  4DU3 A;  5FPE A;  2GBZ A;  2OAN A;  3QFU A;  3RMD A;  4C8M A;  3HL8 A;  3AGK A;  3AAQ A;  1LW2 A;  3J8A A;  1RTJ A;  5BR9 A;  4X66 K;  3J7A P;  5LJV A;  1RDU A;  3JS6 A;  4E7L A;  2P9K A;  2P1J A;  3K58 A;  1HYZ A;  1RDB A;  3SLC A;  5HRS A;  3TAB A;  1ZBH A;  4B9N A;  1WSI A;  2F7T A;  4GV3 A;  2RE2 A;  1V4T A;  3S9H A;  2DY4 A;  3QEP A;  2FXU A;  3W3D A;  4KH5 A;  4LY7 A;  1J6Z A;  2Y1I A;  1D9F A;  4Y1C A;  3EL2 A;  3AVN A;  1EKE A;  3MEE A;  4CHN A;  4O4G A;  4A5B A;  4IEI A;  2VCP A;  3CER A;  2YCH A;  3HYF A;  4CHY A;  5CR4 A;  1J54 A;  2UXD K;  1VK0 A;  3DYA A;  5KGW A;  3OYL A;  4KHS A;  4GKK K;  1NGI A;  4BRQ A;  3QEW A;  4FK4 A;  4DLE A;  3PO4 A;  2F9W A;  1RTI A;  4RWT A;  3CPW M;  1G15 A;  2WUS A;  4DFM A;  1DGK N;  4KB1 A;  2YNF A;  4AHC A;  3CXC M;  4JI6 K;  5FRO A;  2ZJP L;  3ULD A;  1GLD G;  1I3A A;  2IDO A;  3CG7 A;  1N5Y A;  4IBN A;  3MWP A;  4DQQ A;  3NE6 A;  2P51 A;  1CLQ A;  1R0A A;  1TUY A;  4CJ4 A;  1NK5 A;  1TGO A;  2ASO A;  2B6A A;  4HCB A;  4EAH D;  1VHX A;  4AH9 A;  5B8H A;  3VER A;  1VQM N;  1RBV A;  3QML A;  4H0O A;  4ELT A;  4DLG A;  4IFE A;  3TAM A;  4FLU A;  1YJN N;  2W6L A;  3DXK B;  5BR8 K;  5C25 A;  3H3N O;  3ZX3 A;  4B08 A;  4IXC A;  4H5N A;  1JJ2 M;  4FK0 A;  1J5E K;  1DTQ A;  4BRN A;  5KTQ A;  3CFO A;  3R9P A;  5GIO A;  1ZBS A;  5T7B A;  5HRN A;  4JRQ A;  2QWP A;  4CGF A;  4AIL C;  3KWI A;  1JL2 A;  5AQF A;  1LWC A;  2VGM A;  4CJV A;  4H8K A;  3L2Q A;  2QKB A;  3RSE B;  1N33 K;  1C1C A;  1NJI O;  3K5O A;  2HHX A;  3JSM A;  1S22 A;  3FZF A;  1FJG K;  2NRW A;  3G0Z A;  1KFD A;  4E1J A;  4N5S A;  4NLB A;  1EX4 A;  3AO4 A;  4JKF A;  3EO3 A;  1HPM A;  1IV0 A;  3WNE A;  1MDU B;  1KLM A;  1XMQ K;  2QXL A;  4CZJ A;  2O8B B;  4X62 K;  4WFB L;  2XY6 A;  4IO8 A;  5JLH A;  4DSJ A;  4E19 A;  5J2Q A;  3DOL A;  4CJ3 A;  4CBU A;  3BEX A;  3TTF A;  1HNI A;  2Q0R A;  1BI4 B;  4FJX A;  4YOV A;  3O08 A;  3UKU B;  3CJA A;  3NGY A;  4QS9 A;  2XY7 A;  2GV9 A;  2P9L A;  2YHB A;  2IGI A;  1QQM A;  5KI6 A;  3OYN A;  4B1X B;  4QOZ B;  1SS6 A;  5BN9 A;  5JS1 A;  3NCI A;  2HNZ A;  4YOR A;  2FC0 A;  4DTJ A;  5FLX O;  3M8S A;  1NGD A;  2BTF A;  2YNI A;  4K42 A;  3LM2 A;  1TL1 A;  4WFN L;  4CIG A;  3R6M A;  1ZBF A;  4EP4 A;  4HVJ A;  3J81 O;  1S5J A;  4CK1 A;  4BVP A;  1KCF A;  2O8C B;  2QWM A;  3FZK A;  4F3T A;  4JI3 K;  2ZM6 K;  5LL6 Z;  4FYD A;  1BHL A;  1A5X A;  3VTH A;  3MEC A;  4GW6 A;  4B9T A;  5K14 A;  3FLC O;  3TWH A;  5A2Q O;  2G8F A;  5D3G A;  2QM1 A;  3AA4 A;  4EHT A;  3CJ1 A;  2GEL A;  3RTV A;  4FM0 A;  2PYJ A;  4FJ5 A;  4YOX A;  3SPY A;  2RHK A;  2KQ2 A;  2FF6 A;  2HBK A;  2Q1N A;  3SYZ A;  4ISE A;  1NLV A;  2EHG A;  1W9H A;  1B9D A;  4PWD A;  2D0A A;  3LDS A;  1XUP O;  2PZS A;  1X3M A;  3B8A X;  1CZB A;  2OTJ N;  3V1Q A;  2QWL A;  1NWK A;  3NVM A;  1WOQ A;  2O4G A;  3O8M A;  4H5V A;  4CZG A;  4FJL A;  3G25 A;  3V9S A;  5C2F A;  3TR8 A;  2KFN A;  3SMS A;  5AZJ B;  1L3U A;  4B1W B;  2AJQ A;  1GOB A;  2YHW A;  3NAE A;  3QIP A;  2E6M A;  3ZEU B;  4DR7 K;  3WEE A;  3WUH A;  4LF7 K;  1JLB A;  1L5U A;  3A0I X;  2GWK A;  2IVN A;  3TSU A;  3OBW A;  5BRH A;  5KRS A;  3IFR A;  3CIP A;  3M6G A;  4DSE A;  3THX A;  2KW4 A;  2DPN A;  4KKO A;  4FL9 A;  3P83 D;  1C0U A;  4YOY A;  1X9W A;  3EN9 A;  4CZF A;  3OYJ A;  1RT4 A;  4BRP A;  3NBP A;  1EO1 A;  1JXE A;  2BH1 A;  3LP1 A;  3EZW A;  1VRU A;  3OYA A;  3TTD A;  3C65 A;  3THW B;  3CM5 A;  3AVB A;  2QXF A;  3SZ2 A;  4BRC A;  1FW6 A;  2E20 A;  4FSV A;  1RTD A;  3O3F A;  3ATU A;  4CJT A;  3M1F A;  2F96 A;  2EWS A;  4EIA A;  4Z4F A;  3FE1 A;  3L2U A;  1QQO A;  3VEO A;  4HTL A;  1KLN A;  1H1V A;  2D1K A;  4JAX A;  1BU6 O;  3I55 N;  1YTA A;  4CGG A;  2R7Y A;  2KLA A;  2WON A;  1DLO A;  3E66 A;  4E7K A;  2FLO A;  3MN9 A;  4N41 A;  5C10 A;  3ZT4 A;  2A5X A;  1ITG A;  3A5L C;  5KPZ A;  4JV5 K;  4W5Q A;  1WSE A;  1VSE A;  4I6M A;  3THY B;  4B9S A;  4FWS A;  5EX5 A;  1LCU A;  1VSH A;  4DR3 K;  4ILH A;  3TAG A;  4DTO A;  2A1R A;  1K9M O;  4QCL A;  2P9S B;  3HSC A;  1T6D A;  4A5A A;  3MXI A;  1EWQ A;  4ZTF A;  1T8E A;  2Q36 A;  1HX1 A;  1LW0 A;  5GIP A;  3NF9 A;  4JI0 K;  3I8D A;  3D7E O;  3VES A;  4LD0 A;  5HL7 L;  2NRR A;  4DB3 A;  3AVH A;  3DXM A;  4M3W A;  1N32 K;  3EEQ A;  2IVP A;  1BL3 A;  1RT6 A;  2BE2 A;  4E1M A;  1ZBI A;  3A5O C;  3U6F A;  1TL3 A;  4LF6 K;  1ATN A;  2ITM A;  3DLB A;  2OPS A;  2AA4 A;  3ENH A;  3LP0 A;  3A5M C;  3HT3 A;  2IS3 A;  3RRH A;  1S1U A;  3O6W A;  1TYQ B;  3CCU N;  2A40 A;  4CJP A;  3CCS N;  4LF5 K;  3L6Q A;  3VQ7 A;  3IG1 A;  4O8K A;  2HVI A;  4OX9 K;  1CXQ A;  3TU5 A;  1YVN A;  2RN2 A;  3IKM A;  3BUZ B;  5MLC Q;  3LZJ A;  3N4P A;  4GV9 A;  4UY8 O;  1XHX A;  1YT3 A;  3TI0 A;  1UA0 A;  3ZSZ A;  4DV3 K;  4CEO A;  4DQR A;  3D2F B;  4FWO A;  3QEI A;  2A42 A;  4B3S K;  1TVR A;  3CFR A;  1S1X A;  4CD3 A;  3QDK A;  4KPY A;  1UOC A;  1IG9 A;  2ZE2 A;  4I9L A;  3W0L A;  1KAX A;  4CJ7 A;  2P5G A;  4FW1 A;  1Q9Y A;  2O8F A;  4CEF A;  1Q8I A;  3QFP A;  4FJ7 A;  4BRM A;  2PBD A;  4AHT A;  5AQG A;  1YUW A;  4DUZ K;  3SBG A;  2F8S A;  3QIC A;  4B9V A;  4JI8 K;  4N47 A;  3VET A;  3KLH A;  4ELV A;  3ZX0 A;  5AQM A;  3BDP A;  3ZT2 A;  3OYC A;  2B4J A;  2OTL N;  2PY5 A;  5AQR A;  1F21 A;  1LAW A;  3K5N A;  5KQD A;  4H0V B;  1VQP N;  1NGA A;  3AA3 A;  3PLA A;  1XQS C;  4FJM A;  2HMP A;  3KVG A;  3O9U A;  4FLV A;  2AP1 A;  4QS7 A;  3HP6 A;  4JYA K;  2P9P A;  3FZM A;  4RW8 A;  3D2E A;  3VQD A;  2XO7 A;  4LFC K;  4XEI A;  4FWM A;  3ZSW A;  4FOI A;  3QEV A;  1NK4 A;  5C12 A;  3OYM A;  4K8X A;  3CI5 A;  1XNR K;  1KAZ A;  3PV8 A;  1T7P A;  3T19 A;  4YHH K;  4I9Q A;  3OYB A;  1Q18 A;  4K25 A;  3OJU A;  1DTT A;  1HPZ A;  3RMB A;  3A5N C;  2DTU A;  1HLU A;  2PAV A;  3H46 O;  4FWK A;  3SQ0 A;  1NK7 A;  4WQ5 A;  2CGJ A;  2YX6 A;  5GAH P;  1J9A A;  4E3S A;  4CZM A;  3A8Y A;  1LOT B;  1BUP A;  3SJH A;  1FKO A;  2Q0U A;  3C95 A;  4E7I A;  1XC9 A;  1NK9 A;  2O8E B;  1OH5 A;  4XH1 A;  3MWT A;  4FLY A;  3V9Z A;  3C6H A;  4DTP A;  1HJR A;  4CJE A;  4JK7 A;  3PUF A;  4AF1 A;  1HQE A;  4ZHR A;  2QWO A;  3AA5 X;  4LH5 A;  4ELU A;  1U2V B;  4B8A B;  2UUA K;  2FBV A;  3V9W A;  4MFB A;  3S3M A;  2A6A A;  5JIC A;  2IOC A;  3PO5 A;  4OPK A;  1C0G A;  4H0Y B;  1NGE A;  2ASM A;  3KK7 A;  2HF3 A;  2EX3 A;  2ITG A;  4DF4 A;  1RDA A;  1VAZ A;  3DMJ A;  3QEX A;  3MED A;  4JHD A;  2I5J A;  4L3Q A;  4BG8 A;  4CJ5 A;  4JKH A;  4H0P A;  4CED A;  2UYT A;  3QNO A;  1XNQ K;  3C94 A;  1VQK N;  3DRP A;  4FO0 A;  4A59 A;  4R5P A;  4IOA L;  1BQM A;  2GX9 A;  1WAF A;  3K9J A;  4RCH A;  1IBM K;  4PKI A;  4OPH A;  4DR5 K;  3V4I A;  4JI7 K;  3WNH A;  1D9D A;  1E4F T;  4B9L A;  3C7N A;  3BP8 A;  1KQS M;  3OYG A;  4FLW A;  2VWK A;  2V52 B;  1U6Z A;  3KIO A;  3AVM A;  3LAK A;  3OJS A;  3AO5 A;  4KHQ A;  4KHN A;  1U48 A;  2D0C A;  3EYZ A;  3LM9 A;  3P5J A;  3FFI A;  4FLZ A;  1SKR A;  3LP2 A;  2Y1J A;  4F3O A;  4NCB A;  3RRG A;  3NH1 A;  4BGA A;  4FK2 A;  3SQ4 A;  4KFB A;  4OJR A;  2HBM A;  2CGK A;  4FXD A;  2P9I A;  3BF1 A;  4BRD A;  3VTI A;  2XHB A;  1NJY A;  3T1A A;  1K8K B;  2G8U A;  3AA2 A;  3UE5 A;  1I39 A;  4CZK A;  2ZJR L;  3RWU A;  4RW9 A;  4MO4 A;  4BC5 A;  1OVY A;  2YHA A;  3VQ4 A;  4AM7 A;  3L8B A;  1D8Y A;  1J5O A;  2VWB A;  3HM9 A;  4W5R A;  4YOT A;  1TKT A;  1QZ6 A;  5KGX A;  3NF7 A;  4U7B A;  1HJO A;  4ILG B;  3VQA A;  3LWM A;  4OKK A;  2IAJ A;  3VGL A;  1N8R O;  1BCO A;  2YI1 A;  3F2K A;  1C0F A;  2QWR A;  5M1K A;  3ITH A;  4FVU A;  5KRT A;  3I33 A;  2O4I A; 
#chains in the Genus database with same CATH homology
 4F3T A;  4B9M A;  4BDY A;  1VSD A;  3G10 A;  1X9S A;  3A2F A;  2G8K A;  1REV A;  2HB5 A;  4HTU A;  4FYD A;  1Z25 A;  3LAM A;  1BHL A;  3V1R A;  2JLE A;  1A5X A;  3ZT0 A;  3NHG A;  3V6D A;  1NJZ A;  3QNN A;  3MEC A;  1RT7 A;  3E01 A;  1SUQ A;  4GW6 A;  5K14 A;  4B9T A;  3SCX A;  3TWH A;  3OY9 A;  4KB0 A;  3SUN A;  1RCH A;  3TAR A;  5CY4 A;  2BGG A;  4BDZ A;  4NCG A;  1TKD A;  4ID5 A;  2G8F A;  5D3G A;  4DWI A;  1JXB A;  3AA4 A;  3VQP A;  3PX6 A;  2G8V A;  4CEA A;  2Z1G A;  1EXQ A;  3OS0 A;  2YV0 X;  4FM1 A;  2HHS A;  1VSM A;  3ZSX A;  4CJR A;  1U49 A;  3RTV A;  3PX0 A;  4FM0 A;  2PYJ A;  1EET A;  4FJ5 A;  3F73 A;  4M3R A;  4CCH A;  4FJH A;  3SPY A;  3EY1 A;  2KQ2 A;  3SYZ A;  1QS4 A;  3NH2 A;  5CYQ A;  4UQG A;  2EHG A;  3HVT A;  4FVM A;  1HRH A;  1B9D A;  1W9H A;  2D0A A;  1L3T A;  4PWD A;  1J53 A;  1FXX A;  4IG0 A;  3LPT A;  3M8Q A;  3L2R A;  3NGZ A;  3LDS A;  1SL1 A;  4ICL A;  4IG3 A;  4RW6 A;  3SUO A;  5DMR A;  1T05 A;  2NUB A;  2DFH A;  1YTU A;  1KVC A;  3KK2 A;  4DQP A;  4F2R A;  1CZB A;  3V1Q A;  5SWM A;  3OYH A;  3TAN A;  4KTZ A;  4Z4G A;  4FZZ A;  2O4G A;  1TK8 A;  4CF1 A;  3NF6 A;  1BIZ A;  4BE1 A;  1WSH A;  3O3H A;  5J2M A;  3V9S A;  4FJL A;  1C0T A;  3L2W A;  5FDL A;  3TR8 A;  4F8R A;  4RW7 A;  4KO0 A;  4B8C A;  4NYF A;  4M3U A;  1C6V A;  2KFN A;  2XRI A;  3HP9 A;  1L3U A;  3WNF A;  1JLQ A;  1GOB A;  2Z1I A;  4E7J A;  3NAE A;  2AJQ A;  1VSI A;  3QIP A;  4LSL A;  4C8N A;  2E6M A;  4BAC A;  3ZCM A;  3TAE A;  1JLB A;  4IDK A;  4LSN A;  1L5U A;  1NOY A;  4N76 A;  1QQC A;  3HK2 A;  2ZQB A;  1QTM A;  4FZY A;  3OS1 A;  4FLT A;  4M45 A;  3VQ8 A;  3CFP A;  4HUE A;  3QO9 A;  1RBT A;  1NJW A;  2HVH A;  4KRE A;  3CM6 A;  3M8P A;  3MXM A;  3KTQ A;  5KRS A;  2JGU A;  4OKE A;  4DSE A;  1U04 A;  3HXM A;  3LAL A;  2KW4 A;  3KLE A;  4KKO A;  3P83 D;  1C0U A;  2PYL A;  3O4Q A;  2HMI A;  1X9W A;  4DTU A;  3OYJ A;  1RT4 A;  5E41 A;  3NBP A;  1JXE A;  3LP1 A;  4BE0 A;  1JLC A;  1BGX T;  4JS4 A;  3KLI A;  3I0R A;  2IC3 A;  2VG7 A;  4JRP A;  4DQI A;  1HQU A;  1VRU A;  2X78 A;  3OYA A;  1K6Y A;  1QHT A;  2VG5 A;  3DLE A;  4CJU A;  2OPP A;  4J2D A;  4L8R B;  4CGD A;  4FJJ A;  3ZT1 A;  4CFA A;  1L3S A;  3CM5 A;  3AVB A;  2QXF A;  3SZ2 A;  4CJL A;  5C42 A;  5FRN A;  2Q3S A;  2KZM A;  3H08 A;  3L3V A;  1C1B A;  1RTD A;  3HPH A;  5HRO A;  3O3F A;  1KRP A;  3C6T A;  3M8R A;  1QSY A;  2YKM A;  4CJT A;  3DRS A;  1RBS A;  1RNH A;  4KHU A;  2D0B A;  1ASW A;  1KVB A;  4KHW A;  4JS5 A;  2F96 A;  4Z4F A;  3AVK A;  3CQ8 A;  1KTQ A;  3L2U A;  1FKP A;  4O55 A;  3SQ2 A;  2HHQ A;  1VSL A;  2YNH A;  4KTW A;  4OVL A;  1TKZ A;  1KLN A;  4KI4 A;  4HUG A;  4ID1 A;  2HHU A;  3SUP A;  1ZYQ A;  1IKX A;  4FJI A;  1YTA A;  2LSN A;  4CGG A;  2R7Y A;  4DS5 A;  3AVC A;  4FW2 A;  4BDP A;  2WON A;  1DLO A;  4OKJ A;  4KTQ A;  3BGR A;  1TAU A;  3K57 A;  4E7K A;  4N41 A;  4YFU A;  4DSF A;  4CHQ A;  3O3G A;  4CGH A;  3DRR A;  5CYM A;  3KK3 A;  3OYE A;  3NGI A;  3ZT4 A;  3QET A;  3TAQ A;  1U45 A;  1ITG A;  2QKK A;  4W5O A;  5FRM A;  3K2P A;  3VA0 A;  3ZSY A;  1L3V A;  3ZSR A;  1KFS A;  2VG6 A;  3C6U A;  4DTR A;  2G8I A;  2FBX A;  4W5Q A;  3LAN A;  1YVU A;  1WSE A;  2F8T A;  1VSE A;  4RW4 A;  3HPG A;  1FK9 A;  4B9S A;  3AO3 A;  1VSH A;  3QER A;  3WNG A;  3TAG A;  2A1R A;  4DTO A;  4QCL A;  3L2V A;  4M3Y A;  5J1E A;  3VQC A;  1T03 A;  3D0P A;  1RT2 A;  4KV8 A;  3VQ5 A;  1RBR A;  1W0H A;  1JLE A;  1TK0 A;  4O0J A;  4I7F A;  2HNY A;  4IFY A;  4FM2 A;  2FBT A;  3MXI A;  1UAX A;  3LP3 A;  4ZTF A;  4CHZ A;  1T8E A;  3LZI A;  3SPZ A;  3DOK A;  4CJS A;  1LW0 A;  1WSJ A;  4CJK A;  4J2E A;  3AO1 A;  3NF9 A;  4CF8 A;  5HP1 A;  4F4K A;  4LH4 A;  3I8D A;  1LV5 A;  2BAN A;  4LD0 A;  1WNS A;  4OLB A;  1WLJ A;  4CE9 A;  5J2P A;  1RT5 A;  1S1W A;  3DLR A;  3SV3 A;  4ZTJ A;  4Z4E A;  3KK1 A;  4CFD A;  2FBY A;  4Z4C A;  2RPI A;  3AVH A;  4I2P A;  5I42 A;  1S6Q A;  4CGI A;  4JLH A;  4QAG A;  1ASV A;  4KHY A;  4M3W A;  4HCC A;  2ATQ A;  3RR7 A;  4J2B A;  1BL3 A;  1RT6 A;  2BE2 A;  4OGC A;  4AHS A;  2HHT A;  4Q5V A;  1GOC A;  2HND A;  4O44 A;  1GOA A;  3VQB A;  1TKX A;  1A5V A;  4E1M A;  4CIF A;  1NK6 A;  1JL1 A;  3U6F A;  3KKS A;  1ZBI A;  1WN7 A;  2VWJ A;  4M42 A;  1TL3 A;  3V81 A;  5C24 A;  3DLB A;  1XWL A;  2OPS A;  2ZD1 A;  1X9M A;  1D5A A;  3LP0 A;  2G8H A;  1C0M A;  3MXJ A;  3HT3 A;  1SKS A;  2IS3 A;  3ISN C;  5CZ1 A;  3P1G A;  3RRH A;  1S1U A;  3DLH A;  1NKB A;  1JLA A;  3ZSQ A;  1SKW A;  4FJ9 A;  1LAV A;  1ZBL A;  4H4M A;  4DSI A;  4BWM A;  4CJP A;  4PQU A;  3K5M A;  3KJV A;  1HMV A;  3VQ7 A;  3IG1 A;  3MEG A;  3AVF A;  1NJX A;  2HVI A;  4CF0 A;  3O4N A;  3L3U A;  4AHV A;  3IRX A;  1CXQ A;  3CYM A;  3AO2 A;  3QIO A;  2RN2 A;  3OYD A;  3VQ9 A;  1BCM A;  1VSF A;  4HUF A;  3LZJ A;  2HHW A;  1LWE A;  4NCA A;  1XHX A;  1YT3 A;  3TI0 A;  4FJG A;  1UA0 A;  3ZSZ A;  4CEO A;  3TAF A;  4DQR A;  3B6P A;  3QEI A;  4Z0U A;  1TVR A;  3JYT A;  4XIU A;  3PX4 A;  2DFE A;  2HW3 A;  3F9K A;  2X6S A;  1S1X A;  3KLG A;  3CFR A;  4F2S A;  2OZS A;  4KPY A;  3QLH A;  1UOC A;  3K59 A;  2ZE2 A;  1IG9 A;  4BE2 A;  4I9L A;  5JS2 A;  2P5G A;  3ZSV A;  4DTX A;  1S9G A;  1Y97 A;  4CHO A;  4FW1 A;  4CIE A;  3KLF A;  3T3F A;  1Q9Y A;  1WSG A;  5CZ2 A;  4CEF A;  1Q8I A;  1TV6 A;  4DQS A;  4IFV A;  4FJ7 A;  1ASU A;  1CXU A;  2OA8 A;  4YNQ A;  3HPO A;  4FLX A;  4DTM A;  3KD5 E;  1JKH A;  4AHT A;  3RR8 A;  3HO1 A;  1RTH A;  4FJ8 A;  3RMC A;  3V9U A;  2G8W A;  2E4L A;  3HST B;  4CF9 A;  5SZT A;  3V9X A;  3VQ6 A;  3OYI A;  3U3G A;  3NH0 A;  3IAY A;  2F8S A;  4PY5 A;  2KTQ A;  4CGJ A;  5HBM A;  1NKE A;  1UWB A;  4B9V A;  4Q0B A;  4N56 A;  3I0S A;  4N47 A;  2KFZ A;  3KLH A;  1S1V A;  4DU3 A;  2GBZ A;  3HVR A;  4DU4 A;  4ELV A;  4KRF A;  3RMD A;  4C8M A;  3HL8 A;  3BDP A;  1LW2 A;  3ZT2 A;  3OYC A;  4CFB A;  2B5J A;  4GMJ B;  2B4J A;  1RTJ A;  4DMN A;  4M3X A;  2PY5 A;  4I2Q A;  1KSP A;  3QES A;  3AV9 A;  1F21 A;  1LAW A;  3K5N A;  4FJK A;  3LWL A;  4E7L A;  1BQN A;  1SL2 A;  3AA3 A;  2P1J A;  3K58 A;  1HYZ A;  4M3T A;  4FJM A;  1RDB A;  3TAB A;  4M41 A;  5HRS A;  1ZBH A;  1S1T A;  1XI1 A;  1WSI A;  1NKC A;  3EZ5 A;  4B9N A;  4DF8 A;  1JLF A;  1RBU A;  1SV5 A;  4FLV A;  4Z4H A;  3S9H A;  3KD1 E;  5J2N A;  2DY4 A;  3QEP A;  3HP6 A;  4LY7 A;  4DSK A;  2Y1I A;  1D9F A;  4Y1C A;  2OPR A;  3AVN A;  4RW8 A;  1EKE A;  3AVA A;  3UIQ A;  1S6P A;  3SI6 A;  4CFC A;  5EU7 A;  3VQD A;  3MEE A;  4CHN A;  2XO7 A;  4O4G A;  3HJF A;  3ZSW A;  3QEV A;  4K8Z A;  4CHY A;  1Z26 A;  3HYF A;  1NK4 A;  1BIU A;  4E1N A;  1QSL A;  3SV4 A;  1J54 A;  1A5W A;  2RKI A;  1VK0 A;  3OYM A;  4K8X A;  3DYA A;  1IH7 A;  4GVM A;  5KGW A;  1NK0 A;  5DK5 A;  3OYL A;  3PV8 A;  3S3O A;  1T7P A;  3T19 A;  4KHS A;  4CF2 A;  3OYB A;  2WOM A;  3QIN A;  1MU2 A;  3OJU A;  3PY8 A;  4I9Q A;  1DTT A;  1HPZ A;  3RMB A;  2GUI A;  3QEW A;  3VQQ A;  4DLE A;  3PO4 A;  4FK4 A;  4EZ6 A;  3U3Y A;  2DTU A;  1KVA A;  4CEC A;  4DFK A;  1RTI A;  1G15 A;  4WE1 A;  4DFM A;  3SQ0 A;  4KB1 A;  2YNF A;  4AHC A;  1NK7 A;  4NYN A;  4W5T A;  1CZ9 A;  1U4B A;  4B9U A;  3AVG A;  5HLF A;  5FRO A;  4OPJ A;  1J9A A;  4OGE A;  4PUO A;  4O5B A;  2X74 A;  4E3S A;  1QSS A;  2YKN A;  3ULD A;  1I3A A;  4W5N A;  2IDO A;  3CG7 A;  4CES A;  2HHV A;  4DTN A;  3NDK A;  1UA1 A;  4AHU A;  1N5Y A;  4IBN A;  1WAJ A;  1FKO A;  1XC9 A;  3C95 A;  4E7I A;  1U47 A;  4DQQ A;  2Z1H A;  2W42 A;  1NK9 A;  4H4O A;  3ALY A;  3NE6 A;  2P51 A;  1CLQ A;  1R0A A;  2QK9 A;  1B92 A;  4FLY A;  3V9Z A;  4CJW A;  4CJ4 A;  1NK5 A;  1TGO A;  4E0D A;  2B6A A;  3OYK A;  4CEZ A;  4HCB A;  4AH9 A;  4DFJ A;  4DTP A;  2ETJ A;  4FJN A;  1HJR A;  4CJE A;  3OYF A;  1VSK A;  2BDP A;  3PUF A;  3ASM A;  4DSL A;  1RBV A;  4O0I A;  1HQE A;  1O1W A;  4DU1 A;  4ZHR A;  4ELT A;  3AA5 X;  4ELU A;  4LH5 A;  4DLG A;  3TAM A;  4FLU A;  4B8A B;  2RF2 A;  2FBV A;  3V9W A;  2D5R A;  1IKY A;  4MFB A;  4PA1 A;  5C25 A;  1RT3 A;  3S3M A;  1N6Q A;  2IOC A;  3PO5 A;  4OPK A;  4CHP A;  1TK5 A;  4B08 A;  4BWJ A;  3DM2 A;  1QE1 A;  1C1A A;  5HRP A;  4FK0 A;  2EX3 A;  1DTQ A;  2ITG A;  5KTQ A;  3CFO A;  4EP5 A;  4DF4 A;  1RDA A;  3DMJ A;  4E7H A;  2PZS A;  3DLK A;  3QEX A;  2A1S A;  5T7B A;  3MED A;  5HRN A;  1RT1 A;  2I5J A;  4JRQ A;  4CGF A;  3DLG A;  1NOZ A;  4AIL C;  3TAP A;  4CJ5 A;  3OS2 A;  3SNN A;  1IO2 A;  4EZ9 A;  4CED A;  3QNO A;  1RDC A;  2OYQ A;  3C94 A;  1JL2 A;  3DRP A;  2Z1J A;  4CEQ A;  3SUQ A;  1LWC A;  4CJV A;  4R5P A;  1BI4 A;  4H8K A;  1RIL A;  3B6O A;  3L2Q A;  3S3N A;  2QKB A;  3NF8 A;  1BQM A;  1C1C A;  1WAF A;  1LWF A;  3K5O A;  1X1P A;  1HYV A;  3RMA A;  2HHX A;  1SL0 A;  3JSM A;  3V4I A;  2OZM A;  3WNH A;  1Q9X A;  1D9D A;  3SQ1 A;  4B9L A;  3ZSO A;  4CJQ A;  3MAQ A;  4FCY A;  2XY5 A;  3G0Z A;  3AVJ A;  1KFD A;  4N5S A;  1WSF A;  4FZX C;  4DTS A;  4IKF A;  1EX4 A;  3AVL A;  3AO4 A;  3OYG A;  4FLW A;  4J2A A;  2VWK A;  4CEE A;  4RG8 A;  3KIO A;  3VA3 A;  4DS4 A;  3AVM A;  3LAK A;  3WNE A;  3OJS A;  3AO5 A;  4B3O A;  1KLM A;  2OPQ A;  4KHQ A;  1TAQ A;  1U48 A;  4KHN A;  2D0C A;  3EYZ A;  1JLG A;  1BIS A;  2P5O A;  3P5J A;  1XHZ A;  1VRT A;  3FFI A;  2XY6 A;  1B9F A;  4FLZ A;  1SKR A;  3LP2 A;  3IS9 A;  4KI6 A;  4KAZ A;  3LPU A;  3NFA A;  4DSJ A;  4M3Z A;  1EP4 A;  4C8O A;  2Y1J A;  4F3O A;  4NCB A;  3RRG A;  3NH1 A;  4E19 A;  3VQE A;  5J2Q A;  4FK2 A;  3DOL A;  4CJ3 A;  3SQ4 A;  4KFB A;  4OJR A;  1HNI A;  4AHR A;  4FXD A;  4G1Q A;  1BI4 B;  4CK2 A;  1NJY A;  2XHB A;  4FJX A;  3NGY A;  3T1A A;  4CK3 A;  2GV9 A;  2XY7 A;  3AA2 A;  2G8U A;  4OLA A;  3K5L A;  1I39 A;  4CJF A;  2YNG A;  3RWU A;  2YHB A;  3DI6 A;  4RW9 A;  3V1O A;  1S9E A;  4CEB A;  4DG1 A;  2KZZ A;  2IGI A;  5KI6 A;  3OYN A;  1VSJ A;  2YHA A;  3VQ4 A;  4QOZ B;  4MQ3 A;  3L8B A;  3THV A;  1J5O A;  1D8Y A;  4C8K A;  1HYS A;  5JS1 A;  3D45 A;  4CER A;  3NCI A;  2HNZ A;  2X6N A;  3HM9 A;  3AVI A;  2FC0 A;  4DTJ A;  4W5R A;  3M8S A;  1TKT A;  4HHT A;  2DFF A;  3KKR A;  2YNI A;  3OVN A;  5KGX A;  5HRR A;  4Z4I A;  1TL1 A;  1NK8 A;  3NF7 A;  3VQA A;  4CIG A;  3LWM A;  4OKK A;  2IAJ A;  4Y1D A;  1BCO A;  1ZBF A;  2XY8 A;  4C8L A;  4TSX A;  4EP4 A;  4HVJ A;  1IKW A;  3ZT3 A;  1IKV A;  1HNV A;  1S5J A;  3SJJ A;  3ITH A;  4E89 A;  2E6L A;  5I3U A;  5KRT A;  4CK1 A;  1KCF A;  3VN5 A;  1RDD A;  1ZBU A;  4DFP A;  2O4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...