4CJXA

The crystal structure of trypanosoma brucei n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) complexed with nadp cofactor and inhibitor
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
297
structure length
297
Chain Sequence
MPEAVVIDGRAVAKAIQKELTEEVALLERRYKGRRPGLSTIICGKRKDSQTYVRLKRKAAAACGFRNFSVELPANVTQEALEREVIRLNEEEACHSIVVQLPLPPHIDKVAALSKIKPEKDADCLLPVNVGQLHIRERNPAIVPCTASAVMELLRCSGVEICGKRVVVLGRGDIAGLPVATLLANEDATVTVVHSATPLCDIADIVRASDIVVSAAGQPGLVRGEWIKLGAAVIDVGTTPVADPSKVPGYRLVGDVCFDVARKRAAYITPVPGGVGPVTVSMLLKNTLTMFKRSVRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-1-TETRAHYDROFOLATE SYNTHASE, CYTOPLASMIC, PUTATIVE
publication title Characterization of 2,4-Diamino-6-Oxo-1,6-Dihydropyrimidin-5-Yl Ureido Based Inhibitors of Trypanosoma Brucei Fold and Testing for Antiparasitic Activity.
pubmed doi rcsb
source organism Trypanosoma brucei brucei strain 927/4 gutat10.1
molecule tags Oxidoreductase
total genus 104
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature ec 1.5.1.5: Methylenetetrahydrofolate dehydrogenase (NADP(+)).
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00763 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
A PF02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cjxA01
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 4cjxA02
3L0DA 1AHIA 3T7CA 3I23A 1ZBQA 3UKOA 3C8MA 3GFBA 1RWBA 4UVHA 1GEEA 4U6QA 1A9ZA 2O23A 2CF6A 2PZLA 2FR1A 4F6LA 2FY8A 1PTJA 1JVSA 2WYVA 3U4IA 2G76A 3ZWNA 2X9NA 1LDGA 4YYZA 3W8DA 2QYSA 2VNAA 2Q3EA 4CM6A 5TF4A 1P1KA 2FOIA 4GWGA 2E82A 4I5GA 4R16A 1GCUA 2E6UX 4ZJUA 1DFIA 3C1TA 4FGWA 5GY7A 3GY0A 3JQDA 3RBZA 4ESOA 1I0ZA 2EW8A 2JFGA 5IFLA 3INGA 2EEZA 3JD1A 1ENPA 2Q2QA 1F8GA 1WDMA 3VPHA 1P9LA 2Z5LA 4CMKA 2FZWA 3H9GA 5ICMA 1GY8A 5IDYA 1R16A 1WAMA 1YDWA 3RC1A 4OMUA 1WLYA 4B7CA 4EJ6A 4XDYA 1DHRA 3BMCA 5TJ9A 4BIIA 2I99A 4PG6A 3ZWPA 3GQVA 4DTIA 5K6AA 2RCYA 5EESA 1X1TA 5G0VA 1EE9A 2HMSA 4NU6A 2FPPA 4ZVVA 5H81A 3H8VA 5GZ6A 2AXQA 2FPGA 2QRLA 2P4QA 3GRKA 1HZZA 3HDQA 1KVTA 4K6CA 1DC4A 1LRLA 2Y1OA 3DTYA 1GZ3A 4YT4A 3AU8A 5JLAA 5TNXA 3RWBA 4J4TA 4OQYA 3KYCA 3EMKA 1TLTA 3ZHZA 4G2NA 5JY1A 3D4NA 3UVEA 3AM3A 5G2OA 2D59A 3D3WA 3MWDB 4E5KA 3N58A 2DTDA 2HAEA 4BNJA 3I6IA 3KXDA 1T24A 3S2EA 4EBFA 5TS3A 3WJAA 4Q9NA 5I8ZA 2DQ4A 3PEFA 4X54A 1DO8A 1WMBA 1P45A 2UV8A 2BGMA 1MG5A 4G81A 3Q2KA 1P77A 2X7HA 3EW7A 3G1UA 4WE3A 1VL6A 2NM0A 1KEUA 1T4DA 3WGQA 2PY6A 2B4TO 1U3TA 3IC5A 1RM3A 4IXWA 3TN7A 1CRWG 1G1AA 1M75A 3UFXA 4DIFA 1DXYA 1ISFA 1A27A 2Q1WA 4LMPA 4J43A 1BGVA 4NK4A 4R51A 4PRLA 3ZGYA 3ZWMA 3GN2A 3FI9A 3LYLA 1YBAA 4WLFA 3Q1LA 2X5OA 4YQYA 3DZGA 4Q3EA 1DC5A 3D5TA 1NVMB 2X23A 2YV2A 3DAGA 2CZCA 1B7GO 2GUGA 3WLEA 3G49A 2Y05A 2RH8A 4MKZA 3ASVA 1MV8A 1PGNA 3WNVA 3GDOA 4YT5A 4NK5A 2PZJA 3GNTA 5HWSA 1E1NA 2VUUA 3TWOA 3WYBA 3RJ5A 4PG7A 2VRBA 1GQYA 1LLDA 3E9QA 4HNHA 2X9GA 3OMLA 4BO5A 1GPJA 3JYLA 1C3VA 1SO8A 5C37A 2DBRA 5LDHA 1YH3A 1XHLA 3L77A 3DXFA 3I3OA 3BHIA 2O3JA 4I5FA 4XGNA 1MXHA 2GR9A 1E1KA 1A4UA 2VT2A 3F5SA 4JJIA 4O1MA 4BV9A 4FFNA 3ONEA 4P38A 5DULA 4Q3DA 4BNWA 2IZ1A 3OICA 2AG5A 2P5UA 4L0QA 1KOLA 4XIJA 2FR8A 4IJWA 4QT0A 4FC6A 4W7IA 4BNNA 3Q11A 4RO0A 1RKXA 2P91A 3GVPA 3NJ8A 4ZQHA 3NTOA 4FR5A 4ZGWA 2ZTVA 1O0SA 3FBGA 3AUSA 4ID9A 4K28A 4NJMB 4PLYA 3TZ6A 1DRUA 3U62A 4OO3A 2NVUA 3GDGA 4NNJA 2XPCA 1U2DA 2VRCA 2VZ8A 1NX6A 1T2DA 1HLPA 2AQKA 3I9OA 1C0PA 3K2EA 3UCXA 3WTBA 4DQVA 5C7IO 5T57A 4IQ0A 1GYPA 3WXBA 4XJSA 3EYWA 4J4BA 4B8WA 1PJ4A 3GR6A 2ZB3A 3ONDA 4UEKA 2WD8A 1XYGA 4GI2A 1ZKMA 1J49A 1DAOA 2E49A 3AK4A 1HE4A 5ER6A 5IG2A 3CIFA 2HSDA 5MDHA 1WP4A 4RZHA 4YJDA 3QY9A 3V2HA 2VYVD 4HFJA 4NBWA 4JJFA 1RM4A 1ZUD1 1AE1A 1I3MA 1OBFO 4ZU3A 3GZNB 3A4VA 3GAFA 5JBIA 4PLTA 4XDZA 1LLUA 1JN0A 4BKPA 2QHXA 2RH4A 1ZSVA 3KSUA 3WYEA 3ZV4A 4O6VA 5JXWA 1TVEA 1UZNA 4A0SA 1M66A 1GYQA 2E37A 2CMDA 3I9NA 1B0AA 1PWXA 1QV6A 2D8AA 3ZWCA 5I7VA 3RUFA 2GDZA 1U7HA 5ENVA 1N5DA 1VSVA 4CQMA 4OGWA 2QX7A 2PGJA 4NR0A 3TFOA 3IMFA 4CV1A 2IYOA 8ADHA 3CH6A 5IDXA 1VJ1A 3D0OA 5T8KA 1JQBA 1CF2O 4MVJA 1FJHA 3UOGA 4CUZA 2OBNA 5JFOA 3ITKA 5I9NA 3WYCA 2Y93A 3OETA 1HDRA 2PKQP 3JQAA 3PFWO 1ISMA 3RASA 1E1LA 5L3ZA 4GMGA 4J7CA 4MOWA 1B8UA 3AOGA 4OM8A 5KVVA 1AUPA 3ZW8A 2CY0A 2W2KB 1FK8A 4J9UE 1ZXLA 2DKNA 3QVTA 4ALIA 4CL8A 1GUFA 4EUHA 4ZQEA 3PWZA 4E31A 1Q1NA 3BTUA 3QV1A 2Y99A 2FN7A 3BIOA 4XKJA 1HE5A 3RVDA 2BFOA 3RAJA 4AICA 1YQXA 1ZXBA 2Y1DA 1SB8A 2BLLA 2PWZA 1VKOA 3DBHB 4UVEA 4KQXA 2P5YA 3TPCA 1ZK2A 3FBTA 2YZ7A 2ZK7A 4Y6RA 2WYWA 1SC6A 4RLHA 3W8EA 1IOLA 4XQEA 3GHHA 1ORRA 3KB6A 4ZQFA 5K9ZA 3ITDA 3WJ7A 1K6XA 4QFCA 1EVJA 1Y7TA 3NT5A 1PR3A 1HE2A 3HDHA 5THKA 1HDXA 3LLSA 4XJTA 1LLCA 5ILOA 3K9QO 4HADA 3UN1A 4AJEA 1UZLA 3QWAA 3K5PA 2FP4A 4GX0A 4DBZA 2DPHA 2GZ2A 4RORA 1HDYA 3AJRA 1P3DA 1ZK1A 4GKBA 3X2EA 2LDBA 1NASA 3U49A 3E8XA 3OQ1A 3QVXA 4KDEA 2I6TA 3QWFA 3WX0A 1BSVA 3BAZA 1JKIA 4TRNA 1DIHA 5I7FA 3DBLB 3P2YA 5LCXA 4RF2A 1HYGA 3PQEA 3JQ9C 4TKMA 2NTNA 2X5KO 2X9VA 3FCOA 2IRWA 3O8QA 3VDQA 5B4UA 3BMOA 2YQ5A 3KVOA 2EF1A 1ZK0A 1HKUA 2FSSA 2C7GA 3Q9NA 4FC7A 1YL6A 4LGVA 3ZW9A 5IF3A 3ROQA 1DDOA 2QIOA 4RGBA 2JFHA 1MXFA 1D1TA 4YJFA 4CQLA 4Q3CA 3ZI0A 3BMQB 2WE8A 4EZBA 1M6HA 1UXIA 1WVGA 3KETA 4PLFA 3C24A 3M6IA 4AJHA 3PJEA 3PDUA 4D44A 3NTRA 3RUHA 2NQTA 4W4TA 4YAIA 1LX6A 1NQ5A 2B4RO 3DHEA 3AWDA 1LUAA 2EKLA 2Q2WA 3GVHA 3H3JA 1Z73A 1MX3A 1X0XA 3DOJA 2GNAA 3U5TA 1E7SA 4HP8A 3R1IA 1Y9EA 1XCBA 3AI2A 1LSOA 3UICA 4RDIA 4KZPA 2WM3A 4ZRNA 2AE1A 3P7MA 4NG5A 1H9BA 1V0JA 4E30A 4FB5A 4DVJA 2PZMA 3BHMA 4K1LA 4CMCA 4IINA 3VOSA 3STHA 1QG6A 2FSVA 2EKQA 3BMNA 3KTDA 1DIGA 1E7MA 4NH4A 4NHEA 1MUUA 2GPTA 3HN7A 4JBIA 3SLKA 5JYEA 1EUZA 1I24A 1QSGA 3WIEA 1JDJA 3LF2A 1PZHA 5TIIA 5IN5A 4D0RA 2DBVO 3CTMA 4HXYA 2OGUA 1F06A 4DLBA 1R4NB 1KVQA 1C0KA 3PDJA 2DC1A 4J90A 5TQVA 3KYDA 3JYOA 3FN4A 1ZJYA 1GU7A 4J7XA 5CEFA 2Y0DA 1ZMTA 4YJHA 5A3VA 2JKVA 7ADHA 3LZ6A 4RVDA 3JQFC 1HT0A 2ZB8A 5B4TA 4BQRA 1P1HA 1U3WA 3EZYA 3JCZA 1LNQA 2NU8A 1VLLA 1P74A 1B2LA 4YBZA 2POQX 3AUUA 3QWBA 4OYRA 5LC1A 2OP1A 1EEHA 4GL4A 1I01A 3INRA 4Z0HO 1BXGA 4Z9XA 4KOAA 4DWVA 2TMGA 1QRRA 3Q2IA 2QZ9A 1XLTA 1PS0A 3ASUA 3OBBA 1OZAA 1Z7BA 1PJSA 4NIMA 4RCVA 3WNQA 4D3FA 4CLOB 1ENZA 2B69A 3CINA 4A7PA 3DL2A 3F3SA 4OJNA 4QTZA 3B1KA 3BTSA 4JP3A 5T67A 1N7GA 3L4BC 1YJQA 3P5SA 3VPFA 1MC5A 1CIVA 1ADBA 5ICSA 1R12A 2R2GA 2WWRA 2BI8A 5DP2A 3VVCA 3HDYA 4W9NA 4BO3A 4IDDA 3WGGA 5L53A 1V8BA 1PZFA 1BVUA 1NVGA 5F1PA 2PGLA 2EIHA 3GVCA 3PLNA 4N7RA 2ZYGA 4CM4A 3FPCA 3DZHA 1Y9AA 2X58A 4M87A 4J91A 5KVCA 4WCFA 1QXSA 4DA9A 5KIAA 5JE8A 2EJWA 4TRJA 5EQFA 3BMCB 1T1RA 1JW9B 3RBXA 4A73A 3FPLA 1WZIA 3JD0A 3I4CA 4KP7A 2ZQZA 3KYBA 4I5EA 2FHSA 5HBRA 3ROMA 3S2IA 2OORA 5JO9A 4P22A 3QP9A 2DM6A 4DREA 3AUTA 1ONNA 4WLUA 5U4QA 4BMNA 2QG4A 4UREA 3LC7O 1ZVMA 5KTKA 1NWCA 3OA2A 1V6AA 3VPGA 3IIEA 3ZHYA 1ZW1A 4CLEA 1OI7A 4DQUA 4DUPA 3RFXA 3PWKA 2EW2A 2O7SA 3AY6A 3SJ7A 5L4SA 5K6AC 1QV7A 4A5OA 3KSZO 3D5QA 3HJAA 3K96A 3WDSA 4YACA 5HS6A 4R5MA 5KVSA 2PD3A 3HWRA 3ZWOA 5GMOA 3TZHA 3SXPA 1BHSA 3M1LA 3PRJA 3OP4A 1YDEA 1GYRA 4N5MA 2QQ5A 5HM8A 3CEAA 3H4VA 4B79A 1I32A 1DB3A 2YY7A 1Z45A 5F3RA 4JLWA 1EBUA 1KY5A 3ZWWA 4R41A 3DFUA 2VHWA 1YS4A 2X22A 1O94A 1U3VA 1VJTA 4RQUA 5I9MA 2B83A 3E18A 4Q3AA 3W6UA 1PEDA 4RF5A 4CMAA 3H2ZA 5CDTA 4JJGA 1C0IA 1B14A 2EG9A 3K92A 4BKUA 3W4KA 4XX0A 2G82A 4WOKA 4AFNA 4J4HA 4O5OA 4ALKA 1UDBA 4NMHA 4YT8A 2PK3A 5BNTA 4RDHA 1ZCJA 1X1EA 4NFHA 4MKXA 3SVTA 3R3SA 1AXEA 2VWHA 4XB2A 4E13A 2XAAA 4MVJM 2DLDA 2PKQO 1JKJA 4FDAA 4FS3A 1YL7A 1QYWA 2CVOA 4KUHA 3UCEA 3AOEA 2YHIA 1M2WA 3HB5X 2XOXA 1NQOA 2IYPA 1E1MA 1ZK4A 3FSRA 4J2OA 4W99A 4FFRA 2X0IA 3E9MA 3T4EA 3ZV6A 3ZWXA 4HFNA 4MP3A 3H9QA 2BHLA 4BVAA 4J1TA 2A4KA 3GUYA 2R6JA 2YDXA 7MDHA 1OAAA 3QVOA 3ZN2A 4KQWA 4DIBA 3IOYA 1GFSA 1EUCA 2ZYDA 3NYWA 1DLJA 3RIHA 4GKVA 1IYZA 4RF4A 3H2SA 4CLRA 3DQPA 5CG1A 4XEHA 1SNYA 2I67A 4D42A 3A9WA 4O0LA 4BMVA 2VRCD 4IDBA 1BDBA 1YKFA 4XCVA 5HTOA 2A94A 2VHYA 3RC9A 3JD4A 1HSOA 3Q9UA 1NPTO 2AW5A 3D1LA 5FI3A 4PZDA 1YB5A 5IXSA 4IDCA 1C14A 1EE2A 5JC1A 4HV4A 4N54A 1R15A 3M2PA 3E03A 2VT3A 4M1QA 3ETEA 4ND5A 1E3JA 3UCFA 2HQ1A 3WS7A 6LDHA 5FEUA 1E7YA 2OUIA 3F4LA 4UVGA 3RU9A 1NPDA 3NAQA 3GAZA 3K73O 1E6UA 4LCJA 4CR6A 4YRDA 2CVQA 1CETA 3VDRA 2UYYA 1F0YA 2GN9A 3ORFA 5CG2A 4N18A 1VL8A 4J3FA 2XXBA 1NNUA 4M8SA 3PXXA 1K0UA 2J3KA 2WJPA 4IIVA 1I2BA 1P44A 2GN6A 5ES3A 2GD1O 2J3IA 5G4KA 3VZQA 1S6YA 3TZKA 3I9KA 4HNGA 4MVJP 4CQMD 4MIYA 2Q1UA 1FDUA 4ZA2A 1XQ6A 2JD0A 3PHLA 1HZJA 3FWNA 1A4IA 4CQMB 5AXCA 4MVJD 1PSDA 1QYDA 1GTMA 1YWGO 5BT9A 1X7DA 1DOHA 3CUKA 4QXMA 3HHPA 2X4GA 3JQAD 1XA0A 3EGOA 4BNTA 4I08A 1M76A 4PVCA 4GBJA 4AJKA 4OXKA 4BGUA 4E33A 4I9UA 3IKTA 4LK3A 5DNAA 3L9WA 3K6JA 2PNFA 4DYDA 2YDYA 1YOVA 2HDHA 4WOJA 1KETA 2PFGA 1QYXA 1X15A 3GDFA 3KEOA 4M89A 5ITWA 2DFDA 3RC7A 1JTVA 3INTA 2HCTA 2HO5A 1PQWA 3ENNA 4IDEA 3U3XA 1R0SA 3VZPA 1EVIA 4K6FA 5BR7A 1KVUA 3PJFA 4AJPA 3PYXA 2W2LA 4H3VA 3L6OO 4TQGA 5F5LA 4BO4A 1Y6JA 4CM1A 1DIAA 1DJNA 2VOEA 2V6BA 3H6KA 3TQHA 1HTBA 5FYDA 2UDPA 4QQRA 2HK9A 4IY1A 5HS4A 1R0LA 2RHCA 3IJPA 3KBOA 2PGDA 5A03A 5EMHA 5H83A 4URFA 4ALJA 4WKGA 4PLZA 4D43A 1XSEA 1TT5A 2D5AA 3WR5A 1BXKA 1LTHR 4Z0TA 1HYHA 3OEYA 2HKIA 3LK7A 1H5QA 3AFMA 1Q2XA 3V8BA 1MGOA 2HRZA 3M1AA 5JMPA 2GLXA 4U8GA 3GEMA 4WLEA 1HF3A 3ROPA 3ONFA 1QYVA 4L4XA 4CM8A 4E5MA 1E3WA 2BGLA 2CFCA 2PV7A 5L95A 4BO1A 2EGHA 3C7AA 2DUWA 5CAEA 2AQIA 3O8QB 2J3HA 3ANNA 3BA1A 2D2IA 3BMOB 2O3QA 2CSUA 2NVBA 1ONOA 1U8XX 2UVDA 3PQDA 1NM5A 4EGFA 2BKAA 4YJFB 4CQLB 1UP4A 1ULSA 1Y8RA 1P31A 1HRDA 5L7WA 4RLSA 3PK0A 5A05A 3A14A 1O5IA 3F4BA 4PG5A 5DOZA 1J4AA 1I2ZA 1QORA 1FF9A 3C85A 5DBGA 5FFFA 4YRAA 1VJ0A 2J6IA 3CKYA 4LN1A 4B4OA 4R1SA 4LRTB 3MJ4A 3QIVA 2ET6A 1PGJA 1ARZA 4XYGA 4LMRA 3E5MA 4NZ9A 3WGTA 2AA3A 5DBFA 2WD7A 2AEMA 2C54A 1EUDA 3GG2A 3M2TA 1KVSA 3K8ZA 2VTEA 3NTQA 4FN4A 3UXYA 2J5QA 1XGKA 2D5CA 4FBGA 1HDOA 3VH4A 3AI1A 3L4SO 3S1LA 4PLVA 3W4JA 1XELA 3D64A 1SAYA 1UJMA 1NWHA 2Q45A 4CM9A 1NFRA 4RVUA 4RZIA 4QEDA 3BMNB 3AU9A 3WTCA 2PZKA 3IUSA 1O95A 4UEOA 3JQCA 3NUGA 4IZIA 1O6ZA 5EQDA 1WWKA 3F46A 4E12A 3PVZA 5L45A 3ABIA 4W7HA 2PH3A 1G0NA 3T7EA 2Y68A 4LSMA 4RPJA 3AW9A 4I5DA 4XGKA 4XR9A 4XA8A 4DYVA 5COQA 3EAGA 1BW9B 2GN8A 5KJ6A 4B4UA 4DPKA 3DTTA 1H6AA 1RPNA 1OFGA 2A92A 4YJHB 3DR3A 3WBFA 1UXJA 5F21A 1ISIA 3FTPA 2WEKA 3RFVA 5JYDA 2CVZA 3B1JA 2Q4BA 4I9NA 1PS9A 2ZKLA 1D8AA 1K5HA 3ZU5A 4OAQA 3DB2A 5JAIA 3GG9A 4PZEA 3ST7A 4K9DA 4DGSA 4NPCA 3RQSA 4KTTE 4ROSA 3HZZA 2BMAA 2CUKA 2JAHA 3OJEA 4CMIB 1GL3A 1YQDA 2O2SA 3FNGA 3ANLA 5JDCA 4JCOA 1Y8QA 3GVXA 1E7QA 4B3HA 4RQTA 4XYBA 1HE3A 4FQ8A 3ZV5A 2WTBA 3H5RA 1UZMA 3ETGA 3KLMX 4ALLA 1OMOA 2EV9A 2JFFA 4KDFA 4L8VA 4CLHA 2VCYA 5DN9A 4KTVE 5IDWA 3GPIA 5BSFA 1EQ2A 3AM4A 2AEFA 2EERA 3RKUA 3JYQA 3K31A 4UUNA 4FIZA 2FRDA 1H6BA 2D4AA 4OH1A 4D0SA 3FD8A 5IJZA 2H6EA 4NBVA 2IODA 4PFJA 2RIRA 5BQFA 3PLRA 4XQ9A 3VTFA 4J1NA 4P4LA 2HMWA 2ZTUA 3WG9A 1R4MB 5L4NA 2OO5A 4P4GA 1YQGA 1VM6A 1FMCA 3N74A 1Y5RA 3OIGA 3ENKA 4WCFB 2GASA 4EDFA 1R6DA 1IZ9A 2CDBA 4XB1A 1QLHA 1P1RA 1TT7A 3G1TA 5TSDA 1IPFA 2AE2A 1N9GA 4GSLA 4LVUA 1XKQA 3LDHA 4W9NC 3Q6IA 4HX5A 1P33A 3RROA 2C82A 1UR5A 4BNFA 1MFZA 3PHGA 2H63A 4DMLA 2VYNA 3LC1O 5G4LA 1GEGA 3ZWBA 2AEJA 4G65A 2OL4A 2NACA 3GLQA 3PIDA 4GX2A 3DMTA 1T1SA 2BH9A 2IZZA 2V65A 5DT9A 5A9RA 2JD1A 1F14A 3AY7A 4BGIA 4M49A 4BNZA 4WCFC 4EI2A 4D3DA 3D4OA 1DFHA 2B35A 5CEJA 4OQZA 1X7GA 4A26A 4A27A 1Q0HA 1U5AA 3QVSA 4CV0A 3DBRA 3GHYA 4HFRA 4XQCA 1DFGA 1W0CA 4H16A 1I36A 3LF1A 2EWMA 4MVJF 1DC3A 4ND1A 5HA5A 1GZ4A 4Z3KA 4BOYA 5KJCA 3HFGA 3JQ8B 1UUFA 3JD3A 1X0VA 4EJ0A 4DPMA 3PP8A 1YXMA 1LDEA 2O2YA 2WSBA 2ZTLA 2C29D 3C1OA 2DBQA 3D4PA 3QWHA 2JCVA 3RUEA 4OKNA 5CP8A 3HB4X 3I4FA 4LCEA 5CDSA 3AM5A 4FFLA 3RU7A 3LSYA 3RI3A 4BO6A 5BNIA 4R3NA 3TZQA 1T2CA 3QE3A 2B37A 1NP3A 1C1DA 1ZO8A 2O3RA 4XYEA 4PN3A 3PHIA 3GEDA 1DSSG 2DBZA 4TWRA 3EVNA 2HK7A 1YGYA 1ZSNA 2EGGA 3FNHA 3PJDA 3DFZA 4PLHA 3F5QA 1J5PA 1I3KA 1UDCA 2V7PA 2Y0EA 4TRMA 3WMWA 4GVLA 3F47A 5TT0A 4YRBA 3OJ0A 1BG6A 2Q4EA 1UXGA 1OC2A 1I3NA 2O50A 3WSVA 1LSUA 4YAEA 2X6TA 1GQQA 2Q46A 4FPXA 4HWKA 3MJCA 5EINA 3D3EA 3PJGA 1PGPA 3R6DA 3UF0A 1JLLA 2J5KA 4MIEA 2YHIB 1KC1A 5JAMA 1U4SA 5L7TA 4IIUA 4PG8A 3MJEA 1GCOA 2NLOA 4HFMA 3GMDA 2FMUA 4YCAA 2VNSA 3EDMA 1Z75A 3DHYA 1T2FA 2PD6A 4XYLA 1FDTA 2YQ4A 3IQDB 4IGFA 1EBFA 3WOHA 2PH5A 1K3TA 1YONA 1D7OA 2ZB4A 5C5IA 5CPFA 2ZTMA 3HN2A 1DEHA 4BNXA 1DRWA 1NYTA 3AOEC 2ZCUA 5A9SB 4F45A 1CJCA 4B7XA 5T64A 4PVDA 1IB6A 3DBVO 1H0KA 2X86A 5H82A 4NFSA 1I10A 1TB4A 4Y67A 3HNPA 5A04A 1N92A 2FWMX 4L74A 1XWFA 3WLFA 1P0CA 2V6GA 4G5HA 5G0UA 2PKRA 3GFGA 4PLGA 3V1UA 3PI7A 1KC3A 5DDIP 2C5EA 4IS3A 4Z6KA 1FDSA 5JY6A 4AJIA 2C7VA 2DTXA 1E0DA 1MP0A 3JQ7B 1XU9A 4NJOA 3FWZA 4BB6A 5BSGA 4D45A 3RJ9A 1V3TA 4R3WA 4R4JA 3FR7A 4WASA 2H1SA 1LXCA 4DIOA 2NADA 1DRVA 2OFPA 5I7SA 1U7TA 4TRRA 5C7OO 1CYDA 1Y1PA 2HLPA 2Y1EA 2WE7A 1IE3A 5JCJA 2NSDA 4IDGA 5IZCC 1EK6A 1I33A 1XDWA 3JQGA 3R0IA 3I52A 2PR2A 3IAHA 1UH5A 3QA9A 2JD2A 1QR6A 3K2BA 1LRJA 1W6UA 4GSKA 3NDRA 1PJLA 1Z82A 3WGIA 3HSKA 4WECA 3ZWAA 1V3UA 3EVTA 3WSWA 9LDBA 2VWQA 1KVRA 5CDGA 5KKCA 1U3UA 4YPOA 3ZNNA 5JCXA 1ADGA 2X1HA 4IM7A 3KHUA 3VC7A 3PGJA 3MJTA 4AJ2A 1K6JA 4CMJA 3EK2A 2CDAA 4U0JA 1LQUA 3N7UA 3RUDA 1UXHA 1B8PA 1UAGA 2W2LD 3JYNA 4E6PA 3X2FA 1DHTA 3WBBA 1W73A 2FPIA 3DAPA 4AJJA 3VTZA 4E21A 2Q1SA 1MFPA 3LT1A 1E5QA 1PS8A 3U9LA 3Q3CA 4WCDA 4F3YA 4ZHSA 3DWFA 2UUOA 3QHAA 3MJVA 4WPGA 5A9TA 2BRUA 2ILTA 3LU1A 2RAFA 1GDHA 3DMYA 5THQA 1XIVA 3NRCA 3O26A 3S8MA 2EXXA 4MJLA 1GUYA 3NT2A 2C2XA 4YQZA 3I83A 3V1TC 1Q0LA 4JGBA 5DP1A 4QX6A 3KYCB 3KLPX 3G0OA 4M86A 4Y98A 3MTJA 3JD2A 3D3WB 4FJ2A 4Y6PA 2TMDA 4J0FA 4OXNA 4E5YA 4BL5A 3WQSB 1JVBA 4GX5A 3ICCA 1E3WB 4TVOA 3B1FA 4DLLA 1K6IA 4S3MA 4P4NA 1PJ3A 1IZ0A 4PLWA 5K0ZA 1E6WA 4H15A 2I3AA 1WNTA 5AVOA 1T2EA 4RL6A 3LQFA 2Z1MA 5FF9A 1FDWA 4CR8A 2C0CA 1NPYA 4DBVO 5EPOA 1Q7BA 3OIDA 1XR3A 1E5LA 3GT0A 3OJLA 3SJUA 1LC0A 1U1IA 5I7EA 1Y8RB 2OBYA 1E92A 1JAYA 1EDOA 3FF4A 3ROKA 4B8ZA 4IDAA 5T6BA 1NQTA 4DMMA 1JAXA 3FRJA 3DBHA 3ON5A 4J7UA 4YB8A 2VHVA 1LRKA 3VH3A 1WDKA 3TFQA 5DCUA 4C7JA 4BNMA 2Y1FA 4JX8A 5HRUA 3CZMA 3V5NA 1A72A 3WGHA 1YL5A 2YHUA 1MLDA 4DPLA 4XQGA 1LQTA 2GZ3A 4CM9D 5A1TA 2JJYA 1ADCA 2H5LA 3IJRA 1RYDA 4LW8A 4GPD1 3DZJA 3CE6A 3ZNQA 3VHRA 1TI7A 2DPGA 3ETDA 1PGQA 3QVWA 3OJOA 3NDJA 5TRTA 2GZ1A 3GNSA 2ZQYA 3GH3A 1B26A 4R1TA 1A5ZA 4ZQBA 4YAJA 4L76A 4BNLA 1XQ1A 4YWJA 4D41A 5ILGA 3BTVA 3DBLA 3RKRA 4BMSA 2B4QA 1SMKA 1OC4A 3OF2A 4YAGA 1IULA 4Y6SA 3ZH2A 3PTZA 5JSFA 1E3LA 4BKRA 3KM0A 3UUWA 3U0BA 3UH1A 4EEZA 4GQAA 1JWAB 1N8KA 4IJUA 2F1KA 1WDLA 3IDSA 4UUPA 1ZEJA 3V2GA 3OECA 2EHDA 5DF1A 3P19A 3TNLA 3ZCXA 2PD4A 4II2A 5U9CA 2X0NA 1Z6ZA 4ILKA 4YEDA 1MB4A 3GK3A 2E4AA 2WDZA 3JSAA 3ZHXA 3E82A 3L9XA 3P2OA 5KWEA 2NNLD 4KMSA 4TVBA 1IPEA 1LSJA 3GGPA 4J0EA 5G0TA 4Z9FA 2NVUB 4JROA 4RPHA 3OA0A 4CODB 1BWSA 3O38A 3RUAA 3COSA 3RFTA 3GC6A 5EL0A 4PCVA 4KWIA 1IUKA 5A02A 3LC2O 3GNQA 2DT5A 1AHHA 1ULUA 3F6YA 3ZDFA 1DIBA 3OIFA 1ISGA 2YUTA 1Q0QA 5AYVA 4BO8A 1U28A 4HY3A 4XRGA 3UAGA 2GN4A 4IS2A 2R00A 1LLQA 5F1OA 1KYQA 3PHJA 3QQPA 3SC6A 3FR8A 4IPTA 1NVTA 4R9RA 3TOZA 4LRSB 1JA9A 4IZHA 4U6SA 1CQIA 1P1JA 4NBUA 1LBEA 4CM7A 1SEVA 1EK5A 1ZMOA 2GYYA 3VH2A 3IUPA 4R1UA 3KO8A 3NV9A 4L75A 5TX7A 4DC1A 4BO2A 1B16A 1M67A 3FNFA 1UXKA 1U5CA 1YVEI 3TSCA 1B3RA 2YW9A 2YFQA 2O3SA 1LSSA 1K89A 5TJHA 1DLIA 1GV1A 1KIFA 3MOGA 3ZWVA 5J23A 3C1AA 3WIDA 2VYND 2G17A 1WZEA 1N9GB 5JDIA 1S7CA 2RBEA 5BSHA 1PQPA 4B4VA 4JQCA 3L4BA 3SLGA 2QRJA 3OSUA 4TZKA 5KVQA 1HXHA 2GSDA 3R3JA 3AY3A 3JQAB 3HADA 1RYEA 4TSKA 2EP5A 1MC4A 3VPXA 2O3TA 1BTOA 2O4UX 3OQBA 2HK8A 4CLOA 3DBRB 4YJGA 4CMEA 3O9ZA 3JQ6A 5IDQA 1N2SA 4Z9YA 3SEFA 5T8KC 1PU2A 4BHTA 1NHGA 1TXGA 3GZ4A 4NBRA 2O48X 4YT2A 3QWIA 1NAIA 4BS9A 1B8VA 4FCCA 4RJTA 2IXBA 4CMBA 2B5WA 1O9BA 3DMTC 1KEVA 4NDNE 2J5RA 1YB1A 4CUJA 5TGDA 4EJMA 1UP6A 2O3UA 1YO6A 2NU7A 3PHHA 5JNLA 1PJTA 4OL9A 4YA6A 3FTNA 3KRTA 4QO8A 2VZ0A 4NFYA 1C1DB 5L40A 1EMDA 1V35A 1HSZA 2X8LA 4J6FA 5A4DA 2JHFA 2V6MA 2B0JA 1R37A 4CPDA 1I8TA 3EY4A 2I66A 3ANMA 4I8XA 3I9JA 4J1QA 1GD1O 1O8CA 4J16A 3TL2A 1PZEA 3VH1A 4OSOA 2P9CA 1BRMA 3OQ6A 4EW6A 4QECA 1V3VA 1L1FA 3HE3A 1VI2A 1NXQA 5B4VA 3RSHA 4DL9A 3DZIA 2JHGA 2BFAA 1PL8A 4OKIA 4W6ZA 5ITVA 3JV7A 3PWSA 1J0XO 3U4DA 3VVBA 1VL0A 4BQPA 4PLCA 2F00A 3OHSX 4RVGA 1I3LA 1VE9A 1KBZA 3WFIA 5EERA 4INAA 3W8FA 4AJLA 3H9EO 3JQBA 4FFOA 5JW6A 3NGXA 4RF3A 4UAGA 4IMRA 4R1NA 5CHEA 4BO0A 2P2SA 4XGIA 4XIYA 4YXFA 1LDYA 2P68A 4XWYA 2AG8A 1WXDA 2JCXA 4GGOA 4D79A 2BI7A 3C7CB 1XEAA 4WGGA 3LVFO 3ZV3A 1HL3A 4IMPA 1ENYA 1UP7A 2O4CA 3H9JA 2VUTA 4BNYA 1ZJZA 2D1YA 2JAPA 3ZU3A 2VUSA 4UUMA 5A06A 4BNKA 3B70A 4IJKA 1PL6A 2OXIA 5FI5A 5COBA 1RM5A 4RPGA 2C5AA 3GMSA 2Q2VA 1IHXA 5G0SA 3MCVA 1KEWA 4BNUA 1BMDA 3E1KA 5JAQA 2BFMA 3UW3A 4ITUA 4J9VA 1R0KA 4QFDA 1CERA 2YJZA 3KYDB 3A1NA 4B7UA 1Z7EA 4MVJG 2AQ8A 3NEPX 3WWYA 5ADHA 2H9IA 1XG5A 3HFSA 4O63O 4FFPA 2OP0A 1I2CA 3TOXA 4GMFA 4FFMA 2NWQA 5EIOA 1YB4A 3CPSA 3HDJA 2E48A 1DIRA 1NAHA 1VPDA 2HMVA 3ULKA 5JCJD 4FW8A 2C20A 4FD3A 1ZSYA 4AJ1A 4E32A 3DC2A 3CSDA 4E2WA 4BKQA 4BB5A 4MVJI 1HDCA 2ZIZA 3DAFA 3VKUA 1BXGB 3JQGB 3QSGA 4ZICA 4BV8A 1A7AA 3MEQA 1GV0A 2YV1A 1ADFA 1XU7A 5IAAA 1NQAO 4HKTA 4FSHA 2ZYAA 4N5NA 5KJFA 3NDIA 2DFVA 1HWYA 1E7WA 1C1XA 2VN8A 5JPIA 4DXHA 4AL4A 4B3JA 4C7KA 1Z74A 3S2GA 2ZB7A 5KJ1A 4OSPA 4OOEA 1HDZA 4Y9DA 1DAPA 2GF2A 3H5AA 3G79A 4ONEA 3L6EA 4J2HA 1EZ4A 3KUXA 1QMGA 3PYLA 1Y81A 3PGXA 3NJ4A 3F1KA 4CM4B 4NQZA 3AUAA 2OMEA 1E3EA 1ZIDA 4RVHA 3FHLA 4IBOA 9LDTA 4UULA 5KOIA 4MINA 3PPIA 4WLNA 3O03A 5A5EA 4IQGA 2GRAA 1ZEMA 3KOUA 1FXSA 1E7RA 1YBMA 5A5FA 1YRLA 3WMXA 5G0WA 2BGKA 2VZ9A 4WK6A 3EUWA 1GPDG 3H9UA 4E0BA 3EZLA 4M55A 2Q50A 4CMHA 2O7QA 4H7PA 4ZD6A 1QKIA 3DOOA 4L4RA 1E77A 3DEYX 2JCYA 5JMWA 2C2YA 5CFZA 1U2GA 3ZWYA 4GGPA 4CV2A 2NTVA 3FNEA 4JNKA 2Y0CA 1ML3A 4WJZA 3DO5A 5GZ3A 4CUKA 4E5PA 3IL2A 2QRKA 1U4OA 3KEQA 1AXGA 1QP8A 3GGOA 2OOSA 1T26A 4E5NA 2PTGA 2X0JA 4TKLA 1MG0A 1P1IA 3GGGA 4J1SA 4CMGA 3BHJA 4DQXA 2B5VA 4IQ8A 4Q3NA 1DBVO 1RJWA 1PJBA 2X0RA 4D46A 1W8DA 3C3XA 2G5CA 2B36A 1SOVA 4Q39A 3RC2A 1LI4A 2Q49A 1D4FA 3MWEB 4WNIA 4BGEA 1ISJA 3A28A 3H65A 1H9AA 4CL3A 2BELA 2Y1GA 5IN4A 1EVZA 4YVFA 4XYMA 3B20A 3BYZA 4KUEA 1LEHA 3W1VA 4C4OA 3DZBA 5FWNA 4WEQA 1AN9A 1GUZA 4IXTA 2IEBA 4PIVA 2NQ8A 5C3MA 1N7HA 2ZATA 4F46A 3GF4A 2WMDA 4NBTA 3QRWA 2W8ZA 1LDMA 5I8WA 5IZ4A 5KJEA 3T4XA 2LDXA 3JYPA 3VZRA 5AQ1A 4EUFA 4ALNA 2Z95A 3TZCA 1EFLA 4CM5A 2GGSA 2NVWA 2SCUA 2A35A 2WYUA 2Z1NA 4BNVA 2BFPA 1X13A 1PJ2A 4KUGA 1YJ8A 5JS6A 4O59O 3CZRA 3U4CA 1B3BA 1EDZA 1GAEO 3GEGA 3S55A 2J3JA 4D3SA 1GZ6A 2W90A 3E5RA 3H3FA 4R5HA 1PL7A 4GVXA 3QW2A 1PR9A 3IP1A 3PIIA 2ZJ1A 3A06A 4S1VA 1SB9A 2G1UA 3NT4A 1H6CA 4XD2A 5CDUA 3Q0EA 3DZFA 4CLDA 4E4YA 4GLLA 4XR4A 4GAEA 1CWUA 4IGEA 4R68A 3OJFA 4MVJH 1U9JA 1VKNA 4ND3A 2RHRA 4L73A 1PIWA 1QYCA 4MP6A 3U4HA 1QLJA 3BZUA 1KERA 4I9HA 2NUAA 4PZCA 1ENOA 2GO1A 3QJ5A 2IXAA 1GQ2A 4CJXA 4IJVA 1BVRA 4UVIA 3I5MA 2UAGA 2Q99A 4YR9A 3TDKA 1N1EA 3SC4A 3ZU4A 3E9NA 5TC4A 2I76A 4CLRB 4Z0PA 5ENDA 3TF5A 1HLDA 3MOIA 4ND4A 3ADOA 3PQFA 4MP8A 1OOEA 3JTMA 2PA3A 4HUJA 4BUCA 3H5NA 2VWPA 5DCWA 1ZFNA 4ND2A 1PZGA 4B4WA 4Z3DA 4DRYA 1R66A 3I9LA 1O89A 1NR7A 4FJ1A 4ALMA 1W4ZA 4RVFA 3ICPA 2DTEA 3OH8A 4JN6B 4E3ZA 4GH5A 2HJSA 3OFSA 5CEEA 3S2FA 4I1IA 4UUOA 3U09A 2A9FA 3ZU2A 5IXYA 1CEQA 1K2WA 2EKPA 3GVIA 4GX1A 4YDRA 1P1FA 1SCUA 4P8RA 1EQUA 2I5PO 2NU6A 2DU8A 2XF8A 1PQUA 3F9IA 3KSDO 4R9SA 3RBVA 3W6ZA 2V6FA 5MGBA 3ZNOA 4E2ZA 4DC0A 5DBIA 3LT4A 4IDFA 3AFNA 3CMCO 1GR0A 1CQJA 5G4KB 1BW9A 2UUPA 3BTOA 2IE0A 5L4LA 1D1SA 1NHWA 3KV3O 3EHEA 4A10A 1TA4A 3C7DB 4XZ3A 3DHNA 1T4BA 6ADHA 2Y66A 5B37A 1A71A 2R00C 1SZJG 3IS3A 5T5QA 4E2XA 4FGSA 1DPGA 1PX0A 1PWZA 4BNGA 2HU2A 4J49A 5JO0A 8LDHA 5BNFA 3O4RA 3RUCA 1LA2A 4W82A 4LISA 1RM0A 4NJMA 1H93A 4FOOA 4MKRA 2HRBA 4UEJA 3PFFA 1T25A 4A03A 3WGOA 1YOVB 4CMIA 3G17A 1ISHA 4TMFA 1KS9A 4R54A 5L51A 2VHZA 3DOCA 3EC7A 2P9EA 3DZKA 1PGOA 1G0OA 1SBYA 4YJGB 4AVYA 1LC3A 2DAPA 2G0TA 2FZEA 3E6AA 1EFKA 1JU9A 2HMUA 2NTJA 4WNCA 3WB9A 5JDIC 1UAYA 1AGNA 5COAA 5DOVA 5JC8A 2X5JO 4EITA 2CDCA 5EJ2A 4CLXA 1YE3A 1H2BA 3ADPA 3WICA 3GZNA 1WW8A 2VYVA 4B3IA 3UHAA 1M6WA 4K26A 2IEDA 1VC2A 4MPDA 3GUCA 3I1JA 5AXDA 1NFFA 1HYEA 5B1YA 1KEPA 1X7HA 3MZ0A 1R4MA 3B6ZA 4M54A 3TRIA 4QSMA 4CMEC 2Q1TA 1TT5B 4RV9A 1IY8A 1ZK3A 2PLAA 1P0FA 4L9RA 4RVSA 4BO7A 1NR1A 4JBGA 4ZRMA 4FJ0A 4GWKA 4WLOA 4FOSA 3RCBA 4ZQGA 1LU9A 3NGLA 3CXRA 1LDBA 2W4QA 3I9MA 3LT0A 4LSWA 4CM8B 1ZZEA 2YFHA 3WQRA 2AQHA 3LT2A 3OM9A 4EYEA 2ZCVA 5EN4A 3NX4A 4BNHA 4AJ4A 3MJSA 4CR7A 2DUUA 1WMAA 5TT1A 3HQ4O 5KKAA 2AHRA 2Y67A 3NKLA 1IHYA 2VQ3A 2W2KA 4LVCA 2VTDA 3CMMA 2EJVA 1Q7CA 4DLAA 1LJ8A 4JIGA 4QO7A 2I9PA 4WEOA 2QW8A 3BXXA 2VWGA 4PLPA 5CPBA 2GERA 1E6EA 4OXYA 4Q3BA 1C0LA 4RPKA 4OOFA 1U8FO 3JQ8A 5KNLA 1LDNA 1UDAA 4TROA 5DCYA 4MO2A 2WD7B 5GZ1A 1GADO 4MIOA 1G6KA 1TEHA 3OEWA 1JKFA 3JQ9A 3UGKA 4D7AA 1A7KA 3D7LA 1NFQA 4PRKA 2NV6A 1PJQA 2HJRA 5L9AA 3VZSA 2HUNA 4OHUA 1DC6A 5F5NA 3WFJA 3JQBC 2BF7A 3V2UA 1BDMA 2HMTA 5CDYA 1D3AA 1IL0A 1CDOA 4Y8VA 1Q7GA 2JL1A 4L4SA 2XXJA 2C59A 3H7AA 3GPDG 5LDGA 3PYMA 4JXKA 3QLJA 1Y5MA 4EUEA 4EEXA 3ZZNA 3WGZA 4YTEA 3VPSA 1PJCA 3PZRA 3JQEA 2W98A 4U5QA 2OHXA 5TLSA 1E3SA 1BXZA 5ER9A 4XRRA 1WPQA 1B15A 3IKVA 4OIMA 4R01A 5DZSA 4N5LA 2I65A 4QUKA 4AG3A 2FR0A 5B12A 3BMQA 1L7EA 1YBVA 3KZVA 1DJQA 3ZNPA 4BNIA 3W4IA 2DVMA 3LLVA 1NTOA 4WLVA 3GN1A 3WWZA 5AOVA 4A2CA 4TZTA 2CNBA 3TL3A 2IDZA 5C7LO 3PZBA 2P4HX 1SPXA 4U7WA 4CM3A 4NU5A 1ZH8A 3HUDA 2VOJA 1H6DA 2NU9A 2EP7A 2VHXA 2C07A 3AI3A 3DONA 4UVDA 1F17A 1V9LA 2QYTA 2Y1CA 4WUVA 3RUIA 4U0KA 2D0IA 4YAKA 5KCZA 2IZ0A 1MA0A 1ONPA 2ZJ0A 1Y8QB 2J8ZA 5F1KA 3HG7A 1C1XB 4RPLA 1A9YA 4IUYA 4E2YA 5A9SA 3WGYA 4AJOA 4BKOA 5BSEA 1KY4A 4GLOA 3GRPA 4II3A 3WQQA 3JQFA 1T2AA 4JBHA 1N1GA 3DDNA 3VKVA 4PGFA 2I3GA 2YV3A 3ZHBA 2BD0A 1SOWA 3MTGA 1EVYA 4PG4A 3SBOA 5JAZA 1F12A 1VRWA 1R4NA 4MDHA 4F6CA 1HEUA 3F1LA 5U1PA 4ZN6A 1J6UA 1NBOA 3GA0A 5JDCC 5IZCA 1L7DA 1FDVA 5I9LA 3SX2A 1I30A 4BGVA 2OZPA 3E48A 4HBGA 4JK3A 4NI5A 1H94A 1H2HA 4BO9A 3L07A 2CF5A 1F8FA 2GCGA 2P9GA 3JQ7A 1ZNQO 2CD9A 3L6DA 5AXBA 5L7YA 4CV3A 2AMFA 5A3JA 1VSUA 2D3TA 1ID1A 1HETA 3IP3A 3I6QA 3RD5A 3TJRA 1SEPA 4JP2A 3VAZA 1I5RA 1JWBB 1E3IA 3G3EA 4KWHA 1HDGO 2YYYA 4MVJE 3K30A 3V1YA 1X14A 4AJNA 5AXAA 4R69A 2QZZA 3GOHA
chains in the Genus database with same CATH superfamily
1DWQA 1AHIA 3GUHA 2HU8A 4AZ0B 3FHCB 3T7CA 6REQA 4H0FA 2XMDA 1DWUA 4AUNA 2QRNA 2OVBA 1P6XA 1RWMA 4PIMA 4UVHA 1X1CA 4EB8A 2R8ZA 4AMVA 4A2QA 4HVTA 1KJIA 2PZLA 4RIHA 3TSYA 3UOWA 5FWXA 3TTWA 2WWTA 3H13A 3LL7A 2DBYA 4C3VA 4F4CA 1PLLA 1JVSA 4F1JA 2UXDB 1NI4B 1NBWB 4YP1A 1RQLA 2QD4A 2KLHA 2EFDB 3HYTA 4QDOA 1TM1E 2X9NA 1LDGA 3OPMA 5B1HA 2JIZA 3QU9A 4I66A 1QG2A 2QYSA 4GG1A 1B0PA 4LMAA 3SHFA 1IJBA 4CM6A 4RIIA 5P8WA 5TF4A 4EKNB 2FOIA 2I4TA 2IKSA 3E7PA 1CJUC 4N5IX 4QWWA 3TRKA 4ZJUA 5LXTF 4QAQA 4FYHA 3RLFA 1XCJA 5C4IA 1J2YA 4KO1S 2JFGA 1IQRA 1QB8A 4G5FA 2Q2QA 3R3YA 3A0RB 3VPHA 5ICMA 3HB7A 1N36B 5D01A 4CG1A 4QM7A 4HGYA 4L0DA 1XNRB 2YC2C 2R6R1 2OV6A 4D9FA 3RC1A 2ZRGA 4ZCSA 2XOKA 1MABB 1QG4A 4XDYA 1P4AA 2WNSA 3BMCA 2WWVD 2EDCA 1L5HB 1NUAA 1TKCA 2I99A 2IPOA 3Q7PA 5D1NA 5EE9A 4AM8A 1ESMA 1X1TA 3N87A 3K5WA 1RRMA 5G0VA 6ABPA 2GPNA 2CVPA 3A4MA 2FPPA 3IPXA 3CZQA 1IJFA 3H8VA 2QRLA 1XTIA 3GRKA 4IRUB 1Q0RA 4OHVA 2AZXA 4K6CA 1DC4A 1CQZA 1XN1A 1CUJA 3CG0A 1GZ3A 1V16B 2BY4A 2QP3A 3LG2A 2P90A 3M6VA 2C57A 1X94A 3HKDA 1PN3A 2PT5A 2ROQA 4RJKA 4QBGB 4LFBB 4MRSA 1G5HA 2C95A 2D1TA 4G2NA 3UQZA 1I80A 5K45A 4IHJF 1KQ3A 2XT6A 3O9MA 4NMLA 3HCRA 3D4NA 4G9EA 4TXJA 3SHVA 3AM3A 1JPNA 3UFBA 5ALVA 5F9HA 3V8EA 1PW7A 3U7QB 3T5BA 2DTDA 2WILA 3H11A 2HAEA 3KXDA 1HUQA 1OVMA 3EZXA 3OCWA 4REQA 4IFIA 5C8ZA 4FZRA 1QVAA 3S1AA 2XCOA 1T0JB 2DR2A 1F48A 2MINB 2JGJA 3KYIB 1UK9A 2BTOA 4QGGA 4EPXA 2UV8A 1MHPA 4G81A 4RHXA 1O54A 1FP1D 3Q2KA 3SSOA 3D7SA 3T52A 4HNSA 2N1BA 3VMFA 1VL6A 4UARA 1IRIA 5FX2A 2PY6A 3DVAB 3QLVA 5KMGB 2XKBA 2WMYA 3GJ7A 1UBSB 1RM3A 4KH1A 4IXWA 2X0DA 1CRWG 1AKVA 3TN7A 2D7DA 4DLYA 1ISFA 2JNWA 2OCXA 2Q1WA 1FVHA 1N57A 3L8HA 2PKWA 2EAUA 3WHIA 5B3KA 2O2XA 3BJMA 1BGVA 4J43A 5G3YA 1XHFA 3ED5A 4WINA 4R51A 3VKFA 3ZGYA 2XDWA 1PZMA 3FI9A 1DCFA 1KJJA 3LYLA 4QGFA 3H3XA 1MO6A 4I4IA 2GBGA 1Z06A 5KQSA 3DLIA 4MV4A 2IH5A 3DZGA 4U4AA 1M73E 1RI1A 3BICA 1NVMB 2WLTA 4TUYF 2PVSA 4AI6A 2C0QA 4F8JA 4L4UA 2FE4A 2EATA 1R9MA 1X9HA 2FUEA 5LP6B 2BN4A 1X3LA 4FILA 4QGSA 4HH4A 2Y05A 1U7ZA 4HAXA 1T6ZA 2DPLA 2R8EA 3ASVA 4NS4A 2H9AA 1MV8A 2IYAA 3WNVA 1CZOA 4COKA 1DKRA 3KPUA 2P41A 2ACWA 2ZSUA 3E05A 3B3GA 4Q1EA 4UHKA 2WUEA 3A9TA 2FUKA 2YJ4A 2ERXA 4CKZA 3F73A 1XF1A 1E1NA 2VUUA 1GZHB 1J8VA 5AT1A 3TWOA 1IQUA 2VRBA 3NMUF 3M6MD 1M9NA 4RM3A 1GQYA 4K8OA 1DWPA 5D3MA 1GPJA 1UBTS 3ZGVA 1Q22A 4DA4A 1C3VA 2D7CA 3QNWA 3GLGB 3DWGA 4RY9A 2DBRA 3QVGA 1YH3A 2WFLA 2Y2VA 1ZGBA 4HTFB 3I3OA 3L6CA 4NBNA 1E6CA 3QMVA 2RB4A 1MXHA 4EHBA 1A4UA 1VMKA 3HH8A 5K0NA 4D4HA 4B80A 2W5UA 4P9NA 4L78A 5IKEA 1XCPA 2DSNA 2EQ5A 3EE6A 3KKLA 4U3JB 4EGSA 3W2GA 4BNWA 3PEWA 3FOWA 1QFMA 2P5UA 1JNYA 4L0QA 2WABA 4JT8A 4Q02A 5DXJA 1KOLA 1DKNA 1AMNA 5FBQB 4IJWA 4QT0A 1GKYA 1KMCA 2QQFA 2CHFA 5DM70 4W7IA 1REQA 2MR5A 2CXUA 3WGKA 1N6NA 4EL0A 2X41A 1M8JA 4XPIB 3HVIA 1NUHA 3KX2A 1O0CA 3FBGA 4K28A 2C88A 1CR6A 1PP4A 2CXXA 4NNJA 5HKKA 2C1XA 1CY1A 2OCPA 1N6LA 2B8JA 3O75A 3I9OA 3K2EA 3WTBA 3T3NA 5C7IO 4Y2QA 5T57A 3EGVA 3ORYA 3JR3A 1GYPA 4XJSA 4DCGA 4I5IA 3HL0A 1IXZA 9MHTA 3ONDA 4LJYA 2WD8A 3BUSA 3KSBC 1ZKMA 3EDCA 3GA7A 2E49A 3QM1A 2WQ6A 3HM2A 3OLQA 2W0MA 5B57C 5IG2A 3UJCA 2P9JA 4RZHA 2XUIA 3D54D 5EZ6B 1JHRA 1P7YA 2EX1A 4RQBA 2AN3A 4H6VA 1XDUA 1ZUD1 1XXHB 3WGJA 4C0BA 4D9IA 3ZDAA 1FP7A 1I3MA 5AH0A 5HOEA 4ZU3A 1R2QA 2J3MA 2O06A 4TL7A 1FB5A 1T8SA 4F4UA 2YIMA 4QKQA 2CGEA 2J45A 2V7UA 4MW1A 3R44A 3KOOA 5AJXA 1BROA 1US8B 1Z2EA 2NGRA 2RH4A 1H05A 2EKZA 3K0BA 3KSUA 4JVSB 4OKSA 5JPDA 2QN2A 1OJLA 1UZNA 3W7VA 5BW5A 4PXAA 1Y42X 1M66A 5JXWA 3LDAA 4B0OA 2CMDA 3LX4A 2BM1A 2Q9BA 2Q6TA 5KSOA 1A50B 2VPWA 3THYA 1GAXA 1V9CA 4F85A 2JBHA 4CQMA 1N5DA 1VSVA 4GDFA 3OCJA 3IHKA 4OGWA 3IKMB 4CV1A 2EFJA 1PZXA 2BRUC 4HLUA 2Q4RA 3OF5A 4P2BA 3OQMA 5C1DA 1VJ1A 5DYNA 3WLQA 3W7AA 1W9MA 4I2NA 3CA8A 3ZX5A 5I9NA 5DXFA 2G5PA 4YJKA 3WYCA 2OXCA 4L85A 1YZVA 3RASA 4HDQB 2VJQA 4GPAA 2M6SA 3D3QA 5A1JA 2D7JA 4X1IB 1VSQA 1L5LA 2ODBA 5AK4A 1VBMA 2CY0A 2O19A 4YQEA 5ALKA 1HGXA 3VA7A 5LZ8A 3B6KA 3BTUA 1EVEA 2Y99A 2FN7A 1HQDA 3MRXA 4WI1A 1IIRA 2J0UB 5JPCA 4YHBA 1OGIA 1YR3A 4KSBA 5IDVA 4ZOQI 2PWZA 2XKJE 4MGEA 5MFPA 1H5UA 2QJRA 2DFNA 3OP1A 3RYIA 2XTAA 3MQ4A 2XCSB 2A7XA 1YASA 3BMXA 2G9VA 3UGJA 1LV7A 5FR1A 3W8EA 1IOLA 1GO2A 1OZ0A 1X8LA 2CFRA 3KB6A 3LFHA 4XQEA 3OE7D 5JCPA 1E4EB 4WHMA 1EVJA 2WWHA 1Y7TA 2VIIA 1WXIA 1CIJA 3HDHA 3MINB 5THKA 3WGUA 3ETJA 4XJTA 4C87A 1AS3A 2W6PA 1BWRA 5F98A 2D2FA 2JJ8A 5FDFA 3QHPA 4HCJA 1B93A 5JXIA 2ZJ4A 3K5PA 1H2WA 2GRUA 2GZ2A 1ECBA 3BE4A 3OEED 3AJRA 3IERA 1P3DA 3PGVA 1FC0A 4U9IS 3H2JA 3X2EA 1UT5A 1Z4IA 5HKAA 3UWDA 3ADBA 3OQ1A 3TX2A 1WETA 3AFIA 2X40A 4HDRB 4KHZA 3QKWA 1MT3A 2DQYA 5CT4A 5CB4B 4EF5A 4G25A 5I7FA 5LCXA 4OLAA 2HHHB 2PA0A 2HSJA 1SURA 1GSHA 1VIVA 3B48A 4FK8A 4B2LA 5HIMA 13PKA 1L8AA 4L28A 5KTTA 3ESYA 3O0TA 1L8XA 1FSSA 2A30A 2P9BA 3IQEA 4LTNA 1NQXA 1XTRA 9ABPA 4P86A 1SUIA 5D6NA 3X1MA 1TW3A 4LGVA 2FKNA 3T9DA 3VR6D 5IF3A 2TMYA 3B9QA 4LGMA 1DDOA 2BH2A 2O2ZA 4RGBA 1WMDA 2XMZA 4P84A 3FPBA 3OZBA 4CQLA 4Q3CA 3U2QA 2FFQA 1DL5A 4BFVA 1WVGA 4IHKA 1T8UA 2VP6A 2P8SA 5C1IA 3G0BA 4GUAA 1P7PA 1JJIA 3Q3EA 3T7AA 5FH9A 3NTRA 3ED1A 1HQCA 3WWEA 1ICEA 4JJ4A 2B4RO 4TLDA 4CEIB 1NLMA 1QHEA 5IANA 2FWRA 2H2FA 3I8SA 3GDWA 2GNAA 3U5TA 4AC9A 1WABA 1J09A 2NYAA 1RZRD 4LFAB 4YP7A 4QG3A 5AJWA 2QS9A 3AI2A 3HLTA 3R0VA 2GXAA 4DZTA 4RQAA 3UICA 1XT6A 3ITNA 4RDIA 2WM3A 1JG2A 2AE1A 5I3CA 4E30A 2P9QA 1USWA 4K1LA 2WF6A 4BC0A 4CMCA 2Y71A 1GRVA 1P7WA 5IAJA 1EG2A 3TTSA 4BGDA 5K2MA 3KTDA 3OMWA 4IICA 5JOQA 5HIJA 2LRHA 4M7WA 5HUHA 1U6IA 4FDLA 2IV3A 1TEXA 1UDXA 1W19A 3BCRA 4FEEA 4C29A 1I24A 2YIVX 3LF2A 5EMKA 5TIIA 2JDIA 4GU5A 4PGMA 2DBVO 5IKOA 3RNLA 1NXWA 2BC9A 4DLBA 4EG7A 2GZRA 1KVQA 1C0KA 1RPTA 2XSZA 5TQVA 3PJRA 2D1SA 3PUJA 1ZJYA 1DE0A 1ORHA 2AUMA 4Z8XA 5A3VA 3FG9A 4I50B 1CK4A 2QVXX 3UC9A 4C0AC 1N0HA 4JXJA 3WK4A 1TRKA 4V0OA 2GVZC 3FNIA 3SE7A 4LVOA 1U3WA 3UGQA 5AI6A 4I7EA 5AVQA 3NXSA 4IHQA 3EZYA 5ANRB 3EZFA 3ZE7A 3ZHSA 1T5LA 1P74A 1B2LA 3L7DA 3SIXA 3VC2A 1OH7A 1GZ5A 2ZI9A 2DQSA 2LVBA 2OP1A 5JQGA 1EEHA 2GTPA 4GOLD 1T2VA 2GK6A 1Y3AA 3CLHA 4LDJA 1NRIA 2ESRA 5F4BA 4Q4DA 6REQB 3PE6A 4Z99A 5G3ZA 1H9CA 4TMWA 2IY9A 3NWJA 1CTQA 2QZ9A 1CP2A 1X8XA 2I4IA 2R0QC 3NG1A 2Z57A 3C8HA 4TTJA 1Q50A 2CXNA 1P2DA 3QU4A 1YC5A 1S02A 3ELBA 5FWXB 3NH6A 3BWDD 3CZ9A 1FNCA 4MGYR 3B78A 2C2OA 3O8NA 3MRTA 1Y3IA 3H2IA 4C6RA 4C7XA 3B1KA 3JS5A 2FW6A 1ANKA 1NJSA 3C5EA 3I39X 4I0WB 4JP3A 2HBZA 2BFBA 4XH9B 4ZQIA 5FHRA 1N7GA 1Z4NA 3L4BC 2RGEA 1WSDA 2HV9A 4U7FA 1MC5A 4MRPA 4XLLA 1ADBA 3OVMA 4YAWA 3DCYA 3SOPA 4C0XA 4TM8A 3HU1A 2ZSKA 3BM5A 3R24A 2CDRA 2BI8A 3A1DA 5CR9A 5DP2A 3AETA 2VT7A 3VVCA 5BR1A 5GIPE 4BO3A 1SH7A 2DKOA 4EVRA 3M3DA 3WGGA 4BE4A 5FOWA 2ATCA 2PT6A 2YWGA 5JD3A 4R1PA 3WLKX 3DE3X 1BEUB 4RS3A 2O54A 2EIHA 3PLNA 3KQOA 2ZYGA 3JY6A 3FPCA 4BVGA 5LA6A 3HXQA 1YV9A 3L7AA 5A4KA 2G08A 4WSOA 4E14A 1IIBA 1PTJC 3T06B 1VDMA 5DK6A 3QTLA 4A5SA 1FYXA 5KIAA 1U8YA 3GARA 3KELA 1XMQB 3GLHE 2QF7A 3E7XA 3RK4A 1HR0B 2BW0A 3ZI7A 4NBKA 3BMCB 2IYNA 4TSFA 1AG9A 2RE8A 2OBFA 3MD0A 4MGIR 3OQNA 2IU4A 3NOVA 2FPPB 2ZQZA 3QOXA 3ROMA 2VKQA 3S2IA 2F1JA 1L7PA 1F8YA 1E2KA 2V7VA 5FPKA 3P2MA 2LE0A 3OMXA 3WJ1A 3H7IA 1I4EB 4RDXA 3LGAA 1Y48E 3WIBA 3PU6A 5IARA 4C5CA 4BMNA 4F0JA 3HEAA 3KB2A 4UREA 1JDTA 2WKQA 2XUDA 4ISBA 4ZVQA 3ZHUA 1NWCA 5KTKA 3OA2A 3NTVA 7AT1A 1A5BB 3DWIA 1V5GA 3K9BA 4TMXA 3ABRB 5T4BA 2QTMA 4IIEA 3G2NA 4F2DA 5HW0A 4L6IA 1XDSA 1QG0A 3ZHOA 2VEOA 3H11B 2C2KA 2QJOA 3L0CA 3SJ7A 2HCFA 5I9BA 2VDUE 3EY9A 2GJ4A 1ECPA 1JVNA 3HBLA 1JIIA 1Z0JA 3S1AB 5KVSA 1K7EB 3HWRA 3UWSA 2ZUFA 3N86A 4ZODA 3TPFA 3TZHA 4KPGA 4O2RA 2FPOA 1BHSA 2V7XA 4M9SA 4UTRA 2Z08A 4BLUA 3M1LA 2JFQA 1GYRA 2HLDA 4FFSA 1E2HA 4FSXA 3OZGA 2X77A 3QU7A 4D57A 4KO2S 4TV9B 4KLRA 1QNFA 1JF8A 1I32A 4RFLA 4O4HB 4Z53A 1JEYB 1EBUA 2ZIAA 2ZQ5A 1KXJA 4PE5B 3CEJA 1NU8A 3GBVA 4UKDA 3CONA 2C2GA 2IOFA 4C7BA 1MIOB 2V7QA 1YS4A 1QCYA 4PV7A 3MT0A 1O94A 1SHUX 1VJTA 2RHOA 2B83A 4Q3AA 2PE5A 3QE4A 4KW7A 3UPDA 2RGDA 1PEDA 2F1OA 4RF5A 5EYPA 1GTZA 2W6CX 3DHVA 5D5PA 3TMYA 3ZHRA 4C2AA 4LF6B 5EMJA 1C0IA 1Y98A 3MLBA 1GIAA 2B1QA 3S5JA 2XHEA 2Q5IA 4BKUA 4EP1A 1GGNA 1TLFA 3QBTA 3QLUA 3W4KA 3LECA 4JR1A 4XX0A 3RSZA 5CD9A 5AI8A 2Z43A 4WOKA 2H59A 4O5OA 4AFNA 4DEXA 3ZGLA 4O1HA 1HNNA 1NF3A 3M34A 4IGKA 1EIWA 4M1TA 2I7DA 2XV1A 4RDHA 4RZUA 1UMBB 1X1EA 4MKXA 2VWHA 3VR4D 1XXLA 4ZVNA 2YQZA 5CB6A 1G42A 3G1WA 1SCQA 3EOZA 2CVOA 1DQZA 3EZNA 5DX1A 1DGQA 3UCEA 5D3MB 4CETA 3PNKA 4OP2A 1NNI1 1X7XA 2Q41A 4AZWA 1ZOLA 2YZNA 4GI1A 5FI0B 3O92A 1O96A 1IG3A 2HA5A 3QVGB 5IS2A 3GYBA 2ZIEA 1K4YA 2CJFA 4IKOA 1VZ3A 3T4EA 5FL7A 3ZWXA 3D4LA 4MP3A 1TQDA 4NMXB 5K8LA 1NSTA 4CEJB 1W2WB 1Y1RA 5DYTA 3N0XA 3ZN2A 3QVOA 2X1VA 3WK5A 2B78A 3MCWA 4DIBA 3IOYA 2G72A 1PD0A 3NBMA 5HIIA 1XD8A 2ZYDA 3MLAA 2YICA 1NW7A 4QBIA 1DLJA 4FP9A 3RIHA 3G89A 3CNBA 1VLVA 2VG8A 4RF4A 1N6OA 1J90A 3JWEA 1YQUA 3W6PA 4OXIA 4OSEA 1U0GA 5FOTA 2N0SA 4C1NA 1CZUA 1J8FA 1XVLA 3BB3A 3U7GA 1WKCA 1VHJA 4D42A 2I67A 2JIDA 1QBKC 3A9WA 1REQB 3JASB 2PIDA 3TVDA 2VP4A 3AHFA 5ADVA 2RG1A 1JDNA 5K8JB 3L8DA 1DOZA 2ZJ5A 4EPWA 3N2YA 2F9FA 4XCVA 3UAVA 3TG2A 2BEVB 1VCMA 4BE9A 2MT9A 2XZTA 1HSOA 1U2ZA 4GI3A 3EWAA 5E1OA 3RC9A 4ZYVA 3FPHA 3THWB 1BU5A 5IXSA 4M46A 1NVDA 2R8XA 1Z26A 4HVAA 4CI0B 3B38A 5A6VA 1FZQA 4BBZA 4N54A 2SKCA 4YK7A 4LJSA 4CIYA 5KTNA 3FOEC 3M2PA 1E3JA 2HQ1A 3ZDEA 2ZP1A 1G64A 3F4LA 3GUVA 4I8IA 3Q7EA 4ZT4A 3NAQA 4BNDA 1V1JA 1UJNA 3BB4A 2APJA 4EZEA 3SHTA 4O08A 1RBYA 2H1RA 2HCBA 1L4FA 5H8WA 3VDRA 2UYYA 4UBMA 2GN9A 1G8KA 1NJ1A 1VL8A 3ANTA 3ZXIA 2PUFA 4J3FA 1ECFA 3PDIB 3A4NA 3MCUA 4K3VA 4M8SA 4UNNA 4YRLA 5AWFC 5LD2B 2WV9A 2G1AA 2WJPA 4IIVA 4DEVA 1XVAA 2GD1O 5G4KA 3EFBA 3I9KA 3FCYA 3UC5A 5JD4A 4LRUA 5JAPA 3COWA 1LH0A 3FROA 3PWTA 1CQPA 4MIYA 4YMUA 2J9RA 4CIAA 1FDUA 4J3JA 4NOKA 3KT8A 1XQ6A 3VVLA 2D2VA 3THYB 4ZMBA 1D2EA 4CQMB 1M6YA 2GBFA 3AUFA 5ECGC 4BP3A 2B7BA 1YVPA 3BQ9A 4QREA 1FLDA 1YJCA 3KQVA 3K53A 1TVKA 2Q9AA 3QUSA 1DOHA 3Q3IA 2VDJA 3K6RA 2OC4A 4QXMA 2X4GA 2WUDA 1XA0A 3EGOA 4FUQA 4HDOB 2RI0A 1XD2A 4N03A 4I08A 2GHIA 3VISA 1M76A 3VNVA 4Q1AA 3CLRD 1AUXA 1AT1A 2DZDA 3ZY5A 4YMTA 1YA4A 3HVRA 5JRJA 2EQAA 3TVYA 3CCCA 2QGZA 5DNAA 1B2RA 3L8YA 3NHBA 4B7ZA 5JZ9A 1QNLA 1L3CA 3QH4A 4WOJA 1KETA 3GDFA 3SXUB 4TLCA 4M89A 1NQWA 1UKVY 2DFDA 5LXTA 1G3UA 4GPZA 4O25A 4YRSA 2H65A 4S1WA 2HCTA 1KGDA 3ENNA 4QIHA 1DJLA 4FHFA 2CJXA 2JFZA 4K6FA 5K4AA 3GLFA 3MAGA 4OXQA 4IWYA 1G4HA 2JFWA 3AP1A 3BFJA 3PJFA 5T6MA 2CWDA 1DIAA 2V6BA 5C81A 2DT8A 4NYMQ 4WFKA 1U5BA 1JAZA 3JYHA 5HQ3A 2ODAA 2PWBA 2VL7A 5A4MS 2HYIC 2WF9A 5HS4A 2SCUB 2RHCA 2WSIA 4ZCTA 3HJTA 3PQ5A 4C3OB 4MVXA 4CFZA 5K0FA 4F5EA 4CBVA 4N41A 3KBOA 1ZYUA 1A9XA 1GGJA 3IDFA 1A3CA 4F60A 5EJFA 4ZP1A 3BVPA 4YS6A 1ZGHA 3JPYA 5KNCA 3LHDA 5BW6B 3FUUA 1XPOA 1ZM4A 1BXKA 3HA5A 4Z0TA 3AJDA 1HYHA 2HKIA 5DM4A 4IHJA 2NW6A 1OH6A 3FPJA 1XAIA 2M6LA 2VDKB 1MGOA 1L7BA 5LIPA 2ONJA 2GLXA 4EFMA 2XCUA 4RZXA 3LDUA 4QYXA 1GPYA 2H18A 4TYWA 2ZWVA 4QU9A 5ESWA 2ID7A 3GD5A 1E3WA 4FYMA 5IVHA 3QQ5A 1P8AA 2EGHA 1YDFA 2XUOA 3SY8A 4MV8A 4F72A 4F4FA 1GN8A 2OZKA 3KJFA 4PSVA 2V03A 4TL6A 5CAEA 2G0AA 1GTJ1 2JVJA 4KYTA 3THXA 2IZ6A 2XJ9A 2YN2A 1J9ZA 4L5IA 5C46F 1NM5A 3ZDDA 3HCAA 3ZYZA 1G18A 1K2VN 5F73A 4FOTA 5FAKA 2AJDA 4CQLB 4YJ3F 1Y8RA 3T0FA 1XJ0A 4RLSA 1Y9ZA 3CH7A 1O5IA 1CUEA 1I2ZA 2SKDA 3B1XA 5DBGA 5FFFA 3OZAA 1JPUA 1VJ0A 2W6MA 3CKYA 1XLUA 1Z47A 3NWPA 1EVKA 4ZVMA 5IKXA 4B4OA 1RYHA 5K0GA 1B6SA 1XRJA 3T34A 5C51B 2ET6A 3VFDA 4ER3A 4H7FA 4I46A 5LYYA 3K0CC 4GXQA 2QT0A 5DBFA 2ZUBA 2AEMA 1X80A 2R44A 2C54A 4LZZA 1EUDA 1RRVA 4NJEA 3M2TA 1PFUA 1KVSA 1W1WA 2VTEA 3NTQA 3GPCA 3ZW8A 5IC4A 2K2WA 3H5LA 5JV5A 2J5QA 5A2GA 2WV7A 2ZR7A 3BGIA 4AP5A 1ABEA 2WZDA 3AW8A 2XNDA 3AI1A 2QMQA 3FPFA 3BRWA 3ABZA 4HDKA 2CHGA 3M5PA 3D64A 3W4JA 2UZ1B 3ND7A 3PUXA 1UJMA 2WU4A 3R23A 4ANFA 5DCLA 4MLPA 4BP8A 3R74A 2Q45A 1NNSA 3OFJA 1FTNA 3AU9A 1SZPA 2V4MA 4H1VA 4JKYA 1SCUB 2KLBA 2QTTA 4IZIA 1N5KA 5EQDA 2DETA 3F46A 3PVZA 3ABIA 4W7HA 1MDBA 5TQ0B 1N2XA 1H0SA 3LP8A 4I1UA 2HL6A 2HPZA 2PBLA 1G0NA 2PH3A 2PV0A 4JI0B 3HJGA 5KS2A 4RMHA 3AW9A 4XGKA 5AK3A 1THTA 2NXJA 3O4GA 1WXHA 1XZDA 4GBMA 4XA8A 3D31A 5BUCA 3CJTA 1BW9B 5IEJA 2ZIUB 4B4UA 4JVLA 5BN1A 1DDIA 2OECA 1XZPA 3NNSA 1E1DA 3DYVA 4G5QA 2NXNA 3H99A 1JSCA 4LV8B 1XRMA 3R0JA 4RK4A 1OT3A 3IXQA 3HEMA 1BFDA 4UZEA 2RGGA 5FOXA 5GM2A 5HKOA 1W0JA 3TK1A 2C31A 4G0XA 1ISIA 1NYLA 3DP9A 1RNLA 4RSHA 3PQ4A 1JH9A 3SKVA 3B1JA 1PS9A 2DB3A 2JI6A 2ZKLA 5JD5A 1LI5A 1G6HA 1ZONA 2OO3A 2ZUSA 4GOOD 1FFXA 4IIJB 2CLCX 5CLJA 1K5HA 3BC1A 3IBFA 4FW9A 3ZU5A 3N2IA 2IYXA 4CVNA 2P9ZA 3GG9A 4PZEA 5JQGB 4K9DA 4DGSA 1R6UA 3C7TA 4NPCA 3IMGA 4Z2AA 1U7XA 4X00A 3AT1A 2I2CA 1G5TA 2IOHA 1B6RA 3BWVA 3F97A 2X19A 5EWMA 2CUKA 2O7VA 3HGMA 1JE0A 3G59A 3OJEA 1GFIA 4L7QA 4XARA 2ZRJA 3FPKA 4CMIB 3CCBA 1T8RA 1KPGA 1N6IA 2O2IA 3OTQA 5CA1A 3FNGA 3ANLA 2Q0QA 1JIVA 1A88A 4Z86A 1DCKA 2Z6VA 1CLEA 4AF6A 1GPMA 4B3HA 3OCUA 2X42A 4XYBA 5FFNA 4HRAA 5ALOA 3DZDA 4INPA 2QD3A 1T6NA 1A2OA 4E88A 1GQOA 4OLFA 2JAQA 1UZMA 4F9EA 3KLMX 4KXVA 4ALLA 2EV9A 4KDFA 2XT0A 4OAPA 5C52B 3OCYA 3PNVA 4TXHA 2VCYA 1CUDA 5DN9A 4KTVE 4DIUA 3GPIA 4DRXB 2P2LA 5IDWA 5CITA 4JP8A 1YCHA 3A6GA 1OROA 3V4LA 3DTVA 3W04A 1GUDA 3AETB 3ISTA 2B7LA 5C9ZA 2A0WA 2FRDA 1H6BA 3FCAA 5DFAA 1G8AA 3STWA 4OH1A 3EEFA 4M6WA 1NY6A 3R3UA 4F8YA 2F1HA 4D0SA 5IJZA 3PNSA 5FV7A 4R7ZA 3RIMA 1BGXT 4C4TA 1MENA 3PLRA 2Z8YA 1YRYE 4JLDA 2RGWA 2ZJBA 1SIWA 5LA6B 1A5SB 4RANA 5L4NA 1H23A 1Z2DA 1YQGA 2MDTA 5TGTA 2RHMA 2VPZA 3ENKA 4B82A 1M0EA 1JQKA 2WVGA 1Q74A 4LOKA 1R6DA 2OYSA 2YWEA 3GV0A 5MN6A 4WACA 1S2OA 3D7KA 3G8AA 4OU4A 3O8LA 3NM6B 1NW3A 3SAJA 4KVFA 4DG9A 1IPFA 3M6XA 1KMIY 1OASA 2EHJA 2VDWB 1Z37A 1WSWA 1KDVA 3FOAA 3IHWA 1VCOA 1YB6A 5GJCA 1QH1B 4DMLA 2ZAGA 1FDRA 5JYCA 1OLSA 2VYNA 2ZJ7A 3LC1O 3P97A 3E7WA 4ZRDA 3M5WA 5G4LA 1QV9A 3SF8A 3PIDA 1K7SN 3WYAA 4OGGA 5J4LA 5DT9A 1W25A 2I1LA 5YASA 4GOXA 5BN3A 2PRZA 2PAAA 2QQGA 1GSOA 4C06A 1WXFA 4DMUB 4EI2A 4BNZA 1H8HA 4HYYA 4IEIA 1IZYA 3D4OA 3K9LA 3LQRA 5MGBA 4OQZA 5AW6A 2XB4A 5IJ9A 4A27A 3EXFA 1GU1A 3QVSA 4C43A 2F64A 3W79A 3RJMA 4ETMA 1I36A 2ZFUA 2B8TA 1BIFA 2Y6VA 1KDYA 4S24A 4OHZA 2EWMA 4OA8A 1DC3A 1NW5A 3PPVA 3SGLA 3NTXA 4D3ZA 4Z3KA 5JSZB 3TXAA 1UUFA 1MJFA 3DCNA 4EDHA 2OORC 4UBNA 4EJ0A 4DPMA 2R6CA 4HEQA 4AZSA 5BRJA 4BBPA 1I7LA 1I7PA 5TPZD 5HILA 2CLMB 1Y37A 3CFYA 5FTMA 1MDFA 3RTBA 4ZT7A 4WJLA 2WSBA 2C29D 4TS3A 4OKNA 1H8EA 4M9QA 5CP8A 4LCEA 2IOQA 2PX6A 3IUJA 4RIFA 5ALZA 3AR3A 4ENPA 2CE2X 4BO6A 4ZDIA 1RQGA 2EZUA 1DAIA 4KJZA 1Y33E 4R3NA 3QE3A 2MCFA 4FLFA 3SYRA 1Q6YA 1JLSA 1ZO8A 3PRYA 1HL7A 4US1R 1AZSC 4XYEA 3G9TA 4CZ2A 4QQNA 4TWRA 3AF5A 3ZCRA 2HK7A 1V26A 2CC2A 1NONA 2EGGA 2HBYA 1J2RA 1J25A 1UC9A 1R10A 4EG4A 2YVLA 2H48A 5TY0A 1ZRMA 4V03A 4ZC8A 5E3HA 3R9IA 3WMWA 2QXUA 1OWOA 2W9XA 1OXBB 4GVLA 5IEBA 3S4YA 2P75A 5JBQA 1NBHA 1WDWB 1KS2A 3WRVA 1VSTA 3AP3A 5EZYB 1UXGA 2BUBA 4FI3C 3RFUA 3M1YA 4V1CA 3U7RA 5JHGB 5FLXA 4KAAA 3WBKA 4HWKA 4NC9A 3PL5A 3X43A 4DG5A 1JH8A 4US2R 1SXJC 4H7HA 2WG2A 4DDHA 1N2CB 3D3EA 1SIBE 1K4MA 1KXZA 1ZICA 1QK4A 2IJGX 1V47A 4LOIA 3PJGA 3CS3A 3QMWA 1UC5B 3R6DA 4O2AA 3UF0A 2F3TA 3NC1C 3CX6A 3H9CA 1KC1A 3F7NA 2D1FA 3ZLJA 1UODA 3LGSA 4Q5IA 2GKOA 4OK5A 1O96B 2X76A 3MJEA 4Y0VA 1GCOA 5AI9A 1NLUA 2BCEA 2NLOA 5KAPA 2ZWMA 2IF2A 2FMUA 3ETLA 4YCAA 2DQKA 2HWWA 4O02B 3L41A 5TB5A 1Z75A 1F1JA 3ZC3A 3ZR4B 1U0RA 4NCKA 2NU9B 5KWIA 5T3YA 2YQ4A 3B9RA 4C01A 1CJBA 5ETJA 3WOHA 1V9SA 3AF4A 4ZO7A 1D7OA 2WRZA 5FV4A 5GINE 3FAZA 3LXUX 4MW0A 3S70A 4UNSA 1DI0A 4BECA 1S2NA 1GGKA 2BSXA 3AOEC 3IXMA 1PDWA 4RLFA 5A9SB 2GM3A 5AK5A 1KOJA 2QNIA 4FBLA 4PX3A 5K0JA 2HT6A 2ZETA 4OQFA 2ATEA 4Z1MA 3JVUA 1T9BA 1IB6A 2MSEB 2RB5A 1U1CA 4MAFA 3A2LA 1GZDA 1TO2E 2YMMA 5AKLA 5BR8B 3PEYA 1I10A 2XGMA 3NXKA 4D6XA 2FFJA 1T1IA 3L5OA 1KFKB 3BFXA 3I05A 5GONA 1T3LA 2FWMX 1XWFA 4FLMA 1M2FA 5J9FA 4DA0A 4KKXB 4ZEMA 4UASA 2V6GA 3TQSA 4G5HA 4NY1A 5G0UA 2I71A 1Y9JA 1Z0UA 2J4DA 2NO6A 3GFGA 3SSNA 1MC8A 4C9BA 5JWRA 3V1UA 4MJ7A 3EA4A 3KKQA 4CU2A 3ZG6A 2AI2A 4DQDA 2DPXA 4R1MA 4QPJC 521PA 3OIVA 4BDSA 1EU1A 3X1XA 5JY6A 2C5FA 3EA0A 4LBWA 3WQHA 4HGRA 4ZI5A 5KNDA 1XU9A 4N39A 2QR5A 4R1OA 1W48A 3G13A 3FWPA 1V3TA 1SBCA 1SQ5A 5IUKC 1K97A 3FR7A 4BMDA 4XLZA 2IHZA 2EOAA 4DIOA 1KKLA 1XJCA 2R1UA 2NADA 3AGQA 1XU4A 1Q1AA 1U7TA 4TRRA 4B85A 5C7OO 1SCJA 1Y1PA 5JTTA 3NM5A 3T9FA 2YFYA 3X0DA 3ZCSA 2Y1EA 1U7PA 3CISA 3LZDA 5JCJA 1SU4A 1AS0A 1YRAA 1I33A 3AEXA 3LA8A 2PR2A 3DNMA 1NYQA 1WF3A 2JD2A 4I55F 4EVQA 1NE7A 5IULC 4KFSA 2PSSA 1WW2A 1WHTA 4XVUA 4MUXA 4FZJA 1FX0B 3LXMA 4V0ME 3F90A 4C3UA 4MRMA 4IF4A 2QL9A 3WSWA 4D9HA 1LBSA 1JFVA 1XD2B 4A8JA 1D03A 4YPOA 1ZR2A 2L42A 2CK3A 4OK3A 2Q0XA 4QFMA 1ADGA 2J9FA 3AEKA 2G80A 2UYGA 3PGJA 4HB2A 2JHCA 2F62A 5A5VA 1V43A 3EC1A 1FA9A 2LIPA 1Z15A 3EOAI 1SKBA 3N7UA 1XI2A 2FV8A 4PYKA 4YALA 1Z6TA 5KC8A 3DMDA 1Q21A 1FNMA 2VYFA 3S2UA 4ERNA 4FYXA 3U17A 3X2FA 3NHUA 1K8YB 1YB2A 4QQFA 4Q3KA 3WBBA 3P9YA 3WDLA 1XZBA 1R8QA 4AJJA 4E21A 3RM3A 4ESVA 1FRZA 3GLFB 2YNMD 2QMZA 3X1DA 5JAUA 3QY0A 3T1VA 4BZQA 1F2TA 2F9LA 1PS8A 3OX3A 3TNDA 3N2GB 3Q3CA 1KMMA 3BJRA 1YIDA 5JZMA 1N3IA 1Q7EA 1RP1A 3KV1A 5CX1A 4F04A 3GLIA 3QHAA 1RPZA 2RGNC 1U5BB 5A9TA 5HQ3B 2BRUA 2ZDGA 3CE9A 3B7GA 3LL4A 2RAFA 3QUQA 5THQA 3AYZB 5CCBA 1IWBB 5JJ5A 2B82A 3A6EA 3NRCA 1YOBA 1GGHA 2WNIA 1FDIA 1A9XB 4Z51A 2EXXA 4MJLA 1I1QB 4O4LB 1YJBA 4YQZA 1KAHA 4K05A 5H70A 3T7KA 3TKLA 3MJDA 3R6WA 3V1TC 4FT2A 5EJ5A 2LKDA 2Q5FA 7GPBA 4EAAA 5C53B 3TQCA 1E2DA 3AVTA 2CCJA 3I2JA 2QV0A 1JHAA 1N8SA 4N5DA 2H31A 4UAJA 4KPFC 2PXAA 5DPMA 1AMOA 1N2BA 6GPBA 1NURA 5DYIA 3M7IA 4E5YA 1HLGA 4OBEA 1V41E 3IMEA 4N3BA 1E3WB 2CLEB 2Z2IA 4TVOA 5CJ2A 4YYEA 2AF4C 1MEJA 1K6IA 3WMEA 4CF3A 1XDBA 1IZ0A 2F7SA 3MK31 3AVXA 4H15A 4JI7B 2K87A 5DBOA 1GT6A 2RONA 2AJCA 3SOZA 4RA9A 1MOSA 2C0CA 4MUMA 1NPYA 4DBVO 4V0QA 4BMXA 1XR3A 3E9CA 1T91A 2FZKA 3GT0A 3LWBA 4YROA 3TE7A 1U1IA 1MR3F 1Z08A 1Y8RB 1OIWA 1NKSA 2FFAA 3PPYA 3N39C 4ME6A 2C9OA 2CL0X 1JAYA 2J0EA 4L8WB 5HXAA 2QPLA 4B8ZA 1TMKA 1IOZA 2IC5A 3AB3A 3QBDA 4MPPA 2QU8A 2VSNA 1WV0A 5JNSA 5JAHA 5T6BA 1THZA 1NQTA 2Q8NA 4AECA 1KAMA 2MSKA 2CNLA 4PANA 2ZI4A 4DS3A 3OIYA 1ZGGA 2NT3A 2A9OA 2VCHA 4NV0A 2EFEB 1H69A 3FZNA 5ESRA 5GPBA 3RAPR 1JDBB 1X80B 3CZMA 5HRUA 1EUDB 4NJEB 1S4MA 5D85A 1QE0A 4G5XA 2ODTX 4A1OA 4JXXA 4A15A 1CCWA 2QTZA 2FMXA 3QPWA 4DB2A 1WB5A 1ADCA 2VNJA 2VVTA 3ICVA 4JLJA 4YMWA 5HF6A 4ZGBA 4HDKB 1O95D 1RYDA 5IK2D 4FI3F 4GPD1 4ER0A 3DZJA 3GJQA 3P9QA 3ETDA 1KYYA 2C4WA 4QUAA 3M82A 4MV5A 1ZJWA 1XRNA 3C5WP 4S0ZA 3PD7A 1SGWA 1XB2A 1A5ZA 2ZDHA 3A9SA 3CM0A 3ESCA 4FD2A 1TVCA 4YAJA 1NBEA 4YWJA 1TECE 4QOJA 2DHRA 2JIPA 1TEVA 3RKRA 1RJEA 3V8NA 4YRRA 3ZDQA 1NBMD 1E2BA 1IULA 1S9HA 4EECA 4LAFA 5ALEA 4X94A 1E3LA 3KM0A 1JP7A 3AONB 1FIUA 1N1MA 1OA0A 1G5PA 1PLKA 3ENWA 4PF1A 4JNCA 3IDSA 1UQUA 3UT6A 5BW4A 4EKGA 1KJZA 1YQWA 3V2GA 1CB0A 1RQXA 4LFCB 3T3OA 2VJDA 3IT1A 3PA6A 5DF1A 1C3LA 1UT8A 1JIUA 3C15C 4ZV9A 1E89A 1OBCA 1W4BA 3PRKE 1GOTA 2PX8A 5CVUA 2BJHA 4ZOBA 5T41A 3RS0A 1UPCA 4II2A 3HDTA 5U9CA 3BK2A 4RPCA 3V8QA 4ILKA 4YEDA 3GK3A 4AAYA 1Y5IA 4EARA 1Z25A 2WDZA 3JSAA 2WSSA 4ZC1A 3MERA 4XGRA 3ZHXA 3P4YA 4TVBA 1Y3HA 2DWUA 3DS8A 1LSJA 1I5OA 3OESA 1XZAA 2FUG1 5EHIA 5G0TA 3RRXA 4EY8A 2NZ8A 1EFRA 4JROA 4ZREA 5EWMB 4KXQA 1WTAA 3ADKA 5CYOA 4WBSA 5EL0A 2AS0A 1BDJA 4KWIA 5CA1B 1BNCA 3PUYA 3A7DA 1IUKA 3EVZA 4XD7D 3LC2O