4CJXA

The crystal structure of trypanosoma brucei n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) complexed with nadp cofactor and inhibitor
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
297
structure length
297
Chain Sequence
b'MPEAVVIDGRAVAKAIQKELTEEVALLERRYKGRRPGLSTIICGKRKDSQTYVRLKRKAAAACGFRNFSVELPANVTQEALEREVIRLNEEEACHSIVVQLPLPPHIDKVAALSKIKPEKDADCLLPVNVGQLHIRERNPAIVPCTASAVMELLRCSGVEICGKRVVVLGRGDIAGLPVATLLANEDATVTVVHSATPLCDIADIVRASDIVVSAAGQPGLVRGEWIKLGAAVIDVGTTPVADPSKVPGYRLVGDVCFDVARKRAAYITPVPGGVGPVTVSMLLKNTLTMFKRSVRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-1-TETRAHYDROFOLATE SYNTHASE, CYTOPLASMIC, PUTATIVE
publication title Characterization of 2,4-Diamino-6-Oxo-1,6-Dihydropyrimidin-5-Yl Ureido Based Inhibitors of Trypanosoma Brucei Fold and Testing for Antiparasitic Activity.
pubmed doi rcsb
source organism Trypanosoma brucei brucei strain 927/4 gutat10.1
molecule tags Oxidoreductase
total genus 104
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature ec 1.5.1.5: Methylenetetrahydrofolate dehydrogenase (NADP(+)).
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00763 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
A PF02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cjxA01
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 4cjxA02
3DFZA 5ER9A 1HF3A 4WCFC 5JC1A 1T4DA 4OH1A 3E5MA 3KOUA 4B7UA 1ZXLA 4RPLA 5JW6A 2F00A 1C1DB 3ZV6A 4WNIA 2QIOA 3PJDA 4IGFA 4DC1A 5IJZA 1KVSA 2DU8A 4FJ1A 3FN4A 4IZIA 4W9NA 3OQ6A 2X4GA 5B4VA 3K31A 4U6SA 3BTOA 4IJVA 4JLWA 4DTIA 2RH4A 3DBRB 4YAKA 3ETEA 2NVBA 2W8ZA 1FK8A 4R16A 3WLEA 1LRLA 1NPTO 4OKNA 3RAJA 2HKIA 1HWYA 4HNGA 4Z9YA 3H7AA 4CJXA 3FTPA 2J5KA 2JCVA 1XCBA 3I83A 3O26A 1WZIA 4CQMB 3KYCA 5F1OA 2PFGA 4XX0A 4KQXA 1X1EA 2NNLD 4FFOA 1G0OA 1ULSA 3C3XA 1HE5A 4W82A 3HDHA 1CYDA 2PGLA 2YYYA 4KTVE 1Y8RA 1RM3A 5JE8A 4E0BA 4NK5A 3KETA 3DEYX 1ZZEA 2GN9A 2VZ0A 3BMNA 4GBJA 3W4IA 3EYWA 4NI5A 1R4NB 2NACA 4BV9A 1QSGA 1ENZA 1GEEA 1E3LA 1OAAA 3NYWA 4BL5A 2O3TA 4WPGA 5C5IA 1P0FA 4RZHA 2YV2A 4B3JA 1A71A 3G1TA 2NTJA 2WD8A 3JQCA 3TRIA 4IIVA 3TQHA 3K5PA 4OXYA 3H9QA 4HADA 4YAJA 3UXYA 3WGOA 4ZQFA 3IL2A 5L51A 1C0PA 4P4GA 1ENOA 2FR1A 1DXYA 4RPJA 1NWCA 1ISGA 3NGXA 4M1QA 4J4TA 2RHCA 5DULA 4CR8A 4DLBA 4O59O 3IKTA 3DTTA 1J49A 3F1KA 1VC2A 3ROKA 2WD7A 1H6AA 2C7GA 1J6UA 3AOEC 2YQ5A 3ADOA 3IOYA 4Y6SA 2P91A 4OL9A 1PU2A 4ND2A 3SX2A 5CG2A 4OOFA 2D5CA 2BLLA 4IGEA 1Z7BA 1Z45A 2ZYGA 1N1EA 2NTNA 1K6JA 1Q2XA 2AXQA 5T6BA 1ARZA 4RDIA 4HFNA 5A04A 1LDBA 3U09A 5H81A 1LDMA 2D8AA 2C82A 4XRGA 3TPCA 1C3VA 1PIWA 4Y6RA 3HN7A 4DIBA 1PJLA 2Z5LA 4RL6A 3W6UA 4BNYA 3I4CA 2BFAA 1QLJA 1GZ3A 3PHIA 4YA6A 2J3JA 2EGHA 3GC6A 2FPPA 4IDFA 1IYZA 4QTZA 4I08A 5DNAA 4XA8A 1DO8A 2C54A 3DZJA 1YXMA 4J4HA 2BMAA 4ALMA 1DIBA 5I9LA 1RKXA 3JQAB 4ITUA 4BNUA 2O7SA 4JXKA 3VKUA 3BMOB 3DR3A 3CSDA 2G17A 3PLRA 3SJUA 3V2UA 3NDRA 2VTDA 3JQ7B 3RIHA 1SAYA 2X9VA 1GCUA 1EUZA 1IZ0A 5AXAA 3BHJA 4TVOA 4NK4A 1AE1A 4UULA 2FR8A 1UUFA 3I3OA 4J16A 4LVCA 4M49A 1I30A 4MOWA 1JN0A 5A3VA 5TRTA 2QX7A 2CDBA 3H9GA 3KXDA 2HLPA 4RVGA 3ZWXA 5CFZA 5L4NA 3QWFA 3LLVA 2X7HA 4BO6A 2YW9A 1R6DA 1ZJYA 3MJTA 5A9RA 2NM0A 4Z9FA 3CEAA 3KVOA 2IYOA 4QT0A 1B14A 2JD1A 3HDQA 2PK3A 4BGEA 1VSVA 1XU7A 1Z82A 3PVZA 1EDOA 3JQ9A 2NU9A 3W4KA 4DYDA 2NU6A 4J0FA 3QWIA 3PZBA 1NBOA 3KEOA 4OMUA 4YYZA 4OQYA 4XDZA 4L4SA 4NR0A 4E4YA 1UH5A 3FRJA 3JD2A 1E0DA 3ZWOA 2VTEA 2PZLA 3TWOA 2QRLA 3G3EA 3L9WA 4IQGA 4J90A 4CR6A 3E18A 4BNXA 3FBGA 1HZZA 4WEQA 1FDWA 4MVJD 3BHMA 5EL0A 3RUHA 3DZIA 1I3NA 2J3KA 4DQUA 3JV7A 1SC6A 3MWEB 3C8MA 5B12A 3U5TA 3I9KA 2VHYA 3BXXA 3OIFA 3KYBA 5JXWA 4KOAA 4UUMA 4YEDA 4J2HA 4EYEA 3FD8A 4GMFA 4GX1A 3KYDB 4RF5A 1H6DA 4BMNA 2HQ1A 4D0RA 4YAEA 5DT9A 4S3MA 2J3IA 3DZBA 1B0AA 3KTDA 4AJKA 4HUJA 4GSKA 3FPCA 1YQDA 2HO5A 4XEHA 2VYVA 1F8GA 1YB5A 3S8MA 2X8LA 3NUGA 2OL4A 3TL2A 1ZMTA 3P2OA 1H93A 3FCOA 4NFSA 4MVJA 5JCJD 1B8PA 3D4PA 4XJTA 3BZUA 1Y5RA 1I2BA 3WSVA 4RVSA 4Z6KA 1X7GA 4YJDA 2ZB4A 3EZLA 2B4RO 2UUOA 4FFMA 4YT5A 4A2CA 4EJ6A 3GLQA 4CV3A 3ONEA 3BMQA 3BMCB 1LUAA 4EUEA 1BMDA 1PGPA 3Q9NA 4KZPA 1Q0HA 5BNIA 1P3DA 1X0XA 5T64A 4CL8A 1PJCA 3V1YA 2NVUA 4IS2A 4MP6A 5K6AC 5IXYA 1QYWA 1YONA 2CD9A 1H94A 4YJGA 3GT0A 3DHYA 2X1HA 3M6IA 2QQ5A 4UUOA 2UV8A 2X5JO 4PLVA 4PLTA 5F5NA 1HYGA 3DOCA 5FEUA 2QYTA 4Q9NA 2Q2VA 5DBFA 3F9IA 5JCJA 3U9LA 4E5MA 3KLPX 4Z0TA 3TZKA 4I5DA 4MVJI 4HFMA 1WP4A 2O3UA 4UVDA 4BB6A 5IXSA 3RBZA 4W6ZA 5JMPA 1LXCA 3IUPA 3DQPA 3PQDA 2FMUA 3DMTC 4I5GA 1PX0A 4XR4A 1KVQA 3N58A 4CM1A 3PZRA 3VH4A 1VKNA 2O2YA 2G76A 1BGVA 2Y66A 3PYMA 1ONNA 3Q9UA 3D7LA 4W7HA 4F46A 5A5EA 2DBQA 4BNVA 5JDIA 3DL2A 1QKIA 3I23A 1KVRA 1I24A 1H2BA 4C7KA 1OI7A 3K8ZA 1H2HA 3AK4A 2XXBA 4CV2A 2GN4A 4XJSA 2YHIA 5G0SA 5T8KA 1N7GA 4CMHA 2EXXA 2VHZA 5TJHA 1BDBA 4FR5A 3FSRA 4J7XA 1H6CA 1PGNA 3OQBA 1VJ0A 5L40A 1RWBA 3MOGA 3OEWA 2VCYA 2OBYA 1E7MA 1YBVA 4CUZA 3PQEA 2Q45A 1Y8QA 3GA0A 2GZ2A 2O3QA 3PGJA 4ONEA 3SLGA 3PWZA 4AICA 3X2EA 1LRJA 4HFJA 3FNFA 2PGJA 3EGOA 4H16A 1U28A 1P0CA 3GPIA 3GHYA 3HB4X 1NPDA 4CLDA 4CM8A 3DHNA 1F0YA 1T2DA 1I8TA 3PWKA 1I10A 1YL6A 5THKA 2ZJ0A 1YO6A 1PGQA 2YJZA 1U7TA 1UXGA 1DFIA 2Q1UA 1QXSA 3ZU3A 2R00A 3R0IA 4XQ9A 3PLNA 1V3VA 2ZQZA 3H2ZA 3QLJA 4ZQHA 1DEHA 1Y5MA 5ENVA 3ZWAA 2PLAA 3CINA 3JQ8B 1GV1A 3F4LA 1LJ8A 1PJ4A 4KUEA 4YT4A 1I2CA 5ENDA 3M2PA 3EDMA 1BXKA 3A4VA 3P7MA 4IXWA 3RJ5A 3PFFA 3JD3A 4DXHA 1PJSA 3RFXA 3PGXA 4Q3NA 4J1TA 2GZ1A 3WBBA 2VHWA 4CUJA 4A03A 2YZ7A 1A27A 2QYSA 1BW9B 3KBOA 4HXYA 3JD1A 4CMEA 5LDGA 2D2IA 3AU8A 2PZJA 1DIHA 1YQXA 1NAIA 3LF1A 1DC6A 3MOIA 3OP4A 5TSDA 1PWZA 2GR9A 3A14A 3GN1A 1ISFA 4D44A 2W2KA 5BQFA 1ZK4A 2RCYA 1WMBA 3GG2A 4XYEA 2IEBA 1AN9A 2G5CA 2IRWA 4QXMA 1ZJZA 1M76A 3RKUA 2FSSA 4D42A 1PJBA 1UR5A 1EBUA 1O8CA 3WQSB 2CDCA 4OM8A 4BO3A 3ZNQA 4WLVA 1PGOA 3UGKA 4Z3KA 5CDGA 1LDGA 1NXQA 2YDYA 4R5HA 3RUEA 3IQDB 5CEFA 2GCGA 4Z0PA 1QV6A 3OBBA 2ZJ1A 4Q3AA 3WGHA 1WXDA 3TDKA 3ZNPA 4A73A 2ZTLA 1HZJA 3L6DA 3JD4A 2NU8A 2DVMA 1E3WA 1V8BA 4DUPA 4OAQA 1UZLA 4JJFA 3P19A 1D8AA 4UVHA 3INGA 3H4VA 5L4LA 1H9AA 1N8KA 3KEQA 1PSDA 3ZWMA 2WSBA 1DHRA 1HT0A 5AQ1A 1O0SA 4QFCA 3F47A 5JAMA 4JIGA 4N54A 1YL7A 2B36A 4W99A 1BSVA 4E5KA 2Z1MA 5KOIA 1YE3A 1LTHR 4IMPA 1Q1NA 1LDEA 1KVTA 2P9EA 3EVTA 4XGNA 3UCXA 3OQ1A 2P2SA 4Z9XA 3TZ6A 3AI2A 1Q7GA 4A0SA 4ZHSA 2B5VA 5A02A 2I66A 3LK7A 2C07A 3ZN2A 2PKQP 3LSYA 5LC1A 4AJOA 1N92A 5CEEA 1V0JA 3GRKA 2VZ8A 4KDFA 5IN4A 1R16A 2O3RA 5F21A 2B4TO 4RLHA 2FRDA 3QJ5A 1E92A 4QX6A 1OFGA 2IXAA 4X54A 3KM0A 1ISIA 3E48A 5J23A 1EE2A 4RF4A 2I65A 4E6PA 4JROA 2VRBA 5GZ1A 4PLHA 4MVJF 4R1NA 3ZWVA 2JFGA 2C0CA 3EC7A 4YRDA 4E2WA 3E82A 4FGWA 4LSWA 3K2EA 5KKAA 3FR8A 4XGKA 3C7CB 3L0DA 4CLRA 1YOVB 2VN8A 4L4XA 4Z0HO 1GAEO 3HDJA 4R54A 3U0BA 3F46A 3BYZA 2EKLA 4B4VA 2D1YA 2CVOA 2PWZA 3WSWA 3W8DA 1FJHA 1KY5A 4U6QA 4ND4A 1RYEA 4J6FA 2VT3A 4R1TA 1F8FA 1EVIA 1B3BA 3VH3A 3VZRA 3ZWPA 1JQBA 3GRPA 3KRTA 1FDTA 4PLWA 4XB2A 2JFHA 3ENNA 4BNJA 1D7OA 1UJMA 2ZYAA 4GKBA 1CJCA 1XWFA 1SEVA 5I7VA 4DGSA 5JY6A 4H3VA 2W98A 1GV0A 4URFA 5TX7A 1ADCA 3LZ6A 1T1SA 2V6GA 3LQFA 4WJZA 2GRAA 2B83A 1G1AA 4Y98A 4E2ZA 2LDXA 3ROMA 4XQGA 3EZYA 4B8ZA 3GDOA 1FDUA 4DPMA 3D3WB 3QVTA 4LGVA 1DDOA 3R6DA 1BVRA 4PRLA 4P22A 3ZU2A 3JQEA 3WNVA 2OHXA 1GCOA 3CKYA 3GAFA 3AOGA 5ADHA 3K30A 1MG0A 1OC4A 3ROQA 5L45A 1YBAA 1PZGA 2Q99A 1GDHA 4EJ0A 2G1UA 3JYOA 1IPFA 4BQPA 3ZWCA 4XYLA 3H9JA 3MJCA 4CM4B 4XD2A 2IEDA 1P44A 1NYTA 5B4UA 5DZSA 1MGOA 1NWHA 1H0KA 2A35A 4FSHA 3H65A 4LCEA 1SEPA 5BSEA 2HRZA 4LRTB 3NT2A 2DAPA 1CDOA 4AFNA 2DM6A 1DOHA 3L4BC 1WLYA 4W7IA 3JYQA 4BKOA 4AVYA 1ZSNA 1GUYA 4PLPA 4OQZA 2EEZA 3BIOA 3C1TA 3O8QB 4QEDA 1QLHA 5BNFA 3AI1A 1A4UA 1J0XO 4MVJP 2H63A 1JW9B 3ENKA 3GAZA 5G4KA 3LT1A 2NQTA 1BXGB 4XRRA 1U2DA 2JAPA 2XXJA 4BKRA 1PJTA 4OIMA 1U5AA 2DTEA 1P33A 2I3AA 4FW8A 5JYDA 3E9QA 3VDQA 3VKVA 4RF2A 4I5FA 3DFUA 1JAXA 3N74A 3ZWBA 5DBIA 1B8UA 2Q1SA 1UP6A 3TZQA 4AJLA 1P1IA 4R1SA 1EE9A 2D4AA 4Q3BA 4BMSA 4P4LA 3IIEA 3T4XA 1NM5A 2OFPA 2P9CA 2YHUA 3EMKA 4R1UA 5IF3A 3JQFA 4XCVA 1ENPA 2EGGA 4WOKA 2C2YA 2HK9A 3TN7A 2PTGA 3GMDA 3MZ0A 1KOLA 4IUYA 2XOXA 4BNTA 4DMMA 2OP1A 5HBRA 1M2WA 1Q7BA 4CMCA 2X0NA 1XGKA 4CLOA 4H7PA 2P5YA 3KV3O 1HLDA 5CPFA 4R01A 1NASA 5L7TA 1ML3A 1EMDA 1ZKMA 3VZSA 1ZBQA 5DCUA 3JQDA 2JD0A 4BGUA 5IZCA 4B7CA 3ITDA 4WKGA 3ZNNA 2AMFA 3MWDB 4BGVA 4P8RA 4CMBA 4YT8A 3DOJA 1SOWA 2HK8A 3WQRA 4W9NC 4KTTE 4BOYA 1BVUA 5AYVA 3QW2A 2VUTA 3DHEA 3JQBC 1WVGA 1Y6JA 5CG1A 5L3ZA 5L95A 4YJHA 5JDCC 1SOVA 1VPDA 1S7CA 1Y8RB 4JJIA 1UAGA 1PR3A 4E32A 1YB1A 2X0JA 4YVFA 1VSUA 3PQFA 1T26A 2EKQA 4WCFA 3ZHXA 3RUAA 3ZZNA 1GADO 2Q4EA 4LMRA 4B4OA 3H9EO 4L8VA 3C7DB 6ADHA 3OJEA 1YDWA 4PGFA 5B1YA 4FQ8A 4JBGA 3WTCA 3ASUA 1MC4A 5HTOA 1GQQA 2FSVA 5THQA 1SMKA 2V6FA 2P4HX 3GNQA 3HB5X 3LU1A 5CAEA 4O0LA 1I33A 2GGSA 1NTOA 2TMGA 3D5QA 3IC5A 4RLSA 4DLAA 1UXHA 3WMWA 4NPCA 4NBTA 2YV3A 2ILTA 3NTQA 3E6AA 4CM9D 3H3FA 3WIDA 1K6IA 4BNWA 4INAA 2WD7B 1KEVA 2FWMX 4RV9A 1R37A 4YJFA 2BKAA 1ONPA 9LDBA 1BG6A 4D79A 4HKTA 5U9CA 4QO7A 2OP0A 1HL3A 1YJ8A 3DBRA 3UKOA 3WOHA 1ADGA 1KERA 1CRWG 2ZATA 3GF4A 5K0ZA 1XHLA 4WCDA 1YL5A 1E7YA 1I2ZA 1A9YA 3Q0EA 4JBIA 4A5OA 1NQOA 3FR7A 1XEAA 4BNZA 1R15A 3UUWA 3V5NA 3U4HA 5H82A 2GZ3A 2XF8A 4PLFA 4FOSA 1YGYA 3TSCA 3EUWA 2C2XA 4ZQBA 3QE3A 2ZB7A 3OIGA 1Z74A 2X5OA 4CM9A 2BRUA 1SB8A 2V6MA 2VNAA 5KJ1A 5TLSA 7ADHA 1DC5A 5TJ9A 3O38A 3HHPA 4TVBA 4KUGA 1UXIA 4U7WA 2VYNA 4FS3A 3MTJA 4O5OA 2LDBA 5I8WA 4IIUA 4II2A 4N18A 2JCYA 4R5MA 4BIIA 2IYPA 2YFHA 4GWGA 5I7EA 1QR6A 4MINA 1GQYA 1E6EA 1XELA 2HDHA 3V2GA 2O4UX 4PG5A 1PQUA 3SC4A 5KTKA 1EUDA 3HUDA 2IDZA 4E30A 4MIEA 5IZ4A 1H5QA 2Z1NA 4BO0A 4I5EA 1WWKA 2IE0A 4BS9A 4A7PA 3UHAA 1LA2A 3DC2A 3O03A 3VPHA 4NU5A 4ZN6A 5C7LO 3QIVA 5F5LA 1VL6A 1J5PA 4LK3A 1WPQA 5FWNA 3COSA 4GMGA 2DTDA 5BR7A 4B4UA 5KCZA 4WGGA 3WQQA 3S55A 3I1JA 4YPOA 2ZK7A 1AXEA 2VZ9A 2GERA 4J1NA 1JDJA 4CLXA 4A27A 1CWUA 2Y1CA 2E82A 4IDAA 3NJ4A 4AJEA 3I6QA 4DA9A 1JWAB 3KO8A 1TLTA 1Z73A 2J3HA 4ZVVA 3VH2A 3L4SO 4OXKA 5MGBA 3K73O 4DIOA 1GQ2A 3PHGA 1ZEJA 4GPD1 3N7UA 2HUNA 4BO7A 1B16A 2X9NA 3AJRA 3K6JA 1EDZA 8LDHA 3QQPA 3DZGA 1BRMA 5T5QA 1UZMA 1T4BA 3KSUA 2BFOA 2WYVA 3BA1A 4UUPA 3OEYA 1N5DA 4BKPA 1XQ6A 4HY3A 5A3JA 4J2OA 3D4OA 2VYVD 4D41A 4Y6PA 4PIVA 3GNTA 3DBLB 1HDXA 3GQVA 4MKZA 1I01A 1E5QA 3PHLA 2UYYA 4EBFA 1E1LA 3VHRA 3GFBA 5ILOA 3WIEA 3HWRA 4ESOA 1YWGO 3SBOA 1O94A 1X7HA 3ZV3A 1GD1O 3MTGA 1DC3A 3RUCA 3INRA 2ET6A 3IUSA 1LRKA 3LDHA 4DQVA 4ZICA 4TRRA 1N9GA 1W73A 4IBOA 5IG2A 4AL4A 4EDFA 4TQGA 3I5MA 5COQA 1KC3A 4XB1A 2RHRA 3RD5A 5CEJA 4NNJA 3GZ4A 2DUUA 3PDJA 3Q2KA 1HDCA 3IP3A 5CPBA 1IPEA 1XA0A 3AW9A 3JYPA 3VZQA 1HDGO 1JLLA 4R69A 2OZPA 5TQVA 3H5RA 3WGTA 1C1XA 3T7CA 1ISMA 5JY1A 2VOJA 4ND3A 4EUHA 3BMQB 2BH9A 3KB6A 1UXJA 4PN3A 2JL1A 3RC2A 5L9AA 1XDWA 4M55A 1OOEA 5A06A 4CLHA 4ZQEA 5I7FA 3FBTA 3PIIA 3TF5A 2NVUB 1Y1PA 5LDHA 1R4MA 2AG8A 2QRJA 3GDFA 4NFYA 3F3SA 4NDNE 4B3IA 5L4SA 1LSUA 3WJ7A 3NDJA 1K6XA 1KBZA 1WW8A 4GI2A 2DT5A 4WLEA 3ZV5A 1JKJA 1VJ1A 4RJTA 3B1KA 2TMDA 5TF4A 1QMGA 3GZNB 4TRMA 3BTVA 4UEJA 2I76A 5C37A 2BD0A 2O23A 1GUZA 5ER6A 2DBVO 4ALIA 5DCWA 1Z7EA 4MKRA 3DBHB 2B0JA 3L6OO 2B5WA 5TS3A 2EJWA 5JFOA 2HMVA 1IZ9A 1DRUA 1I5RA 3B6ZA 3GY0A 4R9RA 5ES3A 1C0IA 4GL4A 3WJAA 3PYLA 4KWIA 3V1TC 2UVDA 1V6AA 3W1VA 4E31A 1CEQA 2VWGA 2Y0CA 4I1IA 2GUGA 3U4DA 4AJPA 5K9ZA 1OBFO 2C5AA 1U3UA 4GVLA 1U7HA 1XLTA 2ZCVA 1A7AA 2XPCA 4FIZA 5FF9A 2VOEA 5KKCA 2X22A 5K6AA 1TXGA 3C1OA 4HV4A 1LQUA 2YHIB 4OXNA 1MG5A 4BNFA 4TSKA 2B35A 3UCFA 1U1IA 3GG9A 1ENYA 3M1AA 1UP4A 1E7WA 1MFPA 3BMCA 5AXCA 5JDIC 2DLDA 2CY0A 3RU9A 3UFXA 4II3A 4BNKA 3T4EA 1KYQA 2PKQO 1Y8QB 1IE3A 3ZV4A 1S6YA 4YDRA 1W0CA 3AM5A 3LT0A 5DP2A 3IJRA 3G49A 4TRNA 4D0SA 3HFSA 2Y0DA 1BDMA 2EG9A 3E8XA 1ZH8A 2CNBA 3DMTA 2CF6A 3WWZA 3CZRA 1PL7A 2JJYA 2W2LA 5AXBA 4CM8B 1K3TA 1Q0LA 5JMWA 3F1LA 1E3IA 2FPIA 4PG4A 3MCVA 1XU9A 3IP1A 9LDTA 3JQGA 1WNTA 4DQXA 3RASA 3T7EA 1ZK3A 3DOOA 4NJMA 2VUSA 4XQEA 3EAGA 1YRLA 4NFHA 3WICA 1LX6A 1N1GA 1DPGA 3DAGA 4BNIA 4Y8VA 2C5EA 5TGDA 4BNGA 1E6WA 1I3LA 1JVSA 5HM8A 4DRYA 4J9UE 1U4OA 4P38A 4CLEA 5L7WA 1DIAA 3ZW8A 4CL3A 4PVCA 5ITWA 4L75A 3ZW9A 5A9SB 4XYMA 5ILGA 2PZKA 1YS4A 2V65A 3FNHA 4F6CA 1UDAA 2FOIA 2DUWA 1QYDA 5FI3A 1A5ZA 4FCCA 1YH3A 2ZB8A 4FFLA 4IXTA 4M87A 4CV1A 1QV7A 3NDIA 3EVNA 4YB8A 3FF4A 5T67A 3GVXA 4WNCA 2I99A 4BVAA 1TT7A 3OETA 1QYVA 3ST7A 2DC1A 2D3TA 1ZNQO 1E5LA 5COBA 3QSGA 2NLOA 5TNXA 2Y1EA 1G0NA 4XIJA 4PFJA 8ADHA 2EIHA 3SEFA 4NH4A 2PA3A 3I9NA 2RAFA 1O89A 1NQAO 1WDLA 4BO5A 1M75A 2EP7A 3PXXA 2H9IA 1U5CA 4CQLA 4CMEC 1SBYA 2O3JA 1R0KA 2QRKA 1V3TA 5EINA 1CERA 2W90A 5BSGA 2VNSA 1NPYA 4HX5A 4UREA 3PWSA 1UDBA 2P4QA 1EK5A 4ID9A 3NV9A 4PG8A 2PH3A 1T24A 4RVFA 1Q0QA 4PRKA 1I3MA 2AE2A 2Q49A 2JHFA 2JHGA 1R12A 2OOSA 3DXFA 4D45A 4G81A 4XWYA 3NTOA 5KVSA 2CZCA 3PP8A 1JVBA 2GO1A 1U4SA 1ULUA 2WYUA 3GEGA 3ZHZA 3VZPA 1E3SA 3RC9A 4DBVO 5H83A 3QVWA 3WGYA 1LLQA 4GKVA 4ND1A 5ICSA 3DZKA 3RROA 2B37A 3UH1A 1PR9A 5BNTA 4K1LA 1U2GA 3ZU5A 3RU7A 4J7CA 1O6ZA 2WDZA 4L74A 3WGQA 4KQWA 2WE7A 1V3UA 3D64A 1BW9A 3RSHA 3RFTA 3D1LA 1B3RA 6LDHA 2WE8A 4N5LA 1Y7TA 5EESA 3VOSA 1L7EA 3ASVA 4RPKA 4A10A 4BKUA 2ZTMA 5EPOA 4EW6A 4JP3A 4A26A 1CIVA 4JNKA 3TNLA 3WGZA 2PKRA 5HA5A 2Y67A 1D1TA 4Y67A 1EFLA 4TZKA 5I9MA 1F17A 1K0UA 3QHAA 1LC0A 4QFDA 3JD0A 3R3JA 5IDWA 1EVZA 3NX4A 3HFGA 4CMJA 1GPJA 5JS6A 3QP9A 1EBFA 3E5RA 4FD3A 3A06A 1T2FA 5CDSA 3F4BA 2QZZA 4XQCA 4CLRB 1TT5A 1HETA 3Q6IA 1LBEA 3RC7A 1T2EA 1IULA 2WEKA 2CMDA 1RYDA 4JJGA 4FB5A 1LDNA 1PL6A 3FWNA 5I8ZA 4CM5A 5GZ3A 3TZCA 1EUCA 1P1KA 1BXZA 4PLGA 4ZU3A 2D0IA 2VUUA 4Y9DA 2BGKA 2FN7A 4FGSA 5KJCA 5KIAA 3PTZA 1DHTA 4BUCA 4WLNA 5G0WA 2Q46A 3QA9A 1GYRA 4IJWA 3WBFA 5FI5A 4E12A 3ULKA 3KZVA 4NHEA 3S2EA 2DFVA 5G2OA 3PYXA 1GL3A 1B7GO 1JAYA 1B26A 1MFZA 3Q3CA 3AU9A 4DREA 5I7SA 3FNEA 4GLOA 1IHYA 5JC8A 2FZEA 1WDMA 2PD4A 3D5TA 2GYYA 4BQRA 3OJOA 1JKFA 4B4WA 4R41A 3H5AA 4Q3CA 2VWQA 3RCBA 1MB4A 7MDHA 3DAFA 4TKLA 2YFQA 3ZWYA 3OA0A 3C24A 5HS6A 4JN6B 1K89A 3PIDA 5HWSA 3AY6A 4IQ8A 4BNHA 4WOJA 1LI4A 1YDEA 2PGDA 3WR5A 5EMHA 4BV8A 5C7IO 3JQ6A 5CDTA 3QVOA 3H8VA 2X0IA 4NBVA 3WWYA 3BHIA 3ON5A 4ZRNA 1NFRA 3AFMA 4ILKA 1IHXA 1NX6A 4R51A 5TT0A 4M54A 4OYRA 2I5PO 5HS4A 5G4KB 4J7UA 2B69A 1KEPA 2C7VA 2G82A 1QORA 3HADA 3GVCA 3LC1O 4BB5A 4C4OA 5JAZA 4LRSB 4LW8A 4JQCA 1G6KA 3VVCA 4E5YA 1C14A 3RFVA 2G0TA 1HYHA 1LLCA 2D59A 4J0EA 1WDKA 5COAA 4J4BA 1ZK2A 4ALNA 3WYBA 3PEFA 5TT1A 1DIRA 5AOVA 4YCAA 4CMGA 4I9UA 4UVGA 2I3GA 4CM3A 4NJOA 2CFCA 3ABIA 3GVIA 4WLUA 5F1KA 2O50A 3FWZA 4QECA 2CVQA 1I32A 3FNGA 1UAYA 1QYXA 3RBVA 2HRBA 1DAOA 3L4BA 2WMDA 4PG6A 4JGBA 3WGGA 4ZD6A 4GLLA 3K92A 1O95A 3H2SA 1TI7A 2C29D 3EHEA 4CLOB 1KVUA 1YVEI 3WDSA 3S1LA 4BO1A 2NADA 5IDQA 4NBUA 1B8VA 1AXGA 3V2HA 1KY4A 4DWVA 3K9QO 1DIGA 3ZHYA 3AI3A 5LCXA 3C85A 3GR6A 4G2NA 4CM6A 2X86A 3IDSA 1VLLA 3HG7A 3OJ0A 5C7OO 3MJVA 1DLJA 1E77A 3DBVO 4WE3A 1CQIA 4MP3A 2DPHA 2AG5A 3O8QA 5EERA 4FC7A 2YUTA 1DJNA 4CMIA 3WG9A 2X58A 3WTBA 3M2TA 2VT2A 3BAZA 5A1TA 1BXGA 4GSLA 2JFFA 3KUXA 4M89A 1Y9AA 1ID1A 3NT5A 3OF2A 1ZSVA 4WCFB 5A03A 2YQ4A 4Q39A 1P1RA 3F5QA 3CZMA 4TROA 4WUVA 3I4FA 1IL0A 1PJ2A 2AW5A 1PWXA 1LDYA 1P1HA 2FPGA 4RVUA 5DOZA 4E3ZA 3KYCB 2BFMA 2P68A 5KWEA 2UUPA 4BNMA 4RPGA 1QG6A 4QUKA 1HXHA 3MJ4A 4BO4A 3DZFA 2BGMA 3O9ZA 3BMNB 5DF1A 4R3NA 2RBEA 1YKFA 1GUFA 4OKIA 1PTJA 2E48A 2WJPA 4IY1A 2GDZA 4L9RA 3AUUA 2Y1OA 3DONA 3WNQA 2Y68A 5KNLA 1NVMB 1P74A 1HE4A 3RJ9A 1HSOA 3HZZA 3PHJA 4U5QA 3PJEA 4FOOA 4ZJUA 2EP5A 1TEHA 3CUKA 3Q11A 4YJFB 5EQDA 4D3DA 4K6FA 4CQMD 3ITKA 3D3EA 3JQBA 1HKUA 3E9NA 5BSHA 2AHRA 3L07A 1VL8A 2O48X 3I9MA 3QRWA 3KSZO 4ZQGA 5JDCA 4QQRA 5KVVA 3LF2A 3NKLA 1JTVA 3VPSA 4MKXA 1UDCA 2PZMA 2GN8A 5G0UA 3TOXA 5DP1A 3LVFO 1C1DA 3AM4A 5IN5A 3X2FA 4DBZA 1NFFA 1ZXBA 3IJPA 2E4AA 3CMCO 4GVXA 4MO2A 2VYND 2EJVA 1P1JA 4J91A 1HDZA 4XYBA 1XG5A 1PS0A 1DC4A 1P77A 5KJ6A 2DBRA 4L4RA 2NV6A 1A9ZA 5EJ2A 4DIFA 4CQMA 5JYEA 4NIMA 5DCYA 4MVJM 4YRAA 4XDYA 2HJSA 4FDAA 4RDHA 2PY6A 3GH3A 4S1VA 3STHA 3OECA 2IZ0A 1LNQA 2P9GA 1A72A 2O7QA 3BTSA 3UCEA 4O1MA 2DPGA 1SO8A 5JSFA 1EK6A 2VWHA 4HNHA 4RZIA 4R9SA 3WFIA 4UEKA 5EQFA 1HDYA 1R4NA 1VM6A 3E9MA 1PL8A 2NWQA 3W8EA 2QG4A 1QYCA 3S2GA 1E7SA 4KDEA 1I0ZA 1PQPA 1NR1A 3W4JA 5EN4A 3CIFA 4NZ9A 4TRJA 5JCXA 1EEHA 2FR0A 3JYNA 4MJLA 4XIYA 3AOEA 3WB9A 1E1MA 3U4IA 3RUDA 4Q3EA 2B4QA 4IS3A 4CUKA 5DDIP 1ZVMA 1KEWA 4NBRA 2OORA 1B15A 4BGIA 1NQTA 1C0KA 4FFRA 3ZU4A 2RH8A 2HMUA 2E37A 4QO8A 1I36A 1ONOA 2BI8A 3JQAD 1LU9A 1HEUA 1X0VA 3U4CA 1E1NA 2DFDA 3G1UA 3PJGA 4DLLA 1T1RA 2BFPA 2AQHA 2GPTA 3ETDA 4I9NA 1XR3A 3WS7A 4AJHA 4YWJA 1QRRA 3GN2A 1O5IA 3I6IA 4JP2A 3KSDO 5FYDA 4PZEA 5AXDA 1E3EA 3VVBA 2DQ4A 3LC7O 4Q3DA 1SB9A 3V8BA 4U8GA 2WYWA 3G0OA 1DSSG 1W4ZA 1DAPA 2Y0EA 1R0SA 5TIIA 4IPTA 1SNYA 1PZFA 2AQ8A 2Y1FA 1SCUA 4WLOA 4C7JA 2UDPA 1NVGA 3M1LA 2Q1WA 3FTNA 4IQ0A 3GHHA 1GYPA 1YB4A 2FY8A 4YT2A 4NQZA 5HRUA 1YQGA 2BI7A 1XIVA 1GFSA 4RQUA 2QW8A 3JQ9C 2HMTA 3QWHA 4CV0A 1T25A 3NRCA 1HLPA 4OGWA 3CE6A 4UAGA 2GASA 2YV1A 1NQ5A 3JQAA 4PZDA 3UAGA 4B79A 2UAGA 3BMOA 2NSDA 4P4NA 3WLFA 1NHWA 3R3SA 1FMCA 4CMAA 3AFNA 3HE3A 1ZEMA 1F06A 1V35A 1N9GB 2ZCUA 4L76A 3CXRA 3JQ7A 2VWPA 4TWRA 1L1FA 3SXPA 3UW3A 3U49A 3ONDA 5IAAA 1N2SA 2X0RA 4AJIA 4YACA 2VRCD 4IMRA 1XKQA 3ZH2A 3OIDA 4DVJA 3GPDG 4OHUA 5TC4A 3RUFA 1X7DA 1YBMA 3OFSA 2YDXA 3LYLA 3PDUA 3DWFA 4KUHA 4LISA 4AJNA 4OSOA 4FC6A 5I9NA 1LC3A 2AQIA 1C1XB 4ALKA 4L0QA 3RWBA 3GOHA 1KC1A 2Y1DA 4BMVA 5F1PA 3ZDFA 1U3VA 3ICCA 4WK6A 5JNLA 1R4MB 3EY4A 1GPDG 3TFQA 2NU7A 3UVEA 1XYGA 4FFPA 4D3FA 3A9WA 1TA4A 1ZFNA 2HMWA 4XGIA 4DMLA 4HWKA 4YAIA 1FXSA 2VRCA 3CH6A 4OJNA 1UP7A 2HSDA 4JCOA 5U1PA 2IODA 1ZSYA 2X5KO 1EZ4A 3HSKA 2PNFA 4LCJA 5CP8A 3DBLA 3I9LA 4MDHA 4TZTA 4FJ2A 2O3SA 4BNNA 4PLYA 2QZ9A 2IZZA 1MP0A 1WMAA 4YJGB 2A4KA 1DRWA 1LSOA 4BHTA 1H9BA 4RGBA 4N5NA 4D7AA 1FDVA 1E1KA 5DOVA 3RBXA 2R2GA 1U8XX 3DDNA 3D0OA 2WWRA 2Q4BA 3AUSA 1M6WA 3KYDA 2ZIZA 3OM9A 2BHLA 3OJLA 4G65A 1NFQA 2CDAA 2AE1A 3PFWO 2IXBA 4MPDA 1X15A 1VKOA 4QSMA 4ZA2A 5JAIA 2Q50A 1AHHA 2C20A 5F3RA 2YY7A 3PPIA 3RKRA 5ICMA 3TOZA 1IOLA 5CHEA 4Z3DA 3RQSA 4IJKA 1MX3A 1SZJG 1CETA 3WXBA 1HDOA 2F1KA 4E13A 1V9LA 4RQTA 3Q2IA 4YR9A 2W2LD 5CDUA 1FF9A 1SPXA 3L9XA 1JKIA 4UVEA 2I67A 4JBHA 3IAHA 1BTOA 1X13A 1ZW1A 2PR2A 2VQ3A 4WECA 1NP3A 1LSJA 4EITA 3GEDA 2EW8A 4EEZA 2DBZA 4E21A 4E2YA 4PLCA 1K2WA 5JAQA 3EW7A 3GFGA 3QV1A 4ALJA 3I9OA 3PI7A 3RI3A 1ZK1A 2A9FA 3IMFA 3B1JA 1K5HA 1GYQA 1Y81A 3GZNA 4FJ0A 2Q1TA 4E2XA 2AEFA 1LLDA 3JQGB 3ROPA 3NTRA 4L73A 2J5RA 4NJMB 2I9PA 1I3KA 3DBHA 1NHGA 4N5MA 2NVWA 3L77A 3VPXA 5T8KC 5CDYA 3VTZA 5KJEA 3PJFA 4E5PA 1L7DA 4PCVA 2DTXA 4M8SA 2ZTVA 2OBNA 4D43A 1UXKA 3WYCA 4GWKA 4IZHA 2H5LA 2V7PA 2JCXA 1P9LA 4DL9A 4BO2A 3ZI0A 3LC2O 4IDCA 3DZHA 2GSDA 3H6KA 1GZ4A 3KLMX 3V1UA 4NU6A 3TL3A 5G0TA 4IDEA 5B37A 5IDYA 3RUIA 2E49A 3ANNA 4U0JA 1A4IA 3C1AA 4WASA 1GR0A 1PS8A 4F45A 5GY7A 2PD6A 2ZKLA 4I9HA 1VJTA 3INTA 1M6HA 3U3XA 4FBGA 4LN1A 3GVPA 2I6TA 1LSSA 1MXFA 1RM4A 3SJ7A 4DC0A 2H6EA 1HDRA 2P5UA 3W8FA 1WAMA 3VAZA 4CPDA 2Q2WA 5DBGA 2R00C 2PD3A 1NR7A 1GZ6A 1KEUA 2D5AA 3R1IA 3UN1A 2FZWA 3MJSA 4NBWA 1RPNA 3C7AA 5A05A 1JWBB 3ZWWA 4KWHA 3TZHA 3HN2A 2VHXA 3CMMA 4NMHA 4AJ4A 4CQLB 2JD2A 2CSUA 3UOGA 3O4RA 4CODB 4RF3A 3IS3A 4OSPA 1N7HA 1PZEA 1EQUA 1KS9A 1H6BA 4DPKA 1NVTA 3OA2A 3BTUA 3CTMA 1BHSA 2HCTA 3ANMA 4J1QA 4ALLA 1M66A 1ZK0A 2W2KB 3NGLA 4MIYA 3SC6A 3WX0A 5KVCA 3LT2A 1D1SA 4RORA 3DO5A 3A28A 1D4FA 1DFHA 4OOEA 1GTMA 1VI2A 2V6BA 1GY8A 1ZMOA 1T2CA 5KJFA 1ZCJA 4AG3A 5A9SA 4AJ1A 3B20A 5DN9A 4LVUA 3MEQA 1PS9A 1KETA 3H3JA 4CR7A 4EUFA 4PVDA 2EHDA 2HAEA 5A9TA 1TVEA 3PHHA 3E1KA 3Q1LA 2VHVA 3JQ8A 2OO5A 2E6UX 2J5QA 2EWMA 1E3WB 3GMSA 1DLIA 3ZGYA 2ZB3A 1O9BA 4F6LA 1HSZA 1DRVA 4MP8A 4ZRMA 4D3SA 4GGOA 4LSMA 1ADBA 2WTBA 3GGOA 3PRJA 4FFNA 1B2LA 1Z6ZA 1IUKA 4AJJA 4W4TA 1HE3A 2O2SA 2ZYDA 1JA9A 3GUCA 4E33A 2AQKA 1ISHA 2GN6A 3AWDA 2BGLA 3B70A 2HMSA 1A7KA 1DFGA 4JK3A 2GF2A 3ANLA 5KVQA 1C0LA 1OZAA 2CF5A 2OUIA 4GGPA 1ZIDA 3GNSA 1YJQA 3HJAA 5A5FA 2WM3A 4O6VA 5GMOA 2CUKA 3JTMA 2AEJA 1OC2A 2Y1GA 1EFKA 2J6IA 3ZNOA 2NQ8A 1BWSA 1D3AA 4KP7A 5IFLA 4IM7A 4BO9A 4IDDA 1P1FA 2XAAA 4EZBA 2ZTUA 1TT5B 4HFRA 4ZGWA 3QY9A 4BO8A 2NUAA 4GX0A 4LMPA 2PV7A 4RVDA 3ZWNA 2BF7A 4WEOA 3AUTA 4DYVA 1X14A 4K6CA 5B4TA 1ZO8A 3G17A 3JSAA 4CMKA 5GZ6A 1PJQA 2O4CA 3QWAA 1RM0A 1X1TA 2GLXA 3AM3A 4J3FA 2EERA 3ETGA 2Z95A 1NAHA 5U4QA 3I52A 3OMLA 1LLUA 2CVZA 4WLFA 1RM5A 2POQX 5C3MA 1MUUA 4UUNA 1UZNA 5G0VA 3UF0A 2A92A 1Y9EA 3TJRA 1AHIA 1P45A 1EVJA 3RC1A 1U3WA 4MIOA 3B1FA 4BNLA 4YRBA 3IKVA 2DKNA 3VTFA 3TFOA 3F5SA 4HP8A 4I8XA 3F6YA 2OXIA 2EW2A 3QVXA 4MVJG 3NJ8A 4EI2A 1ADFA 3MJEA 1OMOA 4CM7A 1PQWA 3I9JA 3FI9A 3K2BA 3GVHA 4RCVA 2Y93A 1U9JA 3VPGA 2QHXA 4XYGA 5L53A 2AEMA 3UICA 3OICA 1NNUA 1MLDA 1DBVO 2NTVA 3ADPA 5AVOA 2R6JA 1F12A 1IY8A 4J9VA 1U8FO 1PEDA 3VH1A 1MC5A 2JKVA 1E3JA 2RIRA 2H1SA 3WGIA 1Q7CA 2BELA 5JO0A 4ROSA 2C59A 3ZHBA 3L6EA 3QWBA 4YTEA 3VC7A 4B8WA 1DB3A 3P2YA 3LT4A 5JBIA 4EEXA 2Q2QA 1M67A 3DB2A 2JAHA 1MXHA 3WMXA 1W6UA 5ITVA 3NEPX 4YXFA 1RJWA 3H9UA 4D46A 4EGFA 3GGGA 1KIFA 4NG5A 1U3TA 5BT9A 5A4DA 4K9DA 4GAEA 2J8ZA 1XSEA 1LEHA 2A94A 2Y99A 4UEOA 3PK0A 3WFJA 4YQZA 4U0KA 4B7XA 4DPLA 3U62A 3VDRA 4IJUA 1YOVA 3OJFA 2SCUA 1MV8A 5FFFA 3HQ4O 5BSFA 2GNAA 4J1SA 5G4LA 4O63O 1AUPA 3H5NA 1QP8A 3S2FA 4K28A 3CPSA 3GK3A 1CF2O 3ONFA 3ICPA 4IDGA 2HK7A 2EF1A 2X6TA 1DJQA 3KHUA 3G79A 3OH8A 3ORFA 1PJ3A 3D4NA 2Y05A 3DAPA 4YAGA 3HDYA 4G5HA 1WZEA 3SVTA 1JU9A 4GX2A 3GEMA 1HRDA 3OSUA 1E7QA 1PZHA 1PGJA 4ND5A 3W6ZA 3JCZA 1HE2A 3GUYA 3AY7A 4MVJH 3P5SA 1E6UA 1J4AA 1ZUD1 3OHSX 3E03A 4M86A 4J49A 1GU7A 4FPXA 4TMFA 1HTBA 1EVYA 2HU2A 5L7YA 4RVHA 2IZ1A 4B3HA 2Q3EA 3AY3A 3HNPA 4GX5A 1ORRA 5JPIA 3D3WA 2EV9A 4IINA 2W4QA 3DMYA 5IDXA 1EQ2A 2GD1O 3EK2A 1R0LA 4XZ3A 2ZQYA 3S2IA 1IB6A 4GQAA 2HJRA 3SLKA 4R68A 4XR9A 1XQ1A 3NAQA 4J43A 1CQJA 4OO3A 3QVSA 2EKPA 3K96A 1VRWA 1VE9A 3FPLA 3NT4A 3ZCXA 1FDSA 4AJ2A 4E5NA 2OGUA 1T2AA 3DTYA 1MA0A 4H15A 4CM4A 1W8DA 3FHLA 1VL0A 3JYLA 4HBGA 4CMIB 3JQFC 5EIOA 5MDHA 4FN4A 5JLAA 3RVDA 1ISJA 2X9GA 4R3WA 4MVJE 3VPFA 2OMEA 4XKJA 4UVIA 4BKQA 1E7RA 3A1NA 4EJMA 1F14A 3WYEA 4YBZA 3GGPA 4GH5A 4JX8A 4YQYA 5JO9A 4YJHB 4KMSA 4PLZA 4PZCA 3GDGA 4F3YA 4IDBA 1P31A 2AA3A 4N7RA 3AUAA 4R4JA 5IZCC 4RO0A 1LQTA 2PH5A 5T57A 1Z75A 4K26A 1TB4A 3LLSA 4PG7A 1AGNA 2FHSA 1GEGA 2X23A 4TKMA 2FP4A 1HYEA 4RPHA 1R66A
chains in the Genus database with same CATH superfamily
2OZKA 1UBSB 2COUA 1U1FA 2ZJ7A 3DFZA 3CTPA 4DUYB 1HF3A 4ZXFA 1V3QE 4WCFC 5JMOA 2J33A 1VA5A 1XEWY 3OQIB 3T7JA 1K9SA 2JFBA 4DLTA 4B7UA 1DX4A 4EAQA 1HNXB 5HKLA 3OCCA 4WNIA 1OZHA 2QIOA 2A5FA 1LPNA 4Z4FA 1DKRA 1QVRA 1KVSA 2DU8A 2R751 2PJDA 4P82A 4HG2A 2X4GA 2G77B 2FSVC 3BORA 3S3TA 5C5EA 2QMHA 4TTVA 3NW9A 3FSEA 3GPCA 3VYVA 2F8TA 4BVEA 2B98A 2ZSAA 3ETEA 1FC0A 3G2MA 4MGIR 1EJ6A 2BEWB 4PQRA 3O8LA 1FK8A 5E1BA 1JL3A 1TVCA 3LHIA 3MWDA 1G6Q1 4U2FA 1CS0A 5LZ4A 1HURA 3QLVA 1IWOA 1XA3A 2HKIA 1QCYA 2IHYA 3H7AA 4P58A 3WGMA 3FTPA 2J5KA 2YOHA 2JCVA 5CCBA 3I83A 2GEVA 3O26A 3GLIA 3PGLA 3Q7QA 3H5LA 4GUDA 5ALOA 2O1WA 4KQXA 2XT6A 3BRWD 4OGKA 4OQMA 1ULSA 1ZQ1A 3HB9A 4I1PA 2PWPA 1RM3A 3EW9A 2C03A 5JE8A 3K9CA 2H1FA 3IURA 4NK5A 2J9YB 3S1SA 5A5VA 3KETA 4GBJA 5ED0A 3KOZA 3KXKA 4G8DA 3EYWA 4GQIA 4BV9A 1QSGA 2P9ZA 4EOGA 4ZALA 2IBMA 3OE5A 4BL5A 1CZNA 2IOFA 4MRVA 2G28A 1VIMA 1U11A 3IFSA 1BJTA 3Q3EA 4OF4A 1JVNA 1BROA 3UAZA 4RS4A 5CJJA 4ZI7F 1IXYA 3FXAA 3GQBA 3IL2A 2G5TA 2V7QD 1X1AA 3DO8A 3HUUA 2EX1A 1FTNA 4JC5A 4IIFA 2X0EA 1ENOA 4AS2A 4IG9A 5E6RB 4BJ1A 4TGLA 1QIKA 1PD0A 2YXPX 3MAJA 5E8RA 3SS7X 4DLBA 5JWOA 1QHEA 1GTG1 5SV2A 1J49A 2WOJA 3TQSA 4INOA 3QKRA 4K05A 4B34A 5ALUA 3L84A 1A4RA 1LJUA 3EIWA 4Q4AA 3UAOA 1LV8A 2IYQA 1N8NA 1LCIA 3ODGA 4KO1S 2YQ5A 3TVDA 4GMDA 3IOYA 2VBIA 2LKCA 2ZI6A 1FYVA 3FPEA 4UBLA 3X1MA 2I2DA 4OOFA 4OMCA 3I42A 4MA5A 4IGEA 3B2EA 2DSNA 4PBRA 1PNTA 1K4YA 1D07A 1KMHB 3QUSA 1A8QA 1Z39A 4G36A 2YOGA 1RZRD 2WP0A 1K6JA 4KXMA 1ARZA 1XQXA 4RDIA 5MFZA 3COYA 5K3FA 3U09A 2CUTA 5JANA 1LDMA 2D8AA 5ES4B 4FMCB 1YS9A 2F90A 1JR2A 2GEFA 1DELA 4TUYF 1Q16A 4UU8A 5DEOA 4YRGA 5K99A 4RA6A 2ZYSA 4ITVA 2BFAA 1QLJA 4V3BA 3KD3A 3AI7A 4OBXA 3TTTA 3LKDA 2JIRA 2P78A 4LOJA 2V7WA 1T6BY 4IDFA 3GRCA 5FOUA 1BCRA 3P9IA 3BRSA 5TDHA 1R5OA 5KTPA 4HRYA 3T5PA 4JAVC 5FTMA 4ALMA 3WIVA 3U4MA 4RJJA 5I9LA 3JQAB 3F8SA 4KYUA 4JXKA 1QJ4A 5KSYA 2Q4RA 3PLRA 4OPMA 1RAHA 2EZ8A 3NDRA 5I4KA 4AN0A 3JQ7B 2PZ8A 1SAYA 3A26A 2X9VA 5HTKA 5C32A 4C88A 4JI5B 1IZ0A 3KU4A 5C8ZA 2NV0A 1IJEA 1GCIA 2HPHA 3NJRA 3MN1A 1Y4AE 2NW6A 3G5UA 1EB9A 3I3OA 5TRTA 5M34A 2RK6A 1UMCA 4Q24A 2CDBA 3H9GA 4UAJA 4FUQA 4LE1A 1Q83A 4F0JA 2AOUB 3NM6B 4PYQA 4X66B 1L2TA 1RSZA 4AUNA 1XOIA 3IV6A 5KQSA 5LP6A 3LLVA 2WHQA 2BP7B 4YCSA 4QUEA 3WFZA 1VLVA 4LOIA 1ZJYA 4CGZA 4QNRA 4KE7A 4TTJA 3W5CA 3CEAA 1J0DA 4DA0A 4ZVNA 5IS2A 1BO6A 3HL0A 5FA8A 3VOTA 4DJ5X 4RMIA 1YFLA 1OIVA 3ZDXB 3IAS1 2FWBA 2QEQA 3GRRA 2RAVA 4KR3A 5TMBA 2M1ZA 3W4KA 1H3NA 3GBVA 8AT1A 1P0MA 4DYDA 3AEUB 1XD9A 3WL4A 3P9RA 2YRFA 1NBOA 1T0HB 3OX3A 4E03A 1PFWA 2QSJA 3CNLA 3HSYA 3A7EA 5ICFA 4E4YA 1A96A 2A1TR 2YMMA 2G4LA 2A9KA 1CY0A 1UFOA 5C8YF 2W71A 2EHJA 2GHTA 2LCIA 2GKSA 2PZLA 1A1SA 2CHVA 2H7CA 2R62A 2V4UA 3LPAA 4TMTA 3TWOA 1ZRNA 1MAVA 1BH6A 2AGVA 1B74A 3MWJA 2IYWA 4BNXA 4UCFA 5JBNA 1XNHA 4WEQA 2LVBA 4CNBA 3S8YA 1FDWA 3PD7A 3QVGB 1M74A 3RNLA 3JV7A 1CIJA 3MWEB 3TLXA 4HRAA 3BGDA 4TKVB 2VHYA 3RODA 6REQA 4OHOA 1QZZA 3Q8XB 4JYMA 1XXLA 4QPJC 4UUMA 5JXWA 2POCA 4HN2A 4YEDA 4L6AA 4BN5A 2C5FA 3FD8A 4GX1A 4RK1A 3RVOA 4RF5A 1N6LA 2V0CA 1DXOA 3BIJA 2GF0A 5L3SA 1FMTA 2IIVA 3ERCA 2HQ1A 4NOKA 4PRYA 4TWAA 1L4EA 3CEJA 4RM3A 1TYZA 3TIIA 2P4EA 4M9UA 4Z2YA 2BVNA 2GPJA 2AIRA 3VO9A 1H5NA 3VVLA 4HUQB 4CI9A 4B6EA 1YQDA 2OCXA 3C14C 1PV2A 1N8SA 221PA 1F2UA 2XOEA 1P72A 4HXGA 2W43A 3C43A 2JLSA 2G67A 2JBHA 3MBKA 3ZCQA 2J0UA 2ETVA 1OX6A 3JX9A 4M0FA 2VF8A 4HMQA 3SS8A 4CETA 2CMGA 2FW6A 3PEVA 4FLEA 4BAUA 2XECA 1Y5RA 4LGYA 4LNUA 2BISA 1VE1A 3E81A 3QBEA 3SI7A 4Z6KA 2VK1A 2PUEA 1XEXB 2ZB4A 5CFRA 3ORYA 4UDNA 2ORED 3RUPA 1VLQA 1G9XA 2XADA 2Y76A 1AH2A 2LCFA 1CYEA 3BGVA 4KO4S 5EYPA 2ZUDA 3AL0C 1I3CA 1EKXA 3Q9NA 4KZPA 1Q0HA 1QH0A 2RGYA 2OXTA 5T64A 3R41A 1CB7A 2VT7A 2NVUA 4IS2A 3S2YA 3UMMA 3OZCA 5HF8A 4ENWA 5D3ZA 1I1QB 4K3UA 3B60A 1RVV1 5ALJA 4YJGA 2ZRMA 2QUZA 1V11B 2W6JA 4RMJA 4DDTA 2QQ5A 1N7IA 3L4JA 4I1RA 4UUOA 3GX1A 2X5JO 1U2ZA 2AF3C 3OI7A 1RP7A 2V3WA 1O4WA 3EGWA 3O4HA 5F5NA 1HYGA 1M2KA 2QYTA 2PSEA 4Q9NA 2Q2VA 4YMLA 3OPYB 3NVAA 4QUAA 1TK3A 3DAHA 5EMJA 1E62A 2Y6VA 3TZKA 3D7RA 4NCXA 4HFMA 2Q8NA 4Q05A 4DFDA 2O3UA 3P0FA 2XGGA 3LAWA 2R8OA 1B0ZA 3ILYA 1QGUA 3BAFA 4JQYA 2I2XB 1SA0A 3IUPA 4QBHA 3WA7A 3PQDA 3NCHA 4DCGA 1K4MA 4CM1A 3L8DA 3VH4A 1P17A 1AX9A 4B47A 4KPUA 3G2KA 5HOEA 2DPXA 4JUAA 3HKEA 5AIAA 3D7LA 5A5EA 3I2IA 1XNGA 4BNVA 5BW4A 4N47A 4MXDA 4C7KA 3I23A 1I24A 1H2BA 3B51X 1B93A 1GITA 1KXZA 2NUPB 3D8HA 1KARA 3OU2A 3HCNA 1JXAA 5EJ6A 3TGWA 3W2IA 2CSXA 4ECEA 1HI9A 5TMEA 3AK4A 4HN4B 4GZMA 3U26A 4CV2A 1I0LA 1C2TA 4H1UA 4P81A 1BDJA 2H1OA 4B85A 1RTTA 2WWXA 3L0YA 4Q7MB 1O08A 1V16B 2IPOA 1FEZA 2VHZA 3D7SA 1N9ZA 3O74A 1GPUA 3E27A 1JBKA 1NUAA 1XF9A 1R88A 2QSYA 5TJHA 4EYSA 4J7XA 3DWEX 4GSYA 1DS6A 3DOHA 3F96A 5LMUB 4HDRB 4OHZA 3MOGA 1S2OA 2VCYA 1JDUA 1E7MA 1DUVG 1YBVA 3K09A 3PQEA 3ISVA 4Q4JA 3E70C 2QX9A 1Y8QA 3GA0A 5MN5A 2WTXA 5FADA 4ZVOA 1Y9DA 3PGJA 3CN7A 1SHJA 4MWCA 4ZD6A 5B57C 5J4YA 2R85A 2XE6A 4HFJA 4EABA 3EGOA 1NONA 2XTNA 2GBGA 1MBZA 2H5EA 3GPIA 3STVA 1SXJD 3GLFB 3I0NA 4CM8A 1H2RS 4OMFG 1YJXA 4GRIA 4D99A 2CB0A 4QU5A 2ZJ0A 4GI7A 4P9NA 4RYDA 2JLYA 3N8GA 3S70A 4WKOA 1MAAA 1JQ5A 1U7TA 1EVQA 3TI9A 5ALGA 3PGMA 1UXGA 5GWXA 4BEJA 2NO7A 3Q8LA 1QDLB 3BX1A 3TK1A 3UJ8A 3RGWS 2AG0A 3HCWA 4XQ9A 2RONA 2Q0QA 3R77A 2ZQZA 3A25A 3E9ZA 1XMXA 4YLEA 5U4XA 1SXJB 2W6ZA 3ZGXA 3H2IA 4UNRA 5I3CA 5ENVA 3ZWAA 4X44A 1E4EA 2A5LA 3CINA 4M98A 1U2TA 3F4LA 3W7AA 5IPFA 1DNPA 1IUNA 3GLGE 5GIOE 2WUDA 5TPZA 3CCBA 3DWIA 1JE0A 1I2CA 1FUUA 1SZCA 5ALEA 2XMRA 3AONB 4KQ1A 4KFTA 3RAEC 3M2PA 1NW8A 3V9PA 5DU2A 3KJIA 3A4VA 1DMRA 1VGQA 2VLIA 3PFFA 1AB5A 2W83A 4QAQA 4ZOCA 4ZCQA 5K0JA 1PJSA 2CV1A 3RFXA 3C70A 4LHZA 2VIIA 4IDQA 1XF1A 3GEBA 3V4SA 3WBBA 3KZ1E 1DKNA 4YP5A 2YZ7A 3KBOA 2XCLA 3NOQA 4GEKA 2R6AA 3Q0IA 4DA6A 1M33A 4N7JA 3K9BA 2NX2A 3AU8A 4FHGA 5FOTA 1YQXA 1BOOA 5FNVB 2VF2A 2E21A 4NXNB 3JARA 1X38A 1GU1A 2OVBA 3WK5A 1ZBDA 3ZHVA 2WHXA 1OLSA 2X2FA 5D7BA 3ORRA 1ISFA 3I64A 5LP6F 1JH9A 4MPRA 3EDCA 1QB8A 2ID4A 2P5SA 2A5YB 2HB6A 5E2AA 3UGQA 1ZK4A 3QG5A 3VKFA 5KX5A 2RCYA 4MI3A 4IHJB 3FWKA 2G5CA 4TTQA 4F11A 4WY2A 1ZJZA 1M76A 5BYKA 1U81A 4JDPA 2FSSA 4YMSA 1XZ8A 2JFWA 3UBTA 3PCRB 5AVRA 1QVVA 1EBUA 4BMOB 1H66A 1JX6A 3L0SA 4M37A 4RK5A 3RRMA 4BO3A 3CVUA 1M6EX 1QNFA 5B1SA 3EQ2A 1O9HA 3QI2A 3HWWA 3UGKA 1KYVA 3THYB 1LDGA 3OEHA 2ZEJA 4ZEMA 3RK4A 2GCGA 3SEQA 5EC8A 3OBBA 4ASUD 5C53B 2GX6A 1BD3A 4Q3AA 4PGAA 4RH1A 4C30A 3CISA 3PEUA 1V1RB 2JGMA 1SUBA 4U2BA 5AVJA 4AECA 4A73A 4QREA 3BZBA 4K86A 5TEWA 2ZTLA 3VZBA 2B20A 2P1RA 2NU8A 3R7BA 1E3WA 5FUQA 3PC3A 5TQ0B 4OAQA 1P4JA 5HK8A 4BLPA 5C31A 3INGA 2P0AA 5L4LA 2QIPA 1N8KA 1YDFA 2R6DA 5EG5A 1JWLA 1FPMA 1GPNA 1PSDA 4B83A 1TPZA 4DWWA 3CKMA 4A2QA 2YJNA 4KQ9A 5JAMA 4AS1A 1PAUA 2Q5HA 3C3EA 1YL7A 4LBVA 4LI0A 4DMGA 5LFAA 2XUKA 2Z1MA 2WKWA 2AI1A 2O2JA 1A5AB 2AEEA 1M7HA 1LTHR 4IMPA 5KYGA 4JBYA 2UXBB 5HPYB 1Z6PA 3PHBE 4ENSA 4YUYA 4AY6A 2P9EA 3BJRA 4EO4A 4L5IA 3OQ1A 1TQDA 3GXOA 2IKSA 3K3PA 1F6BA 2P2SA 4Z9XA 4BC1A 4NENB 4HVCA 3PFHA 3WRYC 4NONA 3NUQA 4ZHSA 5BUZA 4N39A 3LK7A 5A02A 3ZN2A 2PKQP 4DG9A 2J9RA 3SG0A 5FFMA 3P1JA 4D4JA 4C07A 2ZBGA 4LCBA 3H4IA 4LK2A 5TARA 1X2BA 2FRDA 3QJ5A 1O77A 1E92A 1K97A 1RCFA 1UCFA 2PZAA 5AHRA 1YDMA 3LUPA 4X54A 1Z6QA 3O3MB 4JI0B 2ZWVA 2V5AA 3JAKA 4JLMA 5F9MA 3FCSB 4C4PA 1H42A 3QX9A 1I94B 5HZHA 5IHPA 1N2CA 2DFKB 1VPVA 3ACBA 1AKVA 4R1NA 3QELB 3ZWVA 1YKSA 2C0CA 3ODPA 4QDUA 4YRDA 3RIGA 4HDSB 4BWYA 3ZS9A 5EY5B 3W9BA 3K2EA 4DS3A 5HKKD 1A7UA 1YZLA 2ZJBA 3FNQA 3KQKA 5GV7A 2OBMA 3ZJUA 3ZY4A 1EEXB 4G07A 4NCBA 2VN8A 3AFHA 3RYCA 3I0ZA 5LB4A 1M0WA 3CX6A 1GL7A 3PPVA 1O57A 2WNHA 4Z0HO 3HDJA 5AKIA 5DISB 1FYDA 5FA6A 5EPUA 4HDNB 3U0BA 4B3GA 3AUXA 2AFVA 4C2TA 3CSSA 4HMPA 2DFNA 1NW6A 1Q19A 1AUVA 2PWZA 1FJHA 3PXAA 4LVNA 3WLRA 2H4HA 2C7QA 5GGXA 1ZAYA 2A67A 4ND4A 1E2MA 5CYGA 1G8PA 1EJ2A 2EJBA 3I28A 3AR2A 3IHTA 2DUJA 2JH3A 1NBHA 3NBYC 3R8CA 3GRPA 3HCOA 3KRTA 1XTQA 3RJMA 3TQRA 5GTDA 4XB2A 2IHKA 2JFHA 4KIUA 4LRYA 4BNJA 3LUKA 2ZYAA 3RRFA 4EX7A 5LM3A 1AJEA 4H3VA 1ZI9A 1NBIA 3A2KA 1CBUA 2P11A 3LPMA 3X1DA 3IMEA 4BMZA 4OXIA 1GG8A 4UU0A 4L95C 4WJZA 2QUJA 3F5DA 5BV2P 5AVYA 1G1AA 1RP1A 2ZWOA 1A9PA 3OLQA 3AIOA 4E2ZA 3BFPA 1MOQA 3DTVB 2R84A 3GJZA 4JJ8A 4B8ZA 4EFMA 3UNXA 3AV0B 1YACA 1GPWB 1ECJA 1K1EA 3T7IA 1DDOA 3LO8A 4X9XA 1TZKA 4PSAA 1ZA1A 1G5TA 1KO5A 2QMEA 1CY7A 1MPTA 4N0QA 4V0QA 4E5SA 4K6KA 4LA4A 2JJMA 1X9HA 5EHQA 3EIOA 1GCOA 1CQJB 3CKYA 3GAFA 4JMPA 3L4EA 5KU1A 3IA2A 1OC4A 1M1NB 3I32A 4XIFA 3ROQA 1PZGA 2HRQA 3A4TA 3R3VA 5AKEA 1GDHA 3H9CA 1I13A 1HGXA 2R4QA 1OY1A 1IPFA 2VDNB 3JYOA 3P32A 1E0KA 3QLUC 4JU8A 4GPZA 4RSRA 4BQQA 5HIMA 3E9EA 4EKGA 3H9JA 3ZGZA 3S27A 2ZRIA 4NE2A 5CCDA 1PKXA 4CTJA 1VKJA 2I8LA 1FRVA 1WKCA 3ENWA 1NYTA 3FGOA 4WZBA 1FUYB 1NXXA 1QHNA 1VIVA 1W49A 3D6TB 4HHEA 3I05A 4CEJB 1TAUA 1K7YA 4RTJA 3ZDBA 3T5TA 4EPYA 4JLAA 2FW7A 2H7XA 4KL8S 2XCIA 3IV9A 1M1ZA 3JWEA 3NIGB 1HFKA 5D85A 1L5FA 2DM6A 3L4BC 1QB7A 2C8JA 1AZWA 1M2FA 1WLYA 3PRYA 4KV7A 3CWQA 2RK3A 2OBFA 4YCMA 1DX6A 5KDOA 4QEDA 3NCTA 1FSZA 5AVZA 3AI1A 2CV2A 1P61B 4WMLA 1KI9A 1XZNA 2WJ6A 1FTGA 3QKSA 4K9OA 3SJCA 1GKUB 1OWPA 4XRRA 4YQFA 1TKBA 2JAPA 1TKAA 3GRVA 3CPHA 2IEAA 3TFWA 3G2OA 4CHGA 1U5AA 3TBHA 3BL8A 2I3AA 3LW8A 3E9QA 4KSYA 3VKVA 3QPBA 2ZIVB 1J07A 1KE2A 5D8DA 1JAXA 3N74A 4FMDB 1NVVQ 3USCS 2B21A 1E1YA 3DD1A 2Q1SA 1UP6A 1Y7LA 3TZQA 1XWWA 4YHBA 4AJLA 3B48A 2EBFX 5ELLA 5JVDB 4KXXA 1QZUA 4LJYA 4P4LA 5BSMA 3WRXC 3BSFA 5M04A 1V1MB 3PU6A 4WOKA 3WQBA 4AROA 4S0ZA 2HK9A 2FB9A 2HA4A 4ANFA 3MQ2A 4R9NA 2C88A 3BT7A 1WX1A 4ZT4A 4IUYA 1Z9BA 4BNTA 5HDQA 2AN4A 2IV2X 2OP1A 5KQGA 3VR6D 2ZDGA 1EXMA 1LTKA 2B92A 2X0NA 3CLSD 3NHLA 4MMYB 4UZFA 5AJVB 5KBYA 1XGKA 2H2WA 2W93A 4H60A 3VJMA 2ABWA 4JP8A 4JX9A 4DIMA 1XP5A 3DUFB 1BHO1 1HLDA 3MT9A 3VZSA 1OX4B 4RHXA 2XRMA 2VR1A 1ZBQA 3P9ZA 4YMGA 1NP7A 3CZQA 3OOYA 2MJLA 2JD0A 4AURA 2O8DB 4AUEA 1C3LA 4Q9LA 4EHDA 4WXPA 4CMBA 4A36A 1IEQA 3TW0A 3V4VB 5JS1A 1Z5PA 2ZBUA 3A7DA 3WQRA 2XV1A 5HRCA 2GJ8A 2ZR0A 4RENA 4B3DA 3ND5A 3HYNA 2GM9A 4RWZA 3DHEA 3JQBC 4D6PA 4EA8A 1UJ2A 2FGKA 5E1MA 2FAXA 2H00A 1XE3A 1KOJA 2H4JA 3VR4H 2HHLA 1KYYA 1T26A 4RPIA 4WZAA 4OJMX 3RTDA 3U4AA 5DHAA 2AKYA 1GADO 1K92A 3IXQA 2C3MA 3OPVA 4R8RA 1H8HD 1UBEA 3ESRA 1K68A 4WUTA 1X7ZA 2IDKA 4DCCA 1BXRA 3OJEA 2DJIA 1PFGA 3D7KA 1YQQA 3FW1A 4DSNA 3ZKWB 3NHUA 4QDOA 1B4DA 5EZ6B 4CIVA 1E69A 1V48A 3B2QA 4FOLA 5DLPA 4CIXA 2P4HX 4TMXA 3HB5X 2YZMA 1P62B 5LZ7A 4TM7A 3QTLA 1VKHA 3TB6A 4KRGA 3RO7A 2XXAB 2GGSA 1TQ8A 2TMGA 1H2XA 2QPAA 2Z0MA 5BR1A 2IHNA 1WBDA 5D2CA 4TLCA 5TEVA 2ID8A 4NBTA 4R3UC 1ZN7A 2ILTA 4DCMA 1ZJJA 5DNYB 2XD4A 3RS9A 3D8SA 4I46A 1D2RA 1KEVA 3BC1A 2Q0HA 3D6FA 3HRHA 4OFWA 4QDJA 5L3RA 3WB0A 2ZPAA 4YJFA 1XZBA 2BKAA 5BYBA 1BNCA 4D79A 2EG5A 1S89A 4PR3A 4TSRA 3U81A 5U9CA 1TYAE 1L4FA 1HL3A 1YJ8A 1ZMBA 2NZJA 2WJVA 2OV2A 3HDVA 4HAZA 4Q7KA 1U0NA 2OGWA 4LTDA 1D9XA 3GEIA 2IPNA 1EDEA 2XMQA 4XVUA 5MGNA 4M21A 2ZATA 3EMVA 3HCBA 4M1EA 3GF4A 2BEWA 3RAPR 4B2PA 1AU9A 1BEEA 3A6FA 4OHMA 1JUDA 3OU7A 2GM5A 3SOPA 3P0IA 1YTLA 3W5JA 1XHLA 3N6XA 1YL5A 3ZIAD 1E7YA 1I2ZA 2YYZA 1B23P 1MRSA 4RJTA 1GNVA 1N75A 4P32A 4QTYA 4JELA 3O3NB 1F5NA 5C1OA 4PLFA 1YGYA 3ETHA 3DGEC 1VSTA 4XJVA 3VRHA 2O2CA 2XJ4A 4Q1EA 3HJHA 3TAXA 3Q41A 5DI3A 1XMOB 4MWBA 1F51E 1VB5A 2OBLA 4G0PA 4I8DA 1RQRA 1Z15A 1Z74A 4QUHA 3I5XA 2QMYA 2OCIA 2BRUA 1ZUIA 2F1HA 2VNAA 2EVWX 2FW8A 1G4AE 2G1AA 3Q6NA 5E0KB 5PNTA 2I55A 4FB4A 1DC5A 3A2LA 3MAGA 3HHPA 1GWNA 2J5BA 4O5OA 1Z63A 5I8WA 1WSWA 4OQEA 3TSWA 4BIIA 2O14A 5ALNA 5KQRA 3K71B 3R3ZA 3G6KA 3ROFA 2ZYRA 1H2EA 1JF8A 2PU7A 2VATA 4P3PA 4QXRA 5KUTA 4MHTA 1EFRA 2QE6A 4MINA 2P69A 2XBMA 1GQYA 1E6EA 1FW8A 1XELA 2C94A 2HDHA 5A5DA 1NULA 4KYTA 3F7MA 4UW9A 3NU1A 1EUQA 3QKTA 4G37A 2IDZA 2BFFA 1GRNA 2AZDA 1H5QA 2A7XA 2HMAA 3IXMA 4U00A 4BO0A 4OHYA 2JLQA 3ETCA 3G9TA 4XM2A 3V8NA 3CJTA 4A7PA 4P3YA 3E35A 1P9WA 3DC2A 1DTWA 1JQEA 2AYXA 4IFTA 5AW3A 3HU1A 4DDVA 5CYPA 4FEGA 4B6SA 4C5BA 3DMGA 1RCTE 2BPOA 3FMIA 3I5YA 1YK0A 3COSA 1JEYA 3EYAA 3CO5A 2DTDA 4HWSA 4ZYWA 2I4RA 3WL3A 3VNSA 3WQQA 4C5CA 4FFBA 3S55A 1ITZA 1TX4B 2CNNA 3E61A 4L02A 2PXHA 3DW3X 4CLXA 3VX4A 3D6AA 4O4HB 1QX4A 3SYRA 3NJ4A 1DAEA 1GG9A 1JWAB 3G13A 3EY9A 2A9OA 4X92A 1NBAA 4BFUA 4F1KA 5FQOA 4FN5A 2P6OA 2GM4A 2QN7A 1N6PA 1RRPA 4OXKA 1SCJA 3NHMA 4BECA 5MGBA 1KQFA 2X41A 3SJBA 4OX9B 4NCKA 1YS2X 3BGOS 1CS4C 3S7TA 1ZEJA 4MR9B 4MVXA 3N7UA 4HWRA 4BO7A 3NBKA 2A86A 1JT2A 2HWWA 1RYHA 2ZIEA 1JPVA 2NU7B 4TYQA 5EEHA 3AJRA 3W8NA 1EDZA 3NC0C 2J9GA 3FNRA 2VDQB 4RSGA 3DZGA 3EVEA 2WWGA 2GEDA 1BRMA 3GJSA 1T4BA 2BFOA 5J4VA 1Z2OX 2CHFA 3OEYA 4XWGA 4HY3A 4D8TA 4Q7LA 3D6UA 3VC3A 3AT1A 2IBSA 4D41A 1P73A 2HEGA 3R7DA 3GQVA 4DHWA 3SLRA 3JRNA 2P30A 5K0NA 4ENTA 4L50A 4P98A 2UYYA 1A9RA 2RG1A 4G1MB 4ZOLB 2JFQA 3RV3A 4EBFA 3GFBA 4U7HA 2AOUA 4J29A 3ROXA 1RI4A 3WIEA 3AUYA 3GJYA 1YWGO 3QBVA 1O94A 3HBJA 4O33A 1GD1O 2FYTA 1DC3A 3CQ9A 3KR0A 3DXYA 4JQOA 5B36A 5IWCA 3INRA 2N1BA 4Q82A 3MLAA 3IUSA 1ZGBA 4DQVA 5BVHA 4TRRA 1DBSA 2F4NA 2VK4A 4IBOA 5LOVB 1IBLB 2VYCA 3N5KA 2Q1XA 3E15A 2YYSA 3WYDA 1HLFA 5TF0A 5LZ2A 2J6HA 4XB1A 3TLMA 1UBLS 1WSBA 1X74A 1ZH0A 2DUUA 2PM8A 2R4TA 3G2JA 3II6X 2ASEA 3C8DA 3Q2KA 5AK3A 2PRIA 1YZUA 1YR1A 2J9FB 2MR5A 2VQSA 3IPLA 4ZYTA 2G9UA 2HIMA 3F98A 2CDRA 3ZVNA 2QN3A 2N0SA 2QUAA 4R69A 4CXMA 2ZGVA 1RQPA 3EIQA 4I4TB 3V8QA 4EGAA 3PF9A 4JCCA 5JY1A 4EYGA 4ND3A 3WGLA 3BMQB 1SRQA 2GJAA 3E05A 1OA0A 3K32A 1G16A 2BH9A 4EMSA 1UXJA 3ISTA 3B5IA 2JL1A 1CSEE 3AKZA 1XDWA 5CVEA 4Q4DA 1OOEA 4CLHA 2Z5VA 4TKUA 4Z86A 3TF5A 3GO4A 4F3NA 2V0NA 1R4MA 2RCNA 3M33A 1N5KA 3NDPA 4HGRA 2W6ID 1EUYA 1B00A 1FXWA 3BE5A 2A0FA 2AG8A 4FHZA 1MNQA 2JJQA 3O91A 3QXXA 3H0CA 3WAKA 1UDWA 3F3SA 4NDNE 3M6AA 2QLNA 3K8YA 3TI7A 3MWEA 1WW8A 4GI2A 2DT5A 2H18A 3MD0A 3O4VA 4TKVA 2AOWA 3OAAD 3UHPA 3NHYA 1DG3A 2ZPUA 1FNCA 1TZCA 1YQ9A 4O4LB 1QMGA 1TE2A 2V55B 1I4WA 3GZNB 1U0HC 4FQ7A 4TRMA 1ZYUA 1XDDA 2WK1A 1KJ9A 2FFRA 3KT8A 4UTOA 4UZSA 5ER6A 2DBVO 5C1IA 5IVPA 3RK0A 2YVAA 1Z26A 2ZBVA 3VPDA 1AF7A 4QLAA 4IFBA 1RLMA 3FBWA 3DBOB 3HA5A 4YV0A 3EFEA 4P35A 1WHTB 3LL4A 1OLUB 3QJGA 1PJZA 4IF6A 2HMVA 3GY0A 1DRUA 3B6ZA 4HUQA 5FIUA 2FFHA 5FWDA 3SIWA 4F91B 2HRRA 1Q92A 1VJ5A 4UHCA 1UKBA 3EZ7A 3PUHA 2YRWA 4KWIA 1V6AA 4Q15A 3OIYA 3O7MA 2QA5A 4YS6A 3W1VA 2HCBA 2UYHA 1CEQA 1W34A 4I1IA 121PA 3U4DA 2Z4SA 4JYAB 1OBFO 2HGSA 3G7NA 1XZGA 2C5AA 2ZCVA 1T2VA 1A7AA 1UBTS 2CLKB 2XPCA 4W5JA 5FF9A 4ETMA 3QJYA 2K2WA 4Q19A 4LRWA 2XIJA 5K6AA 5JJIA 1TXGA 5H3CA 1XEXA 2XMSA 3PHCA 4HV4A 1YUMA 5EA2A 5C8XA 4TSKA 4E08A 2WW8A 2B35A 3UCFA 1U1IA 4FE3A 4JJKA 4NC9A 3U7HB 1ENYA 2BEUB 2FSPA 3PF8A 2QRQA 1HQKA 3VHQA 1PSWA 5LMZA 3OOSA 4MS4A 5EEGA 5JDIC 3HBMA 1UK7A 3RU9A 2A8YA 3Q2OA 4II3A 4BNKA 1F48A 4G0UA 2AMYA 3ZV4A 5K0FA 2WIKA 2GK4A 4G0MA 3VNRA 3AM5A 3LT0A 2O8CB 1M0SA 3IJRA 3QMPA 4D0SA 2ID7A 2J09A 1SQ5A 1TOAA 1X94A 3QTBA 1H8EA 3GIDA 3E8XA 1O2DA 3DMTA 3LLCA 3Q3HA 2W2LA 4I50F 1K3TA 5JMWA 3WR5A 1DRKA 4M6WB 3TX2A 4PG4A 4JLSA 2BHTA 4IF4A 1XU9A 1JHAA 4R05A 1BFDA 2Y9PB 2WZQA 3K0CC 4GQBA 4AZ3A 1MQ8B 3PFKA 5CVUA 2I3BA 4F9FA 3RASA 3I5UA 4QHTA 1ZK3A 2HLHA 3VJKA 1PD1A 1YRLA 5AO9A 3WICA 4AO8A 4B9EA 1W29A 3GJRA 4IJMA 3WZLA 4CQJA 2IHVA 2D5IA 2O8EB 2Q21A 1K6MA 5LU8A 1ABEA 2JGEA 2OV6A 2GAJA 5TGDA 3UG6A 4BNGA 5JCOC 4DB4A 1PR1A 5HM8A 1JVSA 3AF4A 2ZITA 1U4OA 3MMSA 4P38A 3BH7A 1W36C 1MIOA 4LHEA 5A1JA 4CL3A 2FWJA 1R2QA 3HHEA 2OA0A 3WKEA 2CUNA 1V71A 4NYJR 5B7PA 1CUZA 1TZ2A 1JDNA 1WB4A 2AD1A 1KYXA 2IGBA 4L75A 1MIHA 3IEXA 4X84A 5ILGA 3UK0A 5KNCD 4MW5A 4P7JA 2IXTA 4OIFA 1P8JA 5B2FA 2NUPA 3MS2A 4C2AA 4F6CA 3RQIA 1R4AA 1KPIA 1QBKC 1WDWB 2DUWA 4HCJA 4EHNA 3VSEA 2Q5QA 1AMNA 1J8QA 4IG4A 1EFCA 1QV7A 3V4ZA 2ODWA 2VF7A 3FMVA 5K0GA 5C1DA 4YB8A 3FF4A 4OAOA 4I3GA 3TLYA 1UOOA 3HGQA 2ZCJA 2I99A 1SUIA 1TT7A 4FXPA 1FVOA 1WXWA 1IN5A 1E5LA 1J2RA 4QXQA 5AKKA 2Q8PA 5ECYA 1UM9B 5IJ9A 1CJUC 4RTQA 1PG2A 2BFEA 3QFFA 1E1RA 4IV8A 3N1UA 4QU0A 3I9NA 3SZMA 1IXKA 1DAFA 2XVMA 1NQAO 5AM5A 4EHBA 1AZLA 2MINA 3IMKA 5HCUA 2IUFA 3NV7A 5JNSA 4OB8A 2XEDA 4DA7A 1ABBA 1P9NA 2G06A 2LRHA 3GLFA 1GKIA 2NZWA 2W9XA 4HX5A 5EZQA 1WXQA 1CX9B 4Y0AA 3X44A 3DDCA 5KAMA 1RYYA 5IWAB 1Y34E 4ARUA 5SYMA 1JI0A 4R1OA 3T9FA 4NJEB 2PH3A 3T35A 3G0IA 1JLMA 4YDSA 5DW3A 2AE2A 4BQOA 3D6MA 2JHFA 2JHGA 2YWBA 2GBLA 3KDSE 2ZDQA 5FEMA 4BUZA 3DXFA 2A1UA 3LY7A 3ZVRA 4X97A 4MB2A 5K1ZA 2Q3BA 1H4QA 2J3MA 2CZCA 4A8JC 1U4SA 3CLUC 3GEGA 2N3ZA 4I55A 3ZHZA 3KUDA 3GJTA 3RC9A 1J0CA 1Y98A 2GAFA 2KHZA 5M3BA 3W06A 1ZXXA 3DHWC 2O1SA 3LCJA 5CA1B 4GKVA 4ND1A 4BZXA 5FPSA 2RGDA 1MJFA 3TB4A 2NQ2C 2I3DA 4NG4A 4OREX 5CK4A 5BNTA 4R81A 1WJGA 2YWCA 1PJ8A 4PNEA 1D2MA 3WGQA 5K3OA 2CLHB 3OP1A 2XYHA 1N2JA 4N49A 1QHHB 2GF9A 2OHIA 2LTAA 4HI0E 4RGVA 1TO2E 1JP7A 5EWLA 3PXUA 4WIAA 1V3UA 2EKDA 3A3PA 3RSHA 2PANA 2XCOA 4BFZA 3D1LA 4RLQA 1ESNA 3AEQB 4HZGA 5EESA 4XX1A 2C9YA 1Q50A 3ASVA 2OV1A 2V9PA 3HKBB 5FNVA 4C01A 2QNIA 4B75A 2ZTMA 2WWFA 2QJWA 4ZKEA 1ZD1A 4IH4A 2HCFA 4H08A 4L8WB 1YVDA 3S2ZA 5MF6A 4EBBA 2Q6IA 2X76A 3WGZA 1CRPA 1P9OA 5KTNA 2RKBA 3KL4A 5TV2A 3V48A 2F7SA 2JGIA 5J3JA 1G21B 2R5NA 4IHJA 4Z4EA 4WESB 1GT91 3HXQA 4B0PA 1EFLA 1EFPB 5I9MA 2P9YA 2XY4A 3OBIA 2JFNA 2HA3A 1KAEA 1SPBS 3BCSA 3NATA 4QFDA 3JD0A 4V3CA 4RPCA 1RMYA 1C1YA 2FG5A 3T9AA 3FAKA 5LR6A 1H4TA 5CB0A 3IDOA 2VNKA 3C87A 4FHFA 3CO0S 4GC5A 4WDRA 5SY4A 3GELA 2NOAA 1L4GA 5IVIA 2BCJQ 2G09A 1SD2A 2YWEA 3B9QA 4PYMA 3ZI7A 5CDSA 4CLRB 3P4UA 1L5RA 1V1RA 3IXLA 3Q6IA 2ZU6A 3PSAA 4L5BA 5DW0A 1JSRA 2QTMA 4YPVA 1QVAA 1A0OA 2IH4A 1RYDA 2I7CA 3JZMA 1PL6A 2CXRA 1B6TA 2Z4TA 1GGFA 2OZLB 4Q48A 3I34X 5AKLA 4ZVLA 5TQ0A 4CM5A 3NASA 4RVCA 3TZCA 1T34A 4HGYA 1AGXA 5P8WA 1CCWA 2WV9A 1G7RA 4D26A 1P1KA 3LOPA 1BXZA 4N12A 4PLGA 2AG6A 2FWPA 5HILA 3N8NA 4IOMA 2G88A 4U2KA 2FN7A 4MV6A 4HLNA 1UMDB 3H4MA 4L85A 4ZZIA 4LJ4A 3ZZ1A 2BEKA 3QUBA 1OV4A 1SHUX 1T36B 4QDKA 1LBIA 2VF5X 3OFNA 1PFYA 3O2QB 4UBOA 4RESA 4I36A 4BUCA 6NULA 3OZ7A 4WLNA 5IK2D 2W42A 5FBVB 1U04A 5IBRA 2ZJ2A 1WUHS 5FI5A 3G68A 3GP3A 3RF6A 1S8NA 1FLAA 3ULKA 5BOSB 3MIZA 5JMTA 2A0KA 1WPRA 2XMBA 2BUBA 3PNMA 3H8SA 3HMKA 4Y0VA 5JD6A 4LKOA 3S81A 3R7FA 1XZKA 2O0MA 5JJBA 1LPOA 5T41A 1JAYA 4PPGA 4BWVA 1F0KA 4DZRA 1UPXA 4BEWA 5CGQB 4O3MA 1MFZA 5AM2A 1W0KA 4DREA 3TLBA 2BLNA 3UQZA 3K9HA 4E07A 2W8BB 3H19A 4BRUA 3STYA 1OWOA 1HH4A 1KAOA 4AG6A 5JC8A 5JS7A 3GOQA 4BQRA 4XW2A 3O4JA 5TB5A 3SYKA 3NI2A 4Q3CA 3WNDA 3WV5A 1NIJA 4P54A 3ZE8A 1B6GA 4QL3A 3RCBA 4IMJB 3DAFA 4G86A 2YFQA 4Q9KA 3OA0A 1TDJA 4GZLA 3DH0A 3ESCA 3NBZC 1XCLA 2YJ3A 3EGXB 4JN6B 3DE5X 3IQWA 2HMYB 1H0RA 1TM2A 2PZEA 2BGTA 3AY6A 4UOQA 1ORTA 4BNHA 4TLEA 2HXSA 4WOJA 4QOJA 2DR2A 1G8FA 1YDEA 1NXSA 4BV8A 1T6ZA 3E58A 2X40A 4EF5A 4POOA 1EAMA 4OYHA 3OPMA 2X0IA 5TPWB 4HDNA 3KQLA 3FYHA 3HCEA 4HDQB 4LOHA 2IS1A 4WA8A 3TINA 1G5HA 1IHXA 5LA6B 1NX6A 4R51A 5TT0A 2XWBF 4V02A 1J33A 4OYRA 1NLMA 3A1SA 3SSNA 2Y1XA 3UW1A 2JGLA 3V4OA 2TRSB 1VBFA 3UJPA 1THTA 2RHBA 1M9NA 2B69A 2OSVA 2GA9A 3M6UA 4G23A 4OYLA 2C7VA 1WB5A 4DR7B 4U3JB 2FNAA 4BB5A 4EPXA 1P2GA 5CA0F 1I51A 4QWWA 4D97A 1KAMA 2V6IA 1VGVA 2G0TA 2REXB 3A1DA 5D1HA 4J0EA 2OQ2A 4YRPA 1WDKA 3TH5A 2ZROA 4XIGS 5UKDA 3L43A 1Z8HA 3JASB 4F7DA 5A71A 4UTNA 3DYBA 3FF1A 2RBKA 2GO7A 3WYBA 4Z5XA 4NP6A 5G1PA 1OXKB 1VG9B 3AILA 3NBQA 5H80A 3FYDA 3NHKA 4WBXC 4G56A 4Q1FA 3B6IA 4S2UA 4D56A 3V8EA 4P84A 4DCOA 3DT8A 3ND9A 4ERNA 1FYFA 2NUTB 4Q93A 3PI6A 1I32A 1M1NA 3KB2A 2RAPA