4CK1A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ck1A00
5KI6A 1T8EA 4FJGA 2IAJA 5E41A 4KTQA 1JLGA 4CHNA 3KJVA 3E01A 2KW4A 1VRTA 3KKRA 5J2QA 1WAJA 3NFAA 1KRPA 3AVKA 3MEGA 4PUOA 4OLAA 4EZ9A 3ITHA 1WSFA 1HRHA 3OYEA 3M8PA 4WE1A 4HCBA 1F21A 3OYNA 1C6VA 4E7IA 1NK6A 4KHUA 4ZTFA 3L2UA 3WNEA 3OYKA 3AVLA 3DRPA 4CEOA 4FJXA 3V9ZA 2VWJA 1QHTA 4NCBA 2QXFA 3DRRA 3KD5E 2LSNA 3B6OA 1L3UA 1BISA 3PX4A 4CCHA 4AHUA 3WNFA 4E1MA 2OZMA 3VQ9A 4QCLA 4NYNA 3HP9A 4DU3A 4N56A 1X9MA 2Q3SA 5J2PA 4BWMA 4E89A 3NF8A 1EXQA 3AO4A 3OYAA 3D0PA 1TAQA 4CIFA 3OJUA 3PO4A 4M45A 5HLFA 3LP3A 3LP2A 2O4IA 4N76A 3QNOA 1S9EA 4K8XA 1KLMA 3L2WA 4DSKA 4FLXA 4FLTA 3VQPA 1KVCA 1QSLA 3AA4A 1T05A 3KLGA 1RBTA 1BGXT 2IDOA 4C8KA 3HVTA 2KFNA 4MFBA 5FROA 3K5OA 4OKJA 4DG1A 4N5SA 1VSKA 4E3SA 3ZCMA 3TAQA 1ZBHA 2HHVA 4RW4A 1K6YA 1RT5A 2VG6A 3SQ0A 3QETA 1HYSA 1I39A 3HO1A 1UA0A 2A1SA 3AVHA 3CQ8A 3C94A 2ETJA 4ZHRA 3VA3A 4CHPA 3ISNC 1WSEA 2G8IA 1RT7A 4EP4A 4CIEA 4B08A 2HNZA 4DTXA 4LSLA 4B8CA 3NDKA 2HW3A 2P5GA 3AA2A 1MU2A 1ASUA 3NE6A 3S3NA 1S1VA 1LAVA 4NCAA 1L5UA 3M8RA 3TWHA 2YNFA 1ASVA 2KTQA 3L3VA 4CFBA 4YFUA 3THVA 1WSJA 1Y97A 1SL2A 4DMNA 1TKDA 3RR8A 4M3ZA 4CJ4A 3KKSA 4FLVA 3TARA 1SKSA 4CHYA 2YNHA 4CJLA 1S1UA 3ZSWA 2OPPA 3OS1A 3QESA 4W5TA 3NGIA 1RTHA 1UWBA 3HP6A 4DLGA 3DLRA 4CK1A 4CF9A 4BE1A 1GOCA 1NK9A 1S5JA 4CJPA 3VQDA 4CJWA 2XY5A 3RTVA 3T3FA 3L2RA 1TKXA 4FJLA 1HMVA 1IKYA 4CGDA 3CFRA 2G8UA 3TAMA 2AJQA 3IRXA 3V4IA 1YTUA 3TR8A 3CG7A 5HBMA 3BGRA 4CEAA 4E7KA 3RMCA 1A5VA 1HQUA 3SNNA 1CXQA 2ITGA 1L3VA 4B9UA 4Z4HA 3SZ2A 3V9UA 3U3GA 1KVAA 3V9SA 2KZMA 1CLQA 1HQEA 5HRSA 2IC3A 3OYMA 3P83D 1YT3A 3NGZA 3IAYA 5J2NA 3TANA 3PY8A 3MEDA 3RRGA 2EX3A 4IFVA 4DFMA 1D9DA 3G0ZA 5J1EA 4FLYA 5CYMA 4CFCA 4E7JA 2WOMA 3OYJA 3K59A 1NKBA 4FLZA 2XRIA 4AILC 4KI4A 3ASMA 1JLQA 3AA3A 1G15A 3NCIA 1WLJA 5KTQA 5HROA 1JL1A 2DFEA 2HB5A 1DLOA 2YNGA 2P51A 1BI4A 4KTWA 4AHSA 3K5MA 4DSEA 3TABA 1SL1A 1U45A 1KSPA 3RWUA 1VRUA 2PYLA 2YHBA 3CFOA 4BWJA 1WSHA 4FJ5A 4FK2A 4ELTA 2ATQA 1NJYA 4L8RB 1VSIA 4DSFA 1JLCA 1S1WA 4FLWA 3DYAA 1GOAA 4YNQA 3ZSXA 4HTUA 3T19A 1Q9YA 4CJEA 3WNGA 2DY4A 3ZT2A 2HHSA 1TK5A 3MXIA 1JLEA 3S9HA 1ZBFA 3VQ8A 1SL0A 2DTUA 2IGIA 3G10A 1CZBA 1RCHA 2OZSA 3QIOA 1NK5A 3MXMA 3L8BA 3OVNA 4ID5A 4AHCA 2FBYA 3D45A 4W5NA 1TVRA 5T7BA 1ZBUA 1B9FA 3VA0A 5HRRA 1FKOA 4DSJA 4OLBA 4FXDA 3RR7A 3RRHA 3QEVA 1REVA 3TAEA 2ZD1A 1UOCA 2Z1JA 1N6QA 4DTRA 2HHWA 3KLIA 1FKPA 4CJKA 2X6SA 4F2RA 4C8NA 2X74A 1A5XA 5FDLA 3VQQA 4DTJA 3A2FA 4CE9A 4CERA 3DM2A 3SV4A 2FBVA 4B9MA 1LW0A 1JL2A 1SUQA 4F3TA 2KFZA 1JLAA 4CJUA 2X78A 3V9XA 4KAZA 3AVGA 2GBZA 2RN2A 3HYFA 1BQMA 5DK5A 3CM6A 4FCYA 3BDPA 3ZSQA 1BL3A 2OPRA 4I9QA 1UA1A 4OGEA 1C1BA 2Z1IA 1XWLA 4RG8A 2OYQA 4DQPA 1JXBA 3TI0A 4PQUA 4CF8A 2OA8A 3HPOA 4DTNA 5C24A 4PY5A 5CZ2A 3DOLA 1EX4A 4UQGA 4Q5VA 4FZYA 3K5LA 1CZ9A 2GV9A 4KTZA 3VQCA 3S3OA 1NJZA 2XY6A 1TK8A 1VSMA 3LALA 5CZ1A 3PX0A 1DTQA 4OPKA 4KHSA 3OYDA 3NF9A 1RDAA 2Z1HA 4XIUA 3NGYA 4M3WA 4DQRA 5CY4A 1XHZA 3KD1E 1LAWA 4DU1A 3ULDA 3DOKA 1QE1A 4FW2A 3LWLA 3P5JA 3IS9A 1J9AA 3O4NA 2XO7A 1RT4A 3EY1A 1B9DA 2QKKA 1SV5A 2G8VA 3M8SA 1BIZA 4K8ZA 4H4OA 4AHTA 2YKNA 3SQ4A 4CGIA 4CGHA 3AO1A 1U4BA 1NJWA 4NCGA 3B6PA 4O44A 3KIOA 4IFYA 1LV5A 5SZTA 3TAFA 1VSLA 4IDKA 3V1RA 1RT1A 4NYFA 4CJ3A 3AVMA 4DTMA 3QO9A 4CECA 1W0HA 4CF0A 3DRSA 4H4MA 1LWCA 3KK2A 4FJIA 1NOZA 4AHVA 4HUGA 3QINA 4B3OA 2HNYA 2D0AA 3O4QA 3ZT3A 1RBUA 3OY9A 2Z1GA 1ZYQA 4C8OA 1S1TA 1IH7A 3ZT1A 4BE0A 4PWDA 3QIPA 1NKCA 1I3AA 4O55A 3QERA 3DLEA 3VQ5A 3LP0A 1BCOA 2JGUA 1IKVA 4OJRA 4HHTA 3SUOA 4CFAA 1WAFA 1W9HA 4KV8A 2ZE2A 4B8AB 4FJ7A 1WSIA 4DFJA 4HVJA 3EZ5A 3KK3A 2XY7A 4DTSA 4DQQA 1RDDA 4DTOA 3OYCA 1FXXA 5FRMA 2YHAA 4LD0A 4N41A 4M42A 1S9GA 4CFDA 3HPHA 2A1RA 2G8KA 5HP1A 2RKIA 3QEXA 2HHQA 3SYZA 2XHBA 1Q8IA 2RF2A 3DLGA 1X9WA 1JLFA 3K57A 1YVUA 3AVBA 4BDYA 4DQSA 1NJXA 4JRQA 4B9NA 5KGXA 4FJKA 3JYTA 3RMDA 1LW2A 2OPSA 1HNVA 1FK9A 4R5PA 4RW9A 4M3TA 5D3GA 4Z4CA 1C0UA 1B92A 3AV9A 1NKEA 4ICLA 4AH9A 4J2EA 1J5OA 2D0CA 3AA5X 5KRTA 2YKMA 2D0BA 5KRSA 4CJTA 1S6PA 3AVCA 4DF8A 3K5NA 1TAUA 4ZTJA 1VSDA 3ZT4A 3KLFA 3H08A 4KFBA 4O4GA 4AHRA 3NBPA 4GW6A 4IG3A 4OGCA 3HPGA 1KFDA 3LAKA 3DLKA 4IBNA 3K58A 2VWKA 3VN5A 1BHLA 2RPIA 4HUFA 4FJJA 4Z4IA 3PV8A 2Y1IA 2R7YA 3SQ2A 3OYHA 3AVAA 2ZQBA 2PYJA 1KTQA 3CM5A 3ZSRA 4CJ5A 4E7LA 1XI1A 1IKXA 4KPYA 2BDPA 4FK0A 3WNHA 4I9LA 4CGJA 1RTJA 3O3GA 2F96A 3F73A 1ZBLA 2EHGA 4KI6A 4LH5A 3QNNA 5JS2A 4J2DA 4RW6A 4FZZA 1SKRA 3RMBA 3I0SA 4DSLA 1QS4A 4CEFA 2YNIA 4CESA 4I7FA 4DTPA 3V81A 3SQ1A 4OVLA 3I0RA 3C95A 3VQEA 4M3XA 3NF6A 4B9LA 2B5JA 1C1CA 1RNHA 3CYMA 4EP5A 4JRPA 1U49A 3HM9A 2OPQA 1TKZA 3V6DA 4KHNA 4FLUA 1O1WA 1TV6A 3PUFA 4GMJB 4LY7A 3L2VA 4Q0BA 2HHTA 4CEDA 1Q9XA 4QOZB 4KHYA 3IG1A 1HYZA 2P1JA 3SI6A 4CHOA 4KHWA 2BANA 2HHXA 3NF7A 1HJRA 1RBSA 2IS3A 1D9FA 1NK7A 1BQNA 2DFFA 1KLNA 4KB0A 4F8RA 1KVBA 2DFHA 4B9VA 4KHQA 4ID1A 3OYBA 3FFIA 4E7HA 3L2QA 1R0AA 3PX6A 3KTQA 1GOBA 3VQ4A 3TAGA 3C6UA 4CEQA 3MXJA 4CJQA 3HJFA 3HVRA 3OJSA 4CJVA 4IKFA 4FJ8A 3AVIA 2BE2A 4DTUA 4H8KA 4FJMA 4HUEA 1D8YA 4B9SA 1L3SA 2HNDA 1RTIA 3HXMA 1ASWA 1TKTA 1U04A 2KQ2A 3AO5A 4PA1A 5C25A 2IOCA 4M41A 3OYIA 1WN7A 4ELVA 4DFPA 5K14A 3VQBA 4W5RA 2X6NA 1NK8A 3LZIA 4FVMA 2D5RA 2B4JA 3HL8A 1NOYA 3OYGA 1NK4A 4J2AA 4KB1A 3SV3A 4CK2A 3SCXA 5I3UA 4HCCA 3ZSZA 3DMJA 1VK0A 3LP1A 1KFSA 2PY5A 3UIQA 3OS2A 4CF2A 2Y1JA 1X9SA 3NHGA 3LWMA 4DFKA 1S6QA 3MECA 1S1XA 4E1NA 4CJRA 4RW7A 1T7PA 1EP4A 3NH0A 1RT6A 3ZT0A 4Z4FA 2BGGA 4FYDA 1JLBA 1QQCA 3HT3A 4Z0UA 3LDSA 4ELUA 2HHUA 1A5WA 4CEEA 4CHZA 3QEPA 4IG0A 1NK0A 3DLHA 3SUNA 1TGOA 4KO0A 2JLEA 5DMRA 4C8MA 3DI6A 3NAEA 2HVHA 1C1AA 3ZSOA 1HPZA 3VQAA 4G1QA 1TL1A 1WNSA 3M8QA 4B9TA 3F9KA 1TL3A 4CEBA 3LPUA 1QSSA 1J54A 3AVFA 3KK1A 4FW1A 4Y1CA 3AVJA 3NH2A 3U6FA 3VQ6A 3HSTB 1HYVA 2VG7A 3K2PA 1VSFA 1DTTA 3LAMA 4C8LA 1EETA 4BACA 4I2PA 2G8FA 3PO5A 2FBTA 4CHQA 1RILA 3KLEA 4DLEA 2I5JA 3VQ7A 4BDPA 1T03A 4BDZA 4KREA 4FJNA 1QTMA 1IO2A 3MEEA 4RW8A 3L3UA 3HK2A 4Z4EA 4LH4A 4N47A 2P5OA 2G8WA 4FK4A 2HVIA 1RBVA 5FRNA 4LSNA 1TK0A 4CK3A 1BIUA 3RMAA 1U47A 1ITGA 1Z26A 5HRPA 2HMIA 3LPTA 2B6AA 4OKKA 2YV0X 3QEIA 3JSMA 4O0JA 4O5BA 4M3RA 2W42A 3EYZA 4FM0A 4CJFA 3S3MA 2XY8A 4DWIA 1D5AA 5C42A 4J2BA 2QKBA 1ZBIA 3QEWA 3OS0A 1C0TA 3LZJA 2F8SA 1YTAA 3V9WA 4M3UA 2GUIA 3DLBA 1U48A 2G8HA 4EZ6A 4MQ3A 1KCFA 3ALYA 5J2MA 1QSYA 5SWMA 4F3OA 1IKWA 1BI4B 2E6MA 3SPZA 3AVNA 4GVMA 5JS1A 1VSHA 1UAXA 1Z25A 1LWEA 1X1PA 4CGFA 5HRNA 4DQIA 4KKOA 4JS4A 1EKEA 4Y1DA 4BE2A 5EU7A 1J53A 1JKHA 3V1OA 1RT2A 3KLHA 4JLHA 1C0MA 4JS5A 4OPJA 5I42A 1HNIA 1LWFA 4QAGA 4W5OA 1XHXA 2PZSA 4DF4A 3P1GA 3QLHA 4E0DA 1CXUA 4FM2A 2VG5A 4KRFA 4CEZA 1IG9A 4M3YA 4I2QA 1SKWA 2NUBA 4O0IA 1L3TA 1RDCA 4F4KA 1VSEA 3C6TA 2FC0A 4E19A 1RDBA 1JXEA 2E6LA 4TSXA 3I8DA 3SUPA 3OYFA 4FM1A 4DS5A 4FZXC 5KGWA 2O4GA 2F8TA 4DU4A 4CIGA 4W5QA 3V1QA 3ZSVA 1BCMA 3CFPA 4OKEA 3O3FA 3ZSYA 3U3YA 4DSIA 3SUQA 3AO3A 3T1AA 3MAQA 3AO2A 4FJ9A 1N5YA 1RBRA 1WSGA 2WONA 5CYQA 4CF1A 4CJSA 1XC9A 2FBXA 1RTDA 4DS4A 4F2SA 4Z4GA 3OYLA 2E4LA 3TAPA 4FJHA 4CGGA 3O3HA 2KZZA 3SPYA 1VSJA 3NH1A 3LANA 3SJJA 1RT3A 2QK9A
chains in the Genus database with same CATH superfamily
2IAJA 2HF4A 3VOVA 1JLGA 3PIPL 3K0SA 3E01A 2KW4A 1Q82O 4CJ7A 3IMXA 4JKGB 4MLEA 4QS8A 4EZ9A 3ITHA 5TKYA 3OYEA 4WE1A 4HCBA 3OYNA 1C6VA 5ELZA 4E7IA 4ZTFA 4RCHA 1QHTA 3WEEB 5AQNA 4CCHA 3PX4A 3J7ZO 5DM7L 4NYNA 4DU3A 2E8AA 3OYAA 1TAQA 3GG4A 4XH5A 2DPNA 4CIFA 4YOYA 4M45A 1VQLN 4K8XA 2FSJA 1T05A 5E26A 3KLGA 1BGXT 2IDOA 4DR7K 3FGUA 2ZJPL 4MFBA 4DG1A 3ZCMA 1K6YA 2VG6A 4GY2B 3SQ0A 1OH8A 4JYAK 1UA0A 3C94A 4CHPA 2P9IB 4DTXA 4RTFD 3NDKA 5C2FA 4JHDA 1RDWX 1L5UA 1TYQB 4H5RA 3M8RA 1ASVA 2KTQA 5AQGA 2WFBA 3TARA 1O13A 5AQTA 3OS1A 4IFEA 1KQSM 1RTHA 3SMSA 3HP6A 2O8CB 4CK1A 4CJPA 2XY5A 3RTVA 3WXJA 4BRDA 3L2RA 5JLHA 1TKXA 2QA4N 1EWQA 3BGRA 1A5VA 1GLCG 2IIRA 4B9UA 3SZ2A 3N4QA 1KVAA 2KZMA 1HQEA 3M1FA 1W2BM 3O9TA 3EL2A 5KQ8A 1XMOK 3IAYA 3TANA 1SS6A 3PY8A 4IFVA 4DFMA 5J1EA 4E7JA 4FLZA 3ASMA 4LF4K 3UKRB 4NO7A 1DLOA 2QI2A 1MA9B 5M1FA 1KSPA 1ZBSA 2PYLA 2YHBA 5M1NA 4U7BA 3WUHA 1NJYA 5BREA 4DSFA 1S1WA 2P9NA 1GOAA 4YNQA 1Q9YA 3T19A 4U67L 3ZT2A 3BF1A 1V4SA 3QIOA 4BVOA 4PKIA 2AA4A 2FBYA 4W5NA 5T7BA 3CC2N 1GLEG 5HRRA 3LDLA 3CJCA 3RRHA 1YI2N 5M1PA 2Z1JA 2HHWA 4DTRA 2OTLN 4CERA 2FBVA 2QEXN 1JL2A 1SUQA 2AP1A 3A5NC 4CJUA 2P9LB 5TKWA 4X65K 4IEEA 3HYFA 4YDUA 1BL3A 2OPRA 1ZC6A 4OGEA 3SJHA 2P9PA 3VENA 3WT0A 3VEVA 4PL8A 4CF8A 5C24A 1EX4A 4FWOA 1TK8A 2GV9A 1VSMA 3ATUA 3EEQA 5BPLA 1RDAA 1VHXA 1P8ZA 2VWBA 1JCEA 3NGYA 4CZGA 2O8BA 4DQRA 3OW2M 1LAWA 3VEZA 4DU1A 1J9AA 4IEIA 3ZLJA 3P31A 5AQUA 2VGNA 2QKKA 1OH6A 2W6LA 4AHTA 2UXCK 4O44A 3CJ9A 4IFYA 1NGEA 1VSLA 3SMPA 3AVMA 3QICA 4CECA 4CD3A 4H4MA 4B3OA 2RE2A 4HWIA 2CH6A 1RBUA 2A42A 5JVHL 4C8OA 1U2VA 3DXMA 3DLEA 4IO8A 2YI1A 3LP0A 1BCOA 2JGUA 4DR3K 5GAGP 1WAFA 4KV8A 3CHWA 4DV5K 3CCQN 4FJ7A 4DFJA 4HVJA 1YITN 5AQQA 4DQQA 4DV2K 4AQYK 2YHAA 3QEXA 2XHBA 3W0LA 4NXNK 5JVGL 1N8RO 5MLCQ 4FJKA 2OPSA 3ID8A 1BUPA 4Z4CA 1C0UA 2QXLA 4ICLA 3UKUB 4AH9A 2ZJQL 1NMNA 2D0CA 1J5OA 2YKMA 4CJTA 3AVCA 3LM9A 2Q31A 1TAUA 3C7NA 3ZT4A 1YUWA 4KFBA 4AHRA 4OGCA 3QB0A 3CC7N 3DAWA 4IBNA 3MCPA 3WXMB 2GWJA 3PV8A 3MWTA 3BP8A 2ZQBA 1KTQA 1XI1A 4KPYA 4FOEA 3PSIA 3J7YP 2BDPA 4FK0A 4I9LA 1ZBLA 4KI6A 2EHGA 5JS2A 3CCUN 4R79A 3THYA 4M3XA 1HX1A 3E9LA 4IZ9A 3THXA 3D2EB 4EP5A 5FLXO 4MDBA 4KH6A 1WB9A 4KHNA 3PUFA 3L2VA 4CEDA 1Q9XA 3PSFA 4JI7K 4KHYA 2GX9A 4K0KK 3MN6A 3ULEA 3SI6A 1K8KB 3A5OC 3EN9A 1BO5O 2QWMA 3GL1A 1FJGK 3U9DA 1KLNA 2DFFA 1VQ7N 4F8RA 2P9UB 2V51B 3A5MC 3FFIA 3L2QA 5AQIA 2YJFA 3A5LC 4WFNL 1XNQK 4A62A 4DR1K 2BE2A 2HBJA 2FF3B 4IWVA 5C10A 1D8YA 1L3SA 1RTIA 3HXMA 2HF3A 1U04A 4IOXA 2IOCA 4NLBA 1ESVA 2O8EB 1WN7A 4ELVA 5K14A 2X6NA 3KVGA 3LZIA 4FVMA 2D5RA 1GLLO 3HL8A 3O9RA 4H0YB 4GKKK 3SCXA 3ZSZA 1BU6O 2Q1NA 3LP1A 1KFSA 2PY5A 3OS2A 4CF2A 2Y1JA 1GLAG 4LF5K 1BOTO 3NHGA 4JI1K 1S1XA 4E1NA 1T7PA 1EP4A 3NH0A 1RT6A 4FYDA 3HT3A 4JHDB 2E1YA 4Z0UA 3LDSA 4B1UB 3SUNA 4C8MA 3NAEA 4GV3A 3GDQA 1C1AA 1TL1A 1WNSA 3F9KA 2VGMA 3LPUA 1QSSA 3AVFA 3KK1A 2QWRA 4YDUC 4QS9A 3NH2A 2IVOA 3HSTB 4CZEA 2H3GX 2NRHA 3LAMA 3KHYA 4BACA 1X3MA 4B3MK 4CZFA 1NU0A 3VQ7A 1LCUA 1T03A 3IFRA 3MEEA 1QTMA 1GLBG 3L3UA 4IXCA 2P5OA 4DR2K 4BGAA 3GOIA 4AM6A 3JXUA 1HNWK 3LDPA 4A2BA 1U47A 1ATRA 1Q18A 3JSMA 1NGGA 3HOTA 4B1VA 3FZFA 3S3MA 4M3RA 4CJFA 2QKBA 3QEWA 3WXKA 1K8AO 3OS0A 1C0TA 2F8SA 2V7ZA 3DLBA 3EO3A 5J2MA 2VCPA 4IOAL 3VGLA 3JS6A 3U9ZA 2E6MA 3SPZA 2NRZA 5HRNA 1UAXA 4KKOA 3FFKB 5EU7A 4I6MA 4JI6K 4JLHA 1C0MA 4OPJA 2ASMA 4JKBA 5AQVA 1LWFA 4DF4A 3P1GA 3KWIA 4E0DA 2Q0RA 4M3YA 3VETA 1K73O 1L3TA 2NUBA 1ILYA 3ZX2A 1DGKN 4DQ8A 2FC0A 1SZ2A 5EVZA 3CCMN 4DU4A 4CVNE 3HTVA 1WSGA 2WONA 4CF1A 2JWKA 4CJSA 1RTDA 3LDQA 3SPYA 1VSJA 4ISGA 4KBOA 3LANA 4DKWA 4N41A 1NGBA 5GINA 4FJGA 4JKDA 4IJAA 3CETA 1VRTA 3NFAA 3AVKA 3D7EO 1WSFA 1HRHA 3T7ZA 1F21A 2P9PB 2A5XA 4BR2A 3OYKA 3DRPA 5JMVA 3CMEN 2QXFA 1EWRA 2LSNA 4KHPK 3CJBA 5LJVA 4AHUA 3WNFA 4B3TK 3L4QA 3HP9A 3HSCA 1HKCA 1X9JA 3NF8A 3AO4A 4CZKA 3OJUA 3PO4A 2F7TA 3LP3A 3QNOA 1S9EA 3L2WA 4BRLA 3VQPA 1YXQA 4FVUA 4C8KA 3HVTA 4X66K 2CGJA 4OKJA 1VSKA 4E3SA 1ZBHA 1RT5A 1HYSA 3HO1A 5AQSA 3J81O 1IBMK 4ZHRA 3VA3A 3HOSA 2FLOA 3O9SA 5CR4A 4EP4A 4CIEA 4BRPA 4B08A 2HNZA 4LSLA 4B8CA 1GLJO 4PL7A 3AA2A 1MU2A 3NE6A 3S3NA 1LAVA 3OBYA 1RFQA 3TWHA 3L3VA 4CFBA 3DXMB 1SL2A 2P9KB 3BEXA 3ZSWA 4YY3K 4W5TA 3NGIA 2W40A 1UWBA 4DLGA 3VQDA 3EZWA 3T3FA 3HM8A 4YHHK 1YTUA 3CG7A 3RMCA 4WQ4A 2NRVA 1L3VA 4Z4HA 3V9UA 3CXCM 4BRCA 1CLQA 3AARA 1HNZK 3NGZA 2A40A 4FWRA 3VGMA 3VEWA 3RRGA 3G25A 1QVGM 1XNRK 4CFCA 2WOMA 1E4FT 2O8DB 1NBWA 3B8AX 3D2FA 1G15A 1JL1A 2P51A 1HLUA 1BI4A 3WXLA 3TABA 1U45A 5AQYA 3THWB 4BWJA 2UXBK 1WSHA 2ATQA 1VSIA 1JLCA 4XH4A 3ZSXA 4DHYA 1HNXK 2DY4A 3ZEUB 1JJ2M 2HHSA 2FF6A 2WTUA 2IGIA 2Q97A 3ZX3A 4AF1A 4EFHA 3OVNA 4ID5A 4H5VA 3D45A 3E66A 4DSJA 3MMVA 3QEVA 4JI4K 1UOCA 2KHOA 3T1HK 4CJKA 3EKUA 2E2OA 1A5XA 3VQQA 3A2FA 3SV4A 2KFZA 4WQ5A 1JLAA 3ULEB 3RSEB 1U6ZA 5DK5A 4FCYA 4BC5A 3ZSQA 4I9QA 5A2QO 1C1BA 2Z1IA 4FWLA 4CZIA 4RG8A 3J8AA 1BA0A 1JXBA 3TI0A 2OA8A 3HPOA 4PY5A 5CZ2A 4FZYA 4UQGA 4Q5VA 4BRHA 3MX5A 1CZ9A 3K5LA 1NJZA 4A5BA 5CZ1A 4BY9C 3E9OA 4XIUA 4M3WA 4FW2A 1NGAA 3LWLA 3P5JA 2HMPA 3WXIA 2O8FB 2E1ZA 2G8VA 3M8SA 4JKEA 5AQPA 4CGIA 3AO1A 1NJWA 4NCGA 3B6PA 3KIOA 2F4VK 5FPNA 3TAFA 5GIOA 4IDKA 3UB5A 4DTMA 2I7NA 4FJIA 1W0HA 4CF0A 5AZJB 2GUPA 4AHVA 4HUGA 3QINA 2HNYA 2D0AA 2HHHK 3OY9A 2Z1GA 1IH7A 3ZETB 3ZT1A 4PWDA 1NKCA 3VQ5A 4HHTA 1IKVA 4OPHA 3WQUA 4C23A 4H0OA 3IUCA 1WSIA 2D1KA 3KK3A 4DTSA 4JNEA 1RDDA 3FZKA 5FRMA 2A1RA 2G8KA 2RKIA 3DLGA 2HBLA 1C0GA 1YVUA 3CJAA 4BDYA 3MCAB 4JRQA 1NJXA 3J80O 3JYTA 3RMDA 1FK9A 4R5PA 4DV1K 4M3TA 4JEPA 3ENHA 4WFAL 1B92A 1Q81O 4J2EA 3AA5X 2D0BA 3CCVN 1YAGA 3TPQA 1VSDA 3O4WA 3CF5L 3H08A 3CCRN 5I9EB 2F9TA 4O5FA 3NBPA 1CZAN 1HPMA 2YHYA 3FZMA 1KFDA 3LAKA 3I55N 2VWKA 5BRHA 4FJJA 1OVQA 2R7YA 1QQNA 1N34K 4CZLA 3CM5A 1IKXA 2GEMA 3F73A 4MO5A 2F96A 4BREA 4BR0A 3QNNA 4J2DA 4FZZA 3TTDA 3VTIA 2UUBK 4FPAA 5AQMA 2YNIA 4CESA 3V81A 2D4WA 1YF5L 1MDUB 1RNHA 3CYMA 4WQ4C 5BN9A 2OPQA 3H3OB 3V6DA 1TV6A 4GMJB 4LY7A 3JAMO 2HHTA 4HTLA 2QWQA 3IG1A 4H5NA 2BANA 3R3LA 1VQKN 4OX9K 3FZLA 1NK7A 1BQNA 4KHQA 4B1WB 4ID1A 1JCFA 3VQ4A 3C6UA 4X64K 1N32K 4CW7B 1DT9A 2KLAA 4IKFA 2J4RA 4FJ8A 1DEJA 4H8KA 4BG9A 4BG8A 4HUEA 2HNDA 4CI6A 1ASWA 5C25A 3CCEN 4M41A 1WBBA 3U8XA 3LM2A 3OTOK 1NOYA 3OYGA 4KB1A 4PHTX 1VQ6N 5F1XA 3UIQA 2UXDK 1IBLK 3A0IX 3LWMA 4DFKA 1S6QA 4LFAK 4GV9A 4Z4FA 1ATNA 4LF8K 3O80A 4ELUA 3R6MA 2UU9K 1A5WA 5KPRA 4IG0A 4JK9A 4WQ5C 2JLEA 2HVHA 1HPZA 3O9UA 3M8QA 4B9TA 1TL3A 4MO4A 4FW1A 1G99A 4Y1CA 4A5AA 3U6FA 1QQOA 1HYVA 1VSFA 4C8LA 1EETA 4CHQA 1RILA 4JKFA 1VQON 4KREA 3O1BA 4FJNA 3O8MA 3HK2A 4Z4EA 4N47A 2G8WA 1RBVA 1TK0A 4JD2A 3CIPA 2NRRA 3MN9A 4FWKA 4O0JA 2NRTA 4JI8K 4K43A 4FPBA 5C42A 3LZJA 2E20A 1YTAA 1U48A 2G8HA 4EZ6A 2VQFK 5BR9A 1BI4B 3QMLA 4LF6K 4Z94A 3AVNA 4B3SK 3FZHA 2E88A 1VSHA 4CD1A 3J7AP 5JS1A 1X1PA 1EKEA 3L6QA 1KAYA 3CJ1A 5AQWA 5I42A 3BUZB 3TTFA 3M3ZA 4FM2A 1OH7A 4CEZA 1SQKA 3C6TA 4E19A 3I8DA 3OYFA 1T6DA 4EHTA 3Q7CA 5KGWA 4RWTA 4CIGA 4W5QA 4FSVA 3ZSVA 4KH4A 4H0XB 4OKEA 3ZSYA 3SUQA 3AO3A 3EE9A 3VMFB 3AO2A 1N5YA 1IG8A 1XC3A 1RBRA 3IKMA 5CYQA 1W7AA 5B8HA 4DS4A 3O08A 4CGGA 2KZZA 3SJJA 3PIOL 4CHNA 1YVNA 3UE5A 4H03B 3KKRA 4M7YA 3H46O 1WAJA 5J2QA 3MEGA 3R8EA 5LL6Z 4A61A 3M8PA 1NK6A 3WNEA 3AVLA 4CEOA 4FJXA 3V9ZA 1S22A 1KD1O 4NCBA 1QZ5A 4BR7A 3PLAA 3VQ9A 4DV6K 1X9MA 2QM1A 4PKGA 1JCGA 5J2PA 2E2QA 3D0PA 4MDAA 3WEEA 3Q7BA 4XEIA 2O4IA 1KLMA 4DSKA 4FLTA 4BR4A 1KVCA 5C2DA 1VAZA 1RBTA 2KFNA 4DUYK 3CPWM 5FROA 2HHVA 1Z05A 4JKHA 2HBKA 3H45C 3QETA 1I39A 5GAEP 5AZIA 4H0PA 4EAHD 1RT7A 3MX2A 1GLDG 1QQMA 4M7XA 1ASUA 1S1VA 3O1WA 2RHKA 5BPMA 1YHQN 4LC9B 4BVPA 2YNFA 3CC4N 1H1VA 3THVA 1Y97A 4M3ZA 3KZBA 4FLVA 1SKSA 4CHYA 1TYQA 2D0PA 2OPPA 3N4PA 3QESA 1DKGD 4Y0WA 3DLRA 4CF9A 1YJNN 1N6QA 1IG9A 5LMNK 5EXWA 1IKYA 1HMVA 4CGDA 4X62K 3CFRA 2W6KA 3IRXA 3SAHA 1XMQK 3V4IA 5HBMA 2ZF5O 2O8CA 3SNNA 3AAQA 2P9SA 3V9SA 4AM7A 3OYMA 2IC3A 1YT3A 5AQKA 2ITMA 4JI0K 4G9ZA 3MEDA 1D9DA 3G0ZA 4FLYA 1NKBA 1BA1A 3K59A 4AILC 5C0YA 2OTJN 4KI4A 3AA3A 3NCIA 1WLJA 2P9NB 5HROA 1NG9A 3K5MA 2OANA 4AHSA 1Q86O 4CZJA 3RWUA 3G6EN 3CFOA 3S41A 4ELTA 3UKRA 4FLWA 3DYAA 3CCJN 5GIPA 3MN5A 3WNGA 2EWSA 1XUPO 3MXIA 3S9HA 1ZBFA 3VQ8A 1CZBA 1RCHA 2OZSA 3MXMA 3L8BA 4FWNA 4L3QA 3K9KA 5C12A 3VA0A 1B9FA 4OLBA 3AGKA 3RR7A 1BG3A 1REVA 3TAEA 4DV3K 3A8YA 3CPEA 1FKPA 2X6SA 1WBDA 4F2RA 5FDLA 1C0FA 2Q36A 3FLCO 4DTJA 3MN7A 3LDOA 3CD6N 3VGKA 2YX6A 3DM2A 4H0VB 4B9MA 1LW0A 3M6GA 2VYPA 4PKHA 2GBZA 2RN2A 1NNEA 1BQMA 1VQ9N 3CM6A 2UUCK 1NMDA 2W41A 1VQ5N 2P9LA 2OYQA 4PQUA 1QHAA 4GV6A 2NLXA 1M90O 3DOLA 1BDGA 1YJ9N 2O8BB 3VQCA 4BC2A 1K9MO 3PX0A 2WBNA 4KHSA 3OYDA 3NF9A 1FW6A 1YIJN 1EQYA 3VPZA 3BF3A 3F2KA 3ULDA 3IS9A 3O4NA 1RT4A 3I56N 1BIZA 2E5LK 4K8ZA 1N36K 2YKNA 4JN4A 3ID6A 5SZTA 3V1RA 1U2VB 4NYFA 3AY9A 3QO9A 3KK2A 3DRSA 5JLFA 1LWCA 1NGFA 5LY3A 1NGCA 3HRGA 4BRMA 5KPZA 5M1OA 5FPEA 1ZYQA 4BE0A 3QIPA 4YOUA 4O55A 4QS7A 4OJRA 2ZGZA 4CFAA 1W9HA 2ZE2A 1GLFO 1SAZA 1NWKA 3CERA 2BH1A 3OYCA 1FXXA 4JD2B 4LD0A 4YORA 4CFDA 3HPHA 5ADXA 5HP1A 3SYZA 1Q8IA 4K25A 4DQSA 5LJWA 1NLVA 1HNVA 4RW9A 3I33A 5EX5A 3C7NB 2NZTA 4ILJA 1T44A 4MLHA 5KRTA 3TTCA 3M5RA 4BRNA 3K5NA 2ZJRL 2ZGYA 4CZMA 1MWKA 4M63C 3HPGA 3DLKA 3OBWA 3K58A 3RVCA 4Z4IA 3SQ2A 2NNWA 3AVAA 2PYJA 4CJ5A 4WYBA 3WNHA 3THYB 4CGJA 4LFCK 1J5EK 3THXB 3L4IA 4RW6A 2WUSA 2FSNA 1SKRA 4LFBK 4DSLA 4CEFA 4DTPA 4FWQA 3SQ1A 2OCEA 3VQEA 3NF6A 4H5WA 1C1CA 1U49A 4JRPA 3MK6A 1TKZA 1O1WA 1Z6RA 4Q0BA 5C15A 2P1JA 2HHXA 4CHOA 3D2EA 3CJ7A 3NF7A 2IS3A 4KB0A 4IO9L 1KVBA 1KXPA 2DFHA 3WQTA 4EHUA 3VEXA 1R0AA 3PX6A 1K8KA 4JKAA 5AQLA 3TAGA 1X3NA 4J8FA 3DLLL 3HVRA 3OJSA 2QWPA 4CJVA 3AVIA 4DTUA 2P9UA 1Y64A 4FJMA 1VQPN 3C0BA 4B9SA 4BRAA 1TKTA 3AO5A 4PA1A 3OYIA 4DFPA 2CGLA 3AGRA 3DWLA 1OKJA 2B4JA 4NB4A 3SV3A 4CK2A 5I3UA 3DMJA 5AQOA 2O8EA 5ADXH 5AFUA 4JAXA 1R59O 5AZIB 3FE1A 1X9SA 3VEOA 3U4LA 4CJRA 4RW7A 3ZT0A 3C6HA 1D4XA 3NVMA 2BGGA 2V7YA 4CHZA 4CEEA 1MWMA 3QEPA 3DLHA 1TGOA 4KO0A 3DI6A 1BWFO 3KWGA 3VQAA 3QFPA 4CEBA 1J54A 3TSQA 4JI5K 3AVJA 5CHIA 3VQ6A 2VG7A 3K2PA 2UUAK 4A2AA 1I94K 1DTTA 1V4TA 2G8FA 2FBTA 3NMUA 4BR5A 4GNIA 3KLEA 4DLEA 2I5JA 1VQ8N 4BDPA 3BY5A 1IO2A 4LH4A 1IBKK 2HVIA 5FRNA 1BIUA 1Z26A 3DXKA 2GELA 2P9SB 2B6AA 4OKKA 2YV0X 3QEIA 3EKSA 4O5BA 2W42A 4FM0A 4J2BA 1D5AA 2V52B 4DV0K 2D0OA 2GUIA 1J6ZA 2QW9A 4MQ3A 5M1KA 3ALYA 5IT9O 4I6MB 5SWMA 4F3OA 1ZXOA 3ATVA 1NGDA 2QWNA 4GVMA 4YOTA 1Z25A 1LWEA 2WC9A 4DQIA 2QTDA 3ENOA 4Y1DA 2CH5A 1J53A 3TU5A 3KLHA 4C1NK 1VQMN 1HNIA 4QAGA 1TUYA 2PZSA 3VERA 2VG5A 1IV0A 4K41A 4OPAA 4O0IA 4F4KA 1JXEA 4TSXA 4FM1A 4FZXC 2O4GA 3MDQA 3O9QA 2F8TA 3OHRA 4YOWA 3V1QA 3CFPA 3E9PA 3T1AA 3C6AA 5AQXA 1YJWN 3P4IA 1XC9A 2ASPA 2JWLA 3OYLA 3TAPA 3NH1A 1RT3A 3CMAN 3VF4A 5KI6A 1T8EA 5E41A 4KTQA 3KJVA 3E1YA 5AFUH 5F0XA 1KRPA 4PUOA 4OLAA 2ZM6K 4A59A 1NGJA 1T6CA 4IJNA 4B1ZA 4KHUA 3L2UA 2GWKA 2VWJA 3DRRA 3KD5E 5CE3A 1NM1A 3B6OA 1BISA 1L3UA 4E1MA 2OZMA 4QCLA 2I7PA 4N56A 2Q3SA 4BWMA 4E89A 1EXQA 4JI3K 3G4SN 5HLFA 3LP2A 2QWOA 5BN8A 5FPMA 4N76A 4YOXA 2KKZA 5FPDA 4FLXA 1HUXA 1QSLA 3AA4A 3FR0A 5JICA 3TAQA 3K5OA 4N5SA 4RW4A 3CCSN 2A1SA 3AVHA 3CQ8A 2ETJA 3ISNC 4FWMA 1WSEA 5HL7L 2PBDA 2HW3A 2P5GA 2GTDA 4EIAA 4IDHA 4NCAA 4DV7K 4BGBA 4YFUA 2E2PA 1WSJA 5AQRA 4BROA 4F9OA 4DMNA 1TKDA 3RR8A 4CJ4A 3KKSA 3BZCA 2YNHA 4CJLA 1S1UA 3SBGA 4BE1A 1NK9A 4DV4K 1GOCA 5F2RA 1S5JA 2P9KA 4CJWA 4FJLA 2G8UA 3TAMA 4JKCA 2AJQA 3TR8A 1S3XA 4CEAA 4E7KA 1T3VA 1HJOA 1HQUA 1CXQA 2ITGA 2YHWA 4JV5K 3U3GA 5HRSA 3P83D 3D2FB 5J2NA 5AQHA 2EX3A 5CYMA 3OYJA 4DR5K 5GADP 2XRIA 1JLQA 5KTQA 2DFEA 2HB5A 2YNGA 4KTWA 5IWAK 1SL1A 4DSEA 3G71N 1VRUA 2NRWA 4FJ5A 4FK2A 2O8DA 3C65A 4L8RB 1S72N 2ASOA 4HTUA 3NVKA 3D6RA 4CJEA 4OO1J 1TK5A 4WF9L 3THWA 4DB3A 1JLEA 1SL0A 2DTUA 3G10A 2FXUA 5EOYA 4KH5A 4B9QA 1NK5A 3R1XA 4AHCA 1TVRA 3T69A 1ZBUA 3EE8A 3ZEUA 1FKOA 1W97L 4FXDA 4DR6K 5AQJA 5M1QA 2ZD1A 3KLIA 3GE1A 4C8NA 1NGHA 2X74A 4FL9A 1HKBA 3CQYA 4CE9A 5H1SQ 1VQNN 4F3TA 5EY4A 4H0TB 2X78A 3MWPA 4NXMK 3V9XA 4LF9K 4KAZA 3AVGA 4JK8A 2Q0UA 4BRKA 3BDPA 4JKGA 4JI2K 4E1JA 1UA1A 1XWLA 1QVFM 3RSEA 1E3MA 4DQPA 4DTNA 3SLCA 3QBXA 5KPTA 3S3OA 4KTZA 2XY6A 3LALA 1DTQA 4FOIA 4OPKA 1KC8O 2VQEK 2Z1HA 4ILGB 4CBXA 3ZYYX 4B1XB 5CY4A 1XHZA 3KD1E 3HBTA 5AQFA 3DOKA 1QE1A 3KK7A 2XO7A 3EY1A 1B9DA 1SV5A 3HZ6A 4H4OA 3TSPA 3SQ4A 4DR4K 4CGHA 1U4BA 2O8FA 2P9IA 1XQSC 1LV5A 2UYTA 1RT1A 4GKJK 4CJ3A 4A57A 1OH5A 1NOZA 4UY8O 3ENBA 5DM6L 3ZT3A 3O4QA 2YCHA 1S1TA 4JK7A 1E4GT 1I3AA 3VF6A 3QERA 1RDUA 4BQZA 5AZJA 3SUOA 3P38A 4ILHA 5BRFA 4B8AB 3L0QA 3ZETA 3EZ5A 2XY7A 3ZX0A 4DTOA 1VQ4N 4LF7K 4M42A 4K42A 1S9GA 1KAXA 1QZ6A 2HHQA 3DXKB 2RF2A 1X9WA 1JLFA 3K57A 3AVBA 4H5TA 4B9NA 5KGXA 1LW2A 2HBMA 4DCHA 5D3GA 3AV9A 1NKEA 4XH1A 3H1VX 1NJIO 5KRSA 1S6PA 4DF8A 4ZTJA 2PFUA 3KLFA 3HI0A 4CBWA 3SK3A 3R9PA 1OVYA 4O4GA 1N33K 4GW6A 4IG3A 4BRQA 5BR8K 3I8BA 1BHLA 3VN5A 1WUAA 2RPIA 4HUFA 2F9WA 2Y1IA 3K9JA 3OYHA 4C1NI 3ZSRA 4E7LA 3O3GA 1RTJA 4BC3A 4LH5A 1EO1A 5BRDA 3RMBA 3I0SA 1QS4A 4I7FA 1M1KO 4OVLA 4CZHA 3I0RA 4ISFA 3C95A 4B9LA 2B5JA 3TSUA 3HM9A 1WOQA 5LMUK 4FLUA 4NLCA 2BTFA 4BRIA 4O8KA 4O8UA 5AQZA 4QOZB 4BR9A 3GBTA 1HYZA 4KHWA 3QFUA 4B1YB 4GVEA 1HJRA 1RBSA 1D9FA 3SAGA 4BC4A 3O5BA 4FO0A 4B9VA 3KTQA 3OYBA 3CCLN 4E7HA 3LDNA 1GOBA 4CEQA 3MXJA 4CJQA 3HJFA 2ZWHA 3VF2A 1ATSA 3SAFA 2IVPA 2KQ2A 4V19S 3LL3A 3VQBA 4W5RA 2QWLA 1NK8A 5AR0A 1NK4A 1P90A 3IDHA 5HOOA 2YHXA 4J2AA 4HCCA 2FSKA 1VK0A 4WFBL 4YOVA 1IJJA 1LOTB 2A41A 2E2NA 3P39A 3MECA 4WCEL 3VTHA 3H6EA 1JLBA 1QQCA 2CGKA 2HHUA 1NK0A 1HR0K 2PAVA 1KAZA 1TUUA 3O6WA 5AJ3K 5DMRA 4B3RK 3VEYA 3ZSOA 4G1QA 3AAPA 2BUPA 3F9MA 1NGIA 5E84A 2HOEA 5KQDA 4CBUA 3H3NO 4I2PA 3PO5A 5GAHP 4BDZA 3H1QA 4RW8A 4FK4A 4FWPA 4LSNA 4CK3A 3RMAA 1ITGA 3BZKA 5HRPA 4FWSA 1RGIA 2HMIA 3LPTA 3DJCA 2NRXA 4BQLA 3EYZA 4DWIA 2XY8A 3QBWA 1ZBIA 3V9WA 3T1YK 4M3UA 1Q7YO 1KCFA 3UKUA 3W3DA 1QSYA 5BPNA 4DUZK 4ISEA 1IKWA 3VESA 4BRFA 4CGFA 2YJEA 4JS4A 4BE2A 1JKHA 3V1OA 2IVNA 1RT2A 4JS5A 2Q2RA 4BRGA 4W5OA 1XHXA 3QLHA 2A6AA 1CXUA 4KRFA 4I2QA 3QDKA 1SKWA 1RDCA 1VSEA 1RDBA 2E6LA 3SUPA 4DS5A 3OA9A 3CQXA 3U3YA 1BCMA 3O3FA 4DSIA 3MAQA 4FJ9A 3SBTA 3CI5A 4Z4GA 1HKGA 2HSTA 2FBXA 4F2SA 2A3ZA 4IOCL 2E4LA 4FJHA 3O3HA 3F5TA 2G8IA 2QK9A
chains in the Genus database with same CATH topology
5KI6A 1T8EA 4FJGA 2IAJA 5E41A 4KTQA 1JLGA 4CHNA 3KJVA 3E01A 2KW4A 1VRTA 3KKRA 5J2QA 1WAJA 3NFAA 1KRPA 3AVKA 3MEGA 4PUOA 4OLAA 4EZ9A 3ITHA 1WSFA 1HRHA 3OYEA 3M8PA 4WE1A 4HCBA 1F21A 3OYNA 1C6VA 4E7IA 1NK6A 4KHUA 4ZTFA 3L2UA 3WNEA 3OYKA 3AVLA 3DRPA 4CEOA 4FJXA 3V9ZA 2VWJA 1QHTA 4NCBA 2QXFA 3DRRA 3KD5E 2LSNA 3B6OA 1L3UA 1BISA 3PX4A 4CCHA 4AHUA 3WNFA 4E1MA 2OZMA 3VQ9A 4QCLA 4NYNA 3HP9A 4DU3A 4N56A 1X9MA 2Q3SA 5J2PA 4BWMA 4E89A 3NF8A 1EXQA 3AO4A 3OYAA 3D0PA 1TAQA 4CIFA 3OJUA 3PO4A 4M45A 5HLFA 3LP3A 3LP2A 2O4IA 4N76A 3QNOA 1S9EA 4K8XA 1KLMA 3L2WA 4DSKA 4FLXA 4FLTA 3VQPA 1KVCA 1QSLA 3AA4A 1T05A 3KLGA 1RBTA 1BGXT 2IDOA 4C8KA 3HVTA 2KFNA 4MFBA 5FROA 3K5OA 4OKJA 4DG1A 4N5SA 1VSKA 4E3SA 3ZCMA 3TAQA 1ZBHA 2HHVA 4RW4A 1K6YA 1RT5A 2VG6A 3SQ0A 3QETA 1HYSA 1I39A 3HO1A 1UA0A 2A1SA 3AVHA 3CQ8A 3C94A 2ETJA 4ZHRA 3VA3A 4CHPA 3ISNC 1WSEA 2G8IA 1RT7A 4EP4A 4CIEA 4B08A 2HNZA 4DTXA 4LSLA 4B8CA 3NDKA 2HW3A 2P5GA 3AA2A 1MU2A 1ASUA 3NE6A 3S3NA 1S1VA 1LAVA 4NCAA 1L5UA 3M8RA 3TWHA 2YNFA 1ASVA 2KTQA 3L3VA 4CFBA 4YFUA 3THVA 1WSJA 1Y97A 1SL2A 4DMNA 1TKDA 3RR8A 4M3ZA 4CJ4A 3KKSA 4FLVA 3TARA 1SKSA 4CHYA 2YNHA 4CJLA 1S1UA 3ZSWA 2OPPA 3OS1A 3QESA 4W5TA 3NGIA 1RTHA 1UWBA 3HP6A 4DLGA 3DLRA 4CK1A 4CF9A 4BE1A 1GOCA 1NK9A 1S5JA 4CJPA 3VQDA 4CJWA 2XY5A 3RTVA 3T3FA 3L2RA 1TKXA 4FJLA 1HMVA 1IKYA 4CGDA 3CFRA 2G8UA 3TAMA 2AJQA 3IRXA 3V4IA 1YTUA 3TR8A 3CG7A 5HBMA 3BGRA 4CEAA 4E7KA 3RMCA 1A5VA 1HQUA 3SNNA 1CXQA 2ITGA 1L3VA 4B9UA 4Z4HA 3SZ2A 3V9UA 3U3GA 1KVAA 3V9SA 2KZMA 1CLQA 1HQEA 5HRSA 2IC3A 3OYMA 3P83D 1YT3A 3NGZA 3IAYA 5J2NA 3TANA 3PY8A 3MEDA 3RRGA 2EX3A 4IFVA 4DFMA 1D9DA 3G0ZA 5J1EA 4FLYA 5CYMA 4CFCA 4E7JA 2WOMA 3OYJA 3K59A 1NKBA 4FLZA 2XRIA 4AILC 4KI4A 3ASMA 1JLQA 3AA3A 1G15A 3NCIA 1WLJA 5KTQA 5HROA 1JL1A 2DFEA 2HB5A 1DLOA 2YNGA 2P51A 1BI4A 4KTWA 4AHSA 3K5MA 4DSEA 3TABA 1SL1A 1U45A 1KSPA 3RWUA 1VRUA 2PYLA 2YHBA 3CFOA 4BWJA 1WSHA 4FJ5A 4FK2A 4ELTA 2ATQA 1NJYA 4L8RB 1VSIA 4DSFA 1JLCA 1S1WA 4FLWA 3DYAA 1GOAA 4YNQA 3ZSXA 4HTUA 3T19A 1Q9YA 4CJEA 3WNGA 2DY4A 3ZT2A 2HHSA 1TK5A 3MXIA 1JLEA 3S9HA 1ZBFA 3VQ8A 1SL0A 2DTUA 2IGIA 3G10A 1CZBA 1RCHA 2OZSA 3QIOA 1NK5A 3MXMA 3L8BA 3OVNA 4ID5A 4AHCA 2FBYA 3D45A 4W5NA 1TVRA 5T7BA 1ZBUA 1B9FA 3VA0A 5HRRA 1FKOA 4DSJA 4OLBA 4FXDA 3RR7A 3RRHA 3QEVA 1REVA 3TAEA 2ZD1A 1UOCA 2Z1JA 1N6QA 4DTRA 2HHWA 3KLIA 1FKPA 4CJKA 2X6SA 4F2RA 4C8NA 2X74A 1A5XA 5FDLA 3VQQA 4DTJA 3A2FA 4CE9A 4CERA 3DM2A 3SV4A 2FBVA 4B9MA 1LW0A 1JL2A 1SUQA 4F3TA 2KFZA 1JLAA 4CJUA 2X78A 3V9XA 4KAZA 3AVGA 2GBZA 2RN2A 3HYFA 1BQMA 5DK5A 3CM6A 4FCYA 3BDPA 3ZSQA 1BL3A 2OPRA 4I9QA 1UA1A 4OGEA 1C1BA 2Z1IA 1XWLA 4RG8A 2OYQA 4DQPA 1JXBA 3TI0A 4PQUA 4CF8A 2OA8A 3HPOA 4DTNA 5C24A 4PY5A 5CZ2A 3DOLA 1EX4A 4UQGA 4Q5VA 4FZYA 3K5LA 1CZ9A 2GV9A 4KTZA 3VQCA 3S3OA 1NJZA 2XY6A 1TK8A 1VSMA 3LALA 5CZ1A 3PX0A 1DTQA 4OPKA 4KHSA 3OYDA 3NF9A 1RDAA 2Z1HA 4XIUA 3NGYA 4M3WA 4DQRA 5CY4A 1XHZA 3KD1E 1LAWA 4DU1A 3ULDA 3DOKA 1QE1A 4FW2A 3LWLA 3P5JA 3IS9A 1J9AA 3O4NA 2XO7A 1RT4A 3EY1A 1B9DA 2QKKA 1SV5A 2G8VA 3M8SA 1BIZA 4K8ZA 4H4OA 4AHTA 2YKNA 3SQ4A 4CGIA 4CGHA 3AO1A 1U4BA 1NJWA 4NCGA 3B6PA 4O44A 3KIOA 4IFYA 1LV5A 5SZTA 3TAFA 1VSLA 4IDKA 3V1RA 1RT1A 4NYFA 4CJ3A 3AVMA 4DTMA 3QO9A 4CECA 1W0HA 4CF0A 3DRSA 4H4MA 1LWCA 3KK2A 4FJIA 1NOZA 4AHVA 4HUGA 3QINA 4B3OA 2HNYA 2D0AA 3O4QA 3ZT3A 1RBUA 3OY9A 2Z1GA 1ZYQA 4C8OA 1S1TA 1IH7A 3ZT1A 4BE0A 4PWDA 3QIPA 1NKCA 1I3AA 4O55A 3QERA 3DLEA 3VQ5A 3LP0A 1BCOA 2JGUA 1IKVA 4OJRA 4HHTA 3SUOA 4CFAA 1WAFA 1W9HA 4KV8A 2ZE2A 4B8AB 4FJ7A 1WSIA 4DFJA 4HVJA 3EZ5A 3KK3A 2XY7A 4DTSA 4DQQA 1RDDA 4DTOA 3OYCA 1FXXA 5FRMA 2YHAA 4LD0A 4N41A 4M42A 1S9GA 4CFDA 3HPHA 2A1RA 2G8KA 5HP1A 2RKIA 3QEXA 2HHQA 3SYZA 2XHBA 1Q8IA 2RF2A 3DLGA 1X9WA 1JLFA 3K57A 1YVUA 3AVBA 4BDYA 4DQSA 1NJXA 4JRQA 4B9NA 5KGXA 4FJKA 3JYTA 3RMDA 1LW2A 2OPSA 1HNVA 1FK9A 4R5PA 4RW9A 4M3TA 5D3GA 4Z4CA 1C0UA 1B92A 3AV9A 1NKEA 4ICLA 4AH9A 4J2EA 1J5OA 2D0CA 3AA5X 5KRTA 2YKMA 2D0BA 5KRSA 4CJTA 1S6PA 3AVCA 4DF8A 3K5NA 1TAUA 4ZTJA 1VSDA 3ZT4A 3KLFA 3H08A 4KFBA 4O4GA 4AHRA 3NBPA 4GW6A 4IG3A 4OGCA 3HPGA 1KFDA 3LAKA 3DLKA 4IBNA 3K58A 2VWKA 3VN5A 1BHLA 2RPIA 4HUFA 4FJJA 4Z4IA 3PV8A 2Y1IA 2R7YA 3SQ2A 3OYHA 3AVAA 2ZQBA 2PYJA 1KTQA 3CM5A 3ZSRA 4CJ5A 4E7LA 1XI1A 1IKXA 4KPYA 2BDPA 4FK0A 3WNHA 4I9LA 4CGJA 1RTJA 3O3GA 2F96A 3F73A 1ZBLA 2EHGA 4KI6A 4LH5A 3QNNA 5JS2A 4J2DA 4RW6A 4FZZA 1SKRA 3RMBA 3I0SA 4DSLA 1QS4A 4CEFA 2YNIA 4CESA 4I7FA 4DTPA 3V81A 3SQ1A 4OVLA 3I0RA 3C95A 3VQEA 4M3XA 3NF6A 4B9LA 2B5JA 1C1CA 1RNHA 3CYMA 4EP5A 4JRPA 1U49A 3HM9A 2OPQA 1TKZA 3V6DA 4KHNA 4FLUA 1O1WA 1TV6A 3PUFA 4GMJB 4LY7A 3L2VA 4Q0BA 2HHTA 4CEDA 1Q9XA 4QOZB 4KHYA 3IG1A 1HYZA 2P1JA 3SI6A 4CHOA 4KHWA 2BANA 2HHXA 3NF7A 1HJRA 1RBSA 2IS3A 1D9FA 1NK7A 1BQNA 2DFFA 1KLNA 4KB0A 4F8RA 1KVBA 2DFHA 4B9VA 4KHQA 4ID1A 3OYBA 3FFIA 4E7HA 3L2QA 1R0AA 3PX6A 3KTQA 1GOBA 3VQ4A 3TAGA 3C6UA 4CEQA 3MXJA 4CJQA 3HJFA 3HVRA 3OJSA 4CJVA 4IKFA 4FJ8A 3AVIA 2BE2A 4DTUA 4H8KA 4FJMA 4HUEA 1D8YA 4B9SA 1L3SA 2HNDA 1RTIA 3HXMA 1ASWA 1TKTA 1U04A 2KQ2A 3AO5A 4PA1A 5C25A 2IOCA 4M41A 3OYIA 1WN7A 4ELVA 4DFPA 5K14A 3VQBA 4W5RA 2X6NA 1NK8A 3LZIA 4FVMA 2D5RA 2B4JA 3HL8A 1NOYA 3OYGA 1NK4A 4J2AA 4KB1A 3SV3A 4CK2A 3SCXA 5I3UA 4HCCA 3ZSZA 3DMJA 1VK0A 3LP1A 1KFSA 2PY5A 3UIQA 3OS2A 4CF2A 2Y1JA 1X9SA 3NHGA 3LWMA 4DFKA 1S6QA 3MECA 1S1XA 4E1NA 4CJRA 4RW7A 1T7PA 1EP4A 3NH0A 1RT6A 3ZT0A 4Z4FA 2BGGA 4FYDA 1JLBA 1QQCA 3HT3A 4Z0UA 3LDSA 4ELUA 2HHUA 1A5WA 4CEEA 4CHZA 3QEPA 4IG0A 1NK0A 3DLHA 3SUNA 1TGOA 4KO0A 2JLEA 5DMRA 4C8MA 3DI6A 3NAEA 2HVHA 1C1AA 3ZSOA 1HPZA 3VQAA 4G1QA 1TL1A 1WNSA 3M8QA 4B9TA 3F9KA 1TL3A 4CEBA 3LPUA 1QSSA 1J54A 3AVFA 3KK1A 4FW1A 4Y1CA 3AVJA 3NH2A 3U6FA 3VQ6A 3HSTB 1HYVA 2VG7A 3K2PA 1VSFA 1DTTA 3LAMA 4C8LA 1EETA 4BACA 4I2PA 2G8FA 3PO5A 2FBTA 4CHQA 1RILA 3KLEA 4DLEA 2I5JA 3VQ7A 4BDPA 1T03A 4BDZA 4KREA 4FJNA 1QTMA 1IO2A 3MEEA 4RW8A 3L3UA 3HK2A 4Z4EA 4LH4A 4N47A 2P5OA 2G8WA 4FK4A 2HVIA 1RBVA 5FRNA 4LSNA 1TK0A 4CK3A 1BIUA 3RMAA 1U47A 1ITGA 1Z26A 5HRPA 2HMIA 3LPTA 2B6AA 4OKKA 2YV0X 3QEIA 3JSMA 4O0JA 4O5BA 4M3RA 2W42A 3EYZA 4FM0A 4CJFA 3S3MA 2XY8A 4DWIA 1D5AA 5C42A 4J2BA 2QKBA 1ZBIA 3QEWA 3OS0A 1C0TA 3LZJA 2F8SA 1YTAA 3V9WA 4M3UA 2GUIA 3DLBA 1U48A 2G8HA 4EZ6A 4MQ3A 1KCFA 3ALYA 5J2MA 1QSYA 5SWMA 4F3OA 1IKWA 1BI4B 2E6MA 3SPZA 3AVNA 4GVMA 5JS1A 1VSHA 1UAXA 1Z25A 1LWEA 1X1PA 4CGFA 5HRNA 4DQIA 4KKOA 4JS4A 1EKEA 4Y1DA 4BE2A 5EU7A 1J53A 1JKHA 3V1OA 1RT2A 3KLHA 4JLHA 1C0MA 4JS5A 4OPJA 5I42A 1HNIA 1LWFA 4QAGA 4W5OA 1XHXA 2PZSA 4DF4A 3P1GA 3QLHA 4E0DA 1CXUA 4FM2A 2VG5A 4KRFA 4CEZA 1IG9A 4M3YA 4I2QA 1SKWA 2NUBA 4O0IA 1L3TA 1RDCA 4F4KA 1VSEA 3C6TA 2FC0A 4E19A 1RDBA 1JXEA 2E6LA 4TSXA 3I8DA 3SUPA 3OYFA 4FM1A 4DS5A 4FZXC 5KGWA 2O4GA 2F8TA 4DU4A 4CIGA 4W5QA 3V1QA 3ZSVA 1BCMA 3CFPA 4OKEA 3O3FA 3ZSYA 3U3YA 4DSIA 3SUQA 3AO3A 3T1AA 3MAQA 3AO2A 4FJ9A 1N5YA 1RBRA 1WSGA 2WONA 5CYQA 4CF1A 4CJSA 1XC9A 2FBXA 1RTDA 4DS4A 4F2SA 4Z4GA 3OYLA 2E4LA 3TAPA 4FJHA 4CGGA 3O3HA 2KZZA 3SPYA 1VSJA 3NH1A 3LANA 3SJJA 1RT3A 2QK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KI6 A;  1T8E A;  4FJG A;  2IAJ A;  5E41 A;  4KTQ A;  1JLG A;  4CHN A;  3KJV A;  3E01 A;  2KW4 A;  1VRT A;  3KKR A;  5J2Q A;  1WAJ A;  3NFA A;  1KRP A;  3AVK A;  3MEG A;  4PUO A;  4OLA A;  4EZ9 A;  3ITH A;  1WSF A;  1HRH A;  3OYE A;  3M8P A;  4WE1 A;  4HCB A;  1F21 A;  3OYN A;  1C6V A;  4E7I A;  1NK6 A;  4KHU A;  4ZTF A;  3L2U A;  3WNE A;  3OYK A;  3AVL A;  3DRP A;  4CEO A;  4FJX A;  3V9Z A;  2VWJ A;  1QHT A;  4NCB A;  2QXF A;  3DRR A;  3KD5 E;  2LSN A;  3B6O A;  1L3U A;  1BIS A;  3PX4 A;  4CCH A;  4AHU A;  3WNF A;  4E1M A;  2OZM A;  3VQ9 A;  4QCL A;  4NYN A;  3HP9 A;  4DU3 A;  4N56 A;  1X9M A;  2Q3S A;  5J2P A;  4BWM A;  4E89 A;  3NF8 A;  1EXQ A;  3AO4 A;  3OYA A;  3D0P A;  1TAQ A;  4CIF A;  3OJU A;  3PO4 A;  4M45 A;  5HLF A;  3LP3 A;  3LP2 A;  2O4I A;  4N76 A;  3QNO A;  1S9E A;  4K8X A;  1KLM A;  3L2W A;  4DSK A;  4FLX A;  4FLT A;  3VQP A;  1KVC A;  1QSL A;  3AA4 A;  1T05 A;  3KLG A;  1RBT A;  1BGX T;  2IDO A;  4C8K A;  3HVT A;  2KFN A;  4MFB A;  5FRO A;  3K5O A;  4OKJ A;  4DG1 A;  4N5S A;  1VSK A;  4E3S A;  3ZCM A;  3TAQ A;  1ZBH A;  2HHV A;  4RW4 A;  1K6Y A;  1RT5 A;  2VG6 A;  3SQ0 A;  3QET A;  1HYS A;  1I39 A;  3HO1 A;  1UA0 A;  2A1S A;  3AVH A;  3CQ8 A;  3C94 A;  2ETJ A;  4ZHR A;  3VA3 A;  4CHP A;  3ISN C;  1WSE A;  2G8I A;  1RT7 A;  4EP4 A;  4CIE A;  4B08 A;  2HNZ A;  4DTX A;  4LSL A;  4B8C A;  3NDK A;  2HW3 A;  2P5G A;  3AA2 A;  1MU2 A;  1ASU A;  3NE6 A;  3S3N A;  1S1V A;  1LAV A;  4NCA A;  1L5U A;  3M8R A;  3TWH A;  2YNF A;  1ASV A;  2KTQ A;  3L3V A;  4CFB A;  4YFU A;  3THV A;  1WSJ A;  1Y97 A;  1SL2 A;  4DMN A;  1TKD A;  3RR8 A;  4M3Z A;  4CJ4 A;  3KKS A;  4FLV A;  3TAR A;  1SKS A;  4CHY A;  2YNH A;  4CJL A;  1S1U A;  3ZSW A;  2OPP A;  3OS1 A;  3QES A;  4W5T A;  3NGI A;  1RTH A;  1UWB A;  3HP6 A;  4DLG A;  3DLR A;  4CK1 A;  4CF9 A;  4BE1 A;  1GOC A;  1NK9 A;  1S5J A;  4CJP A;  3VQD A;  4CJW A;  2XY5 A;  3RTV A;  3T3F A;  3L2R A;  1TKX A;  4FJL A;  1HMV A;  1IKY A;  4CGD A;  3CFR A;  2G8U A;  3TAM A;  2AJQ A;  3IRX A;  3V4I A;  1YTU A;  3TR8 A;  3CG7 A;  5HBM A;  3BGR A;  4CEA A;  4E7K A;  3RMC A;  1A5V A;  1HQU A;  3SNN A;  1CXQ A;  2ITG A;  1L3V A;  4B9U A;  4Z4H A;  3SZ2 A;  3V9U A;  3U3G A;  1KVA A;  3V9S A;  2KZM A;  1CLQ A;  1HQE A;  5HRS A;  2IC3 A;  3OYM A;  3P83 D;  1YT3 A;  3NGZ A;  3IAY A;  5J2N A;  3TAN A;  3PY8 A;  3MED A;  3RRG A;  2EX3 A;  4IFV A;  4DFM A;  1D9D A;  3G0Z A;  5J1E A;  4FLY A;  5CYM A;  4CFC A;  4E7J A;  2WOM A;  3OYJ A;  3K59 A;  1NKB A;  4FLZ A;  2XRI A;  4AIL C;  4KI4 A;  3ASM A;  1JLQ A;  3AA3 A;  1G15 A;  3NCI A;  1WLJ A;  5KTQ A;  5HRO A;  1JL1 A;  2DFE A;  2HB5 A;  1DLO A;  2YNG A;  2P51 A;  1BI4 A;  4KTW A;  4AHS A;  3K5M A;  4DSE A;  3TAB A;  1SL1 A;  1U45 A;  1KSP A;  3RWU A;  1VRU A;  2PYL A;  2YHB A;  3CFO A;  4BWJ A;  1WSH A;  4FJ5 A;  4FK2 A;  4ELT A;  2ATQ A;  1NJY A;  4L8R B;  1VSI A;  4DSF A;  1JLC A;  1S1W A;  4FLW A;  3DYA A;  1GOA A;  4YNQ A;  3ZSX A;  4HTU A;  3T19 A;  1Q9Y A;  4CJE A;  3WNG A;  2DY4 A;  3ZT2 A;  2HHS A;  1TK5 A;  3MXI A;  1JLE A;  3S9H A;  1ZBF A;  3VQ8 A;  1SL0 A;  2DTU A;  2IGI A;  3G10 A;  1CZB A;  1RCH A;  2OZS A;  3QIO A;  1NK5 A;  3MXM A;  3L8B A;  3OVN A;  4ID5 A;  4AHC A;  2FBY A;  3D45 A;  4W5N A;  1TVR A;  5T7B A;  1ZBU A;  1B9F A;  3VA0 A;  5HRR A;  1FKO A;  4DSJ A;  4OLB A;  4FXD A;  3RR7 A;  3RRH A;  3QEV A;  1REV A;  3TAE A;  2ZD1 A;  1UOC A;  2Z1J A;  1N6Q A;  4DTR A;  2HHW A;  3KLI A;  1FKP A;  4CJK A;  2X6S A;  4F2R A;  4C8N A;  2X74 A;  1A5X A;  5FDL A;  3VQQ A;  4DTJ A;  3A2F A;  4CE9 A;  4CER A;  3DM2 A;  3SV4 A;  2FBV A;  4B9M A;  1LW0 A;  1JL2 A;  1SUQ A;  4F3T A;  2KFZ A;  1JLA A;  4CJU A;  2X78 A;  3V9X A;  4KAZ A;  3AVG A;  2GBZ A;  2RN2 A;  3HYF A;  1BQM A;  5DK5 A;  3CM6 A;  4FCY A;  3BDP A;  3ZSQ A;  1BL3 A;  2OPR A;  4I9Q A;  1UA1 A;  4OGE A;  1C1B A;  2Z1I A;  1XWL A;  4RG8 A;  2OYQ A;  4DQP A;  1JXB A;  3TI0 A;  4PQU A;  4CF8 A;  2OA8 A;  3HPO A;  4DTN A;  5C24 A;  4PY5 A;  5CZ2 A;  3DOL A;  1EX4 A;  4UQG A;  4Q5V A;  4FZY A;  3K5L A;  1CZ9 A;  2GV9 A;  4KTZ A;  3VQC A;  3S3O A;  1NJZ A;  2XY6 A;  1TK8 A;  1VSM A;  3LAL A;  5CZ1 A;  3PX0 A;  1DTQ A;  4OPK A;  4KHS A;  3OYD A;  3NF9 A;  1RDA A;  2Z1H A;  4XIU A;  3NGY A;  4M3W A;  4DQR A;  5CY4 A;  1XHZ A;  3KD1 E;  1LAW A;  4DU1 A;  3ULD A;  3DOK A;  1QE1 A;  4FW2 A;  3LWL A;  3P5J A;  3IS9 A;  1J9A A;  3O4N A;  2XO7 A;  1RT4 A;  3EY1 A;  1B9D A;  2QKK A;  1SV5 A;  2G8V A;  3M8S A;  1BIZ A;  4K8Z A;  4H4O A;  4AHT A;  2YKN A;  3SQ4 A;  4CGI A;  4CGH A;  3AO1 A;  1U4B A;  1NJW A;  4NCG A;  3B6P A;  4O44 A;  3KIO A;  4IFY A;  1LV5 A;  5SZT A;  3TAF A;  1VSL A;  4IDK A;  3V1R A;  1RT1 A;  4NYF A;  4CJ3 A;  3AVM A;  4DTM A;  3QO9 A;  4CEC A;  1W0H A;  4CF0 A;  3DRS A;  4H4M A;  1LWC A;  3KK2 A;  4FJI A;  1NOZ A;  4AHV A;  4HUG A;  3QIN A;  4B3O A;  2HNY A;  2D0A A;  3O4Q A;  3ZT3 A;  1RBU A;  3OY9 A;  2Z1G A;  1ZYQ A;  4C8O A;  1S1T A;  1IH7 A;  3ZT1 A;  4BE0 A;  4PWD A;  3QIP A;  1NKC A;  1I3A A;  4O55 A;  3QER A;  3DLE A;  3VQ5 A;  3LP0 A;  1BCO A;  2JGU A;  1IKV A;  4OJR A;  4HHT A;  3SUO A;  4CFA A;  1WAF A;  1W9H A;  4KV8 A;  2ZE2 A;  4B8A B;  4FJ7 A;  1WSI A;  4DFJ A;  4HVJ A;  3EZ5 A;  3KK3 A;  2XY7 A;  4DTS A;  4DQQ A;  1RDD A;  4DTO A;  3OYC A;  1FXX A;  5FRM A;  2YHA A;  4LD0 A;  4N41 A;  4M42 A;  1S9G A;  4CFD A;  3HPH A;  2A1R A;  2G8K A;  5HP1 A;  2RKI A;  3QEX A;  2HHQ A;  3SYZ A;  2XHB A;  1Q8I A;  2RF2 A;  3DLG A;  1X9W A;  1JLF A;  3K57 A;  1YVU A;  3AVB A;  4BDY A;  4DQS A;  1NJX A;  4JRQ A;  4B9N A;  5KGX A;  4FJK A;  3JYT A;  3RMD A;  1LW2 A;  2OPS A;  1HNV A;  1FK9 A;  4R5P A;  4RW9 A;  4M3T A;  5D3G A;  4Z4C A;  1C0U A;  1B92 A;  3AV9 A;  1NKE A;  4ICL A;  4AH9 A;  4J2E A;  1J5O A;  2D0C A;  3AA5 X;  5KRT A;  2YKM A;  2D0B A;  5KRS A;  4CJT A;  1S6P A;  3AVC A;  4DF8 A;  3K5N A;  1TAU A;  4ZTJ A;  1VSD A;  3ZT4 A;  3KLF A;  3H08 A;  4KFB A;  4O4G A;  4AHR A;  3NBP A;  4GW6 A;  4IG3 A;  4OGC A;  3HPG A;  1KFD A;  3LAK A;  3DLK A;  4IBN A;  3K58 A;  2VWK A;  3VN5 A;  1BHL A;  2RPI A;  4HUF A;  4FJJ A;  4Z4I A;  3PV8 A;  2Y1I A;  2R7Y A;  3SQ2 A;  3OYH A;  3AVA A;  2ZQB A;  2PYJ A;  1KTQ A;  3CM5 A;  3ZSR A;  4CJ5 A;  4E7L A;  1XI1 A;  1IKX A;  4KPY A;  2BDP A;  4FK0 A;  3WNH A;  4I9L A;  4CGJ A;  1RTJ A;  3O3G A;  2F96 A;  3F73 A;  1ZBL A;  2EHG A;  4KI6 A;  4LH5 A;  3QNN A;  5JS2 A;  4J2D A;  4RW6 A;  4FZZ A;  1SKR A;  3RMB A;  3I0S A;  4DSL A;  1QS4 A;  4CEF A;  2YNI A;  4CES A;  4I7F A;  4DTP A;  3V81 A;  3SQ1 A;  4OVL A;  3I0R A;  3C95 A;  3VQE A;  4M3X A;  3NF6 A;  4B9L A;  2B5J A;  1C1C A;  1RNH A;  3CYM A;  4EP5 A;  4JRP A;  1U49 A;  3HM9 A;  2OPQ A;  1TKZ A;  3V6D A;  4KHN A;  4FLU A;  1O1W A;  1TV6 A;  3PUF A;  4GMJ B;  4LY7 A;  3L2V A;  4Q0B A;  2HHT A;  4CED A;  1Q9X A;  4QOZ B;  4KHY A;  3IG1 A;  1HYZ A;  2P1J A;  3SI6 A;  4CHO A;  4KHW A;  2BAN A;  2HHX A;  3NF7 A;  1HJR A;  1RBS A;  2IS3 A;  1D9F A;  1NK7 A;  1BQN A;  2DFF A;  1KLN A;  4KB0 A;  4F8R A;  1KVB A;  2DFH A;  4B9V A;  4KHQ A;  4ID1 A;  3OYB A;  3FFI A;  4E7H A;  3L2Q A;  1R0A A;  3PX6 A;  3KTQ A;  1GOB A;  3VQ4 A;  3TAG A;  3C6U A;  4CEQ A;  3MXJ A;  4CJQ A;  3HJF A;  3HVR A;  3OJS A;  4CJV A;  4IKF A;  4FJ8 A;  3AVI A;  2BE2 A;  4DTU A;  4H8K A;  4FJM A;  4HUE A;  1D8Y A;  4B9S A;  1L3S A;  2HND A;  1RTI A;  3HXM A;  1ASW A;  1TKT A;  1U04 A;  2KQ2 A;  3AO5 A;  4PA1 A;  5C25 A;  2IOC A;  4M41 A;  3OYI A;  1WN7 A;  4ELV A;  4DFP A;  5K14 A;  3VQB A;  4W5R A;  2X6N A;  1NK8 A;  3LZI A;  4FVM A;  2D5R A;  2B4J A;  3HL8 A;  1NOY A;  3OYG A;  1NK4 A;  4J2A A;  4KB1 A;  3SV3 A;  4CK2 A;  3SCX A;  5I3U A;  4HCC A;  3ZSZ A;  3DMJ A;  1VK0 A;  3LP1 A;  1KFS A;  2PY5 A;  3UIQ A;  3OS2 A;  4CF2 A;  2Y1J A;  1X9S A;  3NHG A;  3LWM A;  4DFK A;  1S6Q A;  3MEC A;  1S1X A;  4E1N A;  4CJR A;  4RW7 A;  1T7P A;  1EP4 A;  3NH0 A;  1RT6 A;  3ZT0 A;  4Z4F A;  2BGG A;  4FYD A;  1JLB A;  1QQC A;  3HT3 A;  4Z0U A;  3LDS A;  4ELU A;  2HHU A;  1A5W A;  4CEE A;  4CHZ A;  3QEP A;  4IG0 A;  1NK0 A;  3DLH A;  3SUN A;  1TGO A;  4KO0 A;  2JLE A;  5DMR A;  4C8M A;  3DI6 A;  3NAE A;  2HVH A;  1C1A A;  3ZSO A;  1HPZ A;  3VQA A;  4G1Q A;  1TL1 A;  1WNS A;  3M8Q A;  4B9T A;  3F9K A;  1TL3 A;  4CEB A;  3LPU A;  1QSS A;  1J54 A;  3AVF A;  3KK1 A;  4FW1 A;  4Y1C A;  3AVJ A;  3NH2 A;  3U6F A;  3VQ6 A;  3HST B;  1HYV A;  2VG7 A;  3K2P A;  1VSF A;  1DTT A;  3LAM A;  4C8L A;  1EET A;  4BAC A;  4I2P A;  2G8F A;  3PO5 A;  2FBT A;  4CHQ A;  1RIL A;  3KLE A;  4DLE A;  2I5J A;  3VQ7 A;  4BDP A;  1T03 A;  4BDZ A;  4KRE A;  4FJN A;  1QTM A;  1IO2 A;  3MEE A;  4RW8 A;  3L3U A;  3HK2 A;  4Z4E A;  4LH4 A;  4N47 A;  2P5O A;  2G8W A;  4FK4 A;  2HVI A;  1RBV A;  5FRN A;  4LSN A;  1TK0 A;  4CK3 A;  1BIU A;  3RMA A;  1U47 A;  1ITG A;  1Z26 A;  5HRP A;  2HMI A;  3LPT A;  2B6A A;  4OKK A;  2YV0 X;  3QEI A;  3JSM A;  4O0J A;  4O5B A;  4M3R A;  2W42 A;  3EYZ A;  4FM0 A;  4CJF A;  3S3M A;  2XY8 A;  4DWI A;  1D5A A;  5C42 A;  4J2B A;  2QKB A;  1ZBI A;  3QEW A;  3OS0 A;  1C0T A;  3LZJ A;  2F8S A;  1YTA A;  3V9W A;  4M3U A;  2GUI A;  3DLB A;  1U48 A;  2G8H A;  4EZ6 A;  4MQ3 A;  1KCF A;  3ALY A;  5J2M A;  1QSY A;  5SWM A;  4F3O A;  1IKW A;  1BI4 B;  2E6M A;  3SPZ A;  3AVN A;  4GVM A;  5JS1 A;  1VSH A;  1UAX A;  1Z25 A;  1LWE A;  1X1P A;  4CGF A;  5HRN A;  4DQI A;  4KKO A;  4JS4 A;  1EKE A;  4Y1D A;  4BE2 A;  5EU7 A;  1J53 A;  1JKH A;  3V1O A;  1RT2 A;  3KLH A;  4JLH A;  1C0M A;  4JS5 A;  4OPJ A;  5I42 A;  1HNI A;  1LWF A;  4QAG A;  4W5O A;  1XHX A;  2PZS A;  4DF4 A;  3P1G A;  3QLH A;  4E0D A;  1CXU A;  4FM2 A;  2VG5 A;  4KRF A;  4CEZ A;  1IG9 A;  4M3Y A;  4I2Q A;  1SKW A;  2NUB A;  4O0I A;  1L3T A;  1RDC A;  4F4K A;  1VSE A;  3C6T A;  2FC0 A;  4E19 A;  1RDB A;  1JXE A;  2E6L A;  4TSX A;  3I8D A;  3SUP A;  3OYF A;  4FM1 A;  4DS5 A;  4FZX C;  5KGW A;  2O4G A;  2F8T A;  4DU4 A;  4CIG A;  4W5Q A;  3V1Q A;  3ZSV A;  1BCM A;  3CFP A;  4OKE A;  3O3F A;  3ZSY A;  3U3Y A;  4DSI A;  3SUQ A;  3AO3 A;  3T1A A;  3MAQ A;  3AO2 A;  4FJ9 A;  1N5Y A;  1RBR A;  1WSG A;  2WON A;  5CYQ A;  4CF1 A;  4CJS A;  1XC9 A;  2FBX A;  1RTD A;  4DS4 A;  4F2S A;  4Z4G A;  3OYL A;  2E4L A;  3TAP A;  4FJH A;  4CGG A;  3O3H A;  2KZZ A;  3SPY A;  1VSJ A;  3NH1 A;  3LAN A;  3SJJ A;  1RT3 A;  2QK9 A; 
#chains in the Genus database with same CATH topology
 2IAJ A;  2HF4 A;  3VOV A;  1JLG A;  3PIP L;  3K0S A;  3E01 A;  2KW4 A;  1Q82 O;  4CJ7 A;  3IMX A;  4JKG B;  4MLE A;  4QS8 A;  4EZ9 A;  3ITH A;  5TKY A;  3OYE A;  4WE1 A;  4HCB A;  3OYN A;  1C6V A;  5ELZ A;  4E7I A;  4ZTF A;  4RCH A;  1QHT A;  3WEE B;  5AQN A;  4CCH A;  3PX4 A;  3J7Z O;  5DM7 L;  4NYN A;  4DU3 A;  2E8A A;  3OYA A;  1TAQ A;  3GG4 A;  4XH5 A;  2DPN A;  4CIF A;  4YOY A;  4M45 A;  1VQL N;  4K8X A;  2FSJ A;  1T05 A;  5E26 A;  3KLG A;  1BGX T;  2IDO A;  4DR7 K;  3FGU A;  2ZJP L;  4MFB A;  4DG1 A;  3ZCM A;  1K6Y A;  2VG6 A;  4GY2 B;  3SQ0 A;  1OH8 A;  4JYA K;  1UA0 A;  3C94 A;  4CHP A;  2P9I B;  4DTX A;  4RTF D;  3NDK A;  5C2F A;  4JHD A;  1RDW X;  1L5U A;  1TYQ B;  4H5R A;  3M8R A;  1ASV A;  2KTQ A;  5AQG A;  2WFB A;  3TAR A;  1O13 A;  5AQT A;  3OS1 A;  4IFE A;  1KQS M;  1RTH A;  3SMS A;  3HP6 A;  2O8C B;  4CK1 A;  4CJP A;  2XY5 A;  3RTV A;  3WXJ A;  4BRD A;  3L2R A;  5JLH A;  1TKX A;  2QA4 N;  1EWQ A;  3BGR A;  1A5V A;  1GLC G;  2IIR A;  4B9U A;  3SZ2 A;  3N4Q A;  1KVA A;  2KZM A;  1HQE A;  3M1F A;  1W2B M;  3O9T A;  3EL2 A;  5KQ8 A;  1XMO K;  3IAY A;  3TAN A;  1SS6 A;  3PY8 A;  4IFV A;  4DFM A;  5J1E A;  4E7J A;  4FLZ A;  3ASM A;  4LF4 K;  3UKR B;  4NO7 A;  1DLO A;  2QI2 A;  1MA9 B;  5M1F A;  1KSP A;  1ZBS A;  2PYL A;  2YHB A;  5M1N A;  4U7B A;  3WUH A;  1NJY A;  5BRE A;  4DSF A;  1S1W A;  2P9N A;  1GOA A;  4YNQ A;  1Q9Y A;  3T19 A;  4U67 L;  3ZT2 A;  3BF1 A;  1V4S A;  3QIO A;  4BVO A;  4PKI A;  2AA4 A;  2FBY A;  4W5N A;  5T7B A;  3CC2 N;  1GLE G;  5HRR A;  3LDL A;  3CJC A;  3RRH A;  1YI2 N;  5M1P A;  2Z1J A;  2HHW A;  4DTR A;  2OTL N;  4CER A;  2FBV A;  2QEX N;  1JL2 A;  1SUQ A;  2AP1 A;  3A5N C;  4CJU A;  2P9L B;  5TKW A;  4X65 K;  4IEE A;  3HYF A;  4YDU A;  1BL3 A;  2OPR A;  1ZC6 A;  4OGE A;  3SJH A;  2P9P A;  3VEN A;  3WT0 A;  3VEV A;  4PL8 A;  4CF8 A;  5C24 A;  1EX4 A;  4FWO A;  1TK8 A;  2GV9 A;  1VSM A;  3ATU A;  3EEQ A;  5BPL A;  1RDA A;  1VHX A;  1P8Z A;  2VWB A;  1JCE A;  3NGY A;  4CZG A;  2O8B A;  4DQR A;  3OW2 M;  1LAW A;  3VEZ A;  4DU1 A;  1J9A A;  4IEI A;  3ZLJ A;  3P31 A;  5AQU A;  2VGN A;  2QKK A;  1OH6 A;  2W6L A;  4AHT A;  2UXC K;  4O44 A;  3CJ9 A;  4IFY A;  1NGE A;  1VSL A;  3SMP A;  3AVM A;  3QIC A;  4CEC A;  4CD3 A;  4H4M A;  4B3O A;  2RE2 A;  4HWI A;  2CH6 A;  1RBU A;  2A42 A;  5JVH L;  4C8O A;  1U2V A;  3DXM A;  3DLE A;  4IO8 A;  2YI1 A;  3LP0 A;  1BCO A;  2JGU A;  4DR3 K;  5GAG P;  1WAF A;  4KV8 A;  3CHW A;  4DV5 K;  3CCQ N;  4FJ7 A;  4DFJ A;  4HVJ A;  1YIT N;  5AQQ A;  4DQQ A;  4DV2 K;  4AQY K;  2YHA A;  3QEX A;  2XHB A;  3W0L A;  4NXN K;  5JVG L;  1N8R O;  5MLC Q;  4FJK A;  2OPS A;  3ID8 A;  1BUP A;  4Z4C A;  1C0U A;  2QXL A;  4ICL A;  3UKU B;  4AH9 A;  2ZJQ L;  1NMN A;  2D0C A;  1J5O A;  2YKM A;  4CJT A;  3AVC A;  3LM9 A;  2Q31 A;  1TAU A;  3C7N A;  3ZT4 A;  1YUW A;  4KFB A;  4AHR A;  4OGC A;  3QB0 A;  3CC7 N;  3DAW A;  4IBN A;  3MCP A;  3WXM B;  2GWJ A;  3PV8 A;  3MWT A;  3BP8 A;  2ZQB A;  1KTQ A;  1XI1 A;  4KPY A;  4FOE A;  3PSI A;  3J7Y P;  2BDP A;  4FK0 A;  4I9L A;  1ZBL A;  4KI6 A;  2EHG A;  5JS2 A;  3CCU N;  4R79 A;  3THY A;  4M3X A;  1HX1 A;  3E9L A;  4IZ9 A;  3THX A;  3D2E B;  4EP5 A;  5FLX O;  4MDB A;  4KH6 A;  1WB9 A;  4KHN A;  3PUF A;  3L2V A;  4CED A;  1Q9X A;  3PSF A;  4JI7 K;  4KHY A;  2GX9 A;  4K0K K;  3MN6 A;  3ULE A;  3SI6 A;  1K8K B;  3A5O C;  3EN9 A;  1BO5 O;  2QWM A;  3GL1 A;  1FJG K;  3U9D A;  1KLN A;  2DFF A;  1VQ7 N;  4F8R A;  2P9U B;  2V51 B;  3A5M C;  3FFI A;  3L2Q A;  5AQI A;  2YJF A;  3A5L C;  4WFN L;  1XNQ K;  4A62 A;  4DR1 K;  2BE2 A;  2HBJ A;  2FF3 B;  4IWV A;  5C10 A;  1D8Y A;  1L3S A;  1RTI A;  3HXM A;  2HF3 A;  1U04 A;  4IOX A;  2IOC A;  4NLB A;  1ESV A;  2O8E B;  1WN7 A;  4ELV A;  5K14 A;  2X6N A;  3KVG A;  3LZI A;  4FVM A;  2D5R A;  1GLL O;  3HL8 A;  3O9R A;  4H0Y B;  4GKK K;  3SCX A;  3ZSZ A;  1BU6 O;  2Q1N A;  3LP1 A;  1KFS A;  2PY5 A;  3OS2 A;  4CF2 A;  2Y1J A;  1GLA G;  4LF5 K;  1BOT O;  3NHG A;  4JI1 K;  1S1X A;  4E1N A;  1T7P A;  1EP4 A;  3NH0 A;  1RT6 A;  4FYD A;  3HT3 A;  4JHD B;  2E1Y A;  4Z0U A;  3LDS A;  4B1U B;  3SUN A;  4C8M A;  3NAE A;  4GV3 A;  3GDQ A;  1C1A A;  1TL1 A;  1WNS A;  3F9K A;  2VGM A;  3LPU A;  1QSS A;  3AVF A;  3KK1 A;  2QWR A;  4YDU C;  4QS9 A;  3NH2 A;  2IVO A;  3HST B;  4CZE A;  2H3G X;  2NRH A;  3LAM A;  3KHY A;  4BAC A;  1X3M A;  4B3M K;  4CZF A;  1NU0 A;  3VQ7 A;  1LCU A;  1T03 A;  3IFR A;  3MEE A;  1QTM A;  1GLB G;  3L3U A;  4IXC A;  2P5O A;  4DR2 K;  4BGA A;  3GOI A;  4AM6 A;  3JXU A;  1HNW K;  3LDP A;  4A2B A;  1U47 A;  1ATR A;  1Q18 A;  3JSM A;  1NGG A;  3HOT A;  4B1V A;  3FZF A;  3S3M A;  4M3R A;  4CJF A;  2QKB A;  3QEW A;  3WXK A;  1K8A O;  3OS0 A;  1C0T A;  2F8S A;  2V7Z A;  3DLB A;  3EO3 A;  5J2M A;  2VCP A;  4IOA L;  3VGL A;  3JS6 A;  3U9Z A;  2E6M A;  3SPZ A;  2NRZ A;  5HRN A;  1UAX A;  4KKO A;  3FFK B;  5EU7 A;  4I6M A;  4JI6 K;  4JLH A;  1C0M A;  4OPJ A;  2ASM A;  4JKB A;  5AQV A;  1LWF A;  4DF4 A;  3P1G A;  3KWI A;  4E0D A;  2Q0R A;  4M3Y A;  3VET A;  1K73 O;  1L3T A;  2NUB A;  1ILY A;  3ZX2 A;  1DGK N;  4DQ8 A;  2FC0 A;  1SZ2 A;  5EVZ A;  3CCM N;  4DU4 A;  4CVN E;  3HTV A;  1WSG A;  2WON A;  4CF1 A;  2JWK A;  4CJS A;  1RTD A;  3LDQ A;  3SPY A;  1VSJ A;  4ISG A;  4KBO A;  3LAN A;  4DKW A;  4N41 A;  1NGB A;  5GIN A;  4FJG A;  4JKD A;  4IJA A;  3CET A;  1VRT A;  3NFA A;  3AVK A;  3D7E O;  1WSF A;  1HRH A;  3T7Z A;  1F21 A;  2P9P B;  2A5X A;  4BR2 A;  3OYK A;  3DRP A;  5JMV A;  3CME N;  2QXF A;  1EWR A;  2LSN A;  4KHP K;  3CJB A;  5LJV A;  4AHU A;  3WNF A;  4B3T K;  3L4Q A;  3HP9 A;  3HSC A;  1HKC A;  1X9J A;  3NF8 A;  3AO4 A;  4CZK A;  3OJU A;  3PO4 A;  2F7T A;  3LP3 A;  3QNO A;  1S9E A;  3L2W A;  4BRL A;  3VQP A;  1YXQ A;  4FVU A;  4C8K A;  3HVT A;  4X66 K;  2CGJ A;  4OKJ A;  1VSK A;  4E3S A;  1ZBH A;  1RT5 A;  1HYS A;  3HO1 A;  5AQS A;  3J81 O;  1IBM K;  4ZHR A;  3VA3 A;  3HOS A;  2FLO A;  3O9S A;  5CR4 A;  4EP4 A;  4CIE A;  4BRP A;  4B08 A;  2HNZ A;  4LSL A;  4B8C A;  1GLJ O;  4PL7 A;  3AA2 A;  1MU2 A;  3NE6 A;  3S3N A;  1LAV A;  3OBY A;  1RFQ A;  3TWH A;  3L3V A;  4CFB A;  3DXM B;  1SL2 A;  2P9K B;  3BEX A;  3ZSW A;  4YY3 K;  4W5T A;  3NGI A;  2W40 A;  1UWB A;  4DLG A;  3VQD A;  3EZW A;  3T3F A;  3HM8 A;  4YHH K;  1YTU A;  3CG7 A;  3RMC A;  4WQ4 A;  2NRV A;  1L3V A;  4Z4H A;  3V9U A;  3CXC M;  4BRC A;  1CLQ A;  3AAR A;  1HNZ K;  3NGZ A;  2A40 A;  4FWR A;  3VGM A;  3VEW A;  3RRG A;  3G25 A;  1QVG M;  1XNR K;  4CFC A;  2WOM A;  1E4F T;  2O8D B;  1NBW A;  3B8A X;  3D2F A;  1G15 A;  1JL1 A;  2P51 A;  1HLU A;  1BI4 A;  3WXL A;  3TAB A;  1U45 A;  5AQY A;  3THW B;  4BWJ A;  2UXB K;  1WSH A;  2ATQ A;  1VSI A;  1JLC A;  4XH4 A;  3ZSX A;  4DHY A;  1HNX K;  2DY4 A;  3ZEU B;  1JJ2 M;  2HHS A;  2FF6 A;  2WTU A;  2IGI A;  2Q97 A;  3ZX3 A;  4AF1 A;  4EFH A;  3OVN A;  4ID5 A;  4H5V A;  3D45 A;  3E66 A;  4DSJ A;  3MMV A;  3QEV A;  4JI4 K;  1UOC A;  2KHO A;  3T1H K;  4CJK A;  3EKU A;  2E2O A;  1A5X A;  3VQQ A;  3A2F A;  3SV4 A;  2KFZ A;  4WQ5 A;  1JLA A;  3ULE B;  3RSE B;  1U6Z A;  5DK5 A;  4FCY A;  4BC5 A;  3ZSQ A;  4I9Q A;  5A2Q O;  1C1B A;  2Z1I A;  4FWL A;  4CZI A;  4RG8 A;  3J8A A;  1BA0 A;  1JXB A;  3TI0 A;  2OA8 A;  3HPO A;  4PY5 A;  5CZ2 A;  4FZY A;  4UQG A;  4Q5V A;  4BRH A;  3MX5 A;  1CZ9 A;  3K5L A;  1NJZ A;  4A5B A;  5CZ1 A;  4BY9 C;  3E9O A;  4XIU A;  4M3W A;  4FW2 A;  1NGA A;  3LWL A;  3P5J A;  2HMP A;  3WXI A;  2O8F B;  2E1Z A;  2G8V A;  3M8S A;  4JKE A;  5AQP A;  4CGI A;  3AO1 A;  1NJW A;  4NCG A;  3B6P A;  3KIO A;  2F4V K;  5FPN A;  3TAF A;  5GIO A;  4IDK A;  3UB5 A;  4DTM A;  2I7N A;  4FJI A;  1W0H A;  4CF0 A;  5AZJ B;  2GUP A;  4AHV A;  4HUG A;  3QIN A;  2HNY A;  2D0A A;  2HHH K;  3OY9 A;  2Z1G A;  1IH7 A;  3ZET B;  3ZT1 A;  4PWD A;  1NKC A;  3VQ5 A;  4HHT A;  1IKV A;  4OPH A;  3WQU A;  4C23 A;  4H0O A;  3IUC A;  1WSI A;  2D1K A;  3KK3 A;  4DTS A;  4JNE A;  1RDD A;  3FZK A;  5FRM A;  2A1R A;  2G8K A;  2RKI A;  3DLG A;  2HBL A;  1C0G A;  1YVU A;  3CJA A;  4BDY A;  3MCA B;  4JRQ A;  1NJX A;  3J80 O;  3JYT A;  3RMD A;  1FK9 A;  4R5P A;  4DV1 K;  4M3T A;  4JEP A;  3ENH A;  4WFA L;  1B92 A;  1Q81 O;  4J2E A;  3AA5 X;  2D0B A;  3CCV N;  1YAG A;  3TPQ A;  1VSD A;  3O4W A;  3CF5 L;  3H08 A;  3CCR N;  5I9E B;  2F9T A;  4O5F A;  3NBP A;  1CZA N;  1HPM A;  2YHY A;  3FZM A;  1KFD A;  3LAK A;  3I55 N;  2VWK A;  5BRH A;  4FJJ A;  1OVQ A;  2R7Y A;  1QQN A;  1N34 K;  4CZL A;  3CM5 A;  1IKX A;  2GEM A;  3F73 A;  4MO5 A;  2F96 A;  4BRE A;  4BR0 A;  3QNN A;  4J2D A;  4FZZ A;  3TTD A;  3VTI A;  2UUB K;  4FPA A;  5AQM A;  2YNI A;  4CES A;  3V81 A;  2D4W A;  1YF5 L;  1MDU B;  1RNH A;  3CYM A;  4WQ4 C;  5BN9 A;  2OPQ A;  3H3O B;  3V6D A;  1TV6 A;  4GMJ B;  4LY7 A;  3JAM O;  2HHT A;  4HTL A;  2QWQ A;  3IG1 A;  4H5N A;  2BAN A;  3R3L A;  1VQK N;  4OX9 K;  3FZL A;  1NK7 A;  1BQN A;  4KHQ A;  4B1W B;  4ID1 A;  1JCF A;  3VQ4 A;  3C6U A;  4X64 K;  1N32 K;  4CW7 B;  1DT9 A;  2KLA A;  4IKF A;  2J4R A;  4FJ8 A;  1DEJ A;  4H8K A;  4BG9 A;  4BG8 A;  4HUE A;  2HND A;  4CI6 A;  1ASW A;  5C25 A;  3CCE N;  4M41 A;  1WBB A;  3U8X A;  3LM2 A;  3OTO K;  1NOY A;  3OYG A;  4KB1 A;  4PHT X;  1VQ6 N;  5F1X A;  3UIQ A;  2UXD K;  1IBL K;  3A0I X;  3LWM A;  4DFK A;  1S6Q A;  4LFA K;  4GV9 A;  4Z4F A;  1ATN A;  4LF8 K;  3O80 A;  4ELU A;  3R6M A;  2UU9 K;  1A5W A;  5KPR A;  4IG0 A;  4JK9 A;  4WQ5 C;  2JLE A;  2HVH A;  1HPZ A;  3O9U A;  3M8Q A;  4B9T A;  1TL3 A;  4MO4 A;  4FW1 A;  1G99 A;  4Y1C A;  4A5A A;  3U6F A;  1QQO A;  1HYV A;  1VSF A;  4C8L A;  1EET A;  4CHQ A;  1RIL A;  4JKF A;  1VQO N;  4KRE A;  3O1B A;  4FJN A;  3O8M A;  3HK2 A;  4Z4E A;  4N47 A;  2G8W A;  1RBV A;  1TK0 A;  4JD2 A;  3CIP A;  2NRR A;  3MN9 A;  4FWK A;  4O0J A;  2NRT A;  4JI8 K;  4K43 A;  4FPB A;  5C42 A;  3LZJ A;  2E20 A;  1YTA A;  1U48 A;  2G8H A;  4EZ6 A;  2VQF K;  5BR9 A;  1BI4 B;  3QML A;  4LF6 K;  4Z94 A;  3AVN A;  4B3S K;  3FZH A;  2E88 A;  1VSH A;  4CD1 A;  3J7A P;  5JS1 A;  1X1P A;  1EKE A;  3L6Q A;  1KAY A;  3CJ1 A;  5AQW A;  5I42 A;  3BUZ B;  3TTF A;  3M3Z A;  4FM2 A;  1OH7 A;  4CEZ A;  1SQK A;  3C6T A;  4E19 A;  3I8D A;  3OYF A;  1T6D A;  4EHT A;  3Q7C A;  5KGW A;  4RWT A;  4CIG A;  4W5Q A;  4FSV A;  3ZSV A;  4KH4 A;  4H0X B;  4OKE A;  3ZSY A;  3SUQ A;  3AO3 A;  3EE9 A;  3VMF B;  3AO2 A;  1N5Y A;  1IG8 A;  1XC3 A;  1RBR A;  3IKM A;  5CYQ A;  1W7A A;  5B8H A;  4DS4 A;  3O08 A;  4CGG A;  2KZZ A;  3SJJ A;  3PIO L;  4CHN A;  1YVN A;  3UE5 A;  4H03 B;  3KKR A;  4M7Y A;  3H46 O;  1WAJ A;  5J2Q A;  3MEG A;  3R8E A;  5LL6 Z;  4A61 A;  3M8P A;  1NK6 A;  3WNE A;  3AVL A;  4CEO A;  4FJX A;  3V9Z A;  1S22 A;  1KD1 O;  4NCB A;  1QZ5 A;  4BR7 A;  3PLA A;  3VQ9 A;  4DV6 K;  1X9M A;  2QM1 A;  4PKG A;  1JCG A;  5J2P A;  2E2Q A;  3D0P A;  4MDA A;  3WEE A;  3Q7B A;  4XEI A;  2O4I A;  1KLM A;  4DSK A;  4FLT A;  4BR4 A;  1KVC A;  5C2D A;  1VAZ A;  1RBT A;  2KFN A;  4DUY K;  3CPW M;  5FRO A;  2HHV A;  1Z05 A;  4JKH A;  2HBK A;  3H45 C;  3QET A;  1I39 A;  5GAE P;  5AZI A;  4H0P A;  4EAH D;  1RT7 A;  3MX2 A;  1GLD G;  1QQM A;  4M7X A;  1ASU A;  1S1V A;  3O1W A;  2RHK A;  5BPM A;  1YHQ N;  4LC9 B;  4BVP A;  2YNF A;  3CC4 N;  1H1V A;  3THV A;  1Y97 A;  4M3Z A;  3KZB A;  4FLV A;  1SKS A;  4CHY A;  1TYQ A;  2D0P A;  2OPP A;  3N4P A;  3QES A;  1DKG D;  4Y0W A;  3DLR A;  4CF9 A;  1YJN N;  1N6Q A;  1IG9 A;  5LMN K;  5EXW A;  1IKY A;  1HMV A;  4CGD A;  4X62 K;  3CFR A;  2W6K A;  3IRX A;  3SAH A;  1XMQ K;  3V4I A;  5HBM A;  2ZF5 O;  2O8C A;  3SNN A;  3AAQ A;  2P9S A;  3V9S A;  4AM7 A;  3OYM A;  2IC3 A;  1YT3 A;  5AQK A;  2ITM A;  4JI0 K;  4G9Z A;  3MED A;  1D9D A;  3G0Z A;  4FLY A;  1NKB A;  1BA1 A;  3K59 A;  4AIL C;  5C0Y A;  2OTJ N;  4KI4 A;  3AA3 A;  3NCI A;  1WLJ A;  2P9N B;  5HRO A;  1NG9 A;  3K5M A;  2OAN A;  4AHS A;  1Q86 O;  4CZJ A;  3RWU A;  3G6E N;  3CFO A;  3S41 A;  4ELT A;  3UKR A;  4FLW A;  3DYA A;  3CCJ N;  5GIP A;  3MN5 A;  3WNG A;  2EWS A;  1XUP O;  3MXI A;  3S9H A;  1ZBF A;  3VQ8 A;  1CZB A;  1RCH A;  2OZS A;  3MXM A;  3L8B A;  4FWN A;  4L3Q A;  3K9K A;  5C12 A;  3VA0 A;  1B9F A;  4OLB A;  3AGK A;  3RR7 A;  1BG3 A;  1REV A;  3TAE A;  4DV3 K;  3A8Y A;  3CPE A;  1FKP A;  2X6S A;  1WBD A;  4F2R A;  5FDL A;  1C0F A;  2Q36 A;  3FLC O;  4DTJ A;  3MN7 A;  3LDO A;  3CD6 N;  3VGK A;  2YX6 A;  3DM2 A;  4H0V B;  4B9M A;  1LW0 A;  3M6G A;  2VYP A;  4PKH A;  2GBZ A;  2RN2 A;  1NNE A;  1BQM A;  1VQ9 N;  3CM6 A;  2UUC K;  1NMD A;  2W41 A;  1VQ5 N;  2P9L A;  2OYQ A;  4PQU A;  1QHA A;  4GV6 A;  2NLX A;  1M90 O;  3DOL A;  1BDG A;  1YJ9 N;  2O8B B;  3VQC A;  4BC2 A;  1K9M O;  3PX0 A;  2WBN A;  4KHS A;  3OYD A;  3NF9 A;  1FW6 A;  1YIJ N;  1EQY A;  3VPZ A;  3BF3 A;  3F2K A;  3ULD A;  3IS9 A;  3O4N A;  1RT4 A;  3I56 N;  1BIZ A;  2E5L K;  4K8Z A;  1N36 K;  2YKN A;  4JN4 A;  3ID6 A;  5SZT A;  3V1R A;  1U2V B;  4NYF A;  3AY9 A;  3QO9 A;  3KK2 A;  3DRS A;  5JLF A;  1LWC A;  1NGF A;  5LY3 A;  1NGC A;  3HRG A;  4BRM A;  5KPZ A;  5M1O A;  5FPE A;  1ZYQ A;  4BE0 A;  3QIP A;  4YOU A;  4O55 A;  4QS7 A;  4OJR A;  2ZGZ A;  4CFA A;  1W9H A;  2ZE2 A;  1GLF O;  1SAZ A;  1NWK A;  3CER A;  2BH1 A;  3OYC A;  1FXX A;  4JD2 B;  4LD0 A;  4YOR A;  4CFD A;  3HPH A;  5ADX A;  5HP1 A;  3SYZ A;  1Q8I A;  4K25 A;  4DQS A;  5LJW A;  1NLV A;  1HNV A;  4RW9 A;  3I33 A;  5EX5 A;  3C7N B;  2NZT A;  4ILJ A;  1T44 A;  4MLH A;  5KRT A;  3TTC A;  3M5R A;  4BRN A;  3K5N A;  2ZJR L;  2ZGY A;  4CZM A;  1MWK A;  4M63 C;  3HPG A;  3DLK A;  3OBW A;  3K58 A;  3RVC A;  4Z4I A;  3SQ2 A;  2NNW A;  3AVA A;  2PYJ A;  4CJ5 A;  4WYB A;  3WNH A;  3THY B;  4CGJ A;  4LFC K;  1J5E K;  3THX B;  3L4I A;  4RW6 A;  2WUS A;  2FSN A;  1SKR A;  4LFB K;  4DSL A;  4CEF A;  4DTP A;  4FWQ A;  3SQ1 A;  2OCE A;  3VQE A;  3NF6 A;  4H5W A;  1C1C A;  1U49 A;  4JRP A;  3MK6 A;  1TKZ A;  1O1W A;  1Z6R A;  4Q0B A;  5C15 A;  2P1J A;  2HHX A;  4CHO A;  3D2E A;  3CJ7 A;  3NF7 A;  2IS3 A;  4KB0 A;  4IO9 L;  1KVB A;  1KXP A;  2DFH A;  3WQT A;  4EHU A;  3VEX A;  1R0A A;  3PX6 A;  1K8K A;  4JKA A;  5AQL A;  3TAG A;  1X3N A;  4J8F A;  3DLL L;  3HVR A;  3OJS A;  2QWP A;  4CJV A;  3AVI A;  4DTU A;  2P9U A;  1Y64 A;  4FJM A;  1VQP N;  3C0B A;  4B9S A;  4BRA A;  1TKT A;  3AO5 A;  4PA1 A;  3OYI A;  4DFP A;  2CGL A;  3AGR A;  3DWL A;  1OKJ A;  2B4J A;  4NB4 A;  3SV3 A;  4CK2 A;  5I3U A;  3DMJ A;  5AQO A;  2O8E A;  5ADX H;  5AFU A;  4JAX A;  1R59 O;  5AZI B;  3FE1 A;  1X9S A;  3VEO A;  3U4L A;  4CJR A;  4RW7 A;  3ZT0 A;  3C6H A;  1D4X A;  3NVM A;  2BGG A;  2V7Y A;  4CHZ A;  4CEE A;  1MWM A;  3QEP A;  3DLH A;  1TGO A;  4KO0 A;  3DI6 A;  1BWF O;  3KWG A;  3VQA A;  3QFP A;  4CEB A;  1J54 A;  3TSQ A;  4JI5 K;  3AVJ A;  5CHI A;  3VQ6 A;  2VG7 A;  3K2P A;  2UUA K;  4A2A A;  1I94 K;  1DTT A;  1V4T A;  2G8F A;  2FBT A;  3NMU A;  4BR5 A;  4GNI A;  3KLE A;  4DLE A;  2I5J A;  1VQ8 N;  4BDP A;  3BY5 A;  1IO2 A;  4LH4 A;  1IBK K;  2HVI A;  5FRN A;  1BIU A;  1Z26 A;  3DXK A;  2GEL A;  2P9S B;  2B6A A;  4OKK A;  2YV0 X;  3QEI A;  3EKS A;  4O5B A;  2W42 A;  4FM0 A;  4J2B A;  1D5A A;  2V52 B;  4DV0 K;  2D0O A;  2GUI A;  1J6Z A;  2QW9 A;  4MQ3 A;  5M1K A;  3ALY A;  5IT9 O;  4I6M B;  5SWM A;  4F3O A;  1ZXO A;  3ATV A;  1NGD A;  2QWN A;  4GVM A;  4YOT A;  1Z25 A;  1LWE A;  2WC9 A;  4DQI A;  2QTD A;  3ENO A;  4Y1D A;  2CH5 A;  1J53 A;  3TU5 A;  3KLH A;  4C1N K;  1VQM N;  1HNI A;  4QAG A;  1TUY A;  2PZS A;  3VER A;  2VG5 A;  1IV0 A;  4K41 A;  4OPA A;  4O0I A;  4F4K A;  1JXE A;  4TSX A;  4FM1 A;  4FZX C;  2O4G A;  3MDQ A;  3O9Q A;  2F8T A;  3OHR A;  4YOW A;  3V1Q A;  3CFP A;  3E9P A;  3T1A A;  3C6A A;  5AQX A;  1YJW N;  3P4I A;  1XC9 A;  2ASP A;  2JWL A;  3OYL A;  3TAP A;  3NH1 A;  1RT3 A;  3CMA N;  3VF4 A;  5KI6 A;  1T8E A;  5E41 A;  4KTQ A;  3KJV A;  3E1Y A;  5AFU H;  5F0X A;  1KRP A;  4PUO A;  4OLA A;  2ZM6 K;  4A59 A;  1NGJ A;  1T6C A;  4IJN A;  4B1Z A;  4KHU A;  3L2U A;  2GWK A;  2VWJ A;  3DRR A;  3KD5 E;  5CE3 A;  1NM1 A;  3B6O A;  1BIS A;  1L3U A;  4E1M A;  2OZM A;  4QCL A;  2I7P A;  4N56 A;  2Q3S A;  4BWM A;  4E89 A;  1EXQ A;  4JI3 K;  3G4S N;  5HLF A;  3LP2 A;  2QWO A;  5BN8 A;  5FPM A;  4N76 A;  4YOX A;  2KKZ A;  5FPD A;  4FLX A;  1HUX A;  1QSL A;  3AA4 A;  3FR0 A;  5JIC A;  3TAQ A;  3K5O A;  4N5S A;  4RW4 A;  3CCS N;  2A1S A;  3AVH A;  3CQ8 A;  2ETJ A;  3ISN C;  4FWM A;  1WSE A;  5HL7 L;  2PBD A;  2HW3 A;  2P5G A;  2GTD A;  4EIA A;  4IDH A;  4NCA A;  4DV7 K;  4BGB A;  4YFU A;  2E2P A;  1WSJ A;  5AQR A;  4BRO A;  4F9O A;  4DMN A;  1TKD A;  3RR8 A;  4CJ4 A;  3KKS A;  3BZC A;  2YNH A;  4CJL A;  1S1U A;  3SBG A;  4BE1 A;  1NK9 A;  4DV4 K;  1GOC A;  5F2R A;  1S5J A;  2P9K A;  4CJW A;  4FJL A;  2G8U A;  3TAM A;  4JKC A;  2AJQ A;  3TR8 A;  1S3X A;  4CEA A;  4E7K A;  1T3V A;  1HJO A;  1HQU A;  1CXQ A;  2ITG A;  2YHW A;  4JV5 K;  3U3G A;  5HRS A;  3P83 D;  3D2F B;  5J2N A;  5AQH A;  2EX3 A;  5CYM A;  3OYJ A;  4DR5 K;  5GAD P;  2XRI A;  1JLQ A;  5KTQ A;  2DFE A;  2HB5 A;  2YNG A;  4KTW A;  5IWA K;  1SL1 A;  4DSE A;  3G71 N;  1VRU A;  2NRW A;  4FJ5 A;  4FK2 A;  2O8D A;  3C65 A;  4L8R B;  1S72 N;  2ASO A;  4HTU A;  3NVK A;  3D6R A;  4CJE A;  4OO1 J;  1TK5 A;  4WF9 L;  3THW A;  4DB3 A;  1JLE A;  1SL0 A;  2DTU A;  3G10 A;  2FXU A;  5EOY A;  4KH5 A;  4B9Q A;  1NK5 A;  3R1X A;  4AHC A;  1TVR A;  3T69 A;  1ZBU A;  3EE8 A;  3ZEU A;  1FKO A;  1W97 L;  4FXD A;  4DR6 K;  5AQJ A;  5M1Q A;  2ZD1 A;  3KLI A;  3GE1 A;  4C8N A;  1NGH A;  2X74 A;  4FL9 A;  1HKB A;  3CQY A;  4CE9 A;  5H1S Q;  1VQN N;  4F3T A;  5EY4 A;  4H0T B;  2X78 A;  3MWP A;  4NXM K;  3V9X A;  4LF9 K;  4KAZ A;  3AVG A;  4JK8 A;  2Q0U A;  4BRK A;  3BDP A;  4JKG A;  4JI2 K;  4E1J A;  1UA1 A;  1XWL A;  1QVF M;  3RSE A;  1E3M A;  4DQP A;  4DTN A;  3SLC A;  3QBX A;  5KPT A;  3S3O A;  4KTZ A;  2XY6 A;  3LAL A;  1DTQ A;  4FOI A;  4OPK A;  1KC8 O;  2VQE K;  2Z1H A;  4ILG B;  4CBX A;  3ZYY X;  4B1X B;  5CY4 A;  1XHZ A;  3KD1 E;  3HBT A;  5AQF A;  3DOK A;  1QE1 A;  3KK7 A;  2XO7 A;  3EY1 A;  1B9D A;  1SV5 A;  3HZ6 A;  4H4O A;  3TSP A;  3SQ4 A;  4DR4 K;  4CGH A;  1U4B A;  2O8F A;  2P9I A;  1XQS C;  1LV5 A;  2UYT A;  1RT1 A;  4GKJ K;  4CJ3 A;  4A57 A;  1OH5 A;  1NOZ A;  4UY8 O;  3ENB A;  5DM6 L;  3ZT3 A;  3O4Q A;  2YCH A;  1S1T A;  4JK7 A;  1E4G T;  1I3A A;  3VF6 A;  3QER A;  1RDU A;  4BQZ A;  5AZJ A;  3SUO A;  3P38 A;  4ILH A;  5BRF A;  4B8A B;  3L0Q A;  3ZET A;  3EZ5 A;  2XY7 A;  3ZX0 A;  4DTO A;  1VQ4 N;  4LF7 K;  4M42 A;  4K42 A;  1S9G A;  1KAX A;  1QZ6 A;  2HHQ A;  3DXK B;  2RF2 A;  1X9W A;  1JLF A;  3K57 A;  3AVB A;  4H5T A;  4B9N A;  5KGX A;  1LW2 A;  2HBM A;  4DCH A;  5D3G A;  3AV9 A;  1NKE A;  4XH1 A;  3H1V X;  1NJI O;  5KRS A;  1S6P A;  4DF8 A;  4ZTJ A;  2PFU A;  3KLF A;  3HI0 A;  4CBW A;  3SK3 A;  3R9P A;  1OVY A;  4O4G A;  1N33 K;  4GW6 A;  4IG3 A;  4BRQ A;  5BR8 K;  3I8B A;  1BHL A;  3VN5 A;  1WUA A;  2RPI A;  4HUF A;  2F9W A;  2Y1I A;  3K9J A;  3OYH A;  4C1N I;  3ZSR A;  4E7L A;  3O3G A;  1RTJ A;  4BC3 A;  4LH5 A;  1EO1 A;  5BRD A;  3RMB A;  3I0S A;  1QS4 A;  4I7F A;  1M1K O;  4OVL A;  4CZH A;  3I0R A;  4ISF A;  3C95 A;  4B9L A;  2B5J A;  3TSU A;  3HM9 A;  1WOQ A;  5LMU K;  4FLU A;  4NLC A;  2BTF A;  4BRI A;  4O8K A;  4O8U A;  5AQZ A;  4QOZ B;  4BR9 A;  3GBT A;  1HYZ A;  4KHW A;  3QFU A;  4B1Y B;  4GVE A;  1HJR A;  1RBS A;  1D9F A;  3SAG A;  4BC4 A;  3O5B A;  4FO0 A;  4B9V A;  3KTQ A;  3OYB A;  3CCL N;  4E7H A;  3LDN A;  1GOB A;  4CEQ A;  3MXJ A;  4CJQ A;  3HJF A;  2ZWH A;  3VF2 A;  1ATS A;  3SAF A;  2IVP A;  2KQ2 A;  4V19 S;  3LL3 A;  3VQB A;  4W5R A;  2QWL A;  1NK8 A;  5AR0 A;  1NK4 A;  1P90 A;  3IDH A;  5HOO A;  2YHX A;  4J2A A;  4HCC A;  2FSK A;  1VK0 A;  4WFB L;  4YOV A;  1IJJ A;  1LOT B;  2A41 A;  2E2N A;  3P39 A;  3MEC A;  4WCE L;  3VTH A;  3H6E A;  1JLB A;  1QQC A;  2CGK A;  2HHU A;  1NK0 A;  1HR0 K;  2PAV A;  1KAZ A;  1TUU A;  3O6W A;  5AJ3 K;  5DMR A;  4B3R K;  3VEY A;  3ZSO A;  4G1Q A;  3AAP A;  2BUP A;  3F9M A;  1NGI A;  5E84 A;  2HOE A;  5KQD A;  4CBU A;  3H3N O;  4I2P A;  3PO5 A;  5GAH P;  4BDZ A;  3H1Q A;  4RW8 A;  4FK4 A;  4FWP A;  4LSN A;  4CK3 A;  3RMA A;  1ITG A;  3BZK A;  5HRP A;  4FWS A;  1RGI A;  2HMI A;  3LPT A;  3DJC A;  2NRX A;  4BQL A;  3EYZ A;  4DWI A;  2XY8 A;  3QBW A;  1ZBI A;  3V9W A;  3T1Y K;  4M3U A;  1Q7Y O;  1KCF A;  3UKU A;  3W3D A;  1QSY A;  5BPN A;  4DUZ K;  4ISE A;  1IKW A;  3VES A;  4BRF A;  4CGF A;  2YJE A;  4JS4 A;  4BE2 A;  1JKH A;  3V1O A;  2IVN A;  1RT2 A;  4JS5 A;  2Q2R A;  4BRG A;  4W5O A;  1XHX A;  3QLH A;  2A6A A;  1CXU A;  4KRF A;  4I2Q A;  3QDK A;  1SKW A;  1RDC A;  1VSE A;  1RDB A;  2E6L A;  3SUP A;  4DS5 A;  3OA9 A;  3CQX A;  3U3Y A;  1BCM A;  3O3F A;  4DSI A;  3MAQ A;  4FJ9 A;  3SBT A;  3CI5 A;  4Z4G A;  1HKG A;  2HST A;  2FBX A;  4F2S A;  2A3Z A;  4IOC L;  2E4L A;  4FJH A;  3O3H A;  3F5T A;  2G8I A;  2QK9 A; 
#chains in the Genus database with same CATH homology
 5KI6 A;  1T8E A;  4FJG A;  2IAJ A;  5E41 A;  4KTQ A;  1JLG A;  4CHN A;  3KJV A;  3E01 A;  2KW4 A;  1VRT A;  3KKR A;  5J2Q A;  1WAJ A;  3NFA A;  1KRP A;  3AVK A;  3MEG A;  4PUO A;  4OLA A;  4EZ9 A;  3ITH A;  1WSF A;  1HRH A;  3OYE A;  3M8P A;  4WE1 A;  4HCB A;  1F21 A;  3OYN A;  1C6V A;  4E7I A;  1NK6 A;  4KHU A;  4ZTF A;  3L2U A;  3WNE A;  3OYK A;  3AVL A;  3DRP A;  4CEO A;  4FJX A;  3V9Z A;  2VWJ A;  1QHT A;  4NCB A;  2QXF A;  3DRR A;  3KD5 E;  2LSN A;  3B6O A;  1L3U A;  1BIS A;  3PX4 A;  4CCH A;  4AHU A;  3WNF A;  4E1M A;  2OZM A;  3VQ9 A;  4QCL A;  4NYN A;  3HP9 A;  4DU3 A;  4N56 A;  1X9M A;  2Q3S A;  5J2P A;  4BWM A;  4E89 A;  3NF8 A;  1EXQ A;  3AO4 A;  3OYA A;  3D0P A;  1TAQ A;  4CIF A;  3OJU A;  3PO4 A;  4M45 A;  5HLF A;  3LP3 A;  3LP2 A;  2O4I A;  4N76 A;  3QNO A;  1S9E A;  4K8X A;  1KLM A;  3L2W A;  4DSK A;  4FLX A;  4FLT A;  3VQP A;  1KVC A;  1QSL A;  3AA4 A;  1T05 A;  3KLG A;  1RBT A;  1BGX T;  2IDO A;  4C8K A;  3HVT A;  2KFN A;  4MFB A;  5FRO A;  3K5O A;  4OKJ A;  4DG1 A;  4N5S A;  1VSK A;  4E3S A;  3ZCM A;  3TAQ A;  1ZBH A;  2HHV A;  4RW4 A;  1K6Y A;  1RT5 A;  2VG6 A;  3SQ0 A;  3QET A;  1HYS A;  1I39 A;  3HO1 A;  1UA0 A;  2A1S A;  3AVH A;  3CQ8 A;  3C94 A;  2ETJ A;  4ZHR A;  3VA3 A;  4CHP A;  3ISN C;  1WSE A;  2G8I A;  1RT7 A;  4EP4 A;  4CIE A;  4B08 A;  2HNZ A;  4DTX A;  4LSL A;  4B8C A;  3NDK A;  2HW3 A;  2P5G A;  3AA2 A;  1MU2 A;  1ASU A;  3NE6 A;  3S3N A;  1S1V A;  1LAV A;  4NCA A;  1L5U A;  3M8R A;  3TWH A;  2YNF A;  1ASV A;  2KTQ A;  3L3V A;  4CFB A;  4YFU A;  3THV A;  1WSJ A;  1Y97 A;  1SL2 A;  4DMN A;  1TKD A;  3RR8 A;  4M3Z A;  4CJ4 A;  3KKS A;  4FLV A;  3TAR A;  1SKS A;  4CHY A;  2YNH A;  4CJL A;  1S1U A;  3ZSW A;  2OPP A;  3OS1 A;  3QES A;  4W5T A;  3NGI A;  1RTH A;  1UWB A;  3HP6 A;  4DLG A;  3DLR A;  4CK1 A;  4CF9 A;  4BE1 A;  1GOC A;  1NK9 A;  1S5J A;  4CJP A;  3VQD A;  4CJW A;  2XY5 A;  3RTV A;  3T3F A;  3L2R A;  1TKX A;  4FJL A;  1HMV A;  1IKY A;  4CGD A;  3CFR A;  2G8U A;  3TAM A;  2AJQ A;  3IRX A;  3V4I A;  1YTU A;  3TR8 A;  3CG7 A;  5HBM A;  3BGR A;  4CEA A;  4E7K A;  3RMC A;  1A5V A;  1HQU A;  3SNN A;  1CXQ A;  2ITG A;  1L3V A;  4B9U A;  4Z4H A;  3SZ2 A;  3V9U A;  3U3G A;  1KVA A;  3V9S A;  2KZM A;  1CLQ A;  1HQE A;  5HRS A;  2IC3 A;  3OYM A;  3P83 D;  1YT3 A;  3NGZ A;  3IAY A;  5J2N A;  3TAN A;  3PY8 A;  3MED A;  3RRG A;  2EX3 A;  4IFV A;  4DFM A;  1D9D A;  3G0Z A;  5J1E A;  4FLY A;  5CYM A;  4CFC A;  4E7J A;  2WOM A;  3OYJ A;  3K59 A;  1NKB A;  4FLZ A;  2XRI A;  4AIL C;  4KI4 A;  3ASM A;  1JLQ A;  3AA3 A;  1G15 A;  3NCI A;  1WLJ A;  5KTQ A;  5HRO A;  1JL1 A;  2DFE A;  2HB5 A;  1DLO A;  2YNG A;  2P51 A;  1BI4 A;  4KTW A;  4AHS A;  3K5M A;  4DSE A;  3TAB A;  1SL1 A;  1U45 A;  1KSP A;  3RWU A;  1VRU A;  2PYL A;  2YHB A;  3CFO A;  4BWJ A;  1WSH A;  4FJ5 A;  4FK2 A;  4ELT A;  2ATQ A;  1NJY A;  4L8R B;  1VSI A;  4DSF A;  1JLC A;  1S1W A;  4FLW A;  3DYA A;  1GOA A;  4YNQ A;  3ZSX A;  4HTU A;  3T19 A;  1Q9Y A;  4CJE A;  3WNG A;  2DY4 A;  3ZT2 A;  2HHS A;  1TK5 A;  3MXI A;  1JLE A;  3S9H A;  1ZBF A;  3VQ8 A;  1SL0 A;  2DTU A;  2IGI A;  3G10 A;  1CZB A;  1RCH A;  2OZS A;  3QIO A;  1NK5 A;  3MXM A;  3L8B A;  3OVN A;  4ID5 A;  4AHC A;  2FBY A;  3D45 A;  4W5N A;  1TVR A;  5T7B A;  1ZBU A;  1B9F A;  3VA0 A;  5HRR A;  1FKO A;  4DSJ A;  4OLB A;  4FXD A;  3RR7 A;  3RRH A;  3QEV A;  1REV A;  3TAE A;  2ZD1 A;  1UOC A;  2Z1J A;  1N6Q A;  4DTR A;  2HHW A;  3KLI A;  1FKP A;  4CJK A;  2X6S A;  4F2R A;  4C8N A;  2X74 A;  1A5X A;  5FDL A;  3VQQ A;  4DTJ A;  3A2F A;  4CE9 A;  4CER A;  3DM2 A;  3SV4 A;  2FBV A;  4B9M A;  1LW0 A;  1JL2 A;  1SUQ A;  4F3T A;  2KFZ A;  1JLA A;  4CJU A;  2X78 A;  3V9X A;  4KAZ A;  3AVG A;  2GBZ A;  2RN2 A;  3HYF A;  1BQM A;  5DK5 A;  3CM6 A;  4FCY A;  3BDP A;  3ZSQ A;  1BL3 A;  2OPR A;  4I9Q A;  1UA1 A;  4OGE A;  1C1B A;  2Z1I A;  1XWL A;  4RG8 A;  2OYQ A;  4DQP A;  1JXB A;  3TI0 A;  4PQU A;  4CF8 A;  2OA8 A;  3HPO A;  4DTN A;  5C24 A;  4PY5 A;  5CZ2 A;  3DOL A;  1EX4 A;  4UQG A;  4Q5V A;  4FZY A;  3K5L A;  1CZ9 A;  2GV9 A;  4KTZ A;  3VQC A;  3S3O A;  1NJZ A;  2XY6 A;  1TK8 A;  1VSM A;  3LAL A;  5CZ1 A;  3PX0 A;  1DTQ A;  4OPK A;  4KHS A;  3OYD A;  3NF9 A;  1RDA A;  2Z1H A;  4XIU A;  3NGY A;  4M3W A;  4DQR A;  5CY4 A;  1XHZ A;  3KD1 E;  1LAW A;  4DU1 A;  3ULD A;  3DOK A;  1QE1 A;  4FW2 A;  3LWL A;  3P5J A;  3IS9 A;  1J9A A;  3O4N A;  2XO7 A;  1RT4 A;  3EY1 A;  1B9D A;  2QKK A;  1SV5 A;  2G8V A;  3M8S A;  1BIZ A;  4K8Z A;  4H4O A;  4AHT A;  2YKN A;  3SQ4 A;  4CGI A;  4CGH A;  3AO1 A;  1U4B A;  1NJW A;  4NCG A;  3B6P A;  4O44 A;  3KIO A;  4IFY A;  1LV5 A;  5SZT A;  3TAF A;  1VSL A;  4IDK A;  3V1R A;  1RT1 A;  4NYF A;  4CJ3 A;  3AVM A;  4DTM A;  3QO9 A;  4CEC A;  1W0H A;  4CF0 A;  3DRS A;  4H4M A;  1LWC A;  3KK2 A;  4FJI A;  1NOZ A;  4AHV A;  4HUG A;  3QIN A;  4B3O A;  2HNY A;  2D0A A;  3O4Q A;  3ZT3 A;  1RBU A;  3OY9 A;  2Z1G A;  1ZYQ A;  4C8O A;  1S1T A;  1IH7 A;  3ZT1 A;  4BE0 A;  4PWD A;  3QIP A;  1NKC A;  1I3A A;  4O55 A;  3QER A;  3DLE A;  3VQ5 A;  3LP0 A;  1BCO A;  2JGU A;  1IKV A;  4OJR A;  4HHT A;  3SUO A;  4CFA A;  1WAF A;  1W9H A;  4KV8 A;  2ZE2 A;  4B8A B;  4FJ7 A;  1WSI A;  4DFJ A;  4HVJ A;  3EZ5 A;  3KK3 A;  2XY7 A;  4DTS A;  4DQQ A;  1RDD A;  4DTO A;  3OYC A;  1FXX A;  5FRM A;  2YHA A;  4LD0 A;  4N41 A;  4M42 A;  1S9G A;  4CFD A;  3HPH A;  2A1R A;  2G8K A;  5HP1 A;  2RKI A;  3QEX A;  2HHQ A;  3SYZ A;  2XHB A;  1Q8I A;  2RF2 A;  3DLG A;  1X9W A;  1JLF A;  3K57 A;  1YVU A;  3AVB A;  4BDY A;  4DQS A;  1NJX A;  4JRQ A;  4B9N A;  5KGX A;  4FJK A;  3JYT A;  3RMD A;  1LW2 A;  2OPS A;  1HNV A;  1FK9 A;  4R5P A;  4RW9 A;  4M3T A;  5D3G A;  4Z4C A;  1C0U A;  1B92 A;  3AV9 A;  1NKE A;  4ICL A;  4AH9 A;  4J2E A;  1J5O A;  2D0C A;  3AA5 X;  5KRT A;  2YKM A;  2D0B A;  5KRS A;  4CJT A;  1S6P A;  3AVC A;  4DF8 A;  3K5N A;  1TAU A;  4ZTJ A;  1VSD A;  3ZT4 A;  3KLF A;  3H08 A;  4KFB A;  4O4G A;  4AHR A;  3NBP A;  4GW6 A;  4IG3 A;  4OGC A;  3HPG A;  1KFD A;  3LAK A;  3DLK A;  4IBN A;  3K58 A;  2VWK A;  3VN5 A;  1BHL A;  2RPI A;  4HUF A;  4FJJ A;  4Z4I A;  3PV8 A;  2Y1I A;  2R7Y A;  3SQ2 A;  3OYH A;  3AVA A;  2ZQB A;  2PYJ A;  1KTQ A;  3CM5 A;  3ZSR A;  4CJ5 A;  4E7L A;  1XI1 A;  1IKX A;  4KPY A;  2BDP A;  4FK0 A;  3WNH A;  4I9L A;  4CGJ A;  1RTJ A;  3O3G A;  2F96 A;  3F73 A;  1ZBL A;  2EHG A;  4KI6 A;  4LH5 A;  3QNN A;  5JS2 A;  4J2D A;  4RW6 A;  4FZZ A;  1SKR A;  3RMB A;  3I0S A;  4DSL A;  1QS4 A;  4CEF A;  2YNI A;  4CES A;  4I7F A;  4DTP A;  3V81 A;  3SQ1 A;  4OVL A;  3I0R A;  3C95 A;  3VQE A;  4M3X A;  3NF6 A;  4B9L A;  2B5J A;  1C1C A;  1RNH A;  3CYM A;  4EP5 A;  4JRP A;  1U49 A;  3HM9 A;  2OPQ A;  1TKZ A;  3V6D A;  4KHN A;  4FLU A;  1O1W A;  1TV6 A;  3PUF A;  4GMJ B;  4LY7 A;  3L2V A;  4Q0B A;  2HHT A;  4CED A;  1Q9X A;  4QOZ B;  4KHY A;  3IG1 A;  1HYZ A;  2P1J A;  3SI6 A;  4CHO A;  4KHW A;  2BAN A;  2HHX A;  3NF7 A;  1HJR A;  1RBS A;  2IS3 A;  1D9F A;  1NK7 A;  1BQN A;  2DFF A;  1KLN A;  4KB0 A;  4F8R A;  1KVB A;  2DFH A;  4B9V A;  4KHQ A;  4ID1 A;  3OYB A;  3FFI A;  4E7H A;  3L2Q A;  1R0A A;  3PX6 A;  3KTQ A;  1GOB A;  3VQ4 A;  3TAG A;  3C6U A;  4CEQ A;  3MXJ A;  4CJQ A;  3HJF A;  3HVR A;  3OJS A;  4CJV A;  4IKF A;  4FJ8 A;  3AVI A;  2BE2 A;  4DTU A;  4H8K A;  4FJM A;  4HUE A;  1D8Y A;  4B9S A;  1L3S A;  2HND A;  1RTI A;  3HXM A;  1ASW A;  1TKT A;  1U04 A;  2KQ2 A;  3AO5 A;  4PA1 A;  5C25 A;  2IOC A;  4M41 A;  3OYI A;  1WN7 A;  4ELV A;  4DFP A;  5K14 A;  3VQB A;  4W5R A;  2X6N A;  1NK8 A;  3LZI A;  4FVM A;  2D5R A;  2B4J A;  3HL8 A;  1NOY A;  3OYG A;  1NK4 A;  4J2A A;  4KB1 A;  3SV3 A;  4CK2 A;  3SCX A;  5I3U A;  4HCC A;  3ZSZ A;  3DMJ A;  1VK0 A;  3LP1 A;  1KFS A;  2PY5 A;  3UIQ A;  3OS2 A;  4CF2 A;  2Y1J A;  1X9S A;  3NHG A;  3LWM A;  4DFK A;  1S6Q A;  3MEC A;  1S1X A;  4E1N A;  4CJR A;  4RW7 A;  1T7P A;  1EP4 A;  3NH0 A;  1RT6 A;  3ZT0 A;  4Z4F A;  2BGG A;  4FYD A;  1JLB A;  1QQC A;  3HT3 A;  4Z0U A;  3LDS A;  4ELU A;  2HHU A;  1A5W A;  4CEE A;  4CHZ A;  3QEP A;  4IG0 A;  1NK0 A;  3DLH A;  3SUN A;  1TGO A;  4KO0 A;  2JLE A;  5DMR A;  4C8M A;  3DI6 A;  3NAE A;  2HVH A;  1C1A A;  3ZSO A;  1HPZ A;  3VQA A;  4G1Q A;  1TL1 A;  1WNS A;  3M8Q A;  4B9T A;  3F9K A;  1TL3 A;  4CEB A;  3LPU A;  1QSS A;  1J54 A;  3AVF A;  3KK1 A;  4FW1 A;  4Y1C A;  3AVJ A;  3NH2 A;  3U6F A;  3VQ6 A;  3HST B;  1HYV A;  2VG7 A;  3K2P A;  1VSF A;  1DTT A;  3LAM A;  4C8L A;  1EET A;  4BAC A;  4I2P A;  2G8F A;  3PO5 A;  2FBT A;  4CHQ A;  1RIL A;  3KLE A;  4DLE A;  2I5J A;  3VQ7 A;  4BDP A;  1T03 A;  4BDZ A;  4KRE A;  4FJN A;  1QTM A;  1IO2 A;  3MEE A;  4RW8 A;  3L3U A;  3HK2 A;  4Z4E A;  4LH4 A;  4N47 A;  2P5O A;  2G8W A;  4FK4 A;  2HVI A;  1RBV A;  5FRN A;  4LSN A;  1TK0 A;  4CK3 A;  1BIU A;  3RMA A;  1U47 A;  1ITG A;  1Z26 A;  5HRP A;  2HMI A;  3LPT A;  2B6A A;  4OKK A;  2YV0 X;  3QEI A;  3JSM A;  4O0J A;  4O5B A;  4M3R A;  2W42 A;  3EYZ A;  4FM0 A;  4CJF A;  3S3M A;  2XY8 A;  4DWI A;  1D5A A;  5C42 A;  4J2B A;  2QKB A;  1ZBI A;  3QEW A;  3OS0 A;  1C0T A;  3LZJ A;  2F8S A;  1YTA A;  3V9W A;  4M3U A;  2GUI A;  3DLB A;  1U48 A;  2G8H A;  4EZ6 A;  4MQ3 A;  1KCF A;  3ALY A;  5J2M A;  1QSY A;  5SWM A;  4F3O A;  1IKW A;  1BI4 B;  2E6M A;  3SPZ A;  3AVN A;  4GVM A;  5JS1 A;  1VSH A;  1UAX A;  1Z25 A;  1LWE A;  1X1P A;  4CGF A;  5HRN A;  4DQI A;  4KKO A;  4JS4 A;  1EKE A;  4Y1D A;  4BE2 A;  5EU7 A;  1J53 A;  1JKH A;  3V1O A;  1RT2 A;  3KLH A;  4JLH A;  1C0M A;  4JS5 A;  4OPJ A;  5I42 A;  1HNI A;  1LWF A;  4QAG A;  4W5O A;  1XHX A;  2PZS A;  4DF4 A;  3P1G A;  3QLH A;  4E0D A;  1CXU A;  4FM2 A;  2VG5 A;  4KRF A;  4CEZ A;  1IG9 A;  4M3Y A;  4I2Q A;  1SKW A;  2NUB A;  4O0I A;  1L3T A;  1RDC A;  4F4K A;  1VSE A;  3C6T A;  2FC0 A;  4E19 A;  1RDB A;  1JXE A;  2E6L A;  4TSX A;  3I8D A;  3SUP A;  3OYF A;  4FM1 A;  4DS5 A;  4FZX C;  5KGW A;  2O4G A;  2F8T A;  4DU4 A;  4CIG A;  4W5Q A;  3V1Q A;  3ZSV A;  1BCM A;  3CFP A;  4OKE A;  3O3F A;  3ZSY A;  3U3Y A;  4DSI A;  3SUQ A;  3AO3 A;  3T1A A;  3MAQ A;  3AO2 A;  4FJ9 A;  1N5Y A;  1RBR A;  1WSG A;  2WON A;  5CYQ A;  4CF1 A;  4CJS A;  1XC9 A;  2FBX A;  1RTD A;  4DS4 A;  4F2S A;  4Z4G A;  3OYL A;  2E4L A;  3TAP A;  4FJH A;  4CGG A;  3O3H A;  2KZZ A;  3SPY A;  1VSJ A;  3NH1 A;  3LAN A;  3SJJ A;  1RT3 A;  2QK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...