4CK1A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
molecule keywords INTEGRASE
molecule tags Transferase
source organism Human immunodeficiency virus 1
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ck1A00
3AA4A 4HVJA 3QNNA 3V6DA 1DLOA 1EETA 3U3GA 1NJWA 3V9SA 1ZBLA 2QK9A 4DS5A 1LWCA 3AVAA 3VQ8A 4EZ6A 3SI6A 2QKKA 4KHQA 2PZSA 3K5OA 2HHXA 1I39A 3DLEA 3VA3A 3RWUA 3OYFA 1JLGA 4BDZA 1SL2A 3S3NA 1A5WA 1SUQA 4CHPA 2XY6A 4DSFA 2YKNA 3QETA 3ZSRA 3QEXA 4OLAA 2FBTA 4UQGA 1WSGA 4IKFA 3KLIA 1NK6A 3C6TA 3QERA 3S3OA 4M3UA 4QOZB 2HHTA 1FK9A 3O3GA 3VQ7A 3DOLA 4AHVA 3OJUA 2HMIA 2KFZA 4WE1A 4AH9A 2HHQA 3ASMA 1XWLA 2W42A 2HHUA 4KREA 4E3SA 3SQ4A 3SPZA 1B92A 5KRSA 3NGZA 4J2BA 3AVIA 2RN2A 3LAMA 1S1TA 3HXMA 3K59A 1RDBA 5HBMA 5J2NA 4CJWA 4ZHRA 3ZT2A 2X6NA 3OY9A 3OJSA 3EYZA 4DU4A 3TAPA 3TANA 1HJRA 3HL8A 1L3SA 1REVA 3TAEA 4OGEA 1Y97A 4CK3A 1S6PA 4IDKA 3KK3A 3ZSOA 4B9SA 4DU3A 1HYVA 3OVNA 1QSLA 2DFEA 3ZSYA 2WOMA 4IFYA 3TAQA 4CGFA 2YHAA 5CZ2A 4CJ4A 1QTMA 2P5GA 3U6FA 1X9WA 4KFBA 1BI4B 4OVLA 1DTQA 3PX0A 1JLAA 4CFAA 3KLGA 3ITHA 1RTIA 3SCXA 4I2QA 4ELTA 1Z26A 2YHBA 1X1PA 1TAQA 3QO9A 3MAQA 3TAFA 3HSTB 1TGOA 2WONA 2G8VA 1VSIA 1NJXA 3PV8A 4KV8A 3SV3A 4CJSA 1GOAA 3LAKA 4N47A 1QSYA 1SV5A 3HT3A 3KKRA 3NF9A 3ZT0A 1B9DA 4CEAA 3K58A 2PYLA 4FYDA 2DY4A 4YFUA 1O1WA 3V9XA 2DFFA 4DF4A 2HHVA 4O4GA 1WSJA 4O0IA 1KCFA 3KD5E 1QS4A 3HP6A 1S6QA 1HYZA 3DLHA 4DQQA 1VSHA 2F8TA 3OYKA 5HP1A 4GW6A 1VK0A 3IS9A 3OYDA 3SV4A 1S9GA 1IKXA 3KKSA 3CFOA 1U49A 4I7FA 1KLNA 4E1NA 2RKIA 1YTUA 4M41A 4O44A 4CGJA 4BACA 2IDOA 4KHUA 5CY4A 4O0JA 1WAFA 1HMVA 4DLEA 2XRIA 3VQDA 3AA5X 3PUFA 1NK7A 4E19A 4OJRA 4CIEA 4FW1A 1JLQA 2BANA 3OYIA 1NK5A 1KVBA 3OYEA 2HNYA 1KLMA 1RTHA 3AVJA 3NGYA 4W5NA 1R0AA 4FLXA 1X9MA 1WSFA 2BE2A 3HPOA 3K5LA 3IRXA 1EXQA 1VRUA 1U45A 3KLFA 3TABA 4B9LA 1JXEA 4FJJA 4CGGA 4KB0A 3C6UA 3M8SA 2ZD1A 4CECA 3VQEA 4IG3A 3OS2A 3ZCMA 3ULDA 2XY5A 1TAUA 3ZSWA 4AHTA 3VQBA 3U3YA 1BIZA 1UA0A 4C8OA 4DSLA 4CGDA 1HYSA 3OYLA 4JS4A 1EP4A 1NJZA 5HROA 4CJRA 4FM1A 2I5JA 4Z4HA 3HPGA 2BDPA 3D45A 4IFVA 3VQ5A 4HTUA 1ASUA 4DTRA 4FJLA 1BCOA 1HQUA 4K8XA 3I0SA 4CK2A 1NOZA 4CIGA 3QNOA 3AV9A 4AHCA 2XO7A 4IBNA 1HRHA 4EP5A 3TWHA 2OA8A 3VQ4A 4BWJA 1LW2A 3RTVA 1RTDA 4KAZA 3B6OA 1T7PA 3SJJA 1Q9XA 2JLEA 2G8KA 4N41A 2GUIA 4Z4GA 1S9EA 3CM5A 3T19A 4DFJA 3LP3A 1N5YA 3NGIA 3QIOA 3CYMA 4CF9A 4F3OA 1NK4A 3AVMA 3OYNA 3NF7A 4PWDA 4PA1A 3ALYA 2P51A 1TL1A 2ITGA 1C1CA 4W5RA 3PX6A 3VN5A 1T05A 3PO5A 1BISA 5FDLA 3AO2A 1D9FA 4KKOA 1LV5A 3OS0A 4PY5A 4F2SA 4CF2A 3HM9A 1D8YA 1WNSA 4ICLA 3NE6A 4FLVA 1ZBIA 2YNGA 2IC3A 4FJ7A 3AVHA 2A1SA 1CXQA 1RT6A 3I8DA 4LH5A 2VWKA 4G1QA 3F9KA 3G10A 3VQQA 4BE1A 3RMAA 3AVGA 3RR8A 4OKEA 4DQPA 4FLZA 1BQNA 1SL0A 4DTXA 4N56A 1IKWA 2Z1IA 3V1RA 1XC9A 3MXMA 3NH2A 1LWEA 2AJQA 2HNZA 4O5BA 3HVRA 4C8LA 2E6LA 4DTPA 2O4IA 1CXUA 3A2FA 4MFBA 4Z4CA 3SUOA 3WNHA 1VSMA 4AILC 4E89A 1Q8IA 5J1EA 1C0UA 3SUNA 4R5PA 4CJTA 1TVRA 2IAJA 3SZ2A 4NCBA 3K5MA 4B8CA 3SQ2A 3AO5A 4E1MA 4DSJA 4DLGA 3K5NA 4W5QA 4Z4IA 1YVUA 2NUBA 2KZZA 2EX3A 4RW8A 3VQAA 1XI1A 1TV6A 3SQ0A 1VSLA 3QEWA 3RR7A 4FK2A 3DLBA 4AHUA 2HNDA 4FJIA 3LPTA 4MQ3A 1HNVA 4CJPA 3AO4A 4NYNA 4HUEA 4C8KA 3TAMA 4HCCA 2YKMA 1T03A 4FVMA 2YV0X 2ATQA 4IG0A 1VSDA 4KTQA 1XHZA 1C1BA 3NF8A 4H8KA 3DRRA 4Q0BA 3ZSXA 4J2DA 4CJFA 4KHNA 1RBVA 5I42A 4RW9A 1TK0A 4ELUA 3CFRA 1K6YA 2OPQA 5T7BA 4JS5A 5D3GA 3LALA 2B6AA 3AVBA 3LP2A 3ISNC 3L3UA 1BIUA 1S5JA 2HB5A 3VQ9A 4FJXA 4FM2A 1NKEA 1U48A 2FC0A 3L8BA 2X78A 4DTUA 1RILA 3DM2A 4DFMA 4CEFA 4DWIA 2E4LA 3SPYA 1RT5A 3G0ZA 1IH7A 1QSSA 4QCLA 1BGXT 4NYFA 3LP0A 2LSNA 4N5SA 2OZMA 3P1GA 4AHSA 4HUGA 4M3TA 3CM6A 3IAYA 1RDDA 1S1WA 4H4MA 2OZSA 2ZE2A 1W9HA 2RPIA 4W5TA 2VWJA 1WSIA 1A5XA 4FCYA 3NH1A 1D9DA 3LANA 1RTJA 3F73A 5HRSA 3PO4A 1WAJA 4QAGA 3T3FA 1QQCA 1KVCA 1SL1A 2P5OA 5JS2A 4M3YA 1L3TA 3LZIA 2KQ2A 2GV9A 4FLTA 2D0BA 2VG7A 4CJ5A 4NCAA 3HK2A 4AHRA 4FJ9A 1RCHA 2F96A 5K14A 4CE9A 3ZSVA 2XY8A 4FLWA 3RRHA 1BHLA 1A5VA 3QLHA 4GVMA 4DF8A 1C1AA 4CJKA 3IG1A 4B9UA 5C24A 1GOBA 2Z1JA 3FFIA 5CYMA 3O3HA 3HJFA 4B8AB 3NDKA 2DTUA 1KVAA 1SKRA 2QXFA 4CFDA 1N6QA 2OPRA 1C0MA 4CFBA 5KRTA 4BDYA 1VSFA 4CFCA 4KPYA 3MECA 2HHWA 1S1XA 4KTWA 4FZZA 3RRGA 4DSEA 3AO1A 4DFPA 4DTMA 3QEIA 3THVA 1C6VA 1CZ9A 1ZBUA 3K57A 4I9QA 4KRFA 1J9AA 3TR8A 5HRNA 4DTSA 1TKTA 4M42A 3P83D 3HVTA 3QESA 4CGHA 4DS4A 2ZQBA 3BDPA 4DTJA 4KB1A 1NJYA 4Z4EA 3ZT4A 4BE0A 3V4IA 1GOCA 3SNNA 4B9MA 4E0DA 1CLQA 3C94A 1JLCA 1NKCA 1B9FA 3SQ1A 2KW4A 3TI0A 2OYQA 4ID1A 1EKEA 3M8PA 3KIOA 1BL3A 4CJUA 1NKBA 3QINA 4Q5VA 1RBRA 4FK0A 4N76A 1RBTA 1L5UA 2IOCA 4C8NA 4CEDA 3LWLA 1WSEA 1C0TA 4M3XA 3DLGA 3V81A 1UWBA 4DQRA 5HRRA 4H4OA 4F3TA 4OKKA 3NH0A 4B3OA 1UAXA 3DRSA 3LDSA 4DG1A 1I3AA 2A1RA 3K2PA 4CESA 1WN7A 4LD0A 3M8QA 4GMJB 5EU7A 4CERA 3OYCA 4L8RB 4RG8A 4Z0UA 2G8IA 3NHGA 3HPHA 4JLHA 3WNGA 3AVKA 2Y1JA 2QKBA 4BWMA 5CZ1A 4M45A 3AA3A 4DTNA 2YNHA 3V9ZA 4DSIA 3C95A 1RT4A 1D5AA 5E41A 4DQSA 3SUQA 5KTQA 4BDPA 4CJVA 1X9SA 4FK4A 2HVIA 1J53A 3MXIA 2Z1HA 4YNQA 2DFHA 4CEEA 3SYZA 1IO2A 2Z1GA 1L3VA 3JYTA 3QEVA 1F21A 3KLHA 4B9VA 4XIUA 1IKVA 2ETJA 3O4NA 2EHGA 3L3VA 4DSKA 1BCMA 3T1AA 1ZBHA 4CEBA 4KHYA 3SUPA 4F2RA 1BQMA 4KI6A 1ITGA 1HNIA 4FW2A 4Y1CA 1Z25A 1QE1A 3LWMA 3LZJA 1JLEA 1HPZA 1S1UA 4LSNA 3L2WA 4BE2A 5JS1A 1J5OA 1JXBA 3BGRA 3P5JA 4CCHA 4C8MA 1QHTA 1S1VA 2O4GA 3KJVA 1SKWA 4FXDA 2FBVA 4FJGA 1KFDA 1TKZA 1HQEA 2D0AA 1WLJA 3EZ5A 4KTZA 3KLEA 4FM0A 1KFSA 1Q9YA 1TK5A 1NK0A 5HRPA 1IKYA 3V1QA 1RDCA 4KHSA 4PQUA 2YNFA 1JKHA 1VSKA 1T8EA 4CJLA 3OS1A 2PY5A 3PX4A 4ZTFA 3KTQA 4KHWA 1XHXA 4F8RA 2YNIA 3O4QA 3VA0A 2OPPA 4CF1A 1RBSA 1JL1A 4DU1A 3RMCA 4ZTJA 4M3ZA 1LAWA 3TARA 4B9TA 4FJHA 3QIPA 4E7JA 2G8UA 5FRMA 1RT7A 3DOKA 1ASWA 3MEEA 3DLRA 3RMDA 1U47A 4EZ9A 3V9UA 4E7LA 2F8SA 3L2RA 2HVHA 2R7YA 3VQCA 4KI4A 3DMJA 2XY7A 2FBYA 1FKOA 1VSEA 3DI6A 5C42A 4CHYA 3CG7A 4FJ8A 4LY7A 3NAEA 4W5OA 2IS3A 3OYMA 4OPJA 2D0CA 4FZYA 1YTAA 5FRNA 3DLKA 3DYAA 4LH4A 1RNHA 3OYBA 3L2VA 1FKPA 4CGIA 2P1JA 5J2QA 1ZYQA 4RW7A 4FZXC 1JLFA 1U04A 1TKDA 4FJNA 5KI6A 4NCGA 3VQ6A 1CZBA 4M3WA 5HLFA 4CEOA 3O3FA 1KTQA 3AVNA 4CHNA 3UIQA 3PY8A 1RT3A 4HCBA 1RT2A 5SZTA 1W0HA 4ELVA 3EY1A 1ASVA 1RT1A 2X74A 4DMNA 4FLYA 1J54A 3E01A 4EP4A 1NK8A 2KTQA 5C25A 4CF8A 5KGXA 1RBUA 3AVLA 4OGCA 3WNEA 3V1OA 4DFKA 1JLBA 2PYJA 4Z4FA 3KK2A 3L2QA 4ID5A 1U4BA 2E6MA 3OYHA 2FBXA 4PUOA 2X6SA 4CJEA 1LAVA 2HHSA 4RW6A 4FJMA 3AVCA 3NFAA 4E7IA 4CJQA 3S3MA 1VSJA 5FROA 4B9NA 2KZMA 3WNFA 3LP1A 1IG9A 2RF2A 3M8RA 4CHZA 4J2EA 3NCIA 4HUFA 2D5RA 2VG6A 5J2MA 3S9HA 1FXXA 1DTTA 4K8ZA 1RDAA 1WSHA 2B4JA 2OPSA 3ZSZA 4CHOA 4OKJA 4M3RA 4JRQA 4OLBA 1JL2A 2BGGA 4CHQA 1LWFA 3NF6A 1G15A 2VG5A 3HP9A 3CFPA 4CJ3A 3HYFA 5DK5A 5J2PA 2Y1IA 3ZT1A 4DQIA 4F4KA 2G8FA 4FJ5A 3H08A 5I3UA 1UOCA 3OYAA 3VQPA 4CEZA 3B6PA 3CQ8A 1NK9A 1KSPA 4FLUA 4OPKA 1TKXA 1LW0A 1ZBFA 2B5JA 3LPUA 1EX4A 3MEDA 3MXJA 3V9WA 5SWMA 3AA2A 4CIFA 4J2AA 3ZSQA 2Q3SA 1BI4A 3OYJA 2IGIA 4B08A 3TAGA 1SKSA 2HW3A 3KK1A 3L2UA 1KRPA 4CEQA 4O55A 1NOYA 1VRTA 3AVFA 2GBZA 4I9LA 5KGWA 3JSMA 4LSLA 4E7HA 3D0PA 4FJKA 2XHBA 1L3UA 4DTOA 2JGUA 1TL3A 5CYQA 3RMBA 4E7KA 3I0RA 4CK1A 3NBPA 1YT3A 4KO0A 4CF0A 4JRPA 4TSXA 4HHTA 2G8WA 3KD1E 3ZT3A 3OYGA 1UA1A 3AO3A 5DMRA 4RW4A 1MU2A 4I2PA 4Y1DA 3HO1A 2KFNA 3MEGA 2G8HA 3DRPA 1TK8A 3QEPA
chains in the Genus database with same CATH superfamily
3CCRN 3U3GA 1NMDA 1NJWA 2W6LA 3A5MC 3CMEN 1N34K 3EE9A 3VQ8A 4KHQA 2PZSA 3K5OA 3H1QA 1DT9A 3VA3A 3OYFA 2WC9A 5AQZA 1WBBA 1A5WA 5FPMA 2ZWHA 3QETA 3THWB 1QQMA 5DM7L 2FBTA 1WSGA 2Q0UA 4IKFA 2HBLA 1VQLN 1SS6A 4M3UA 4QOZB 1VQNN 1RDWX 1SZ2A 2HMIA 4NO7A 1YHQN 2HHQA 4E3SA 3AVIA 2RN2A 2ZJQL 4JHDB 3IMXA 3K59A 1QTMA 2UUCK 5FPEA 5HBMA 3RR8A 3H3OB 3ZT2A 3EYZA 4DU4A 4H0PA 3CJ1A 3HL8A 1REVA 1OVYA 1TUYA 4IDKA 4ILJA 1HYVA 2WOMA 4BC2A 2YHAA 4BR0A 1YITN 3JS6A 1BI4B 3VENA 2QTDA 3SCXA 4YDUA 1TAQA 3QO9A 3H46O 2G8VA 1NJXA 3PV8A 4KV8A 2YHWA 1QSYA 3HT3A 4PKIA 3K58A 1B9DA 1K8AO 2PYLA 5BRDA 3ZX0A 3Q7CA 2HHVA 4DF4A 5FPNA 3T7ZA 4DR6K 4H0VB 1QS4A 4O8UA 1HYZA 3DLHA 3OYKA 3LDLA 3CXCM 3OYDA 4IOAL 3CFOA 5M1OA 4I7FA 2P9UA 4E1NA 1YTUA 4CGJA 3VERA 4H5RA 4KHUA 3IUCA 3AA5X 1NK7A 4CIEA 4FW1A 1JLQA 1NK5A 1KVBA 5KPTA 3OYEA 3AVJA 3NGYA 3GL1A 1WSFA 4X66K 2Q31A 3HPOA 1U45A 4FJJA 3DXKB 4CGGA 3WQTA 4JI6K 3UKUB 2QW9A 2NRWA 4IEEA 1BIZA 3PIOL 3TSUA 4CGDA 1HYSA 4C1NI 1NJZA 3TTFA 5HROA 4B1ZA 2JWKA 4BGAA 3HPGA 3D45A 3E9LA 3AGRA 1BCOA 3D2EA 4CIGA 3G6EN 4EP5A 4YHHK 4DR5K 2GUIA 1VQPN 3DJCA 1NK4A 1YJNN 5BPNA 2A42A 3ALYA 2P51A 1TL1A 2ITGA 4WFAL 4W5RA 5C10A 1TYQA 3VN5A 4AM7A 3PO5A 3VESA 4B9QA 5FDLA 3R6MA 1LV5A 3OS0A 4F2SA 4ICLA 3P31A 2IC3A 5AQNA 2W41A 3I8DA 1FJGK 4BE1A 1NGFA 1NLVA 4OKEA 3GOIA 5AFUH 1BQNA 1SL0A 4N56A 4H5VA 4IO8A 4H5WA 2AJQA 4O5BA 3HVRA 4C8LA 4DTPA 2O4IA 1CXUA 4MFBA 4Z4CA 3WNHA 4E89A 1Q8IA 4BRAA 1TVRA 4NCBA 1NGDA 3AARA 3K5MA 3CCVN 3AO5A 1S72N 1VQ9N 1BOTO 2KZZA 2EX3A 1HX1A 3SQ0A 4XEIA 3LPTA 1BWFO 1HNVA 4CJPA 3TAMA 4FVMA 4CZFA 4JKEA 3VEYA 2ATQA 1XHZA 4BQLA 2ZGYA 3K9KA 4AF1A 4BRGA 2VQFK 4KHNA 1RBVA 5AQFA 4RW9A 2HSTA 3VEWA 1HLUA 5D3GA 1K6YA 2OPQA 4JS5A 4FWPA 3LALA 3MN6A 3ZX3A 4GNIA 3LP2A 3ISNC 1YXQA 1S5JA 2HB5A 3VQ9A 2QWRA 4KH4A 4DFMA 4U7BA 3SPYA 4QCLA 3LP0A 1U2VA 3J8AA 1S1WA 4CW7B 2ZF5O 3R8EA 2HBMA 1GLDG 4M7XA 1OH8A 1WSIA 4FWMA 3LANA 2D4WA 5HRSA 1WAJA 4MO5A 1QZ5A 1SL1A 5AQTA 1L3TA 2GV9A 3VTHA 2VG7A 4NCAA 4CJ5A 3HK2A 4FLWA 3KD5E 1NGBA 3RRHA 1C1AA 3IG1A 3MK6A 1N32K 2GX9A 4MLEA 3QMLA 3NDKA 4NXNK 1SKRA 1HPMA 1NM1A 3MECA 1S1XA 4FZZA 3RRGA 4DSEA 3QEIA 4DTMA 4I9QA 3TR8A 2PFUA 4M42A 1KAYA 4CGHA 2YJEA 3F2KA 4DS4A 1YVNA 1NJYA 2P9NA 3EL2A 4DKWA 1Q18A 5EOYA 5C2FA 1NWKA 1NMNA 2OYQA 2E8AA 3QFUA 2VQEK 3M8PA 4QS7A 4WF9L 3QINA 4Q5VA 4A62A 1RBTA 2A3ZA 1L5UA 2ASPA 1HNZK 3DLGA 3V81A 4DQRA 1UAXA 3LDSA 3O9UA 2P9PA 5JVGL 4CERA 3E9PA 4Z0UA 1RDUA 4H0OA 4JLHA 2QKBA 1Q82O 4BG8A 4BWMA 4DTNA 4JD2B 4DQSA 3ATUA 4RCHA 1T3VA 3VEVA 2Z1HA 2DFHA 5EY4A 2IVNA 3OA9A 4CI6A 3I33A 3OBYA 5LL6Z 4A57A 4M7YA 5ADXA 2EHGA 3L3VA 5JS1A 3WXMB 1J5OA 1Y64A 3P5JA 4FXDA 1QHTA 1SKWA 3ZEUA 2FBVA 1QHAA 3ENHA 4JI0K 3ZETB 4B1VA 1Q9YA 2DPNA 1NU0A 3V1QA 4PQUA 1JKHA 4H0XB 4I6MA 5AR0A 3PX4A 4ZTFA 3KTQA 4NLBA 2YNIA 3NVMA 2P9NB 4UY8O 2VGNA 3RMCA 4M3ZA 5AQUA 2QM1A 3CJAA 3BEXA 4YOXA 3BZKA 1RT7A 3CIPA 1ASWA 3L4IA 1HKBA 1XUPO 3DLRA 3AAQA 3V9UA 4E7LA 3KVGA 2O8BA 2R7YA 2P9PB 1GLEG 2XY7A 2UXCK 3DI6A 4FJ8A 4LY7A 1X9JA 3NAEA 3MCAB 4OPJA 1YTAA 2HHWA 3DLKA 3L2VA 1FKPA 2P1JA 3FE1A 1U04A 1TKDA 1VQ7N 3ATVA 4FJNA 3VQ6A 1EO1A 5EX5A 3J80O 2ITMA 4CHNA 5SZTA 3H1VX 4OPHA 4DMNA 3A0IX 2KTQA 5C25A 3ID6A 3AVLA 2I7PA 1JLBA 4DV5K 3ZEUB 3KK2A 4OO1J 1U4BA 3AGKA 2BTFA 5BN9A 4CJEA 1LAVA 2KKZA 4FJMA 3AVCA 4I6MB 2E20A 2KZMA 1WUAA 3LP1A 1IG9A 1VAZA 2RF2A 5KPRA 4CHZA 3M8RA 3NCIA 4J2EA 5AZIA 2VG6A 5J2MA 3S9HA 4DB3A 1RDAA 1WSHA 1QQNA 5M1NA 4IOXA 4PKHA 1SAZA 3HP9A 5J2PA 4HTLA 2Y1IA 1OH7A 2G8FA 4FJ5A 3H08A 3OYAA 4CEZA 3B6PA 4CZLA 3CQ8A 1KSPA 4FLUA 3EEQA 3LPUA 3MEDA 3DXMA 3AA2A 4J2AA 1N33K 1XQSC 3HI0A 4B1XB 4CZJA 3L2UA 4CEQA 1VRTA 5KGWA 3JSMA 5GIPA 4BC4A 1QZ6A 4DTOA 4CK1A 1GLFO 3KD1E 4OLAA 2G8WA 3CETA 2UXBK 3AO3A 2YX6A 3THXA 5BR8K 4OPAA 1NGAA 2A40A 3QEPA 1HKCA 3QNNA 3CJBA 3V9SA 2HBKA 4DS5A 1LWCA 2HHXA 3MWPA 1I39A 3CCUN 4BVOA 4LF6K 2QWMA 4CZKA 4CHPA 1X3NA 3ZSRA 1JJ2M 4UQGA 1IV0A 1HJOA 1DKGD 1NK6A 3S3OA 1YJ9N 3EKUA 4JKAA 4U67L 3OJUA 4WE1A 4CZHA 3N4PA 3ASMA 2W42A 1W7AA 4KREA 1B92A 5KRSA 4IJNA 3HXMA 1RDBA 5J2NA 3QICA 1BG3A 4ZHRA 2X6NA 3TANA 3TAEA 5LJWA 1Y97A 4CK3A 1S6PA 3ZSOA 4B9SA 4JI3K 1GLBG 3ZSYA 3DXMB 2P5GA 5CZ2A 2UUBK 3U6FA 1X9WA 4KFBA 4FPAA 3PX0A 3VF4A 4I2QA 3KK7A 1SQKA 3C7NB 2NRRA 1GLJO 1TGOA 4CJSA 5AJ3K 4N47A 5KQDA 2FXUA 3C65A 3ZT0A 4CEAA 3M1FA 3CPWM 1QQOA 5DM6L 4O0IA 2ASOA 4BGBA 4DQQA 5HP1A 1VK0A 4A61A 4YOWA 2V51B 1KLNA 4ILHA 1G99A 3KWIA 3MCPA 2RKIA 4BACA 4MDBA 3THWA 1KXPA 2QWNA 4O0JA 3PUFA 4BRIA 3L0QA 1W97L 3FZFA 2NZTA 4PL7A 4BRFA 3BY5A 1V4TA 4FLXA 2BE2A 4B9LA 4JHDA 1VRUA 4BREA 3TABA 4KB0A 3C6UA 4BQZA 2ZD1A 4CECA 3VQEA 3ULDA 3Q7BA 2F7TA 3ZYYX 4DQ8A 1UA0A 2IVOA 5AQKA 3D2FB 4CJRA 1J5EK 3QBXA 3UB5A 3VQ5A 1NGIA 1HQUA 4CK2A 5FLXO 3QNOA 4EHTA 3AV9A 2XO7A 1ATSA 4BWJA 3WXKA 1LW2A 2QWQA 3IDHA 5GAGP 3RTVA 4KAZA 1T7PA 3SJJA 4Z4GA 1GLLO 4DFJA 3LM2A 3LP3A 3QIOA 1T6CA 2O8FB 1T05A 2YHXA 4ILGB 1BISA 3AO2A 2P9SA 3J81O 2BH1A 3C6AA 3HM9A 1WNSA 3AVHA 4DV2K 2A1SA 1CXQA 4DV1K 4LH5A 2VWKA 3VQQA 3RMAA 5A2QO 4BRPA 2VCPA 4DQPA 4FLZA 4BRCA 1XMOK 5HL7L 1XC9A 3MXMA 5AQLA 4AILC 1XNQK 1DGKN 5J1EA 4R5PA 4CJTA 3DXKA 4X62K 3EO3A 5F2RA 4E1MA 4DSJA 3UKUA 4IWVA 4Z4IA 3WEEB 3VQAA 3RR7A 3QEWA 1M1KO 4MQ3A 3VGKA 3AO4A 4HCCA 5AQQA 3WT0A 2JWLA 2O8DB 1VSDA 4KTQA 2D0PA 3N4QA 3DRRA 4Q0BA 3ZSXA 4CJFA 5I42A 5GADP 1TK0A 3PLAA 3CPEA 2B6AA 3AVBA 1BO5O 5TKYA 1JCFA 4DWIA 2E4LA 2P9SB 4FVUA 2E2NA 4AHSA 3LM9A 1RDDA 3GBTA 3E1YA 2ZE2A 3I8BA 1OKJA 3UE5A 3OHRA 3NH1A 5EVZA 3F73A 1KVCA 2P5OA 3GE1A 5JS2A 5LJVA 2KQ2A 2D0BA 1HUXA 4FJ9A 3TPQA 3FGUA 4XH4A 4CE9A 3THVA 4GVMA 3MN5A 5AQHA 2AP1A 2F9WA 1GOBA 4J8FA 2Z1JA 3O3HA 4EFHA 4LFCK 1KVAA 4CFDA 2OPRA 1Z05A 1X3MA 3AO1A 4DFPA 4LF9K 1C6VA 3PIPL 5MLCQ 4KRFA 5HRNA 3O8MA 1TKTA 3BDPA 2HMPA 3V4IA 1GOCA 4DUZK 1NKCA 3TI0A 3CC2N 3KIOA 1NKBA 5CR4A 3P4IA 4C8NA 3TSPA 2HBJA 1ZBSA 4WQ5C 5HRRA 4F3TA 4OKKA 1I3AA 2A1RA 3K2PA 4CESA 4LD0A 3IFRA 1FW6A 3OYCA 4RG8A 5M1PA 3AVKA 5CZ1A 4M45A 3E9OA 2YNHA 4DSIA 3C95A 1EWRA 1D5AA 5KTQA 5HOOA 1KD1O 4B3RK 1L3VA 2Z1GA 4BR9A 3QEVA 4OX9K 1F21A 1J6ZA 3MX2A 3TTDA 5GAHP 2ETJA 2YCHA 3O9RA 1ZBHA 5M1QA 3SUPA 4F2RA 1BQMA 1HNIA 1Z25A 3LWMA 3LZJA 1JLEA 1HPZA 3M3ZA 3U9ZA 2VWBA 3BGRA 3R3LA 4DV3K 3CCSN 2O8EA 1HQEA 1WLJA 3EZ5A 2P9IB 1NK0A 1NGCA 4IZ9A 5HRPA 1IKYA 3VF6A 2QI2A 4WQ4C 1H1VA 1T8EA 4CJLA 4CD3A 5AQWA 2OPPA 4CF1A 4DU1A 1JL1A 4BVPA 4ZTJA 3CERA 5AQPA 4B9TA 4FJHA 3J7AP 2G8UA 2ZJPL 1ILYA 2QWOA 2OANA 5AQIA 3QFPA 4K43A 3RMDA 4XH5A 4EZ9A 3G25A 4C1NK 2FBYA 4BRNA 4CHYA 3EZWA 4W5OA 3OYMA 4JD2A 1EQYA 2D0CA 3DYAA 3R9PA 2GUPA 4RW7A 4EAHD 4Z94A 5GAEP 4NCGA 5E26A 4DHYA 4M3WA 4FPBA 3O3FA 4HCBA 4ELVA 4JI7K 2X74A 1J54A 1NK8A 4FWRA 2UU9K 3W3DA 4CF8A 2NRHA 4DFKA 5AQOA 4Z4FA 4GV3A 3L2QA 2O8EB 4ID5A 2FBXA 2IIRA 3ZETA 3FR0A 4RW6A 3WUHA 3F9MA 3NFAA 4YY3K 5BPLA 3WNFA 4B1YB 5IT9O 2D5RA 3CC4N 1ESVA 3CI5A 3ZSZA 4CHOA 5F1XA 1Q7YO 4M63C 3NF6A 1G15A 4O5FA 3CFPA 4FJLA 2E1ZA 5BREA 2KLAA 1EX4A 3BZCA 3DAWA 3ZSQA 3TAGA 4GV9A 2HW3A 3LL3A 3CHWA 4O55A 2FSNA 4E7HA 4FJKA 2JGUA 1TL3A 1NGGA 4JRPA 4CZGA 1XMQK 1UA1A 4I2PA 3HO1A 2KFNA 1LOTB 3MEGA 4FWLA 3CF5L 2OCEA 3DRPA 5BN8A 2HOEA 2FF6A 3AA4A 3V6DA 4B1UB 4WQ4A 3VEZA 3AVAA 4EZ6A 3O08A 2QKKA 4JV5K 4YOTA 3DLEA 2NNWA 2QWLA 5BRFA 1SL2A 3S3NA 1SUQA 4ISFA 2YKNA 3HM8A 3QEXA 2HF4A 2V7ZA 3KLIA 3QERA 1K73O 2HHTA 1FK9A 4AHVA 1Q81O 2KFZA 2HHUA 2W6KA 3SQ4A 3SPZA 4B3SK 4JKDA 3LAMA 3KZBA 4N41A 1GLAG 3OY9A 3TAPA 1L3SA 3LDPA 4OGEA 3P38A 3KK3A 3ENBA 4DU3A 3OVNA 1GLCG 4IFYA 2CGLA 3MN9A 3G71N 1DTQA 5AQYA 2FF3B 3VETA 3OBWA 3ITHA 1RTIA 2ASMA 3VTIA 4NLCA 4ELTA 3MAQA 3TAFA 2F4VK 3HSTB 4FWQA 1R59O 3E66A 2OTJN 1NGEA 3SBTA 4DV6K 4FYDA 2DY4A 3V9XA 4O4GA 1JCEA 1WSJA 4GY2B 1S6QA 1ATNA 1ZC6A 1YIJN 1C0FA 4GW6A 4EIAA 3IS9A 3SV4A 1S9GA 4CD1A 3KKSA 3HOTA 1U49A 3KWGA 3CCEN 4O44A 1WBDA 1WAFA 2P9LB 1VQ5N 3VQDA 1IG8A 4E19A 4OJRA 3M5RA 1VQKN 2BANA 3OYIA 4WCEL 1KLMA 1RTHA 5BR9A 4FL9A 4W5NA 1R0AA 1X9MA 3K5LA 3IRXA 1EXQA 1JXEA 3M8SA 3ZCMA 2XY5A 3ZSWA 3C6HA 3U3YA 4C8OA 3OYLA 4E1JA 4FM1A 2I5JA 4Z4HA 2BDPA 5E84A 4IFVA 4IXCA 1ASUA 3O5BA 3SJHA 3I0SA 3MDQA 4JN4A 4DV4K 3C7NA 4IBNA 1HRHA 3TWHA 4AQYK 3VQ4A 4WFNL 1RTDA 3B6OA 3EN9A 4XH1A 1Q9XA 2JLEA 2G8KA 1S9EA 3CYMA 4CF9A 4F3OA 2Q0RA 3OYNA 4PWDA 4Y0WA 4PA1A 2O8CA 1C1CA 3PX6A 4LF7K 5C2DA 2WUSA 4BG9A 3L4QA 1D9FA 2IVPA 3DLLL 4JI1K 3T1HK 4PY5A 1D8YA 3D6RA 3NE6A 2YNGA 1VQ8N 4FJ7A 1E3MA 1RT6A 3JAMO 3PSIA 3B8AX 2D1KA 4DTXA 1IKWA 4JK9A 3NH2A 1LWEA 2HNZA 5AZJB 3VGLA 1NG9A 3A2FA 5JMVA 1VQON 4JKCA 3SUNA 2GEMA 2QXLA 4NB4A 1MWKA 4QS8A 4CBXA 4BR5A 1Z6RA 2NRXA 2YHYA 1YVUA 2NUBA 5AQVA 3DLBA 1HNXK 3D2FA 2HNDA 4AHUA 4FO0A 4JK8A 4NYNA 4C8KA 1T03A 2YV0X 1VHXA 3MN7A 4IG0A 5C15A 4BR2A 3NF8A 4H8KA 1VQ6N 3CFRA 1KC8O 1BA1A 5T7BA 1WOQA 1BIUA 1C0GA 1YI2N 3QDKA 4FJXA 4JNEA 1U48A 2FC0A 2O8FA 4YOVA 2X78A 5AQMA 2O8CB 3DM2A 4CEFA 3L6QA 1RT5A 3G0ZA 3TTCA 1IH7A 3O1BA 1QSSA 1BGXT 1T6DA 3BF3A 4N5SA 4B1WB 3P1GA 4HUGA 3CM6A 3IAYA 4L3QA 3U8XA 2RPIA 4W5TA 5KQ8A 2VWJA 4FCYA 1A5XA 5JLHA 3FFKB 3PO4A 3NVKA 3T3FA 3K0SA 5F0XA 4YDUC 2NRVA 4FLTA 2ZM6K 2F96A 5K14A 3ZSVA 4DF8A 1BHLA 1A5VA 2A6AA 4CJKA 4B9UA 3QB0A 5CYMA 4JK7A 5AQSA 3THYB 2DTUA 3LDOA 4DCHA 5ADXH 4LF4K 1KAZA 4BDYA 4CFBA 1VSFA 4KTWA 3WEEA 3WXLA 4YORA 1N36K 4EHUA 4KBOA 3K57A 1CZ9A 1P8ZA 3SAHA 2QEXN 3P83D 3A5NC 3HVTA 5FPDA 3QESA 2E2PA 4DTJA 4KB1A 4BE0A 4B9MA 4A5BA 2O8DA 3C94A 3T69A 1JLCA 2FSKA 2KW4A 4JEPA 3TSQA 4ID1A 4CBUA 1EKEA 1BL3A 2GELA 3BUZB 3O6WA 4YOUA 1RBRA 4N76A 4HWIA 1C0TA 4M3XA 1UWBA 4H4OA 4BRKA 3DRSA 3LDQA 4GMJB 4KHPK 4JKFA 3NHGA 3HPHA 3A5OC 4BC5A 5GIOA 2Y1JA 2ZGZA 3AA3A 3CJ7A 3CJ9A 5E41A 3SUQA 1QVGM 4BDPA 4MDAA 2HVIA 1J53A 3SYZA 4FWOA 4CEEA 1T44A 4DV0K 4RTFD 3JYTA 3KLHA 4B9VA 3O9SA 4XIUA 4DR7K 1IKVA 3O4NA 1BCMA 3T1AA 3ULEB 3FZLA 4KI6A 4Y1CA 1QE1A 5GINA 4BE2A 1S1UA 3H3NO 4LSNA 3CC7N 1JXBA 1S3XA 1S1VA 2O4GA 4FSVA 4IJAA 1KFDA 1TKZA 1BU6O 4KTZA 1KFSA 3IKMA 2NRZA 4KHSA 2YNFA 4DR1K 2PY5A 4BR7A 4KHWA 3OS1A 1YF5L 3S41A 3O4QA 1RBSA 2Q97A 2UXDK 4K0KK 3TARA 2FLOA 3CQXA 3QIPA 5B8HA 4E7JA 2H3GX 3SLCA 3MEEA 3U4LA 4AM6A 4BRDA 4CJ7A 4CZMA 4X65K 2UYTA 2F8SA 4ISEA 3VPZA 3FZHA 3L2RA 2HVHA 3JXUA 1LCUA 3DMJA 2GWJA 1VSEA 2V7YA 5C42A 3CG7A 1IJJA 2E1YA 4IO9L 4FZYA 3CD6N 2WFBA 4LH4A 4FZXC 5J2QA 1YAGA 1JLFA 3VEXA 3MMVA 5C12A 2WTUA 4LF8K 5KI6A 1CZBA 5HLFA 4CEOA 3AVNA 1RT3A 1K8KA 3AY9A 1ASVA 1RT1A 4FLYA 3E01A 4EP4A 4BRMA 5KPZA 3OYHA 2KHOA 2P9IA 2HHSA 4E7IA 4BROA 4CJQA 3S3MA 1VSJA 2I7NA 4LF5K 1HNWK 3EE8A 3H6EA 4NXMK 1DTTA 2OPSA 4OKJA 4M3RA 2P9KA 4OLBA 3VEOA 1JL2A 1W2BM 4CHQA 1LWFA 3FZKA 4F4KA 3HBTA 5I3UA 1NK9A 2W40A 1U6ZA 1TKXA 3V9WA 5SWMA 5M1FA 4LFBK 4LFAK 1OH5A 4B08A 3A8YA 1KRPA 3WXJA 3QBWA 1L3UA 4C23A 3I0RA 3NBPA 1YT3A 4CF0A 4V19S 3HTVA 5DMRA 4G9ZA 4RW4A 3PSFA 1MU2A 4DV7K 3O4WA 4Y1DA 4X64K 5JLFA 1K8KB 3BF1A 3M6GA 4HVJA 3ENOA 1DLOA 1EETA 4BY9C 1ZBLA 2QK9A 4DR2K 3SI6A 3D7EO 3RWUA 1JLGA 4BDZA 3O1WA 2P9UB 1NGJA 1HR0K 2XY6A 4DSFA 4JKGA 3C6TA 3VF2A 4PKGA 4BR4A 3O3GA 3VQ7A 3DOLA 4AH9A 1XWLA 3ID8A 4GV6A 1VQMN 3NGZA 2EWSA 2P9KB 4J2BA 5AQRA 1S1TA 1TUUA 2A5XA 4CJWA 3WXIA 3OJSA 3FZMA 1HJRA 2PAVA 3CCQN 4JKHA 1QSLA 2DFEA 2GWKA 4QS9A 3TAQA 4CGFA 4CJ4A 3I55N 5BPMA 4OVLA 1EWQA 4JKBA 1JLAA 4CFAA 3KLGA 3D2EB 1Z26A 2YHBA 1X1PA 3CCLN 1JCGA 2WONA 1VSIA 3UKRA 4YOYA 3SV3A 1GOAA 3LAKA 1SV5A 5LMUK 3KKRA 3NF9A 3VMFB 4YFUA 1O1WA 3OTOK 3LDNA 1IBLK 3O80A 2DFFA 1KCFA 1TYQB 3HP6A 1BA0A 1VSHA 2F8TA 2VGMA 1IKXA 1VQ4N 4FWSA 2YI1A 4M41A 4JKGB 1NGHA 2IDOA 4JAXA 4JYAK 5CY4A 1HMVA 4DLEA 1HKGA 2XRIA 4R79A 1V4SA 2OTLN 4IDHA 4WQ5A 3SMSA 1KQSM 2HNYA 2RE2A 2HHHK 3KLFA 4GKKK 1ATRA 5M1KA 3OS2A 4IG3A 1YUWA 1TAUA 3HRGA 3VQBA 4AHTA 4MLHA 4GVEA 4DSLA 4JS4A 1EP4A 5LY3A 3ZX2A 1S22A 4DTRA 4HTUA 4K8XA 4DR3K 1NOZA 4AHCA 2OA8A 3UKRB 5JICA 2HF3A 2E5LK 3CM5A 3T19A 1N5YA 3NGIA 1MA9B 3AVMA 3NF7A 3GDQA 2VYPA 2RHKA 5CE3A 4KKOA 1U2VB 4LC9B 4CF2A 1ZBIA 3K9JA 4FLVA 5CHIA 4G1QA 3F9KA 3G10A 3AVGA 4ISGA 4K25A 2PBDA 3CJCA 2P9LA 2Z1IA 3V1RA 2E6LA 1KAXA 1BUPA 3SUOA 3HOSA 1VSMA 1YJWN 1C0UA 2NRTA 3SZ2A 2IAJA 2CGKA 4B8CA 1IBMK 3SQ2A 3O9QA 5AQJA 3W0LA 4WYBA 4DLGA 2J4RA 3K5NA 4W5QA 4RW8A 3A5LC 4A5AA 1XI1A 1TV6A 4FK2A 1VSLA 3FLCO 4FJIA 1D4XA 4HUEA 2YKMA 3BP8A 2WBNA 2Q1NA 1C1BA 1O13A 5AQGA 4J2DA 5EXWA 3HZ6A 4ELUA 2CGJA 4B3TK 4K42A 3L3UA 4FM2A 4A2BA 1NKEA 3L8BA 4DTUA 1RILA 3TU5A 1NJIO 1RFQA 3U9DA 4BRLA 4NYFA 2LSNA 5AQXA 4JI4K 4M3TA 4H4MA 3SK3A 2OZSA 1W9HA 1K9MO 1D9DA 3VGMA 1RTJA 3EKSA 2GTDA 2E2QA 4FOIA 2A41A 4QAGA 1QQCA 4MO4A 4WFBL 2QA4N 4M3YA 4B3MK 1Q86O 4H0YB 3I56N 3LZIA 5AZJA 1WB9A 4AHRA 1RCHA 2D0OA 2XY8A 3QLHA 5C0YA 3ZLJA 1QVFM 5C24A 3FFIA 3HJFA 4B8AB 3SMPA 1N6QA 2QXFA 2OZMA 1C0MA 5KRTA 4CFCA 5I9EB 4KPYA 1NNEA 4A59A 3AAPA 1ZBUA 1J9AA 4DTSA 4RWTA 2ZQBA 2F9TA 4Z4EA 3ZT4A 3SNNA 4E0DA 2ZJRL 4PL8A 1CLQA 4PHTX 3NMUA 1B9FA 3SQ1A 3OW2M 4CZEA 1OH6A 4CJUA 4FK0A 5TKWA 2IOCA 4FWKA 4H0TB 3LWLA 4CEDA 1WSEA 1MDUB 4DUYK 3NH0A 4B3OA 2O8BB 4CBWA 4DG1A 1WN7A 2BUPA 3M8QA 5EU7A 4L8RB 1ZXOA 2Q36A 2G8IA 4IEIA 3WNGA 4A2AA 4H5TA 4K41A 1E4GT 3V9ZA 1RT4A 1NBWA 5IWAK 4CJVA 1X9SA 4FK4A 2CH5A 4DR4K 3MXIA 4YNQA 1IO2A 4FWNA 2FSJA 4DSKA 4JI8K 4CEBA 4KHYA 1ITGA 1OVQA 1DEJA 4FW2A 5LMNK 1M90O 1CZAN 3L2WA 4CCHA 4C8MA 3KJVA 3THYA 3SAGA 3SBGA 4FJGA 2CH6A 2D0AA 4KH5A 3KLEA 4FM0A 1TK5A 4CZIA 1MWMA 1RDCA 1VSKA 4GKJK 4KH6A 1XHXA 4F8RA 3T1YK 3VA0A 5AZIB 1LAWA 2UUAK 5FRMA 2NLXA 4JI2K 4CVNE 3DOKA 1P90A 4FOEA 1U47A 3R1XA 3VQCA 4KI4A 3H45C 1N8RO 1FKOA 4F9OA 3CCJN 3RSEA 5AFUA 3SAFA 3O9TA 2IS3A 4H03B 4BRHA 2QWPA 3VOVA 3MWTA 5FRNA 3OYBA 1RNHA 2YJFA 1ZYQA 4CGIA 4BRQA 3HSCA 1KTQA 3UIQA 3GG4A 3THXB 3PY8A 1RT2A 1W0HA 3EY1A 3ULEA 3MX5A 1I94K 5KGXA 1RBUA 1IBKK 4OGCA 4O8KA 3WNEA 3V1OA 4BC3A 2PYJA 2E2OA 2E6MA 5BRHA 4PUOA 4IOCL 2X6SA 2E88A 4JI5K 3CCMN 3F5TA 5FROA 4B9NA 3J7ZO 3C0BA 5ELZA 5H1SQ 4HUFA 3WQUA 1FXXA 4K8ZA 2B4JA 5JVHL 4H5NA 4JRQA 2BGGA 2AA4A 1E4FT 2VG5A 4CJ3A 3HYFA 2V52B 5DK5A 4DQIA 3ZT1A 1UOCA 2Q2RA 3VQPA 4IFEA 4OPKA 2B5JA 1LW0A 1ZBFA 3RVCA 3MXJA 1XC3A 4CIFA 3J7YP 3OYJA 2Q3SA 1BI4A 2IGIA 1SKSA 3KK1A 3P39A 3CQYA 3RSEB 1NOYA 3AVFA 2GBZA 4I9LA 4LSLA 3D0PA 2XHBA 3CMAN 3G4SN 5CYQA 3RMBA 1BDGA 1RGIA 3DWLA 4E7KA 4HHTA 4KO0A 4TSXA 3ZT3A 3OYGA 1XNRK 2G8HA 1TK8A 3KHYA
chains in the Genus database with same CATH topology
3AA4A 4HVJA 3QNNA 3V6DA 1DLOA 1EETA 3U3GA 1NJWA 3V9SA 1ZBLA 2QK9A 4DS5A 1LWCA 3AVAA 3VQ8A 4EZ6A 3SI6A 2QKKA 4KHQA 2PZSA 3K5OA 2HHXA 1I39A 3DLEA 3VA3A 3RWUA 3OYFA 1JLGA 4BDZA 1SL2A 3S3NA 1A5WA 1SUQA 4CHPA 2XY6A 4DSFA 2YKNA 3QETA 3ZSRA 3QEXA 4OLAA 2FBTA 4UQGA 1WSGA 4IKFA 3KLIA 1NK6A 3C6TA 3QERA 3S3OA 4M3UA 4QOZB 2HHTA 1FK9A 3O3GA 3VQ7A 3DOLA 4AHVA 3OJUA 2HMIA 2KFZA 4WE1A 4AH9A 2HHQA 3ASMA 1XWLA 2W42A 2HHUA 4KREA 4E3SA 3SQ4A 3SPZA 1B92A 5KRSA 3NGZA 4J2BA 3AVIA 2RN2A 3LAMA 1S1TA 3HXMA 3K59A 1RDBA 5HBMA 5J2NA 4CJWA 4ZHRA 3ZT2A 2X6NA 3OY9A 3OJSA 3EYZA 4DU4A 3TAPA 3TANA 1HJRA 3HL8A 1L3SA 1REVA 3TAEA 4OGEA 1Y97A 4CK3A 1S6PA 4IDKA 3KK3A 3ZSOA 4B9SA 4DU3A 1HYVA 3OVNA 1QSLA 2DFEA 3ZSYA 2WOMA 4IFYA 3TAQA 4CGFA 2YHAA 5CZ2A 4CJ4A 1QTMA 2P5GA 3U6FA 1X9WA 4KFBA 1BI4B 4OVLA 1DTQA 3PX0A 1JLAA 4CFAA 3KLGA 3ITHA 1RTIA 3SCXA 4I2QA 4ELTA 1Z26A 2YHBA 1X1PA 1TAQA 3QO9A 3MAQA 3TAFA 3HSTB 1TGOA 2WONA 2G8VA 1VSIA 1NJXA 3PV8A 4KV8A 3SV3A 4CJSA 1GOAA 3LAKA 4N47A 1QSYA 1SV5A 3HT3A 3KKRA 3NF9A 3ZT0A 1B9DA 4CEAA 3K58A 2PYLA 4FYDA 2DY4A 4YFUA 1O1WA 3V9XA 2DFFA 4DF4A 2HHVA 4O4GA 1WSJA 4O0IA 1KCFA 3KD5E 1QS4A 3HP6A 1S6QA 1HYZA 3DLHA 4DQQA 1VSHA 2F8TA 3OYKA 5HP1A 4GW6A 1VK0A 3IS9A 3OYDA 3SV4A 1S9GA 1IKXA 3KKSA 3CFOA 1U49A 4I7FA 1KLNA 4E1NA 2RKIA 1YTUA 4M41A 4O44A 4CGJA 4BACA 2IDOA 4KHUA 5CY4A 4O0JA 1WAFA 1HMVA 4DLEA 2XRIA 3VQDA 3AA5X 3PUFA 1NK7A 4E19A 4OJRA 4CIEA 4FW1A 1JLQA 2BANA 3OYIA 1NK5A 1KVBA 3OYEA 2HNYA 1KLMA 1RTHA 3AVJA 3NGYA 4W5NA 1R0AA 4FLXA 1X9MA 1WSFA 2BE2A 3HPOA 3K5LA 3IRXA 1EXQA 1VRUA 1U45A 3KLFA 3TABA 4B9LA 1JXEA 4FJJA 4CGGA 4KB0A 3C6UA 3M8SA 2ZD1A 4CECA 3VQEA 4IG3A 3OS2A 3ZCMA 3ULDA 2XY5A 1TAUA 3ZSWA 4AHTA 3VQBA 3U3YA 1BIZA 1UA0A 4C8OA 4DSLA 4CGDA 1HYSA 3OYLA 4JS4A 1EP4A 1NJZA 5HROA 4CJRA 4FM1A 2I5JA 4Z4HA 3HPGA 2BDPA 3D45A 4IFVA 3VQ5A 4HTUA 1ASUA 4DTRA 4FJLA 1BCOA 1HQUA 4K8XA 3I0SA 4CK2A 1NOZA 4CIGA 3QNOA 3AV9A 4AHCA 2XO7A 4IBNA 1HRHA 4EP5A 3TWHA 2OA8A 3VQ4A 4BWJA 1LW2A 3RTVA 1RTDA 4KAZA 3B6OA 1T7PA 3SJJA 1Q9XA 2JLEA 2G8KA 4N41A 2GUIA 4Z4GA 1S9EA 3CM5A 3T19A 4DFJA 3LP3A 1N5YA 3NGIA 3QIOA 3CYMA 4CF9A 4F3OA 1NK4A 3AVMA 3OYNA 3NF7A 4PWDA 4PA1A 3ALYA 2P51A 1TL1A 2ITGA 1C1CA 4W5RA 3PX6A 3VN5A 1T05A 3PO5A 1BISA 5FDLA 3AO2A 1D9FA 4KKOA 1LV5A 3OS0A 4PY5A 4F2SA 4CF2A 3HM9A 1D8YA 1WNSA 4ICLA 3NE6A 4FLVA 1ZBIA 2YNGA 2IC3A 4FJ7A 3AVHA 2A1SA 1CXQA 1RT6A 3I8DA 4LH5A 2VWKA 4G1QA 3F9KA 3G10A 3VQQA 4BE1A 3RMAA 3AVGA 3RR8A 4OKEA 4DQPA 4FLZA 1BQNA 1SL0A 4DTXA 4N56A 1IKWA 2Z1IA 3V1RA 1XC9A 3MXMA 3NH2A 1LWEA 2AJQA 2HNZA 4O5BA 3HVRA 4C8LA 2E6LA 4DTPA 2O4IA 1CXUA 3A2FA 4MFBA 4Z4CA 3SUOA 3WNHA 1VSMA 4AILC 4E89A 1Q8IA 5J1EA 1C0UA 3SUNA 4R5PA 4CJTA 1TVRA 2IAJA 3SZ2A 4NCBA 3K5MA 4B8CA 3SQ2A 3AO5A 4E1MA 4DSJA 4DLGA 3K5NA 4W5QA 4Z4IA 1YVUA 2NUBA 2KZZA 2EX3A 4RW8A 3VQAA 1XI1A 1TV6A 3SQ0A 1VSLA 3QEWA 3RR7A 4FK2A 3DLBA 4AHUA 2HNDA 4FJIA 3LPTA 4MQ3A 1HNVA 4CJPA 3AO4A 4NYNA 4HUEA 4C8KA 3TAMA 4HCCA 2YKMA 1T03A 4FVMA 2YV0X 2ATQA 4IG0A 1VSDA 4KTQA 1XHZA 1C1BA 3NF8A 4H8KA 3DRRA 4Q0BA 3ZSXA 4J2DA 4CJFA 4KHNA 1RBVA 5I42A 4RW9A 1TK0A 4ELUA 3CFRA 1K6YA 2OPQA 5T7BA 4JS5A 5D3GA 3LALA 2B6AA 3AVBA 3LP2A 3ISNC 3L3UA 1BIUA 1S5JA 2HB5A 3VQ9A 4FJXA 4FM2A 1NKEA 1U48A 2FC0A 3L8BA 2X78A 4DTUA 1RILA 3DM2A 4DFMA 4CEFA 4DWIA 2E4LA 3SPYA 1RT5A 3G0ZA 1IH7A 1QSSA 4QCLA 1BGXT 4NYFA 3LP0A 2LSNA 4N5SA 2OZMA 3P1GA 4AHSA 4HUGA 4M3TA 3CM6A 3IAYA 1RDDA 1S1WA 4H4MA 2OZSA 2ZE2A 1W9HA 2RPIA 4W5TA 2VWJA 1WSIA 1A5XA 4FCYA 3NH1A 1D9DA 3LANA 1RTJA 3F73A 5HRSA 3PO4A 1WAJA 4QAGA 3T3FA 1QQCA 1KVCA 1SL1A 2P5OA 5JS2A 4M3YA 1L3TA 3LZIA 2KQ2A 2GV9A 4FLTA 2D0BA 2VG7A 4CJ5A 4NCAA 3HK2A 4AHRA 4FJ9A 1RCHA 2F96A 5K14A 4CE9A 3ZSVA 2XY8A 4FLWA 3RRHA 1BHLA 1A5VA 3QLHA 4GVMA 4DF8A 1C1AA 4CJKA 3IG1A 4B9UA 5C24A 1GOBA 2Z1JA 3FFIA 5CYMA 3O3HA 3HJFA 4B8AB 3NDKA 2DTUA 1KVAA 1SKRA 2QXFA 4CFDA 1N6QA 2OPRA 1C0MA 4CFBA 5KRTA 4BDYA 1VSFA 4CFCA 4KPYA 3MECA 2HHWA 1S1XA 4KTWA 4FZZA 3RRGA 4DSEA 3AO1A 4DFPA 4DTMA 3QEIA 3THVA 1C6VA 1CZ9A 1ZBUA 3K57A 4I9QA 4KRFA 1J9AA 3TR8A 5HRNA 4DTSA 1TKTA 4M42A 3P83D 3HVTA 3QESA 4CGHA 4DS4A 2ZQBA 3BDPA 4DTJA 4KB1A 1NJYA 4Z4EA 3ZT4A 4BE0A 3V4IA 1GOCA 3SNNA 4B9MA 4E0DA 1CLQA 3C94A 1JLCA 1NKCA 1B9FA 3SQ1A 2KW4A 3TI0A 2OYQA 4ID1A 1EKEA 3M8PA 3KIOA 1BL3A 4CJUA 1NKBA 3QINA 4Q5VA 1RBRA 4FK0A 4N76A 1RBTA 1L5UA 2IOCA 4C8NA 4CEDA 3LWLA 1WSEA 1C0TA 4M3XA 3DLGA 3V81A 1UWBA 4DQRA 5HRRA 4H4OA 4F3TA 4OKKA 3NH0A 4B3OA 1UAXA 3DRSA 3LDSA 4DG1A 1I3AA 2A1RA 3K2PA 4CESA 1WN7A 4LD0A 3M8QA 4GMJB 5EU7A 4CERA 3OYCA 4L8RB 4RG8A 4Z0UA 2G8IA 3NHGA 3HPHA 4JLHA 3WNGA 3AVKA 2Y1JA 2QKBA 4BWMA 5CZ1A 4M45A 3AA3A 4DTNA 2YNHA 3V9ZA 4DSIA 3C95A 1RT4A 1D5AA 5E41A 4DQSA 3SUQA 5KTQA 4BDPA 4CJVA 1X9SA 4FK4A 2HVIA 1J53A 3MXIA 2Z1HA 4YNQA 2DFHA 4CEEA 3SYZA 1IO2A 2Z1GA 1L3VA 3JYTA 3QEVA 1F21A 3KLHA 4B9VA 4XIUA 1IKVA 2ETJA 3O4NA 2EHGA 3L3VA 4DSKA 1BCMA 3T1AA 1ZBHA 4CEBA 4KHYA 3SUPA 4F2RA 1BQMA 4KI6A 1ITGA 1HNIA 4FW2A 4Y1CA 1Z25A 1QE1A 3LWMA 3LZJA 1JLEA 1HPZA 1S1UA 4LSNA 3L2WA 4BE2A 5JS1A 1J5OA 1JXBA 3BGRA 3P5JA 4CCHA 4C8MA 1QHTA 1S1VA 2O4GA 3KJVA 1SKWA 4FXDA 2FBVA 4FJGA 1KFDA 1TKZA 1HQEA 2D0AA 1WLJA 3EZ5A 4KTZA 3KLEA 4FM0A 1KFSA 1Q9YA 1TK5A 1NK0A 5HRPA 1IKYA 3V1QA 1RDCA 4KHSA 4PQUA 2YNFA 1JKHA 1VSKA 1T8EA 4CJLA 3OS1A 2PY5A 3PX4A 4ZTFA 3KTQA 4KHWA 1XHXA 4F8RA 2YNIA 3O4QA 3VA0A 2OPPA 4CF1A 1RBSA 1JL1A 4DU1A 3RMCA 4ZTJA 4M3ZA 1LAWA 3TARA 4B9TA 4FJHA 3QIPA 4E7JA 2G8UA 5FRMA 1RT7A 3DOKA 1ASWA 3MEEA 3DLRA 3RMDA 1U47A 4EZ9A 3V9UA 4E7LA 2F8SA 3L2RA 2HVHA 2R7YA 3VQCA 4KI4A 3DMJA 2XY7A 2FBYA 1FKOA 1VSEA 3DI6A 5C42A 4CHYA 3CG7A 4FJ8A 4LY7A 3NAEA 4W5OA 2IS3A 3OYMA 4OPJA 2D0CA 4FZYA 1YTAA 5FRNA 3DLKA 3DYAA 4LH4A 1RNHA 3OYBA 3L2VA 1FKPA 4CGIA 2P1JA 5J2QA 1ZYQA 4RW7A 4FZXC 1JLFA 1U04A 1TKDA 4FJNA 5KI6A 4NCGA 3VQ6A 1CZBA 4M3WA 5HLFA 4CEOA 3O3FA 1KTQA 3AVNA 4CHNA 3UIQA 3PY8A 1RT3A 4HCBA 1RT2A 5SZTA 1W0HA 4ELVA 3EY1A 1ASVA 1RT1A 2X74A 4DMNA 4FLYA 1J54A 3E01A 4EP4A 1NK8A 2KTQA 5C25A 4CF8A 5KGXA 1RBUA 3AVLA 4OGCA 3WNEA 3V1OA 4DFKA 1JLBA 2PYJA 4Z4FA 3KK2A 3L2QA 4ID5A 1U4BA 2E6MA 3OYHA 2FBXA 4PUOA 2X6SA 4CJEA 1LAVA 2HHSA 4RW6A 4FJMA 3AVCA 3NFAA 4E7IA 4CJQA 3S3MA 1VSJA 5FROA 4B9NA 2KZMA 3WNFA 3LP1A 1IG9A 2RF2A 3M8RA 4CHZA 4J2EA 3NCIA 4HUFA 2D5RA 2VG6A 5J2MA 3S9HA 1FXXA 1DTTA 4K8ZA 1RDAA 1WSHA 2B4JA 2OPSA 3ZSZA 4CHOA 4OKJA 4M3RA 4JRQA 4OLBA 1JL2A 2BGGA 4CHQA 1LWFA 3NF6A 1G15A 2VG5A 3HP9A 3CFPA 4CJ3A 3HYFA 5DK5A 5J2PA 2Y1IA 3ZT1A 4DQIA 4F4KA 2G8FA 4FJ5A 3H08A 5I3UA 1UOCA 3OYAA 3VQPA 4CEZA 3B6PA 3CQ8A 1NK9A 1KSPA 4FLUA 4OPKA 1TKXA 1LW0A 1ZBFA 2B5JA 3LPUA 1EX4A 3MEDA 3MXJA 3V9WA 5SWMA 3AA2A 4CIFA 4J2AA 3ZSQA 2Q3SA 1BI4A 3OYJA 2IGIA 4B08A 3TAGA 1SKSA 2HW3A 3KK1A 3L2UA 1KRPA 4CEQA 4O55A 1NOYA 1VRTA 3AVFA 2GBZA 4I9LA 5KGWA 3JSMA 4LSLA 4E7HA 3D0PA 4FJKA 2XHBA 1L3UA 4DTOA 2JGUA 1TL3A 5CYQA 3RMBA 4E7KA 3I0RA 4CK1A 3NBPA 1YT3A 4KO0A 4CF0A 4JRPA 4TSXA 4HHTA 2G8WA 3KD1E 3ZT3A 3OYGA 1UA1A 3AO3A 5DMRA 4RW4A 1MU2A 4I2PA 4Y1DA 3HO1A 2KFNA 3MEGA 2G8HA 3DRPA 1TK8A 3QEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA4 A;  4HVJ A;  3QNN A;  3V6D A;  1DLO A;  1EET A;  3U3G A;  1NJW A;  3V9S A;  1ZBL A;  2QK9 A;  4DS5 A;  1LWC A;  3AVA A;  3VQ8 A;  4EZ6 A;  3SI6 A;  2QKK A;  4KHQ A;  2PZS A;  3K5O A;  2HHX A;  1I39 A;  3DLE A;  3VA3 A;  3RWU A;  3OYF A;  1JLG A;  4BDZ A;  1SL2 A;  3S3N A;  1A5W A;  1SUQ A;  4CHP A;  2XY6 A;  4DSF A;  2YKN A;  3QET A;  3ZSR A;  3QEX A;  4OLA A;  2FBT A;  4UQG A;  1WSG A;  4IKF A;  3KLI A;  1NK6 A;  3C6T A;  3QER A;  3S3O A;  4M3U A;  4QOZ B;  2HHT A;  1FK9 A;  3O3G A;  3VQ7 A;  3DOL A;  4AHV A;  3OJU A;  2HMI A;  2KFZ A;  4WE1 A;  4AH9 A;  2HHQ A;  3ASM A;  1XWL A;  2W42 A;  2HHU A;  4KRE A;  4E3S A;  3SQ4 A;  3SPZ A;  1B92 A;  5KRS A;  3NGZ A;  4J2B A;  3AVI A;  2RN2 A;  3LAM A;  1S1T A;  3HXM A;  3K59 A;  1RDB A;  5HBM A;  5J2N A;  4CJW A;  4ZHR A;  3ZT2 A;  2X6N A;  3OY9 A;  3OJS A;  3EYZ A;  4DU4 A;  3TAP A;  3TAN A;  1HJR A;  3HL8 A;  1L3S A;  1REV A;  3TAE A;  4OGE A;  1Y97 A;  4CK3 A;  1S6P A;  4IDK A;  3KK3 A;  3ZSO A;  4B9S A;  4DU3 A;  1HYV A;  3OVN A;  1QSL A;  2DFE A;  3ZSY A;  2WOM A;  4IFY A;  3TAQ A;  4CGF A;  2YHA A;  5CZ2 A;  4CJ4 A;  1QTM A;  2P5G A;  3U6F A;  1X9W A;  4KFB A;  1BI4 B;  4OVL A;  1DTQ A;  3PX0 A;  1JLA A;  4CFA A;  3KLG A;  3ITH A;  1RTI A;  3SCX A;  4I2Q A;  4ELT A;  1Z26 A;  2YHB A;  1X1P A;  1TAQ A;  3QO9 A;  3MAQ A;  3TAF A;  3HST B;  1TGO A;  2WON A;  2G8V A;  1VSI A;  1NJX A;  3PV8 A;  4KV8 A;  3SV3 A;  4CJS A;  1GOA A;  3LAK A;  4N47 A;  1QSY A;  1SV5 A;  3HT3 A;  3KKR A;  3NF9 A;  3ZT0 A;  1B9D A;  4CEA A;  3K58 A;  2PYL A;  4FYD A;  2DY4 A;  4YFU A;  1O1W A;  3V9X A;  2DFF A;  4DF4 A;  2HHV A;  4O4G A;  1WSJ A;  4O0I A;  1KCF A;  3KD5 E;  1QS4 A;  3HP6 A;  1S6Q A;  1HYZ A;  3DLH A;  4DQQ A;  1VSH A;  2F8T A;  3OYK A;  5HP1 A;  4GW6 A;  1VK0 A;  3IS9 A;  3OYD A;  3SV4 A;  1S9G A;  1IKX A;  3KKS A;  3CFO A;  1U49 A;  4I7F A;  1KLN A;  4E1N A;  2RKI A;  1YTU A;  4M41 A;  4O44 A;  4CGJ A;  4BAC A;  2IDO A;  4KHU A;  5CY4 A;  4O0J A;  1WAF A;  1HMV A;  4DLE A;  2XRI A;  3VQD A;  3AA5 X;  3PUF A;  1NK7 A;  4E19 A;  4OJR A;  4CIE A;  4FW1 A;  1JLQ A;  2BAN A;  3OYI A;  1NK5 A;  1KVB A;  3OYE A;  2HNY A;  1KLM A;  1RTH A;  3AVJ A;  3NGY A;  4W5N A;  1R0A A;  4FLX A;  1X9M A;  1WSF A;  2BE2 A;  3HPO A;  3K5L A;  3IRX A;  1EXQ A;  1VRU A;  1U45 A;  3KLF A;  3TAB A;  4B9L A;  1JXE A;  4FJJ A;  4CGG A;  4KB0 A;  3C6U A;  3M8S A;  2ZD1 A;  4CEC A;  3VQE A;  4IG3 A;  3OS2 A;  3ZCM A;  3ULD A;  2XY5 A;  1TAU A;  3ZSW A;  4AHT A;  3VQB A;  3U3Y A;  1BIZ A;  1UA0 A;  4C8O A;  4DSL A;  4CGD A;  1HYS A;  3OYL A;  4JS4 A;  1EP4 A;  1NJZ A;  5HRO A;  4CJR A;  4FM1 A;  2I5J A;  4Z4H A;  3HPG A;  2BDP A;  3D45 A;  4IFV A;  3VQ5 A;  4HTU A;  1ASU A;  4DTR A;  4FJL A;  1BCO A;  1HQU A;  4K8X A;  3I0S A;  4CK2 A;  1NOZ A;  4CIG A;  3QNO A;  3AV9 A;  4AHC A;  2XO7 A;  4IBN A;  1HRH A;  4EP5 A;  3TWH A;  2OA8 A;  3VQ4 A;  4BWJ A;  1LW2 A;  3RTV A;  1RTD A;  4KAZ A;  3B6O A;  1T7P A;  3SJJ A;  1Q9X A;  2JLE A;  2G8K A;  4N41 A;  2GUI A;  4Z4G A;  1S9E A;  3CM5 A;  3T19 A;  4DFJ A;  3LP3 A;  1N5Y A;  3NGI A;  3QIO A;  3CYM A;  4CF9 A;  4F3O A;  1NK4 A;  3AVM A;  3OYN A;  3NF7 A;  4PWD A;  4PA1 A;  3ALY A;  2P51 A;  1TL1 A;  2ITG A;  1C1C A;  4W5R A;  3PX6 A;  3VN5 A;  1T05 A;  3PO5 A;  1BIS A;  5FDL A;  3AO2 A;  1D9F A;  4KKO A;  1LV5 A;  3OS0 A;  4PY5 A;  4F2S A;  4CF2 A;  3HM9 A;  1D8Y A;  1WNS A;  4ICL A;  3NE6 A;  4FLV A;  1ZBI A;  2YNG A;  2IC3 A;  4FJ7 A;  3AVH A;  2A1S A;  1CXQ A;  1RT6 A;  3I8D A;  4LH5 A;  2VWK A;  4G1Q A;  3F9K A;  3G10 A;  3VQQ A;  4BE1 A;  3RMA A;  3AVG A;  3RR8 A;  4OKE A;  4DQP A;  4FLZ A;  1BQN A;  1SL0 A;  4DTX A;  4N56 A;  1IKW A;  2Z1I A;  3V1R A;  1XC9 A;  3MXM A;  3NH2 A;  1LWE A;  2AJQ A;  2HNZ A;  4O5B A;  3HVR A;  4C8L A;  2E6L A;  4DTP A;  2O4I A;  1CXU A;  3A2F A;  4MFB A;  4Z4C A;  3SUO A;  3WNH A;  1VSM A;  4AIL C;  4E89 A;  1Q8I A;  5J1E A;  1C0U A;  3SUN A;  4R5P A;  4CJT A;  1TVR A;  2IAJ A;  3SZ2 A;  4NCB A;  3K5M A;  4B8C A;  3SQ2 A;  3AO5 A;  4E1M A;  4DSJ A;  4DLG A;  3K5N A;  4W5Q A;  4Z4I A;  1YVU A;  2NUB A;  2KZZ A;  2EX3 A;  4RW8 A;  3VQA A;  1XI1 A;  1TV6 A;  3SQ0 A;  1VSL A;  3QEW A;  3RR7 A;  4FK2 A;  3DLB A;  4AHU A;  2HND A;  4FJI A;  3LPT A;  4MQ3 A;  1HNV A;  4CJP A;  3AO4 A;  4NYN A;  4HUE A;  4C8K A;  3TAM A;  4HCC A;  2YKM A;  1T03 A;  4FVM A;  2YV0 X;  2ATQ A;  4IG0 A;  1VSD A;  4KTQ A;  1XHZ A;  1C1B A;  3NF8 A;  4H8K A;  3DRR A;  4Q0B A;  3ZSX A;  4J2D A;  4CJF A;  4KHN A;  1RBV A;  5I42 A;  4RW9 A;  1TK0 A;  4ELU A;  3CFR A;  1K6Y A;  2OPQ A;  5T7B A;  4JS5 A;  5D3G A;  3LAL A;  2B6A A;  3AVB A;  3LP2 A;  3ISN C;  3L3U A;  1BIU A;  1S5J A;  2HB5 A;  3VQ9 A;  4FJX A;  4FM2 A;  1NKE A;  1U48 A;  2FC0 A;  3L8B A;  2X78 A;  4DTU A;  1RIL A;  3DM2 A;  4DFM A;  4CEF A;  4DWI A;  2E4L A;  3SPY A;  1RT5 A;  3G0Z A;  1IH7 A;  1QSS A;  4QCL A;  1BGX T;  4NYF A;  3LP0 A;  2LSN A;  4N5S A;  2OZM A;  3P1G A;  4AHS A;  4HUG A;  4M3T A;  3CM6 A;  3IAY A;  1RDD A;  1S1W A;  4H4M A;  2OZS A;  2ZE2 A;  1W9H A;  2RPI A;  4W5T A;  2VWJ A;  1WSI A;  1A5X A;  4FCY A;  3NH1 A;  1D9D A;  3LAN A;  1RTJ A;  3F73 A;  5HRS A;  3PO4 A;  1WAJ A;  4QAG A;  3T3F A;  1QQC A;  1KVC A;  1SL1 A;  2P5O A;  5JS2 A;  4M3Y A;  1L3T A;  3LZI A;  2KQ2 A;  2GV9 A;  4FLT A;  2D0B A;  2VG7 A;  4CJ5 A;  4NCA A;  3HK2 A;  4AHR A;  4FJ9 A;  1RCH A;  2F96 A;  5K14 A;  4CE9 A;  3ZSV A;  2XY8 A;  4FLW A;  3RRH A;  1BHL A;  1A5V A;  3QLH A;  4GVM A;  4DF8 A;  1C1A A;  4CJK A;  3IG1 A;  4B9U A;  5C24 A;  1GOB A;  2Z1J A;  3FFI A;  5CYM A;  3O3H A;  3HJF A;  4B8A B;  3NDK A;  2DTU A;  1KVA A;  1SKR A;  2QXF A;  4CFD A;  1N6Q A;  2OPR A;  1C0M A;  4CFB A;  5KRT A;  4BDY A;  1VSF A;  4CFC A;  4KPY A;  3MEC A;  2HHW A;  1S1X A;  4KTW A;  4FZZ A;  3RRG A;  4DSE A;  3AO1 A;  4DFP A;  4DTM A;  3QEI A;  3THV A;  1C6V A;  1CZ9 A;  1ZBU A;  3K57 A;  4I9Q A;  4KRF A;  1J9A A;  3TR8 A;  5HRN A;  4DTS A;  1TKT A;  4M42 A;  3P83 D;  3HVT A;  3QES A;  4CGH A;  4DS4 A;  2ZQB A;  3BDP A;  4DTJ A;  4KB1 A;  1NJY A;  4Z4E A;  3ZT4 A;  4BE0 A;  3V4I A;  1GOC A;  3SNN A;  4B9M A;  4E0D A;  1CLQ A;  3C94 A;  1JLC A;  1NKC A;  1B9F A;  3SQ1 A;  2KW4 A;  3TI0 A;  2OYQ A;  4ID1 A;  1EKE A;  3M8P A;  3KIO A;  1BL3 A;  4CJU A;  1NKB A;  3QIN A;  4Q5V A;  1RBR A;  4FK0 A;  4N76 A;  1RBT A;  1L5U A;  2IOC A;  4C8N A;  4CED A;  3LWL A;  1WSE A;  1C0T A;  4M3X A;  3DLG A;  3V81 A;  1UWB A;  4DQR A;  5HRR A;  4H4O A;  4F3T A;  4OKK A;  3NH0 A;  4B3O A;  1UAX A;  3DRS A;  3LDS A;  4DG1 A;  1I3A A;  2A1R A;  3K2P A;  4CES A;  1WN7 A;  4LD0 A;  3M8Q A;  4GMJ B;  5EU7 A;  4CER A;  3OYC A;  4L8R B;  4RG8 A;  4Z0U A;  2G8I A;  3NHG A;  3HPH A;  4JLH A;  3WNG A;  3AVK A;  2Y1J A;  2QKB A;  4BWM A;  5CZ1 A;  4M45 A;  3AA3 A;  4DTN A;  2YNH A;  3V9Z A;  4DSI A;  3C95 A;  1RT4 A;  1D5A A;  5E41 A;  4DQS A;  3SUQ A;  5KTQ A;  4BDP A;  4CJV A;  1X9S A;  4FK4 A;  2HVI A;  1J53 A;  3MXI A;  2Z1H A;  4YNQ A;  2DFH A;  4CEE A;  3SYZ A;  1IO2 A;  2Z1G A;  1L3V A;  3JYT A;  3QEV A;  1F21 A;  3KLH A;  4B9V A;  4XIU A;  1IKV A;  2ETJ A;  3O4N A;  2EHG A;  3L3V A;  4DSK A;  1BCM A;  3T1A A;  1ZBH A;  4CEB A;  4KHY A;  3SUP A;  4F2R A;  1BQM A;  4KI6 A;  1ITG A;  1HNI A;  4FW2 A;  4Y1C A;  1Z25 A;  1QE1 A;  3LWM A;  3LZJ A;  1JLE A;  1HPZ A;  1S1U A;  4LSN A;  3L2W A;  4BE2 A;  5JS1 A;  1J5O A;  1JXB A;  3BGR A;  3P5J A;  4CCH A;  4C8M A;  1QHT A;  1S1V A;  2O4G A;  3KJV A;  1SKW A;  4FXD A;  2FBV A;  4FJG A;  1KFD A;  1TKZ A;  1HQE A;  2D0A A;  1WLJ A;  3EZ5 A;  4KTZ A;  3KLE A;  4FM0 A;  1KFS A;  1Q9Y A;  1TK5 A;  1NK0 A;  5HRP A;  1IKY A;  3V1Q A;  1RDC A;  4KHS A;  4PQU A;  2YNF A;  1JKH A;  1VSK A;  1T8E A;  4CJL A;  3OS1 A;  2PY5 A;  3PX4 A;  4ZTF A;  3KTQ A;  4KHW A;  1XHX A;  4F8R A;  2YNI A;  3O4Q A;  3VA0 A;  2OPP A;  4CF1 A;  1RBS A;  1JL1 A;  4DU1 A;  3RMC A;  4ZTJ A;  4M3Z A;  1LAW A;  3TAR A;  4B9T A;  4FJH A;  3QIP A;  4E7J A;  2G8U A;  5FRM A;  1RT7 A;  3DOK A;  1ASW A;  3MEE A;  3DLR A;  3RMD A;  1U47 A;  4EZ9 A;  3V9U A;  4E7L A;  2F8S A;  3L2R A;  2HVH A;  2R7Y A;  3VQC A;  4KI4 A;  3DMJ A;  2XY7 A;  2FBY A;  1FKO A;  1VSE A;  3DI6 A;  5C42 A;  4CHY A;  3CG7 A;  4FJ8 A;  4LY7 A;  3NAE A;  4W5O A;  2IS3 A;  3OYM A;  4OPJ A;  2D0C A;  4FZY A;  1YTA A;  5FRN A;  3DLK A;  3DYA A;  4LH4 A;  1RNH A;  3OYB A;  3L2V A;  1FKP A;  4CGI A;  2P1J A;  5J2Q A;  1ZYQ A;  4RW7 A;  4FZX C;  1JLF A;  1U04 A;  1TKD A;  4FJN A;  5KI6 A;  4NCG A;  3VQ6 A;  1CZB A;  4M3W A;  5HLF A;  4CEO A;  3O3F A;  1KTQ A;  3AVN A;  4CHN A;  3UIQ A;  3PY8 A;  1RT3 A;  4HCB A;  1RT2 A;  5SZT A;  1W0H A;  4ELV A;  3EY1 A;  1ASV A;  1RT1 A;  2X74 A;  4DMN A;  4FLY A;  1J54 A;  3E01 A;  4EP4 A;  1NK8 A;  2KTQ A;  5C25 A;  4CF8 A;  5KGX A;  1RBU A;  3AVL A;  4OGC A;  3WNE A;  3V1O A;  4DFK A;  1JLB A;  2PYJ A;  4Z4F A;  3KK2 A;  3L2Q A;  4ID5 A;  1U4B A;  2E6M A;  3OYH A;  2FBX A;  4PUO A;  2X6S A;  4CJE A;  1LAV A;  2HHS A;  4RW6 A;  4FJM A;  3AVC A;  3NFA A;  4E7I A;  4CJQ A;  3S3M A;  1VSJ A;  5FRO A;  4B9N A;  2KZM A;  3WNF A;  3LP1 A;  1IG9 A;  2RF2 A;  3M8R A;  4CHZ A;  4J2E A;  3NCI A;  4HUF A;  2D5R A;  2VG6 A;  5J2M A;  3S9H A;  1FXX A;  1DTT A;  4K8Z A;  1RDA A;  1WSH A;  2B4J A;  2OPS A;  3ZSZ A;  4CHO A;  4OKJ A;  4M3R A;  4JRQ A;  4OLB A;  1JL2 A;  2BGG A;  4CHQ A;  1LWF A;  3NF6 A;  1G15 A;  2VG5 A;  3HP9 A;  3CFP A;  4CJ3 A;  3HYF A;  5DK5 A;  5J2P A;  2Y1I A;  3ZT1 A;  4DQI A;  4F4K A;  2G8F A;  4FJ5 A;  3H08 A;  5I3U A;  1UOC A;  3OYA A;  3VQP A;  4CEZ A;  3B6P A;  3CQ8 A;  1NK9 A;  1KSP A;  4FLU A;  4OPK A;  1TKX A;  1LW0 A;  1ZBF A;  2B5J A;  3LPU A;  1EX4 A;  3MED A;  3MXJ A;  3V9W A;  5SWM A;  3AA2 A;  4CIF A;  4J2A A;  3ZSQ A;  2Q3S A;  1BI4 A;  3OYJ A;  2IGI A;  4B08 A;  3TAG A;  1SKS A;  2HW3 A;  3KK1 A;  3L2U A;  1KRP A;  4CEQ A;  4O55 A;  1NOY A;  1VRT A;  3AVF A;  2GBZ A;  4I9L A;  5KGW A;  3JSM A;  4LSL A;  4E7H A;  3D0P A;  4FJK A;  2XHB A;  1L3U A;  4DTO A;  2JGU A;  1TL3 A;  5CYQ A;  3RMB A;  4E7K A;  3I0R A;  4CK1 A;  3NBP A;  1YT3 A;  4KO0 A;  4CF0 A;  4JRP A;  4TSX A;  4HHT A;  2G8W A;  3KD1 E;  3ZT3 A;  3OYG A;  1UA1 A;  3AO3 A;  5DMR A;  4RW4 A;  1MU2 A;  4I2P A;  4Y1D A;  3HO1 A;  2KFN A;  3MEG A;  2G8H A;  3DRP A;  1TK8 A;  3QEP A; 
#chains in the Genus database with same CATH topology
 3CCR N;  3U3G A;  1NMD A;  1NJW A;  2W6L A;  3A5M C;  3CME N;  1N34 K;  3EE9 A;  3VQ8 A;  4KHQ A;  2PZS A;  3K5O A;  3H1Q A;  1DT9 A;  3VA3 A;  3OYF A;  2WC9 A;  5AQZ A;  1WBB A;  1A5W A;  5FPM A;  2ZWH A;  3QET A;  3THW B;  1QQM A;  5DM7 L;  2FBT A;  1WSG A;  2Q0U A;  4IKF A;  2HBL A;  1VQL N;  1SS6 A;  4M3U A;  4QOZ B;  1VQN N;  1RDW X;  1SZ2 A;  2HMI A;  4NO7 A;  1YHQ N;  2HHQ A;  4E3S A;  3AVI A;  2RN2 A;  2ZJQ L;  4JHD B;  3IMX A;  3K59 A;  1QTM A;  2UUC K;  5FPE A;  5HBM A;  3RR8 A;  3H3O B;  3ZT2 A;  3EYZ A;  4DU4 A;  4H0P A;  3CJ1 A;  3HL8 A;  1REV A;  1OVY A;  1TUY A;  4IDK A;  4ILJ A;  1HYV A;  2WOM A;  4BC2 A;  2YHA A;  4BR0 A;  1YIT N;  3JS6 A;  1BI4 B;  3VEN A;  2QTD A;  3SCX A;  4YDU A;  1TAQ A;  3QO9 A;  3H46 O;  2G8V A;  1NJX A;  3PV8 A;  4KV8 A;  2YHW A;  1QSY A;  3HT3 A;  4PKI A;  3K58 A;  1B9D A;  1K8A O;  2PYL A;  5BRD A;  3ZX0 A;  3Q7C A;  2HHV A;  4DF4 A;  5FPN A;  3T7Z A;  4DR6 K;  4H0V B;  1QS4 A;  4O8U A;  1HYZ A;  3DLH A;  3OYK A;  3LDL A;  3CXC M;  3OYD A;  4IOA L;  3CFO A;  5M1O A;  4I7F A;  2P9U A;  4E1N A;  1YTU A;  4CGJ A;  3VER A;  4H5R A;  4KHU A;  3IUC A;  3AA5 X;  1NK7 A;  4CIE A;  4FW1 A;  1JLQ A;  1NK5 A;  1KVB A;  5KPT A;  3OYE A;  3AVJ A;  3NGY A;  3GL1 A;  1WSF A;  4X66 K;  2Q31 A;  3HPO A;  1U45 A;  4FJJ A;  3DXK B;  4CGG A;  3WQT A;  4JI6 K;  3UKU B;  2QW9 A;  2NRW A;  4IEE A;  1BIZ A;  3PIO L;  3TSU A;  4CGD A;  1HYS A;  4C1N I;  1NJZ A;  3TTF A;  5HRO A;  4B1Z A;  2JWK A;  4BGA A;  3HPG A;  3D45 A;  3E9L A;  3AGR A;  1BCO A;  3D2E A;  4CIG A;  3G6E N;  4EP5 A;  4YHH K;  4DR5 K;  2GUI A;  1VQP N;  3DJC A;  1NK4 A;  1YJN N;  5BPN A;  2A42 A;  3ALY A;  2P51 A;  1TL1 A;  2ITG A;  4WFA L;  4W5R A;  5C10 A;  1TYQ A;  3VN5 A;  4AM7 A;  3PO5 A;  3VES A;  4B9Q A;  5FDL A;  3R6M A;  1LV5 A;  3OS0 A;  4F2S A;  4ICL A;  3P31 A;  2IC3 A;  5AQN A;  2W41 A;  3I8D A;  1FJG K;  4BE1 A;  1NGF A;  1NLV A;  4OKE A;  3GOI A;  5AFU H;  1BQN A;  1SL0 A;  4N56 A;  4H5V A;  4IO8 A;  4H5W A;  2AJQ A;  4O5B A;  3HVR A;  4C8L A;  4DTP A;  2O4I A;  1CXU A;  4MFB A;  4Z4C A;  3WNH A;  4E89 A;  1Q8I A;  4BRA A;  1TVR A;  4NCB A;  1NGD A;  3AAR A;  3K5M A;  3CCV N;  3AO5 A;  1S72 N;  1VQ9 N;  1BOT O;  2KZZ A;  2EX3 A;  1HX1 A;  3SQ0 A;  4XEI A;  3LPT A;  1BWF O;  1HNV A;  4CJP A;  3TAM A;  4FVM A;  4CZF A;  4JKE A;  3VEY A;  2ATQ A;  1XHZ A;  4BQL A;  2ZGY A;  3K9K A;  4AF1 A;  4BRG A;  2VQF K;  4KHN A;  1RBV A;  5AQF A;  4RW9 A;  2HST A;  3VEW A;  1HLU A;  5D3G A;  1K6Y A;  2OPQ A;  4JS5 A;  4FWP A;  3LAL A;  3MN6 A;  3ZX3 A;  4GNI A;  3LP2 A;  3ISN C;  1YXQ A;  1S5J A;  2HB5 A;  3VQ9 A;  2QWR A;  4KH4 A;  4DFM A;  4U7B A;  3SPY A;  4QCL A;  3LP0 A;  1U2V A;  3J8A A;  1S1W A;  4CW7 B;  2ZF5 O;  3R8E A;  2HBM A;  1GLD G;  4M7X A;  1OH8 A;  1WSI A;  4FWM A;  3LAN A;  2D4W A;  5HRS A;  1WAJ A;  4MO5 A;  1QZ5 A;  1SL1 A;  5AQT A;  1L3T A;  2GV9 A;  3VTH A;  2VG7 A;  4NCA A;  4CJ5 A;  3HK2 A;  4FLW A;  3KD5 E;  1NGB A;  3RRH A;  1C1A A;  3IG1 A;  3MK6 A;  1N32 K;  2GX9 A;  4MLE A;  3QML A;  3NDK A;  4NXN K;  1SKR A;  1HPM A;  1NM1 A;  3MEC A;  1S1X A;  4FZZ A;  3RRG A;  4DSE A;  3QEI A;  4DTM A;  4I9Q A;  3TR8 A;  2PFU A;  4M42 A;  1KAY A;  4CGH A;  2YJE A;  3F2K A;  4DS4 A;  1YVN A;  1NJY A;  2P9N A;  3EL2 A;  4DKW A;  1Q18 A;  5EOY A;  5C2F A;  1NWK A;  1NMN A;  2OYQ A;  2E8A A;  3QFU A;  2VQE K;  3M8P A;  4QS7 A;  4WF9 L;  3QIN A;  4Q5V A;  4A62 A;  1RBT A;  2A3Z A;  1L5U A;  2ASP A;  1HNZ K;  3DLG A;  3V81 A;  4DQR A;  1UAX A;  3LDS A;  3O9U A;  2P9P A;  5JVG L;  4CER A;  3E9P A;  4Z0U A;  1RDU A;  4H0O A;  4JLH A;  2QKB A;  1Q82 O;  4BG8 A;  4BWM A;  4DTN A;  4JD2 B;  4DQS A;  3ATU A;  4RCH A;  1T3V A;  3VEV A;  2Z1H A;  2DFH A;  5EY4 A;  2IVN A;  3OA9 A;  4CI6 A;  3I33 A;  3OBY A;  5LL6 Z;  4A57 A;  4M7Y A;  5ADX A;  2EHG A;  3L3V A;  5JS1 A;  3WXM B;  1J5O A;  1Y64 A;  3P5J A;  4FXD A;  1QHT A;  1SKW A;  3ZEU A;  2FBV A;  1QHA A;  3ENH A;  4JI0 K;  3ZET B;  4B1V A;  1Q9Y A;  2DPN A;  1NU0 A;  3V1Q A;  4PQU A;  1JKH A;  4H0X B;  4I6M A;  5AR0 A;  3PX4 A;  4ZTF A;  3KTQ A;  4NLB A;  2YNI A;  3NVM A;  2P9N B;  4UY8 O;  2VGN A;  3RMC A;  4M3Z A;  5AQU A;  2QM1 A;  3CJA A;  3BEX A;  4YOX A;  3BZK A;  1RT7 A;  3CIP A;  1ASW A;  3L4I A;  1HKB A;  1XUP O;  3DLR A;  3AAQ A;  3V9U A;  4E7L A;  3KVG A;  2O8B A;  2R7Y A;  2P9P B;  1GLE G;  2XY7 A;  2UXC K;  3DI6 A;  4FJ8 A;  4LY7 A;  1X9J A;  3NAE A;  3MCA B;  4OPJ A;  1YTA A;  2HHW A;  3DLK A;  3L2V A;  1FKP A;  2P1J A;  3FE1 A;  1U04 A;  1TKD A;  1VQ7 N;  3ATV A;  4FJN A;  3VQ6 A;  1EO1 A;  5EX5 A;  3J80 O;  2ITM A;  4CHN A;  5SZT A;  3H1V X;  4OPH A;  4DMN A;  3A0I X;  2KTQ A;  5C25 A;  3ID6 A;  3AVL A;  2I7P A;  1JLB A;  4DV5 K;  3ZEU B;  3KK2 A;  4OO1 J;  1U4B A;  3AGK A;  2BTF A;  5BN9 A;  4CJE A;  1LAV A;  2KKZ A;  4FJM A;  3AVC A;  4I6M B;  2E20 A;  2KZM A;  1WUA A;  3LP1 A;  1IG9 A;  1VAZ A;  2RF2 A;  5KPR A;  4CHZ A;  3M8R A;  3NCI A;  4J2E A;  5AZI A;  2VG6 A;  5J2M A;  3S9H A;  4DB3 A;  1RDA A;  1WSH A;  1QQN A;  5M1N A;  4IOX A;  4PKH A;  1SAZ A;  3HP9 A;  5J2P A;  4HTL A;  2Y1I A;  1OH7 A;  2G8F A;  4FJ5 A;  3H08 A;  3OYA A;  4CEZ A;  3B6P A;  4CZL A;  3CQ8 A;  1KSP A;  4FLU A;  3EEQ A;  3LPU A;  3MED A;  3DXM A;  3AA2 A;  4J2A A;  1N33 K;  1XQS C;  3HI0 A;  4B1X B;  4CZJ A;  3L2U A;  4CEQ A;  1VRT A;  5KGW A;  3JSM A;  5GIP A;  4BC4 A;  1QZ6 A;  4DTO A;  4CK1 A;  1GLF O;  3KD1 E;  4OLA A;  2G8W A;  3CET A;  2UXB K;  3AO3 A;  2YX6 A;  3THX A;  5BR8 K;  4OPA A;  1NGA A;  2A40 A;  3QEP A;  1HKC A;  3QNN A;  3CJB A;  3V9S A;  2HBK A;  4DS5 A;  1LWC A;  2HHX A;  3MWP A;  1I39 A;  3CCU N;  4BVO A;  4LF6 K;  2QWM A;  4CZK A;  4CHP A;  1X3N A;  3ZSR A;  1JJ2 M;  4UQG A;  1IV0 A;  1HJO A;  1DKG D;  1NK6 A;  3S3O A;  1YJ9 N;  3EKU A;  4JKA A;  4U67 L;  3OJU A;  4WE1 A;  4CZH A;  3N4P A;  3ASM A;  2W42 A;  1W7A A;  4KRE A;  1B92 A;  5KRS A;  4IJN A;  3HXM A;  1RDB A;  5J2N A;  3QIC A;  1BG3 A;  4ZHR A;  2X6N A;  3TAN A;  3TAE A;  5LJW A;  1Y97 A;  4CK3 A;  1S6P A;  3ZSO A;  4B9S A;  4JI3 K;  1GLB G;  3ZSY A;  3DXM B;  2P5G A;  5CZ2 A;  2UUB K;  3U6F A;  1X9W A;  4KFB A;  4FPA A;  3PX0 A;  3VF4 A;  4I2Q A;  3KK7 A;  1SQK A;  3C7N B;  2NRR A;  1GLJ O;  1TGO A;  4CJS A;  5AJ3 K;  4N47 A;  5KQD A;  2FXU A;  3C65 A;  3ZT0 A;  4CEA A;  3M1F A;  3CPW M;  1QQO A;  5DM6 L;  4O0I A;  2ASO A;  4BGB A;  4DQQ A;  5HP1 A;  1VK0 A;  4A61 A;  4YOW A;  2V51 B;  1KLN A;  4ILH A;  1G99 A;  3KWI A;  3MCP A;  2RKI A;  4BAC A;  4MDB A;  3THW A;  1KXP A;  2QWN A;  4O0J A;  3PUF A;  4BRI A;  3L0Q A;  1W97 L;  3FZF A;  2NZT A;  4PL7 A;  4BRF A;  3BY5 A;  1V4T A;  4FLX A;  2BE2 A;  4B9L A;  4JHD A;  1VRU A;  4BRE A;  3TAB A;  4KB0 A;  3C6U A;  4BQZ A;  2ZD1 A;  4CEC A;  3VQE A;  3ULD A;  3Q7B A;  2F7T A;  3ZYY X;  4DQ8 A;  1UA0 A;  2IVO A;  5AQK A;  3D2F B;  4CJR A;  1J5E K;  3QBX A;  3UB5 A;  3VQ5 A;  1NGI A;  1HQU A;  4CK2 A;  5FLX O;  3QNO A;  4EHT A;  3AV9 A;  2XO7 A;  1ATS A;  4BWJ A;  3WXK A;  1LW2 A;  2QWQ A;  3IDH A;  5GAG P;  3RTV A;  4KAZ A;  1T7P A;  3SJJ A;  4Z4G A;  1GLL O;  4DFJ A;  3LM2 A;  3LP3 A;  3QIO A;  1T6C A;  2O8F B;  1T05 A;  2YHX A;  4ILG B;  1BIS A;  3AO2 A;  2P9S A;  3J81 O;  2BH1 A;  3C6A A;  3HM9 A;  1WNS A;  3AVH A;  4DV2 K;  2A1S A;  1CXQ A;  4DV1 K;  4LH5 A;  2VWK A;  3VQQ A;  3RMA A;  5A2Q O;  4BRP A;  2VCP A;  4DQP A;  4FLZ A;  4BRC A;  1XMO K;  5HL7 L;  1XC9 A;  3MXM A;  5AQL A;  4AIL C;  1XNQ K;  1DGK N;  5J1E A;  4R5P A;  4CJT A;  3DXK A;  4X62 K;  3EO3 A;  5F2R A;  4E1M A;  4DSJ A;  3UKU A;  4IWV A;  4Z4I A;  3WEE B;  3VQA A;  3RR7 A;  3QEW A;  1M1K O;  4MQ3 A;  3VGK A;  3AO4 A;  4HCC A;  5AQQ A;  3WT0 A;  2JWL A;  2O8D B;  1VSD A;  4KTQ A;  2D0P A;  3N4Q A;  3DRR A;  4Q0B A;  3ZSX A;  4CJF A;  5I42 A;  5GAD P;  1TK0 A;  3PLA A;  3CPE A;  2B6A A;  3AVB A;  1BO5 O;  5TKY A;  1JCF A;  4DWI A;  2E4L A;  2P9S B;  4FVU A;  2E2N A;  4AHS A;  3LM9 A;  1RDD A;  3GBT A;  3E1Y A;  2ZE2 A;  3I8B A;  1OKJ A;  3UE5 A;  3OHR A;  3NH1 A;  5EVZ A;  3F73 A;  1KVC A;  2P5O A;  3GE1 A;  5JS2 A;  5LJV A;  2KQ2 A;  2D0B A;  1HUX A;  4FJ9 A;  3TPQ A;  3FGU A;  4XH4 A;  4CE9 A;  3THV A;  4GVM A;  3MN5 A;  5AQH A;  2AP1 A;  2F9W A;  1GOB A;  4J8F A;  2Z1J A;  3O3H A;  4EFH A;  4LFC K;  1KVA A;  4CFD A;  2OPR A;  1Z05 A;  1X3M A;  3AO1 A;  4DFP A;  4LF9 K;  1C6V A;  3PIP L;  5MLC Q;  4KRF A;  5HRN A;  3O8M A;  1TKT A;  3BDP A;  2HMP A;  3V4I A;  1GOC A;  4DUZ K;  1NKC A;  3TI0 A;  3CC2 N;  3KIO A;  1NKB A;  5CR4 A;  3P4I A;  4C8N A;  3TSP A;  2HBJ A;  1ZBS A;  4WQ5 C;  5HRR A;  4F3T A;  4OKK A;  1I3A A;  2A1R A;  3K2P A;  4CES A;  4LD0 A;  3IFR A;  1FW6 A;  3OYC A;  4RG8 A;  5M1P A;  3AVK A;  5CZ1 A;  4M45 A;  3E9O A;  2YNH A;  4DSI A;  3C95 A;  1EWR A;  1D5A A;  5KTQ A;  5HOO A;  1KD1 O;  4B3R K;  1L3V A;  2Z1G A;  4BR9 A;  3QEV A;  4OX9 K;  1F21 A;  1J6Z A;  3MX2 A;  3TTD A;  5GAH P;  2ETJ A;  2YCH A;  3O9R A;  1ZBH A;  5M1Q A;  3SUP A;  4F2R A;  1BQM A;  1HNI A;  1Z25 A;  3LWM A;  3LZJ A;  1JLE A;  1HPZ A;  3M3Z A;  3U9Z A;  2VWB A;  3BGR A;  3R3L A;  4DV3 K;  3CCS N;  2O8E A;  1HQE A;  1WLJ A;  3EZ5 A;  2P9I B;  1NK0 A;  1NGC A;  4IZ9 A;  5HRP A;  1IKY A;  3VF6 A;  2QI2 A;  4WQ4 C;  1H1V A;  1T8E A;  4CJL A;  4CD3 A;  5AQW A;  2OPP A;  4CF1 A;  4DU1 A;  1JL1 A;  4BVP A;  4ZTJ A;  3CER A;  5AQP A;  4B9T A;  4FJH A;  3J7A P;  2G8U A;  2ZJP L;  1ILY A;  2QWO A;  2OAN A;  5AQI A;  3QFP A;  4K43 A;  3RMD A;  4XH5 A;  4EZ9 A;  3G25 A;  4C1N K;  2FBY A;  4BRN A;  4CHY A;  3EZW A;  4W5O A;  3OYM A;  4JD2 A;  1EQY A;  2D0C A;  3DYA A;  3R9P A;  2GUP A;  4RW7 A;  4EAH D;  4Z94 A;  5GAE P;  4NCG A;  5E26 A;  4DHY A;  4M3W A;  4FPB A;  3O3F A;  4HCB A;  4ELV A;  4JI7 K;  2X74 A;  1J54 A;  1NK8 A;  4FWR A;  2UU9 K;  3W3D A;  4CF8 A;  2NRH A;  4DFK A;  5AQO A;  4Z4F A;  4GV3 A;  3L2Q A;  2O8E B;  4ID5 A;  2FBX A;  2IIR A;  3ZET A;  3FR0 A;  4RW6 A;  3WUH A;  3F9M A;  3NFA A;  4YY3 K;  5BPL A;  3WNF A;  4B1Y B;  5IT9 O;  2D5R A;  3CC4 N;  1ESV A;  3CI5 A;  3ZSZ A;  4CHO A;  5F1X A;  1Q7Y O;  4M63 C;  3NF6 A;  1G15 A;  4O5F A;  3CFP A;  4FJL A;  2E1Z A;  5BRE A;  2KLA A;  1EX4 A;  3BZC A;  3DAW A;  3ZSQ A;  3TAG A;  4GV9 A;  2HW3 A;  3LL3 A;  3CHW A;  4O55 A;  2FSN A;  4E7H A;  4FJK A;  2JGU A;  1TL3 A;  1NGG A;  4JRP A;  4CZG A;  1XMQ K;  1UA1 A;  4I2P A;  3HO1 A;  2KFN A;  1LOT B;  3MEG A;  4FWL A;  3CF5 L;  2OCE A;  3DRP A;  5BN8 A;  2HOE A;  2FF6 A;  3AA4 A;  3V6D A;  4B1U B;  4WQ4 A;  3VEZ A;  3AVA A;  4EZ6 A;  3O08 A;  2QKK A;  4JV5 K;  4YOT A;  3DLE A;  2NNW A;  2QWL A;  5BRF A;  1SL2 A;  3S3N A;  1SUQ A;  4ISF A;  2YKN A;  3HM8 A;  3QEX A;  2HF4 A;  2V7Z A;  3KLI A;  3QER A;  1K73 O;  2HHT A;  1FK9 A;  4AHV A;  1Q81 O;  2KFZ A;  2HHU A;  2W6K A;  3SQ4 A;  3SPZ A;  4B3S K;  4JKD A;  3LAM A;  3KZB A;  4N41 A;  1GLA G;  3OY9 A;  3TAP A;  1L3S A;  3LDP A;  4OGE A;  3P38 A;  3KK3 A;  3ENB A;  4DU3 A;  3OVN A;  1GLC G;  4IFY A;  2CGL A;  3MN9 A;  3G71 N;  1DTQ A;  5AQY A;  2FF3 B;  3VET A;  3OBW A;  3ITH A;  1RTI A;  2ASM A;  3VTI A;  4NLC A;  4ELT A;  3MAQ A;  3TAF A;  2F4V K;  3HST B;  4FWQ A;  1R59 O;  3E66 A;  2OTJ N;  1NGE A;  3SBT A;  4DV6 K;  4FYD A;  2DY4 A;  3V9X A;  4O4G A;  1JCE A;  1WSJ A;  4GY2 B;  1S6Q A;  1ATN A;  1ZC6 A;  1YIJ N;  1C0F A;  4GW6 A;  4EIA A;  3IS9 A;  3SV4 A;  1S9G A;  4CD1 A;  3KKS A;  3HOT A;  1U49 A;  3KWG A;  3CCE N;  4O44 A;  1WBD A;  1WAF A;  2P9L B;  1VQ5 N;  3VQD A;  1IG8 A;  4E19 A;  4OJR A;  3M5R A;  1VQK N;  2BAN A;  3OYI A;  4WCE L;  1KLM A;  1RTH A;  5BR9 A;  4FL9 A;  4W5N A;  1R0A A;  1X9M A;  3K5L A;  3IRX A;  1EXQ A;  1JXE A;  3M8S A;  3ZCM A;  2XY5 A;  3ZSW A;  3C6H A;  3U3Y A;  4C8O A;  3OYL A;  4E1J A;  4FM1 A;  2I5J A;  4Z4H A;  2BDP A;  5E84 A;  4IFV A;  4IXC A;  1ASU A;  3O5B A;  3SJH A;  3I0S A;  3MDQ A;  4JN4 A;  4DV4 K;  3C7N A;  4IBN A;  1HRH A;  3TWH A;  4AQY K;  3VQ4 A;  4WFN L;  1RTD A;  3B6O A;  3EN9 A;  4XH1 A;  1Q9X A;  2JLE A;  2G8K A;  1S9E A;  3CYM A;  4CF9 A;  4F3O A;  2Q0R A;  3OYN A;  4PWD A;  4Y0W A;  4PA1 A;  2O8C A;  1C1C A;  3PX6 A;  4LF7 K;  5C2D A;  2WUS A;  4BG9 A;  3L4Q A;  1D9F A;  2IVP A;  3DLL L;  4JI1 K;  3T1H K;  4PY5 A;  1D8Y A;  3D6R A;  3NE6 A;  2YNG A;  1VQ8 N;  4FJ7 A;  1E3M A;  1RT6 A;  3JAM O;  3PSI A;  3B8A X;  2D1K A;  4DTX A;  1IKW A;  4JK9 A;  3NH2 A;  1LWE A;  2HNZ A;  5AZJ B;  3VGL A;  1NG9 A;  3A2F A;  5JMV A;  1VQO N;  4JKC A;  3SUN A;  2GEM A;  2QXL A;  4NB4 A;  1MWK A;  4QS8 A;  4CBX A;  4BR5 A;  1Z6R A;  2NRX A;  2YHY A;  1YVU A;  2NUB A;  5AQV A;  3DLB A;  1HNX K;  3D2F A;  2HND A;  4AHU A;  4FO0 A;  4JK8 A;  4NYN A;  4C8K A;  1T03 A;  2YV0 X;  1VHX A;  3MN7 A;  4IG0 A;  5C15 A;  4BR2 A;  3NF8 A;  4H8K A;  1VQ6 N;  3CFR A;  1KC8 O;  1BA1 A;  5T7B A;  1WOQ A;  1BIU A;  1C0G A;  1YI2 N;  3QDK A;  4FJX A;  4JNE A;  1U48 A;  2FC0 A;  2O8F A;  4YOV A;  2X78 A;  5AQM A;  2O8C B;  3DM2 A;  4CEF A;  3L6Q A;  1RT5 A;  3G0Z A;  3TTC A;  1IH7 A;  3O1B A;  1QSS A;  1BGX T;  1T6D A;  3BF3 A;  4N5S A;  4B1W B;  3P1G A;  4HUG A;  3CM6 A;  3IAY A;  4L3Q A;  3U8X A;  2RPI A;  4W5T A;  5KQ8 A;  2VWJ A;  4FCY A;  1A5X A;  5JLH A;  3FFK B;  3PO4 A;  3NVK A;  3T3F A;  3K0S A;  5F0X A;  4YDU C;  2NRV A;  4FLT A;  2ZM6 K;  2F96 A;  5K14 A;  3ZSV A;  4DF8 A;  1BHL A;  1A5V A;  2A6A A;  4CJK A;  4B9U A;  3QB0 A;  5CYM A;  4JK7 A;  5AQS A;  3THY B;  2DTU A;  3LDO A;  4DCH A;  5ADX H;  4LF4 K;  1KAZ A;  4BDY A;  4CFB A;  1VSF A;  4KTW A;  3WEE A;  3WXL A;  4YOR A;  1N36 K;  4EHU A;  4KBO A;  3K57 A;  1CZ9 A;  1P8Z A;  3SAH A;  2QEX N;  3P83 D;  3A5N C;  3HVT A;  5FPD A;  3QES A;  2E2P A;  4DTJ A;  4KB1 A;  4BE0 A;  4B9M A;  4A5B A;  2O8D A;  3C94 A;  3T69 A;  1JLC A;  2FSK A;  2KW4 A;  4JEP A;  3TSQ A;  4ID1 A;  4CBU A;  1EKE A;  1BL3 A;  2GEL A;  3BUZ B;  3O6W A;  4YOU A;  1RBR A;  4N76 A;  4HWI A;  1C0T A;  4M3X A;  1UWB A;  4H4O A;  4BRK A;  3DRS A;  3LDQ A;  4GMJ B;  4KHP K;  4JKF A;  3NHG A;  3HPH A;  3A5O C;  4BC5 A;  5GIO A;  2Y1J A;  2ZGZ A;  3AA3 A;  3CJ7 A;  3CJ9 A;  5E41 A;  3SUQ A;  1QVG M;  4BDP A;  4MDA A;  2HVI A;  1J53 A;  3SYZ A;  4FWO A;  4CEE A;  1T44 A;  4DV0 K;  4RTF D;  3JYT A;  3KLH A;  4B9V A;  3O9S A;  4XIU A;  4DR7 K;  1IKV A;  3O4N A;  1BCM A;  3T1A A;  3ULE B;  3FZL A;  4KI6 A;  4Y1C A;  1QE1 A;  5GIN A;  4BE2 A;  1S1U A;  3H3N O;  4LSN A;  3CC7 N;  1JXB A;  1S3X A;  1S1V A;  2O4G A;  4FSV A;  4IJA A;  1KFD A;  1TKZ A;  1BU6 O;  4KTZ A;  1KFS A;  3IKM A;  2NRZ A;  4KHS A;  2YNF A;  4DR1 K;  2PY5 A;  4BR7 A;  4KHW A;  3OS1 A;  1YF5 L;  3S41 A;  3O4Q A;  1RBS A;  2Q97 A;  2UXD K;  4K0K K;  3TAR A;  2FLO A;  3CQX A;  3QIP A;  5B8H A;  4E7J A;  2H3G X;  3SLC A;  3MEE A;  3U4L A;  4AM6 A;  4BRD A;  4CJ7 A;  4CZM A;  4X65 K;  2UYT A;  2F8S A;  4ISE A;  3VPZ A;  3FZH A;  3L2R A;  2HVH A;  3JXU A;  1LCU A;  3DMJ A;  2GWJ A;  1VSE A;  2V7Y A;  5C42 A;  3CG7 A;  1IJJ A;  2E1Y A;  4IO9 L;  4FZY A;  3CD6 N;  2WFB A;  4LH4 A;  4FZX C;  5J2Q A;  1YAG A;  1JLF A;  3VEX A;  3MMV A;  5C12 A;  2WTU A;  4LF8 K;  5KI6 A;  1CZB A;  5HLF A;  4CEO A;  3AVN A;  1RT3 A;  1K8K A;  3AY9 A;  1ASV A;  1RT1 A;  4FLY A;  3E01 A;  4EP4 A;  4BRM A;  5KPZ A;  3OYH A;  2KHO A;  2P9I A;  2HHS A;  4E7I A;  4BRO A;  4CJQ A;  3S3M A;  1VSJ A;  2I7N A;  4LF5 K;  1HNW K;  3EE8 A;  3H6E A;  4NXM K;  1DTT A;  2OPS A;  4OKJ A;  4M3R A;  2P9K A;  4OLB A;  3VEO A;  1JL2 A;  1W2B M;  4CHQ A;  1LWF A;  3FZK A;  4F4K A;  3HBT A;  5I3U A;  1NK9 A;  2W40 A;  1U6Z A;  1TKX A;  3V9W A;  5SWM A;  5M1F A;  4LFB K;  4LFA K;  1OH5 A;  4B08 A;  3A8Y A;  1KRP A;  3WXJ A;  3QBW A;  1L3U A;  4C23 A;  3I0R A;  3NBP A;  1YT3 A;  4CF0 A;  4V19 S;  3HTV A;  5DMR A;  4G9Z A;  4RW4 A;  3PSF A;  1MU2 A;  4DV7 K;  3O4W A;  4Y1D A;  4X64 K;  5JLF A;  1K8K B;  3BF1 A;  3M6G A;  4HVJ A;  3ENO A;  1DLO A;  1EET A;  4BY9 C;  1ZBL A;  2QK9 A;  4DR2 K;  3SI6 A;  3D7E O;  3RWU A;  1JLG A;  4BDZ A;  3O1W A;  2P9U B;  1NGJ A;  1HR0 K;  2XY6 A;  4DSF A;  4JKG A;  3C6T A;  3VF2 A;  4PKG A;  4BR4 A;  3O3G A;  3VQ7 A;  3DOL A;  4AH9 A;  1XWL A;  3ID8 A;  4GV6 A;  1VQM N;  3NGZ A;  2EWS A;  2P9K B;  4J2B A;  5AQR A;  1S1T A;  1TUU A;  2A5X A;  4CJW A;  3WXI A;  3OJS A;  3FZM A;  1HJR A;  2PAV A;  3CCQ N;  4JKH A;  1QSL A;  2DFE A;  2GWK A;  4QS9 A;  3TAQ A;  4CGF A;  4CJ4 A;  3I55 N;  5BPM A;  4OVL A;  1EWQ A;  4JKB A;  1JLA A;  4CFA A;  3KLG A;  3D2E B;  1Z26 A;  2YHB A;  1X1P A;  3CCL N;  1JCG A;  2WON A;  1VSI A;  3UKR A;  4YOY A;  3SV3 A;  1GOA A;  3LAK A;  1SV5 A;  5LMU K;  3KKR A;  3NF9 A;  3VMF B;  4YFU A;  1O1W A;  3OTO K;  3LDN A;  1IBL K;  3O80 A;  2DFF A;  1KCF A;  1TYQ B;  3HP6 A;  1BA0 A;  1VSH A;  2F8T A;  2VGM A;  1IKX A;  1VQ4 N;  4FWS A;  2YI1 A;  4M41 A;  4JKG B;  1NGH A;  2IDO A;  4JAX A;  4JYA K;  5CY4 A;  1HMV A;  4DLE A;  1HKG A;  2XRI A;  4R79 A;  1V4S A;  2OTL N;  4IDH A;  4WQ5 A;  3SMS A;  1KQS M;  2HNY A;  2RE2 A;  2HHH K;  3KLF A;  4GKK K;  1ATR A;  5M1K A;  3OS2 A;  4IG3 A;  1YUW A;  1TAU A;  3HRG A;  3VQB A;  4AHT A;  4MLH A;  4GVE A;  4DSL A;  4JS4 A;  1EP4 A;  5LY3 A;  3ZX2 A;  1S22 A;  4DTR A;  4HTU A;  4K8X A;  4DR3 K;  1NOZ A;  4AHC A;  2OA8 A;  3UKR B;  5JIC A;  2HF3 A;  2E5L K;  3CM5 A;  3T19 A;  1N5Y A;  3NGI A;  1MA9 B;  3AVM A;  3NF7 A;  3GDQ A;  2VYP A;  2RHK A;  5CE3 A;  4KKO A;  1U2V B;  4LC9 B;  4CF2 A;  1ZBI A;  3K9J A;  4FLV A;  5CHI A;  4G1Q A;  3F9K A;  3G10 A;  3AVG A;  4ISG A;  4K25 A;  2PBD A;  3CJC A;  2P9L A;  2Z1I A;  3V1R A;  2E6L A;  1KAX A;  1BUP A;  3SUO A;  3HOS A;  1VSM A;  1YJW N;  1C0U A;  2NRT A;  3SZ2 A;  2IAJ A;  2CGK A;  4B8C A;  1IBM K;  3SQ2 A;  3O9Q A;  5AQJ A;  3W0L A;  4WYB A;  4DLG A;  2J4R A;  3K5N A;  4W5Q A;  4RW8 A;  3A5L C;  4A5A A;  1XI1 A;  1TV6 A;  4FK2 A;  1VSL A;  3FLC O;  4FJI A;  1D4X A;  4HUE A;  2YKM A;  3BP8 A;  2WBN A;  2Q1N A;  1C1B A;  1O13 A;  5AQG A;  4J2D A;  5EXW A;  3HZ6 A;  4ELU A;  2CGJ A;  4B3T K;  4K42 A;  3L3U A;  4FM2 A;  4A2B A;  1NKE A;  3L8B A;  4DTU A;  1RIL A;  3TU5 A;  1NJI O;  1RFQ A;  3U9D A;  4BRL A;  4NYF A;  2LSN A;  5AQX A;  4JI4 K;  4M3T A;  4H4M A;  3SK3 A;  2OZS A;  1W9H A;  1K9M O;  1D9D A;  3VGM A;  1RTJ A;  3EKS A;  2GTD A;  2E2Q A;  4FOI A;  2A41 A;  4QAG A;  1QQC A;  4MO4 A;  4WFB L;  2QA4 N;  4M3Y A;  4B3M K;  1Q86 O;  4H0Y B;  3I56 N;  3LZI A;  5AZJ A;  1WB9 A;  4AHR A;  1RCH A;  2D0O A;  2XY8 A;  3QLH A;  5C0Y A;  3ZLJ A;  1QVF M;  5C24 A;  3FFI A;  3HJF A;  4B8A B;  3SMP A;  1N6Q A;  2QXF A;  2OZM A;  1C0M A;  5KRT A;  4CFC A;  5I9E B;  4KPY A;  1NNE A;  4A59 A;  3AAP A;  1ZBU A;  1J9A A;  4DTS A;  4RWT A;  2ZQB A;  2F9T A;  4Z4E A;  3ZT4 A;  3SNN A;  4E0D A;  2ZJR L;  4PL8 A;  1CLQ A;  4PHT X;  3NMU A;  1B9F A;  3SQ1 A;  3OW2 M;  4CZE A;  1OH6 A;  4CJU A;  4FK0 A;  5TKW A;  2IOC A;  4FWK A;  4H0T B;  3LWL A;  4CED A;  1WSE A;  1MDU B;  4DUY K;  3NH0 A;  4B3O A;  2O8B B;  4CBW A;  4DG1 A;  1WN7 A;  2BUP A;  3M8Q A;  5EU7 A;  4L8R B;  1ZXO A;  2Q36 A;  2G8I A;  4IEI A;  3WNG A;  4A2A A;  4H5T A;  4K41 A;  1E4G T;  3V9Z A;  1RT4 A;  1NBW A;  5IWA K;  4CJV A;  1X9S A;  4FK4 A;  2CH5 A;  4DR4 K;  3MXI A;  4YNQ A;  1IO2 A;  4FWN A;  2FSJ A;  4DSK A;  4JI8 K;  4CEB A;  4KHY A;  1ITG A;  1OVQ A;  1DEJ A;  4FW2 A;  5LMN K;  1M90 O;  1CZA N;  3L2W A;  4CCH A;  4C8M A;  3KJV A;  3THY A;  3SAG A;  3SBG A;  4FJG A;  2CH6 A;  2D0A A;  4KH5 A;  3KLE A;  4FM0 A;  1TK5 A;  4CZI A;  1MWM A;  1RDC A;  1VSK A;  4GKJ K;  4KH6 A;  1XHX A;  4F8R A;  3T1Y K;  3VA0 A;  5AZI B;  1LAW A;  2UUA K;  5FRM A;  2NLX A;  4JI2 K;  4CVN E;  3DOK A;  1P90 A;  4FOE A;  1U47 A;  3R1X A;  3VQC A;  4KI4 A;  3H45 C;  1N8R O;  1FKO A;  4F9O A;  3CCJ N;  3RSE A;  5AFU A;  3SAF A;  3O9T A;  2IS3 A;  4H03 B;  4BRH A;  2QWP A;  3VOV A;  3MWT A;  5FRN A;  3OYB A;  1RNH A;  2YJF A;  1ZYQ A;  4CGI A;  4BRQ A;  3HSC A;  1KTQ A;  3UIQ A;  3GG4 A;  3THX B;  3PY8 A;  1RT2 A;  1W0H A;  3EY1 A;  3ULE A;  3MX5 A;  1I94 K;  5KGX A;  1RBU A;  1IBK K;  4OGC A;  4O8K A;  3WNE A;  3V1O A;  4BC3 A;  2PYJ A;  2E2O A;  2E6M A;  5BRH A;  4PUO A;  4IOC L;  2X6S A;  2E88 A;  4JI5 K;  3CCM N;  3F5T A;  5FRO A;  4B9N A;  3J7Z O;  3C0B A;  5ELZ A;  5H1S Q;  4HUF A;  3WQU A;  1FXX A;  4K8Z A;  2B4J A;  5JVH L;  4H5N A;  4JRQ A;  2BGG A;  2AA4 A;  1E4F T;  2VG5 A;  4CJ3 A;  3HYF A;  2V52 B;  5DK5 A;  4DQI A;  3ZT1 A;  1UOC A;  2Q2R A;  3VQP A;  4IFE A;  4OPK A;  2B5J A;  1LW0 A;  1ZBF A;  3RVC A;  3MXJ A;  1XC3 A;  4CIF A;  3J7Y P;  3OYJ A;  2Q3S A;  1BI4 A;  2IGI A;  1SKS A;  3KK1 A;  3P39 A;  3CQY A;  3RSE B;  1NOY A;  3AVF A;  2GBZ A;  4I9L A;  4LSL A;  3D0P A;  2XHB A;  3CMA N;  3G4S N;  5CYQ A;  3RMB A;  1BDG A;  1RGI A;  3DWL A;  4E7K A;  4HHT A;  4KO0 A;  4TSX A;  3ZT3 A;  3OYG A;  1XNR K;  2G8H A;  1TK8 A;  3KHY A; 
#chains in the Genus database with same CATH homology
 3AA4 A;  4HVJ A;  3QNN A;  3V6D A;  1DLO A;  1EET A;  3U3G A;  1NJW A;  3V9S A;  1ZBL A;  2QK9 A;  4DS5 A;  1LWC A;  3AVA A;  3VQ8 A;  4EZ6 A;  3SI6 A;  2QKK A;  4KHQ A;  2PZS A;  3K5O A;  2HHX A;  1I39 A;  3DLE A;  3VA3 A;  3RWU A;  3OYF A;  1JLG A;  4BDZ A;  1SL2 A;  3S3N A;  1A5W A;  1SUQ A;  4CHP A;  2XY6 A;  4DSF A;  2YKN A;  3QET A;  3ZSR A;  3QEX A;  4OLA A;  2FBT A;  4UQG A;  1WSG A;  4IKF A;  3KLI A;  1NK6 A;  3C6T A;  3QER A;  3S3O A;  4M3U A;  4QOZ B;  2HHT A;  1FK9 A;  3O3G A;  3VQ7 A;  3DOL A;  4AHV A;  3OJU A;  2HMI A;  2KFZ A;  4WE1 A;  4AH9 A;  2HHQ A;  3ASM A;  1XWL A;  2W42 A;  2HHU A;  4KRE A;  4E3S A;  3SQ4 A;  3SPZ A;  1B92 A;  5KRS A;  3NGZ A;  4J2B A;  3AVI A;  2RN2 A;  3LAM A;  1S1T A;  3HXM A;  3K59 A;  1RDB A;  5HBM A;  5J2N A;  4CJW A;  4ZHR A;  3ZT2 A;  2X6N A;  3OY9 A;  3OJS A;  3EYZ A;  4DU4 A;  3TAP A;  3TAN A;  1HJR A;  3HL8 A;  1L3S A;  1REV A;  3TAE A;  4OGE A;  1Y97 A;  4CK3 A;  1S6P A;  4IDK A;  3KK3 A;  3ZSO A;  4B9S A;  4DU3 A;  1HYV A;  3OVN A;  1QSL A;  2DFE A;  3ZSY A;  2WOM A;  4IFY A;  3TAQ A;  4CGF A;  2YHA A;  5CZ2 A;  4CJ4 A;  1QTM A;  2P5G A;  3U6F A;  1X9W A;  4KFB A;  1BI4 B;  4OVL A;  1DTQ A;  3PX0 A;  1JLA A;  4CFA A;  3KLG A;  3ITH A;  1RTI A;  3SCX A;  4I2Q A;  4ELT A;  1Z26 A;  2YHB A;  1X1P A;  1TAQ A;  3QO9 A;  3MAQ A;  3TAF A;  3HST B;  1TGO A;  2WON A;  2G8V A;  1VSI A;  1NJX A;  3PV8 A;  4KV8 A;  3SV3 A;  4CJS A;  1GOA A;  3LAK A;  4N47 A;  1QSY A;  1SV5 A;  3HT3 A;  3KKR A;  3NF9 A;  3ZT0 A;  1B9D A;  4CEA A;  3K58 A;  2PYL A;  4FYD A;  2DY4 A;  4YFU A;  1O1W A;  3V9X A;  2DFF A;  4DF4 A;  2HHV A;  4O4G A;  1WSJ A;  4O0I A;  1KCF A;  3KD5 E;  1QS4 A;  3HP6 A;  1S6Q A;  1HYZ A;  3DLH A;  4DQQ A;  1VSH A;  2F8T A;  3OYK A;  5HP1 A;  4GW6 A;  1VK0 A;  3IS9 A;  3OYD A;  3SV4 A;  1S9G A;  1IKX A;  3KKS A;  3CFO A;  1U49 A;  4I7F A;  1KLN A;  4E1N A;  2RKI A;  1YTU A;  4M41 A;  4O44 A;  4CGJ A;  4BAC A;  2IDO A;  4KHU A;  5CY4 A;  4O0J A;  1WAF A;  1HMV A;  4DLE A;  2XRI A;  3VQD A;  3AA5 X;  3PUF A;  1NK7 A;  4E19 A;  4OJR A;  4CIE A;  4FW1 A;  1JLQ A;  2BAN A;  3OYI A;  1NK5 A;  1KVB A;  3OYE A;  2HNY A;  1KLM A;  1RTH A;  3AVJ A;  3NGY A;  4W5N A;  1R0A A;  4FLX A;  1X9M A;  1WSF A;  2BE2 A;  3HPO A;  3K5L A;  3IRX A;  1EXQ A;  1VRU A;  1U45 A;  3KLF A;  3TAB A;  4B9L A;  1JXE A;  4FJJ A;  4CGG A;  4KB0 A;  3C6U A;  3M8S A;  2ZD1 A;  4CEC A;  3VQE A;  4IG3 A;  3OS2 A;  3ZCM A;  3ULD A;  2XY5 A;  1TAU A;  3ZSW A;  4AHT A;  3VQB A;  3U3Y A;  1BIZ A;  1UA0 A;  4C8O A;  4DSL A;  4CGD A;  1HYS A;  3OYL A;  4JS4 A;  1EP4 A;  1NJZ A;  5HRO A;  4CJR A;  4FM1 A;  2I5J A;  4Z4H A;  3HPG A;  2BDP A;  3D45 A;  4IFV A;  3VQ5 A;  4HTU A;  1ASU A;  4DTR A;  4FJL A;  1BCO A;  1HQU A;  4K8X A;  3I0S A;  4CK2 A;  1NOZ A;  4CIG A;  3QNO A;  3AV9 A;  4AHC A;  2XO7 A;  4IBN A;  1HRH A;  4EP5 A;  3TWH A;  2OA8 A;  3VQ4 A;  4BWJ A;  1LW2 A;  3RTV A;  1RTD A;  4KAZ A;  3B6O A;  1T7P A;  3SJJ A;  1Q9X A;  2JLE A;  2G8K A;  4N41 A;  2GUI A;  4Z4G A;  1S9E A;  3CM5 A;  3T19 A;  4DFJ A;  3LP3 A;  1N5Y A;  3NGI A;  3QIO A;  3CYM A;  4CF9 A;  4F3O A;  1NK4 A;  3AVM A;  3OYN A;  3NF7 A;  4PWD A;  4PA1 A;  3ALY A;  2P51 A;  1TL1 A;  2ITG A;  1C1C A;  4W5R A;  3PX6 A;  3VN5 A;  1T05 A;  3PO5 A;  1BIS A;  5FDL A;  3AO2 A;  1D9F A;  4KKO A;  1LV5 A;  3OS0 A;  4PY5 A;  4F2S A;  4CF2 A;  3HM9 A;  1D8Y A;  1WNS A;  4ICL A;  3NE6 A;  4FLV A;  1ZBI A;  2YNG A;  2IC3 A;  4FJ7 A;  3AVH A;  2A1S A;  1CXQ A;  1RT6 A;  3I8D A;  4LH5 A;  2VWK A;  4G1Q A;  3F9K A;  3G10 A;  3VQQ A;  4BE1 A;  3RMA A;  3AVG A;  3RR8 A;  4OKE A;  4DQP A;  4FLZ A;  1BQN A;  1SL0 A;  4DTX A;  4N56 A;  1IKW A;  2Z1I A;  3V1R A;  1XC9 A;  3MXM A;  3NH2 A;  1LWE A;  2AJQ A;  2HNZ A;  4O5B A;  3HVR A;  4C8L A;  2E6L A;  4DTP A;  2O4I A;  1CXU A;  3A2F A;  4MFB A;  4Z4C A;  3SUO A;  3WNH A;  1VSM A;  4AIL C;  4E89 A;  1Q8I A;  5J1E A;  1C0U A;  3SUN A;  4R5P A;  4CJT A;  1TVR A;  2IAJ A;  3SZ2 A;  4NCB A;  3K5M A;  4B8C A;  3SQ2 A;  3AO5 A;  4E1M A;  4DSJ A;  4DLG A;  3K5N A;  4W5Q A;  4Z4I A;  1YVU A;  2NUB A;  2KZZ A;  2EX3 A;  4RW8 A;  3VQA A;  1XI1 A;  1TV6 A;  3SQ0 A;  1VSL A;  3QEW A;  3RR7 A;  4FK2 A;  3DLB A;  4AHU A;  2HND A;  4FJI A;  3LPT A;  4MQ3 A;  1HNV A;  4CJP A;  3AO4 A;  4NYN A;  4HUE A;  4C8K A;  3TAM A;  4HCC A;  2YKM A;  1T03 A;  4FVM A;  2YV0 X;  2ATQ A;  4IG0 A;  1VSD A;  4KTQ A;  1XHZ A;  1C1B A;  3NF8 A;  4H8K A;  3DRR A;  4Q0B A;  3ZSX A;  4J2D A;  4CJF A;  4KHN A;  1RBV A;  5I42 A;  4RW9 A;  1TK0 A;  4ELU A;  3CFR A;  1K6Y A;  2OPQ A;  5T7B A;  4JS5 A;  5D3G A;  3LAL A;  2B6A A;  3AVB A;  3LP2 A;  3ISN C;  3L3U A;  1BIU A;  1S5J A;  2HB5 A;  3VQ9 A;  4FJX A;  4FM2 A;  1NKE A;  1U48 A;  2FC0 A;  3L8B A;  2X78 A;  4DTU A;  1RIL A;  3DM2 A;  4DFM A;  4CEF A;  4DWI A;  2E4L A;  3SPY A;  1RT5 A;  3G0Z A;  1IH7 A;  1QSS A;  4QCL A;  1BGX T;  4NYF A;  3LP0 A;  2LSN A;  4N5S A;  2OZM A;  3P1G A;  4AHS A;  4HUG A;  4M3T A;  3CM6 A;  3IAY A;  1RDD A;  1S1W A;  4H4M A;  2OZS A;  2ZE2 A;  1W9H A;  2RPI A;  4W5T A;  2VWJ A;  1WSI A;  1A5X A;  4FCY A;  3NH1 A;  1D9D A;  3LAN A;  1RTJ A;  3F73 A;  5HRS A;  3PO4 A;  1WAJ A;  4QAG A;  3T3F A;  1QQC A;  1KVC A;  1SL1 A;  2P5O A;  5JS2 A;  4M3Y A;  1L3T A;  3LZI A;  2KQ2 A;  2GV9 A;  4FLT A;  2D0B A;  2VG7 A;  4CJ5 A;  4NCA A;  3HK2 A;  4AHR A;  4FJ9 A;  1RCH A;  2F96 A;  5K14 A;  4CE9 A;  3ZSV A;  2XY8 A;  4FLW A;  3RRH A;  1BHL A;  1A5V A;  3QLH A;  4GVM A;  4DF8 A;  1C1A A;  4CJK A;  3IG1 A;  4B9U A;  5C24 A;  1GOB A;  2Z1J A;  3FFI A;  5CYM A;  3O3H A;  3HJF A;  4B8A B;  3NDK A;  2DTU A;  1KVA A;  1SKR A;  2QXF A;  4CFD A;  1N6Q A;  2OPR A;  1C0M A;  4CFB A;  5KRT A;  4BDY A;  1VSF A;  4CFC A;  4KPY A;  3MEC A;  2HHW A;  1S1X A;  4KTW A;  4FZZ A;  3RRG A;  4DSE A;  3AO1 A;  4DFP A;  4DTM A;  3QEI A;  3THV A;  1C6V A;  1CZ9 A;  1ZBU A;  3K57 A;  4I9Q A;  4KRF A;  1J9A A;  3TR8 A;  5HRN A;  4DTS A;  1TKT A;  4M42 A;  3P83 D;  3HVT A;  3QES A;  4CGH A;  4DS4 A;  2ZQB A;  3BDP A;  4DTJ A;  4KB1 A;  1NJY A;  4Z4E A;  3ZT4 A;  4BE0 A;  3V4I A;  1GOC A;  3SNN A;  4B9M A;  4E0D A;  1CLQ A;  3C94 A;  1JLC A;  1NKC A;  1B9F A;  3SQ1 A;  2KW4 A;  3TI0 A;  2OYQ A;  4ID1 A;  1EKE A;  3M8P A;  3KIO A;  1BL3 A;  4CJU A;  1NKB A;  3QIN A;  4Q5V A;  1RBR A;  4FK0 A;  4N76 A;  1RBT A;  1L5U A;  2IOC A;  4C8N A;  4CED A;  3LWL A;  1WSE A;  1C0T A;  4M3X A;  3DLG A;  3V81 A;  1UWB A;  4DQR A;  5HRR A;  4H4O A;  4F3T A;  4OKK A;  3NH0 A;  4B3O A;  1UAX A;  3DRS A;  3LDS A;  4DG1 A;  1I3A A;  2A1R A;  3K2P A;  4CES A;  1WN7 A;  4LD0 A;  3M8Q A;  4GMJ B;  5EU7 A;  4CER A;  3OYC A;  4L8R B;  4RG8 A;  4Z0U A;  2G8I A;  3NHG A;  3HPH A;  4JLH A;  3WNG A;  3AVK A;  2Y1J A;  2QKB A;  4BWM A;  5CZ1 A;  4M45 A;  3AA3 A;  4DTN A;  2YNH A;  3V9Z A;  4DSI A;  3C95 A;  1RT4 A;  1D5A A;  5E41 A;  4DQS A;  3SUQ A;  5KTQ A;  4BDP A;  4CJV A;  1X9S A;  4FK4 A;  2HVI A;  1J53 A;  3MXI A;  2Z1H A;  4YNQ A;  2DFH A;  4CEE A;  3SYZ A;  1IO2 A;  2Z1G A;  1L3V A;  3JYT A;  3QEV A;  1F21 A;  3KLH A;  4B9V A;  4XIU A;  1IKV A;  2ETJ A;  3O4N A;  2EHG A;  3L3V A;  4DSK A;  1BCM A;  3T1A A;  1ZBH A;  4CEB A;  4KHY A;  3SUP A;  4F2R A;  1BQM A;  4KI6 A;  1ITG A;  1HNI A;  4FW2 A;  4Y1C A;  1Z25 A;  1QE1 A;  3LWM A;  3LZJ A;  1JLE A;  1HPZ A;  1S1U A;  4LSN A;  3L2W A;  4BE2 A;  5JS1 A;  1J5O A;  1JXB A;  3BGR A;  3P5J A;  4CCH A;  4C8M A;  1QHT A;  1S1V A;  2O4G A;  3KJV A;  1SKW A;  4FXD A;  2FBV A;  4FJG A;  1KFD A;  1TKZ A;  1HQE A;  2D0A A;  1WLJ A;  3EZ5 A;  4KTZ A;  3KLE A;  4FM0 A;  1KFS A;  1Q9Y A;  1TK5 A;  1NK0 A;  5HRP A;  1IKY A;  3V1Q A;  1RDC A;  4KHS A;  4PQU A;  2YNF A;  1JKH A;  1VSK A;  1T8E A;  4CJL A;  3OS1 A;  2PY5 A;  3PX4 A;  4ZTF A;  3KTQ A;  4KHW A;  1XHX A;  4F8R A;  2YNI A;  3O4Q A;  3VA0 A;  2OPP A;  4CF1 A;  1RBS A;  1JL1 A;  4DU1 A;  3RMC A;  4ZTJ A;  4M3Z A;  1LAW A;  3TAR A;  4B9T A;  4FJH A;  3QIP A;  4E7J A;  2G8U A;  5FRM A;  1RT7 A;  3DOK A;  1ASW A;  3MEE A;  3DLR A;  3RMD A;  1U47 A;  4EZ9 A;  3V9U A;  4E7L A;  2F8S A;  3L2R A;  2HVH A;  2R7Y A;  3VQC A;  4KI4 A;  3DMJ A;  2XY7 A;  2FBY A;  1FKO A;  1VSE A;  3DI6 A;  5C42 A;  4CHY A;  3CG7 A;  4FJ8 A;  4LY7 A;  3NAE A;  4W5O A;  2IS3 A;  3OYM A;  4OPJ A;  2D0C A;  4FZY A;  1YTA A;  5FRN A;  3DLK A;  3DYA A;  4LH4 A;  1RNH A;  3OYB A;  3L2V A;  1FKP A;  4CGI A;  2P1J A;  5J2Q A;  1ZYQ A;  4RW7 A;  4FZX C;  1JLF A;  1U04 A;  1TKD A;  4FJN A;  5KI6 A;  4NCG A;  3VQ6 A;  1CZB A;  4M3W A;  5HLF A;  4CEO A;  3O3F A;  1KTQ A;  3AVN A;  4CHN A;  3UIQ A;  3PY8 A;  1RT3 A;  4HCB A;  1RT2 A;  5SZT A;  1W0H A;  4ELV A;  3EY1 A;  1ASV A;  1RT1 A;  2X74 A;  4DMN A;  4FLY A;  1J54 A;  3E01 A;  4EP4 A;  1NK8 A;  2KTQ A;  5C25 A;  4CF8 A;  5KGX A;  1RBU A;  3AVL A;  4OGC A;  3WNE A;  3V1O A;  4DFK A;  1JLB A;  2PYJ A;  4Z4F A;  3KK2 A;  3L2Q A;  4ID5 A;  1U4B A;  2E6M A;  3OYH A;  2FBX A;  4PUO A;  2X6S A;  4CJE A;  1LAV A;  2HHS A;  4RW6 A;  4FJM A;  3AVC A;  3NFA A;  4E7I A;  4CJQ A;  3S3M A;  1VSJ A;  5FRO A;  4B9N A;  2KZM A;  3WNF A;  3LP1 A;  1IG9 A;  2RF2 A;  3M8R A;  4CHZ A;  4J2E A;  3NCI A;  4HUF A;  2D5R A;  2VG6 A;  5J2M A;  3S9H A;  1FXX A;  1DTT A;  4K8Z A;  1RDA A;  1WSH A;  2B4J A;  2OPS A;  3ZSZ A;  4CHO A;  4OKJ A;  4M3R A;  4JRQ A;  4OLB A;  1JL2 A;  2BGG A;  4CHQ A;  1LWF A;  3NF6 A;  1G15 A;  2VG5 A;  3HP9 A;  3CFP A;  4CJ3 A;  3HYF A;  5DK5 A;  5J2P A;  2Y1I A;  3ZT1 A;  4DQI A;  4F4K A;  2G8F A;  4FJ5 A;  3H08 A;  5I3U A;  1UOC A;  3OYA A;  3VQP A;  4CEZ A;  3B6P A;  3CQ8 A;  1NK9 A;  1KSP A;  4FLU A;  4OPK A;  1TKX A;  1LW0 A;  1ZBF A;  2B5J A;  3LPU A;  1EX4 A;  3MED A;  3MXJ A;  3V9W A;  5SWM A;  3AA2 A;  4CIF A;  4J2A A;  3ZSQ A;  2Q3S A;  1BI4 A;  3OYJ A;  2IGI A;  4B08 A;  3TAG A;  1SKS A;  2HW3 A;  3KK1 A;  3L2U A;  1KRP A;  4CEQ A;  4O55 A;  1NOY A;  1VRT A;  3AVF A;  2GBZ A;  4I9L A;  5KGW A;  3JSM A;  4LSL A;  4E7H A;  3D0P A;  4FJK A;  2XHB A;  1L3U A;  4DTO A;  2JGU A;  1TL3 A;  5CYQ A;  3RMB A;  4E7K A;  3I0R A;  4CK1 A;  3NBP A;  1YT3 A;  4KO0 A;  4CF0 A;  4JRP A;  4TSX A;  4HHT A;  2G8W A;  3KD1 E;  3ZT3 A;  3OYG A;  1UA1 A;  3AO3 A;  5DMR A;  4RW4 A;  1MU2 A;  4I2P A;  4Y1D A;  3HO1 A;  2KFN A;  3MEG A;  2G8H A;  3DRP A;  1TK8 A;  3QEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...