4CKBB

Vaccinia virus capping enzyme complexed with gtp and sah
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
287
structure length
284
Chain Sequence
MDEIVKNIREGTHVLLPFYETLPELNLSLGKSPLPSLEYGANYFLQISRVNDLNRMPTDMLKLFTHDIMLPESDLDKVYEILKINSVKYYGRSTKADAVVADLSARNKLFKRERDAIKSNTENNLYISDYKMLTFDVFRPLFDFVNEKYCIIKLPTLFGRGVIDTMRIYCSLFKNVRLLKCVSDSWLKDSAIMVASDVCKKNLDLFMSHVKSVTKSSSWKDVNSVQFSILNNPVDTEFINKFLEFSNRVYEALYYVHSLLYSSMTSDSKSIENKHQRRLVKLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Vaccinia Virus Mrna Capping Enzyme Provides Insights Into the Mechanism and Evolution of the Capping Apparatus.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Transferase/hydrolase
molecule keywords MRNA-CAPPING ENZYME CATALYTIC SUBUNIT
total genus 102
structure length 284
sequence length 287
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03341 Pox_mRNA-cap Poxvirus mRNA capping enzyme, small subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11680 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ckbB02
4CKCB 4CKBB 2VDWB 4CKEB
chains in the Genus database with same CATH superfamily
1G7RA 3FPGA 3AEQA 4RTSA 3R9XB 3T3IA 3P0EA 1VKNA 2YWDA 3GRRA 5L40A 5JYCA 3H4TA 4UEQA 4I9GA 5ELLA 2PFGA 3A6JA 4PO3X 1Q6YA 4OXYA 4LF4B 3GFFA 4YAIA 3H2YA 2BZSA 2QRGA 3NG1A 5ECYA 5BOVA 1UKVY 2PD6A 3GCZA 4LMAA 4Q1EA 1YDMA 1OBCA 2FN3A 4HGNA 1BGWA 3D3QA 3T3GA 1NGSA 4JA2A 4B73A 4DQUA 3SC6A 2Z5VA 3EGIA 3ZWPA 4MUYA 4MDEA 2A0XA 4DREA 3I04M 1NPDA 4D5GA 4C43A 1X92A 4FI3C 3C8ZA 2DFPA 2J09A 2WWFA 2HA4A 1YO6A 1IK6A 4KWIA 5JI2E 2IZ5A 3IT2A 2WM2A 4DYVA 2X0IA 1AF7A 3TRKA 5KHAA 1PGQA 1TFUA 3OECA 5TQ2B 3CNBA 3H16A 4HVLA 1HRKA 2OAQ1 3LDHA 1H0RA 3S28A 2QGFA 4URYR 1DKQA 1D9XA 5E9JA 4LF6B 4E4RA 1XVVA 2GEFA 2I03A 4IOLA 4JWKA 1J8MF 2IVFA 4FYKA 1YB2A 3GLQA 4LOLA 5G1NA 3KEQA 4FM9A 1TAUA 1X13A 3W2IA 4G23A 3UAOA 1JXOA 5EKDA 3HG7A 2ZYGA 2C42A 2UZ1B 1LK0A 5IJZA 1D6SA 4EPRA 3QIAA 1GZUA 5LU8A 1S2IA 5IBQA 4Q9IA 1MC4A 1TF2A 3U26A 3BJRA 1Q7CA 5JJIA 1MG0A 2VPYA 3OQIB 4DLSA 3U1TA 5H80A 5GPBA 1DDGA 5CFZA 2VTBA 4LGMA 4YJ2B 2F9FA 2YNMC 1XMIA 2QTHA 3SGLA 2CJFA 4DXHA 4ZEVA 5LMZA 2Y93A 3BFJA 3D3JA 5BVGA 4FWBA 3ZCSA 4PZ0A 1GN9A 3GB9A 4YWHA 3IBSA 1A8SA 1J1IA 4P3NA 1KETA 2YVUA 4KE8A 1ETHA 4XEHA 3RYFA 3JPYA 3WMRA 1QQ6A 3A6ZA 4FI3F 2YQ5A 4EKNB 1MFPA 4BC0A 3T41A 2FMFA 3AUSA 2ZUBA 3S8EA 1SK9A 4D9BA 2V3WA 3RYHB 5C5CA 2B1QA 2WAOA 3GMSA 4X3CA 1J0CA 3M6MD 5HIKA 6NULA 5IASA 2IX9A 4KO8A 5JT1A 3GJXC 4ZAGA 1SUCA 1AQIA 3K73O 4TL7A 4ESHA 3LY9A 4FZVA 5DNWA 1XFAA 4ECAA 4UBKA 5JMPA 3UXHA 2PS3A 2NXNA 4LCEA 1UDXA 5DTEA 4CQMD 2J3MA 4Y2JA 4DM4A 2H7YA 5GWXA 3NHUA 4RK0A 3O4RA 3QV1A 3HYLA 1NYLA 3H84A 5F1YA 4NBVA 3NNDA 5HNKA 2I2FA 2Q2VA 4IEIA 2PGAA 1BCSB 2CHQA 3RK4A 2WTMA 3ADOA 5FNVA 1VSVA 4ARSA 5LP6A 4URWR 4D8VA 4F2DA 1AJEA 4DFDA 3JQQA 1M6EX 4ZP1A 3FNHA 3YASA 1JTFA 1IXSB 1F06A 3ZDRA 4YMVA 3F5MA 4ZOQI 5CFNA 1KC3A 1O0BA 5IUNC 3LF1A 4CIDA 2ZFUA 4HGOA 5G3ZA 2QORA 1LK5A 3KXDA 3TM4A 2ZYUX 3UJ9A 3KHTA 5T7BA 4FKMA 1SKAA 1X80A 3B9RA 3VHRA 4LI3X 3SHQA 2QN8A 2VT3A 4MCAA 1GTVA 1K9SA 3ICWA 2ZR0A 2PKYX 4RLFA 1BVYF 2GLXA 3RODA 1GNRA 1PR5A 1DCMA 2GRUA 4C0QC 1QVAA 4ZEMA 4MJ7A 5BYKA 2QMZA 1A69A 2PGDA 5B58T 4AZ0B 2XNDA 4CKWB 3WYAA 5LMCA 2EBWA 2W2LD 1EIWA 4X6XA 2VHJA 4OI4A 4LXHA 3T7EA 3WMXA 1MB2A 1QGYA 1V5WA 4A8JA 4B7CA 1M5RA 3DL7A 4RE6A 1SOWA 3Q2KA 1UPUA 3A4VA 1HDGO 1NF9A 1P17A 2ISCA 5LN1A 3GRVA 1NUSA 1A5AB 1VGRA 3CLTC 1DE0A 2AWNA 1R0BA 1EBBA 3PNMA 4C6SA 4P2BA 3C3AA 3VQTA 2C2GA 1RWOA 1T3ZA 2I71A 1FRNA 2IE8A 3P97A 4FFVA 4RVSA 3U4MA 1SRRA 4ZYVA 4TKMA 4P92A 4WLUA 5JZ9A 5J23A 3PWTA 1GSHA 4L78A 2WB2A 2Y1KA 3F7OA 4LXUA 4YPFA 3AVXA 3D6HA 2D06A 2OILA 1SPBS 2P4HX 4FC6A 4H7KA 2X1LA 4HK4A 1MXHA 1RPJA 4KQIA 4X7BA 5IYZA 5JQGB 2MSNA 5E3IA 2EQAA 1W6RA 2FEOA 2N46A 2O3TA 3MSXA 4HAYA 4J75A 1F0KA 4LS3A 4UFNA 4ALJA 4P3KA 4E7PA 1A9PA 1Z17A 4MV9A 5SY9A 4TN1A 1K92A 2WWYA 1K8XB 2EOAA 3OQOA 2FKNA 4BX9A 1NR7A 2G8LA 2NU9A 1E5QA 3HO1A 2ZROA 5LIPA 5JJLA 4OAOA 1GDHA 1U4SA 5EIOA 3W05A 3LVBA 2B5OA 1RYMA 3M6LA 3TTXA 3J7AC 1QZ3A 3I9V1 1K66A 1XA0A 3HDHA 3DKRA 5JS7A 2R6DA 3ISTA 1JIJA 3IAM6 4JI7B 1R6AA 3H9GA 4WXMA 3MG9A 4NZOA 2G7MC 3QE4A 3S1SA 1K63A 4W5JA 1B1CA 1OB2A 2ODTX 4AJHA 3HA2A 4L6AA 3DVAA 3M5DA 1WZEA 1QNLA 2X8JB 2ZJAA 4HJRA 4Y1RB 5DCYA 5HE8A 3SZMA 4BAZA 3EPKA 4NV0A 1M8PA 4I19A 3IH5A 1TJPB 3G59A 4M0PA 4YMWA 1QKJA 1W8IA 3SXJA 5TMPA 1H6CA 2CFRA 3Q3JB 1H9AA 5AJVB 4ZZIA 1AQJA 1VECA 1QQTA 1XTQA 1EP2B 2VKQA 1R18A 2ECFA 3RI3A 3E8SA 3EGVA 3TM5A 1Y8QB 2ZSHA 1OFGA 3B3FA 4G56A 4EG0A 1V7QA 3FMVA 3AW8A 4BV8A 3KTOA 1DOZA 2HQ1A 3W5HA 1EAYA 2WVAA 1QTQA 3EOBI 4PPYA 2G8NA 2FFAA 4Q66C 1CQJB 2ZI6A 3O21A 3G9XA 1WXXA 1E1MA 5KYYB 1U8UA 4QYWA 2FPRA 2W2QA 3QKWA 3M2TA 4D4GA 5AJXA 3QF4B 4KR2A 4C04A 5IWCA 1ZNZA 3ROGA 3N7AA 3RSHA 2X7JA 4CIYA 5CLFA 3D7KA 1VHDA 4CEHA 1J0DA 1GDDA 1EJ6A 1P0IA 3KE8A 3G3EA 5D3ZA 3D4BA 1P2DA 1E9AA 1SXJD 2BI4A 2VP9A 4IUYA 1KYXA 1YD7A 2Q27A 3HWX1 4IXTA 1NDQA 1W35A 4YAOA 3PQ5A 4UMVA 3ROFA 3AFHA 1N0VC 2ZIGA 3IT0A 4P58A 2J6IA 2IEGA 3K1TA 3VI4B 5JSHA 1FNSA 4HWOA 4BFWA 2PRYA 1LS1A 4KMMA 2J5BA 1HH4A 2CMFA 3RIGA 3T7JA 1J21A 3OC0A 3V46A 4KO1S 2BMJA 3QXSA 5ECGC 2RKWA 3PNLA 2WNSA 4O5OA 3E3NA 2Q1SA 4MVJE 3QNUA 4QWMA 3LT1A 2PQ2A 5DBEX 5CH5A 1YCFA 1PUIA 3R5KA 5AESA 1IEQA 5EP2A 1Z7BA 3PGJA 5IBRA 2E4WA 2R8OA 2EP7A 2I9PA 3JQBC 4N8SA 4YRQA 1TQ2A 2B25A 4REMA 3RRXA 2JJQA 4RWZA 3NBKA 4F4DA 2D4HA 2E82A 3UQZA 3H65A 1FMCA 2VH5R 2HADA 5EFZA 1NDHA 1OT3A 4UMFA 4D79A 1CFZA 2G4VA 2NU8B 2G08A 2Q4OA 2AUTA 3S2FA 1I3OA 4DMHA 1WULS 5AHOA 5BMVB 5JSFA 1J4AA 4NCNA 1NX6A 3UEOA 4PRYA 1RZVA 4BNLA 1C3OA 5IK2D 3LYUA 3LIIA 1U31A 3WRYC 2IITA 2P5SA 4MCIA 3UGKA 2ONKA 3NRJA 1G2OA 1JAHA 1WPXA 3GJ0A 1FFDA 4WLFA 4UASA 5EJFA 3EGXA 1CF2O 1G9XA 3VOTA 1FJGB 4O1MA 2QUJA 3DO5A 4TYQA 4DR4B 1MG5A 2A86A 1BE1A 4M1SA 4RWEA 2A94A 3OEYA 3OHMA 4NNOA 2P9JA 4X71A 3TQSA 4D5EA 4MRMA 3ETNA 1T4DA 5HQTA 2PGIA 1BWQA 1ECLA 2KLBA 2P6MA 2C95A 1J2UA 3N53A 1IPEA 2JF0A 1CE8A 3L7AA 1DU4A 1Z0UA 4Q7MB 3AM4A 2CV1A 4Q4JA 3DMNA 3TDNA 2GPYA 5DGHA 1JQBA 1Q7RA 1JS1X 4ZRDA 3ZEIA 7REQB 3FOAA 1QVZA 2QTNA 4NEGA 3I23A 3U81A 1PN3A 2PCLA 3IB3A 1YBAA 4RHCA 3TVYA 2QRVA 4JI3B 3PI6A 4HH3C 3K0CC 3GJQA 3ZWAA 4B3MB 4B6SA 3DEYX 4P22A 5AOCA 3WNQA 3MCWA 3F5DA 1I4OA 3PD7A 4FK8A 1MVLA 1YUNA 5CGZA 3EVGA 1YQUA 3GLFE 3TMKA 3UK0A 3BGIA 3EEIA 2JGJA 1LZLA 1KJQA 2B2CA 3D3EA 2OHHA 2MSWA 2JGMA 5GZ1A 4RJ2A 3QEAZ 1P19A 2QQGA 4N6GA 2ONJA 3OMXA 3GLHA 4Q1FA 3ZU2A 3M70A 4QYIA 3T7RA 1I94B 2QV7A 4HCJA 2Z6UA 1A27A 1K6EA 2JS7A 4BKQA 1RCTE 4KO3S 3U4QA 1O0SA 2PT6A 2XECA 1JDTA 1V41E 2ZBQA 3G2PA 4G65A 4X20A 3ODGA 5ALZA 1I2AA 2ODQA 3WS7A 4DJAA 1ZOSA 3H2SA 5JE8A 3PWSA 3GGJA 2DPYA 3LCMA 4PXAA 3UNXA 1R6BX 1DHRA 5KPJA 3G2QA 2EFGA 3QXCA 4I1YA 1RRVA 4RACA 1GL6A 1QLHA 1AQNA 4W9MC 2W2KB 3AVTA 1K8ZB 3AESB 1DC4A 1EE9A 1BMDA 2XGOA 5CPFA 3FMOB 3V8MA 4KHZA 3TW8B 1JDPA 3H86A 3D31A 3LC0A 3I5YA 1MR3F 1GV1A 2W11A 2LCQA 3UYKA 1Q12A 3F4LA 1XMQB 1NP6A 3LL7A 5CCDA 5BSHA 3WWEA 4D9KA 2IXAA 2C2HA 2ZYRA 3M4YA 1ZK0A 3H0EA 3QX8A 3ZDFA 1KTIA 3L06A 3GVIA 2OT3B 2WIBA 4M9CA 3ZGVA 4BQRA 4C22A 2GS9A 1YFLA 2XLBA 1QOZA 1KQPA 3G13A 3JAWB 2XQVA 3BJZA 1G5IA 4MV6A 4WH0A 4EUFA 4S1WA 4UM5A 1AHIA 4P82A 3LWDA 4DIUA 1XEWX 1R6XA 1N2EA 4ZYZA 1F3LA 4YI5A 1ZJ6A 3GJ6A 4EPYA 3B89A 4QE3A 16PKA 4LZZA 1V96A 1MEJA 3LUBA 1ZMTA 3N8NA 1N75A 1ZR4A 1KIFA 1JWBB 5DTIA 2GZ3A 2PZJA 1MIHA 2RKBA 2CXXA 4HDQB 2WG1A 3CB4A 3WMEA 4JUAA 1FLAA 3DE2X 3LW8A 3U5TA 2C78A 5C4GB 1CUSA 4INPA 3UK1A 5C8YB 4Z4QA 4DGSA 1JMVA 1MVOA 2CKMA 1XJ0A 2PUAA 4I99A 4R9NA 3ZHYA 5F7XA 2DBRA 4Y1FA 4D3SA 3DL2A 1OLUB 1SK8A 3HDTA 2HNKA 2H9IA 1A97A 3L8GA 2GBIA 3QWFA 1ORRA 5AHWA 4Z4HA 3V2GA 3KOWA 2OVFA 1NN5A 1YFZA 3BXZA 5F76A 5IN5A 4KBYA 4AB1A 4EG5A 5IT0A 4JJKA 4EB8A 1N0HA 4IHQA 2PPLA 2W6JA 2AVDA 4G84A 4QU0A 4ZCPA 2Z8XA 5LB4A 5KQPA 4MNTA 1RZRD 4MUFA 5CNKA 1QXSA 1TZJA 1T8UA 2QX4A 4IDBA 3RKRA 2QPOA 3ST7A 2BFPA 2H6EA 3IOMA 1JPNA 1IHPA 3LT0A 4LXYA 1FTWA 4IQ0A 2QRMA 5KWEA 4BZPA 3CJRA 4FFLA 3ZXUB 1SKMA 5L7YA 4TWBA 3W8NA 4BKUA 1KVQA 1L4FA 4F4CA 1A3CA 3DMDA 1C9DB 3DZHA 4KE6A 3MOGA 4MOWA 3N0RA 1ZKDA 1HT3A 1RWKA 1ZUD1 1I6KA 3NPMA 1F6WA 3C5CA 4KDEA 4D6XA 1SO8A 2DR3A 4Q4LA 3PEVA 1JU4A 2R00C 3ZE2B 4WNIA 4C88A 4PS0A 3U0BA 1RRKA 3FNEA 3KTAB 4NNPA 4YRCA 3OU7A 4UNIA 1GRNA 3ETJA 4J0CA 2PBZA 1TYDE 2I6TA 3OUZA 5K4AA 3T9CA 4B84A 4I5GA 3DDNA 1NV9A 3ROKA 4EPTA 3D2BA 2A9PA 4PRZA 2ZATA 1HDCA 1UIMA 4WLNA 3NIBA 3KKNA 1U8EA 3VO1A 4MQ5A 1FXSA 2VDQB 3VM6A 2XY4A 3K70C 1DLJA 2UXDB 4B79A 3TDKA 1LLCA 3GZ4A 3L8ZA 3UFXB 3D5TA 5C8ZA 3FR8A 3SVTA 2UUCB 3C6QA 4JQSA 4UD6A 3ENZA 4UFOA 4C7KA 2HCRA 3R7WB 1PWXA 1V2GA 1J7KA 3N07A 2AK2A 3P0FA 4WCFB 1O96B 4LDJA 2P4EA 2X41A 4GWKA 5FBKA 1MZVA 5EZQA 3DTYA 4BXOA 4FDTA 2QP9X 1GCUA 1T1GA 4IS3A 3TKYA 3UWPA 1YL7A 1PUJA 2HOQA 3HACA 3P2JA 4YAWA 4XWWA 3MOSA 5JO9A 4UNPA 2BM8A 1TT7A 4GC5A 2QTTA 5AKEA 3MINA 1Z68A 3C1UA 2A5YB 3AQIA 4KQKA 1JRLA 1TGYA 3I53A 3TRDA 5JSZA 5CHYA 2O5EA 2IQIA 2COUA 3SJBA 1FLDA 3K5IA 1LDBA 4ZO4A 1DAKA 2B8WA 2IEDA 5BQPA 3ZY4A 1G1AA 3CHYA 2HD4A 5T6BA 4WGGA 4EPXA 3IESA 4Q6WA 1CUUA 2JIZD 1QU2A 1ESCA 3KVRA 1BD4A 2UYCA 2Q46A 1I2DA 3QPWA 4HZUA 4YECA 1D4AA 5GOTA 3NHPA 3G0DA 1U1DA 2R8XA 1XPUA 2PZKA 2QAIA 3PQEA 1JHZA 1EK6A 5KYKA 3NVMB 1QPZA 1GG5A 4UDXX 4B8WA 4RF3A 4D43A 3BHIA 3OF5A 3RIXA 1E9VA 1GQOA 1P33A 2CD9A 3PDUA 1CC1S 3OMWA 3T0GA 3ZKWB 2GCEA 2HLPA 2QPLA 3COPA 2OFPA 3K9HA 4LNAA 4YGXB 5DBOA 4UZSA 3FGNA 3OLVA 4L7VA 1DARA 4NYIQ 5EWLB 2HA5A 1AC5A 1HF3A 3D8HA 3HB9A 4HXFB 3WFZA 5AI9A 1QWSA 2FWIA 3P4UA 3R4VA 3VYWA 1GADO 1MF7A 4BQNA 4Q6BA 5DT2A 1TTTA 2PS0A 2ZR7A 2ODEA 4YCNA 1AIPA 1JX6A 2ZB4A 3NDBB 4BLVA 1GJRA 4IXWA 2C4MA 3PI7A 3SYLA 2WUGA 4BNHA 1TYCA 3PHCA 2X0EA 1NLFA 2QRKA 1R9NA 4IIJA 3RF6A 3SF0A 1SULA 1UKYA 4RK1A 3AR5A 2DUNA 4P98A 3Q6MA 1NVMB 1XQ9A 2JGRA 5HGJA 4GDFA 3O0TA 4RMIA 2ZJ6A 3CIOA 3KDAA 4RDIA 3SDZA 5HBGA 2X2OA 3FY4A 2BJVA 1UOPA 1QRAA 4I6GA 5ENZA 3SXUA 2AL7A 2G67A 4MP6A 2B9EA 3S1AB 2X7HA 1D2CA 3EGWA 4GVXA 3KE9A 4FB5A 1BMQA 2GN1A 1KFBB 3T1VA 4EUKA 4WKBA 2VJMA 4UHEA 1JIQA 4AURA 5ARBA 4ZYXA 1SA0A 1XRNA 5KI6A 1TJ5A 2C2KA 4FNOA 2HWXA 1L5HA 3K05A 1CVIA 1SU6A 3GAFA 2XXAB 1SHLA 3ZVKA 1JMYA 1GGFA 3L4SO 2RJ3A 3K9LA 4R5MA 2WC1A 1RP7A 3Q1LA 3S70A 1P3DA 1WXWA 3KJHA 3UZUA 4R6WA 4EB3A 4YV7A 5BWLA 5J4KA 1X77A 2LDXA 3B82A 2FFQA 1UAYA 2AH5A 4BMXA 1FP4A 5IJ0A 3HKBB 1OVMA 2ASVA 3QSGA 2ZE7A 1CCWA 4MINA 2F3QA 1L5KA 3AFOA 3GEHA 5EMLA 8ADHA 2DT8A 2WWWA 4CIBA 1VMEA 2AEMA 1ZI6A 4XQ9A 3TNLA 4RTOA 4X97A 4P38A 5C1PA 3L5OA 3WTCA 3SEFA 4BJ6A 4BFXA 5AM0A 3OZFA 4S1OA 1W36D 4TUYB 3LUCA 4JI6B 1RT9A 2BMDA 1YS7A 4I8XA 3BN3A 5H4HA 3GVCA 3BXOA 3LCRA 1QHEA 2AC2A 2ADMA 3HN6A 4Q12A 4OHRA 3H9QA 1ZSNA 1GITA 1NI3A 4DMLA 2XRMA 3E7DA 4ND4A 4OKSA 3HC7A 1JR3E 1Z6PA 3QMMA 4IIYA 1AVTA 1K08A 1BWRA 3L2OB 2A88A 3AM5A 4BNVA 4WNAB 4FFDA 3PCXA 3FWPA 3A3NA 3RK1A 4MYSA 2HL6A 2VWQA 4H4EA 3E27A 2C07A 3V8NA 3EIOA 4LJ9A 1C9JA 4RUKA 2GNAA 4KIGA 2HQOA 1REQA 3R6TA 4HLDA 4QO7A 2GXUA 3PEFA 5EE3A 1TUBA 1R64A 3Q5EA 1CJVC 4BC1A 2ID9A 1V1MB 2GM5A 2HUPA 1MT0A 1A9ZA 1I1QB 2Z4RA 3TB6A 4BJ3A 3IPAA 5M29A 5A5EA 1EUZA 3UBTA 2XXBA 3GH3A 2IYYA 1CUXA 3LRPA 4W5OA 2P68A 3OZDA 4FDLA 3QVTA 2DP4E 5I3ZA 1EVYA 3SMVA 2PXCA 3N39C 5TVKA 1SFRA 3RGGA 2Q6KA 2NO9A 4EYKA 2XAAA 3U9TA 1DQSA 1YR3A 1GNPA 4KNVA 1T34A 2GA9A 5FWXB 1D7OA 4WAUA 4TKVA 2XYRA 3SK0A 1HYHA 5ALRA 4IEEA 4NONA 4BVAA 3IP8A 1W2GA 2ZUSA 4MB6A 1RHJA 3AT1A 2I3BA 3L8HA 2F48A 4W63A 1PJCA 2AYYA 3RIYA 4HX2A 4POAA 1Y3FE 2XDAA 3N5CA 2O4UX 3EIEA 1U02A 5H59A 3TS1A 3VJLA 5CEJA 4RTPA 4TSKA 1Z4OA 4NJEB 3O1IC 2EIHA 1HMYA 4IRXA 1AHNA 3HUTA 2G0TA 5EUQB 3RVKA 1JE0A 1I6LA 4RMJA 3S7ZA 4R71A 1O5TA 5AVQA 1RRGA 1YU6A 4CEHB 1G2PA 2PSFA 1OV4A 1TTHA 2UYOA 4X66B 1XLTC 4B34A 1A8HA 3DA8A 4Z99A 4O2AB 1JHAA 1IYZA 4MROA 1CUCA 2BMFA 4OGGA 4PIMA 3UENA 4CMEA 1YDWA 1JLMA 2PLNA 5IEJA 4CN8A 4LYEA 2FN4A 2PK3A 4NU0A 1MMFB 3B52X 1TAQA 3GD5A 2F2TA 1XPRA 1GR0A 4MKRA 1NR5A 1L7XA 5FXMA 3HEMA 3TXXA 3L05A 4Q3CA 1EB9A 1Y1KE 3T1QA 2F3RA 3B6EA 3BB1A 3E7WA 4ZPJA 5BWBA 3BREA 1GUAA 3T3NA 4EB6A 1ZBQA 1TC1A 4HKTA 4U3JA 3CZ9A 1NLZA 4GXTA 4RORA 1U8XX 4EI8A 1B0PA 1BN6A 1K5HA 2PZ8A 3N74A 1D03A 2J32A 3ET5A 4FR2A 4LBWA 1SC6A 3LIPA 2VP5A 1A8QA 3FOZA 1WHTB 5SZHB 2C04A 4XYBA 3WKBA 1IWPB 2X8JA 1AB6A 2OCGA 2WFMA 5K0TA 3EUEA 3E4DA 2NVWA 1XF9A 1VCNA 5AR1A 3PPIA 3DDOA 3UOGA 1O6BA 1PIWA 3OZ7A 4LZOA 3ETDA 3ZDQA 1G0OA 3TW8A 2EYUA 4MIKA 5AQ1A 1WCV1 3ZLVA 1M67A 1JHRA 3VR3A 1U1FA 3WL5A 3HU2A 4AMUA 1PZEA 1L6RA 2D1RA 2JCGA 5MDHA 4WECA 1O6ZA 1T1IA 1V9CA 3ZV6A 3W5DA 4RHTA 3DAPA 1R0WA 1N6IA 3K2EA 4KJZA 3BKWA 3KCNA 1PJZA 2AW5A 3VRHA 2WTEA 3TPFA 5L4LA 5CYOA 1T2UA 1R6TA 2DSNA 4R54A 3T3DA 5ALNA 1BXGB 4QX6A 4G0WA 3VR5A 2VDWA 1X1TA 3AL2A 3ZK8A 3BULA 1T9GR 2BT4A 1BKDR 4C2UA 1J99A 2H5IA 1XZMA 2D13A 2PMBA 4NSNA 2BFBB 1JT2A 1NLUA 1X7XA 3R0QA 3ZHVA 2H0RA 4DAEA 2G3YA 3KQOA 1E5XA 1ZA1A 1UKZA 3BH7A 3DFFA 2BP7B 1PFWA 3HBNA 4M54A 4ZT4A 4EYEA 1EWKA 3ETCA 3O7WA 2PFKA 4J16A 1XEWY 2BTQB 3C14C 5E4YA 4WZAB 3RYIA 4EG7A 2JANA 3A2LA 3C1AA 2GWRA 3DS8A 3PKJA 2NTVA 1HNZB 2XQGA 1SC3A 1NI4B 4K5QA 4PG6A 4RESA 4PBRA 1SHZA 4RIGA 5IC5A 1G8YA 1TNDA 2D1QA 2X23A 3HB5X 3JVDA 4J0GA 3HBJA 1LD3A 2PVCA 2QKYA 3G8CA 4PZAA 3TLAA 1VQ1A 4YMIA 4N5MA 4AZ0A 3ERCA 1XT6A 1Q1BA 5AWFC 1UZUA 3IUYA 3Q5DA 1O94C 4NBTA 1NW9B 3OX4A 4DNFA 3DNMA 1YCDA 1NXSA 3PX3A 3ZXYA 3S29A 3WYFA 5K0SA 5GVSA 1UMCA 1NIPA 4WD3A 3ZD6A 5AKYA 3A26A 2EBFX 4KW7A 1Y3HA 3W6UA 1E9SA 4GPD1 4EEKA 1VMDA 2IEAA 2G40A 2XE8A 1OPXA 4J4TA 2XADA 2W2MA 5KTKA 1P9OA 3HCFA 4IM7A 1UWCA 1P75A 2I3ZA 1UBNA 5A05A 4MQBA 3ZOKA 3VKHA 4IX9A 1N6OA 1Q16A 1PO7A 1Q11A 1JN0A 3IDOA 4JYCA 4LW8A 4PLFA 3AKYA 3SC3A 1FDIA 1U90A 1O89A 3LHSA 4OJNA 4J7UA 1T4MA 1J22A 5EUMA 1QR6A 1WMFA 4NC9A 5AUNB 5BUCA 4EAAA 3EXHC 4M1EA 1A2QA 3LLUA 1LBSA 1H8EA 3PUJA 4YV1A 1H1LA 3SF8B 3IOYA 2BF4A 3PQ2A 3VVLA 3AF2A 5BWNA 2J48A 2CSXA 2EC5A 5HP4A 3PYLA 1J0XO 4LJLA 1YT5A 2WJAA 2HFJA 4OB7A 3ECSA 4Y7DA 3ZPXA 1DIOB 2HAEA 2BZ0A 4U8GA 4RF2A 3WLQA 3THWB 1Q2UA 3NIWA 4F4JA 3U4CA 1IAQA 3IQGX 4L7QA 5F51A 1U8ZA 1P1HA 2G80A 4OP1A 1XPJA 4A4DA 4TVSA 3IHWA 1YB6A 4I1UA 3K1AA 4CLHA 3K71B 1F2UA 1RJ9B 2IYQA 1R8QA 1G98A 2IK8A 2QV0A 2QNBA 4OEHA 4QDJA 4OKIA 4PYQA 2B1RA 3I2GA 3N6VA 2ZTUA 2H59A 2JA1A 1Y9ZA 1D04A 4IMPA 4C5BA 2QRPA 2Y71A 3BL8A 1JEDA 3GCGA 3QXHA 5E6UA 1O6CA 4DAOA 3CYFA 3GWGA 3DEIA 3FHOA 3IA2A 3QP9A 1PYOA 4EZBA 4Y6RA 2ACKA 5L8VA 4DLUA 4OLAA 5DF1A 5B1DA 3ZEAA 1Z16A 2WUVA 2BFBA 3BERA 3NYQA 3TEMA 5JNSA 3MWGA 1I3CA 1QRUA 4M53A 1T9BA 1N77A 5KYYA 3EAGA 3ETEA 3Q7SA 2J87A 3LC7O 1P60A 4LXQA 1GQRA 1IB0A 2P0EA 4FXOA 5LYYA 1DJNA 5JRJA 3AVUA 1L5SA 4TRMA 4TV8F 4GWGA 4NABA 3K0AB 3K9FC 2HTEA 1KJWA 3ZI0A 3BWVA 5JU6A 3MYYA 5E4JA 5G0UA 4I9FA 2FV8A 1A0OA 4ME6A 5ELMA 5KTYA 2YX1A 2COEA 4OQEA 2PD4A 2VPXA 2IXBA 1DAOA 2QD3A 4YV2A 4V2UA 3G17A 2VQSA 2QSJA 5D01A 2CN1A 4CPDA 1QGUB 3ZWVA 5K6AC 3WJ7A 2BFWA 3MRTA 4XFJA 3AR6A 4Z51A 1I7DA 2QMEA 1Y8CA 4MUBA 3MJEA 4WK6A 3U9LA 4TMKA 4OLJA 4CM8A 4IV5A 4WZAA 2AF3C 5C7IO 1EDZA 2A8YA 3R74A 5CFLA 4NXMB 4FQ5A 4KXYA 1QO7A 3UQYS 2GCIA 3DVRX 2RMKA 1VGQA 2GN9A 1JBEA 4GVLA 4CHTA 4EHDA 4EKDA 1YBMA 3IP5A 2PUBA 1ZL0A 3DAGA 2AG8A 1Z8NA 1VKZA 3NC0C 5EWMA 5TEWA 5CIQA 3UHPA 4MJXA 1EFVA 5F5NA 3B1ZA 1Y1RA 4Y2VA 4FOTA 3TL6A 2H48A 4GXQA 1ZD2P 2ODNA 4M87A 2QR2A 1GARA 2V6IA 3H04A 4F2PA 1XAIA 3CEHA 1CJCA 1JKJA 2NUTB 4RVDA 2FWJA 2UYYA 4DIEA 1RXVA 3R7SA 1J09A 3N9IA 1R8XA 5C31A 2F64A 3DV2A 4M8LA 4INOA 4RTLA 4EFKA 4JJ4A 4CRWB 3VTFA 4AZSA 4RULA 3L1VA 3BBPA 4WERA 2XDYA 1HZZC 3CLHA 1N7HA 5AJYA 2Z2IA 3FDZB 3N2GB 4MV7A 4XB1A 1BXKA 3ZHXA 5MF6A 1ZM2A 1QU3A 4PY2A 4QOSA 4DWVA 1ZCAA 3SLGA 1EM8B 1TUGA 5DULA 4FX5A 3C3KA 5A4KA 3NIGB 5JD5A 3WKEA 1ILEA 2UDPA 2ZU0C 4F4FA 4TXHA 2BKAA 5LBUA 2XT0A 3COVA 4WKNA 4ZOEA 2OYRA 1CZLA 2IH4A 5HQJA 2GAIA 1V6CA 2VZEA 1ZMOA 1DMRA 1E2PA 1K8YB 3BZUA 4OD0A 4TKVB 5E7MA 1P7VA 4ZO9A 1USWA 2NVBA 2WMDA 5J5AA 5EE5B 3OZUA 3IJRA 4DUYB 3OKCA 3UJ7A 2C00A 2JFXA 1ULSA 3CX7A 1FLVA 3DOHA 4PQGA 4OXQA 3R3JA 1XZJA 4FHDA 1F8YA 5JD4A 3GO4A 4G89A 4TMTA 3VHQA 4CF5A 1Q0LA 1G8JA 2O3QA 5AI6A 3F7MA 5I7UA 4C76A 3CRNA 1B7GO 1OI4A 1PD0A 2CB0A 4UE3S 4DIMA 1QHNA 3QMVA 4K81B 2A5GA 4CTOA 3QE9Y 1H05A 2Z6QA 4G8JA 2QLJA 3KOUA 1BYUA 4G2NA 1EFAA 2WINI 1HORA 4GLOA 4LC0A 4B81A 2OP0A 2B20A 3C5HA 4HYEA 1OJ7A 1ENPA 4TLMB 4LJYA 4B9AA 5K0EA 3F6BX 5TGTA 1KPHA 1UPAA 3HS3A 1J06A 2JRCA 4NBKA 5HMLA 3OE7A 3K70B 3DW3X 4G5QA 3TLGA 4UOEA 3HTXA 1FW8A 2PLAA 5ILQA 1M0TA 1XAGA 2YOHA 3EUWA 2B7BA 3GRKA 3IMEA 3ORRA 1RLIA 3GZNA 3KT8A 4FGSA 4Q02A 2Y0DA 1HZZA 1SXJA 5FDFA 1V3UA 4XVUA 2D7CA 3DMTC 5LOVF 1ZIOA 3KYCA 3C6YA 4D3YA 4G0ZA 4W8HA 1VG9B 2JJMA 3QJ5A 2VUTA 3AF6A 3EPPA 4H3HB 2OZEA 2VZ9A 2NPOA 3WB2A 4D74A 3SVLA 1NU6A 4EUEA 1RPAA 1VJGA 2V6GA 3A3YA 1IOWA 3H2ZA 4NZZA 3FBTA 3I4CA 4M6WA 2GILA 3LQRA 4BMYA 2XTNA 3RH0A 2B4AA 4LF8B 1YJQA 4YCBA 5EFOA 2VSXA 2YXPX 5M7EA 2ZETA 4DCSA 5BSWA 3CUWA 4KBFA 4WXPA 1USVA 2QTMA 2IYLD 3ISVA 3TMAA 1B76A 5EMKA 1OGJA 4CKCB 1XVUA 4GC9A 3HB0A 1F6BA 3ZHSA 2I78A 3DCJA 3H75A 1UK8A 1X2EA 5CVCA 5T6MA 4FX2A 3SS9X 1W1UA 1F17A 3WBFA 2J46A 4UDNA 3E4CA 4WESB 2W6PA 5KS2A 5LSAA 5DSZA 4IDOA 2IZZA 2AT1A 4QXRA 1Q1QA 3RAJA 1L5FA 4NXNB 4WASA 3WGVA 2IU3A 3H1FA 3W2EA 4N0QA 1OFUX 2D59A 1V5FA 4TXNA 3RSGA 1RABA 2REXB 1IJFA 4DW8A 5BSFA 4KITB 4G4SO 1L5HB 4V0MA 3ZWBA 3OEHD 1KYTA 4IV0A 5HOQA 3QMPA 4G1BA 5CH8A 1M2HA 1LJLA 4DEXA 5TQ0B 3RM3A 2M9MA 4FOOA 5AKHA 4IGKA 3V42A 4ENWA 3PDJA 3PTZA 3ZHCA 2PXHA 3DFZA 2B83A 3W5BA 4YJ2F 1DAPA 1U3DA 3NHWA 3KJIA 3VC3A 3S81A 5LJIA 3SYNA 2FEXA 4HBZA 4YACA 1NIJA 4D02A 1M1YA 2JLVA 1OAOA 4UCFA 2WR8A 3RC3A 1Q2XA 2B6HA 1SVUA 1RHKA 2J6HA 3K70D 2HN9A 1IXRC 1E64A 1LDGA 1P45A 2NIPA 4NS1A 3CNLA 4HFNA 4V1CI 5IH7A 4B5LA 3PUXA 2D7DA 2P4QA 5BQXA 4L57A 5FLYA 1O7JA 2IXFA 3G23A 1EVQA 2BR4A 5FEMA 1C1YA 4ENPA 5IULC 4HN9A 4QEKA 3JYPA 2V58A 3R6DA 1U04A 4NMXB 1O95C 3W5UA 4KPFC 4WK4B 4CI9A 4P1ZA 3VO8A 5I7WA 2BFNA 4J0QA 4B43A 4ZV4A 4N48A 1U3CA 1CNFA 1EIZA 2WJHA 4LYYA 5I7OA 2GEBA 4FSXA 4LYGA 3GGDA 1II8A 2B2NA 5GQSA 3F6YA 4OMDA 5LPNA 3M7IA 5FA5A 3W06A 2IZOA 4FT4A 2J9FA 4DLYA 1ST2A 2QMYA 4ZQEA 1EVJA 5J4VA 2JA2A 3S1AA 1GZSA 3ZI4A 3K8QA 2E18A 3KEFA 1P3Y1 4P5DA 1GFIA 5H82A 4H1WA 1CEEA 4O2BF 5BRJA 1LXCA 3AYXB 1G291 2WP0A 1V2HE 3KZXA 4Q3KA 5AH0A 2HHLA 2SKDA 3NVAA 2H06A 521PA 3AIOA 2W83A 3UGTA 1SEPA 1U1EA 3RANA 3CTMA 3G2LA 5JISA 4TOIA 3V3KA 1K5DA 2GMWA 4ARAA 4MVJP 1KWGA 4C0HA 1OXVA 5FBRB 1PQPA 2Q3CA 3I1JA 3OHPA 1M6HA 4AJ9A 2GK7A 4D0GA 4IOMA 1IPHA 1XQWA 4Z7OB 4HLNA 3BF8A 3ROEA 3DVSX 3VYTB 1A96A 2CXPA 3V1KA 4PHTA 3CEAA 1K2VN 4EYSA 1R27A 1YULA 4L50A 2QSUA 2YVKA 3BRCA 1RWWA 3T12A 5ITWA 3ZE1B 3BBLA 2FPOA 2B1JA 1MEOA 4YAFA 5IDYA 3G02A 3R7WA 1UJBA 1U6JA 3GLRA 1NXTA 3KJGA 5DRYA 3STVA 4ZALA 2HCJB 2OORA 4Q3BA 1U7TA 1KK3A 4FNMA 2NU7B 1PFGA 4R1SA 3W8DA 1XD8A 2WE7A 3OKFA 1HDYA 2O5RA 3GRZA 4FMBB 5KNBA 1XSEA 2HMAA 2QG4A 2QUBA 4QT4A 1W5FA 2PXXA 3FVWA 3NHJA 1G20E 5HQ3A 1JLSA 1OWPA 3JQGA 5FBHA 1OZHA 1Q1NA 4S04A 4X94A 1ZS9A 3DONA 1TK3A 3AHEA 3CUVA 3PDCA 4ITVA 3PDIB 3W5VA 5E8RA 1NT4A 2AKAB 5LC1A 1PGPA 2QZ4A 1PEDA 4MTCA 3VSAA 3NU1A 3I04A 5KQGA 2BHNA 2EERA 1GY8A 4QPNA 1ZUNB 2DUWA 3IKJA 3VHLB 4YONB 4KR7A 5TX7A 1M1NB 1X8KA 1XZKA 4KGDA 4XW2A 2HSEA 1UBUS 4HEJA 4NLLA 2J3KA 3LLMA 4G6ZA 4NEHB 1NL3A 4JBXA 2V7XA 5JQGF 2Q3EA 1YBFA 2V5VA 3AFMA 2VSNA 2GXAA 2VLBA 5CNMA 1LTHR 1OHHD 2J0UB 3ER9A 1SQGA 2NOAA 2FOXA 2RAPA 3JQDA 1MRNA 2QQ5A 5IVPA 1UT8A 1YXMA 2P69A 4A15A 1VCOA 1B6SA 5CM8B 4RFSA 4BVFA 2ZIWB 4WEOA 1QE3A 2XH8A 5AM1A 1PQYA 2HF2A 1I14A 4DMKA 13PKA 4L27A 2WWIA 1U3FA 2H2DA 1CQXA 3JASB 1PEAA 2VBFA 2W8ZA 4KWEA 3Q3GE 3OIVA 2VWGA 1DZIA 1N57A 2VTEA 4X65B 4LWOA 4EG4A 4U9HS 4AYXA 4RHXA 4UTVA 2QR3A 4F12A 1LBQA 3MXOA 4NAUA 5KOJA 1WB5A 2VATA 1RLOA 1UOOA 2OXIA 3NHFA 2Q1XA 2X0NA 3KKLA 1JFFB 4LJ5A 4JGIA 1EHCA 4E21A 2VYNA 2Q5QA 1EI9A 2ECOA 2XEDA 4QFDA 4R3WA 4XVRA 9ATCA 1M2VA 4KFTA 3P9KA 4J76A 1PX2A 2QMHA 3G5MA 4NE9A 2JDID 3AFGA 1SVSA 1OH5A 3OJLA 3I30X 1Y7TA 3EMDA 3OH8A 4QGSA 5L4NA 3I4FA 5JMWA 2WFLB 3SBXA 3DLIA 4Q0MA 4UPDA 1H5QA 2P6NA 4JJ8A 4JT2A 5CT5A 3TLMA 4EO9A 4EZIA 2VHUA 1EE2A 1PT8A 5CVEA 2XOKD 2NZVG 2XWBF 5KJEA 5BNTA 4LZNA 3LF2A 5FWXA 4WFIA 1ULZA 2IHBA 1B1AA 3CR8A 3I3OA 1ISMA 3PLNA 4XJXA 5A6SA 4LJ6A 3V8RA 3AINA 2ZDQA 1PS9A 1B8UA 1DC8A 3DE1X 3QUTA 4YDSA 4FS3A 4AFNA 4XB2A 3SQLA 2GDZA 2YFQA 2FR8C 1V8BA 3T06B 3NUQA 3HVUA 1DT3A 1OWMA 1TB4A 1CQZA 4RTKA 3ZHBA 2CK3A 1QFMA 2CZQA 4KWHA 3ZU5A 4BV9A 3GJ4A 1JA9A 2I6QA 1PR6A 2Q9BA 2W93A 3NBZC 1R9MA 3OQJA 3MMSA 4G97A 2IHJA 3AJ9A 5TR9A 1BWPA 2W37A 3RVDA 5BXYA 2BFDB 3DWGA 4B3RB 5E1BA 2VDKB 1FJ2A 5FD8A 1E60A 2C8VA 1YK0A 4GHWA 3SX2A 1VJDA 4KQ2A 1K3TA 1AS0A 2JLCA 4ALIA 5L9AA 1LQUA 5DOZA 5B2EA 1I80A 4D92A 4WE3A 3IRUA 3PXXA 1U0TA 2RHHA 3UW3A 2CNKA 2OV2A 1KDRA 1Y0BA 2ARKA 2JLZA 3PNBA 2W58A 1V39A 2Q1TA 5LZ8A 3L79A 5J4LA 1SVMA 1WUTA 2ONZA 3FSGD 4KGVA 1Y6FA 1UWLA 1N36B 2Z5LA 3CVOA 4QTUB 4MWEA 3TOSA 2QG6A 4FFPA 5EZSA 3M1LA 1PHPA 2XF2A 1JQ3A 4F5YA 1YVRA 4JUFA 2M6KA 3RU2A 2ZTHA 3QFHA 2BRUC 2F9MA 3R09A 2NNWB 4LMPA 4RLSA 1RXEA 3TTWA 1SXIA 4CLEA 5IAAA 3V00A 4PAWA 2O06A 2FU5C 4KP7A 1AQYA 1SVOA 5K01A 2ZBPA 2LV8A 4H2DA 1O5IA 1GRCA 1TZMA 2P2NA 3W8RA 2O2IA 2D8AA 3IJEB 3QLEA 2IYTA 2ZSKA 3D5QA 3ENKA 4KR9A 3IO5A 2O23A 4IYRA 3X1JA 2JIOA 2WW8A 1CSEE 3O8OA 4EA7A 1H85A 4YAJA 2DBVO 2X2EA 3C74A 3CW9A 4RQBA 3GLHB 3O73A 3WDMA 1YBHA 3FDFA 3TD6A 3ZHZA 5JSQA 3OSUA 4K8RB 3FUVA 3IBTA 3IQHX 1DAIA 4IQ8A 3Q3VA 3U16A 2J3HA 5F98A 1P1FA 4X1OA 2EATA 2BIFA 2GHRA 2NVUA 4W5TA 4YUYA 3DQQA 2W2NA 1ZJ5A 2JGFA 1MB0A 3L4JA 3FAZA 1JVBA 5I7AA 1JEQB 1PE0A 1R6VA 3TQHA 1H2HA 3L0SA 4PINA 4BKMA 4CT5A 5I47A 2CFTA 4DS3A 3FHTA 2HO5A 3OTIA 2Q3BA 4U2GA 1RLUA 5B53A 4TQUS 3INGA 3GUCA 4L8YA 5JNLA 1WNTA 2EWVA 5CA1B 1M33A 3GFRA 5AXDA 1GT6A 3Q72A 4KQMA 1V26A 1BHJA 2O0HA 3L0ZA 1ID1A 3INRA 1W76A 1NRXA 2IHNA 2RAUA 2GM3A 1R8SA 3L6DA 3CNOA 4HUJA 4D3XA 2UZ4A 2EXXA 1F1JA 5JDIC 5ICSA 2I3GA 5KVCA 2GVDC 1WHSA 3UV3A 3RSFA 1PZXA 4I4TB 2GK3A 4QIHA 4Z1MD 4ZYWA 5L6MB 3MWLA 2JLXA 2OSVA 4XR4A 3HKDA 3CO0S 2NAPA 2GN0A 3KXIA 1HPLA 4MS3B 1LNQA 1PLLA 4RDHA 4TN5A 3C15C 5CURA 1J0AA 1J20A 1NF2A 3ITKA 4E2XA 5KIAA 1ID8A 4FGUA 2HNBA 1JJ7A 5EERA 2FMHA 2AVNA 1QYXA 1NVEA 3JZMA 4H59A 2OHVA 2ZUDA 2R68A 4ZU6X 4KRGA 1GKLA 4CKXA 4UM9B 1PJ2A 3TR5A 2R8EA 3L01A 3HU1A 3COWA 4RTQA 1JBQA 1JYFA 2AUMA 5I9TA 1R50A 3ENQA 2C3PA 4LY9A 1RWXA 3FIUA 3BQ9A 1ANKA 3GIWA 5IJXA 3OPYI 2QVYX 3OPYA 3H17A 4P53A 3EA0A 3OLYA 1UC8A 3PUKA 1L5YA 4EHBA 4KVGA 3ZGZA 1EDEA 5BWOA 1H4SA 5LQJA 3L8EA 1GUDA 3WKAA 5JEEA 3LAWA 3OOHA 1HOTA 1PJTA 4EO7A 5GGXA 4D2IA 1GR1A 2JFHA 4GVPA 2FW8A 1KDZA 4RSGA 3TRHA 1NN1A 3TWOA 2IZ1A 3HNRA 1G6HA 4XR9A 3ASUA 4BO3A 4LYFA 1UEXC 3D02A 5LR6A 3A8TA 1XDZA 1VDMA 3TLJA 2C9OA 3RFTA 3VC2A 4ALMA 4HRAA 4EFMA 3QWHA 3PITA 2I4OA 4LF9B 4NJMA 5EJ9A 4AQ7A 3HCAA 4JYBA 2VK1A 3BMQB 4Z0HO 3IPYA 1NM5A 2WM9B 3I8XA 3U7EB 4ZCTA 1MU0A 1X3SA 2D4AA 2DFTA 2V5UA 4GLBA 1D3AA 2HIMA 2RIPA 2B4QA 2A4KA 4MP3A 4PONA 3I2IA 2FUKA 1XZBA 4RD6A 2CBXA 2QU7A 2P35A 3KQMA 4AI6A 3TIGA 1HFKA 4J29A 3UFXA 5K51A 2HRZA 3LNCA 4K2HA 4WA7A 4TS1A 4YRTA 3DMFA 2DE0X 1SD5A 2AMYA 5LUBA 4YB8A 2AB0A 2OWDA 2HW8A 1IEVA 3PFBA 1BDMA 5H1YA 5HZKA 1EUCA 2OCDA 5JFOA 4R98A 3KSBC 1I32A 1UZLA 2P77A 4QXAA 3MERA 4GM4A 4M1OA 2AOTA 3HA7A 4G4SP 1JSLA 3ESRA 4G9BA 3O4VA 3RS7A 1NSFA 1NMQA 4IHKA 1XQXA 1NJ1A 4FTWA 4KQEA 1FFAA 3EJ6A 4J2HA 1DWOA 4DA8A 2CXNA 1VBNA 2IEZA 3BIXA 1G2QA 5BRNA 4BQOA 2PUTA 2W2LA 4LSZA 4OTZA 2HLDA 3EF3A 3EBOA 4QNRA 2DQSA 2JIZA 3FKQA 4QBHA 3KYBA 4LHXA 3ZCXA 3VTZA 4XTCS 1PVDA 5CK5A 5AK3A 3BTSA 2H2GA 4PGMA 3GT3A 2G17A 1JIXA 2EL7A 3CV3A 3LYLA 4FKBA 4ECEA 4HUTA 3RWBA 1B23P 4LTDA 1L5VA 2VDVE 3KK0A 1VJRA 2YYAA 1GPMA 2O7RA 4BLWA 2XYVA 2FR1A 4YH1A 1KOGA 2ON6A 1NQ5A 4MULA 3RNOA 1GV0A 3WWCA 1DV1A 5DSXA 3HR7A 5CDFE 4QVIA 2V7QD 1J9GA 2XJ9A 4GAEA 3RTDA 1KS9A 4U8HA 1CY1A 3T61A 4C21A 5C5DA 1ZGZA 1SWVA 5CLJA 3PUYA 1Y80A 4XXHA 3QX9A 2QD4A 4DCCA 3KBOA 4JMPA 5LLDA 2OV4A 1OLUA 3VR6A 4EF6A 3THYA 4P5EA 3TNYA 5TPZA 1T8YA 4FZRA 2OESA 3B53X 4IR7A 4XQCA 1R0SA 4ZA2A 1GZHB 4UREA 3OD5A 1T36B 4G37A 4DBVO 5AYVA 1J2JA 4M1TA 3IKVA 1A4IA 1GG8A 1ZVKA 2XUFA 4CIAA 5REQB 2YXDA 2II6A 1DEOA 4K7JA 1Z4JA 1G8KA 1Q1AA 2VDJA 2YYSA 3ZGLA 4BGEA 5HXAA 3PE3A 1CY4A 3ASVA 2BGRA 1N1DA 4RPJA 1GKIA 3PE4A 3WQBA 5AT1A 5J4HA 10MHA 1TCUA 2FWBA 4EL5A 3P52A 4ZKDA 4HTFA 1FJXA 4BZWA 2JCSA 3EIFA 2F8SA 4JXZA 3DE7X 4DUGD 2LTAA 2AS0A 5K0FA 3M6UA 2Q2NA 5CITA 4MUEA 1IJKA 2DETA 2Z83A 1ECCA 1WTAA 1VSTA 1D0VA 2WA2A 4O3FA 1ODFA 1BQ3A 4V03A 2Q2OA 4BP3A 4AECA 4K46A 2D1YA 1RRFA 3GPDG 3GA7A 4AIRA 5KYNA 4N8EA 1II9A 2GJ8A 4CEIA 3NYWA 3ILXA 4E22A 1B2LA 3JVUA 2HF8A 1J0BA 4NBUA 1XRPA 3FOCA 4PLHA 2PV0A 4HMOA 5TSDA 2XUHA 5DLYA 5ER6A 4FVTA 2J7PD 1H3EA 3B60A 2QRNA 4I5EA 1F2TA 3B1VA 1MAVA 2ZWVA 3LO5A 3QQ5A 3DEFA 4JS0A 1XZHA 3L84A 2DG2A 2MOKA 4HC4A 4D8WA 3L18A 1CP3A 1KP2A 3IILA 4C4ZA 3DTTA 2XUDA 1ZN2A 4ARVA 1P1IA 3JX9A 3M8KA 2Q9UA 3A4MA 3SDBA 4KMSA 2ZXEA 3DOJA 1M74A 2G83A 1ULUA 3SEAA 3CVYA 1NI5A 4V0QA 3FR7A 4PSCA 3QWBA 3ZN2A 1RI2A 4NPHA 2GXQA 4LPSA 3QOXA 3RDPA 3QLUC 4ER7A 1A8IA 5DASA 1F0PA 1QV9A 2HZBA 5E4TA 3CW8X 1KOLA 1GIAA 3ZXIA 3PXDA 3ZWKA 1XAJA 3UXYA 2CV2A 1HQKA 3BXHA 4K6OA 2QP3A 4EY4A 4HBGA 5HDQA 3WBBA 4PX2A 2JFNA 1NSTA 3V7UA 2P75A 1OFIA 4IX1A 4KR0A 4PN7A 1XRSB 3DHWC 4YRFA 5BPFA 5DNYB 3GPLA 5TNXA 3WLEA 4Z8XA 4D8UA 4KPUA 5FFNA 1FS6A 1KOJA 1NVWQ 1XCMA 4MYCA 4DDUA 1D0IA 4GICA 2JZCA 1NJGA 3HXKA 3OM1A 4BNYA 3RSSA 5ALYA 4DJ5X 5KWVA 4FIZA 3EPLA 3W4JA 1NN0A 3WYCA 3VR4D 3RK0A 5A2QA 2BELA 3Q2OA 1JTEA 2XMGA 2UVPB 3ELYA 1Z5GA 4C7BA 5LOVA 1CE8B 1NNLA 1EFUA 3OLXA 3RR2A 3BK7A 2NV6A 3HKBA 4OOFA 4HQKA 5I8ZA 1XKTA 1FUKA 1DTSA 1MGOA 5BW6B 3LV8A 4MQEB 1G64A 4EY3A 3UPTA 1VBKA 2LNDA 4YP5A 2VP2A 3LX4A 1AGXA 1IZ9A 4K1XA 4OI1A 1H2FA 4B76A 4GRIA 1USUA 4JOSA 4DIKA 3NHBA 1UL1X 2XXAA 4GRDA 5DHRA 2AZMA 4MV3A 4Z8YA 4E2WA 5I9NA 2ZU6A 4H16A 2V5AA 4LSMA 1Q0SA 2NV2B 5LQCA 1L1FA 4MIEA 1OVGA 3JVEA 2FK7A 1SKYB 5KHLB 3DO8A 1NVXQ 3EJWA 3FOBA 4EEZA 2EP5A 2G1UA 2C4VA 2YL2A 5P8WA 4BQSA 1NN3A 3GJRA 1QG6A 3I6ZA 2WTUA 3UMMA 4UBNA 3HCCA 1U8FO 1THTA 2G36A 3BMOA 1KOFA 4AKIA 2DTDA 1H6DA 3IAFA 4N8DA 5G41A 3UANA 2ZIEA 2EDAA 2AG1A 2NSDA 2PH1A 3W2FA 4AVYA 1XYVA 1DIGA 3Q6IA 5IKEA 4UOQA 1EPUA 1A82A 1XLWA 3OX3A 2FWMX 3V3TA 1YHYA 3KQYA 4GSYA 1YNSA 4JJ7A 5CYGA 4CLRA 2DBZA 2UVQA 3H2KA 3JWHA 4G8BA 3ZS8A 2BGUA 4MR7B 5KU7A 2QVBA 4AG6A 1ZQ9A 4FMPA 4OFXA 1JHVA 4J94A 2HM7A 3EE6A 1FSGA 5EOVA 4G1UC 1W2HA 1GA4A 4MVJF 4B46A 3A9WA 5IT9A 4PNHA 2RGBA 3ABZA 5GONF 4AZVA 5TV2A 2JVIA 3IELA 5T8KC 3SF8A 4BUCA 4BAUA 2LPMA 1ARZA 1I5EA 3QMWA 2ZBDA 4RXTA 2XKAA 4GT1A 3LT4A 2AMFA 3MGKA 3RKUA 1M72A 4ESVA 2PH3A 2PAFA 2GDJA 2I7TA 1KI6B 3P9XA 3QHQA 4EIWA 3CVVA 2ZBGA 1QP0A 2W2TA 3FNQA 4JODA 5AK4A 4ZT2A 5HKKD 2FZEA 3FIJA 4WKOA 3WIOA 2QJFA 5EHGA 3TG2A 3HPRA 4ZQBA 3AVVA 4Y18A 4II7A 3CNQS 3GLTA 3PRJA 4MRRA 1C30A 3HBFA 4RD4A 5C5IA 1H66A 4OLHA 3NOQA 3KZOA 4BMOB 1IBMB 4OG2A 2ZI3A 3T15A 4H35A 4PGGA 4L3VA 2NPIA 3BTVA 1DV2A 3K6JA 5GZ3A 3TKLA 2I2WA 1ORWA 3H1AA 3CZAA 2C9MA 1OIWA 2NP7A 1P1BA 2JVJA 3RRMA 3RAPR 1E18A 2PVSA 1TD9A 4ZODA 4KQFA 3JYLA 1FZTA 1K5GA 2V7QA 1LS6A 3HMQA 2YIDA 3PPWA 2W7TA 2HBRA 1DXQA 3K72B 1C7IA 1KI7A 2IYPA 3M83A 4Q3LA 4TLDA 3EPJA 2XBLA 3EGOA 5LQUA 4EMBA 4F1JA 5KWIA 4BBPA 2HDHA 1G21B 2JGDA 1EXMA 1Q3HA 1OW3B 1VE6A 2GKOA 2VF4X 2ZEJA 3E48A 1ZQ1A 3G1TA 3MGAA 4XX0A 2Q7OE 1P9WA 2AQIA 1CR6A 3RYIB 3U4DA 3LBHA 3KR0A 1WDLA 4QXPA 1OC2A 2O3JA 4LGYA 4V0ME 4Y9RA 5CTAA 2EQ5A 5AI5A 1YZHA 4HVAA 4UBMA 3DZFA 4ZVMA 4C07A 4F71A 1DFGA 2Q5JA 2ZWOA 4WY2A 5ER9A 3RHTA 3GGGA 2ISQA 2GR9A 2E85A 3K31A 4IGAA 1H1TA 1T1EA 1OX5A 1YQGA 3OZWA 1VPDA 3BGVA 1W2WB 2FPKA 4WCVA 2OBXA 2HQBA 2OK7A 2PO5A 5KVSA 4GMGA 3UAVA 1KP3A 2PJZA 3OQ1A 4WWHA 4EKEA 1U3WA 5A0VA 4Q48A 4Q39A 3HVRA 1BEZA 2VHCA 3T38A 2VJQA 4D9IA 1KR5A 2F00A 4KV7A 5CLHA 3NHYA 5DMHA 3CX8A 3CLVA 3V8VA 2BF7A 3BOSA 1H9BA 3R3UA 2OLJA 4MW7A 3H5AA 4DNOA 2FOLA 3MWYW 4GMFA 4A6EA 3T1HB 2OM2A 2A9KA 2ECKA 3PNKA 3SKYA 4HNRA 5HKOA 1IUOA 1N32B 2I6XA 2VWPA 4TWZA 3OZSA 1LNSA 4OV6B 3I37X 3RHZA 2SNIE 4PG7A 3NDPA 4S24A 1BIFA 4LVOA 1Z4QA 2NMVA 4F4UA 3RUIA 3GCXA 3BD9A 1VL2A 4P3YA 3ZGOA 4DJTA 2ZE5A 2E0IA 3AU8A 4PSAA 4WDQA 4CLDA 3HUFA 5B3KA 1CJKC 1KSJA 1DS6A 2PUGA 1T9KA 5HIJA 2A9VA 1MT3A 3FJOA 4WZBA 4TTVA 3MA0A 5LZ5A 2WMNB 2A57A 2D2VA 2CD7A 4I8DA 4NPCA 3C3BA 3ORQA 1XDUA 3M0EA 3OC6A 5KO2A 2FMIA 1FB5A 5HIMA 1DL5A 1F0YA 1KNXA 1T9AA 4LNUA 5DP2A 4C4RA 4A8JC 1QIHA 1JXQA 4U4AA 4FONA 2YVQA 5E2AA 5GV8A 2E37A 2WJYA 4AJJA 3QJGA 4O1IA 5I7VA 1UOQA 3RW9A 3S40A 5FF9A 5CA1F 4ZVOA 3UFBA 1Z13A 1V3QE 1XQYA 3T99A 1ZR2A 3KUUA 2HT6A 2YY7A 4TMYA 2JIPA 4YJFB 4Q9KA 5C4IA 3TBKA 2GPAA 1FXUA 1S2MA 3ND7A 2O0MA 1OREA 1I7LA 3G5UA 1DRVA 4MWGA 3THXB 1F7VA 2QDKA 4IDDA 4BQPA 4MV1A 2QRUA 1YHNA 2Z9BA 3EGEA 3I6QA 3CR7A 2CLHB 3VNVA 5BNWA 1RAGA 4C6HA 4DUPA 1FVFA 1N0WA 1ESNA 1TKCA 1LC3A 1MO6A 4FZ3A 2G6BA 1RXUA 3I09A 4ZRNA 4D0NA 1WCYA 2IPMA 1KBQA 1Z6ZA 3OLQA 5KYVA 4XWAA 5CRIA 2WDPA 4ZQFA 4EQZA 5CFMA 4DR3B 1SKUA 4KK4A 5IN4A 5IS2A 3M5WA 1PFKA 1V8DA 4IIBA 3GMIA 3ZHRA 4BX0A 4E13A 2X9VA 3DBLB 1UZNA 1DQYA 4EA8A 3N58A 2YBDA 3B1FA 1ZIDA 2ORED 4OYLA 4YCSA 2DGDA 2H7CA 3Q6NA 3VH4A 5CIWA 4A9AA 3VO9A 4QJIA 5B2FA 4ATNA 3EXHB 1L4YA 1ZM9A 5DP1A 3IE0A 4AT1A 1XTRA 1FSZA 3AM3A 4QWWA 1G3IA 1WZUA 2RH8A 1KPIA 1N3IA 4Q1VA 3DC2A 3U2QA 5CFOA 4MKGA 1Y1LA 5EMHA 3WMFA 4HZGA 4LY3A 4E5MA 4J2TA 1AG9A 4GZLA 4QYXA 3EQ9A 1MGPA 3BL6A 4KYIB 4U2BA 1PJRA 5IT4A 4RABA 4NCJA 2AN5A 2WUDA 3L7MA 3VNAA 3OQVA 2G5CA 4YQEA 4W1RA 2WA1A 4GOKA 3DZKA 5DX0A 5LP6C 4MO2A 2QHXA 4N3NA 2VQEB 4Y2GA 5EQTA 3HKDB 4R3UC 4K26A 1X1BA 1JLHA 5EMJA 3BQMB 1UADA 4JLMA 3WGIA 4C29A 4JSYA 5A71A 1JSCA 3WV4A 1OTHA 3G88A 2CEKA 3B13B 4H3VA 3H2IA 4RF4A 3SC2A 3ICEA 4I1OA 5B7PA 3U9SA 1LPMA 1E6UA 3LUAA 1F2TB 4EHHA 5D3MB 2P3QA 2DCMA 2Y1GA 4EVRA 4C4AA 1RLJA 5BN3A 2CZGA 2X40A 2ZAGA 2AJ8A 5BRAA 5BSGA 4JGGA 3WGQA 4JC8A 3FCYA 4YR9A 5F9HA 3NXSA 2HXYA 4XPIB 2C5AA 1VI2A 2R4TA 4I50B 4LHEA 1C7QA 3ROZA 1ZCFA 2EW2A 3S5JA 1N1GA 4A8HA 2WOOA 2QUAA 2BP7A 3AF0A 4G4IA 3T7CA 1JIUA 5A9SB 3COYA 3C7KA 1BH2A 4NOMA 1W4BA 5BN5B 4QBKA 3BGDA 3UCXA 3LGAA 4WZBE 3R9XA 1AU9A 4ZQHA 1C3OB 3QW4B 4OQYA 2O1EA 3KOMA 4UTOA 2ET6A 4NICA 4ITRC 3WYNA 5JH7A 3CS3A 1V5EA 1Y9JA 1GSAA 4KRFA 1HEYA 1AK9A 1P39A 3ZD7A 3CLSC 1RM4A 1NUAA 1P5ZB 4Q9JA 2NU8A 2NUAB 3O1HB 3REGA 4ERXA 1E0DA 3STTA 4F38A 4Z86A 1W5BA 4I1IA 2ZCJA 4MVJD 3C3EA 1B00A 1ZU5A 4H9GA 2XCTB 1SEVA 4Y9TA 1L1EA 3HB1A 1GA6A 4KTTE 3CM0A 1QDLB 3KJFA 4U5QA 2X0JA 3QY9A 3V1MA 3VKFA 2DMRA 2RH9B 4WKGA 3SJ7A 3WICA 4CCYA 5JXGA 1F5NA 5C1OA 4I46A 3WYEA 5CDHA 3L1IA 4MKIA 4DB4A 1P6UA 1NNSA 2B4RO 5TDHA 2AOUB 3BFPA 1J33A 3A32A 4IIFA 3E9YA 3BD8A 3H9JA 4OI0A 2A9FA 4RH0A 1I7SB 3NTRA 2IODA 1XG5A 3KYCB 3KB8A 2PUVA 4EUNA 4NOKA 1W4ZA 3MMZA 8OHMA 1S9HA 5THQA 4CM4B 3BDIA 2A4MA 1D1QA 2FPGB 3GLGE 4CGZA 3LP8A 4QM6A 2A58A 2ZR8A 4V0KA 4J4BA 3U3XA 4GX5A 1XTZA 4IFIA 5GM2A 2QZZA 4U3JB 4W1PA 1C7ZA 1M2OA 3LZDA 2Z8YM 4JEIA 4YUXA 2FUEA 2R84A 1P4HA 1T9HA 1ZC3A 2R1VA 2DY1A 3ANNA 3NW9A 4OH7A 5DKFA 3WC4A 1Z33A 4GUDA 1THGA 4MYTA 4IY1A 4DV1B 1EFPB 2G70A 5GVRA 3AHFA 5JO0A 5B1HA 3ZDXB 1GEGA 4O4LB 4E0BA 3HDGA 4R51A 2I4IA 4WMLA 2B34A 1W7AA 3TB4A 5AJWA 2CVOA 3LHDA 5KNDH 2K7FA 2WZBA 3IVXA 1CJUC 1YRYE 3IKMB 4RPIA 3ZOZA 3W9SA 1CYDA 2C1ZA 3OIDA 4KTVE 4GNKA 2CMKA 2NYRA 3AJRA 5EXEA 5C18A 5FOQA 1PJSA 1K88A 1R0KA 3BPSA 2E6UX 3G8DA 3LOPA 3Q15C 3VKUA 2OMKA 4CQJA 2TECE 2ZQZA 5LVAA 1NBHA 5SICE 3ZWWA 1QX3A 3FFBA 1OYOA 5G40A 2VG8A 1GQYA 4LG1A 3K92A 1IRIA 1YQEA 1N33B 4HO1X 3UJNA 5CVDA 1GCOA 1GO2A 1NMZA 1SPXA 2RK6A 3Q7EA 4A2CA 4MHOA 3NJ8A 4ZXFA 1K4KA 1L5WA 3OE5A 4F5WA 1HQYE 4TPKA 2VRBA 1L5LA 1SHKA 1CU1A 2F90A 2C4UA 4DV7B 4CDMA 4NV3A 4YC7A 2X9LA 3PFNA 3H3XA 3L6BA 2ZBEA 2O6LA 5H81A 3VUFA 4GPTA 3MJDA 3DMGA 4H0CA 1GNTA 3D8TA 1TA4A 2QD1A 1L8OA 2PJRA 4X8LA 4OYYA 4O4HA 5IAJA 5K1ZA 4FOLA 4JB3A 5F9FA 5ALOA 1U0OC 1ZI9A 4C7MA 3LFTA 3ZU6A 3PEWA 2ZXUA 1LNZA 2YFYA 4A27A 4AXBA 4WUTA 2PE5A 2G9ZA 2O9JA 4GPIB 5E1MA 1YZUA 3P20A 4CI0B 3R3XA 5AHXA 2A1UB 4R05A 4XE5A 2YZKA 5J58A 2ACVA 1E7YA 4LF5B 1QYRA 4Z9YA 4S05A 1Z7YA 1KJYA 2Q41A 1VPVA 2WD7A 3I8OA 1CXZA 3Q10A 5K4HA 1VIMA 2FSFA 5IANA 1GQ2A 1D5WA 3FSRA 3FRIA 3R24A 3A6LA 2GJ4A 2MSLA 1E1KA 3MGCA 1T4CB 2WV9A 2PAAA 4DRZA 2EJCA 2JGEA 3WGLA 1FBNA 1PJ4A 1E4EB 1G0NA 1SD1A 1QJCA 3UJDA 1EXNA 1KAMA 5LYJB 1AA6A 1ISGA 2OGSA 3HRKA 3TE6A 3L9WA 1GL7A 4HLUA 2DLNA 3EXIA 2XAUA 3PG5A 1UPCA 1BWSA 2ZRMA 2V55B 3FGPA 3GFPA 1PNTA 1XQ6A 1CZRA 3C41J 4MVWA 4EJ0A 4I4NA 5KTPA 1OWOA 5DLDA 3JWIA 1EG7A 4KIFA 1Q7BA 1NA5A 2ATIA 1DIRA 3E6AA 4JOBA 4BUZA 4XCXA 4RW0A 4XWTA 1TFRA 1TX4B 3A70A 4C01A 4CF3A 4B33A 1MC8A 3PJRA 1XWFA 3S2EA 1Q77A 4NFLA 5FTNA 4O29A 1Z2AA 3L0PA 4C14A 4HEHA 5FOXA 3AEYA 2XE6A 2Q8QA 1SUDA 3QH4A 1U7HA 1RRMA 2H11A 1X80B 2FLVA 3MLEA 1WUKS 4DXDA 3A9SA 3LUFA 4P32A 4X8HA 1E63A 2NTNA 2ZYWX 5DM0A 3HP4A 2IF2A 3O93A 4CWAA 4L2IB 4KSCA 4FZJA 1ORIA 3A7EA 4NCHA 3R5XA 5A3QA 4YRZA 4TTIA 1UBJS 4HFMA 3KKQA 1NXWA 4WZAE 1XL0A 2MINA 2ZSEA 2ZT5A 1I1NA 3VVCA 4KIWA 3P26A 2Q5HA 4B35A 2K4MA 2VUIB 4L0DA 4BO7A 4KZKA 2J1LA 3TSOA 1KFEB 1J25A 4IDHA 4TX1A 1QBGA 3T5MA 2QJTA 3TL2A 2AIRA 5LIRA 3UXEA 4YRJA 2EARA 3FYDA 1M7GA 1PLJA 2VUUA 1NFQA 2CSUA 4D0RA 2ONCA 3SP1A 4CG2A 1D2GA 1HLPA 1ESZA 1K98A 5B3LA 2RKOA 3AQ4A 1JIVA 3DBHB 3HP7A 3O8OB 4PQRA 5GMOA 2N9UA 5DM60 4ZI7A 2HMSA 3ZZ1A 2X8AA 2Z4TA 3VBCA 1TCVA 4L1KA 3WJ2A 2AFIB 1C9EA 1HG1A 3AI3A 1A9TA 3N2YA 2XZOA 2HY7A 3GL9A 2ZM5A 1G8SA 1U81A 3AJEA 3LDUA 4IIVA 3WO1A 1WUYA 1FYDA 2H2FA 2HA0A 1QRDA 3KYJB 1FTQA 1PG0A 4PYKA 1E2EA 4FOPA 2A33A 4X60A 1JU3A 1YZVA 3LXXA 4ARBA 2FJUA 3D5EA 1EFRD 3PC4A 4LZAA 1CK4A 4PYNA 5WRFA 4EYQA 1Y7PA 2FWRA 2JFFA 5ALKA 1SBCA 4EA6A 3F9IA 1JSZA 1WVMA 3AM1A 1C0PA 3I05A 4PAOA 1HI9A 5MFPA 2O8NA 1O6FA 2P2YA 4JLNA 4F2HA 3SX4A 1S01A 3AVOA 1T6NA 4AC9A 2XF8A 3H4MA 3LXUX 1E2LA 3AERB 2AFIE 3RKSA 4JI8B 4CM5A 2DWUA 3FI9A 1RI3A 2VRCA 2DPLA 1ISIA 2D1SA 2NX2A 1AKQA 1IZ0A 3AUJB 4TM7A 3ETHA 4OJMX 2QL9A 5CB4B 4EG1A 3JALA 4NYJQ 5GAJA 1AMOA 1Z28A 2GBFA 4XFKA 4XYLA 4ZHQA 4UEJA 3T54A 4QO8A 4YJ3B 4E14A 3VH3A 1LI4A 3IODA 1PTKA 1KR2A 2NZXA 4QU8A 3HEAA 4RV4A 3OFSA 1DRWA 4MUMA 3V2IA 3ZY5A 1WXQA 2PMFA 4LV8B 2J41A 3TINA 3K30A 4OPMA 3ZX5A 2CB9A 1SBYA 1Z7GA 2YN0A 3A9VA 3DQPA 1FNNA 4FWIB 4OJQA 3COZA 1FK8A 3VJKA 1IQUA 4RTRA 4JT4A 5HKLA 1DWPA 4M2LA 4L74A 1G55A 3SN6A 3F71A 2YFHA 5ICMA 3KQLA 1NVUQ 1W96A 3M6IA 5HG0A 2YV3A 2OXTA 3UUGA 3LKZA 4R8KA 3T7AA 3HL0A 3WLJA 1B4DA 5ALFA 4GP9A 4IP0A 4L02A 1N6HA 1OXSC 3DQZA 1WVGA 3OLZA 1K06A 3K09C 5E7IA 2H8GA 4BO4A 1MQ8B 1J70A 3MCAA 3ONDA 4RIIA 2W70A 2IP2A 3VX3A 1UODA 1YE8A 4JLUA 4DMMA 3EZ7A 5IAEA 4LMBA 2FWNA 4EARA 2HR1A 3H11B 2WKWA 3L4BC 1D1TA 2WNIA 3OFVA 4XJVA 1BXGA 4ESEA 2PRJA 2REQA 1W34A 2P0YA 3T5DA 2O2YA 4HTFB 3SM3A 3GJTA 5C37A 3UKOA 2ZYIA 1JJAA 1L5GB 1QK3A 2QM3A 2CUKA 3KWMA 4GO1A 3P2IA 1ZH0A 2V59A 3GEPA 4BWGA 1JFFA 3ESXA 1HV8A 2V6JA 2MT9A 4WESA 3KQSA 3PDWA 1YFJA 3KPJA 3UH1A 1A50B 1KYQA 1E8MA 3CZRA 4E94A 3E1GA 1V3TA 4EX7A 1JFVA 2HMWA 1NBWB 3ZI7A 2ZRKA 1CUBA 1PS0A 4IXDA 1WCIB 3AG6A 2R7AA 1VJCA 3N59A 4RE5A 3SSMA 4BKPA 4HDMA 5I5GA 3NBUA 4BNFA 4I1PA 3DAOA 4GLLA 4IF6A 1PL7A 1QVWA 4QECA 4HV4A 2QVLA 3ER8A 1IEWA 4CV3A 2EGHA 5FJJA 1EK2A 2R86A 3JARA 1E32A 1UBGA 4Q18A 5FOUA 1O8CA 1GNLA 3NDJA 4FLFA 5K8UA 4FYPA 4ND8A 3IEIA 4Q1BA 1X19A 2FMTA 3LYAA 2J9XB 1SKYE 4ML3A 3PEEA 4FWTA 1Q44A 3F78A 5DNEA 2HHCA 2A2ZA 3EZYA 2AKEA 3AUAA 1ULHA 4YUAA 2PLFA 5L4SA 4KSYA 5K3SA 1R4NA 4J0IA 3GZNB 2M6SA 3MIZA 1D4OA 1Z4PX 3KQVA 1T4BA 4IUBS 4TV8B 3RNLA 4DLLA 1P80A 3HJAA 1B93A 3OFNA 4JWTA 2WJWA 5B2ZA 4RHFA 5F23A 5KTNA 3KQHA 1UPXA 2RHJA 3NKVA 3URKA 2I22A 1ZCJA 2A5DA 4AP9A 4CKYA 3C5WP 4B5KA 5CEFA 3AL3A 2D0IA 1DMSA 2OV1A 3ZWNA 1IUKA 5K4GA 3ITDA 1T3SA 4UEWA 4MA0A 4ENVA 3M5PA 4FHGA 2H1HA 2XGSA 1EINA 2P2GA 5EQJB 3HGMA 3QA9A 1TMGE 1W0KA 1K5PA 1S1CA 4QQNA 3EXAA 4R2LA 3ILYA 5JH7B 1RXIA 2F1JA 2H1SA 2PCJA 2WWXA 4JSRA 1SUFA 1Y9AA 1ECJA 4GYKA 4KVAA 5JROA 1GPDG 2JGNA 4NJEA 3WK9A 3HADA 3TGLA 2WSMA 1Q21A 3OJXA 4DLXA 1PD1A 1Z36A 3A37A 4EGCB 4JUBA 3KKMA 1J2TA 1WZIA 5HF6A 5DN9A 1QBKC 2FR8A 2GD6A 3DD5A 2WJZB 4CL0A 5K7SA 4P31A 2P9CA 2Z3VA 4I6JA 3G9UA 3EEOA 2O8DB 5DFAA 2NSHA 1VMIA 5KQLA 4Z4IA 2BKLA 4K40A 2D62A 2IKSA 2PGOA 2ZPAA 4Y1RA 3KS9A 2Y68A 2WVJA 3NNSA 4ROSA 5DYNA 4DVJA 4A6DA 2Q0QA 2Q9AA 5J9FA 1ZESA 3MWFA 5KOHB 4YRBA 3NRBA 1L0BA 3GFGA 4Q1AA 1RPTA 3PC3A 4RY8A 1EK5A 3FPJA 1O4VA 3N7UA 3IFSA 2ZT6A 2PIAA 1QLJA 2NZYA 1VRCA 3DPUA 2OE2A 2OHGA 1IM8A 4F6RA 1REQB 3B6ZA 2P91A 2P9TA 3NFRA 4X20B 1MEEA 3MAGA 5ALXA 3RLIA 4U6SA 3A05A 3PF9A 4BO8A 4XIFA 1FEZA 3SR3A 4ZHQB 2GSDA 4RGQA 2EKZA 4ZEOA 4QATA 3AHDA 2QVCA 4Z4FA 1KI2A 1KI6A 3QI2A 1AV6A 1LLFA 2F8LA 1W59A 3OQ6A 4H77A 2A59A 1N7IA 2W71A 4FD3A 3UT6A 4DLPA 4XVCA 4JVNA 1X70A 1YONA 1I3LA 3CF4G 3L0CA 5TGZA 4JN6B 1NX9A 5BR7A 3NTVA 5AVJA 2FPSA 4ZAVA 2CWDA 3JQFC 4FJ2A 3I0MA 3VPBA 1XCGB 4D25A 621PA 2EF1A 1N2HA 4RGYA 3EA4A 3EYWA 2C92A 4QLBA 4W8OA 1C0KA 1G5RA 3RRYA 5A4AA 3EXHA 2FVXA 2O8CA 1Z0ZA 5I7FA 4DT1B 3DCYA 2P40A 2QYOA 1CS0B 3UCFA 5PNTA 1NV8A 3HZRA 2G1AA 3AETB 3V8QA 3LLVA 5JAQA 4CU5A 4XWKA 1ZUHA 2RDMA 3IL2A 1KIAA 1NW4A 1UMBB 2D3TA 4IDAA 5B6JA 2WE8A 1P77A 3GPIA 2I2BA 4X90A 2X8LA 1HYGA 2GLUA 2ZE8A 3IMCA 4M21A 1T8PA 1VZ3A 4NP6A 2W2XA 2ZAIA 4MKZA 2W4QA 3CWCA 1Z29A 3LY7A 1KAQA 1YS4A 2Z57A 1HGXA 5CK4A 3H2BA 5K3EA 4PYOA 4CV1A 3P9RA 1M0SA 2FZLA 3WIUA 3A4YA 2ZJZA 3LHIA 1OZAA 2ZCUA 4RJIA 2P27A 1KFJB 1L5MA 4OQFA 3RC1A 1ZMRA 3GUYA 1QIMA 3AVYA 1RYHA 5EIHA 3FYSA 3DM5A 4K87A 4Y2XA 1MH1A 2V3VA 3KJXA 1EVKA 1KQNA 4B87A 4AP5A 1JLLA 4Z5XA 2CJYA 3BC1A 2C7OA 1YRAA 2IBTA 1IB6A 1TYAE 3RS5A 5K8TA 1LW7A 1H8ED 3JW8A 4E31A 4QFMA 3UM9A 1FRQA 1M8GA 1YB1A 4L8FA 4NPAA 4IUCS 2CHEA 2BHRA 4LDZA 4QODA 4AULA 4E3WA 1QP4A 5EG5A 1R10A 4W8GA 3SG0A 2RG1A 1N5JA 3JD0A 2Z09A 4IJWA 2C7PA 4MYRA 1E2HA 4OFBA 3EY9A 3WLTA 2XTJA 4N4AA 1Y4SA 3ZQ6A 3ZZMA 1E9BA 5EYPB 4C3OB 2G4CA 2QE7A 2H31A 1NW3A 2WFAA 3MJFA 2YYZA 4PC2A 3JR7A 1UPBA 2GZMA 4KH1A 1E9EA 2EFHB 2CFCA 1I3NA 4WZ6A 1VCIA 5IJ9B 5E2IA 1WXGA 4YI3A 1SVKA 4Y0NA 2C2BA 1RKXA 3W3AA 4AS1A 4UAJA 3ZNOA 2X19A 5AW0A 4X61A 1EMDA 1XU7A 4QC2A 4BHTA 5I4KA 1C41A 1IBSA 2HYDA 3CH5A 3F5QA 4ZEXA 1M8FA 4D9CA 4FEAA 1MX9A 4CMEC 3N2EA 4IRMA 4BLTA 4R2WA 4I50F 4A2QA 2P9FA 3ND8A 2OZPA 3KU1A 5LFAA 3B51X 2AXQA 4JYMA 1RBYA 2NU6B 2YC2C 2HX1A 1G63A 4LXGA 4RKEA 2DB3A 2A1TR 3OIGA 5T41A 2OC9A 1ZN8A 5EL0A 2BMWA 3FMFA 2YHUA 3T1TA 3RU3A 1S8FA 4YVFA 1BGVA 1DAEA 1XXLA 2GEDA 4JLOA 1EJ2A 3UPDA 3HA5A 1QUEA 3DDSA 2TS1A 4W1SA 4N47A 3U60B 1X15A 4Q7EA 2UXCB 4ZYYA 3EVTA 4NAVA 3W6NA 1WW8A 1UBTS 2HPAA 2PX5A 1UDAA 2QMQA 2ZW9A 3EHDA 3FCUB 4OREX 1US8A 3IOCA 4GBED 1QE5A 1T5TA 3DLBA 3SC4A 2I3DA 3JQ9A 1DKMA 1DPFA 1RACA 1TK9A 2RHBA 3QKSA 3TNDA 3ZD8A 4HQOA 4R69A 2YJZA 2FZ4A 1FYVA 2ODWA 4M60A 1UIRA 1QH8A 2ZYAA 3M9LA 3PXCX 4LCBA 1WR8A 4O4HB 4PO9A 3P2OA 4UQOA 5CH3A 5A7FA 3OP1A 5BUZA 3JWEA 1F3OA 1TZ2A 2XNSA 3O8LA 5HKBA 2NGRA 3EUFA 1G21A 3IOEA 3AKEA 3I83A 3KAQA 3MWEA 4WFJA 4YRGA 1GLGA 2ERCA 3DLPX 4H6VA 4ZI5A 2H4XA 1YIOA 1FFSA 2V0NA 5L51A 5TLSA 2YMQA 3TLEA 3UPUA 3QY0A 2BGGA 1WY5A 3KELA 2H1LA 4XFDA 1SU7A 5KKAA 2OFFA 3UT0A 4MVJI 4YRDA 5DGXA 3FOFC 3TCNA 3CZCA 5CDGA 4YP9A 3EZ2A 3FOWA 4MQ6A 3Q0IA 2IYNA 1EWVA 1G41A 1MAHA 1ZMBA 2J9RA 3KKPA 4L85A 2GK4A 5TS2A 8LDHA 1IHXA 2ONYA 4B6EA 2IX3A 1A77A 4DCPA 1JFLA 2QN1A 1M6NA 1XCLA 4PTLA 1GGEA 4EMUA 2HI0A 2BEWB 3X3HA 1F20A 3ZU3A 3MPUA 5REQA 2AD5A 1YJCA 1AHPA 4DE5A 3BA6A 3FRJA 3PHJA 3DFIA 1LX6A 3I42A 1GM5A 1JECA 4GRAA 3UHFA 1T9CA 4ZYLA 1ZJWA 3O83A 3EZFA 1ESDA 1MOSA 3IVCA 5IFKA 3ZWXA 1ZJYA 1DKPA 4GPZA 2LZ0A 5GOZA 4KXUA 1JAIA 2VYQA 1RVV1 2NZUG 2R8BA 4OP2A 4PYRA 3GJ8A 4MCHA 4Q7QA 5CIYA 4JI0B 2DZDA 2GEKA 5HTKA 1MNAA 4IF4A 3VOAA 4TXJA 3VPXA 3QFSA 2ZOSA 1K7XB 1G18A 2R1VB 3KSDO 3RG2A 1TJ4A 2A5JA 2PANA 2Q5EA 4IDCA 4PAGA 5K0BA 4RF5A 4MDYA 5HS6A 4DL9A 4MW0A 1RJWA 3GARA 1NJ6A 1Z26A 1B0AA 3ABRB 3LL4A 2DPXA 2IPLA 3LLSA 3K9QO 3CRVA 3U37A 4FN4A 3IAHA 4K9MA 3JARB 4A8PA 1ZW6A 3VZBA 4K0KB 2VDNB 3IEPA 2JASA 1O97C 2B3DA 2R25B 2QF7A 3OETA 5ADWA 2EFJA 2AOUA 4XPZA 1AXRA 5A0TA 1VRWA 1QLWA 5GJCA 4KFUA 4PICA 4M0CA 3EVCA 5HGXA 1VBMA 4EBBA 3GEIA 5EIFA 1U1IA 3CSUA 1CUAA 1EK0A 1NYRA 1M2JA 2ZRFA 3CZ4A 3T3EA 5A4JA 3ML1A 4TUYF 4ZK6A 3UAXA 2WFZA 3LP5A 2ZBFA 2C0PA 2RH5A 3TQTA 3DTVD 1FY2A 1Z0FA 2PYDA 3CBQA 3UWDA 2Y27A 3CVUA 1YR7A 3ICOA 3RYTC 2JAUA 4C03A 2WF7A 3CPEA 5FNVB 1H2XA 2HU5A 5BR1A 4O4IB 2PX6A 4CVNA 3HB7A 1A88A 3D7LA 4BLUA 4Q3AA 2C98A 5JI3E 3AHIA 5IAOA 3SHTA 2Z5GA 2RGGA 5BYJA 4M7RA 1TAHA 1XWWA 5EP3A 4AROA 3FTEA 3BMNB 4RJJA 4D9GA 2KMLA 3EG5A 1XXHA 5HMMA 2ECQA 2OWEA 3B8HA 4E15A 2HRQA 3MJTA 4BNMA 5AW4A 2Y1FA 3AWIA 2FUCA 5FLXA 2VWHA 3L92A 3M4ZA 4IDPA 1PDWA 5DJ5A 3TAXA 1P31A 3IDZA 3EVFA 5IKOA 1JE1A 2ZSDA 2E5WA 1U8AA 4QJ3A 2BH2A 4MQFA 2ICAA 1TT5B 3ZC3A 3ACCA 4GNRA 5CG1A 3FUXA 5TE9A 2J3LA 3WIVA 4AAYA 3P2YA 1G8PA 1B6TA 1UFRA 4PRKA 1O5OA 5K2MA 4X93A 1IATA 3CJQA 4QGBA 4AKEA 2C7QA 2WYIA 1U9JA 5IJ9A 3KQUA 3RYFB 1NUPA 1DQPA 4OBWA 4CNQA 4E1AA 2HSZA 4IQGA 1VKJA 3OBIA 5J2UF 3KKEA 5MGNA 2IYWA 3WSTA 1L6IA 1YHZA 3NANA 4U9UA 3ZCQA 4JY7A 2AWOA 3LNTA 1HWYA 1YA4A 4IOJA 1Y9EA 3P32A 4ZV9A 1OFUA 2OQVA 1NBMA 2VAWA 1WE2A 3Q0TA 2WM8A 1WS6A 2IDKA 3KAPA 4X62B 4O2BA 3K4QA 3FD8A 5DYIA 3QQPA 1X14A 4FE7A 1FLNA 4PW0A 2YXNA 3TAHA 5IZCC 3PC6A 1H1LB 3CGWA 1Y37A 2PX4A 3ORSA 1JIIA 2DM6A 4M8KA 5IAGA 4EHAA 4YMLA 2B5WA 3GUVA 4YT2A 5CW1A 2C8KA 4UBJA 2QEQA 2F7SA 4QUDA 4XLTA 5KSPA 2O8FB 1XVTA 4BN4A 3S4YA 2GAJA 1A5BB 2P6UA 3JQ8B 1PT6A 3I6MA 3MUFA 4KCGA <