4CKCB

Vaccinia virus capping enzyme complexed with sah (monoclinic form)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
287
structure length
284
Chain Sequence
MDEIVKNIREGTHVLLPFYETLPELNLSLGKSPLPSLEYGANYFLQISRVNDLNRMPTDMLKLFTHDIMLPESDLDKVYEILKINSVKYYGRSTKADAVVADLSARNKLFKRERDAIKSNTENNLYISDYKMLTFDVFRPLFDFVNEKYCIIKLPTLFGRGVIDTMRIYCSLFKNVRLLKCVSDSWLKDSAIMVASDVCKKNLDLFMSHVKSVTKSSSWKDVNSVQFSILNNPVDTEFINKFLEFSNRVYEALYYVHSLLYSSMTSDSKSIENKHQRRLVKLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Vaccinia Virus Mrna Capping Enzyme Provides Insights Into the Mechanism and Evolution of the Capping Apparatus.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Transferase/hydrolase
molecule keywords MRNA-CAPPING ENZYME CATALYTIC SUBUNIT
total genus 89
structure length 284
sequence length 287
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03341 Pox_mRNA-cap Poxvirus mRNA capping enzyme, small subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11680 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ckcB02
4CKEB 2VDWB 4CKCB 4CKBB
chains in the Genus database with same CATH superfamily
3M1AA 4QVGA 3QY0A 3K9LA 4L51A 1LSOA 3A9WA 4CDMA 1DEHA 1ZU5A 1Z29A 5I7HA 4ARCA 1L7OA 3HVKA 3TRFA 3CB2A 5KJ6A 2Q46A 2VF2A 1NM5C 4IXNA 2IZ6A 3I92A 1OXKB 5JNSA 2AHRA 2IUUA 4BVKA 5A9SA 1RE0A 4BX2A 1JYEA 2GZDA 1I10A 1WXHA 3HXOA 3G13A 5TB5A 1V9LA 3KVNA 1MQ9A 4LUCA 3JD4A 2C9CA 3HMKA 3WADA 1YJCA 1ZCJA 3RVKA 2BIFA 1D1QA 1NU6A 2OGWA 4ESOA 1OFGA 2ZAOA 4LS3A 4A36A 3DULA 1H8ED 2NU9B 3FAZA 3QJGA 2BDUA 5C8ZA 1YRBA 3D4IA 3GRCA 1XCPA 4CKCB 2GM4A 5DK4A 2PUTA 3FSGA 4MRMA 3LYLA 3FVVA 4HMQA 3RUIA 2XA9A 4BFVA 3L43A 2C8VA 1NW8A 3SE7A 3GLHA 3A28A 1XEWY 3U3MA 3UQYS 1PR5A 5TQ2B 4F7DA 3DBHA 5AM5A 1OLUB 5BQ5A 1EE2A 2OHFA 4KX3A 4B6GA 4MJ7A 4D8YA 4KQIA 1GUFA 3RS3A 1AUVA 2DWPA 4NZYA 4MARA 2OORC 4J2HA 1K8RA 1XPRA 3A70A 3R7AA 4I5GA 2Q28A 3MTAA 4L4SA 3QTBA 1AMOA 2ZJ7A 1CS0B 1JLSA 1Z73A 3H4VA 1MFZA 4GVLA 1BDIA 4F72A 3R8CA 1N2IA 1UXIA 1M1NA 4QXMA 4DMRA 2GQ0A 2WF9A 1ZS9A 2V7EA 5BN5B 1EIWA 4ZIRB 2ZUFA 1Z2CA 2CHFA 3S2ZA 3D64A 1T13A 2G0TA 1KZ7B 2Z6VA 3FI9A 5I4BA 1XRJA 3IKLA 3B1FA 3B9BA 1YRWA 5IVDA 4OI2A 5EEGA 4X64B 4FCWA 2FW7A 1XRNA 2BTOA 4RACA 2X14A 10MHA 5D6NA 1IB0A 3WMFA 1JE0A 4BX3A 1NGSA 3LBHA 4CLOB 3ONEA 3DTVA 3KJGA 1F0PA 1Z2AA 1C8KA 4GOLD 4DIUA 1QP0A 4V39A 5EIXA 1ZW6A 2ILVA 4I1YA 4IJVA 5EKDA 3SF8A 1DIHA 3SS8A 4D3ZA 4XKJA 5ECGC 1JG2A 3RJZA 1CQJA 3ZY4A 5INTA 4M46A 2IE0A 3UGQA 1NVDA 1L5LA 2WVAA 2QZPA 2B1GA 4QPZA 4FFMA 2CE2X 4XGKA 4HZUA 4RMHA 1E2DA 4JLVA 1YJBA 3KSDO 2G70A 4PZYA 4DGQA 2DKFA 3AB7A 1C7QA 1QVVA 1J0EA 1CJVC 1JSZA 1N2JA 1SAYA 1SEPA 1Y3IA 2FH5B 2ZYHA 3DZDA 4FGJA 4OUDB 5CCDA 6AT1A 1GN9A 2F8TA 2H1FA 3IV6A 3GQBB 3I9V1 3GUHA 3CEAA 3IT2A 2F1HA 3VJMA 4B2IA 2C94A 1LWOA 4V2UA 5E1BA 5TT0A 4G8BA 2VT7A 1N2SA 4URVR 1PGJA 2QTGA 2UYHA 4UQPA 1WS6A 4MW2A 4TRMA 3FSEA 1A8QA 1VLZA 1DTEA 2B9EA 2RHRA 1CRQA 3IPRA 3FGPA 4LBVA 2QN9A 2N42A 5JI3E 1IMOA 1X80A 4HYYA 4NYIR 1ONSA 3COZA 5KOJA 4AKIA 1HR0B 3MELA 3IIMA 4GGOA 4WVLA 5IX8A 1SCAA 4A1OA 3NHJA 1L5QA 2DQZA 4DA6A 1L8OA 1I9CA 1RWBA 4XIFA 2P2NA 4PNEA 1PZMA 3RCBA 5K0JA 1ZMXA 5FUQA 1XELA 4MLCA 3GDGA 3TD6A 2QZ9A 3FVWA 1G38A 5REQB 3UAOA 1TCVA 3TX2A 5LB2A 2C84A 3E4DA 1OIVA 2IYYA 3DBIA 4N5HX 5BNTA 4EZIA 5ECYA 2FW9A 3AOEA 3Q6NA 3VPFA 2F64A 1NUQA 1TQ4A 1Y9EA 4LBWA 3UWDA 1O08A 2CJPA 2D59A 3PGJA 4MYHA 4B43A 4BOYA 1XLTC 2ID7A 1II8B 2LCIA 2V97A 3O38A 3BJEA 3F8SA 4RLFA 4EKEA 4JJZA 2B82A 1EVZA 1P62B 1ZPDA 3RYCB 1E1RD 1PV2A 2A0YA 2ZJ4A 3BXGA 1IJFA 1XCGB 3B2NA 3HA3A 4IHJF 4RA6A 3TLBA 4ITUA 4BHTA 2HF9A 1PR6A 4F9FA 3I4FA 5EWLB 5L7WA 1WVIA 2D5AA 2ID4A 2VPXA 2WKWA 3AGPA 2Q21A 4PZZA 4W9NC 2ZR9A 2O1SA 3GEMA 1WUYA 5AUQA 1C3EA 1SQFA 3TRKA 5A4AA 2AOXA 2I34A 1ZGJA 1YONA 2ACWA 1RI2A 4J3FA 3EOBI 4XQEA 5CB8A 2ZKLA 2X2OA 2R8OA 2R85A 3LYUA 3OJWA 1KO8A 4J07A 1CDZA 2NVBA 4H0CA 5TY0A 1PWEA 1EUQA 2B1JA 3C3JA 1E2HA 4N9QA 2GTIA 1X15A 3IJ5A 2YXLA 3IMGA 3IEKA 1O0SA 1KP3A 2YX1A 3ZEIA 2WFAA 4RQTA 4UEKA 1TUIA 1Z18A 1T5BA 2IYTA 2CXOA 1KKUA 3ZPXA 4EO7A 1QQTA 1RLIA 4CMCA 4CVNA 2B7CA 3DS8A 3PNLA 2Z04A 3ETLA 3JQRA 3V8VA 5BWBA 2RHWA 3BXXA 4BXOA 2R86A 2DUNA 4B3DA 1T9KA 3BBPA 3SDBA 5HRUA 2VK1A 5F35A 2RE8A 1Y1KE 2PS1A 5KHLB 1VIYA 3O84A 5A5GA 1JPVA 3GLSA 4JKOA 3R0ZA 5TR9A 5TPZA 1XZCA 2OC4A 2OORA 3B8EA 3NJ8A 4UNIA 1ZVJA 3LDUA 4ZYZA 4IINA 3BK7A 3SOZA 1OBHA 4ACAA 4KOEC 4DCPA 1H3NA 2BMFA 5KDDA 3UMBA 5B4VA 4RHXA 2P2SA 4I3FA 3U3RA 3SDZA 4N82A 1WABA 3RGGA 1MW8X 1PT6A 4IXMA 3PUZA 4W8HA 3THYA 1YDFA 1ONPA 1R0BA 2YMMA 5LSAA 3BHIA 5DE3A 5IVHA 1X6VA 3DWEX 1W34A 2X76A 2W2KB 3OPXA 2ZOSA 4J1SA 4L75A 1AURA 3IUJA 4E2YA 1AUOA 4QKQA 1DG3A 4NMHA 1JJAA 4WK6A 4R7GA 3G5TA 4PYQA 5ALLA 4DY6A 1KZ4A 3GRKA 1SKYB 2SECE 3O8QB 4EO9A 1A69A 5EZYB 2WHXA 1AF4A 1Y3HA 3QE4A 2C7GA 1OBFO 1PJ2A 3AUUA 4IDBA 1XXLA 5FYQA 1VB3A 1A5AB 3HKCA 1G7TA 4WZZA 3VYUB 1WSBA 2XH8A 4NIMA 4CBVA 3EC2A 3ZI0A 1JQ5A 4ZYTA 3GZTB 3U4AA 2QMZA 2IOQA 4CCWA 3A37A 5AK0A 1CE8A 2PUHA 1TJYA 1U6JA 1U2RA 1ZITA 2XAUA 1R0WA 2WTEA 3DXFA 3ER6A 2XHZA 4HWKA 1IN4A 1FFGA 1H1DA 4GM1A 5CDUA 1F7UA 4K5QA 1GCAA 1O94A 4FK8A 3U81A 4O2BF 2GCPA 3CZCA 1HA3A 4CKWB 2JHAA 4IP0A 1T4GA 3J7AC 4XYMA 1QO9A 1UPTA 4UBMA 2JFUA 1C9KA 2YH2A 4IRXA 4PNZA 4JT9A 2JFWA 4MI6A 2XCRB 1SZCA 4NBNA 4XI9A 3H9JA 4I6JA 2ZBVA 3O82A 4X6YA 5EP1A 1NUTA 3DEKA 3RTCA 4ZI7A 5A3SA 3U4CA 2ZWIA 2IK8A 4I5FA 5DWDA 1YU6A 3V9AA 3A4IA 3RWOA 2WVHA 4IGEA 2VYQA 3MMXA 3UAXA 1W1UA 2V98A 1M2KA 2G1UA 2IYVA 1SGWA 4QDXA 1BJRE 4FHDA 1BXGA 3L9XA 4LXTA 4QVKA 4AULA 1ZH0A 3KOOA 4OA8A 4O2BA 2ZIXB 4RY0A 1VQ1A 3T9AA 4OG2A 821PA 2J8ZA 2G80A 3LY7A 1TKCA 1Z2OX 3QA9A 1LSSA 5CDGA 5FDFA 4PG8A 5K2OA 1A9TA 4G86A 2AEFA 4QNNA 1WR8A 2GEDA 3WAGA 1YVEI 5B1YA 1SKYE 2VBIA 3REQB 1ZK4A 5KTPA 4QHTA 3GJXC 1BH6A 2NSDA 5FV7A 3OLVA 1IEVA 1TB4A 4IDNA 1G5FA 4OX9Y 4NMXB 2ZRHA 1O58A 1Z6ZA 4MQ4A 4RA9B 3WMRA 4TZ6A 4IJUA 2BCEA 1NFQA 3I30X 4PO8A 5DYGA 3IDAA 1EVEA 4LE0A 1VL0A 1BC5A 2SKEA 1A0OA 1NOKA 2EFGA 4TV9F 4OLBA 4QO8A 4RXUA 2O19A 1GG5A 4CT0A 2V54A 5HMMA 5C1DA 5EP3A 4K2HA 1GCOA 4H35A 1CVIA 4B80A 4RNDB 3ZWNA 5DHFA 1I4EB 3I4LA 4GPBA 3PYMA 5ESRA 5KYUB 1PFUA 2G0NA 2ZRNA 4DEVA 1RP1A 3UCXA 3SJCA 2B34A 1FDSA 1FXSA 2KPOA 3JPWA 2BUAA 4KUEA 1I30A 2PH5A 1Q95A 3H9BA 4LSMA 4OHCA 4K03A 4Z4CA 4MW6A 2REOA 3HNPA 2HA3A 2KQUA 3D8UA 1ODFA 1JKJA 5B53A 4BMSA 3U80A 2ZIXA 4UHFA 2Y67A 1BW9B 2ZBDA 2BKAA 3DMHA 4BKOA 3BRWD 4Q4HB 2UDPA 4BLUA 1QH8B 4TV9A 4MK4A 1DCFA 1C9DB 3G85A 1HK7A 4P83A 4GPIB 3FHTA 2X4IA 1FRQA 3NHWA 1SRQA 2QK4A 4HAWA 4X8MA 1RLOA 2I87A 3HR7A 1RZRD 2DFDA 4LOJA 3QVJA 4YP0A 1TO1E 1YH3A 4LRYA 4YRDA 2E6KA 4DR5B 1ECFA 1P1IA 4H0FA 2DWQA 2JIZD 4E88A 4ECAA 2Q1WA 2WD9A 5EZ5A 4MS1B 1ZH4A 2WBLC 3NMUF 8AT1A 3RVSA 4UE2A 1H0SA 4D97A 4DBLE 3EZFA 4RPHA 3R3HA 4PX3A 2C2ZA 5TE9A 1ZU4A 1BVRA 3LRXA 5JZOA 5T6BA 3IPXA 4MTLA 1CE8B 3MD0A 4C6SA 3MOIA 1VDMA 2QG4A 3QLTA 1XQ1A 4F46A 5KVVA 5FORA 1WNTA 3KJIA 1EFHA 3WG9A 4DNXA 1I5RA 1U3WA 4BO0A 3ZDZB 5SV2A 1F48A 2YN2A 2VJOA 2XEXA 4TSFD 1V1RA 3RIMA 3B13B 1TZCA 1E59A 1PR3A 1P9LA 2OB1A 3EQ7A 4JS0A 4U7FA 4DYDA 1IH8A 1Z39A 2KB0A 1XZEA 5F2EA 3DF7A 4CV2A 1G6KA 1T4BA 1TXGA 1OWMA 1VFNA 4PC7A 4F1JA 1FDTA 3L18A 4HUJA 2PMDA 3PQ7A 2HWYA 2EL7A 1FFHA 1T24A 5K0LA 3AF3A 3ZD6A 5CJPA 4CM8B 4JI8B 2V1UA 4CF5A 1ESDA 4CL0A 3P97A 1JVSA 1U0OC 4GSKA 3S4YA 4OH7A 3U9SA 3IAUA 3ZXIA 1ZSNA 2ET6A 3ND8A 3FCEA 3GP3A 4OXQA 3KKLA 4AG5A 3QM1A 2Q6IA 3NV7A 2W90A 1DCKA 2D13A 2X1MA 3LUGA 3HSSA 3TMYA 5IZCC 1QE0A 1T10A 2GJSA 2OFFA 1MO2A 4L4UA 4FHZA 4O4HB 5GVSA 3ZDBA 2I1VB 3OQMA 3CRZA 1ONBA 1RWMA 4MS4A 1FYFA 1ZM7A 1E9RA 2H2AA 4OQDA 1XZHA 2CLHB 3X1YA 4MV1A 3TTXA 2WD7A 1T4MA 4ZVOA 4M8LA 4WXPA 1X1RA 3VZRA 2GAIA 3GZJA 4LTMA 1NVGA 3CEMA 2HY7A 3Q7QA 3KNZA 4OEHA 5H3LA 3NUZA 1VLVA 3D2CA 1AGYA 2WSSA 4UU8A 1P2FA 1KNXA 3C0KA 3CMMA 5EGNA 1U4SA 5KTOA 1NT2A 1XROA 3WLIA 1SXQA 2ZYVX 2HR1A 1EM8B 3EXIA 4AXXA 3IUQA 3M9XA 1GZ3A 4M54A 4CQMD 1TZ2A 2QJFA 3E9DA 1NXVA 2K5UA 4BE9A 2X5KO 3FKJA 4GZMA 2M98A 5ES4B 2X0KA 3R3UA 2XEDA 3F8WA 4MQBA 5G4LA 2C95A 1JHVA 3NWOA 4UUNA 3O0DA 3RREA 4TTQA 3V33A 2ZE6A 3LOUA 3AUJB 1RW4A 3WVNA 1YDGA 4M9CA 5J9FA 4ZRMA 5HCUA 2CD9A 2BZ0A 1K2WA 1Y1QA 2EP7A 2AGVA 3Q8WA 1N2BA 5EWLA 4YRKA 5FWNA 3CPSA 4P32A 4EFMA 5K0ZA 4BNLA 5ETJA 1VDZA 3D4BA 4I3HA 4DIBA 4KBFA 5DGCA 1QCCA 5IUJC 1SVUA 3NHYA 1E7SA 3MUFA 4PGFA 5BV7A 1E3WB 2BMAA 1G5PA 2QZ4A 3GA7A 4Q19A 4CQLB 1J0XO 3CKKA 4G8DA 4CYMA 4HQFA 4KODA 3LQYA 3PRHA 3OE7D 4URXR 1GD1O 1KC3A 1JQ3A 3I1IA 3SHFA 3PGVA 4G9BA 1GVHA 2YYAA 4NE9A 1KYZA 2VAXA 5BW4A 1XDUA 5BSMA 2AG1A 5HQTA 3ER9A 1P29A 3ROZA 2VSOA 3N28A 3VO8A 4M2LA 5C8YF 3QU2A 5FLKA 5C35A 2HU8A 2C54A 3H87A 4QUKA 3PCXA 4YJ2F 1D07A 3D0KA 3GLFB 5H7XA 3DZCA 1RYEA 2GDZA 3U4QA 3UUWA 4F4CA 2V6GA 1H8HA 3WGLA 3K9WA 3DE0X 1GGKA 3S2EA 3SC3A 3S6JA 2XNDA 1M2JA 1U0NA 4BVGA 3UMFA 1GRVA 5H16A 3ZIDA 4CQLA 1U5BB 4ENRA 3A32A 3CPEA 2VHQA 2ZR0A 3PPYA 4WUVA 4QU0A 1WXXA 2LNDA 2VDMB 3OJLA 1SUWA 3DOEA 5HA5A 4ARZA 2JFYA 4FUTA 4ZVKA 4TSRA 5CDFE 5JBNA 3EXEA 1LVGA 5C9ZA 2OCKA 4JDUA 1EVIA 2CXQA 5B7NA 1VG8A 3RU7A 4ZK2A 2RGEA 2D5LA 4LF4B 2ZCVA 1KQPA 5EPOA 3SBOA 4YJGA 3KUCA 3LPLA 4EY3A 2ZRJA 3AF4A 3OHMA 5DGIA 1A88A 4KFTA 4WN3A 3WOHA 2NPOA 5BMVF 3BWXA 2YZKA 1UMBA 4X7RA 1HQCA 3O4JA 4AKEA 4E94A 4B5KA 1I6KA 5AJUA 3MGGA 3R41A 2AV6A 3OKAA 2C5SA 1RWNA 4IJ5A 5HF5A 3WLLA 1CHNA 2VXCA 4DLTA 1E77A 2EQBA 4INOA 1A4UA 1QIMA 1KMQA 2NZ2A 2UV8A 3G1UA 3ZYZA 2FW8A 4EGFA 4MYSA 3X1JA 4XQ0A 4RVGA 4FXPA 3ILHA 3DMDA 4U7DA 1ULTA 3E03A 4RKFA 1RS0A 1T6BY 3VBCA 1W36C 5MDHA 3ZXSA 1DOAA 5F5XA 4OK5A 5CDTA 4HAXA 1P7VA 1UDAA 1Y0BA 3EC1A 3USZA 1PD1A 3E5MA 2R48A 1X39A 1ORWA 4UASA 1CS0A 3SF0A 3ZZUA 4JP3A 4QAJA 2C1EA 3C14C 1ENZA 2VZLA 3FA2A 4PGAA 3ZU4A 5LQKA 3LP6A 3AYXB 1AZTA 2VP9A 1M54A 4JIGA 1T36B 2FFHA 4X5OA 4RF2A 2JFVA 1E0AA 1U5CA 1KSFX 4AKHA 2HSDA 4JLNA 3KAKA 4HD8A 5KYWB 5T4FA 2YV5A 3W9SA 2P8JA 4FFWA 4GI5A 4RDHA 2HZ7A 4YUXA 2QJTA 1GGHA 1U0SY 1Q77A 1KZYC 1K8YB 1KFCB 2E37A 3HV2A 1H4TA 1EX9A 4YJ3B 3EZ7A 2ZQZA 5AVOA 3RC7A 2AFIE 4CM8A 3BC1A 2GK4A 4GM0A 4TT3D 1GT6A 4CEHB 3OX3A 1ZI6A 4BVEA 2O7QA 3CH7A 1E2QA 2VJQA 5AKIA 5J4HA 3COJA 5LLSA 4BGEA 1OW3B 1QPGA 1U99A 5AI8A 4CT4B 1ZJ4A 4Y1RA 1BEUB 3MAAC 4Q9AA 1KS2A 4HNRA 1KP9A 4Q9HA 4LI0A 4L4YA 1RBMA 4WRRA 4ER0A 3INRA 3H8WA 4INPA 3BB4A 3DLTA 4GYYA 4XGRA 3I01A 4D46A 2O1WA 2GHIA 2IEGA 5E7IA 4N76A 1GLVA 3B5IA 5CT9A 5DZSA 2W2TA 3ORSA 3D4PA 1NXTA 1SC6A 1MW9X 4I50A 2I62A 1FX1A 4MYCA 1ZD4A 4B6OA 4UCXA 2REBA 2QLBA 1CUGA 3AHFA 3TWOA 5JAMA 4F91B 2JBWA 1P4SA 4MSUA 4NS1A 4LOIA 1F8UA 1C0PA 2LD4A 1KJNA 2QPTA 2H9IA 4XJTA 2YV1A 1B7GO 4ZO7A 4EL0A 2FPPA 1VJDA 4B3IA 3T7DA 4UNQA 2AXQA 1X92A 2VJMA 4EHNA 2JDIA 4TTJA 5LOVF 3AEKB 2OV2A 1ZZGA 1KJQA 2Q3JA 4TL9A 1FLAA 1H2ZA 2AOWA 3K53A 2OCAA 2ZI6A 3F97A 4WZBB 2NVUB 1RI3A 2NXEA 4J1NA 1NW4A 3AHIA 5LA6F 2C7OA 4CM9D 1IXYA 3WYNA 1P73A 3IT3A 1TU0A 5GONB 3I0NA 1WB9A 3N2GB 5JAIA 1NVBA 3ZCRA 2O2DA 3B53X 1W48A 2WTMA 2EW8A 3EGDA 3LMKA 2I4RA 4ZVLA 3NHBA 3TN7A 4F4DA 2GEUA 2VCHA 1L4EA 4ND1A 2IF0A 3LCRA 3O9MA 5EVCA 2HM7A 5T8KC 4C3OB 1EGAA 3BWDD 4AQDA 3UM9A 1F60A 8MHTA 5D7NA 1YI0A 3GDOA 4L4RA 1R4ZA 2JD0A 1B6TA 3JV7A 1NT4A 4MWTA 1JKIA 2VSXA 2FP4B 3ZJYA 5EUMA 1ARZA 3WL8A 3E9ZA 1NF9A 3E2PA 2CGEA 1W29A 3OG9A 5B36A 5KX5F 1FJGB 4YJ2A 1T0PA 2DHDA 2QD2A 1QHYA 2BZSA 2R87A 4M55A 4LJSA 4UU1A 2JIDA 2FMUA 1C4OA 3CEJA 3D8BA 4N5LA 2VN8A 3DO8A 4PHFA 2O7NA 4RF4A 5AVJA 3QITA 2WSYB 4E08A 4AO6A 4KW7A 1OT3A 2GCOA 1SR8A 4BEVA 3V46A 4HNHA 5LR6A 2IEDA 4CCSA 3ZX4A 1OGYA 2OILA 3RT1A 3E1GA 1N3IA 4WJZA 4YECA 2GYUA 3FXAA 5ILGA 4JI4B 3IDQA 3S1AB 4WESA 2JGKA 1DAEA 1FS4A 2AVDA 3HKDA 5DTJA 3A2LA 3NPAA 4LF5B 2XYVA 1XU9A 2E0IA 3A14A 1O8CA 4KPEC 5TQJA 3HDQA 4R8LA 4U9UA 3ZVMA 3HGTA 6ADHA 1ZR2A 1BVYF 4M9SA 4D9NA 5LWHA 4L78A 4GYWA 1ZC3A 1XX6A 3RRBA 3WGGA 1EFAA 3RKUA 5HQ3A 4EI8A 2VP3A 4J0QA 4BJ1A 2B1IA 3STWA 3SQWA 3A1FA 3EIHA 4A0GA 2XCUA 2J9RA 4FGKA 4A23A 2YDXA 5I47A 4DIMA 1P7PA 2ZUBA 3FZQA 4C08A 4D9MA 4QT4A 4NFHA 3JWIA 4XCVA 4Y6GB 2CE7A 5ADVA 4V0NA 3OMXA 5EIOA 3D6AA 1VP3A 4IJWA 1SIUA 2ZU6A 5KUTA 1G21A 2GBGA 1JLMA 4BU1A 2YY5A 1G17A 3PWSA 1PWZA 2GCGA 2BFDA 1R88A 4RPCA 3BAFA 2NU6A 1GG8A 2PUEA 5SZIA 4EHHA 4GOJA 5CA1F 1XD9A 1ZEJA 4JY7A 1W5BA 5GM2A 2R79A 5BORA 1OASA 3KSBC 3WKDA 1NBOA 3R1IA 1VKRA 2YL2A 3H75A 3AR8A 1W8IA 2Q0SA 1Z15A 2WPDA 1H8EA 2VP5A 4YBRA 3OICA 4UFNA 5K09A 3V4OA 2HA6A 2N46A 3H2HA 2XTAA 2PZMA 3EMDA 3IIKA 4MQEA 4R98A 4U2EA 3DJFA 5DTIA 5EQFA 1N0WA 1P8JA 2VDWA 3K15A 4YT8A 4I7EA 1S0UA 3O8QA 4OMCA 1N92A 3OH8A 1J5XA 4X1IB 4MIYA 1FDWA 1QYXA 3S3TA 1K0FA 2BISA 2Y1CA 2CW5A 4EZEA 1M66A 1K5GA 4MIKA 5JRJA 3TB4A 1J0BA 2ZVJA 2Y0CA 1EU1A 4QPDA 5COAA 4PZAA 3PDHA 1Q50A 3A4NA 2QD5A 1R8QA 1W85B 4HS4A 4MGEA 4X93A 5CVCA 3UN1A 4EDFA 2P62A 3NUQA 2EARA 1AKRA 4AP9A 3RVPA 1RJWA 5CM2Z 1GPYA 5FCDA 2B6NA 3FOZA 3ONVA 1EK2A 3YASA 4FNAA 1WG8A 4R68A 1KVSA 3GD7A 1TA4A 3EGCA 3COVA 4TKVB 3K0SA 2XDQB 3HY4A 3QKRA 3DAGA 5FNVA 2OK7A 4MVJI 4UOEA 1SQ0A 3CF4A 2CZQA 4DJFC 1ATZA 1JEDA 1S7GA 1B93A 2AK2A 1JXMA 1MZPA 1ZBQA 3TGWA 4CZ2A 4KREA 2HMVA 2NM0A 3FPFA 3JX9A 3QG5A 1IMJA 5TEWA 2C57A 2AWOA 1VHWA 4KXLA 4OQZA 3T52A 1XKLA 3LUCA 4N03A 5E2IA 2IP4A 1BFUA 3V1KA 3BQNB 1DGQA 4FOLA 5JTTA 2C3UA 1BH2A 2EZTA 1U9YA 2O23A 4NS4A 3LOQA 4YNBA 5EHZA 1LI4A 1X1EA 4CMKA 3MWYW 3AVXA 2UUOA 2NUPA 1F2VA 2AZMA 2B35A 2NUPB 3L0DA 4OYLA 3DHVA 3KUDA 3RARA 1KEVA 4I1PA 1E3TA 1LDMA 3OHPA 1TM2A 1EDZA 3TUJC 1H0RA 4DR1B 3PC2A 3T7EA 5KNCA 2RGUA 5CYFA 2UVPA 4H17A 1DRUA 1ULUA 2Q4OA 2E4UA 1T8YA 3WOVA 1IRXA 5J5VA 4LF6B 7ABPA 5JCJD 2QVCA 1MIOB 1W9HA 1H9BA 4RHYA 3RVJA 1WZNA 4M83A 3UCEA 4FFBA 3PIIA 3Q8MA 3DCIA 4YP5A 1GL6A 2NUBA 3B3QA 3FUUA 3THWA 1N8KA 2F9MA 4DMKA 2GAAA 4A82A 3P0IA 2YY7A 4LJYA 5EJ9A 1NPDA 4FNGA 1HRDA 5A6VA 3FFWA 3MRSA 4KWCA 4X94A 4RTMA 3WGIA 4LNUB 4Y1EA 4XJVA 5H68A 3GRAA 3GO4A 3GLIB 4PX2A 2FPRA 5EHGA 4Q1CA 2VHYA 1XVUA 1H5UA 2DQSA 1SCJA 2YN4A 1T2EA 1XZBA 1V37A 1GPH1 1MVLA 1ZM2A 3RUEA 4Z7NB 1A8IA 5K0EA 7ADHA 1I2ZA 3OQIA 4JL8A 3OEYA 4QYWA 1GA4A 4P58A 4B2LA 2XZOA 2HJRA 5AK6A 3V8PA 5HF8A 4CMIB 5ULLA 1FSFA 2XLCA 3LVQE 1ODLA 1PL8A 4YS6A 2BKVA 1ZJ6A 2HSEA 3FFBA 4IO1A 3GNSA 3JQ9C 4GL2A 1CUZA 2F3PA 4WKPA 5BVHB 1NLYA 1J8DA 4FEYA 2C1ZA 2C2BA 4ME6A 3I9MA 2IELA 3KYIB 2C8LA 4H6WA 5EKUA 1YJ5A 4OVKA 2H52A 4IYRA 1AGRA 1RM0A 4LX8A 5IASA 4AMUA 1WCWA 1XUOA 3E5NA 4TT3A 5GVRA 3QQPA 3D4OA 1ODTC 4KN9S 3LFUA 1NYQA 2PZ8A 3KLNA 3LP5A 1EFPB 2QDXA 3QUTA 4OOFA 3K0AB 5D51S 5FOSA 3WAKA 1MVOA 2RI6A 2W2XA 1DX4A 4K1LA 4RY2A 3L1IA 5BNFA 1JA1A 5A4DA 1QK3A 2H1OA 3DVSX 4EG1A 1Y5MA 1UT8A 4MQMA 1ABBA 1T6ZA 2QRZA 4CM1A 2X9QA 5KAPA 5ALUA 4AWAA 5DBGA 5A5VA 3EPRA 1DFGA 2MSEB 3A4TA 5K4HA 3EISA 1CUYA 3PUIA 4FQ5A 3HO8A 4YVFA 5DM2A 1XE3A 3LX8A 1QB7A 1WAMA 4LQLA 3T94A 2PGOA 2ISCA 3WX0A 1K4YA 4Z3OA 3Q7EA 2FEMA 2CLMB 2R1UA 2XCLA 1KI8A 2E55A 4II7A 4E1VA 1MDFA 1I1OA 3QTLA 2E4XA 1ZH8A 3OCJA 4M0KA 4P3NA 3ZYCA 1IZYA 3ADOA 2G9ZA 3DKKA 3C3PA 2XYGA 4AI6A 4MR7B 1XR3A 2AMJA 1QO7A 4DJTA 2YWHA 1UFRA 5CNMA 5FI5A 5GONF 3HZOA 2ZI5A 3H5WA 5E1OA 4ZU1X 1Z56C 3SM9A 4Q34A 4MRNA 1SHUX 2A1UB 1Q1GA 1FU7A 3KZCA 2EV9A 3F6YA 4QUGA 1FOEB 2J9ZB 4ZANA 1UEXC 2OHVA 5AM0A 4MX8A 2QL6A 3Q7TA 1ZVQA 2OQIA 4XUCA 3ICWA 1NZJA 2B4TO 4G97A 2V7BA 3GEPA 1VIVA 1LQUA 4BMCA 4LOKA 3GUUA 4I50F 2VAVA 5TMBA 4DSAA 3QVKA 2BGMA 3A27A 4M1KA 4PLVA 3OIFA 2HK9A 2PFSA 2ZCJA 2WR8A 3DBHB 4LHVA 1Y5RA 3VZCA 1Z28A 1NYRA 1DJQA 3VDNB 3UANA 2CVOA 1KDTA 2A3RA 4EK9A 13PKA 1PFKA 2BGNA 2C29D 2GPNA 3D81A 2BHLA 4WY8A 3SJUA 2ZRKA 4E14A 1ZVMA 3M6UA 3WLEA 1MRSA 3UAYA 1TVEA 4ALNA 4C2TA 2XRFA 4C0XA 4YQYA 2R7AA 4DV6B 3B8HA 4NRDA 2AN9A 1R7RA 3R09A 4N7BA 2HJWA 3HBLA 3DL0A 3M4NA 4O0LA 2Y9MB 3ZHQA 2PPVA 3GA5A 1B0PA 1X0XA 2ONYA 1YB7A 2RHCA 4Q7KA 5E3IA 3TGLA 3DMGA 4BBPA 3S70A 1U2DC 1G19A 3WSWA 5MFPA 3KP1A 1PFQA 1FYVA 2WIFA 2Z9BA 3I9KA 5AHWA 4ZZ3A 3NHZA 3FR8A 3GUYA 2FSUA 3LY9A 2CYCA 1C3LA 2CHUA 4KSCA 3ZLTA 3EN0A 1EQAA 1S89A 2ZIUB 2J59A 4GW3A 3TZHA 4HV4A 5EZ6B 1QLJA 2Q1SA 5LYJF 2WOJA 1JWAB 3T99A 3PE4A 3R0JA 2WE8A 2C2XA 4UMEA 2Q5JA 4UKDA 4E22A 3E9YA 4Z4GA 1B4DA 5ENZA 1S3IA 4RTLA 3L7OA 4EH1A 4GPAA 2W93A 4G9EA 1HKHA 5F7JA 1PZXA 3VU3A 4DMCA 2ACVA 2H0QA 4F6RB 3JVVA 2N3ZA 4L8WB 1CKEA 3I42A 3D3EA 2JJ2A 3KSRA 1J9GA 4DNPA 2JAWA 5ICCA 4EYEA 5IH7A 2O2JA 1KK3A 5IM4A 2IYPA 5I8WA 1BU8A 1L7QA 3FNEA 4EY7A 2FQWA 2J67A 3FWYA 5I7SA 3BMNB 4PCUA 1ZG3A 3HCBA 1IAVA 2OAGA 3UK6A 2EKZA 2P68A 4DV0B 4IWNA 4QXQA 3A25A 3SXUB 3FGZA 2FLKA 3ZD8A 2O59A 2QM7A 4A9AA 4CU5A 1E2LA 3I45A 1ANKA 2GVZC 1MX5A 1IPEA 2YJ3A 1Q2UA 2OFOA 4XIJA 4BMVA 4D3XA 2BZGA 3HL0A 3ZD9A 4JLWA 1SIOA 1S8NA 2JIPA 5BN3B 2MMGA 1NLUA 2O05A 2I7XA 3OLXA 4Q3CA 3GHYA 4DCVA 3PIRA 2ATIA 1TT5B 1VLQA 2YFKA 4ZD6A 1B43A 2WI8A 1DQZA 3KB2A 2ODEA 4KPUB 2OWEA 4M1ZA 4UTXA 2ZE8A 2H06A 4BFWA 4YJFB 4KQFA 1VJRA 3EGWA 3HN6A 3NBUA 3F4LA 4FPXA 3EZ2A 1R5JA 4PZ9A 4ZO8A 4MLDA 4MCIA 1C9JA 3ANYB 3D2AA 1B8PA 2BM0A 2F43A 4PXSA 3FSJX 2Z5VA 2QG6A 1EHYA 2FX3A 4EI7A 5KB3A 4TV8B 4Q12A 4N48A 2J5QA 4F38A 1SXJE 2BMVA 3AM3A 1CJUC 3DFIA 6GPBA 1XZFA 3T3EA 4FOOA 3QPVA 3CX6A 1FP6A 1U02A 2C2WA 2PX8A 1KEKA 3UJNA 3VNVA 3L93A 3LQ1A 2JAPA 1I0IA 2XGSA 2HV8A 4A8JC 2OECA 3HJAA 2IYOA 4WNCA 3RQIA 4GNRA 3EDYA 2GF0A 3CNEA 4BKQA 4RQAA 4DLNA 5LNK6 1T36A 3O8LA 4NQZA 2OO3A 3TKYA 4F2DA 3ND5A 2M32A 4GXQA 4IAOA 5CT8A 5DLYA 2QX8A 3P2IA 1KFJB 2VCYA 3FTEA 3TR6A 5IYZF 1PS9A 2O3RA 2O54A 3HDTA 1EUDA 3QFRA 5EI5A 4HF7A 1VPVA 5KNCD 1E2IA 1TDJA 3H1AA 1S2DA 3TRJA 3ZKWA 4DM4A 1EB8A 4TYYA 4OXRA 1WW3A 2EBFX 1I1NA 1NUSA 3MXTA 3PRKE 3URKA 3V1NA 1GQSA 2FSIA 4PPQA 3PT9A 4C0JA 4EP1A 4F85A 4R41A 4OQEA 3C4JA 4C87A 3UJCA 3R40A 2AEJA 3BD7A 3MT7A 4FGWA 1UBUS 2Q5IA 4TKLA 4RTSA 2OCXA 2NMVA 1WDTA 3STXA 2GK3A 4OTZA 2OY0A 3LLVA 1IWPB 1LDYA 2IUEA 2Q9BA 2RHOA 3CE9A 5JFTA 3W90A 4BNGA 2Q5HA 2RDMA 4GAEA 1NR1A 1PT5A 2VATA 1GV0A 2WKRA 4LSGA 4YRTA 5FUWA 4DKXA 2YS6A 3L7JA 1E1CB 1GUBA 2FPSA 4ITVA 2FQXA 4JOQA 1JILA 5F2OA 1OVMA 4LWPA 5HYVA 2BFFA 1K98A 5EHNA 2QYOA 3CUEF 3WGJA 4FI3C 4RZUA 4WY5A 3D4LA 2V7XA 2C2MA 2AC7A 3I2GA 4JROA 2VDRB 4DDHA 1WO8A 3P9ZA 1DB3A 2OBNA 2QLFA 3QENA 2OBMA 1THTA 2FJ0A 2Q27A 3EXEB 3IUPA 3V1TC 2W22A 3QHQA 5CIWA 5G0UA 2GETA 3P19A 2HRRA 4IZ6A 3WLKX 4MVJA 5KVQA 5EJEA 2WOOA 1PYOA 4J75A 5D3KA 4BIMA 1CY4A 2O48X 3K70C 5B6PA 1N0IA 3DJYA 2J3QA 3H1BA 1HT2E 3OSZA 4V0LA 3C24A 1FX0B 5HX7A 2NP6A 2PVPA 1YZTA 2B4AA 4I4TF 3WL3A 3TTUA 3UHAA 3O8OA 2J85A 5JMWA 3BREA 4FC7A 5FBVB 2DJIA 2KS6A 3PS9A 3GLFA 3ZXXA 3U4QB 2CC2A 1DRJA 2ZTMA 3H6KA 3PNMA 2G5TA 4UHBA 5AWFC 3OOEA 2MCFA 3T1VA 3T06B 4DCCA 8OHMA 1JYSA 4IQ8A 2P4QA 3QEJA 1AHHA 1H2FA 1VSBA 2JFQA 1OV4A 1YQQA 4PNHA 4V0ME 3UBMA 4CLXA 3KQMA 5SY6A 4RLSA 5EWMA 3TFWA 5HIKA 2XVYA 1JA0A 1OXUA 1TKRA 4P5PA 4JVMA 2MMCA 4IIJA 1FFAA 3JU3A 4D1YA 4D80A 3ZR4B 1R0XA 3AXTA 4YDSA 3SR4A 1USIA 2FSGA 4JL5A 5DJ5A 3UMMA 4U7WA 1L7PA 3QLVC 1JIQA 1TPZA 3H9CA 2I1QA 4PCVA 3DKRA 3VSAA 4H6VA 2HADA 3I12A 1RQRA 5EUQB 1MNQA 1YE5A 4QFCA 1MIOA 4LJ4A 4V38A 4J7AA 1M2GA 3DXXA 1NUHA 4EITA 4BGDA 2QIOA 3LY5A 1VPTA 5ICMA 5KSYA 3DFZA 1DI0A 5ALNA 1MEEA 2VCEA 3OP1A 4F97A 2BEWB 1VJCA 1CSEE 3OJ0A 4ZVMA 4BMXA 2L82A 1CG6A 1WL8A 1XV5A 2VUIB 1A3CA 5JJIA 3GHHA 2B20A 2OPBA 4A3SA 1RC8A 4HKTA 4U3JB 1IY0A 4P7GA 3STHA 4YRQA 3W5VA 4C0WA 1ZMOA 3E15A 2Z5GA 1OC4A 3R6TA 5EJGA 3QPUA 3CB4A 1K7EB 1PSZA 5DNYB 4ISCA 3WYCA 4PLTA 4MWCA 5IJ9B 1EBFA 1PVOA 3VJLA 3GRVA 3COWA 1H5QA 4YRFA 3VUEA 4Y2HA 1RWWA 1MH1A 2NO4A 1RFGE 3KM0A 3TI7A 4BVFA 3EDCA 3ZWBA 3WL6A 2X5OA 5F98A 1J33A 4GUAA 3TDNA 3NHMA 3RYHA 4QYSA 4HH3C 1V6CA 5AM4A 1AOXA 1JEOA 1MX1A 1SJ9A 2AYZA 2M1XA 3GFPA 4NH0A 4NMLA 2GO7A 4PR3A 3OPNA 5IDXA 5ELLA 1QX3A 4Z4FA 3OMLA 3ILXA 4IKEA 2XDQA 2NZUG 3QKRB 4M7PA 3MRXA 5CJ2A 1ZVVA 3GZ4A 5EN4A 3TBHA 1JHUA 1K06A 1V25A 3HJNA 3KLBA 3ZOZA 1P9RA 2GRJA 2IIPA 1HC7A 2QQEA 3NIFB 4Y2VA 4ETNA 2IVZA 2XYQA 4NJOA 1FLNA 1HNNA 5HOQA 3JQBA 1XPOA 4R81A 1U0TA 4Y1GA 1ZESA 5EMHA 1BWRA 5EVJA 7GPBA 2QLJA 4UDYX 4OQFA 2I65A 3IAEA 4L9RA 4BRZA 2DG2A 3TLXA 3K9BA 1NJ6A 4JZKA 3W9BA 3VX4A 2RSLA 3OQBA 2OVBA 4US0R 3QFCA 5ALKA 5EERA 5BOVA 4OI4A 3BXFA 3RRZA 1JHXA 4DQKA 5KX5B 5JEEA 3U5TA 2DT5A 4MRAA 4ZXFA 3PNPA 4P36A 3PITA 3TIGA 5I7AA 2BFNA 5K45A 4GKBA 4Q9DA 2HGSA 5DLDA 3IRVA 2PA0A 3CW9A 1WV1A 3E5RA 1EP9A 2D1QA 2XMBA 3AR3A 5F1PA 4OLFA 4BRWA 1YXMA 1G2IA 4BP9A 2XCIA 4N7JA 1B8UA 2R751 3B70A 3BILA 4OP3A 5C7LO 5LKAA 4WD3A 3KKKA 3SLRA 3ZHXA 1B6SA 4BCCA 1H0KA 3DMPA 1C81A 3RS4A 3E82A 3HJGA 1E5XA 4DCSA 1DUIA 3BF7A 3PIDA 3ZCXA 2HQRA 2O20A 4E1AA 3Q98A 3IIIA 4N6NA 4NEGA 1OZAA 2XUFA 3OJOA 4CLRA 3QJ5A 1P2BA 1L7EA 1SHZA 2J0EA 2QKYA 2XUQA 3WK9A 5KTYA 2EIXA 4MUAA 4WASA 4I5EA 5AK5A 1F2UB 2RH5A 4FLMA 5EZSA 3RHZA 4DDTA 5JXIA 4EHAA 4OBBA 1ND5A 1S4MA 3C1OA 4FGUA 2VHEA 4NCJA 4YUZA 1XTVA 5CFOA 5DW3A 3HO6A 3VH4A 1QKKA 4KAFA 4QUIA 3HCPA 1LNQA 4INZA 3KV1A 3CUWA 1NY6A 1QH8A 4FS3A 2NO7A 4PPGA 2JATA 4TV9B 3QXCA 4S3MA 1YDMA 3TJZA 1Q20A 1A2KC 1YL5A 3ANNA 3AHJA 4KGVA 1ORTA 2EVWX 4KQ6A 4FBLA 4Y2YA 1J8QA 2W4MA 4DW8A 3O8RA 3A4YA 4ODIA 3AEUB 1QU2A 1H66A 1QONA 2AB0A 2OQ2A 1G1MA 1O6FA 1T8SA 1DQNA 4KR0A 4US2R 3OAAD 1PR4A 4M76B 2GPWA 3FMVA 1OZHA 3DMNA 2VYCA 3EOZA 2L17A 3KVOA 3PFBA 4BL5A 4ZZIA 3K3PA 4OA5A 2P9TA 2V45A 1UMDB 2EZ4A 5KCZA 2ZSIA 3E84A 4RFVA 1U81A 4C5AA 4DG8A 5ILOA 3BMOB 1ULAA 4M8KA 4C0KA 1RPZA 1A82A 3VR4D 1QJ4A 1KETA 1V6AA 4GH5A 4UXJA 3NCHA 5D2CA 2QL7A 1KI9A 1QUEA 4QODA 1QLWA 1K7CA 4XFDA 4B81A 5FX2A 3GX1A 1VIMA 1E62A 2ZPTX 2GKSA 5T7BA 2ZBPA 4G0UA 4XGNA 3HYSA 2DPHA 3N70A 4ALMA 3PUJA 1P1BA 3KZXA 2ORIA 3GVXA 3KXPA 1S2IA 3OI7A 4PV7A 4WXYB 1XKTA 1AQYA 2QJWA 3GZNB 4I0WB 3H2GA 2ZS9A 1P6QA 2PR7A 2YZMA 4M0FA 3UC9A 3MTEA 1H9CA 3MJ4A 4LHEA 5CCEA 2AZ4A 5BP7A 3CGGA 3PQ8A 4HWOA 2OM2A 2H9AA 3L6RA 3O91A 3ADCA 5K0SA 1B15A 4J8PA 4L9SA 3AIIA 3FYUC 4JKIA 1JJVA 3O74A 5B4TA 2JASA 2Q3LA 2FPGA 2V7UA 3AFIA 3BERA 5LQUA 1GZ6A 3CE6A 3NFRA 2DTXA 2GA9A 4F5EA 4WZAA 4DDKA 1DCMA 1QFXA 5EKSA 2FFQA 2J3JA 5TF4A 1KORA 1KYXA 2QBYA 1A4XA 5CUQA 4I4IA 1CVLA 3M33A 5I01A 3KEMA 4XR4A 4RSRA 3LCCA 3QBVA 3JVUA 3R3VA 3WB1A 4UTPA 3FBGA 2JAHA 2XB4A 3WWOA 4DSTA 5AW7A 5E6UA 4XVUA 4H1UA 3IAFA 4HGOA 1I32A 3T9DA 3ZDQA 4WOJA 5BRNA 2XT6A 1XLUA 4LDNA 1SZDA 2DBRA 3IMKA 4XR9A 3BFPA 4CMJA 3EY9A 5EINA 5JE8A 3W34A 4L3VA 1BIFA 3HNOA 3N6XA 2PAAA 4B2PA 3BXEA 1A9YA 1Y9JA 1KRWA 3UF0A 2ZS7A 3A05A 2ZG6A 4MV6A 4NH4A 1GQFA 1V1MA 3GVIA 1QVZA 3LKZA 2E4VA 4AECA 4WBNA 5L51A 3MWJA 2GAFA 2OO5C 3PI7A 3A3KA 3T7CA 2PRKA 1EGVB 2IYQA 3H0KA 3LWZA 3OFNA 1PS0A 3OUUA 4OCZA 1V7ZA 5LMUB 1S2LA 2IH4A 3MSXA 3T1QA 2WG0A 4LGMA 1KWGA 2ZBFA 3V2IA 2F3SA 2PGLA 4FM9A 1P1HA 2WYHA 3CUVA 2QVBA 2AMLA 1PUXA 4IHJA 4RK6A 3MWKA 3S7TA 2OD2A 3FHJA 4DCGA 3VDRA 8ABPA 2ODBA 1M1XB 1TMKA 1ZMRA 3AW8A 3I39X 3K8QA 1PL0A 2VVTA 1VPDA 4DPKA 4QQRA 3G2OA 2IGBA 4FYYA 1ACLA 1TKAA 5E8RA 3IMFA 1UBMS 3PGXA 4R1NA 4AICA 3V3KA 1H1LB 3LXMA 5I4CA 1FRFS 1CD5A 1PJBA 2A58A 1PZNA 2QTMA 2W8ZA 3W78A 2QBYB 2P1DA 4XIYA 4O6VA 3ONFA 3JVEA 5HDQA 2H51A 3RFUA 4EW6A 4V03A 1CVRA 2JFHA 3QUSA 5G0SA 3RAPR 4TM8A 2PUCA 1FVFA 1K8XB 1NC3A 1ORHA 1RPTA 5KVAA 1G5QA 1KPGA 1I4WA 3ITEA 3TQFA 2GM5A 1A2BA 2OSVA 1G5HA 4DSUA 1VHDA 2QYTA 4GVPA 4J4BA 1TM5E 4DA4A 5T4EA 1OSNA 3OUZA 3K6SB 1B42A 3L6CA 1XOIA 1KI2A 2PJDA 1N1EA 5JZSA 3QMPA 2JLWA 2GHTA 3ELUA 1YNSA 2J9FB 1TVCA 2HEGA 4BKUA 3FCCA 1W19A 3H9GA 1KGSA 2OZEA 4FR5A 2HU7A 3DAYA 5EXXA 3GT7A 1EFTA 2DE0X 4DEXA 5J4YA 1U1CA 4HCJA 1XMVA 2CNOA 2HXSA 3MPUA 2E6UX 3T3MB 1RWOA 4P7JA 4BRUA 3BIXA 3BMOA 1IEXA 3LXRA 4K87A 2V58A 2HA0A 1G63A 3A9SA 5BSEA 1G2PA 3A4LA 4H6XA 2C0PA 4N7MA 1EHIA 4F4JA 2VXYA 1Y6JA 3C85A 4F1WA 4UQLA 4TN1A 4AQ7A 2FN3A 2OXFA 1SUPA 2HHCA 3E3MA 2D0PB 4G89A 3I2YX 1DJNA 1U6IA 4PIVA 3VR1A 2H4JA 1MUUA 2OLJA 2XOEA 3NOVA 1F4VA 3DLAA 4I4NA 5TC4A 3IP7A 4B76A 1H65A 1EM6A 3P2YA 4DLXA 2GD6A 4RXTA 3A6JA 3MTIA 3N53A 4HDSA 4JJGA 4Z3KA 3A31A 3KLOA 2HJHA 3W9YA 3UXEA 1T0BA 2WIBA 3HA5A 4U7GA 4C30A 4AMVA 5H1YA 4YXWA 1O9BA 1X1SA 4HLCA 2QTLA 3ROEA 5HCIA 4DAOA 3T95A 2HPHA 4F3CA 4OUKX 3OZGA 1PFVA 2ZZNA 4F96A 1WM1A 3QVWA 1NQOA 2EGHA 2IOYA 1U5BA 2MT9A 4PU0A 3RKSA 3KELA 5FAKA 5IVPA 5CURA 4RCZA 3R6GA 4D8WA 3G0HA 2JJ1A 5CT5A 4DZTA 3AFMA 2WNSA 4CJXA 1N5MA 4AF8A 2EJWA 3QH4A 1CR2A 3D7SA 4YMWA 5ER6A 1QP7A 2R6DA 2BFCB 5DOZA 3MG9A 2JH3A 2QS9A 3DA8A 1NKSA 4U9HS 4AS2A 5J1SB 5KKCA 3L82B 2BP7A 3QEBZ 4NHEA 5SYNA 4HAUA 3HLKA 3RRYA 3TSAA 1DC8A 5FBWB 1RKUA 3SP1A 2O3UA 1FYWA 3ETHA 1L5RA 4G1MB 5DHSA 4BEJA 5BMVB 4RD0A 3HADA 2MOKA 3BMXA 1SVNA 3DC2A 2X9GA 3TMKA 4FFDA 1P44A 2AG6A 3H5TA 4R2WA 5IKXA 4IGKA 1U3VA 4AJHA 1GPJA 1NURA 2CVQA 2F59A 1J5PA 1SELA 5B64A 3SPXA 4ZPXA 3LC1O 1X1BA 1ZRHA 3P5BA 2BFWA 2JI8A 4B8YA 3MOGA 2Z6UA 4B8ZA 1UADA 2WUVA 4C7OB 2W6CX 2Y0PA 3Q9UA 1YB5A 3ZE0B 2OYSA 2XT0A 3RKRA 2JGNA 2RGDA 1VGRA 3CMCO 3ACDA 2BVNA 1U0JA 2P8SA 4O2LA 1Q16A 2IPMA 1L5FA 4P92A 1XTRA 2X3YA 1Y34E 3JARB 1SXJC 4IIBA 5KCMA 3RUDA 3G2KA 3AC0A 2FZLA 3D8NA 5JV5A 1JEQB 2HW8A 5ALEA 2CXTA 3PVSA 2B5VA 3RYFB 3JQ8A 4LXXA 4K9OA 3ZUGA 1HT1E 4FVTA 4I6GA 3FOAA 3HA7A 3KTAB 3PZBA 2J3DA 1I2MA 3H13A 3HC7A 3U7IA 2VZ9A 1LQTA 1QRAA 3OJEA 1JP7A 3GGSA 5JS7A 1Q5PA 2A9KA 3PPXA 5GIOE 2NVOA 4HAOA 1VE5A 1DDGA 1XJQA 2QW8A 4LFCB 3V7YA 2LWIA 3KTAA 3UXYA 2FQYA 3CUUA 4HP8A 3AKYA 1Y8QB 2M6KA 2YOFA 1UP6A 4IIUA 4K6GA 4H4EA 1AK1A 1J06A 3SAJA 1SWVA 4YA6A 2JLYA 5M3BA 3MJVA 4TQ9A 3BULA 4KMRA 3PUHA 2XBMA 4I2VA 4HAYA 2ARKA 2NQ2C 4GOOD 4FBGA 2OXIA 2G4CA 1SUBA 1Z4PX 1HQYE 1M33A 3OZWA 1VL5A 3PC8C 4OYYA 3VFDA 3GJ5A 3OWOA 1BYUA 1COWA 4XQCA 4N8DA 4YRLA 1HE5A 3P9IA 4ZV4A 3GLHB 4OAQA 3CC8A 3RH0A 4LYYA 4UZFA 3RVOA 3PHBE 4S1VA 3P0EA 4UDXX 5HSGA 3ET5A 4NX2A 4XUDA 4HWRA 2QSJA 3QVXA 2PUFA 2AYXA 1EX1A 3FUXA 4FGSA 2VAPA 2YJ4A 1DJOA 1VZ3A 2ZAYA 4NFSA 5K9ZA 1IXSB 4RORA 1WD7A 1K7SN 2WIAA 3SE0A 4ZZ0A 2VH5R 3OKCA 5TJ9A 2JKZA 1LDNA 1CU1A 2DT8A 4PQRA 3UA3A 1SOAA 1W88B 3T38A 2Y6VA 3WLPA 3BSFA 5CX1A 5G1NA 2W37A 5KINB 1F4PA 2B5OA 3AR7A 4BFZA 5CG1A 5AICA 2YUIA 1MB0A 4RMIA 3T5BA 4L2IA 3BB1A 2UAGA 3JATA 3Q9LA 5IBRA 1Y5LA 3L0SA 3H4IA 3DV2A 5BR1A 2BAGA 1LNZA 1P18A 1Q1BA 2V9PA 4GSLA 1U94A 2R47A 3NHRA 4PTYA 2O6HA 4MGYR 3Q5GA 3ES9A 4G5HA 4EECA 4GP9A 1G1AA 3VPAA 5AVRA 4G5GA 1LQ2A 2FN4A 3C6YA 3IELA 4NJMA 1GSIA 3L4SO 3X1MA 5KQMA 1DPFA 4RKYA 1E63A 1V43A 3MTJA 4A16A 2RH4A 1VCOA 1IBSA 3OY2A 1FX0A 1A50B 3TTVA 3GRYA 4IDFA 1JHQA 1GCIA 3RWBA 4R69A 5AHXA 5B6JA 3RAEC 5CH8A 5JAZA 1T1SA 2G9UA 1EPUA 3PRYA 4GBMA 2EWWA 3BWMA 2QSYA 1W35A 3EQZA 3ZI7A 2Q5QA 3A2KA 3DV9A 3KT8A 1YZFA 3ZWCA 3JALB 3G2QA 3TLGA 3ORQA 3LPNA 4KQEA 4YRPA 1KJJA 3GJTA 3ZEAA 1D03A 2PX6A 2IYZA 4J6EA 1RWKA 1RYFA 2NVWA 3EXHA 3FWKA 1G8KA 4MV0A 1CC1S 2R1VA 2Q62A 3OZAA 3GP8A 3UMYA 1RXUA 2ZJ3A 2G28A 4B84A 1KFEB 1VJ1A 2NZVG 2QTAA 3B6JA 2WLTA 4PLHA 5EEHA 2AZTA 1NVTA 2ZVPX 2Q5CA 3HVRA 3JTEA 2BGIA 2P4EA 4J2OA 4AVYA 4ZEXA 3TQHA 1UBJS 2DGDA 4YHHB 1P6UA 1XXHE 1YTLA 2X3FA 4XOUA 1GUDA 1QPBA 4RKEA 4ZZ1A 4R8VA 1T2UA 1KE2A 3FUWA 3PF8A 3PNSA 5JU6A 2O2GA 2VK4A 1VRCA 2GILA 2FGJA 4K28A 4R1OA 4TMZA 4F60A 4RTPA 4J16C 4ENUA 3ZG6A 2GWHA 4WL0A 3KKQA 4AP5A 3KJHA 5LYYA 3UXHA 1I3LA 2HHLA 3EMKA 1XZMA 3MSCA 4D3DA 5I9NA 4KBGA 1XRSB 5LFAA 4DV5B 1YV9A 4MO2A 1GGMA 1Y6ZA 3UNXA 3WJ7A 1JFFB 3IP9A 4FN5A 1NJFA 4B3CA 2Q29A 2W2VA 1I3MA 3WRYA 4DEYA 3BE5A 4KFSA 3UWOA 1M72A 4TVBA 4KQMA 2P3SA 4EVQA 1U63A 2QEQA 2RI1A 4WNYA 1EUCB 2H4YA 4ARAA 1UXJA 2OENG 3SXPA 3LRTA 3UEOA 1L6RA 1SQ6A 3BE6A 4C7XA 3I2KA 4NK5A 5IDVA 4KRGA 5HJ7A 1RZ3A 2P79A 3ORFA 3KKPA 2WJWA 1XG5A 2NYUA 4OO3A 4R9NA 1Z8DA 1ZK1A 3OJCA 3S40A 1IN7A 2IYFA 3DZHA 3F67A 4NPCA 2A14A 5BWLA 3NJ4A 3QUCA 4MVWA 1YFJA 4EOGA 4BWFB 2J0VA 4ZEMA 1KJZA 4L4XA 2PRSA 1SVKA 4HGPA 1VRVA 2VQSA 3C1AA 4IG4A 4W8OA 4J2TA 3CPJB 4G4SP 1TW3A 3GWZA 4DUGD 4RMJA 1GFSA 4UVIA 2A94A 2IW3A 5CITA 2PFKA 3C3BA 4MV3A 5DTRA 5LLDA 3JW8A 1P0IA 1NQUA 4TZ0A 1W25A 4K3VA 5J2TA 4JEMA 2OLKA 2IZ0A 2VQ6A 3IULA 4D4HA 3IE0A 1D2EA 1RRFA 3USCS 4E3WA 1NN5A 3K0EA 3RS5A 2G8NA 2C0QA 4RJKA 2DY1A 1M34A 2UYYA 2SKCA 3AJDA 5IH3A 2BGWA 2FSSA 1PQYA 1P9WA 3PX7A 3LC2O 2QRQA 5EE5B 1N0HA 3HU2A 1BDHA 3RIEA 3PP8A 3GGGA 1UAAA 3OWXA 1WUJS 1T26A 3P4UA 4WBNB 2Q1XA 3BWVA 2HFKA 4EA9A 5K05A 5KMGB 3BWCA 2O8NA 4AWXA 2QX6A 4G2NA 2WYUA 1E9CA 3C2QA 2DPYA 1L5HB 2P27A 4GBGA 3JSAA 4PS1A 4TLEA 2GD0A 3IEUA 3ETJA 3SMQA 1PZHA 1E3QA 2YW2A 3NBZC 5FEMA 1F1BA 3AI1A 1WPXA 2C9OA 3L5KA 4G1EB 3QMVA 2OZLB 3T4PA 2UZ4A 2QTHA 1RQ2A 2G9QA 2WUWE 1QYCA 5TNXA 5E0OA 3AONB 1KMHB 1TM1E 5E1DA 5U1PA 4E6EA 2JGAA 3CTMA 5JXHA 3Q11A 4IQ0A 4JP1A 4NZNA 3EQ8A 4NCHA 2PD3A 2B61A 5KZMB 3P94A 2H1WA 2D2XA 3GL9A 2ALJA 4OXNA 2CLSA 4LG1A 5AOAA 3PEEA 5LQSA 5K6AC 2DP4E 1F0YA 1MQ8B 4A0SA 1XF1A 3H5AA 5DM60 4UUPA 2APJA 2FEXA 4TS9A 4WK0B 3C6QA 4LMPA 1XLVA 3KIPA 3ETEA 4P4SA 1J8MF 4LGYA 1JG7A 4PSKA 5C7IO 1DIAA 3V4RA 3MB8A 1RE1A 4EHIA 1IBCA 3IAM6 4QFDA 2Y0DA 1KYQA 4J0DA 1J07A 2DFKB 3UPUA 5K01A 1RM4A 3UFXA 4HRYA 5AVKA 3A11A 3DP7A 4G25A 2FG5A 4O4LB 4OGLA 4C4TA 3N7AA 3IR7A 2F17A 3GC6A 2NW6A 4PRZA 1CJBA 1RHQA 2OCYC 3KZ1E 2HQOA 2IXFA 3MJTA 2B92A 5K8JB 1NBHA 3LU1A 1TT7A 2F9LA 2AQ8A 3AGQA 3N2NA 1IK4A 1MA0A 4TTRA 3O47A 2HT1A 2DX7A 1ZH6A 5FV4A 5KNBH 5JROA 1NRJB 3LO5A 3H9EO 1EFRD 2QRHA 4PBRA 2VLBA 3VVBA 1L6IA 1U2SA 3GT4A 3HN7A 2VKQA 2D5BA 1HPLA 1V96A 1OX5A 5T3UA 3ZJTA 2PBFA 2PT5A 1I1QB 3UJHA 4F9GA 3P9NA 3JQBC 4CQJA 4H1TA 1K9VF 1ULZA 3PSHA 3OO1A 1DFHA 3GEBA 4G5OA 4UBIA 1KRXA 3UKDA 3F7MA 3H0EA 3WICA 4LRTB 2YJZA 5SY9A 2W6ID 4RIFA 3DH0A 2P2CA 4FDLA 1TUGA 4AG3A 3GN2A 1EINA 4NONA 5CJJA 3UIEA 2D7DA 4XB6B 4G5FA 5JUWA 5C1PA 1TOAA 5AK4A 1SUCA 5EMKA 2ZRFA 4N1AA 1H3FA 2Q9CA 3MRTA 1QRSA 4LJAA 2XNKA 4YYZA 4CV1A 3HCOA 3BF8A 1KMCA 3O75A 1XDZA 3IBGA 5DRYA 2I4TA 1G8MA 1J7JA 3NBKA 1QANA 1R5BA 2YVAA 2FQQA 4G4IA 3WRYC 1GPWB 4M1WA 1MAWA 1HY3A 1GQRA 4LBZA 4JU8A 3T4EA 1NN0A 1HTBA 1NOJA 4C2BA 4B32A 1U0RA 3Q8XB 3A10A 1JEQA 2J9XB 4IH4A 1N25A 1WMEA 2BWJA 3WLRA 3LY8A 3BCRA 4Q00A 4MMXB 3CM0A 3OM1A 1ZD9A 3A6EA 3AP1A 1TW2A 3T5TA 4H7HA 3UFBA 1EJ2A 2F8LA 2X22A 5F33A 5G02A 1BGXT 4Z99A 4WCFB 4QGSA 5KOYA 4RW0A 4K1XA 3FOCA 1U3DA 3ASYA 5D1NA 3DT8A 4AJ4A 1YRQA 3LL4A 1WQ4A 1J2RA 4C7OA 3UMSA 4QL3A 1YR8A 1XYVA 1J0CA 1NBEA 4G5XA 4HLQB 5IT5A 2VF5X 1V5WA 5EP2A 1U31A 3MUEA 5AHOA 4CMGA 2I6XA 1E0SA 4YQEA 5FI0B 4IDGA 9LDTA 1J39A 3ZW8A 4EYQA 1ACJA 1T0HB 4AJKA 1MTOA 2RBGA 4XASA 3TQCA 5ITZA 4I81A 3M3DA 1J90A 4NBWA 1R8JA 1BHSA 2FSVC 3AB8A 3N75A 1G3UA 1M83A 3PXDA 3AUXA 1RWXA 3PC3A 4M0EA 5AVXA 4BBAA 2NYAA 3DSRA 2RHGB 2PUBA 2JEZA 5F3WB 1NUAA 2A9FA 2ZEJA 3JQGB 3K2IA 1Z7WA 5CEEA 2ZJ6A 3P9QA 4OB8A 1LBQA 4XM0A 3DMFA 2PV7A 1VYHA 1U2GA 5BUCA 1JIJA 3UH1A 1OFVA 1JPJA 1GRRA 1FUIA 4WXHA 3T0FA 3VNQA 1XD2B 1U0GA 4I66A 1G21E 3E3AA 3GUZA 4WA7A 3HUUA 2WU4A 5CB4A 1H0HA 3IAS6 1TX4B 2F62A 4C0BA 2HA7A 5TDHA 2GZ2A 2IEZA 1XVVA 3OLWA 5DTQA 4BNXA 1V16B 1Z9BA 3H8SA 2FW6A 1QR6A 4LJ5A 3ACBA 3IMEA 1NDQA 1Y6QA 3GFSA 4HYTA 1W96A 4PAMA 4BVLA 1F8XA 2DSNA 1E5VA 1EDBA 1LEHA 1P0PA 4L5CA 4J1TC 4XTCS 2DCMA 4LOAA 3IP5A 4JUFA 2X77A 4G6ZA 2BPOA 2RAFA 4QSMA 4UUOA 1R1DA 3V4PB 4JDPA 1XRMA 4C3VA 1K6MA 2IPOA 2RFLA 3TLKA 3F6BX 4FFBB 3TIXB 1CUSA 1NAIA 1I3CA 4NV3A 3SLGA 4YCDA 1PWYE 1Z2PX 3KVVA 1GZUA 1Y7PA 3ABZA 5IK2A 2Y6UA 2O8DB 4F6CA 5CNIA 3TO5A 2WY2D 2A86A 4MITA 2F00A 3OTQA 4I4TA 3I53A 3RT7A 5P21A 3TTTA 4DXAA 3PWTA 2VRNA 5JXJA 3D3JA 1RHRA 4W99A 4ENQA 1KQFA 5F7XA 4R1MA 5GOTA 3TNFA 3QNWA 5BSFA 4QM7A 1W4CA 3A3YA 1ISFA 3KHSA 1PL6A 1QZZA 2WB2A 1P0MA 2OHIA 4NMMA 4BO4A 5C8XA 5CFRA 1J25A 3UHFA 2QU7A 2W83A 1H2AS 3DYVA 3Q72A 1HORA 1TUBA 3OQ1A 1WTCA 5TQ2A 2DM6A 2P30A 1GTJ1 1WPQA 3LX4A 5H80A 3UWPA 5LYJB 3QWHA 3H2JA 1D6MA 4JVOA 5KSPA 3ZQ6A 1G18A 3AXSA 1FJXA 2V74B 4EYSA 2GNAA 3IBCA 4A03A 5A0TA 4AJ9A 1ZHFA 4X3CA 2J9FA 3WK5A 1SHJA 2ASEA 4CCAA 1G55A 4QRDA 4R05A 2ZJBA 4RIEA 1YC2A 1JWBB 1F0NA 3MNFA 5IC4A 1MJHA 2FSHA 4YJ3F 5EWMB 3LIIA 4H60A 3F98A 1IHDA 2PSFA 2WJIA 5ANRB 2X1VA 2YVQA 3RAJA 3HKBA 3DGEC 1PJLA 1WXFA 4L73A 2IH5A 5A2QA 3ORRA 4YMVA 1E89A 1DRVA 1O4VA 4Y2QA 2YIDA 3F3KA 3NTUA 4JI6B 2RC5A 4GSYA 3V00A 5B12A 2VPWA 4IMJB 3WLNA 5A4IS 1W59A 1FFSA 4WLOA 2NUTB 3TQSA 2GX6A 3O8OB 3T1NA 4BO9A 4DCTA 3IOEA 4H4DA 1PT7A 3BXOA 4KYIB 1LX7A 3SKXA 4AKGA 2R8XA 1KDYA 1DKUA 2PBLA 4QELA 5CIYA 3ADBA 4Q3KA 2RHJA 4I1UA 4AT1A 4DRXA 2O1XA 4BV9A 3Q7IA 3PBKA 3TINA 5CFNA 2H1RA 5K3OA 1WB5A 1U7XA 2YHUA 4BRSA 1Z26A 4EYOA 2XA1A 1HDRA 2PT6A 1KZ1A 3KCNA 4E32A 4UXHA 1VJTA 1NL3A 1YUBA 4TS1A 3R75A 1XLTA 4HDQB 4MUGA 1T1EA 2X2PA 1U8AA 2GYVA 2QWXA 3BCUA 5CXXA 4JBNA 4NARA 2CK3D 2HQBA 4WKBA 3TEMA 4MV7A 4A8TA 1V1MB 3C8UA 1GRNA 3CH4B 2HK8A 3N3BC 1E1RA 1OU4A 5DI3A 2CHQA 4CG0A 5LUAA 4KN8A 2BUCA 3EZYA 4XE5A 2FR0A 3H5NA 3OZVA 1KEZA 2XODA 3BZUA 4W1RA 4KE6A 5A0FA 5K3FB 1MB9A 4B34A 4B3HA 4JEHA 1CF9A 1NXSA 2D1TA 2PFGA 5KHAA 2XDAA 1YCHA 3GFOA 3F4KA 2XJ9A 3IERA 1O9GA 3LGAA 1LJ8A 2ONCA 3BIFA 1PE0A 5HFNA 2E85A 2EIHA 2UKDA 4KVAA 4CV3A 5IF3A 1QCZA 2LKCA 1ST2A 2PDAA 3R23A 5DX1A 4C07A 1S9DA 3A04A 1S2GA 2A4KA 2XB8A 2GN8A 3NHSA 4LTDA 4RKQA 3ZKWB 4DABA 4R31A 2E49A 1ZRNA 1I0LA 3VNUA 2X6TA 1TVKB 3MWEB 2RK6A 4KVFA 3M6FA 2E5WA 2HA2A 2JK0A 2QTVB 1ZOIA 2DCUA 1R9MA 4H31A 2CL7X 4JCOA 3PCTA 1E9SA 3VR3A 4EVRA 2WPDD 3DLCA 4FZRA 3TIVA 3HKDB 3OD5A 4LYFA 4W5OA 3WJAA 4F4IA 4QVIA 5FTLA 4BEWA 3H99A 4LWQA 4TMVA 3OU6A 5AW9A 1V47A 4MUYA 1C3XA 2D2IA 3N6VA 4GQIA 3TUZC 2IS2A 1IHXA 1AU9A 1JFFA 5B3AA 4R1SA 1K1EA 3FROA 1TADA 1KKLA 5GP1A 1EWQA 5BMOA 3F73A 4Y2RA 2GESA 3DEFA 3I32A 3LYAA 5B58C 2VJAA 3O7MA 5AW0A 6CHYA 3SFZA 4D56A 4N3AA 2TMKA 1L5ZA 4J0KA 5FWAA 4EB8A 9MHTA 3WQBA 3BFKA 1PNOA 1N2CA 3LWDA 4KPUA 5AHKA 3N2ZB 2GRUA 1B2RA 3ICCA 2OOKA 2NU7A 4L5IA 4OJYA 4WXEA 1MABB 3WYBA 2N1MA 4CN8A 1TZKA 1IOWA 3EUFA 3JYQA 3EVAA 5COBA 1Q15A 1P1JA 3AEUA 3EGXB 1RYHA 2ONKA 1Z5OA 3VV2A 1JEYA 1ZNWA 1QIDA 3JWEA 4N3NA 1O5IA 1Z6XA 4ZVRA 3VPHA 4C7VA 1T1RA 4FWTA 4MIOA 2F3TA 4JK3A 1S2NA 3TIFA 4OHFA 4GDFA 2EFDB 3EXHB 2IC5A 4IIXA 1NVKA 1PUIA 4IO0A 5ITSA 5K0BA 1E8MA 3AEKA 4YCBA 1K6IA 1X38A 3N6RA 2BBWA 2WJ4A 3SIRA 4C4XA 4EKNB 5JY6A 2JHGA 3UJ9A 1LPNA 4JJ6A 1XWWA 4I5IA 4TKZA 5IBCA 2ZUSA 1E2UA 2LE0A 4JOCA 5CH5A 1BEEA 2HMTA 3RW9A 3TG8A 3VHXA 1E1NA 2O8BB 3ZCPA 1EFCA 3NAZA 3QPBA 2JRLA 4FKBA 5EMMA 3ZKAA 1IE3A 2ZROA 1GP2A 4JVLA 4H0NA 4Z3DA 5BSUA 2BM1A 3EH2A 3EH1A 3PFNA 1E9EA 2XWSA 4FQ8A 4M7RA 1EDEA 3RRJA 3W5HA 3GEEA 4C0HA 3TSWA 4MGHA 1U0BB 1DMSA 3FTQA 4EAQA 1KMIY 1DU4A 2V7TA 3NC0C 3T9FA 1UBNA 1WMFA 1Z2EA 1EG7A 2EFJA 3EQ9A 3ZS8A 4C4YA 2BE7A 3VAYA 2I1LA 1JA9A 3DTVD 1WLSA 2GZHA 4U8HA 2QZJA 3NVKI 3MGKA 4QJ3A 3T7AA 3K5WA 3ENWA 5IKEA 4EHKA 1W88A 3FB4A 4D79A 1O3YA 3GRPA 1SVLA 5FEUA 4G1BA 1K68A 3DNMA 1T2VA 5CFMA 4E5SA 5I7VA 1W0JD 5FA5A 4RTNA 1WMSA 4OY3A 4HRAA 2Q9UA 3PFKA 1XTPA 1WCV1 2EW2A 4JJFA 2W00A 4ZOLB 4WZBE 3T7TA 5DXFA 5C3MA 2NTNA 2VRCD 3E7PA 3K8OE 1MTZA 3LQ2A 2CLFB 3ZE9A 1QLHA 4EW3A 4F8EA 5C5DA 3ENZA 3NTOA 4LN1A 2CYBA 1HE4A 4UEWA 3OZ7A 1TLLA 3VXKA 3FUCA 4J6FA 3DEAA 5CBKA 4HG2A 4B45A 2P2YA 1KAGA 4A6PA 4UZEA 3IP6A 1Q0SA 1ZEMA 5CVVA 4NYMQ 1SCIA 1G0NA 1VA4A 1YZVA 4FGLA 4KUHA 1ZICA 5CMLA 7YASA 3KZOA 3KETA 3G2IA 3K71B 1Y8CA 5AJXA 2IXBA 1PK8A 3VO1A 5JSKA 1RWPA 4BX0A 3JZFA 1J2EA 2QX7A 3U9LA 2JFNA 3L5OA 4UBOA 4DLRA 1BAPA 4Q3BA 2HHHB 4D02A 2Q8NA 4HRVA 1Y8QA 1FS6A 2J5XA 3FCXA 4UFOA 2OV4A 3LVRE 5FNZA 3G8BA 3AT1A 3IQHX 3KOYA 1OLSB 4PRLA 2GEBA 4MDHA 4YMSA 1N4AA 2AFHE 4F4FA 2YDYA 3RUPA 4L0DA 2J0QA 2GZSA 4KKXB 4O4LF 3VZQA 4ZVNA 3TLJA 3FCOA 1JXQA 1Z0UA 3I1FA 1M76A 1YC5A 4JLPA 5A5DA 1NW3A 4ICIA 3JWGA 4H7IA 3HDJA 2BFEA 2VYFA 1OXSC 2XNJA 3WL4A 1RVV1 1ZM9A 1ZGBA 1HDXA 2H1VA 1IWOA 2H16A 4DY4A 4E31A 4AY6A 2H5EA 1XVIA 4NBVA 5KNBD 4LJLA 1JR4A 4GDMA 4OGGA 2GPAA 4YALA 4KYUA 1XJCA 4B9AA 4GKAA 1WHTB 1P3JA 3AF6A 1RBQA 2NNLD 2P5UA 2ZWVA 2OQVA 3VVCA 1OGIA 1QHFA 4UATA 4ZT7A 2GUGA 2LVBA 4OGFA 4QIHA 1Z5UA 2Z3WA 3EW7A 4A0QA 3OQNA 4JYCA 3ZWKA 1TTHA 3A9CA 3BTUA 1EFPA 1E8NA 4ZCSA 3M5DA 3O4HA 3PFFA 4HB2A 3FAKA 1XJ5A 2CJFA 3BD8A 2QX9A 4ZARA 3PL5A 3EXAA 3ZI4A 1UJNA 2RB4A 3FYHA 3QKSB 4INJA 2PJRA 1KJWA 3G5UA 4JWTA 3W3AH 4B6RA 4XDYA 2GN4A 3THSA 1DV2A 2OPHA 1NG1A 2PSEA 5LPNA 4LFAB 3FOEC 4KWEA 3HFJA 4Q7MB 2Y99A 1ZXXA 5D5HA 2W8BB 4IS2A 1ZA2A 4CUZA 3NRBA 3SJBA 5J1TB 3A8TA 2V1XA 3OOYA 5EIEA 6ABPA 3HWWA 4A7PA 1C8BA 2EYQA 2FLWA 2QRPA 3AW9A 5HE8A 4D8XA 2X0EA 3VKFA 1N6IA 1JKFA 5C0OE 2WMYA 1N1MA 1OJLA 1MKYA 1ST3A 1PWHA 2OESA 3QYFA 1YBHA 3G2PA 1XZDA 1MOSA 4D45A 1BS2A 4YAKA 2G7MC 3JQ6A 2YR0A 2QAGB 2QAGC 2Z2XA 1E60A 3R9IA 1B8NA 4LNUA 4ESHA 3VTAA 1BHQ1 4FEEA 2VTDA 3RTEA 4TLMB 5LDHA 2K87A 2AF3C 1IZ8A 3FLAA 2GSDA 4JXKA 4OSOA 1FIUA 2CV1A 3L40A 3THWB 1P7ZA 4RANA 5G40A 4MUJA 4AF6A 3LM8A 4R2IA 4M1TA 5GQSA 2HUNA 2P90A 2VP0A 2ACEA 1H2WA 5GV7A 4JKYA 3RC3A 1N8NA 2QQGA 3K0CC 3ND7A 2NSHA 2QUBA 3JZDA 4ATNA 3TW0A 3WA6A 5JQGB 4AMGA 2ORWA 4IKPA 4KZKA 4K6MA 2PTHA 3IKVA 2UVPB 1FYEA 5I4KA 1TLTA 1TK3A 2C8KA 5J23A 2ZR8A 2VHZA 1XDBA 3OQJA 4CMBA 3FSRA 2H4ZA 3HB9A 3V8QA 4AAYA 4PSUA 1Z5GA 1PGNA 2Q4RA 16PKA 4KE7A 2BKUA 2QLTA 1E2NA 4LQDA 3E9RA 2HJ9A 4EFKA 2CLOB 2EQAA 4HFMA 4Y2JA 4UUAA 5IAOA 3ESQA 2J1LA 2BFEB 3ESYA 3LJKA 1R50A 5AVQA 1NMQA 4YRGA 4PQFA 2X0IA 3COPA 5JI2E 3RNOA 1JZTA 5LZ8A 4HC4A 1PTJA 1ICIA 3ZDXB 5AM3A 3PRJA 2RHLA 4IRUB 1SCNE 2PD6A 1TO2E 4MRPA 4BAZA 4WOPA 5I9IA 1XHEA 2HMSA 2ZBEA 3M0EA 2Z6QA 2ZSKA 4IIHA 4EELA 1CEYA 4DV7B 3P8ZA 4M8IA 1PKXA 4ARVA 4B6JA 1T6NA 3ANMA 2FK7A 4BN0A 2HKIA 2AVNA 3IQIX 3NJRA 2FN7A 3A7EA 3OQHA 4WLEA 1YNOA 1UKYA 2PLWA 4ZOAA 4M21A 1QNFA 5C32A 4KQJA 1T9GS 4RD6A 2F1IA 3LK7A 3WGNA 5LJIA 2FPWA 1C50A 3CUTA 1LLCA 1XCOA 2QR2A 5E38A 3U3OA 4M1QA 3C97A 1IRIA 3EZNA 3I04A 3O2SB 3GUVA 2FWPA 1XCJA 4GWGA 1TMGE 3PKZA 4RD3A 5LNK1 1NVUQ 1YZNA 1E5DA 2RKBA 3K6RA 5IT4A 4YGXB 1PG2A 2ZIZA 4YN3A 4KKVA 3TAXA 3DLHA 2LIPA 4L8YA 1CQIB 4ZO6A 1Q7RA 1T5OA 4L5YA 4Y9RA 5K03A 1BO6A 1Q0QA 4D4IA 4IHJB 4G36A 1NBMA 4MQEB 4RTKA 3KB1A 2GEKA 1YQWA 1N2ZA 2VK8A 2XXBA 2YNMA 3DB2A 4XUGB 4BZWA 4UE3S 3PLRA 4MYTA 3H2SA 2PYIA 1XA4A 1YQDA 3E0XA 1SXGA 3L7BA 3QUAA 4QOHA 3U3ZA 3W5DA 1QP4A 3U5ZB 2FPOA 2ZYWX 2GNPA 3TDKA 3EXG2 4BB6A 3DE7X 1ODKA 3AV3A 2HCTA 3JR3A 1XIVA 2V59A 3QKWA 2VJLA 4QYIB 3N86A 4ZFNA 1UM9A 3EE6A 2FK8A 1T4DA 2C4TA 2J30A 3BMNA 4K9KA 4Q1VA 5FOTA 2PZKA 5JWHA 2PGNA 3U1VA 3VYVA 3FOFC 3OEHA 4N41A 1OX6A 4FD2A 4PC1A 1E2PA 3NHPA 3RQSA 3PFIA 2VPZA 4QLBA 2O9JA 2YWRA 2BM8A 5F73A 4Z9FA 4G0NA 1MT3A 2Z2JA 2QMEA 2PLAA 1U0EA 4HN9A 3PL1A 1E7MA 4AK9A 2FSFA 4G0OA 3K96A 1PYDA 4CG3A 4XVHA 4G5SA 2BJWA 2XD9A 1TQHA 3U44A 3AYZB 1SC3A 3GAZA 1G20B 2IITA 3J7TA 3KYCB 4NAHA 1VKOA 3DW3X 2WFMA 5GWXA 3W8FA 4WUTA 3VX3A 1YIOA 4TYMA 2GHRA 2W6OA 1YMQA 2FZ5A 4IIVA 1DC3A 2Q2VA 3FMPB 4BATA 1I5OA 3CBGA 1ZSVA 1JT9A 2H2HA 2XUZA 2XRYA 2Q1UA 3MC1A 3O3MB 5DM4A 1OTHA 1UODA 1QTNA 5ALMA 5ICGA 1QIJA 1FY2A 1TAGA 2O2SA 5EYPB 3PWZA 1YOVB 1NVEA 3I64A 5LIPA 4IEIA 4UBLA 3WDKA 3GLGB 5JFOA 2NU7B 1GVNB 4IXWA 4N3CA 3W1WA 2NP7A 2PVCA 1M8GA 3GJYA 1V3UA 4HQ0A 4IOJA 1R9GA 1Z7BA 2O14A 2ZJ8A 5E8JA 1BCSA 3DM9B 1DINA 5F5LA 4F4HA 1FA9A 3OOWA 1UJ4A 2XUKA 2YZ7A 5C5CA 3BCSA 3KWMA 3L1UA 4J1TA 3KKOA 5JHHB 3UAVA 4NCIA 1IK6A 2GARA 3SQNA 1NUPA 4BNWA 3L92A 1AN0A 3CSSA 5AVSA 3FGNA 2H7XA 5K99A 1W5TA 4MYUA 5C8YB 1J2YA 1JZSA 3GJ8A 3IALA 5HKAA 4BY9E 1UBTS 2BEJA 4RESA 1P3Y1 1PJCA 4ZEOA 4UUQA 2HTEA 3BK1A 3DXYA 1R8SA 3T1YB 3IPLA 1T91A 3ANLA 1UWLA 4I8XA 2IV7A 2I0FA 2PNFA 3U4DA 3WJ1A 2HU5A 5CPBA 2GPJA 3PTLA 3PNQA 5D3QA 5CTAA 4R3NA 4Q02A 1XL0A 3H19A 1WEKA 3E8SA 2I78A 5CB4F 3E18A 5HOEA 2QXTA 5CDYA 4PF1A 2EHDA 3NGLA 1TI7A 2ZRBA 4IGAA 2W2OA 3HJCA 3VNSA 3ZJUA 4OQYA 1TF5A 3B85A 1YOVA 1FBTA 1WXQA 2E48A 3M82A 4BJ6A 3CJTA 5IKMA 3LVFO 2DKOA 2A6PA 3H7IA 4DMGA 1TVKA 3DOCA 2H0RA 1QP8A 4TRJA 5CLIA 1KY5A 4O1HA 3TXXA 5FPQA 1Y1LA 4TXNA 4XARA 3K09C 1GPLA 3VU0A 3DMTA 5A9RA 3C4QA 1I3KA 4XDGA 4QXRA 1K9SA 1V5FA 3SYNA 4HEA6 2XGGA 1X7HA 5JT1A 2Z2ZA 4N39A 4H1HA 1JUDA 4ZMRA 5CK4A 3G0GA 3JWJA 3RROA 4G65A 4HLNA 5ITWA 1PFWA 2C4UA 1KF0A 2ODPA 4CDNA 1VKNA 3FYUB 4YMGA 3FY4A 3QYPA 1XZIA 1KEEB 3W6ZA 5FLEX 4B3XA 1V0JA 1UM9B 4ZAXA 1ZY2A 3HWSA 1QRUA 4NYIQ 2B69A 4OBXA 1O94C 3L9WA 1N5LA 4RUKA 4GT1A 1P17A 3HCRA 1X9IA 1Y9ZA 2PQ6A 2FFAA 3L1KA 3JQFC 4IDAA 1E4VA 2I80A 4BMYA 3TF5A 1DIRA 4AC9A 3DWIA 3BFXA 2LXNA 1RZUA 3K32A 4D26A 1EDOA 3U0BA 1PLLA 3EYAA 1OXVA 4EJ0A 1F20A 3OCVA 4NE7A 4R2JA 3N2KB 3NIBA 5B2EA 2D3WA 4CKEB 3R3JA 2KMLA 3G2JA 3HFSA 5LB4A 2DHQA 3I6BA 4KH0A 1PT9A 2XSZA 4OLAA 5IAEA 3R9KA 3H9UA 1Q0HA 4AWBA 3Q0IA 5KX5A 4X7MA 4GZ6A 4KFCA 3KZVA 2XV1A 2PRJA 1E69A 1DBSA 1PZEA 1GLNA 3K9QO 3W7BA 1TZJA 3IDFA 3N7UA 1UQTA 2I91A 2PNJA 4XVCA 5H0IA 2E7ZA 3MQ2A 4KXFB 4J94A 4Q9NA 1CQPA 1IATA 3AERA 1X3SA 2C20A 4ZVVA 3T34A 3WIBA 4E46A 2FPXA 1KY2A 3KQOA 5JHGB 3MJEA 4UTOA 3WIDA 3QP9A 1E5QA 3CUSA 1SUEA 1DZ3A 4OHRA 4MCJA 5M2QA 3KQNA 3WYEA 1CP3A 1E58A 1KZHA 4JR2A 3F9IA 3TFQA 1JU4A 2F67A 1PAUA 1WKVA 4X8OA 1Q17A 2NNWB 4YAEA 1VE9A 1IOZA 3L8YA 1ZGGA 4H77A 3G68A 3A6KA 1IM8A 4JJ4A 2HV9A 1PBTA 1W76A 3O9VA 3HI6A 4TX1A 5TT1A 5SZHB 1JWLA 3UG6A 2JD1A 5CLFA 1I33A 3C87A 2P6UA 4Q1AA 4Q7JB 2BW0A 1PDOA 2CF5A 4BNHA 3R2JA 5C8VA 5E4YA 3EFHA 4G0WA 1IXKA 4U1RA 4YAIA 3V2HA 2Q0QA 5ES3A 4IXTA 5L6MB 1ADGA 1ETHA 3BRQA 1ML4A 1ZW1A 3DE4X 2H11A 2VUHB 3DPIA 3NAGA 3W05A 3WQQA 2WJYA 2SBTA 1B6GA 4AN0A 5FLYA 2CZGA 2BEWA 2QGNA 2WG1A 4MB0A 3RLIA 1OLXB 4JBIA 3H1FA 5LQMA 3GJ0A 2G77B 1GQYA 4KSYA 3KS9A 3Q8LA 1Z4JA 1GHTA 1P2DA 1HDIA 3B36A 2YIMA 4RZ3A 5JMPA 2HUPA 3NIWA 5DHUA 2VJBA 1O8BA 2A7QA 3QNMA 4LSWA 3ZHOA 4CUKA 4D6XA 3AVTA 2FKAA 3W5CA 1Y7HA 2PY6A 5ENVA 2PN1A 3M5CA 1FEZA 3CVYA 1BROA 1WOMA 3O3CA 5HUQA 2WWYA 3H2KA 1U3GA 3KEFA 2AZXA 4KJXA 1JAZA 1X7YB 4ZQFA 2RARA 3F6CA 1GG2A 1R9JA 5FNVB 4E11A 1C7ZA 2VWGA 3WMEA 2ERYA 5EG5A 1RCFA 4ENSA 5T5QA 3AL3A 2ZI7A 1DFIA 4XSVA 2PQ0A 3KZMA 4DUGA 4V2IA 2J3MA 4L7VA 1N0VC 3OT4A 4Y1FA 1X42A 4MWSA 1WHSA