4CKCB

Vaccinia virus capping enzyme complexed with sah (monoclinic form)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
287
structure length
284
Chain Sequence
b'MDEIVKNIREGTHVLLPFYETLPELNLSLGKSPLPSLEYGANYFLQISRVNDLNRMPTDMLKLFTHDIMLPESDLDKVYEILKINSVKYYGRSTKADAVVADLSARNKLFKRERDAIKSNTENNLYISDYKMLTFDVFRPLFDFVNEKYCIIKLPTLFGRGVIDTMRIYCSLFKNVRLLKCVSDSWLKDSAIMVASDVCKKNLDLFMSHVKSVTKSSSWKDVNSVQFSILNNPVDTEFINKFLEFSNRVYEALYYVHSLLYSSMTSDSKSIENKHQRRLVKLLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MRNA-CAPPING ENZYME CATALYTIC SUBUNIT
publication title Crystal Structure of Vaccinia Virus Mrna Capping Enzyme Provides Insights Into the Mechanism and Evolution of the Capping Apparatus.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Transferase/hydrolase
total genus 89
structure length 284
sequence length 287
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03341 Pox_mRNA-cap Poxvirus mRNA capping enzyme, small subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11680 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ckcB02
2VDWB 4CKBB 4CKCB 4CKEB
chains in the Genus database with same CATH superfamily
3T15A 2ETXA 5K3FB 3BWDD 2JARA 4K9LA 4YCMA 1CQWA 1EFLA 2ODBA 3O84A 6ABPA 2Y4NA 1U9ZA 4X20B 4O3MA 4HQLA 2P9GA 3HRIA 2RHDA 1U94A 2F3PA 3GT3A 3QE2A 1LBIA 1RSZA 2JGNA 1E9SA 2C97A 4ME6A 5C4MA 2R60A 2MJLA 2OBYA 1DAGA 1XZBA 3PQ2A 2HMSA 2H51A 4XJSA 4IIEA 3T38A 3UMFA 5E1MA 5FOWA 3C48A 3DL0A 4IOJA 5CVUA 4W5OA 2P9BA 2WOOA 1T29A 2B3DA 4LWOA 3ZZNA 5DX0A 5LOVA 3R3UA 1M2EA 2AFIB 1ICEA 2GCNA 2I7DA 2ZBPA 3PQDA 5EQJB 2WT9A 3LY9A 3RHZA 4F2HA 2DFVA 3H5IA 3WG9A 5AVSA 3H99A 3H8SA 3TIVA 5IN4A 3KSAC 1I3LA 3CC8A 4ZQHA 2HA6A 1ID1A 1G8PA 2J5XA 3A6LA 3D6JA 4Q4AA 1SKBA 3NDPA 3U4GA 1ZW1A 1RWXA 3A11A 4LCEA 1ZZEA 4ZCPA 1ADCA 1XF1A 2ZUVA 4PC1A 1LTKA 1TF7A 1BWSA 1XTUA 4BASA 1JZTA 3JARA 2DWOA 3FPGA 4GZ5A 2FVXA 3MYRA 3N2LA 3P9YA 1RKVA 1WS6A 4HDNB 5EC8A 4B3FX 3NRCA 3CFYA 3QVKA 5LOVB 1VTKA 5HGXA 1VI5A 2VYNA 3R0JA 2I6GA 2R44A 2VLBA 3B89A 3PEVA 4WCFA 4YCAA 4IW3B 1S1MA 1P31A 1KJWA 2V6FA 4Q4AB 4E2FA 4A0FA 3ZE1B 1PIWA 3ZK7A 4AX4A 4EZIA 3FMVA 2UU9B 2F43A 5DGTA 4Z7JA 3PNOA 4BFWA 5B5SA 5ESWA 2IHJA 3WWEA 3K96A 3EGIA 3VZQA 1NC3A 2BRUC 3JARB 3OCJA 4O4JB 1ZH0A 2IEAA 4LSGA 2I2AA 3GVIA 4LYFA 2IXEA 2D3TA 1JS1X 2NZWA 1G4HA 2Z5FA 3OD1A 4UAJA 4B0PA 2GKOA 2ET6A 4ZAWA 1Q0LA 3KM0A 3TW0A 3W9UA 1CU1A 4CKYA 2CLSA 4DR5B 3KOOA 3R4VA 4H4EA 3SEFA 1EK6A 2WT8A 1BMQA 2QRZA 1ISGA 1NR5A 3BCUA 3PX7A 4R98A 4XD2A 3S68A 1C9NA 4IO0A 3TLEA 2B8TA 2B69A 1Q22A 1VE9A 5K3EA 5FP0A 4CIAA 2XB9A 3ISVA 5EG5A 5DNCA 1VC2A 3Q3EA 3CLUC 1M34E 2MSKA 1E4OA 2HNBA 3A1SA 3GJ0A 1ENPA 2W2OA 4OY3A 2PUCA 3QEMB 4W8OA 5IZ4A 4R84A 5KDLA 1ECJA 2ZSKA 1FMCA 3IE0A 5LQSA 4R8KA 5IUJC 3J7TA 2DBQA 5EIOA 1E9FA 2BKXA 4DXDA 1Q16A 3WVNA 1S9DA 1XZ8A 1K5DA 3I34X 2Q9UA 1LSJA 3FH0A 1Q92A 3G59A 5EIXA 4JIGA 2VAXA 4H0FA 4C7OA 4E5VA 3B9QA 4V2UA 2XSZA 4EHFA 5IXYA 1ZA1A 5C1BA 3I01A 3P9IA 1SC9A 3V33A 4D0RA 1Y7LA 2X19A 4MX8A 3GD7A 4G5SA 2L2QA 5D1HA 2PGAA 4X8MA 1AT1A 4ZVMA 4AF8A 1QB7A 2PEZA 3FZEA 1B0ZA 3GY0A 2VL7A 4KE6A 3RGWS 4CM1A 1QTRA 5TDHA 4MGEA 1N0IA 2ORIA 5DCWA 5LWHA 1G291 1G2QA 1NUPA 1H0KA 3ANMA 5LR6A 1XXHE 2P0EA 2HRRA 2I5PO 1G21A 2QLJA 2RKBA 5JZSA 3G1TA 2GFIA 1RNLA 3EIOA 2HCBA 1U3UA 4PHGA 3B1KA 1ZVMA 1WNTA 1L5FA 5EJMA 3ZE7A 3HVUA 2D7JA 3PHLA 3UHJA 5C8DA 2HSDA 2VZ9A 5JDIC 3PL1A 1SXQA 3VZBA 4OQ4A 4HVLA 2VR1A 4D6PA 3ETHA 2BI7A 4NIMA 4CMGA 2DF8A 1GZ7A 1OA0A 2F8MA 4IVRA 3BWCA 1KIFA 5IWAB 1Z8DA 4QLOA 1PUIA 1WCIA 1G21B 2IYOA 3LYUA 2PQ2A 5MN4A 3U3MA 4AMUA 1XI2A 1A9QA 5L7TA 4G4SP 4B3SB 1O58A 3DFMA 1ZESA 1TZ2A 2PTHA 3KAKA 4QELA 5LYYA 1KS2A 5BR1A 4NZYA 1QDEA 4L3WA 4KMSA 1O95A 4LWQA 2CB0A 4R0NA 4WLUA 5JAPA 2NGRA 2PLFA 4ESHA 4J03A 2IQIA 3W5BA 1Z17A 1GNVA 2FG5A 3BTUA 2ERYA 4FC7A 2VCYA 4KE8A 1DIHA 3RI3A 3K4PA 1ZOPA 1E3IA 3UWDA 1WCIB 4LGVA 4NG5A 5LM3A 3UMMA 1JKXA 2NU6B 2VJOA 1QC5A 1WUTA 3A27A 2VYCA 4MAAA 5CK5A 1T3TA 2EP8A 2NU8A 4G5OA 1Z22A 3Q3GE 3UOAB 1B0PA 3PUIA 4MI6A 4WKNA 2TECE 4ATNA 4YQFA 4MW6A 4ETMA 3LC1O 3S2FA 2VS1A 5FCDA 1JPJA 4LSMA 2GT1A 3A25A 3AVWA 2ZPUA 2JFQA 5T3UA 4P98A 2CHEA 3L0DA 1T9AA 4P7GA 4AB1A 2PJRA 1UMDB 2ZYWX 3OIFA 1BSVA 3DF9A 4KFCA 3HO1A 1QC5B 5TNXA 1L4KA 1UDWA 4GI2A 1USKA 5FA8A 3H2IA 2AUNA 2HIHA 4XWYA 1L5ZA 5H68A 3JQAB 2C2KA 4AMVA 4CTNA 5LZ7A 1HDRA 3KVVA 3H75A 1VMIA 1UDCA 3B70A 3BSFA 3N6VA 3RGGA 4Z1MA 1X87A 3ZKAA 1AM4D 1D6JA 2IF0A 4NKRA 3MGKA 1FW8A 1JDSA 3QNUA 4B3GA 1EFRD 3EA5A 2JAPA 1NW7A 3FRHA 3OEEA 4N0PA 1OU0A 3IA7A 1U7ZA 1K3UB 8ABPA 4MV4A 5LQDA 1Z8HA 5CB0A 2OHVA 4MW1A 1O87A 4NH4A 2IHTA 3X1XA 5LJLA 4RFVA 4XIJA 1UXKA 3O8BA 3OJ0A 4RO0A 3K92A 1CS4C 3CNNA 3KPVA 3K6SA 2EGHA 3OG9A 3OJWA 4NS1A 4IOMA 2FFRA 2I54A 4G01B 1HE3A 1SU7A 1UBRS 4KO3S 2E0IA 3AEYA 4MW7A 4QG7A 4Q1VA 3T1OA 4CG1A 1NYQA 1NUUA 1TIKA 4LBYA 3QKWA 1ZISA 2HIMA 2G77B 2ZJ6A 2XNSA 4PF1A 4PQFA 2FWJA 1RBQA 1KYVA 5LYJF 2JLQA 5JNVA 2GLUA 1NZJA 3K6SB 2BLLA 2A7XA 4KGDA 4GOKA 3ZHYA 1DAOA 2IHNA 1TEXA 3UB4A 4TYWA 2JFHA 2ZT5A 1K3FA 3QEOA 1EEHA 2Y4OA 4JYMA 5BO5A 1TE2A 1Y3HA 1RPJA 3KX2A 2QTGA 4WA8A 5JD3A 4CV0A 1VYUA 3CEJA 3WRWA 3UHFA 1Q2UA 2VNKA 3DLTA 3GYGA 1E7WA 3IULA 2EJUA 2WYIA 1MAAA 3L7JA 4HP8A 2YASA 4ZANA 3UMVA 4HDAA 3FPJA 2MMCA 3K35A 3GT4A 4XYBA 3R44A 4L07A 1UJ2A 2RSLA 1AXRA 2X4IA 3SX0A 3VXKA 2ZP1A 2HK7A 2JIZA 2ZYTX 3M9WA 4EYSA 4MUXA 3GLVA 4CKBB 1E0DA 3VNRA 4BZWA 1NT2A 4HWPA 4YRBA 4EH1A 2J4FA 2O3SA 4DR7B 1NWHA 1XNHA 1ZONA 1EA5A 1MDFA 2G1UA 1O9BA 4RBNA 1T9HA 1L8OA 4KFUA 2BTQB 3IQXA 1N5DA 1Q21A 3LA8A 4P4GA 3SVZA 3PHHA 5ICFA 5KHOC 1L9KA 2JFPA 4S2EA 3S8EA 1HNXB 3A0UA 5C31A 4QO8A 5TPZA 4Y2JA 4CRWB 2EU8A 3G2IA 1A5ZA 2H0RA 3DPUA 2PRSA 3DVRX 4FFRA 1XPRA 3PEWA 2JLZA 3SD7A 4M1OA 4BFCA 1SXJA 4WA7A 4IAOA 1U9IC 2WU3A 3R5FA 4K7JA 3HNPA 2BGGA 1NP7A 3PE4A 2EFCB 3STUA 5CDTA 3H16A 2C99A 3OAAA 2BBOA 1M6EX 1G8KA 2GM3A 3VYRB 4DIUA 4B6FA 5HUJA 4JYZA 3ZWMA 1V1JA 3W2TA 1HT0A 3GJ6A 4WDRA 4FOOA 4TTVA 4DCOA 5CG2A 4NE2A 4ARCA 1I32A 1LWOA 2IS4A 1MGOA 1UPCA 3MOIA 3EHDA 2ONKA 3L7MA 2EQ5A 3HB0A 3TLGA 2XNKA 1JIKA 1TA9A 3CN9A 4OTZA 3M1AA 3G68A 1SXJB 5LQKA 3R6WA 1TKBA 1Z28A 4X6LA 1PD1A 5B1SA 3UT5A 1RJWA 1VLJA 5A4IS 3UJ8A 4B7XA 2FCRA 5BUSA 4PIPA 1P1CA 5DYGA 3CH7A 1YCDA 1Z16A 4TN5A 2PMEA 5A2QA 3CKYA 4OFWA 1LNSA 4Y8VA 4BC0A 4L28A 4URZR 4GYKA 3DP7A 1R8YA 1TM7E 4Y30A 3TLGB 1U5BA 2QK4A 1UPUA 1W73A 4NX2A 1ZRHA 1O6CA 2J0QA 3CPHA 4QJBA 1Q84A 1HOXA 3FPLA 2EZ4A 2IZ1A 3OJXA 1HQKA 2DY0A 3RNLA 1WMAA 3LT1A 1IMOA 3W5VA 2Z3WA 3ZVLA 4Q6WA 1ODSA 1FJGB 1Z34A 4MS3A 2J3IA 1JXMA 1ZJYA 1UJMA 2E89A 3OUZA 4Q03A 4A92A 1U1IA 3RRXA 2CLMB 3ZHXA 1W0KD 1RRMA 3JAWA 3ER6A 4QPJC 1K97A 4LDPA 1U5BB 2CNWA 3GJ3A 4YV7A 4DV4B 3QVJA 3OZWA 1W1IA 2XCOA 2PO5A 2Y1LA 2PPLA 1QG2A 1ZSNA 5IJAA 1DOHA 3W06A 5LMNB 1Z12A 2QA5A 1FNBA 2VUTA 3DNMA 2HT6A 2XCQA 4H7JA 4C0BA 3JX9A 4GKBA 2FFAA 3WP0A 2ZYGA 1AQLA 2KBFA 2ZRBA 1AKVA 4MS3B 2JA2A 4DKXA 4K6OA 1E1CA 2CZGA 2A0FA 2GPWA 3RUPA 3WMFA 3JAWB 1N2HA 2IXBA 4K3VA 5TARA 3EVFA 2YYSA 4JBLA 5C7YA 1GO2A 3RVKA 3ZHBA 5IS2A 2AMYA 3Q9UA 4CKZA 4LOKA 1ZD8A 4B44A 1PG0A 1TU0A 5CMLA 1CRLA 2VHYA 2VWPA 3PGJA 4RIIA 5AJWA 1H1LA 1O94C 2V7PA 1YNSA 4E5MA 1BA2A 3B1YA 4I08A 3QENA 3ZU4A 1W88A 1KOLA 1YC5A 3FWYA 4C0KA 2HWWA 2GFQA 5FPHA 3W5DA 1QNLA 3T54A 1WD5A 4QEKA 3ZVMA 1E1CB 4RVSA 1DXYA 3ID6C 2XVAA 2W2TA 2PS3A 1LUAA 2ZDHA 4DLXA 1BTOA 5AOBA 3OUTA 2BDEA 2PFGA 3KB8A 5H4GA 3UGJA 1MPTA 1WPRA 4B5LA 1T0HB 3AU9A 3S81A 5IZCC 1TD9A 4BVLA 5B53A 4FFDA 1AUOA 1CDDA 1O54A 1U3GA 2CLHB 1KYQA 5J43A 1GL6A 4B3DA 3GNLA 3ZI7A 2AQHA 4TTRA 3KYDA 4PZEA 3W1WA 1PEKE 1H1LB 4PNHA 1W5SA 1HV8A 2IIPA 1UDAA 3RFCA 1P0QA 2AMJA 4II7A 2Q6OA 3UK2A 1IZ9A 4HXGA 3WZ2A 1ZA2A 5FHRA 2I6SA 4DHEA 5ALMA 4D99A 2FUEA 2NP6A 1QMGA 1UWKA 3NI2A 5F7ZA 4LIPD 2QL6A 1GNLA 2JFFA 1BCSA 1UUFA 3DO8A 5FD8A 2YWDA 5E7IA 4BX9A 5BNFA 3AX6A 2A2ZA 5KTNA 1JXQA 3GYBA 4IDBA 3V4PB 1KBZA 2GHQA 4O02B 4EUHA 2D3WA 4M8SA 2H4XA 1EK5A 4O4JA 1U04A 5AQ1A 4FYHA 3KYDB 3R5SA 5IW8A 1N75A 3QUTA 3RW9A 1PG5A 2FW0A 2I2FA 4EFKA 3BGIA 3KTDA 2JLYA 1WQ4A 1OWLA 4A03A 5JAZA 2C57A 2VYVD 3NEYA 4RKYA 1E2BA 1S3IA 1BVRA 2CSUA 4ZFNA 3WGGA 3HE3A 1YL5A 1M1UA 2R97A 4YAOA 1BCSB 5FBHA 4BWFB 3AG5A 2IH4A 3VAYA 5LXTA 4A91A 1XRNA 1GARA 3CGWA 3DE0X 5DVZA 3L4JA 4Y18A 2O05A 2QT0A 3HCCA 3HXOA 3OBIA 4F93B 4RHXA 1RLOA 3GBPA 1MEOA 3ILHA 3P5SA 5JRJA 4JXZA 1KZ1A 4H3HB 3O9VA 3CVVA 4MI3A 1YHNA 3X1JA 2ZRMA 1G20E 3VV3A 1NY5A 2FF7A 4RSGA 4WNYA 2Y77A 3L6UA 5EHNA 3EC7A 4BB6A 2IOFK 3RJZA 4DDTA 4TS3A 5LXTB 1H8HD 3OKAA 2ZI7A 4ZODA 3LUGA 2IHZA 2NTJA 2PQMA 1CS0A 3AI1A 1RRCA 3RU3A 1Y89A 3HLTA 2PAAA 4CHTA 3BX1A 3LK7A 3FIUA 4BX2A 4QXMA 4C9BA 5ALIA 2OCIA 3BMNA 1J0XO 3IERA 4MCIA 5CNIA 2PQ6A 1CR1A 4TLAA 4LZAA 3OJEA 4Q47A 4QAJA 1OBFO 4YREA 1PT8A 1XE3A 3IDOA 3U56A 2NT4A 2Q5HA 1JLSA 1K75A 1IZ8A 2YN0A 4X44A 3ROMA 4W9NC 3ZD6A 1EE1A 3AUXA 4CUJA 1JYFA 4DV0B 4Q7KA 4JV5B 3NBAA 5CBPA 3K53A 2M6SA 1L7XA 1CS0B 2EW8A 1OX5A 2HU5A 4RVOA 2VTEA 4WZZA 4FB4A 2VRWA 4AP6A 1C14A 2XCTB 3QM1A 1TYCA 1ZO8A 5JBIA 1KI9A 1ZU4A 1V3QE 1ESEA 3BHNA 2Y1OA 3BMNB 3IP8A 2HXSA 4W1QA 4YGXB 3TO5A 2QVBA 2GD1O 3TNYA 3UA4A 5TY0A 5K3BA 4UVHA 3GEIA 3KWFA 1G7SA 4NBWA 3VR4D 3SS7X 1FYVA 5JG7A 2HRCA 4XDGA 4N9WA 4TX1A 4B73A 3DNFA 4WE3A 4P4NA 2KYRA 4B09A 2ZLBA 5IBPA 2F17A 5G53C 6YASA 5BY2A 5CBPB 1DZ3A 1Z6TA 3IOMA 3MWJA 3VAAA 1BJKA 1BQ4A 3U7QA 3JCZA 3MJSA 3UA3A 1P60A 2LVBA 4FGZA 3TSYA 3WO0A 3EOBI 1BU5A 5CW1A 5DHAA 4E12A 2O07A 1TC2A 4DJTA 5EEHA 3P2MA 3GEDA 5ABPA 4OGKA 3HUTA 4EY7A 2CXXA 1INLA 1Q7CA 4Q1DA 4I3GA 1A1SA 1U1FA 1DJNA 1SK9A 4NYIR 2YHAA 3HFSA 4EGAA 2R8XA 3CWCA 3DLIA 4KSCA 2BKAA 2W2VA 4HJXA 4DJFC 5JAUA 4ZO8A 3FR7A 4L4UA 3FCCA 5FR2A 4AQYB 3A31A 3KETA 3MT8A 2H4WA 2JKYA 5D5HA 1XC7A 1MB2A 1RHMA 2GKGA 2UUPA 3ZZTA 5HUQA 1QTIA 3ZV4A 2DQKA 5ER6A 4AKGA 4Q7EA 1P0FA 1OAOA 3KJZA 1GZ4A 5GINE 4DQXA 3LE8A 2CBGA 3HJGA 5F21A 1WSDA 1GTL1 1L5GB 3EGWA 3LFTA 2WV7A 2BJWA 4CYMA 4I5EA 3UANA 2Y1FA 5MGNA 2PT7A 1DPGA 1Z62A 3T0FA 3MT7A 9ATCA 3UGTA 4L7VA 1J4AA 1IWPB 2DPMA 4PN3A 4AXBA 2HK8A 3IHLA 3UKDA 5DN6D 3TMYA 5KKNB 3SHFA 2O4CA 4J3NA 4ZZIA 3AKDA 3HSYA 4PZUA 3S2YA 1DX4A 5BXQC 1AXGA 1WF6A 3I8OA 5E9AA 2OP1A 4CR8A 1XF9A 1J7KA 4ARAA 3RVJA 4B8YA 4YASA 4ZYXA 1J39A 4Z4CA 3AFNA 1PQWA 1T35A 4EKEA 3U7EB 1OTXA 1MB4A 1Q1QA 4ZMBA 3ONEA 2GNOA 4P3NA 4UHKA 5H4HA 3IKMB 2AHOA 4ZO9A 3WIEA 4K46A 5BN1A 3CNQS 1ZH2A 4C4TA 5BQOA 1YNOA 3FPKA 4FFSA 2EV9A 4Q3AA 3EFEA 1U3FA 4UHHA 2NV0A 4JJ4A 4MWBA 5AUPB 5GIPE 3BYZA 2NN3C 2PPVA 5JATA 1GNSA 1P17A 2VNJA 1EP2B 1S8AA 3BEDA 5KPJA 5F3DA 5GVRA 5SZHB 2W0MA 1I5RA 2XZPA 3RTDA 1CFZA 1HYHA 1OWMA 1WXGA 3MTAA 2B9VA 3KKQA 4A2WA 3ZQUA 3LWZA 5K0CA 4J7UA 3NX4A 4AT1A 1HR0B 3KLPX 4AJ2A 1NQWA 3U9LA 4UMFA 2HA2A 5AOAA 3NDIA 2ZUSA 4R1MA 1OH6A 2J45A 2R1ZA 3ZVNA 1IBLB 4IGAA 3R3VA 1PGNA 3OIWA 1QUEA 1U0FA 2V0CA 5AM3A 4KPEC 2FJUA 2Q5LA 3BFJA 3TNDA 2FZCA 2W43A 4NZNA 2COUA 1YB5A 4LZJA 4OUKX 2OC9A 4BVKA 4EL5A 3ADOA 3NATA 2YMQA 2GJ8A 5CFPA 5AXBA 3THWA 2VYFA 4O59O 3MVEA 1R8SA 2OO5C 4WFIA 4M99A 3B1ZA 2ZYUX 5HF8A 2IKSA 3OZGA 5LJIA 2WSMA 4S1TA 2XUIA 4NFLA 3RS5A 4NTZA 4ZVNA 5IT5A 3BD8A 1YDHA 3PQEA 1SQSA 4ZT2A 2W6IA 5TF4A 1SXHA 1HMYA 5T8KA 2CDBA 1U65A 1WXQA 2GAFA 1MF7A 1YJAA 2OLKA 2V03A 3ZLVA 3ZV6A 4C7VA 5BV8A 1FFXA 1Z9BA 2JJ2D 1LPOA 1V11B 2C0CA 2E6KA 1MV5A 3FYHA 3I1IA 2J9XB 4OK3A 2GCEA 3A2KA 2Q0XA 2FWMX 2YZ2A 3G88A 1H9BA 3ESBA 1V48A 2PKQP 4PSDA 3THWB 2A0WA 4BKQA 4BMSA 2V7XA 4KAAA 5ITZB 1A4RA 3EXEA 4CDNA 4RA6A 1DRVA 1TT7A 2VN8A 1G3UA 1OZFA 2IODA 1D8TA 2Y27A 3RH0A 3KQUA 3FYDA 2OUKA 1QGDA 3QUQA 1CDEA 3K0SA 2WIAA 4DA9A 5MN6A 1NPDA 4MKIA 3HEMA 1NNUA 2FPLA 4MARA 2J6HA 3KQOA 4UNSA 2ONCA 5G0WA 1FFXB 5KAMA 4D46A 2RG1A 5L3VA 4C7OB 3IP7A 3T4XA 2VPWA 4EYOA 4YAJA 3HY4A 4G81A 3C15C 1KAMA 1H8ED 4LRXA 3LCMA 5A06A 2JB9A 3KZ1E 2NT3A 3EVZA 2JAXA 1PJLA 4RA6B 4ISCA 4OH1A 2OBBA 3ASZA 3VH3A 1W30A 3RADC 1VCIA 3CLRC 5B3LA 1VJDA 121PA 1H0SA 1LSOA 3IEXA 1CUUA 2C3PA 2Q2WA 3PICA 4MVJD 3VOBA 5ICEA 2G36A 4Z3KA 4GP9A 1J00A 3OTGA 2GAIA 3F7MA 1RLJA 1R00A 3QEBZ 4IYRA 4D96A 2NUPA 4KQMA 2C5SA 2WMDA 2Z43A 2ZATA 2P2ZA 3D6UA 4BCDA 4GOOD 2X1LA 1SEPA 5IMSA 4HB4A 5JT1A 4ZIRA 5SZKB 5KTMA 3F7NA 4D9JA 3ON5A 4FINA 2O2YA 2G82A 4H27A 3C0KA 4YMIA 1W2GA 1BDBA 2DWQA 2MMGA 2UYOA 2F4NA 4AUEA 3OT1A 4DGQA 4EG0A 1SY7A 1EGVB 4KQHA 3RVOA 5AW2A 5KOHA 4YFVA 3RUIA 2RGNA 2NUPB 2ZB3A 2XODA 3PUWA 3L77A 3MWGA 5DB4A 3UG7A 4HS9A 3SZUA 1H3FA 1PZMA 4OMFG 2GPAA 1D7OA 2VK1A 2EZUA 4DSTA 1X7DA 4URYR 3RQIA 2A86A 3V4FA 4WFQA 1NJ6A 3NEJA 1JI3A 2JJMA 3ZHCA 4YJFA 4ZIRB 5LDGA 1XZAA 4UHBA 4WHMA 2HKIA 3LBYA 4JJGA 4LJ6A 4DLKA 2LZ0A 2RAFA 2RHOA 3OT1B 2BISA 4CF5A 3BXHA 4M4SA 5BW8A 4ZOQI 3GEHA 1T2NA 3EXIB 4NAVA 4YRAA 5KOHB 3T9BA 1J2JA 3OQBA 4J9UE 1AGXA 2JK1A 3TB4A 1AMUA 4EGJA 1VA4A 1G0NA 3PRJA 4WOKA 4CMJA 2YN2A 3FNHA 1TL7C 3NRBA 1G2IA 4I50F 2H08A 1LJUA 4YJFB 1QMPA 3PYLA 3V2HA 3VR3A 1USVA 2JGMA 5GOTA 1GFWA 5J5VA 3PF8A 3VU9B 3DEKA 3GQBA 4B3MB 4MUYA 4IDDA 1FW6A 4RU1A 4U2EA 3A14A 2DECA 2OO3A 5KTPA 5GQSA 2DFDA 4QPZA 4P6VF 4GKVA 4RTPA 2QPTA 2MWMA 1QE5A 3ODPA 2QSYA 5FWXA 4OXIA 2G9UA 5F2NA 1GA4A 4O2RA 3TRDA 5C3UA 4RA9B 3ZV7A 4ECEA 5JCZA 4A36A 2XUDA 4OIMA 2YFHA 3RBZA 1K66A 1MXFA 3WJAA 2V7UA 3C7DB 4OLHA 4EHLA 4AJOA 3KD2A 3GQBB 3TCKA 3U9TA 4J9VA 4TVKA 1QBKC 3HN2A 3CF4A 3RRNA 2IXDA 3BE4A 1E2FA 1D2CA 4INAA 3OE4A 4FOSA 1J1UA 2HRZA 3F98A 2AS0A 3PC3A 4LCBA 1NN5A 1D04A 1E1RA 2ZXFA 1X6VA 2AOUA 2YIMA 4J4TA 4PTLA 1SOMA 3NNSA 5CNMA 3VOAA 5FWXB 3LQ2A 2IYVA 4CUZA 2P7IA 1RQXA 2V4MA 2W7TA 1ISSA 4JA0A 5FLXA 2WE8A 1HEUA 1V5GA 3Q0TA 4AG6A 1UQTA 2QW0X 3UZUA 1XWFA 2Z5VA 5DDIP 2ATIA 3P9CA 3IQWA 2RH9B 4PPQA 3W6UA 1AQ6A 1EK2A 1OT3A 1OR8A 2HOQA 2WA2A 1Y9DA 3E53A 2P91A 3JD2A 3ZTWA 5HJ2A 3F5QA 1NSFA 2FGKA 3Q5EA 4ZTBA 3WZMA 2LCQA 3TXAA 5TV2A 3CZQA 1XVLA 1MFPA 4X7RA 3X3HA 3NETA 3TF5A 3F6SA 3SIWA 1Q7GA 4ANFA 4PY2A 5EXTA 3OFND 2QLMA 2W6ZA 4KI7A 2I3AA 1LLFA 3D8UA 4L4YA 1JG4A 4EI8A 5J3JA 1CIVA 3TTWA 1NZFA 2ZCUA 1KI3A 2J5BA 3N0VA 4HOYA 4K9KA 3SBEA 4XIIA 4UQOA 2K6GA 4TSKA 3FWNA 2GERA 3I76A 3KQKA 4RIEA 4Q12A 4UVEA 2DHRA 2FQQA 1T5BA 4IG4A 4HQNA 5LQAA 1MVOA 2XOEA 2VF7A 4UBMA 3GZTB 5AH0A 3HCEA 1TQHA 3DXYA 3QNMA 3OOSA 3DYVA 2UYYA 4DPKA 3L0BA 1DBQA 1A72A 1H23A 3GFTA 1SHJA 3FOWA 3SAJA 5JFGA 4DJ5X 2R7LA 1WDWB 3I72A 5JSHA 5KYYA 3GLIE 2C9BA 4YXWD 3I37X 3W6PA 1BS1A 3TBKA 4U5XA 3MUOA 4P80A 3P4XA 5LLTA 3TK1A 1D2MA 1JDBC 5FOTA 5BSWA 4LVUA 1DJMA 3AWIA 1KARA 4WK4B 4YVFA 5HQ3A 4DLTA 4OHFA 4G6ZA 4LRYA 4GKKB 1JAXA 5A7FA 2ODTX 1TRHA 5IEJA 3NOQA 2QD1A 4RC9A 3BQNB 2C20A 3AERA 1NHGA 3PXXA 4L6IA 2HRDA 3WWZA 4YDQA 5KYYB 1PW5A 2FLVA 3WGTA 3IEIA 1UKAA 3HA5A 4M9CA 1GG9A 2FPXA 4MEAA 5IVDA 4FNMA 2EJVA 4QODA 3FOFC 4ZVTA 1LPNA 3ADKA 3VPFA 1NMQA 5JXIA 2XUKA 1YDMA 1DUVG 4FJ2A 3LFHA 4QDUA 5HR5A 5HQ3B 1E69A 1NOIA 2H7XA 3A3KA 2OV4A 1CY6A 4Q1AA 4WRRA 1UBCA 2OY0A 3L7CA 4G23A 4PHFA 1N36B 1L1EA 3M81A 3W7BA 2NTNA 3PXBA 1KPHA 3AERB 4G8CA 3AVOA 4ZN6A 1UPTA 4KXWA 3D43A 3GRYA 2PWBA 2YINC 3GBSA 4XYMA 3PQFA 3RYCA 1MJNA 4ZCRA 3DL2A 2QIPA 2HCTA 1PZHA 2X14A 2X5NA 1WDKA 4IWNA 1A9XA 2NLOA 1Z4LA 2H2FA 2IZ6A 5KYKA 3GJXC 5DYIA 2CC2A 5DZSA 3ABSB 4MPTA 1PVOA 3ZE9A 3KEQA 2H6EA 3DLAA 4M38A 2OFXA 2Y0CA 3BCRA 3E3OA 3WQBA 4MQLA 3JQ6A 2GN9A 1ZITA 3CW8X 3IESA 4I99A 1VIYA 4F85A 3EHEA 4KSBA 3RYCB 2GPJA 3U44B 1EYZA 2B37A 3T3PB 1QV7A 4QDOA 4BTEA 5AR1A 3BGVA 3V3TA 4E08A 3W9SA 2P68A 1OI3A 1A9XB 3KB1A 4WACA 3DCJA 5FX2A 3CIOA 2XMBA 1NLFA 5K3CA 3LF2A 4GO1A 2QW1A 3L4EA 3M70A 4NPHA 4YDHB 4CFZA 2WWYA 4LMPA 3HC7A 1NIJA 3L1IA 1CVIA 3T94A 1W93A 5TMPA 1RKUA 3EUWA 5BN4A 4N3BA 3V4OA 4US1R 1YOVA 2A9FA 2WHRA 5DV9A 2JIDA 1U7PA 3IDQA 3LUCA 1NJFA 4O0MA 1GGFA 4REQA 2E3JA 4F56A 1QZ3A 1XDGA 1XIVA 5TXGA 3WLPA 2PGOA 2VQ6A 4O4HA 1RJ9A 2AI2A 4MR7B 4ERNA 1EFKA 2Q0SA 3VZCA 5DO9A 3DVSX 4CMBA 1RU3A 2WUGA 4IHJA 4Z8XA 1JGTA 2MSWA 2W6OA 1GRNA 4R9SA 4S1OA 1S2OA 4MVWA 5HIKA 1Z8FA 2BEKA 3LQ1A 4AO7A 1RT9A 2R62A 4D57A 1YOVB 5IFKA 3MFYA 4REQB 5FBLB 4UCXA 4CM5A 4UTRA 1MNAA 5JANA 3CSDA 1F0PA 3LS2A 5JBNA 2OORC 3Q8XB 4C6TA 1P1KA 5F12A 1XRJA 4O4HB 1RJ9B 2ATCA 2L69A 2GBFA 2XTMA 3N2EA 1FQWA 4LOHA 3I52A 2RGDA 1S1CA 3I0MA 1YMQA 1X9IA 4N5DA 4X93A 1PHRA 3STXA 5K8LA 1EDBA 1B6TA 1T3ZA 3HJTA 3GJSA 3D7NA 3PCRB 4MSUA 4O29A 5ESDA 3T7DA 3FOBA 3RFXA 1G17A 1R16A 1QHEA 2X40A 1PWZA 1QKIA 3WWYA 3I6MA 2FSHA 1CB7A 3H2BA 4JMPA 1H2WA 1H2XA 1ZMOA 3IR5A 5EY5B 4C03A 2AR0A 5EMJA 1QM5A 3MJFA 2J0SA 3JQFC 1QFXA 4XR9A 1C3LA 5DCYA 1TK9A 3WTBA 1VSVA 4K6CA 5IJWA 3E7WA 4G36A 3TTXA 1W36C 4N0MA 3VNSA 2O5EA 4KU4A 1SZCA 4UXJA 3I2HA 4IKEA 4P08A 3SJBA 1EXDA 3WGOA 2C2HA 4JOCA 5HE8A 3RV4A 4DMGA 4ZYZA 4PYMA 2PJUA 5DYNA 2X0KA 1TMOA 3NOXA 2I8CA 2Q41A 4TV8A 3U13A 5AUNB 3GGSA 3CNOA 4E09A 5IYZF 3KVYA 2QD3A 3GRFA 4E13A 2XRZA 3CG4A 3RYFA 1W6UA 2XXAA 4EGQA 4EF5A 1X7GA 1SWVA 1M34B 1C7FA 3K31A 1MGPA 3S2EA 1FRFS 3WSWA 4G86A 2AQKA 1UBTS 3B9BA 2H3EA 4KFRA 3T4UA 1NASA 5JS2A 5MHTA 3THXA 1IPHA 2ZUFA 3RYTC 4OJKA 1FVFA 4I8XA 3I6YA 1MD9A 4P5EA 5FOQA 4HDRA 3PSAA 4DYDA 3NR2A 4TV8B 5JAQA 1FFYA 2EBUA 2WKWA 2ZKIA 3IKJA 4IIGA 4YAIA 1WHTA 3RYFB 3V8BA 5BQ5A 1XXHA 4BGIA 1VE7A 2AMFA 4JYCA 3UMSA 2FMIA 2PL5A 4D82A 4AKHA 3THXB 5B58C 1GGEA 1J0AA 2GPBA 4DR1B 3IEMA 1SELA 3VO2A 1G16A 3MQ2A 3O8QA 4OQXA 2O48X 1E2DA 1GZUA 5H8WA 1NAIA 4HDRB 4GLLA 4DQDA 3MHPA 3SF8A 4KRFA 1FNCA 4XGQA 4B3BA 4HB2A 4Q3EA 4PFSA 3SNHA 3HQ4O 1I6LA 2CF5A 2VP4A 1GUDA 1XXHB 1T5HX 1MOQA 2VXYA 1YQQA 1UJ4A 3WAGA 1VJGA 1E1YA 2QTHA 3GQVA 2D06A 5CVVA 1KR5A 3CVOA 4Y67A 1CDOA 3KJXA 4PG5A 5DISB 5LBTA 1HT2E 2HQRA 2IYQA 4MYSA 4WY2A 3DCYA 3VSBA 4B47A 2GPTA 3O8QB 3T3HA 4EF6A 5KSZA 4KK4A 4LK2A 3VTFA 1DAHA 4V38A 2QLFA 3E7FA 5I7OA 1E8DA 1O96A 2A57A 2ZRKA 3A04A 3BIJA 3MTBA 3DLHA 4IIDA 3V32A 1IBKB 3OOWA 4EKNB 1BRMA 1MAWA 4OHPA 3UHAA 1U0RA 4PSAA 1J0BA 2GAAA 3KKLA 1ONOA 3I39X 4LJLA 4M9RA 3SJ7A 5ALHA 3A4LA 1FNMA 2FXVA 4UFOA 5JROA 1RM5A 4FBGA 2C9YA 5F2KA 4DR6B 4C4ZA 1QK5A 2CV0A 3FDJA 1DC3A 1P7YA 6CHYA 1KVTA 2PEYA 2DFKB 4O2BF 3DE4X 4L5IA 3DZCA 4V24A 1AV6A 2JHFA 2OFOA 1UFOA 2QS9A 2O8CA 2YN4A 1O96B 3HZHA 3SICE 1ZGCA 3HH8A 5KTYA 4O2AA 4JI4B 2QRLA 3JQEA 1J6UA 1GAEO 1JTVA 4GM1A 3AOEC 4NZMA 4GQIA 4O2AF 4QQKA 3H9GA 3AOGA 4ZK2A 3W78A 1AN9A 3TXXA 1ZLXA 3MT9A 4PHHA 3E0QA 4O2BB 4ICIA 1BH6A 1RJDA 2XZOA 1EE9A 2BW0A 3WYCA 3O8LA 3SR3A 2ZM5A 2D5AA 3FFXA 3CT6A 2O8CB 2DP4E 2AX4A 4TWAA 3GGGA 2Z9DA 3OIVA 4MRVA 3V6LA 3UW3A 3REGA 4WLFA 4M7PA 4O2AB 2Y71A 2G4CA 3KT0A 1RWKA 1CUVA 2A5FA 4YAKA 4HZGA 3KFLA 3QE9Y 2P9JA 2REQA 3Q9SA 3BBLA 3U1TA 2C82A 2GJKA 4DJDC 4JD5A 1JLKA 1Z7YA 2FNAA 2RC6A 4FE7A 4DLSA 4RTNA 2AYXA 2R84A 1N6IA 4HGOA 4OLBA 3K8YA 3AY0A 3LHSA 3G6KA 4ESEA 4UHFA 3I9MA 1WXDA 3H6HA 4ZYYA 1CUBA 1KTVA 2XKBA 3ESCA 1YWGO 1L5HA 5I9SA 1X2EA 4WJKB 4FFPA 4FQ8A 4CLXA 4YPOA 1AY0A 1B43A 3NVAA 4EUEA 2REQB 5IEBA 3NCHA 4LJ5A 2EKPA 2FUKA 4M0KA 1TZMA 1SA0B 1Z2OX 2GX6A 2BAGA 4RTRA 1QJCA 1X14A 4HFMA 4Q3KA 2DBZA 3DT9A 2FUG1 1JU3A 5DHQA 3SPXA 3HTXA 1RBYA 1RC0A 2HNAA 4PZLA 1NUSA 5JZOA 1YACA 3T6KA 1L5HB 2FEWB 4JL8A 2B7BA 2ZREA 5EAIA 1VKJA 5HJ5A 4MTCA 3S28A 2NO0A 3ZWWA 4DNQA 1DOZA 1O6BA 3QITA 1HLFA 4OF4A 1VI2A 3JWPA 5LQCA 4H35A 4E5DA 4MMXB 2BN4A 3H1EA 3GJ4A 5D7BA 2BE9A 2P9TA 3GLRA 3W34A 3WTCA 1PJRA 1Q0QA 2ZIAA 3CT4A 4MITA 5IF9A 1Z4NA 2OPHA 2YHBA 3F2IA 1T4DA 2AOVA 2AW3A 3OZIA 3QG5A 4DUYB 1Q0ZA 5ALTA 4RMNA 1EZ4A 1RFGE 2CCGA 3CURA 3SSMA 4EI9A 1EI9A 5JISA 1QKJA 3PNYA 4FNGA 4HB3A 4TTIA 1EBFA 3W2IA 3ZWNA 3HSSA 4BLPA 4FDTA 2X9LA 3ZW9A 3ZDDA 3PNKA 1DAKA 2GK3A 3KXIA 1T26A 2BI4A 2VDRB 3H1BA 3RWBA 1TU4A 4R8RA 1VXOA 4KXFB 1R27A 5HGJA 2AMVA 3JWEA 3L01A 1G6OA 2A14A 5EJ2A 5FB3A 3TWOA 1J09A 3A10A 3M89A 2PUFA 3DD1A 3J7AC 1NW4A 1EFDN 3KT8A 5JXGA 1W75A 4H1HA 1FFAA 2IUFA 2O1XA 1NPYA 3U17A 1LK7A 1FXWA 1DARA 1YR6A 4YYEA 3K94A 3RVLA 3PUHA 3VSAA 1IOVA 3B82A 4WKBA 1L9XA 2JBWA 1ORRA 5DTQA 1E63A 1FXWF 4HJRA 4HX2A 2CXNA 2EFEB 3GFOA 4DAOA 1M2KA 4A0HA 4KAJA 4R2JA 1OYVA 4RD6A 2HDNB 5A3QA 2SNIE 3KYCA 1S2GA 2AFRA 4GC5A 1NW3A 3NFRA 4KMMA 1C0KA 4MJ7A 1OWPA 3VOTA 3EX7C 2BKLA 1T2VA 3BZUA 5HMLA 3ND5A 1ZD4A 1EP9A 3O5AA 3AM4A 4G41A 1Y9EA 3QMPA 1TYBE 2Y76A 3AT1A 1OXUA 2XDYA 1ZQ9A 1TTTA 5EZQA 3O1LA 2HZ7A 3H0CA 5JHHB 5DBFA 1N3IA 3NALA 2PMCA 2FJPA 1ISFA 1L1RA 2OZKA 2ZZKA 3P0JA 4GH5A 5DBGA 4BLSA 2QVZX 4GVPA 4CF7A 5LSAA 4FFVA 1IN4A 1UZAA 2LGJA 4UNPA 1YJ8A 5CX4A 2IYNA 2Q5IA 1DRWA 3F2VA 1CJKC 3MTDA 1CJSA 2PK3A 3GRCA 3SLGA 4K26A 1TTQB 4P58A 1SOUA 1ZNWA 2NV6A 3MJRA 4JA2A 2A6PA 4J7CA 5CLQA 4KMOA 5I7UA 2BP7A 4CG2A 1Q0TA 1FYFA 1BMFD 3KZKA 4FMCB 2VZ8A 4QJ4A 1ULBA 4QU8A 3ROKA 2QMOA 2LBPA 4RF5A 4Z4IA 4PX3A 1Z0DA 1T1RA 3E4CA 5IAJA 2E4UA 4JNCA 3GUCA 3R6TA 1RCUA 4UMVA 5AICA 1EXNA 2PUBA 3AFIA 2VP3A 1T2DA 2AEMA 2RHLA 3IBTA 3QVSA 1MO4A 4PM4A 4OBEA 5FO1A 4IJQA 2VZ0A 1QIJA 2OXIA 4RXMA 1O97D 3JPYA 5KWIA 3DV0A 1AIPA 2JS7A 1JFRA 2PD6A 2VJBA 4WESA 1EJ2A 2HWXA 5JMTA 1X3LA 3SYMA 4XSGA 1LC3A 1S2IA 3GI1A 2LDXA 3KDSE 5EHIA 2BP7B 3JRXA 1YUMA 3CH5A 3VPBA 4MYDA 4QDJA 1QCDA 4BO9A 1JIVA 2XMDA 4V02A 2J3LA 1KYWA 3PC6A 4DEYA 3FI9A 2HJWA 4KNWA 4JDUA 2HSJA 2ZSBA 2ZIGA 1IUNA 3HY6A 3EVAA 1ZCJA 1N2SA 4NFHA 1D6SA 4Y9SA 3OLWA 3SJUA 4IG9A 2IYUA 4NCKA 4WADA 3TW8A 3OOEA 1NR1A 4XB2A 5K8JB 3X1DA 4IP0A 2IPXA 4JZYA 1M0WA 5GP1A 2DWUA 4LX0A 4W4TA 3LGSA 9GPBA 4CDMA 2IYLD 3NGMA 1M6HA 3ZNNA 4HVCA 3KCQA 3UQZA 3BWBA 4X1IB 1DCKA 1ZAKA 3FTNA 4J3FA 4AP5A 4KFTA 4RANA 3ZJVA 2X5JO 3P20A 5A7GA 1I9CA 2OXEA 4BP3A 4JLUA 5IC5A 3FW1A 1YDFA 3TW8B 3FJ1A 4HPXB 5JCJA 1NKSA 2P77A 3P9SA 1T1SA 1WKCA 1YZLA 3CLHA 1A9PA 5HF9A 4Z2AA 4JYAB 5CD9A 1HKUA 2Z57A 3D5TA 1RRKA 1HL3A 4FWIB 1GTSA 1YRLA 2RD2A 2WD8A 3EY9A 4NS4A 5DW3A 4H59A 4F5DA 4U2KA 2D0OB 2VHUA 3MGCA 4TLEA 4XI9A 4BLTA 4YC7A 4W5WA 1MAVA 1MC1A 1T25A 1VKRA 5DHPA 2VQDA 3DMPA 4JUBA 1KDZA 3ZV3A 4U7JA 4BPRA 1V8ZA 4IX9A 4NZ9A 4RFLA 2OV6A 3KB6A 1O97C 4R8MA 4AZSA 1G9SA 2CHGA 5LB2A 3BIXA 1XD9A 4PFKA 3K2IA 3RKUA 2EZ8A 4PCLA 1U2SA 3RS3A 1VGQA 3FR8A 3PL5A 3RTEA 3LVRE 4FX5A 1P74A 2WHYA 5EPEA 1NRWA 1L5OA 2I6FA 3CYFA 3W0LB 3WB9A 2YYZA 3WNDA 2DU8A 2VDLB 3HWSA 3Q85A 5EIEA 5JY1A 1KBOA 3G89A 4DABA 1ACLA 3Q98A 4N3AA 2VBGA 4ISBA 4JWKA 2PUAA 3HP4A 3R3YA 2WFLB 1L0BA 1HE8B 1DG9A 1WLYA 4E15A 2V6MA 1PZGA 1E5LA 3D8SA 2BMFA 2I4MA 3P52A 1VHTA 1G0OA 3CZ9A 1SHKA 5HILA 2ECKA 1PTJA 4L85A 2QRQA 4QOGA 2ZRHA 4GX2A 1KK3A 5HJEA 3LKVA 2BM9A 1M2VA 5E8JA 1AJEA 1ZI9A 1HH4A 4DEXA 5GZ3A 1ABEA 2ZTHA 4XUEA 1EM8B 3AG6A 1UEXC 2QNIA 1G20A 1HFJA 2Q1UA 4UUBA 3B2EA 1OH5A 2KLBA 3U4IA 3I62A 1KZHA 2XT0A 3ESDA 1QQ5A 3KSDO 4MRAA 3ZUPA 5E9QA 1KMCA 2FZ4A 2FMUA 3F6PA 1XCPA 4NPAA 4WN9A 4C0AC 4BP1A 1LNQA 1PWHA 2GOYA 2KSQA 1M2VB 2RHCA 3E22A 3JSXA 4JVOA 1S6YA 2AHRA 2Y1XA 4K05A 3DAHA 1Z5GA 3VHLB 4A3SA 1E3SA 4BMPB 3HJFA 3FRJA 5EKDA 3VNAA 1U7DA 1G20B 4GPZA 4GNRA 1NU8A 1A9RA 4JI6B 3KTOA 4QT0A 2WD9A 4MV1A 1H2ZA 3W3ZB 4OHXA 5B3KA 2R5FA 2HH9A 1GUBA 3TZ6A 2L42A 4YIHA 1YI0A 3EG5A 1ZJ5A 2M2IA 3ZCQA 4QT4A 4WN9B 4HNAA 3PIIA 4XLTA 3WK5A 1J8QA 4KITB 3E22B 1VRWA 3P2YA 5EJ9A 1LI4A 1VIVA 2H59A 1NXOA 4FILA 2ZIVB 4P84A 3UKOA 3HXLA 3VBEA 5KHLB 3NORA 2R6AA 1CJBA 1UM9B 4AG5A 2VK8A 4HHEA 4WJLA 3WL4A 3NAMA 4TRJA 5BVHA 2CV1A 2CXRA 1SCDA 4ZVOA 5TEWA 2AK2A 2JGKA 3JATA 3DE7X 3LI2A 3PKJA 4QQNA 5HSGA 4BMVA 4QDKA 2PWAA 3LMKA 3TKYA 3RAEC 5B55A 1WUIS 4B5KA 4MVJP 1XEWY 2A9QA 4QOSA 1TW2A 3EDCA 1Y34E 4EUNA 2IZZA 4WLNA 4HNAB 4CL8A 2C5EA 1RYDA 2G08A 3AJ9A 3TJMA 3A06A 4OJNA 4RLSA 3TLJA 1YJ5A 3GUZA 1BH2A 2BR3A 5IHPA 1MABA 1WMDA 2FWNA 4YPFA 4ID9A 1ZNZA 2OG2A 3C74A 4GI7A 4LKRA 1P61B 4M46A 2Q1TA 3A6GA 5HFNA 3V7FA 1YH3A 2D1YA 2C3YA 2R5NA 3JATB 3A1EA 1YA6A 1E3WA 2C0PA 4WASA 2Z4TA 3AF5A 3PR1A 5C8VA 1U28C 2ECFA 3L06A 4RQTA 1BDIA 1XTZA 1IB6A 1B1CA 1DAFA 2WM8A 1L1FA 1P0CA 1B42A 5B6PA 4CN9A 1G6HA 4BB0A 4NDAA 3VSCA 4RD3A 1FIUA 4LDZA 4OJYA 2GEVA 3DEFA 4KVFA 2R8BA 2RGEA 5TMDA 2YCLA 4A2QA 3OQNA 1E94E 1MABB 3CO0S 2NQTA 4ACBA 4YV1A 4MJ3A 3WWDA 3NGLA 4CM7A 1G6KA 2O1WA 2PTGA 1RI4A 2R6HA 4H6PA 1E3WB 1NSTA 1RAAA 3TOVA 2WSBA 2ZBVA 3T5GA 3P2OA 1G18A 2HZBA 4JL5A 2QVGA 4V3BA 4XEHA 2ZWIA 1BDMA 2RAPA 1GSOA 5FADA 5L4NA 4ZQCB 4M1YA 3B60A 3CZMA 5G02A 1T8PA 4R54A 3VTKA 4S04A 3L0SA 3DG9A 4BECA 2DR3A 2NO9A 3VC3A 3NDBB 2XUHA 1VA5A 1L5KA 2PXCA 5DASA 2YUIA 1KQGA 4IM7A 4L4SA 4RSMA 2YZ7A 1H4VB 3HNOA 1RWQA 2JIOA 2QG9A 4HLQB 1HNNA 1PV1A 1ZBQA 2GKSA 4MWSA 2WZQA 5DJ5A 1HLGA 1NQUA 3VGJA 5DXFA 4MUBA 1KA9H 3AV3A 5H9VA 3HB9A 2DTEA 2QVLA 3I92A 1WSAA 1FSPA 1J8VA 2WLSA 2NU9A 2VIIA 3DVLA 4YFYA 3MGGA 1J2YA 1VPLA 2I33A 2CEAA 2UXDB 1S89A 5BQ3A 1NVWQ 2XA9A 3ROEA 1NW6A 3E5MA 3EVDA 1MFZA 3EXHC 4K0RA 2CHFA 2QU7A 5EJFA 2OXTA 1UZLA 4ZZ0A 3I0NA 5AO9A 3DBIA 5FJIA 1RWMA 1GGNA 3U19A 5AUQA 4LOAA 1GCAA 4NZPA 2WMOB 2BZSA 3HU1A 1DBWA 4ZAFA 3KVOA 3V2IA 5BYAA 3TRJA 1CC1S 4DUZB 2PS1A 2ZJOA 5B12A 1PX0A 2G5PA 2X86A 1ZJWA 4Z1OA 3PQ5A 3VTAA 4JP2A 4NPCA 4ZJYA 5FUVA 2Z1DA 5EA2A 1TM3E 3U31A 2AJTA 1HRDA 1NT4A 1W2HA 3O1HB 3RAFC 1PNRA 3DFFA 2A8YA 4NDZA 5DHRA 4Z49A 4IRXA 5A3JA 5JXHA 3UJ7A 2RMKA 8GPBA 2IBSA 3TBHA 3LJKA 1K7EB 1NVVR 2A30A 3QI2A 4DSZA 5J2UF 3FFAA 3FGPA 3MCWA 2ZEJA 4YJGA 3I2GA 3NIBA 1XQXA 3N8IA 1L7RA 3AW8A 3GVXA 4UPVA 1TT5A 5D86A 1Y3CE 1LD3A 1DQPA 3CE9A 4G65A 4KLZA 3JD0A 3DBOB 5DLYA 5CEJA 1CG6A 2J8ZA 2WEKA 4LQCA 2NMVA 4RKQA 2WTBA 5IBRA 4EUFA 3UM9A 4YP9A 4NRDA 1HG0A 1WCYA 3B5JA 5EKSA 4HK4A 2JJ8A 3GP8A 4D8WA 1G9XA 4UHDA 3ZE8A 4CG3A 1BW9B 1II9A 1YZHA 1J1ZA 1BFUA 1E77A 1T8UA 2O2EA 3DMNA 3JR7A 4YJGB 1OXKB 3PQ3A 4M49A 1A9YA 1IG0A 2AG6A 3JVIA 1GUYA 3RKRA 2EDCA 3EUEA 2HMYB 2FKAA 4I1SA 1TT5B 3U5ZB 1NW8A 1YBAA 2AI1A 1LJ8A 4UEWA 1K4KA 3OY2A 3MAGA 2VHZA 3ZNOA 4QECA 3TYXA 3PITA 4LJ7A 2YV4A 3OHMA 5F98A 1W6RA 4HSGA 4N5HX 3RUCA 1QE3A 4BVEA 2PUGA 4PW0A 5CLIA 4DAEA 2X5OA 3HJUA 2H0QA 3FGZA 4N0QA 1WTCA 5DN9A 4D8UA 2R7NA 1ORTA 1P6UA 3GH3A 3GMTA 5AIAA 2R7AA 5LA6A 1PSWA 3TLCA 4LVCA 3V7UA 3DWGA 2G6TA 3MLEA 4FLFA 2VDNB 4FDAA 2Y92A 1K4YA 4F3NA 2C2BA 4ZOCA 3G6WA 3VX4A 4F2DA 1MG5A 2UZAA 3AVPA 1GTG1 1MV8A 5KJFA 2Q4BA 1C3EA 3PR3A 3WLLA 4LQ4A 3E70C 4XGNA 5C80A 4GSYA 4U8HA 4J4HA 3MEQA 4GM4A 1QK4A 1G8FA 1QIDA 3SG0A 1UBOS 2ASEA 3KYBA 3CB4A 1SHLA 1RWBA 1EG2A 5DP1A 1GTJ1 5LA6B 3A6HA 4CQMA 5K5EA 1XL0A 2H9AA 3CNBA 4X3PA 4G8BA 4U0JA 4FR0A 1H4SA 4ZYVA 3D0RA 4F8YA 3JQ9C 1GPBA 4Q1CA 4AJKA 5GWXA 3O3OB 1OAAA 1K7XB 1MRZA 2XWBF 2FTKE 2ZFUA 3ED1A 4Q6BA 1CUXA 2Q3CA 2QT9A 4M1KA 3Q7TA 1VIDA 2LNDA 2MYTA 4MKHA 1BN7A 1Z26A 1QVZA 4QUAA 3GVCA 5E7QA 3QLUA 5EKXA 1EU1A 1Y8QB 3U39A 5IWCA 1DX9A 4ZT5A 3TR5A 1COWD 3R7NA 4Q7JB 3E9RA 1XMSA 4MV7A 3RSCA 5D3ZA 1WXEA 1XDSA 5AFSA 3E6AA 3EQ8A 3QPWA 1YZQA 3L5OA 4CQMB 3DHNA 4JC8A 5AVJA 5A5FA 3CLSD 3E2MA 5GIOE 1BJRE 1ETUA 1GR1A 1T9DA 1VIAA 1XOIA 1Y4ZA 2I29A 1JJVA 3LZDA 3MS2A 4G97A 3TKLA 3UQYS 2NXNA 2UZIR 4DARA 5JDCA 2FU5C 2H52A 3L2OB 5DEIA 4E5PA 8LDHA 3NTLA 5DM1A 1EUCA 1QGAA 1JQ5A 4B2PA 5LUAA 1WUHS 5ENDA 4JJ7A 2Q1XA 3MRSA 2IHBA 3IIIA 4R9UC 2XKAA 3JYQA 2ZU6A 4F3CA 2C7QA 2LCIA 5E3IA 1TU3A 3HDVA 2QTMA 1R0BA 4PRKA 3RSFA 5EE9A 3T5CA 3TLZA 3FUVA 2YVQA 4JP8A 5F1OA 4E7PA 1USIA 4WOCA 4FLMA 2R751 1CR6A 5DT2A 1LSUA 2B5VA 3UGQA 4C3VA 1HORA 3M5WA 1GQ2A 4NK5A 4COOA 3TUZC 4J0CA 5E0OA 3L8YA 5K3DA 4IFTA 1EUCB 3DULA 2OXRA 1SIUA 2FH5B 1KEZA 2FW1A 3KR0A 1CY7A 2C0QA 2I7CA 1Y1LA 2BL4A 4PEVA 5F77A 3JQBC 1QF9A 1VCMA 1C9YA 4GE3A 2XVYA 1NXQA 3CRRA 1MAHA 1CJTC 1FDUA 1GXSA 5T4EA 2HM7A 4C89A 4D3ZA 4Z7NB 4YYZA 2GCOA 3OEHA 4JITA 4IUDS 3V9AA 3M6VA 2VQSA 3M4YA 4XAQA 3FCEA 1N0UA 2VDOB 4OYHA 1N0VC 2DETA 3PD7A 3T9EA 3RFUA 3JRNA 1X94A 2DCUA 3G2KA 1X1TA 1O0BA 3L8EA 3EZXA 1Q57A 1SBHA 1EUQA 4UBNA 2A5DA 3T5PA 2WYHA 4C04A 1A71A 4BB5A 1XPJA 4L78A 2GBIA 2GUWA 3C3KA 3V4ZA 5IT4A 4IGIA 4BNTA 2H5LA 3OO0A 1Y8RA 1GXSB 2X2PA 2ZUWA 3IPLA 4R5MA 3O31A 4D9HA 1IWOA 1XVTA 2GN0A 3WL7A 2HLHA 2YHUA 4OGLA 3IBFA 3LQQA 4LMRA 4XFKA 4GWGA 3U3XA 1YU6A 3MJVA 3JYNA 4PWYA 4CWAA 5C5EA 1DXOA 4O6VA 3GU3A 3I28A 4QPCA 3A4YA 3STVA 4JLPA 4BKMA 4P34A 5I5EA 4XPZA 2UXBB 1PW7A 5LB4A 5A4DA 1P0PA 2Z58A 2Z56A 3OFKA 2HRBA 4AS2A 3PWSA 1BZYA 4J0JA 4S1PA 3RPEA 5KJ1A 1Y8RB 3UT0A 5J4YA 3LKDA 5DBIA 4HDOB 1GYQA 2QJWA 5F52A 4C1BA 3G82C 5CT8A 1JR4A 3QFFA 1J22A 1MR3F 4G63A 4FUTA 1L7MA 1SVSA 4L15A 1Z35A 5JC8A 1J07A 1KPGA 4I4LA 2ATXA 1GL3A 2JH8A 1EUYA 4OJMX 3LV8A 3VNUA 7REQA 4OO3A 3DLBA 2I67A 5JW6A 4I4TF 2QUAA 3B12A 3CMMA 3E4DA 3U81A 1AHIA 4EY6A 1ZDMA 1N5LA 5FLEX 5IAGA 3DC7A 3RK4A 5KNCH 3ZJUA 3MGBA 1O57A 5AW0A 2DFPA 3MJ4A 4BKOA 2G9QA 2XYHA 1D5WA 1XMQB 2VCEA 4Y9DA 5DIFA 3PEEA 1C1DA 1EX9A 2ADOA 1Y5MA 2OMEA 3IHTA 1P7WA 4FQ5A 3BXPA 2FOLA 3RROA 3MBIA 4DIBA 3H2SA 4MQFA 4ZC1A 3GFFA 2ZB8A 1PVDA 3GLIA 4Q18A 3UMBA 4ARVA 3TPCA 2VJYA 1L7NA 3HBLA 1QB8A 3DZKA 7REQB 2V6JA 5AK3A 4B45A 3TKAA 2WJYA 2DRIA 4EG8A 2WNSA 4BNGA 2NZVG 1HLDA 4F5WA 1JLRA 1G42A 4RY9A 1PYOA 2FZGA 4KXYA 5K05A 4ZZ1A 4BMZA 4FP9A 5M04A 1LTHR 3H5NA 4PYIA 4HAWA 1KQNA 4ENSA 4EYGA 1PE0A 1Z06A 2W9XA 3JQQA 2ZI9A 3QHQA 3JZMA 4MQFB 4PLFA 4R6WA 1ITZA 1G3MA 1MB9A 2SBTA 5TLSA 3GLIB 2I4IA 1F38A 1FUIA 4IILA 3CVWA 3PPVA 5H80A 1NVXQ 2CVFA 2FW8A 3O4IA 4DM3A 3R09A 3H9EO 3QYPA 3EVEA 3TQIA 1Z4PX 3RU2A 2BEVA 2REOA 1NVGA 4PZ0A 2C5AA 3MWEA 4CKCA 1RZRA 1XTRA 3B85A 4Y6SA 4JI0B 2V7TA 3K4HA 1LW7A 3U9SA 1SKAA 2C8KA 4H7DA 4DPLA 2QTAA 1AXEA 4KR0A 1VZ3A 1PWXA 1U8UA 1I2MA 2W6MA 3ACDA 4A6EA 4HC4A 5AW4A 2BBTA 1VMEA 1IBCA 3FWHA 1OW3B 5K09A 1LDBA 2FEPA 1B93A 2YOFA 3KRTA 3NYQA 4MQUA 1TVEA 3PXDA 4MV5A 2ZIZA 1F12A 4KH0A 3L79A 2FUNB 4NEHB 4ZEWA 5ECWA 3IXMA 3KL4A 4H15A 4M22A 2BEVB 4YLGA 2IX3A 3OPMA 1TI7A 3MWEB 3F1LA 5E7MA 5FBRB 4CKCB 5JD6A 4FQ7A 1PD0A 2QI9C 4MYHA 2FPUA 4MUFA 4OFZA 3RSGA 4JT8A 3JWGA 3MWYW 3V4LA 5M7EA 1BS2A 4RCZA 1XZNA 4UTVA 2J46A 5HKKD 4CF3A 1U8XX 3DVQX 3QE0A 1OVMA 3E61A 3TZLA 2I03A 4E21A 1CHDA 1J2UA 4F2WA 5J2TA 4MRRA 4FKBA 5FNZA 4ZEMA 5HTOA 3EPRA 3O4JA 4F4JA 1DQYA 1PT9A 3KJHA 4KN6A 2HC9A 3T7IA 2PMKA 3GCZA 4IGEA 2IP2A 2WZDA 3WB2A 1BEUB 2HXYA 2D2XA 2O8DA 5T67A 1W87A 3SHWA 4FD2A 2HPVA 4HRYA 4AY4A 2I22A 1JR3E 3K0AA 1ULSA 3PFIA 2AX3A 4QJ5A 3IT3A 1MG0A 4DLAA 2QRGA 2OBXA 2BJHA 1ZK1A 2CL0X 4PR3A 2PE5A 1YDGA 4FTWA 1RKQA 1AKUA 1NLUA 2XXBA 2YJ4A 1MQ9A 2G4VA 4H0NA 2CB9A 4XWGA 5KINB 2XNDA 3ZE2B 3ZDRA 1PCXA 3JYLA 1W5AA 1GGHA 5EZYA 3VR5D 3JQCA 4K9SA 4YJDA 2NIPA 4QGFA 4N7RA 3CR7A 1TKAA 2O8DB 3R9IA 4LRSB 4DFDA 4NBVA 3FNFA 1QTNA 3LSTA 3OQHA 3PA8A 1TFUA 3MQ4A 2DWPA 3QELA 4Z4EA 3V1KA 5JMOA 5KNDD 1QRDA 2PL1A 2W6JD 2Z2ZA 3B20A 3DT6A 3S0JA 4IMPA 3F3SA 5L7YA 1QHNA 2ZT7A 4V39A 2CXTA 4DPMA 1DWPA 5EZYB 2QJTA 4LXIA 4TYNA 4OLAA 2VDJA 3Q2KA 3A8TA 4J1TC 3UATA 2E21A 4POOA 4GGMX 1PLLA 2YICA 1X15A 2IE0A 3OCYA 4I55A 4YP6A 2QR2A 3JAKA 4H08A 2SICE 5AT1A 1OE0A 3BA1A 1BWPA 1UOQA 1JV2B 1ISMA 3EH1A 4PIMA 3FX2A 3I5AA 3QELB 4PQRA 4EZEA 4FOPA 1YZ3A 4BVJA 3RG2A 3HDYA 2WU0A 3RAGA 1GU0A 2ODNA 4NOMA 5AVOA 4RPLA 4MP8A 3CPSA 4Q9DA 1YKFA 4HNQA 1TGVA 1QH9A 4A10A 4R1LA 2VJKA 4DIKA 5LKAA 4HFJA 4C05A 2Y1CA 4H7IA 3HBAA 1CP2A 4H9GA 1CETA 2YQZA 4N3NA 4UXIA 2YNMD 3F8WA 4X90A 4I55B 5C34B 3B1WA 3JAKB 3SQDA 2H5IA 2Z3VA 4IVPA 2BFNA 4ILEA 4MGKR 1MT0A 1LWNA 4HDSA 4S12A 3RANA 2BV3A 1H2RS 3ETEA 4MPJA 2PUTA 1SC3A 2F9MA 4QXPA 1TO1E 1UP7A 5HOEA 2BFPA 1JA9A 1FYDA 3FCYA 5M5BA 4G26A 1X7ZB 2GYUA 1OI4A 3C7TA 4R41A 2QQEA 4WERA 1D0SA 2OGTA 4IDQA 1B15A 2CCJA 2EEZA 4WJZA 1RI2A 2P3OA 4ZO6A 1G8GA 2Z2KA 1JIXA 3C97A 2PS0A 4HDSB 1YF3A 4DMLA 2QRHA 4GPAA 1JJBA 2AJDA 621PA 4A8HA 4HL6A 4AJ9A 3OHSX 5CGQB 4EJ6A 2XOKA 2WIDA 3KV1A 3WLFA 1L5WA 4IIJF 1M33A 4MZXA 4V0NA 4RH3A 3EEIA 4E07A 1IIBA 5IX8A 3BM5A 4H18A 1DAPA 4MH0R 1PJ2A 3UPUA 1RTKA 5FBWB 4GR9A 1NG9A 2Q1YA 3CM0A 5GAJA 4US0R 1JSXA 1ZUIA 4JP1A 4YEDA 2EWWA 1TVCA 5TEVA 1KH3A 3KIPA 1K68A 2X22A 5E1BA 1K8RA 5GMOA 5B64A 2OZEA 4IIJB 5AOVA 2O1EA 1XCBA 4YRSA 3B3FA 4Z9YA 4F84A 2FK7A 3G0HA 4JXJA 1NOKA 3U3JA 1G5PA 1EWVA 1DINA 1X7XA 4G0OA 4UTZA 4EJFA 4CCAA 2WJHA 4BN0A 5L3ZA 4CDGA 4Z2YA 4B46A 1MBZA 2YNMC 3NYWA 1F3OA 3VX3A 2GBLA 4JDPA 3A4NA 3OM0A 4YAGA 1IZYA 4DLNA 4CBVA 3VDXA 5CAEA 4A73A 2V1UA 5FQOA 4EEXA 3TI9A 2HT1A 1A8QA 2WG1A 4HFRA 3TJZA 3Q7SA 5BYBA 2QTNA 3A9WA 3HVRA 4ASUA 1J0DA 1JWBB 3B52X 3IALA 1IMJA 2EW1A 2QSUA 1X7XB 4MKFA 3WLQA 1Y8ZA 6NULA 1GFZA 2BMWA 3BFVA 3LL4A 1Y81A 2FQYA 3PZRA 2A4MA 2W4QA 4TLLB 5AJUA 4A16A 4KPUA 4EA8A 4ENUA 3TE6A 3ZHUA 1WCXA 1NNI1 2XUPA 4J2HA 4K6KA 5K01A 1IZ0A 2WABA 5CAEB 1ZH6A 1RHQA 1VXRA 2MYNA 1RAIA 3G9QA 4RQBA 3UJNA 1P1RA 2I7TA 1NL3A 4RY2A 2JEOA 1Q14A 1SIWA 1PDOA 3I09A 1V1RA 1E7MA 4LZPA 3IE1A 3IIEA 1V5EA 3M6UA 3TUJC 4D4KA 2ZS9A 2Q5QA 3FNRA 3LLUA 4BO4A 4LUCA 2FFHA 4GI3A 4YMLA 3K71B 3UMYA 2OD7A 3BMCA 4KPUB 4EJ2A 5I7SA 4GL4A 3G0GA 1CEYA 5HF5A 2ID8A 4OEHA 5LN1A 5CEEA 4UAGA 2BGJA 4NBSA 5AJXA 1T6XA 4RMGA 5EPUA 5BORA 4W63A 2VDUE 3L4BC 4NCJA 1K5HA 3PC8A 2B99A 1G55A 1R4NB 2DLDA 2RCYA 3OA0A 4Q4JA 4TQAA 1J0CA 5ALOA 2RKWA 3OSZA 1V1RB 1ZVKA 4AJEA 4AURA 3U60B 4JCOA 1PLJA 3KV3O 3CRVA 5TVGA 4R2MA 3FF4A 5BT9A 2GZAA 1RCFA 4R2LA 2HMAA 4B6QA 2II6A 3BMCB 4Z0NA 3CJTA 2CE7A 2IEIA 4IFEA 1L6RA 3TAXA 3FBTA 3VJRA 2W6PA 1ZRMA 2ZOSA 1NDHA 2OXFA 2Q6KA 1FXUA 1T0JB 5JAIA 1X19A 3BF7A 4Q4JB 5B2ZA 4RW0A 2DBVO 3RASA 2E18A 2VYQA 1MO5A 1ZMBA 4YACA 4JGGA 1EBUA 1DU4A 1GKIA 4XVHA 5CFZA 3PFHA 4W5RA 4JC0A 4IXNA 3NFYA 4CF4A 3WDKA 3SSNA 4WXPA 3HDJA 3T1QA 4DHWA 2ZIFA 1RXEA 2C8JA 2F9FA 3K9BA 4LC1A 3D54D 1HNZB 2I78A 3KOMA 4IGFA 5CM9C 1JALA 1K8XB 2H11A 1G64A 1YMVA 2WUFA 1FC0A 3JD3A 4RVCA 4FGKA 4UTOA 3RFVA 5ECYA 5TMEA 1FMLA 4HWOA 4EMBA 1OWNA 3T35A 3UK6A 4KNYA 1CR2A 1GN8A 2JDIA 3IAS1 5EMLA 4DZZA 5T41A 2GMWA 1NBME 2OTCA 4D56A 2VNHA 3ELBA 3KEFA 5KSPA 3UK7A 1TVMA 3ZU5A 3E2IA 4BKUA 3ND7A 3CVUA 3IBSA 4TYQA 3EPHA 1G4UR 1FNSA 4A8PA 5JS6A 1DELA 1M76A 1F51E 3DDZX 5SYNA 4MLCA 2RFLA 4NBTA 1U2GA 2X9GA 3FPSA 2V8BA 4NY1A 3AHHA 1YE8A 4R16A 4DREA 3OTWA 2YZGA 3QWIA 5ALYA 3JVEA 5KNLA 3LBNA 4BNFA 2F8TA 1E2GA 3EZLA 3N3BC 5EE1A 3ZWYA 3QVVA 3VVCA 3AFGA 2JJQA 3P9RA 4MOWA 1GDTA 1HE1C 1AUXA 1Q44A 4IBOA 4J6EA 4DMRA 3UBMA 5IJ9A 3PC7A 2HGZA 4I1PA 3I9NA 1K0UA 1EIZA 3MMPA 4KIFA 4EZBA 1ZC3A 2XSZD 4QGSA 1EVYA 4M53A 4WCFC 3DMTA 2P3SA 3CWZA 3BCSA 1GGMA 5AYVA 4M7RA 1WP4A 3QTBA 3BL6A 1P62B 1A2BA 1XAIA 2YZKA 1R6UA 2AF4C 1AGNA 1Y5NA 3MOSA 5B1IA 3KS9A 1IXRC 4L8YA 3I5YA 3ANYB 3BD7A 1HT3A 1NQVA 3CH4B 2P2LA 3KKZA 1XR3A 1B1AA 1E9AA 1T5SA 5IJ9B 2CBXA 4L75A 1KKUA 5EP2A 2CVOA 4G25A 1N0HA 4IUYA 4MMZB 4DDHA 1Q7RA 3F9CA 2WD7A 1NP3A 2X13A 2PY6A 3TX6A 2B7CA 4Z3DA 1I94B 5B2EA 1PU2A 3EZ7A 4I4IA 3TN7A 4ZJZA 4FFBA 1JMKC 4NEQA 2OA0A 3VPHA 3RJ9A 4F3KA 3BE5A 1FS5A 1MC4A 1UJ6A 2I4LA 2DAPA 3IH5A 1XAJA 2ACWA 4CR7A 4FD3A 5BR4A 2Q4OA 3DZBA 3QQPA 1U2RA 3GT0A 5LDDC 3RTGA 3P0IA 3IYLW 2I87A 4B33A 3IQDB 3GUUA 5EERA 1L7EA 1QFJA 1DKLA 2WD7B 1GPYA 2JI8A 1IRXA 1M2OA 3P9QA 3WYEA 1WXWA 1I01A 4OAOA 1WKVA 1R0WA 5IDYA 4CCWA 2WDZA 3GRAA 3JTMA 5DI9A 2CW5A 2IVFA 4FFBB 5KDOA 4NG4A 1CJMA 1QF7A 1MJFA 2QEQA 4KODA 4QNRA 2BEUB 4C6RA 1RM0A 2W2LA 3BH0A 5DSZA 4F97A 4A15A 3QVOA 3FKSA 1A27A 4BQQA 3IJEB 1YTUA 1P7PA 4IH1A 1JG2A 2EL7A 1QQTA 2N1MA 2NQ8A 2VOEA 4JU9A 4QYMA 4Y2YA 4GIBA 2QJOA 4HNVA 3G0IA 4KLRA 2NO6A 1NW9B 1ZC4A 2OD9A 4YXFA 4WEQA 1AHHA 3DHVA 4L50A 5CJPA 5AOCA 2ZK7A 1M2OB 3I2FA 2IE8A 4ZAYA 4ZVVA 1ML4A 2P0AA 4LE1A 1JIUA 3E27A 2C4MA 3JQAD 3M83A 4MUAA 1G60A 1U7HA 3AGPA 4RVUA 1JH8A 4X1OA 2I7XA 1TX4B 3L84A 1Y6GA 1LK0A 1THZA 1ZVJA 3DH0A 4BLOA 3HM2A 3L5KA 4IJMA 2CXPA 4UEOA 3GW8A 5DCLA 4DQ0A 3D2CA 4HH1A 3ZR4B 1FTWA 1ZGZA 1DQSA 3OPYA 3L7BA 5JNTA 1JHUA 4IMJB 4DNXA 2E5FA 2Q46A 3LNCA 2J85A 2G6BA 5E9WA 4BQEA 2DT5A 1ELOA 3WOVA 4XVUA 3KT3A 1GPMA 3HYNA 1I36A 3T1VA 3UIEA 3H4IA 3ND8A 4ZZ2A 2Z8YA 3B9RA 1V9LA 3OCUA 4S0XA 3H42B 1WABA 1GZ5A 1V1MA 3TLKA 1QU2A 2NSLA 2WWFA 1G6Q1 4HUQA 4OYYA 4TS4A 3CUYA 5KNCA 2DSNA 2ZWMA 4JWTA 1LFAA 2FMXA 3EVTA 2P35A 3HFRA 1E1QD 2MSNA 3CTMA 3IAM1 4PZYA 4QHYA 4WOJA 3OLQA 1VIMA 4X1KA 3T5AA 3OPYB 3QVXA 4NABA 3QWFA 3TDMA 5D5QA 2FWBA 2IYAA 2H4YA 2Z2JA 2FDCA 1VB5A 4N6OA 1IG3A 1L5RA 3C3BA 3QUBA 3U7RA 4TWZA 2JC3A 1ZHFA 4B31A 3BQMB 2OQIA 3VUFA 1QYCA 4P3OA 1DC6A 1V25A 3CV3A 2VJAA 1NA5A 1JQJC 1O95C 1MH9A 1V1MB 1RDFA 2HCFA 2WMNB 4JJEA 4WIAA 4HUQB 1EJBA 1ZAYA 2G9VA 3LOPA 5KWJA 3UPDA 1NMYA 3FGNA 3D4IA 1KDYA 2X4LA 2WSSA 4DR4B 1E8MA 4X1KB 3E7XA 4LHSA 4DV3B 3CRNA 4H6XA 3ROGA 4GR4A 721PA 2ZYAA 3CKKA 4LX8A 4MCHA 1H66A 2D0IA 3P27A 5CUQA 3F5SA 3ZY5A 4Q0MA 1BROA 1EVLA 1HE2A 1NIPA 3LA6A 1OZGA 3EWSA 1R8XA 4KAFA 4KWIA 3RWMB 3DZDA 4P4UA 2BT4A 2Q07A 3FPBA 3AP3A 4YT5A 5J23A 3WGIA 2IWRA 1XYYA 1TUIA 2XF2A 4EELA 2PSJA 2IELA 3CRMA 3L1UA 1YT5A 3LSYA 1G3RA 3TOZA 3SJAA 5IRCD 5CB8A 2VVTA 3BMQA 4C4PA 3TM4A 1FUYB 1SKQA 1JQAA 2BKUA 2RGXA 1JTEA 5DK4A 3V8RA 3BMXA 5C32A 3VPXA 3M9LA 2XUQA 2OQ2A 3TMKA 1TEVA 4KSYA 2XNJA 2C31A 2Q3EA 3N53A 2Z2XA 3MQFA 4Q3CA 4DDKA 1Z4OA 3QPDA 5LMCA 3NONA 4XR4A 2Q27A 4Q48A 4Q00A 3KDAA 5IU6A 1I7PA 3PK0A 2A0XA 3S8YA 2JIZD 4YMSA 5CA0A 4H2DA 4BUJA 5IKMA 1N34B 2ANCA 3BMQB 2C2MA 4BS9A 4D0GA 4DTIA 1IBSA 1I4DD 2O5RA 4JLSA 5CA0F 3DMFA 5DBEX 1U2EA 3K09A 4P22A 4R1UA 4BO1A 4CLDA 1QG0A 3KKEA 1SD5A 3B5EA 4ZP1A 4F46A 5KSOA 4TLDA 4MWCA 4BDTA 1BWRA 3KVRA 5AD1A 4X41A 1RQGA 2PZGA 5JYBA 1AGPA 5TPZD 5L9AA 4TXLA 1UXHA 3PI7A 2QRKA 3NH6A 1KE2A 2C4VA 4B32A 3AVTA 2CMGA 4QD3A 4UEKA 5CYOA 3VC1A 4NJOA 3C6MA 1ADGA 3WHIA 3S7ZA 5CA0B 1ECPA 4P36A 2JFYA 2HQBA 3VSEA 1R6XA 2WTUA 2EGUA 4U9HS 3BL5A 4E11A 3I9JA 2BSQA 1BD3A 3GFVA 3DUFB 1P9NA 4RZ3A 4EHNA 1A76A 2GK4A 1WD7A 1JBQA 2V7BA 5AM1A 1CNFA 1P6QA 1UPFA 2GSDA 2YWBA 3SWWA 1U4SA 2QUHA 3B3JA 4IH9A 1KI2A 1WCWA 1QYRA 2OCLA 3I9V1 4IQ0A 4ZOBA 4EABA 3K0HA 3U4QA 2XYRA 3M4NA 1ND5A 3JR3A 4F92B 2QTCA 4JQCA 2QE7D 1IHXA 3V9PA 5JD4A 2XR1A 2VF2A 3AF3A 3C85A 1PJQA 3NDJA 2VUSA 3A1WA 4MCAA 4PO3X 1ONNA 1SK8A 2AE2A 3AXSA 3ADDA 3SVLA 5JVDF 4NI5A 1CYEA 3QBEA 5EJIA 3DV9A 4I6EA 5DSXA 3T9DA 2CNLA 2M6KA 4X64B 3ZUGA 4EG1A 5HIIA 3SQXA 3SS8A 3V6MA 1D4OA 2IYPA 3CZCA 1BE0A 1R4MA 3KLMX 4GLOA 3F5FA 4JS0A 4U00A 5CRIA 2PCJA 2ZJZA 4RM2A 3WGLA 5K0GA 1E8NA 2JAWA 2Q45A 3K5HA 3VKGA 1LDYA 2EFJA 1K2WA 1JE1A 5KC8A 4JI8B 4OBBA 4LF9B 1I7SB 4V0LA 1Y8CA 4LY3A 5KJEA 3WA7A 3QKUA 5T5QA 3B8HA 1W8IA 2VXBA 5CLGA 1FDOA 5E1DA 4UZEA 2NU7A 4U7DA 4CQNA 1M9NA 3ORQA 3HADA 1GUFA 1OKKD 4BQPA 1QFMA 1JFLA 2P9YA 4S2UA 1MT3A 5EIHA 4F2PA 1ZVVA 1PK8A 4IEIA 4BFVA 1R4MB 4JYBA 4QZVA 1E2UA 1G8YA 1VSUA 3C8ZA 2HW8A 4QQFA 4TKZA 2R8ZA 1N6KA 4J2OA 2WYUA 3IILA 4C7KA 1OBOA 1L6IA 4RGQA 5AK6A 4HQ0A 4YCSA 1JPVA 4NENA 1PRYA 1SXJC 1XEXA 1XD2B 4FI3F 5GJCA 1J06A 1XMXA 2A84A 3O73A 2WPDA 4S1NA 1GRRA 5I7EA 3AVVA 2IOFA 3A9SA 3NKFA 1DLIA 2E4VA 3OMLA 3KUDA 3ZVRA 2GF9A 1PBTA 3IV6A 2AXNA 2G3YA 4B9EA 4F4CA 3B53X 2SKCA 4F96A 1F8UA 3NDRA 1D7AA 1H2YA 1L8LA 1QHGA 1W2WB 1CTQA 3FYTA 3PFBA 4R4JA 1JHZA 4BFXA 2OB2A 4FXOA 4QARA 4XQ0A 3H04A 4V0KA 4NENB 4CKWA 2J32A 4NCBA 1RPTA 1F7UA 4CV1A 1DWOA 1XEXB 3O21A 4U6SA 3UMJA 2HA4A 4D4GA 3ERCA 1YA4A 3ZY6A 2QRNA 1DO8A 2UUOA 4OK5A 3IGFA 1H5QA 1ZCBA 2XZDA 1TQ2A 4ARBA 3D8NA 1NE2A 1KI1A 3AEUA 3OQVA 4Y2VA 1VL8A 3RBAA 4LE2A 3KYIB 3EK2A 3OLCX 4TMWA 3CVJA 2Q28A 1GAWA 2XIJA 5AKKA 2G9NA 1ZGHA 3B6MA 3CPEA 2BGWA 1TJ4A 1JIQA 1XRMA 2A5YB 3QXCA 3OT5A 4CKWB 3WKBA 2P79A 2K4MA 3HZRA 3G8YA 2CVZA 4JOSA 3PF9A 1M83A 3QRWA 4H6VA 3QMWA 4EGFA 1J56A 2HDOA 4AY5A 5JADA 3Q3HA 4G1EB 5JXWA 1GV0A 1SCNE 1W0JA 4PCUA 1KL7A 1HETA 1JAYA 2FEAA 2WAOA 3T9CA 4C7XA 1TM5E 1PFKA 2J3KA 1OPRA 1MORA 3FPFA 5IABA 2R6JA 4WXRA 3JALA 1Q50A 3MWDA 3LDAA 2C1EA 3MK31 2C54A 4IS2A 1K86A 3PUXA 1V4VA 1I4WA 2FX3A 3AWDA 3HN7A 2OMKA 1GPNA 3I1YA 1RQLA 1ZOIA 1A69A 1YR2A 2PRIA 1DP4A 2Y66A 1KFKB 1O89A 3I9LA 3FZNA 1UDXA 2BJVA 3EOAI 3WLKX 3HDTA 3ZDCA 2HHHB 2OKCA 3PFFA 5E2AA 1TJ5A 2QYOA 3KQQA 5EKTA 1J2TA 4L0CA 1YR1A 2HYDA 3EE6A 3R8CA 4Y6QA 3G5LA 3ILXA 3JALB 3MWDB 3D2BA 3CQ9A 3M6IA 4PGMA 4URFA 4EG7A 4HGZA 3DTVA 4IUBS 1QOZA 1TC1A 5AJVB 1MN6A 1LDNA 3HA7A 3LQYA 2KWIA 2N75A 4IZHA 1Y63A 3B48A 1QO7A 3LLSA 2ZR8A 4FM9A 2B4YA 5TF0A 5EQFA 1QWOA 3WLJA 3CE6A 1E2PA 4GXRA 2W70A 4X3CA 3S8MA 3ZS8A 3QUAA 2OM2A 4D9GA 2QTRA 4IPTA 2LRHA 1W46A 4XTCS 1I4EB 1DTSA 1LPSA 1TECE 2E49A 3FCXA 3KBBA 3OPXA 3HO6A 1SOVA 4GVXA 4IIBA 3UJAA 4PXAA 2NUTA 1IQUA 4OI4A 3IEVA 1ZCZA 4QXAA 4H31A 3DTVB 2W8ZA 4OD0A 5DWQA 1RBMA 3N2ZB 2PV0A 3DAYA 2ZB7A 5EVJA 3TQQA 3LPMA 2YQ5A 3FCOA 5GJWC 5MFPA 1CUIA 2EF1A 2V96A 3H13A 3P71T 4KRXA 3SM3A 3C4QA 2QUZA 1G59A 2I4OA 4I36A 3E3NA 3MRVA 3TNLA 1JJAA 4MB0A 1KFBB 1T8RA 3CU5A 3AL2A 2ZRPA 2YWCA 3QG1A 4OVKA 3HGMA 4AJJA 3IT2A 4H4DA 3OT4A 4N82A 1E5VA 3E1KA 2VK4A 3SEAA 2NUTB 4PRZA 1YRAA 3LL7A 5JSQA 5C35A 1ICIA 1FY2A 2QZ9A 1PJTA 4MUIA 2QRPA 1Y7HA 1D2NA 2O4UX 4FGLA 4CEHB 1KO4A 1E6KA 2A5GA 3KPJA 3VVLA 1OA1A 2PD3A 3PU6A 1P6XA 2G9RA 1WMSA 4YRQA 4J2TA 3DBVO 5WRFA 3RHSA 1LCIA 3UAWA 4PIVA 1RXCA 3BH7A 2NV2B 3NHMA 4YCNA 1JBEA 3O93A 3R41A 4G67A 2ZTUA 4G5FA 5G1PA 1N57A 4DCCA 4UFNA 3U62A 4R1OA 2EKQA 5FA6A 5IK2D 2P7HA 3OIGA 4ZARA 2JFGA 3E0XA 2JNWA 2NW6A 4AD8A 1KI4A 4B81A 4C5AA 4DNPA 5A1JA 1P5RA 2BMJA 2J07A 3SFVA 4AZWA 1VLVA 4B2IA 5F9FA 1P2BA 1W9HA 3ETJA 3DEZA 2AUMA 5JCOA 1F6BA 3E8MA 4RABA 5CT4A 1OXSC 3ECAA 2OZLA 4DG9A 4J75A 3IQIX 1MO3A 1I0IA 3CZAA 4V3CA 3T1YB 1PGQA 1S4MA 5HRUA 3F4LA 1P4RA 1U4NA 2FZ5A 1N2IA 4RHCA 4RZUA 3AB3A 1RACA 1J7JA 1Z0KA 4E51A 5KO2A 1ECGA 4DLPA 2QUBA 2QDXA 2QXUA 3D4LA 2P1RA 3HU2A 3BC1A 3CY6A 4LGCA 5KQRA 3NOVA 1DKUA 2WYWA 1AC5A 1EGHA 2OZLB 3A3PA 2WTEA 2IEYA 4LXYA 1P8JA 4CIXA 3GARA 1RLIA 4RVNA 3W9YA 3Q3CA 4EPXA 2QF7A 5FUMA 3TVYA 4ER3A 4BZZA 3WLAA 4JKIA 3K6RA 4NMWA 3D4NA 4GPD1 3GLGE 4CLRB 2JCYA 3UY4A 1L4MA 4RTKA 3G5MA 3D6AA 3KFVA 4PLTA 4ZQFA 2AZXA 3RE1A 4B80A 3KJIA 1WMEA 4TMKA 4F3TA 1TJNA 1U1EA 4PO9A 2WHXA 2IY8A 5DU2A 4B6SA 3SSAA 6PFKA 1N2CE 5JZ9A 4GMKA 5LMUB 4GLFA 4L7QA 5JSFA 2TYSB 1DJOA 2EYQA 1OLSA 5A0FA 3ROQA 3H83A 3OEWA 3DE5X 3FBWA 4P83A 1XG5A 4O4LA 5AKHA 2BELA 2EGGA 5CYPA 3L05A 4BKRA 2X1VA 2XITA 1OZ0A 2HUPA 1SQFA 2TSYB 3A32A 3MBOA 1JLLA 3QLTA 4G3XA 4BNZA 2XHEA