4CKLA

Structure of 55 kda n-terminal domain of e. coli dna gyrase a subunit with simocyclinone d8 bound
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
489
structure length
450
Chain Sequence
ALPDVRDGLKPVHRRVLYAMNVLGNDWNKAYKKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDSAAAMRYTEIRLAKIAHELMADLEKETVDFVDNYDGTEKIPDVMPTKIPNLLVNGSSGIATNIPPHNLTEVINGCLAYIDDEDISIEGLMEHIPGPDFPTAAIINGRRGIEEAYRTGRGKVYIRARIIVHEIPYQVNKARLIEKIAELVKLRDESDKDGMRIVIVVLNNLYSQTQLQVSFGINMVALHHGQPKIMNLKDIIAAFVRHRREVVTRRTIFELRKARDRAHILEALAVALANIDPIIELIRHAPTPAEAKTALVANPWQLGNVAAMLEDAARPEWLEPEFGVRDGLYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLDQIAELLRILGSADRLMEVIREELELVREQFGDKRRTEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A New Crystal Structure of the Bifunctional Antibiotic Simocyclinone D8 Bound to DNA Gyrase Gives Fresh Insight Into the Mechanism of Inhibition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords DNA GYRASE SUBUNIT A
total genus 151
structure length 450
sequence length 489
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2014-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00521 DNA_topoisoIV DNA gyrase/topoisomerase IV, subunit A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.268.10 Mainly Alpha Orthogonal Bundle Topoisomerase; domain 3 Topoisomerase, domain 3 4cklA03
3.90.199.10 Alpha Beta Alpha-Beta Complex Topoisomerase II; domain 5 Topoisomerase II, domain 5 4cklA01
4Z3OA 3L4JA 3L4KA 4G0UA 4FM9A 1ZVUA 2RGRA 3LPXA 3FOFA 3QX3A 4G0VA 4Z53A 1X75A 1AB4A 2XCRB 2XCOA 2Y3PA 4J3NA 3FOEA 2XCQA 4TMAA 1BGWA 4CKKA 3NUHA 4Z4QA 4ELZA 4CKLA 1BJTA 4ELYA 4G0WA 4DDQA
chains in the Genus database with same CATH superfamily
4Z3OA 3L4JA 3L4KA 4G0UA 4FM9A 1ZVUA 2RGRA 3LPXA 3FOFA 2QPTA 3QX3A 4CIDA 4G0VA 4Z53A 1X75A 1AB4A 2XCRB 2XCOA 2Y3PA 4J3NA 3FOEA 2XCQA 4TMAA 1BGWA 4CKKA 3NUHA 4Z4QA 4ELZA 4CKLA 1BJTA 4ELYA 4G0WA 4DDQA
chains in the Genus database with same CATH topology
4Z3OA 3L4JA 3L4KA 4G0UA 4FM9A 1ZVUA 2RGRA 3LPXA 3FOFA 3QX3A 4G0VA 4Z53A 1X75A 1AB4A 2XCRB 2XCOA 2Y3PA 4J3NA 3FOEA 2XCQA 4TMAA 1BGWA 4CKKA 3NUHA 4Z4QA 4ELZA 4CKLA 1BJTA 4ELYA 4G0WA 4DDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z3O A;  3L4J A;  3L4K A;  4G0U A;  4FM9 A;  1ZVU A;  2RGR A;  3LPX A;  3FOF A;  3QX3 A;  4G0V A;  4Z53 A;  1X75 A;  1AB4 A;  2XCR B;  2XCO A;  2Y3P A;  4J3N A;  3FOE A;  2XCQ A;  4TMA A;  1BGW A;  4CKK A;  3NUH A;  4Z4Q A;  4ELZ A;  4CKL A;  1BJT A;  4ELY A;  4G0W A;  4DDQ A; 
#chains in the Genus database with same CATH topology
 4Z3O A;  3L4J A;  3L4K A;  4G0U A;  4FM9 A;  1ZVU A;  2RGR A;  3LPX A;  3FOF A;  2QPT A;  3QX3 A;  4CID A;  4G0V A;  4Z53 A;  1X75 A;  1AB4 A;  2XCR B;  2XCO A;  2Y3P A;  4J3N A;  3FOE A;  2XCQ A;  4TMA A;  1BGW A;  4CKK A;  3NUH A;  4Z4Q A;  4ELZ A;  4CKL A;  1BJT A;  4ELY A;  4G0W A;  4DDQ A; 
#chains in the Genus database with same CATH homology
 4Z3O A;  3L4J A;  3L4K A;  4G0U A;  4FM9 A;  1ZVU A;  2RGR A;  3LPX A;  3FOF A;  3QX3 A;  4G0V A;  4Z53 A;  1X75 A;  1AB4 A;  2XCR B;  2XCO A;  2Y3P A;  4J3N A;  3FOE A;  2XCQ A;  4TMA A;  1BGW A;  4CKK A;  3NUH A;  4Z4Q A;  4ELZ A;  4CKL A;  1BJT A;  4ELY A;  4G0W A;  4DDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...