The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
151
|
sequence length |
489
|
structure length |
450
|
Chain Sequence |
ALPDVRDGLKPVHRRVLYAMNVLGNDWNKAYKKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDSAAAMRYTEIRLAKIAHELMADLEKETVDFVDNYDGTEKIPDVMPTKIPNLLVNGSSGIATNIPPHNLTEVINGCLAYIDDEDISIEGLMEHIPGPDFPTAAIINGRRGIEEAYRTGRGKVYIRARIIVHEIPYQVNKARLIEKIAELVKLRDESDKDGMRIVIVVLNNLYSQTQLQVSFGINMVALHHGQPKIMNLKDIIAAFVRHRREVVTRRTIFELRKARDRAHILEALAVALANIDPIIELIRHAPTPAEAKTALVANPWQLGNVAAMLEDAARPEWLEPEFGVRDGLYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLDQIAELLRILGSADRLMEVIREELELVREQFGDKRRTEI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
A New Crystal Structure of the Bifunctional Antibiotic Simocyclinone D8 Bound to DNA Gyrase Gives Fresh Insight Into the Mechanism of Inhibition.
pubmed doi rcsb |
molecule tags |
Isomerase
|
source organism |
Escherichia coli
|
molecule keywords |
DNA GYRASE SUBUNIT A
|
total genus |
151
|
structure length |
450
|
sequence length |
489
|
chains with identical sequence |
B
|
ec nomenclature |
ec
5.99.1.3: Transferred entry: 5.6.2.3. |
pdb deposition date | 2014-01-07 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00521 | DNA_topoisoIV | DNA gyrase/topoisomerase IV, subunit A |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Topoisomerase; domain 3 | Topoisomerase, domain 3 | ||
Alpha Beta | Alpha-Beta Complex | Topoisomerase II; domain 5 | Topoisomerase II, domain 5 |
#chains in the Genus database with same CATH superfamily 4Z3O A; 1ZVU A; 4G0W A; 3FOE A; 1BJT A; 1X75 A; 2XCQ A; 4ELY A; 4G0V A; 4FM9 A; 2XCR B; 3L4K A; 4J3N A; 4TMA A; 1BGW A; 1AB4 A; 3NUH A; 3QX3 A; 4CKL A; 2XCO A; 3FOF A; 2Y3P A; 4DDQ A; 4ELZ A; 4CKK A; 4Z4Q A; 3L4J A; 4G0U A; 2RGR A; 4Z53 A; 3LPX A; #chains in the Genus database with same CATH topology 4Z3O A; 1ZVU A; 4G0W A; 3FOE A; 1BJT A; 1X75 A; 2XCQ A; 4ELY A; 4G0V A; 4FM9 A; 2XCR B; 3L4K A; 4J3N A; 4TMA A; 1BGW A; 1AB4 A; 3NUH A; 3QX3 A; 4CKL A; 2XCO A; 3FOF A; 2QPT A; 2Y3P A; 4DDQ A; 4ELZ A; 4CKK A; 4Z4Q A; 4CID A; 3L4J A; 4G0U A; 2RGR A; 4Z53 A; 3LPX A; #chains in the Genus database with same CATH homology 4Z3O A; 1ZVU A; 4G0W A; 3FOE A; 1BJT A; 1X75 A; 2XCQ A; 4ELY A; 4G0V A; 4FM9 A; 2XCR B; 3L4K A; 4J3N A; 4TMA A; 1BGW A; 1AB4 A; 3NUH A; 3QX3 A; 4CKL A; 2XCO A; 3FOF A; 2Y3P A; 4DDQ A; 4ELZ A; 4CKK A; 4Z4Q A; 3L4J A; 4G0U A; 2RGR A; 4Z53 A; 3LPX A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...