4CL7A

Crystal structure of vegfr-1 domain 2 in presence of cobalt
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
93
structure length
93
Chain Sequence
b'RPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 1
publication title Biophysical Studies of the Induced Dimerization of Human Vegf R Receptor 1 Binding Domain by Divalent Metals Competing with Vegf-A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Receptor
total genus 18
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cl7A00
3BGMB 4U6TA 1NDGA 3VW3H 3NAAL 4QRQB 5EZOL 1F11B 2A74A 2RJMA 4CW1B 4HWZB 4CJ0A 5I75B 2FRGP 1JF1B 5HYFA 2Q7NA 4U6VH 3G6AA 4I18A 5BZWB 1W72H 3MNVB 3BN9D 3SE4A 4N8VB 1MWAA 5LG1A 4NQSB 1NANI 2Z91A 4GXUN 2V9QA 1MFEH 4G8GD 3TZVA 2VLKE 2HJLA 3QEQE 3CUPA 4WO4B 4WJ5A 1EDQA 3MRCB 4PJAF 5CHNB 5J12B 1JYXA 1SEQH 4P23C 5BMFL 1U8IA 2OTUB 4NKQB 5D1QB 5BZDA 4OLVL 4EN3D 1TVHB 1LD9B 1ZLUH 3RHWF 1P7KA 1TJIH 3D0VA 1E28B 2ADFL 5B39A 5GISH 5I9QC 5MP6L 2ICEB 1G6VK 3SDDB 1A4KB 2Q7YB 1N8ZB 3ARUA 1CL7I 1KPRA 2BVUA 2VISA 4GRWB 4IMLB 5GS1B 2F8XC 1MF2L 1NANH 4P59L 4LCWE 4J2XA 2XT1B 1F3JB 3O6LH 1RULL 5D7KE 2RGSA 5BXFA 4MQ7B 3JZ7A 4Z5RB 4FMFA 3IAQA 1J05A 3C08H 3SGEI 1DQDH 1I4FA 1TZIB 3HG1B 3FB5A 4U1LB 1T1XB 2CPCA 5IW6A 4ODTL 4NC1C 4JFDE 3CZFB 2I07B 3LRSB 1YEKH 1ZVSB 1INDH 5F1OB 3MCLL 3OR6B 1CL7H 4XX1E 3DYMA 1ZANL 1YMMA 3N1PC 3D69A 4YHKL 2Q76A 4PRIA 4E5XA 2ARJB 2CIKB 5IVXF 5D6CB 5EWIH 5IT2H 3SGEH 2PTTA 3OJDA 3IDNA 5J9PB 1WC7A 2CXGA 4HS8H 3AS0A 4CL7A 4BSVB 4F3FB 4P3WA 3CCHA 2VL5A 2OSLA 3IDYB 4MB4A 4P57B 1BIIA 1L7IL 5AYUH 1QPPA 3IF1A 4F57H 2AEWA 3NMEA 3MCKA 5AZ2L 3HC0B 4QHKJ 5EO0A 3T65B 1JUFA 4Y1AE 1Q9WA 3MV8B 5I1LA 4ZUWB 5HYQB 1RZFH 2VLKD 4NUGH 1A9BA 3QEQD 2VDLL 1WV7T 2VLJA 1LE9A 1GGYA 1XGYL 2HKHH 4XXCC 5L8JB 4WWKC 1MNUH 3CLEH 2DYPA 3C87A 5KSAB 5GRZA 4JDTL 1AO7A 3DVGA 3BPOC 3OGCA 1F02I 1LEGA 3U0PB 5K9OA 4QRTA 1LP9F 4D3CL 1RSFA 3VXME 4ZUUB 4DGYH 3TO4C 1YNKL 1T22B 5HI5C 4PRPB 4M9PA 3ZKNC 4LCWD 4WU7B 2Y36L 1OPGH 5D1XD 1U8JB 3PG2A 5D7KD 4O58L 4U1IA 4YX2L 5BVPL 3NZHH 1F4HA 2QSCL 4JVPA 4TUJA 1T0PB 1C5DB 2GSGA 2X70B 5D1ZD 1KELL 4P5KA 4MJ4A 5EN2A 2O5ZH 2PO6D 2WLYA 4ORZC 4JFDD 4KROB 4LLVA 5MERB 5I1GL 5L88L 1M71B 1BM3L 1NCBH 3GBML 1RZKH 3RL1B 1DN2A 1KIUA 4RAUA 5E4EB 5IR1A 3G5XA 1U8QB 2R39A 1KLUB 5HSFA 1KCRL 1TVBA 1CR9L 4NQDB 5EPMA 1IGCL 5TDNB 3DWTA 4P9ML 4G6ML 3E3QE 5JMOC 5FKAB 2FWOB 2P5WA 4ELMB 1R5IB 1T5WB 2WAHA 4EOWH 4UTBH 2X6MA 4XCFL 4K3GA 3W11D 1KJMB 1X4YA 1LDSA 4JFQB 3QNXB 3UYRH 3OAZK 3FMGH 4NRYA 3T4YA 3STZB 1U36A 1ULVA 5IBLC 3CMGA 1M7DB 3L3OB 3NIGE 1LO0L 2DM7A 4X8JA 2Y1VA 4QOKE 4Y1AD 1NCCH 4PV8B 5ESQA 3TH4T 1RVFL 5C0AA 2BVYA 2V9TA 5INDA 5HHPA 3WIFB 2YD9A 3PIQB 2C1PA 3QDJB 5F9JB 1HHHB 4NWUL 2C1OA 3ZDXF 1MFCL 4HIXH 1P2CB 1FORL 4IOSD 4N0CD 2PYEB 1F4YL 3MR9B 3ZE0F 5C8JA 1SYSA 4QNPE 3MNWB 3T0EA 1BD2B 2HFGL 5GHWH 3UJIL 1T89C 4UOW1 1HQ4A 1KTKE 3O9WA 3VXMD 2IJ0C 4R26L 3DHMA 4HWEL 1HHGB 3T3PE 1A1OB 2AK4A 5E00A 1BZQK 1RURH 3X13B 2WIIA 4HFUL 4PD4J 1KOAA 3SOBH 4LSSL 4K7FB 1V7NH 1NBZB 3BDBA 2VWEE 3BEVA 2JTDA 5DS8B 2VKWA 4JO4H 5JOPE 3WJLC 4N5EC 2DWEA 4OCSL 2ENSA 1FNAA 4X6CE 4BFBD 2ZUXA 4UNVA 2FEDD 5FYKH 5C6TL 1NGQL 1MJJA 3MGTB 5F3HB 3LKPB 4N68A 3WO3B 3TYGL 4L9LC 2X7LA 4MMZC 1B6DA 2OL3B 2X4NB 4OLZL 3GMMB 4LHUD 1XF4B 2VZTA 1FHGA 2VDNH 4WV1B 5ICXB 4FQXA 4WTXA 3FT4A 3CAFA 4HF5H 1P1ZB 4OQ1A 4KK6D 4Z7WE 1YYML 2R23B 5BOZG 1KBGL 4Z77A 4JFYB 3L7EB 1E4WL 1XMWA 1N26A 3UTQA 3BE1L 3M45A 2A77L 2DI9A 2GSIB 2GIYA 2PR4L 1FGNH 3PL6B 4EI6A 4PJXB 1K3ZA 3IJSA 4I0PD 4RRPA 1HEZA 4LIQE 3PF2A 4QOKD 3MUJA 4P3DA 4U1GC 4XPAL 5DUBA 3V4VL 5DJXA 2WSKA 3HNTH 2K7QA 1CDJA 1EMTH 1UJ3B 4RX4D 4UT9L 1XGQA 4YLQT 2YD1A 1I3GH 3FRPG 3RA7H 1TXKA 4Y2OA 1J1PL 5D71H 3VXRD 4GAJL 3MUHL 2BJMH 2XPGB 5KZCD 3U2SA 4LFHD 4N0UA 1MCOH 4UAOC 5I1DA 2V5RA 2V5TA 1NSNL 3ZE2F 2X40A 1LDPH 4JO3L 3SCMA 2L7UA 4N9OB 3RWDB 3V5KB 4N8CL 1KFAL 4NT6A 2LABA 4HQQL 4HJJL 4WTZA 4ZODA 4XWGL 2Z93B 3CX2A 2HT3D 3OL2A 5D5MB 1YEGH 4XVJL 5HD8D 4P2OA 5JW3H 4UDTA 3PHQB 4K8RC 4Z0XB 1BF8A 4LASL 5I19L 3CVIL 3WKNA 2HH0H 2RFXB 1CE1H 2D4DA 2HT2D 5ETUB 4HBCH 3TA3D 2JIXA 3JTSB 2DJ4A 1KTDB 1OAZH 3ARFD 5D9SB 1I7UB 3LN5A 4KXZI 3QO0A 1IM3A 1Z9LA 3O4OB 5F7EL 3LZFH 1NBYB 2YKLL 3ABZA 1GRWA 1EEZB 3VFMB 1NGWA 4JFEE 5HYJA 4R4FL 4AY0A 4ZUTA 4D8PA 2AABL 3D85B 5DRXB 5F1IB 1LO5A 2OP4H 2QQKH 2ZUQC 3JV6A 2ZNXA 4HSQA 3SDAB 3L3GB 5HGBB 3ARBC 1AHWC 12E8H 1ZLWK 3ARGC 3ZHLA 1OB1A 3UTSA 4P2QB 4C56E 3O6ML 3HFML 2CH8A 5IF0B 1JPTH 2B1HH 2RBLA 4P46C 4DFIA 1AD9B 5DWUH 5AWNL 4FQCL 1IVLA 5EOTA 1T66D 1J8HE 4PJ7A 1U8LB 3T77A 4GKOA 3OXSB 4OZFA 2JE8A 2BCKB 2NY6C 4W4OC 4OM1L 5MHSE 4U6YB 4PGDB 4H20H 2ATPA 1T3FB 3RVXC 5KS9A 1FO0A 2DQTL 3C6LD 3H3KA 4P2RA 4KK9D 5CGYD 3VXOB 2BOCB 1S9VB 2GK0A 1QFUL 3E0GA 1MCPH 1YJDL 3F7QA 1G6RA 3RWCB 5KW9H 3V4PL 5ISZE 3HC4L 1NBVL 2NXZB 1FP5A 1EUUA 5BS0A 1A47A 2A73A 1ZT4A 5LQBH 1HHIA 2C4FT 4ODHH 1EFXB 4AIOA 4XWOD 5I1KH 4JFFA 4MJ6A 4DWHA 5D72H 2F58H 2VXSL 4XI5D 4KRPD 1HSBA 4EVNA 4L1HA 3NN8A 3DXAE 4HMCA 3HA0A 1JPFA 1UKTA 4ZUVA 2NX5E 3FB7B 3HPLB 5C0BB 1ZEAH 2N7AA 4PJGB 5T5NG 5DZNA 3V4UH 3M1BB 5C0IA 4KVCL 1XIWB 4DVBB 4TTGA 1ROWA 2QQLH 2NMSA 4HUXB 4PJCB 1CGSL 1EAJA 2D9QB 5GGQL 3UJJL 1R5WA 1UQSA 1WBYA 1ORQB 4P3CH 1FAIH 3ARDA 4JFED 5ID1A 5CD3A 4J3TA 5J0BA 3ZDYE 5KVDH 1EHLL 1XR8A 5JHLL 1ZVHA 1FVCA 1HI6A 5FB8B 2AXHA 1FZJA 4Q7DA 2DQGH 2FB4L 1SJVA 4M93C 3VGAC 4M5YH 3QCVL 4TRPL 5SWSA 3MUGA 4C56D 4OTXH 4WUKL 4KDVA 3GSUA 4JVUA 2X4QB 4EDXB 4AT6A 3P9LB 4HXBL 4KUCF 5TF0A 2CMRL 5DJAB 4NJ9L 5E7BA 2AW2A 4POUB 1NLBL 5ID0A 4O9HL 1INEH 5ITBH 3C8HA 1ZGLA 3KNBB 3WNKA 3RWEB 1J8HD 4PTUA 5C9JB 4OZGB 1WAAF 1OSZB 5MHSD 4Y4FA 2FGWL 1NUDA 5ECJE 2XRAH 5B3NA 4FG6D 1WFNA 2VDRH 1KEML 5LCVL 3GZKA 5A2FA 3HMWL 2K7PA 3QUXA 1ETZB 1BFTA 1NUNB 1KG0A 2IANA 5F7UA 4NM8L 2FD6L 2UYLB 5DUMH 5C0JA 3TPUB 3LSOB 3C60D 4F7MA 4NNXA 3V6BR 3TJEL 2VQTA 4XMPH 2FR4A 2ATKA 1KXVC 4BYHA 4I3RL 1FNFA 1ZVYA 4HUWA 4LIQL 1W8NA 4H5SB 3MRDA 4G7YL 4IRJA 4CMHB 1FYTA 4UI2A 5IVZA 4Y5YA 5EUOB 3DXAD 4EI5D 5CFHA 1CS6A 3WJJC 5DJZA 1U3HC 2NX5D 4ETQB 2MHAB 3NA9L 5T3ZE 3OF6A 4JDVA 4OB5L 4FQLH 1X5ZA 1W0YT 4OCXH 4A6YH 2QQNH 1UJTA 2AJYL 5AUMB 1BJMA 1XCQB 3LEVL 4GT7A 1CXIA 5DC9B 1K85A 1YEDA 2XN9E 1T04A 2P8LA 4LLMA 1Z5LA 3QA3A 2EDNA 4UDUA 3KLHC 4MB3A 5C0EA 4KHTL 4ZFFA 6FABH 3FFCB 2RAMA 3LD8C 1CU4H 5C92A 2A9NH 4R96B 4Y5VA 4JM2B 5IUSA 4EN3A 3WIIL 4M43H 4TVPL 3BISA 1SMAA 4JAMA 1HOCA 4KJWC 4DQOH 4FHBD 3B43A 4HH9B 1VFBB 1PYWB 1KTRL 4U1KA 2EYSB 3EOBA 1M7XA 4RGNC 3G6JE 2X41A 4GBXB 4XZUB 2J8OA 3W9EB 3ETBF 2CK2A 1AGEA 4HMDA 3FO1A 2XXCB 4JZNA 3MRFB 4JREB 4BZ1H 1A7OL 3LEXB 1CE6B 4R4BB 1OHQA 5J56B 5DRZB 5EBWB 3EYQC 2R4SH 4ZSOB 4PB9L 5IBTH 4CVWA 5IJVB 1NMCB 3RVTC 4PJ7F 2ADJA 2D3VA 1XGUB 3TM6A 3V5HA 1JV5A 1MCFA 3B8SA 4LAQL 2QL1A 3KPSB 2EE3A 3C5ZC 4LLAA 4DVRH 3LEYL 4ODWA 2F9BT 3BHBA 3CMOH 5E6YA 5FA3B 2XNAA 3GSNB 4CU6A 1EEYA 4U1JB 1YEHH 1B90A 1GGBL 4WGVB 5T1DH 4XP6H 5T3ZD 4NHUB 2QEJA 1S7XA 1T21B 3RFZC 3MJ9L 1HINH 1E6OL 3GDBA 1GGCH 5GS3A 1CZ8H 4ZOCA 2DQFB 1KJ2H 2XN9D 1TQCB 1AJ7L 5E03A 1T1YB 2ZUSA 4JFZL 4OIBA 3CU7A 1EGJL 4PREB 3WN5A 3EFFA 3D87B 4Z7VA 3VXUB 4G9FB 2NZIA 1U6AL 4K23H 3MRKA 4FTVA 5JOFA 3KWWA 1XF2A 1C16B 3QPXH 5F6IC 1IKNA 4PS4L 4NP4H 4QHUB 1UB6A 1U3YA 4V1DA 2Z8WC 2BNUA 5A16B 1DL7H 3CH8A 1T7XA 5JA8B 3VXPB 5DLML 3LQMA 4IBLT 5DJ6A 3GSWA 1AR2A 2OLDA 3I85A 4B53A 1V3MA 2PYFA 2W07A 3B2VL 4KH2A 3VRLF 1IBGL 5B4MD 5HYSG 4K7PX 1DBKH 3LRGA 5LJYH 1G7HB 3NCFB 1JNLL 4H26B 1PZUB 4LCWA 2VLRB 1RIUH 1NDGB 3BZ4B 4WTWA 1U58A 2OR8A 2A74B 5F72S 5LBSH 1TNMA 2VXTL 2D0GA 1G0DA 4V2BA 5D1ZA 3G6AB 4I18B 3O2WL 1WFUA 5BQ7A 2PO6A 4R0LA 1MWAB 3D3VE 2DL9A 2Z91B 4UZGA 3BT2L 4U31A 4H8WH 3TZVB 3RX7A 3ARSA 3CUPB 5BVJA 2UWEF 1UA6L 4KMQA 3B9KD 4HHAB 3MRRA 1AD0B 5DEZA 1WIPA 5BZDB 3WUWA 1S9XA 2NLJA 1PD6A 4HCRA 3ZMRA 3H7BA 2MQCA 4JY6A 4YDIH 3VFOA 4R8WH 4LPXA 4X4ZA 4EUPG 1MJ7H 1KPRB 4IOFD 2CLRA 3P4NA 3WDHA 2VISB 1P5UA 4O02L 4J6RH 3KG5A 2X4RA 3G08A 4KKBC 4UT6H 4Z7UF 5BRZB 1PQZA 2VTFA 5BXFB 2YWYA 4S2SA 1QFWM 1AXIB 3QCTH 4WW2C 1FC1A 3FB5B 3R1GL 5C0CB 3GMPB 5IW6B 3F58L 2DM4A 5LXGH 1UZ8A 1MJ8L 5FM4A 5KANG 3RI5K 3FCTB 1X6NA 3S3SA 1H3TA 1WK0A 3OB0H 4LQFH 4B0MM 4LNRA 2QQQA 3FAXA 1T20A 1S5IL 1QSEE 2IG2L 1YMMB 5I1IL 3D69B 2Q76B 2MPAH 3BKJH 4YBQC 3VWJC 1T2XA 5DK2A 4E5XB 5HHMB 2EKSA 5C2BL 2AJVL 2XZQH 4RDQF 3UC0L 2PTTB 3G5ZA 4OQTL 4UB0H 3VXMA 2A6DB 1YEEH 1MFBL 4FZ8H 3WFBH 3MZTA 3CCHB 2VL5B 1BVZA 1BIIB 4PJ8D 1XEDA 3IF1B 3GHEL 4JG0L 2M1KA 4HLZG 5EO0B 4LMQE 1JUFB 4YDKL 1UKSA 1RUKH 1TTGA 1Q9WB 5D2LB 3D3VD 2MQ3A 3QXAB 3O81A 1T7ZA 5D70H 3KJ6H 2W9LA 4JHBA 4DTGL 2W0LA 4IEFB 5DD5L 1N2RA 3INUL 1A9BB 1BREA 1P4LA 2VLJB 1SBSL 1WBZA 4PBXA 2MCPL 3NTCH 6CGTA 5E2VH 5I1CH 4U1SB 3O6FB 1X5KA 5E08L 1A6VH 4ESKA 1CLYL 3ZTJG 1R3IH 4P59H 5ADPH 1AO7B 4ZS7L 2YA1A 3OR7A 1RJYA 1RULH 3OGCB 3P4LA 3GSOA 4QRTB 1J88A 3MLZL 4GMTL 3ARXA 2OZ4L 1ZWIA 3FFDB 5CLWA 4FFWC 1BBDH 4CGTA 2B1AL 4J4PD 3L95A 4ODTH 2VB5A 4U1IB 5I1HH 2JKXA 3HN3A 4Q6YA 4Z0BL 3BEWA 2R0WH 4P23B 2R9HD 3DGGA 4MMXC 4TUJB 5GRVK 4I0PA 2GSGB 4NQCB 1CD8A 4P5KB 4FOMA 5EN2B 1I3VA 4Y16D 5B38G 4K9EH 4JHWH 4LLVB 5I9QB 4IOIA 4RX4A 1T7WA 4NO5A 5C6WH 4O4YL 5DQDH 1A7QH 3VXRA 2DLEA 3D39D 4PJ5E 1G7IA 3G5XB 3SDCA 4YHLL 1L9MA 1A6AB 3CIQA 3WO4B 2Y6SC 4LCCA 1TVBB 4KMTL 1QSED 5EPMB 4OFIA 1YNTA 4F80A 4Y19E 4YXKH 3BXNB 4FNLH 3BIBX 4RAVA 1UZ6E 4I13B 2HKFH 1NCAL 5E6IC 5JIPA 1TZGL 4MX7B 4X6DE 3VGGA 4ZAKC 3UCRA 4XVUC 3T4YB 1MCEA 1FIGL 2X9YA 2ESVE 4XPBH 4CDHA 1EO8L 1FBIL 5D4QA 5GRUL 3S5LG 2AP2A 4QEGA 5DD6B 1DQLL 4TSBH 4BKLA 4HIIA 3TA3A 1DVFC 4LF3B 4KTDL 2VITA 5ESQB 5IHLB 1SEBA 1XGYH 3ARFA 4OUUA 4XCEB 4NQUA 2APBA 1NEZG 5C0AB 4BZ2L 3SBWA 25C8L 5INDB 3TN0C 3KPRE 1IQWH 2C1PB 2E6JA 4I4WA 2GFBA 4M7ZB 1F5WA 1A02N 4OGAC 3W81A 2C1OB 3RZCC 4YXLL 3TEUA 4XTRD 1QRNE 2OJZL 3EHBD 1ZLVH 2Z8RA 4XMKH 4ZFOB 4YDLC 1IFHH 1L7TH 5I2IA 5C8JB 1UG9A 1SYSB 1PKQE 1QBLH 4NN6B 4N1HB 3T0EB 1KC5L 1HE7A 3VWKA 4JPWL 4GKNA 5B38B 3QJHB 1QEWB 5I30H 3LIZL 3LMJH 5E00B 4X5XA 3E6HA 5IKCA 5CUSL 4LSUH 4XP5H 1VHPA 2NY7L 2P24B 5E9DE 3NIDE 4MHHI 4CBPA 5B3JF 1DBBL 4LP5A 3BEVB 4MYWB 4WWKB 1FG9C 3RVVD 4U33A 4ONGL 5DUPH 4NIKB 3HI5H 4NBXB 1U92B 3K0WA 4NHCH 2P8PA 4LLWA 3C6LA 2EIBA 2NY0C 1MJJB 1KJ3H 1ZHBA 4PR5B 1DBAL 2X7LB 3G5YA 2D7MA 4APQC 3TIDA 4PJ5D 4X7FC 3A67H 3Q5YA 3TO4B 3S5LB 3SKJL 5IIEA 4KJPC 4FQXB 3I02A 4AJ0A 2E7LA 4Y19D 2FATH 2DWDA 2HG5A 5ACZA 4F37K 3PXHA 3HNSH 4HXAH 4LCYA 1NEZB 3LB6C 5CEZH 1NGPH 5FGSA 4DUWA 1BQSA 4Z77B 1RU9H 4Z8FL 4PJIE 3ROOA 3UTQB 2ESVD 5FHBL 2ZG1A 1T1ZA 4ORGA 2R2BA 3X12A 3ECBA 4P4RB 4HZLB 4EI6B 2B0SH 1HEZB 2NXYC 1M6OA 4S1QH 1H3PL 4GW5A 5F9WB 4P3DB 3S37X 5DUBB 1MFCH 2ED8A 4RISH 1HXMB 5DJXB 4KJYA 2YPKA 3KPRD 4JLRA 3VH8G 3EDKA 4MXQC 3RDTC 5MI0B 3UJIH 1JE6A 4IMKC 4QXGL 2NZ9D 3BP6A 4OLXL 3VCLA 2GJ6B 4OZFG 1NLDL 4DUVA 4N0UB 5CIPA 4P9HC 5KSUA 3JTTA 1MHPL 1B4JL 1FYHB 1R3LB 3G9AB 3SCMB 2HTKD 3C6SB 4NT6B 2J7LA 3DJ9A 5DVKA 1I1AC 5MENA 1JNNH 1BWWA 4G8IA 2J4WH 2H32A 3KPLB 5GGSY 4X99A 4UBDD 4MD0A 4XCYA 1JN6A 5TGBA 2YD2A 3U4BL 4P2OB 4UDTB 4JPVH 5E9DD 3BP4A 4F7TA 1J8HA 4Z9KB 1MEXH 2BMKA 4MVBD 3O3EA 4F7PB 3EIFA 5DZOA 2CDFA 2A83B 3FTGA 4HWBL 4GRLD 3LN5B 3QO0B 4PJEA 2XQYK 3BQUA 3NPZB 1NGWB 5HYJB 4RBPH 4FXLA 4X7SH 3RGVC 2J6EH 5I74C 4D8PB 3GSQA 3MROA 2CQVA 1LO5B 3JV6B 1JTOA 2AEQL 1Z0MA 3UJTL 1VACA 2MSPA 1BQLH 1AGDA 1CG9A 1AH1A 3P77A 2EDWA 3L5XH 3LY6A 5I17B 3UTSB 2CO7B 3NIGF 5C86A 2PR4H 5ILTH 1UFUA 2VDKL 1PY4A 4HCRH 3L3IA 4J23A 3LV3A 1EGJA 4RMWA 3TGXA 3VH8B 3DXAA 4EI5A 3I3DA 2LU4A 1KGCE 2BXYA 1OTUC 5EOTB 4OZFB 2VUYA 1A0QH 5D2NC 2DMBA 4YE4H 5L7XH 2RHEA 1ITBB 2ATPB 2AKRB 5DEGA 3KPPB 5KS9B 5HHNA 4QNPF 4XVTH 1FO0B 2DQJL 3DBXA 4P2RB 2DQIL 1UWGL 2GK0B 3H9SE 3KYKL 1G6RB 4AZ8A 2WWKO 3TVMC 1A4JA 5LGHH 3T3PF 1IAKA 1NDMB 3SJVA 4N8CH 2FX7H 5BS0B 2A73B 1MRFL 4IIQA 5CJXC 3RQ3A 3X17A 2GJZA 4HG4K 3TBYA 4XNYH 4UINH 1OAQL 1L6ZA 5IB3A 1HSBB 3DX9A 3OKLA 2XTLA 4LVEA 1EBPA 1KN4L 3NN8B 4X6CF 3RWFB 5DRWA 2AXGA 1JPFB 2K1MA 1IC5L 2P5EE 2FX8L 4M1GH 4U6XA 3C09C 4XB8A 1JGDA 1MCBA 3ROLA 1WQVT 5FGRA 3R0NA 5C0IB 3DUHA 4DN3H 1RUAH 4X8XA 1KUMA 1YC7A 2BY2A 1M7IA 1R3JA 1UQSB 4U1NB 4UAOB 3OX8A 2AK1H 1IILE 3VGBA 4LCIL 2X1OA 5D8JL 4OZIE 2O5YH 5M94B 4Z7WF 4PRAA 5CD3B 4JDZB 4Y4KD 4U3XA 4XRCB 3VRJB 3IS1X 1WGOA 1XR8B 1HI6B 1H5BA 3SO3C 3E8UH 4NKMA 2IAMD 3MYJB 1YY9C 2DBLL 4Q2ZB 1OAUH 1KCUH 4FQCH 1OCWL 2OTWA 1R3HB 5EO1B 5SWSB 3MUGB 3RWGA 3CXHK 3GSUB 4LU5L 1SBBA 3GK8L 4U7KA 1K5NA 2H2PC 3VXSA 5ID0B 1KGCD 1XCTA 1JRHL 3EOTL 4OT1L 5DHVA 4PTUB 3GJFA 3BPCA 4BQBA 4Y4FB 4OFYD 3MZGB 2C3XA 3BH9B 3QIWD 1NBVH 1NKOA 2IFGA 1R6VA 2A6JA 2AAVA 3QUXB 3ARGB 2VZSA 3C2AL 1KG0B 4JGJA 2IANB 2XN9A 1U95A 5JR1L 1P7HL 5C0JB 4OQTA 1CVRA 3H9SD 2H26A 4NNXB 3QDGE 3CLFH 4HMEA 2FR4B 2ATKB 5HY9B 3BP5A 3NCYP 4WI3A 1RUQL 1PX4A 2NY6B 4FXKB 4K71C 5KVFH 2YR3A 4HUWB 2HLFD 4X7CC 1PEWA 4IRJB 1OARH 1FYTB 5IVZB 4Y5YB 2IH1B 1R24A 2VXVH 3WLWC 3N9GL 2ZG3A 2P5ED 1RV6X 1IM9D 4ZDHB 1KB9K 2AI0H 2IADA 2QBWA 4JDVB 4H8WC 1AGBB 2BERA 3IVKA 2OXHA 2YZ8A 4HUVA 2Y5EA 1BECA 3U46A 1HHKA 1YEDB 5DA0B 3P9MA 3UTPE 5C0FA 1T04B 5GGRY 5C3TA 4LLMB 5H37G 1IZKA 1ORSB 1Z5LB 5AEAA 5TE4L 2OZ4A 3QA3B 2VZVA 3ARZA 2E7BA 4Y88A 1RMFL 4UDUB 2MFNA 3TBVA 4ZFFB 5HHOE 3P30L 3T1FA 3DVNB 4PJ9D 3B9KA 4NJ9H 4NJAH 3QDAA 1BZ9A 5E8DL 4EN3B 4KKNA 5EOQL 1NMBL 4PP1C 3M8OL 4FQPA 4U1KB 2Z9TA 3EOBB 4G7VL 3T2PA 3MRNA 4CVXA 3TNNA 1N5YL 1T2JA 4GRWE 1OM3H 3PHOA 1ZHNA 1S5HA 5DSCA 4NC0B 3NCBB 4R2GB 1AGEB 4NM8H 5E94A 4I1NB 2NY2D 3FO1B 4JZNB 1OLLA 3QFDA 5TQ2H 3EFDL 2BRQA 4RNRA 4J3SA 1MRCL 1GIGH 5E2WL 2CRMA 3TJEH 3VGAB 5IB4A 3BW9A 2JB6B 4J7RA 5CCKH 1AKJD 4MA3A 4P99A 4WEMB 4ODVL 4LIQH 3QDGD 1RIVL 3S4SG 1H0DA 3C8KA 5FM5O 5F9OH 1WCQA 3BGFB 4KK8C 4MNHB 1JV5B 1C1EL 3JBG7 2VC2H 4P49A 3QHTC 3F5WB 1SQ2N 3HC3L 4GW1A 5F7NC 1OF2A 2HP4A 4KKLC 3MUY1 1EEYB 1DANT 1QA9A 4PRBA 4Q6IA 2EIEA 1FNSH 3ZDYF 3K2UH 3WUWG 2C26A 4NFCA 1S7XB 4PJ8A 5FO9A 2FYYA 3UTPD 2J88H 3FOLA 3H9ZA 2B2XL 3L6FA 4OAWA 2EDFA 3MV8E 1RAMA 3V0WH 3RPIA 5ALBH 2P42B 3WN5B 3EFFB 3KYOA 4WO4D 2FL5A 4Z7VB 3MBXH 3R4DA 3TESA 5H35B 5HHOD 1N64H 3IFNL 3MRKB 4FTVB 1U3HB 3KWWB 3MRGB 4MS8C 5JOFB 2YUXA 5D1QD 5D7LA 4HGMA 5HVWA 4V1DB 1OW0C 2BNUB 2HT4C 4Q9QL 1KV3A 3KLDA 4JQXA 1CFSB 3BJ91 1GOFA 5DJ6B 3GSWB 4NZUH 2DKUA 2P43B 3PV6A 2B4CH 2Q3ZA 2D2OA 3PHSA 3QHZH 4I77L 4YHYC 1DLFL 4M6MH 1KB5B 2NW2B 4JY4A 2XKUA 4YQXH 2UZIH 3DNKA 4PRPE 1CICC 4K9EC 3S4SB 1VGEL 4PLKC 1AIFA 3JSSA 5I71B 2AS5M 4J4PA 4GSDL 3IDGB 4KY1L 1M1SA 2H32H 3LD8B 2VLLB 4YDVA 5D1ZB 5BQ7B 2PO6B 4R0LB 4P48A 4Y16A 1KIRA 1IEBA 1UENA 3RKDC 5J6HA 3DHJA 3PGDA 3NPSC 3OTTA 4ZUSB 1QZ1A 2X1WL 3D39A 1MCJA 3DURA 3WUWB 2ED9A 2XOTA 1S9XB 2NLJB 5DJCB 1EAPA 5HVFB 3NCEB 4KK5D 4NQDE 1EO5A 4L29A 4F7EB 1QSEA 3K3QA 1UADC 3H7BB 1IGFL 4JY6B 4MDJB 4ELME 1UT9A 4X4ME 5DVNA 2OX5A 5FHAH 3QUMH 2CLRB 2J2ZA 3P4NB 2NW3A 5I1EL 3MV11 2X4RB 1HKFA 1JNJA 3G08B 1VESA 1A1NB 5K9JH 1E4XI 1QBBA 4AG4L 4ODSL 1DUZA 4S2SB 1JZ4A 2IEPA 3O6KH 2XQBL 4TUKL 1A3RH 5IQ7L 2QJDA 1YNLH 3DI3B 2YWZA 2HRPH 4YO0B 4ZD3H 3ZKMD 1B2WL 1KSRA 4GKZA 4CU7A 3MV8D 3CPLA 4G8FA 5TE7L 5IFAH 1UZ8B 4HKXA 5FUZH 4UILH 4XBEH 4YH6A 2DQHH 3NA4A 3CK0L 3QDJE 3G6JF 3F12A 4OJFL 3IFOA 3VXQA 5CLTA 4LNRB 1T20B 4MAUH 2E8ZA 1YQVL 1IBGH 1JGEA 3EDFA 2PYEE 5KSAD 1VEPA 2BP3A 4AEIL 4HWBA 1JNLH 4HK0A 4KZEL 2EKSB 5DJ8B 2DQCL 1I3UA 1WZMA 2X4PA 4KKAD 1PG7X 1LMKA 1X4XA 2XTJB 4D0BA 4YAQA 3UBXA 3MXVH 2EC9U 3PGCA 4PRPD 1G9NL 2Q20A 7FABL 4UV7H 4GH7B 1TMCB 2QTEA 4NM4L 3BPLC 2VZ1A 1U42A 3BUYA 3U6RA 1D5BA 2JJSC 4XBPA 1S78D 4KHXH 4OLUH 1MIML 5GRJL 4L8BA 5IHZA 3KPMB 1YEIL 2D03L 3LQZA 5ENWA 5JPNA 3OKNA 1X4ZA 3CJJA 1N2RB 3D2UD 1P4LB 3R06B 1MOEA 1NC2B 4PJ5A 4OBRA 3V52L 4JRYE 4KGJA 4X6BB 5FO7A 4NQDD 4POZD 4GAFB 2F5AH 2HWZL 4YBLC 1R0AL 3OR7B 4Y19A 4JM4L 1JWMA 4MA1C 3BDYH 2ZKHH 1ZWIB 3VA2C 4X7TA 4GW4A 4TULH 1QOKA 1EJOL 3DX8A 2LAAA 4JJ5A 1OAYH 3L95B 4S1DD 2PCPA 2JJWA 1PSKL 1JGVH 4MLIA 4PJXE 5GSVA 5C0RH 4DCQA 3EYVA 3GMNB 1K8IB 2CUIA 3EW3B 3RIFF 5T3ZH 4G6AD 2IG2H 3MA9L 4IOIB 3QHFL 5SV4A 1T80A 3JWDL 4NO5B 5I6XC 3WMSA 1RUMH 4RFOH 3KPRA 3QDJD 1FFPA 1Q1JL 5IV2A 3VXRB 2ITCA 3VMOA 3EJYC 3SDCB 3CFJB 2F8VA 1J86A 4OQTH 1KN2L 5KZCB 4W6YB 1UM4H 1HH6A 2PYED 1YNTB 2D4FA 1MPAH 4BH7B 4KV5E 4KI5E 1BGXL 3CFBA 4S0TD 1GXEA 4WW2B 4EEEA 1JP5A 1KCVH 5CSZA 1MVUB 5GJSH 5D1XC 5D5ME 1QBML 4PUBH 2ZP0T 3PWUA 1EPFA 2R1WA 4BZYA 4GXVH 4NZTL 5E9DA 1VPOH 3WFCH 1YEFL 4YDJA 2QSVA 5GPRA 4DKDC 4BKLB 3WFHA 4HIIB 3TA3B 1SMOA 1I9RH 4XNMA 2VITB 4GRLA 5SWZB 1SEBB 3ARFB 4OUUB 1CDIA 2DRUA 5E8NA 3C8DA 3ES6A 5JIHA 3GB7A 1CLYH 4G6KL 4I4WB 2GFBB 1F6LL 2CK0H 4OIIH 3VGEA 3ULUE 5HHXH 1MCIA 3O45A 3O0RL 5JO5B 4JRYD 1F6FB 3OKDA 3V6OE 3MOAL 5GZOC 5I2IB 3UTOA 2IPTH 1FZKA 1FVDA 4WEBL 2VXQH 5T5FH 3P73A 3VWKB 1W0VA 4GKNB 3GBNL 4JR9H 3NFNA 4KPHL 2VZOA 4MQSB 3OPZH 4X5XB 2VJXA 2FJHA 2B39A 1QLEL 1FE8L 2AJUH 3L5JA 3QNZA 1RK0A 4MWFA 4PJIA 4L1DA 4QGTA 1QSFA 4MD5A 1TVDA 1D5MA 4IRSC 1OT2A 3WFEH 5C08A 3RVUD 4XNQA 2OCFD 3P4OA 5D93B 5GS0D 2Y06L 2G5BA 4KMTH 3N1GC 1TZHA 3HTLX 1DJSA 3G5YB 4O51A 4WU5A 1E4KA 4BFIA 4ZXBA 2ARWA 3ESUF 4J3OC 5IEHA 3AU1A 1LO3H 1LWRA 1A1MA 2VAAA 3I02B 4CAGA 5KTEL 2BHYA 3EZJB 4KI5D 2DWDB 2HG5B 1I8LA 3MLTA 3N85H 2VDML 3K46A 3KPTA 3CDGA 1S9WA 4LCYB 4BQ6A 2CLZA 3V7AG 2HYMA 4OD1H 4CN6A 3ROOB 4PJHA 5F7DA 2XIDA 5C0BE 1T1ZB 4ORGB 3X12B 4PJGE 2ZSVB 4S10A 3BJLA 4X9HA 3WUZA 5E2UL 2BNQA 2DMCA 4GS7B 4PJCE 4PV9A 1M6OB 4GW5B 3ZDZE 3VFPA 1D5IL 1KB9J 1QSZA 2B7DT 2FEDC 4KJYB 2E6QA 2YPKB 5CJOL 1QVOA 3S96A 1AXSB 2ZPKL 1EX0A 1HYRC 5L2JA 3MJ8A 1GJIA 3ULUD 5KSVA 3BP6B 1G7JA 3D85D 5CILL 1IARB 2Q6WA 3VCLB 3BKCL 5EUKB 3SDAD 3VMPA 1GHFL 2YRPA 2IAMA 4X6EA 5CIPB 3WHE1 5KSUB 2GKIA 1BZ7B 4O5LL 3OKEA 2BOBA 1RI8A 1UCBH 4H0IA 3WSQL 2CR6A 1DVFB 4QHLA 1AQKH 3E1F1 3DX7A 5MENB 3P9WB 3I2CL 2FHBA 4G8IB 4EIZC 3GGWA 5DJ2A 2WUBL 1F2XK 4X99B 1A7PL 4NKOB 4MD0B 5DQ9B 4XCYB 3BAEL 5TGBB 3PWPD 4OZGE 5I8CA 4F7TB 1J8HB 4XPTL 5F3BA 3G6DL 4PRNB 4JO2H 3BZDA 4OFYA 3VD5A 3FTGB 1ZGLM 5A2JH 2DDQL 4K7PH 4K3DH 1FV1A 3LKQA 3QIWA 3OKYA 3N06B 3IAPA 3NZ8A 3U4EA 3VJ6A 4PJEB 4JZOA 5DC4B 4R7DB 1V3JA 3BQUB 1UZ6F 1HKLL 4F9PA 4RMTA 1QNZL 4LSVH 4X6DF 2FBJH 1TJHH 3H9SA 5IW3A 3GSQB 5A3IC 1DBJH 2IF7A 2YBRA 3MROB 5E1AA 2NY5H 2NXZD 1CCZA 2PXYA 2EDYA 3HAEH 4ONOA 4BK5A 1Q72H 3A6CL 3BKML 1AGDB 4Z8FH 3P77B 4UV4L 1EFXD 4HWNA 4PJBA 3Q5OA 2ORBL 43C9A 4M6NL 1MI5B 4JY5L 3VE0B 3L3IB 3MLXH 4FABH 1QKZH 3LV3B 4LMQI 3REVA 5IROA 5FXCH 4EI5B 5TH2B 2E9JA 5HGGS 4HS3B 3CNKA 4LVNC 4LLQA 5C0BD 3GBLA 3BIKB 3T0DA 1N59A 5F44A 1IM9A 2I25N 3T4AB 4JO1L 5IEKA 3FT2A 5SX4I 4UTAL 1XIWD 5JXAL 1CXFA 4XC1L 2CXKA 3KXFB 3C9NA 3QQ9C 2B5IC 3P0GB 3ELAT 5F7HA 2CIIA 3X3GL 4KMLB 1EHAA 4LLYA 4U49A 3DBXB 4ZTPL 1TLKA 3ZYIA 3VFNB 2A2QT 3L3HA 4OZIA 4NZDA 5KVEH 5H2BA 4EXKA 1FSKC 5HHVH 1FZMA 4LVHC 3SJVB 4WI2A 5J3HD 2BHZA 1G0YR 5IGXH 3G04A 1CFBA 1Y18A 3SE3A 4K2UH 5L0QC 3CFKA 4IIQB 4RQQA 4ZOAA 1RUPH 3B5TA 4AEHH 1P9MC 4Q9RH 5SX4H 4QRSA 4U1HB 2GJZB 2YPVL 3Q6FB 5BJTA 1JYNA 1K9TA 1OP3K 1IQDA 3OKLB 3R0MA 2HFEA 3HB3C 5LGKA 1NGXA 3MRHB 2AXGB 1YMHA 3BDXA 1MCWM 4TNWF 4OZHF 1JGDB 1PKOA 3ROLB 3QG7H 4WDIA 2WUCL 4LRIC 3U36B 3F6IA 2O61A 3RTQD 5FIEA 1P7QA 1NFDA 2R2EA 1KEGL 4K3EH 1QQDA 4KK9C 1R3JB 5CGYC 3RZWA 5IMOA 2DICA 3JWDC 5FUOH 1BAFL 1S7UA 3DYOA 1VKXB 4LEOB 4PRAB 3OXRA 2G2RA 3MRBA 1VGKA 4ZSOE 5KSBA 1FQ9C 3QDGA 4ZFZB 1FFOB 4DN4H 3SGKA 4NKMB 5DFVD 1K8DA 1O0VA 4XWOC 3SQOL 2OTWB 1G9EA 2C3GA 1FVEA 5KAQG 2H45A 2ZJSL 2DD8H 3PUCA 3O2DH 4KRPC 5JNYA 4I8DA 4OGYH 3P4MA 3CFDA 3AY4A 1K5NB 5M95B 3VXSB 4EXPX 1GZQA 2BNRA 1XCTB 2W60A 2QADC 4KJQD 5DHVB 5FDWB 4FQQB 5EU3A 3GJFB 3CFCL 4KAQL 3FRUB 4WW1A 3RNKA 5I74B 2VDOL 3BPCB 4QXUL 1UXWA 1BF2A 2A6JB 2PTUA 3B2UC 5BZWA 1DUYA 3SDYL 4DEPB 1MRFH 1U95B 3MNVA 4QHNB 3MMEA 4AQOA 4NQSA 3WXWH 3BSZH 3GMOB 4RZCA 4A6YB 2ZCLL 4G9FE 2B4CC 2JJUA 3D9AH 3MFFA 2VDPH 3MRCA 5HHOA 4P5TC 2VYRE 5CHNA 2YD6A 3BP5B 3HE6C 3J7HA 32C2A 4HK3J 2OTUA 4JM2D 3QUYC 4HBQA 3P0VH 1IC5H 1TVHA 1TQBB 5JIIA 2GT9A 2O26U 4PLOB 3FHAA 1E28A 4U0RB 1Q94A 5IWLA 1R24B 2Q7YA 3AREC 3GJFK 3OJMB 1U93A 1M4KA 4GBXD 5GS1A 1OGAA 3GO1L 3S36L 3TVMB 2VLRE 2IADB 1F3JA 4FG6C 4HS6A 5IFHL 5IMLA 3IVKB 4MQ7A 5DGRA 2CKBH 3GRWL 3ULSA 4HUVB 3CSBA 3U46B 2D31A 1C12A 4KKCC 1HHKB 3MJ6A 1OY3B 3QRGH 3P9MB 5JLZA 2DBLH 4U1LA 1OGTA 1IT9H 1T1XA 4M6OL 4QY8B 5FCUL 3C60C 1NAMH 2X42A 1KYOK 1OCWH 3LPFA 3LRSA 4XNZC 2ADGA 1MQKL 1J7VR 2APWA 1IAIL 4HKBA 3LH2H 3T1FB 5J7CC 1DFBL 1J1XL 3MRPB 1A7RH 2SEBA 1LE5B 1BZ9B 3EOTH 1ZA6A 4OT1H 5E8OB 5LWYL 4NO0A 2XZAH 1AI1L 5CP3H 3GIZL 4NKIH 5T3XH 4PG2C 3MRNB 4CVXB 1NL0H 3TNNB 3QIBC 2EXWC 2ZUYA 3RVWC 5JQ6L 3PHOB 3HE7C 3T0AA 5I0ZA 1ZHNB 5DSCB 2E27H 5BRZE 1MRDL 2JELH 4JZJC 4BSVA 5E94B 3CVHH 1IL1A 2IH3A 4OIAA 3QFDB 3SO3B 5TPWH 4RNRB 2CGRH 4MB5A 3LPGA 3HC0A 4KDTC 5GIRA 3AVEA 4L3AA 5IB4B 1HIML 1ZTXH 5C0CE 1S7TA 5EOCL 3RIAF 4MA3B 4K07A 4ZUWA 4PY8I 5HYQA 3MRQB 1VFAA 4GO6B 4NOBA 4G9FD 3C8KB 2DM2A 4LDLB 5F8RC 1CFNB 1N0XL 1YMME 5EA0H 5DJ0A 4NQTA 1PLGL 1OAXL 5HHME 1ADQH 4HK3N 4GW1B 4O2EA 3U0PA 1RZIB 1OF2B 1JGLH 2Q8AL 3EYUL 4ZUUA 1INQA 4KZDL 1Q0YH 3MRLA 4PRBB 4Q6IB 2VL4A 4DGIL 1DQMH 3BYTA 4PRPA 4TQEL 2VLRD 4WU7A 3U0WL 4LOUC 4PJ8B 2F15A 4DOHB 4IJ3C 3EO1A 3GMLA 3NABL 4Y7MA 2N56A 3MBED 3IKCA 5AD0A 3BGAA 5FO9B 2X70A 5I1AA 3HMXL 3IFLH 4GQPH 3FOLB 5D2LE 3L6FB 4OAWB 3RPIB 2X1QA 4F7CA 2ICWI 3MLVL 1NMBH 1PDKA 1S7RB 2FL5B 1Y6KR 3THML 1ED3A 3D2UA 1IGMH 3TFKD 1BX2A 4QTIL 4YPGA 1U8QA 5D7LB 1NMAL 5EU7E 3OAUL 4MGXA 1KLUA 3LS4H 4PG9A 1IC4L 4NQDA 5TDNA 4XVSH 4Y8DC 1AO7E 4ZFGL 4Y4HC 5JXED 3PV6B 2P47B 5FKAA 2FWOA 4Q9BA 2MTPA 1LNUA 1AXTL 1QYGH 1KJMA 3SE8H 4KRMB 5HGAA 3IXTA 5BRZD 1AIFB 4OM0L 2NR6D 1A3LL 1D6EB 2FIRT 1M7DA 5L6YL 4QHMB 4YDVB 3L3OA 4NQCE 3BKYH 2XA8H 5J4MA 4HKZA 4M8QA 5C0CD 1KIRB 4R4ND 3MXWL 3SPVB 2C3WA 1IEBB 5KVGH 3WIFA 5J6HB 1F4AA 3PGDB 3QDJA 3GEWB 4XNXH 5F9JA 3O8XC 3D39B 4ZTOH 2AQ1A 2X89A 3DURB 5ALCL 2OR9H 4JQIH 1EO7A 4Q58C 3HKFA 2AERT 4XCCH 1QSEB 4RA3A 2VMFA 2PYEA 5KN5A 1UACH 3T0WA 2HA1A 4DJMA 2YSSB 5HHMD 4POYA 4K7PY 1IKFH 4YXHH 4URTB 3Q1SL 1S8DA 5F6HJ 5EZIH 4NSKA 3BRFA 3EAKA 4TSCL 2NW3B 4NC1E 1HHGA 1OTTD 1ONQB 1MFDH 1FPTL 1TENA 1I9IH 3LHPL 5EO9A 5L9DH 4UQ3B 1FFNB 3LKOA 5E24E 3RWIB 3RAJH 5CMAA 4B41A 4XHJC 2OI9B 4GG6B 3O2VL 4AQ1B 4YGAB 5C0AE 4KWUA 4G8FB 4DKEL 1NH6A 3GI9H 4HKXB 3X3FL 3MGTA 4JPKL 4RGOL 5F3HA 3LKPA 4GRWF 1SM3L 3GMMA 4MXVE 4TTDD 5BV7H 3HR6A 1FDLH 2FIKA 4JRYA 3O6FD 5ICXA 5BO1L 4H88H 1J5OH 4XPFH 4FP8L 1BFOA 4HK0B 1AO7D 1D7FA 1VGEH 5C3LD 2X4PB 4XP4H 1JPSH 1P1ZA 1GOGA 2NY1B 4M7KH 4OCMC 3IU4H 5E4IA 4D0BB 3UBXB 2Z31A 3TP4A 1CBVL 4PYGA 3TV3L 3FONB 3PGCB 4JFYA 3L7EA 3QYCA 3HI1A 3MOBL 1WT5C 5F21B 3S35H 4MNQB 4L5FH 3DECA 4P23D 5CINL 4PJXA 1LO4H 4X6FA 3QI9C 4NQCD 4S1RH 1D5BB 4OLWL 5HDQL 5I15L 4RDQG 4L8BB 1KF9B 5IHZB 3WXVL 5FKPB 1UJ3A 2UUDH 3LQZB 5ENWB 5D7JC 5JDJA 5JPNB 4YHYB 5KJRL 3OG4B 35C8H 3VFTA 2VQ1A 4M8VA 2MMXA 5ICYB 3A6BH 1TCMA 1TITA 5FO7B 1JMZA 3H8NA 2PN5A 5JHDB 4DGVH 3LQAH 3MJGX 3GNMH 3UZVB 4ONFH 1JWMB 1B0WA 1RIHL 4E41B 3JUYA 4U2YA 2F5BL 4X7TB 3KJ4B 1RZJH 2X4UA 5IHUL 3DX8B 4JB9L 4YHMH 1WBXA 1T83A 4S1SL 3QO1B 2PCPB 4X4XA 4EIGB 3PHQA 3VI3E 5GSVB 4N9GA 3EYVB 4ONHA 3JTSA 3EZ8A 1I7UA 2A1WH 5C0AD 1G9ML 4RWYH 5CJ8A 1NBYA 4I0CC 1EEZA 1GZPB 3KPRB 1FFPB 4QKXB 4MHHG 1YC8A 2ITCB 1X6LA 2GJ6E 1LO2L 3KYMA 1OAKL 4OV6F 1V7MH 4MSWB 5HGBA 4DZBB 2AJSL 5EBLA 1JYVA 3CFBB 3SE9H 4L8CB 4MJ5B 3FQRA 5A2KH 5IBUG 3MJ7B 1HNFA 1A6UH 5CSZB 3EOYG 4XMLH 4XC3H 3FRPA 5T1KA 2B20A 2PTVA 3PWUB 3FAWA 1OWWA 3PWPA 4KVNH 5ITFA 3FN0H 5E9DB 4L8SA 2R9HC 5HXMA 1U8LA 3F7YA 5DVMA 2JCCA 4YDJB 2BFVH 5IB1B 3WFHB 3CC5B 4GRWH 4HUUB 4PGDA 4WWKD 1LGVA 1UYWL 5K59F 1T3FA 2NY5C 1MJUL 4DAGH 3DTXA 5E8NB 3S37L 3ES6B 5E6ZA 3GB7B 2WINB 4ELMF 1OOAA 1S9VA 1EJ6A 4TNVK 5HYJE 3NCJH 3RU8L 2BVOA 4ZQKA 4LPTA 3KR3H 5EC2B 2YD3A 3RWCA 1ZSDB 1C5CL 4X7EC 3TO4D 2W38A 5HI5D 3ZKND 3BD4A 5GGVL 4LSRL 3OKDB 2XACC 4MAYA 1FRGH 2YPLA 1FVDB 4Z7OE 3OZ9H 3UTSE 1EFXA 5DTFB 3P73B 1W0VB 2BRRH 1F58L 2A9MH 4FXGA 1HDMB 3O3BA 4LPYA 4Y5XC 5L2KB 4LHQB 2ZCKH 4MWFB 3QNZB 1RK0B 4PJIB 3W0WA 4HPYH 1EIBA 3MLWH 3DPBA 5C0BA 1QSFB 1YQ2A 4MD5B 4YFDB 1CLOL 4PJGA 1P4IH 4KTYA 5C08B 1XIWA 1FZOA 1U8KA 1F6AB 3P4OB 4XNQB 4FFYH 5KS9E 5I8OL 3AS3A 3AXLA 4D94A 4K94H 5IBUB 1DBML 1I85C 5TFSH 2H1PL 1J8KA 4MA1B 2AEPL 4IM8A 1TZHB 4WU5B 4O51B 4XTRC 4P4KC 4ZXBB 1C5BH 2GJ6D 5F9DC 3GIVA 2NPLX 3V0VB 4YK4C 5IEHB 3AU1B 1A1MB 2VAAB 3UDWA 5IBLD 3HR5B 3FOMB 3GRWA 5F97E 1ZT7A 4LBEB 4F9LC 4PBWD 3U83A 3CDGB 3SCMD 1S9WB 2W9EL 3EJZD 4WHYH 2CLZB 4HIEA 1KJVB 1BFVL 4QF1A 2AJ3A 3P9LA 2YK1H 3L3JA 2QR0A 4PJHB 4B7LA 2EYRA 5I6XB 3RWEA 1Q9KB 4RA0C 2BK8A 1MLCA 5IJKC 2BNQB 4ZFOL 3D25A 3RTQA 2Z0BA 5I16A 2IQ9H 3O0RH 4B5EA 5F88A 2VZ3A 3OAZH 3DO3A 3BI9X 3MOAH 2WBJA 1QVOB 4MA8L 3HNVL 1L4IA 1Z3GH 2UYLA 3TJHC 5HYJD 5MEOA 1BVLB 4CKVX 1HZHL 5L2JB 3LSOA 3MJ8B 4XAWH 1L0YA 5CBAA 2Q6WB 1QFWI 5I73B 4HGKC 4JHZA 4M62L 1KYOJ 2IAMB 5E2TL 3WFDL 3GI8L 4X6EB 3HUJB 1GC1H 3MQIA 5HPMA 4PJXF 5FK9A 4LSTL 2LAGB 3UTSD 5SWSE 1J0YA 1TPXC 2D7PA 2BOBB 3ARVA 4G5ZH 1FH5H 1GPOL 1S3KL 1CVSC 4H5SA 4YUEL 2HJFA 3DX7B 3MLYL 4Z76B 3BPNB 4N5ED 3GGWB 5DJ2B 4DK6A 3U7YH 5IM7A 1XT5A 4M7JL 5H8DA 3QUZC 4NNPH 4ETQA 2R0KL 2CSPA 3NVQA 3FL7A 4AENA 4YHZL 1T03L 1CFQB 5BW7A 3V0AC 1Y0LA 3I3BA 1OSPL 1FV1B 2WIMA 3LKQB 3QIWB 4KI5F 5B21A 5AUMA 2UVFA 4M5ZH 3CSPA 1EEQA 1A64A 2IANE 1UWEH 3AB0C 4WFHE 1HYSC 1JF5A 4NN7B 3NCCB 2F19H 2NZ9C 2EE2A 1DDHB 1T2QH 2YBRB 5E1AB 1JZ3A 5D5MF 2VH5H 1MAML 2PXYB 5I8KL 3VG9C 4Q0XL 4Y2DA 2BY3A 5EZLA 4JM2A 4PJBB 2HTKC 43C9B 2AJXL 3HMXA 1RD6A 4JG1L 4KTEH 1FYTE 1VFBA 3REVB 3NIFE 1PYWA 4UBDC 1MIEH 2DF3A 5JORA 4YIQA 1N4XH 1D5IH 2XZCL 1MCLA 3TWCL 3NFSH 4MVBC 3VD9A 4GBXA 1N59B 2IGFL 1IM9B 2Q8BH 4NOFA 5IEKB 3ULUF 3U4AA 3FT2B 3RPKA 4GRLC 3BYYA 1WWAX 3MRFA 3NH7L 4JHAH 5EC1B 1FNGA 3ZT7A 3EGSA 5CILH 1CE6A 4R4BA 4LLYB 1P4BH 3QFJE 4FZEH 3L3HB 5DRZA 4OZIB 4M7LL 3LAFA 3QAZB 5H2BB 5CSGA 5EIIA 1FNHA 5I18L 1FZMB 1V5JA 2QHRL 3WIHH 3PP4L 4MXWH 4LEXL 2IPKA 3G04B 3HCVA 3U0TA 3T2NL 1Y18B 1NCWH 5DMYA 1K3IA 2IPUK 1TTUA 3CFKB 3MV7A 4PGBB 4RQQB 1XGUA 1A7PH 1HQRB 4NZRL 5HI3D 4I9WE 3ILPA 1F8TL 1KCSL 1UM6L 5SWSD 4QRSB 5BJTB 1KPUA 4R97B 2OL3H 2EO1A 3ZT6A 3F7VA 4JN2B 3Q6GH 1W8OA 5FA3A 1NGXB 1WUNT 1WEJL 3MACH 5CS7A 3GSNA 2XYCA 1YMHB 4JRXA 5F9AC 2YS4A 3MRJA 1CFTA 1PG7H 3I50L 3QXWA 4UUJA 2O61B 1TJGH 4WUUB 5DMIH 5I1JL 1EHNA 2DTSA 4ZS6D 3VDCA 1P7QB 1NFDB 2Z35B 3ARBD 2R2EB 4LCUB 3QRFM 1CGVA 2M26A 3JV4B 3QUXD 3ARGD 1IAOB 1YECH 4M1DH 1G0XA 2IAND 3A6CH 1FLTX 1S7UB 4W81A 5J13B 3GUTA 4MZ2A 4AH2A 4WFHD 3ZE1E 2G2RB 3MRBB 2APFA 4TSAL 1VGKB 4LSQL 5AZEH 5JMRA 5KSBB 4R90L 1A6WL 2H2SD 4NN5B 4KQ4L 5GS0H 5T1LB 2DTMH 2OR7A 4PJGF 5DR5H 4QRRA 1K8DB 3I9GL 4GMSL 4LSPH 4WHDA 2NY6D 1FVEB 2N4IA 2LQRA 1GAFH 3EUUA 4PJCF 3VXPA 5JNYB 4FQIH 4LK4A 3P4MB 4IRJD 3CFDB 1EFQA 1FYTD 2HMID 4M48H 4NWTL 3TT3L 4BUGA 1GZQB 3K80A 4UIKL 2BNRB 2W60B 3RY4A 4HIJA 5DT1L 3X3GH 1A3QA 1MHEA 1QO3A 5EU3B 4BH8A 4OCWH 4WW1B 3OF6D 4H26A 2W91A 1ZLWH 2RCSH 2FECL 2VLRA 5ADOL 3VG0L 5FGBA 3BVNA 3BZ4A 1GGUA 1UXWB 1CGYA 3JWNC 1EZVY 3RBGA 2IMMA 3MBEA 5IG7B 1U8MA 1H3XA 1J1OL 3QFJD 4RMQA 1DUYB 2YMXL 5AG8A 3MMEB 3W5MA 2F74A 4Y4KC 4RZCB 3QXTA 4Z7VE 3STBA 4DZ8A 4GFTB 2ILLA 2R0ZL 3MFFB 4FTVE 2X9XA 5HHOB 4HHAA 1AD0A 2FX9H 4OZGF 32C2B 4IS6B 4NZJA 4V1DE 4I9WD 2R56H 4IRZL 3D6GA 2W59A 2GT9B 4JFPA 3ULUH 1VA9A 1Q94B 3GKWH 5JXEA 3CU1A 5IESH 2ZUUA 4I2XA 4LARH 1U93B 4YHNA 1I7TA 1AFVL 1LK3L 2X4SB 1OGAB 3CXDH 5GJTL 4R2GD 5BRZA 3DSFH 5IMLB 4HS6B 4D2NA 1HILB 2I5YH 3ULSB 2FGZA 4K8RL 4LVOB 3MREB 2D31B 1UXSB 1C12B 2P49B 5E5MA 2YN3A 3VFRA 1WITA 2XV6B 5JLZB 1OGTB 1YN7A 5C0CA 1D9KC 3GMPA 2E6PA 3PDGA 4R9HA 3U9PL 2O5XL 3MLRH 4LAJH 5EUOF 5JA9A 2ADGB 5HYSA 3FCTA 4HKBB 4RGNE 1JHKL 2JJTC 2A6IB 2SEBB 4Q9CA 2HLFC 1ZA6B 4XP1H 1LVEA 5FEBA 3QQNA 4KAQH 4NO0B 3B6SB 1F4XL 4WRLA 1PAMA 1L9NA 4KQ3L 1QLRB 1SVZA 3TT1H 4RMVA 1QFWL 1FGVH 2I60L 3WS6A 2A6DA 3DV4A 3KPQA 4K3JH 4HD9A 3PWLA 3Q2CA 1IL1B 2IH3B 3CGTA 2P7TA 4FFZH 4JM2F 2Y23A 5GIRB 5BV7C 2KQNA 3VFWA 1S7TB 4OV5A 5D2LA 2A0LD 3QXAA 4EUPA 1K4DA 1VFAB 5C07A 1YUHB 4PJ9C 2R4RL 4FTVD 1U3HD 5DFWH 3S34L 2WNGA 4HUKB 2ICES 1WWBX 2IQAA 4V1DD 3SGJA 4U1SA 3O6FA 5DJ0B 3GJEA 3EO9L 4O2EB 2XTJE 5DK0A 4Y8AA 3K74B 3FFDA 1INQB 3MRLB 1F4WL 1CT8B 3JVGC 4AMKL 1I8MA 3B5GA 3IDXH 5JUEL 1GH7A 2VE6B 1ZKAA 3U48A 2ZOKA 3EO1B 3GMLB 1MQKH 3OKMA 5DD3H 4P23A 3IKCB 5E95B 5AD0B 1IAIH 1Z9MA 2R0LL 5I1AB 1IC7H 2H41A 4NQCA 3QUYB 3SN6N 1UEMA 3QBTB 4R6UA 1F3DJ 5EORH 4F7CB 4FFVC 4AL8L 1WVZA 3LQAC 2C4XA 1XF3B 5J8OA 4PJAE 3LS5L 1ED3B 2I9LB 3D2UB 4RGND 3W2DL 1A8JH 5IW1A 1BX2B 1CGUA 4YPGB 1RZJC 3MV9A 1OLZA 4UQ2B 3FZUC 2C7UB 1CK0H 1A6AA 3AM8C 4PG9B 4ERSH 5JQ6H 1T4KB 2FDBP 3AY4C 1F90H 4WFGE 3BXNA 3LKNB 4C4KT 3U30B 2EDRA 2MOVA 3VFGL 1LNUB 4BK4A 4LP4A 5I76B 3AMKA 4MX7A 1JF6A 1WLHA 3EYQD 3U7WH 5HGAB 1J12A 3IXTB 5GRXG 4FQ2L 1BJ1H 1HIMH 1U8HB 1VENA 2D7TL 5FOJA 4EBQL 1OD9A 3V95A 2C3VB 5DD6A 1AE6H 4JKPH 2EH7L 2DLIA 1T5XA 4HKZB 4M8QB 4IDJH 4LF3A 5IMKB 3ULVL 4OKVA 4XCEA 1CDGA 4OCRL 2X4TA 5TE6L 5DD1L 3I6LE 3E2HB 4LRNL 4WO4C 2Y07L 4RIRB 3P2TA 1ZAGA 2DLFL 3B3IA 5J12C 3P0YL 5TF1H 1X5GA 3GSVA 3QIBB 3TBWB 3VXRE 1GGIH 5D1QC 3MO1A 3QQ4A 3HE7B 1WICA 2OK0H 1RZ8A 3EYUH 1PG7W 2OXGA 4ZFOA 4OCYL 4DGIH 5KN5B 3SDDC 4D0DB 1CLZL 5F70A 4Z95H 4NQXA 2Q1EA 1S8DB 1MFAH 2XTJD 5B38A 3QJHA 4NSKB 1QEWA 3AS1A 5IP4A 2JJVA 3VD4A 3PDDA 2CRYA 4GOSA 3B83A 2P24A 5EO9B 4U6VL 2HRLA 3QUKA 1W72L 1Q9LA 3LKOB 5DEFA 3RI5F 3C5JA 4WHTA 5CMAB 4XXCA 1MFEL 4WWKA 5SWZE 4N0RA 1U92A 1ACYH 1JFQH 2GUOB 2PW2A 1SY6H 3VD7A 1AY1H 4PP2B 7CGTA 1H8NA 3DX6A 1KB5L 2HVJA 3GKZA 4PR5A 5SX5K 1IZJA 1NC2D 4KK5C 1DEEA 3TO4A 2FIKB 1F13A 3S5LA 4JRYB 3EBAA 2R29H 4HC1H 4YHPA 4J3UA 1BFOB 2G9HB 4WFGD 4IJ3B 4J12A 2YA0A 3WBDA 4HT1H 3O6LL 2Z31B 4PY8J 4CUCA 1NEZA 1TFHA 2XG5A 9CGTA 4GQ9H 4K94C 2V2WB 1RZ7H 4PGEB 3HI1B 1DQDL 1A7NH 2J5LC 3GSNH 4P4RA 4F15B 1NBQA 4HZLA 4L3EA 3PNWB 4X6FB 3ZKMC 3NGBB 1Y6NR 1YEKL 1INDL 1G7LA 1CL7L 1HXMA 4Y4HB 3BO8A 3I6LD 5DHYA 3SDXA 1RHFA 5MEPA 3VFTB 1N6QL 1ZV5A 2VQ1B 1DE4B 2WBWB 3WE6B 3MCG1 3SDCD 5F7KC 1HSAA 1MREH 2GJ6A 3TPKA 5KSAC 5EWIL 3AAZA 5IT2L 4TSCH 1B3JA 2OS7A 2XWTA 3BN3B 1DLHA 1FPTH 4OLEA 5HBBA 4HS8L 4I3SL 1T1WA 3LDBB 1R3LA 4XT1C 3O41A 3VU2A 2ICWJ 3C6SA 5D2LF 8FABA 2X4UB 4GAGH 4F57L 4U0QB 3KPLA 2WANA 3IS0X 1WBXB 4YFEA 1YYLH 4X4XB 2YRLA 4N9GB 4F7PA 4ONHB 4RGOH 2A83A 2BY1A 1SM3H 3T1WA 1RZFL 3IXAA 4NUGL 4TVPE 4PTTB 5SWZD 4KROC 2L4OA 4YBQD 3FKUS 4LKXA 1GC1C 2HKHL 3LOWA 1A5FH 1T89A 1MNUL 3CLEL 2CLVA 4OSUH 3HLAB 2YXMA 3VD3A 4JGUA 3KYMB 4POZC 1MWAH 5HDLA 3NBNA 5EBLB 4EQ3A 3K8LA 4WY7H 1CFVH 4DGYL 3FQRB 5I17A 1P6AB 3VWKD 3LRHA 1LK2A 5ACMA 3AC0A 4Z7QE 2MWCA 1OPGL 1OVZA 5MENE 1OP5K 4M3JA 3WJLA 3NZHL 4G6JL 5T1KB 3VH8A 4S1DC 3P40A 3PWPB 2EZ0C 4JCMA 2X44D 5ITFB 4L8SB 3F7YB 1OD7A 2JCCB 4LLDA 4L9LA 1YN6A 3LN4A 5IB2A 2AV1B 4ZNCD 1X5JA 2AKRA 1NCBL 1XH3B 1CXEA 3KPPA 1CLCA 4G6AC 3WNLA 3DTXB 4PJEE 1A7BA 2LTQC 4XB7A 4XAKE 2BVOB 4ZQKB 3KVQA 3H3BC 4FFWD 1JGUH 1NDMA 4H1LG 4CMMA 4EOWL 4UTBL 4MAYB 3L1OL 2YPLB 1TETH 3QZWA 4JB9H 4AEEA 3UYRL 4X9IA 2DLHA 1ZLSH 3QI9B 5KG9B 3QIUC 1MI5E 4FXGB 3O3BB 4GUPA 5DD0H 2DKMA 3RWFA 4ALAH 4GLRI 3W0WB 3FN3A 1NCCL 2HFTA 2CUMA 1ZHKA 5I0DA 2ADIA 4MXVF 3UTZB 3KXFE 1FZOB 1U8KB 2Y6SD 1ZS8A 2H8PA 4OD3H 4RFNB 4TVPD 3AXLB 1CF8H 2OMNA 1NAKH 2G60H 3HAEG 4U1NA 3JV5A 2EH8L 4HIXL 5E6ID 4F37F 3LVEA 4JDZA 4WV1C 4ZAKD 3SJVE 4XVUD 3VRJA 4XRCA 2ARJQ 3GIVB 5GHWL 4GLRH 2J8UB 3MYJA 1WFOA 1ZT7B 4HKJA 4Q2ZA 1R3HA 5EO1A 1RURL 5EU4B 1DVFD 3SOBL 4NQEA 4JFXA 4HIEB 5MEND 4QF1B 2AJ3B 1Z9OA 1U2HA 3L3JB 4LPWA 1V7NL 2QR0B 2EYRB 2BVPA 1QSVA 3PL6C 4JO4L 3QG6A 1P6FA 1MLCB 1YY8A 4H1LB 4E42A 3D25B 3RTQB 3PDOA 3EYSL 3PGFH 5FO8A 5I16B 3PE9A 3ULVC 5E8EB 3BH9A 5GS0C 1C7TA 3ARBA 3EKCA 5F88B 1AHWA 2VN7A 1JNHA 4WCYL 4PB0H 4YWGH 5LAXB 3QEGH 3ARGA 2WBJB 3BQUD 1BOYA 2VDNL 3FT3B 4R3SB 5MEOB 4XAKD 4L4TB 5CBAB 4P46A 1HN1A 2WP3T 4QLRA 5HY9A 2DLTA 5HPMB 1CQYA 5FK9B 1XGRB 2VO5A 4FXKA 4W4OA 4ODUA 3WFZA 1OWRM 1MI5D 2EYTA 4KFZC 2HJFB 1YA5A 3RWHB 3T3ME 5LVEA 2IH1A 1FGNL 5IM7B 3L9RB 3VXSE 2W9DL 1YPZB 5T1MA 1IMHC 4HJ0C 3ZHDA 5L8KB 5CJQH 1H3UA 4ZDHA 4BM7A 4APQD 4AENB 3HNTL 5C6PB 1AGBA 2AEPH 4OLYH 3KXFD 5F1KC 4KJPD 3FQWB 1I3GL 1Y0LB 2FEEI 3L5WA 3UXFA 5DO2D 1UH2A 2BJML 3QFJA 3W5NA 5EIVA 1ORSA 3ULUC 3LB6D 1YEJH 3TC9A 1MCOL 3SJVD 1P5VA 2VSDA 2ZSWA 5E99H 3SDAC 3V6OC 3PWVA 1LDPL 3MRMA 3DVNA 4XNUH 3LN9A 3N0PB 5J57B 3ZKXB 4Y2DB 2DJSA 5EZLB 5C7XL 1YEGL 4CU8A 4J8RA 1MAJA 4WI6A 5JW3L 2HH0L 1AGFB 5JORB 1CE1L 2BSED 4YIQB 3VXNA 1C8PA 4HBCL 4NCDA 5HYEA 4C59B 2VXUH 3VA6A 4WIQA 2IFFH 4MXQD 4OI8A 3RDTD 1IJ9A 1OAZL 1ITCA 3BX7C 2XG4A 4P4KB 4JN1H 3O3AA 5K93A 3LZFL 1T0MA 1U41A 1FNGB 3EGSB 1E6JH 4Z7OF 1CYGA 4XP9H 4MA7L 3VDAA 5FM8A 2C9AA 2JB6A 2OP4L 2QQKL 5EIIB 3D1MC 4DKAA 3TYFA 2NXZC 3OB8A 5DGQA 2IPKB 3HCVB 3U0TB 2PNDA 1C08B 1TDQA 2NNAB 3MV7B 3H2WA 4WEUD 1BEYH 1JPTL 2B1HL 4MNHA 3ILPB 2L0DA 1KPUB 2BDNH 3F7VB 4PY7A 5DWUL 5KS9F 2DQDH 3KPOA 1KLGA 3S6CA 3F5WA 5JZ7D 3RY6C 1N7MH 3DVIA 3VXSD 2ZUVA 3WD5H 5D6DC 2K3TA 4JRXB 4H20L 4U4BA 3VRIB 3P11H 5DMGD 4PLJD 3MRJB 1CFTB 3RUGA 4UUJB 1NCDL 2X1PA 2KDGA 1JHTA 1DSFH 1QLFB 2QSQA 3SGDI 1MCPL 4HZAA 5KW9L 2CRZA 2RQ8A 3DGCR 3GUTB 4AH2B 4G3YH 5CJBA 5B8CB 5J3HC 1U2CA 5LQBL 3H42L 4BUHA 4ODHL 1WZLA 5I1KL 4D9LH 3WV0A 2D7QA 1PJ9A 4EDWH 2R1XA 2YN5A 2F58L 3H0TB 5D72L 3WJJA 1OTUD 1U3HA 3MRGA 1WIUA 1KTLA 4QRRB 1W72A 4PJFA 2M2DA 1A14H 3SY0B 4PYHA 1QG3A 3EYFB 4FA8A 1SVCP 5MEQA 2YD8A 1R5VB 1CFSA 1IGJB 3SGDH 3ARPA 1I9JH 1ZEAL 1B0RA 3C5SB 3V4UL 4EQ2A 1AR1C 1KB5A 3JWOH 2NW2A 4HIJB 2QQLL 1MHEB 1QO3B 4BH8B 4KRNA 2YUZA 3TVMD 3S4SA 5ACLA 5ABDE 3BOVA 1WIOA 5BCAA 2H6PA 3IDGA 4MCYA 3BVNB 4DOHE 4P3CL 3H9YA 3O4LB 1FAIL 1RZKC 15C8L 1JHLH 2VLLA 3MBEB 1U8MB 3ZKQD 5KVDL 4DKFL 5J6GA 1DTUA 1RFDH 4XPGH 2GW5A 2F74B 4NBZB 2PUQT 4G9DA 5DHXB 1JWSA 4OD2A 3D0LA 4DZ8B 4M5YL 2CD0A 2LV4A 2NTFA 4OTXL 4ZUSA 3CZJA 3UO1H 5D7LE 4DW2H 1T6WA 5DJCA 1NAMB 3GHBL 5CGTA 4F7EA 4JFPB 4QWWC 4G43B 4CMHC 1FFRA 1INEL 5ITBL 1UM5H 2HN7B 2UZXB 4P9HL 5D7IB 4MDJA 4I2XB 5CWSB 1Y6MR 4YHNB 5HI4D 3V5DA 1I7TB 3TH3T 2W1NA 3RNQB 5EFIA 4HPOH 2XRAL 2IMNA 5F96H 2VDRL 1A1NA 1MCDA 1QRKA 3PQYA 3DETC 1T6VN 4TSAH 4JRWA 5DUML 1JTTA 5E5MB 5GGUA 1L0XA 2ERJC 3VFRB 3RWJA 1UVQB 4JKWA 4HIHA 4X80H 4YO0A 4OZFH 3HI6H 2RR3A 3L3KA 1YN7B 2QKIB 5ESAA 3C5ZA 4XMPL 1KENH 1LEKA 2VN4A 5F1NA 5HYSB 2LE9A 1KXQE 4OF6A 1FO0H 3D39E 1WCBA 4LPVA 4NWTH 3QCUH 1BJ8A 1S7QA 4N1CA 1G6RH 3NCMA 3BD5A 4PLNC 5C09B 1NFIA 5DQJA 4WCYH 5D7SL 5DJ8A 2F54A 2VIRB 3NAAH 5EZOH 1H8OA 4ZYKB 1HXYA 4FQLL 2BVEA 1VFOA 5K33A 3ET9F 1VFUA 1VDGA 3DV4B 1U91A 4I5BA 4A6YL 5A43C 3KPQB 2QQNL 2GTWB 4NDMB 2Y4SA 3PWLB 3UEZA 4JREC 5J11B 3IJHB 5A40E 1UCTA 2P7TB 4D9QE 1P53A 2E8YA 4JPIB 3DMMC 4GG6E 6FABL 3VFWB 4OV5B 3SKOB 2JB5L 5BMFH 1IRAY 1CU4L 4OLVH 3KPMA 4EUPB 1K4DB 2A9NL 5C07B 1NMCC 5EULV 2ADFH 4L4VE 5MP6H 4PJAA 3R06A 4M43L 5DMJB 1WTGT 1NC2A 4DQOL 5D7LD 2IQAB 1BLNA 4X6BA 1MF2H 4IHOB 1Z6JT 2FSEB 4AEFA 3OG6B 3GJEB 2H9GA 5DK0B 3VRLE 1S7WA 5E2JA 1QFPA 3ZE1F 5ANMA 4BZ1L 1I8MB 1A6TA 1MVFA 3Q5TA 2YZ1A 2ZOKB 4MNQE 1JMXA 2V17L 3FO0L 3OKMB 3X11A 2JLLA 3GMNA 3MCLH 2R4SL 1TQCC 1K8IA 3BZEA 1UWXK 5IBTL 5IQ9B 1ZANH 4XBGB 4NCC1 2VDQL 3OGOE 3MTRA 4JQVC 2F8OA 4YHKH 1V3LA 5IW1B 2NY3C 3MV9B 4DVRL 1I9EA 3CFJA 3CMOL 4Z6AT 5JHDE 2VR5A 4BH7A 2HVKB 5IVXA 1YEHL 1MAKA 1ODAA 1L7IH 3WCYA 5T1DL 4XP6L 4E41E 4WW2A 4I48B 1A6ZA 3MUZ1 5AZ2H 2P46B 4Y0GA 1MVUA 2ZWLT 1CXKA 2NTSP 4Z7VF 2EE9A 1HINL 2R69L 1KCLA 1GGCL 2E5EA 1CZ8L 1KJ2L 1X44A 2CKNA 3U7AA 5CP7A 4N8PA 4D9QD 4I18C 2VDLH 1DN0B 1T5XB 4YGVB 3SE4C 4NRXA 1J11A 5SWZA 4OKVB 3HS0B 3TZVC 1XFPA 2X4TB 3VWJA 3QPXL 1WZ1L 4NP4L 4JDTH 4HULB 3B3IB 5DVLA 3TLRA 3TFKC 4L4VD 3GSVB 2KQMA 5TJWK 2ENYA 2AGJL 3MO1B 3QQ4B 4OFDA 4D3CH 5JO5A 1RZ8B 3FQTA 5HTSA 4YHOL 4MJIB 1YNKH 1ZOXA 1L0QA 2Y36H 3KDMA 5GRYA 1DBKL 4O58H 2NY1D 4NQXB 1LP9A 4YX2H 5BVPH 1RIUL 2FJFB 2QSCH 3WLBA 2NY4C 1U8PA 1KELH 2NR6C 5DI8A 1F45A 3OJ2C 3QUKB 1Q9LB 5I1GH 4MNQD 5L88H 4MS8D 1BM3H 2UZYB 5DEFB 1ZMYA 3C5JB 3GBMH 3LS5H 4WHTB 3DVFA 4H8WL 4WI5A 3UYOD 1Q9OA 4R4NC 2PW2B 1FJ1B 4N8VG 1KCRH 1CR9H 1IGCH 3BPOB 3DX6B 4P9MH 2HVJB 3DRTA 3S97C 4G6MH 3I6GA 1MUJB 2P8MA 1DEEB 4XCFH 4YDIL 1CICD 5EU6A 3U79A 4R8WL 5JHDD 4YHPB 1MJ7L 2Y9RT 4BELD 2ZCHL 2W0FB 4EBQH 4QGYA 5DC0A 5IVOA 4J6RL 3T2OA 4E41D 4WENB 4X0KA 5DF0A 1LO0H 1UKQA 5L2KE 3QCTL 3ZYZA 2KUTA 1RVFH 1QSFE 4OF0A 2ZSVA 5H37H 4L3EB 5C08E 5CEZE 5LXGL 1FL3B 4NWUH 4ZMAT 1G7LB 2EC8A 1FORH 3BO8B 4LQFL 5DHYB 3SDXB 1F4YH 4U7MA 5MEPB 4K3HA 1AXSA 1CLZH 3EYOB 4TTDC 2HFGH 5E6IA 2MPAL 3BKJL 5EU7C 4ZAKA 1HSAB 2HTLC 3AAZB 5EUKA 2BY0A 4R26H 3VGDA 2XZQL 4HWEH 2E7MA 2XWTB 5H35A 4UB0L 2GY7B 3UPRA 1DLHB 1HHJB 4FS0A 1BZ7A 4RGMC 5C0DA 1YEEL 4HFUH 1T1WB 3MPCA 4LSSH 5HHQB 3IJYA 4FZ8L 3WFBL 3R8BB 3O41B 1BJ1J 1SJXA 1DVFA 1ND0A 8FABB 5EOCJ 3ILQD 4FRWA 3SEPA 1VADB 4PJHE 4G8EA 2EDTA 3K4DA 3MFGB 4NKOA 5DQ9A 1NC4D 3TN0A 4OCSH 1G7MA 3NFPA 4X5LA 1RUKL 2VZUA 1JCKA 2EDBA 5C6TH 1KB5H 1NGQH 3QZWG 2BNQE 4PRNA 5D70L 3RZCA 3KJ6L 4C83A 3TYGH 3IXAB 4OLZH 1IAIM 4LDEB 1I8IB 4LKXB 3VFUA 3NTCL 4R7DA 2GK2A 5E2VL 5I1CL 2CLVB 1A6VL 1H9VA 1R3IL 3WO4C 5ADPL 3BH8B 4JGMA 1BOGA 1YYMH 4WHYG 5DVOA 3UAJC 1TNNA 5TDOB 3OKKA 1KBGH 3HUJE 1CDBA 1E4WH 4HJGB 3BE1H 2A77H 4YZFE 1BBDL 3MJ9A 1LK2B 2V7HB 5FUCE 1MI5A 5FYLE 1JYWA 3QDME 3VE0A 4D0CB 5I1HL 3N1MC 5L2KD 1SJHB 1VFMA 2R0WL 4MDIA 3EO0A 4NO3A 5TH2A 4PRHE 1JK8A 4U7SA 4HS3A 4XPAH 3V4VH 1QSFD 5B3JE 3MC0A 3BIKA 4UT9H 3SHSA 3IDMA 4LLDB 3T4AA 3MX0A 4K9EL 4L9LB 5C08D 1YN6B 4JHWL 4APQA 5CEZD 3LN4B 5C0NC 5IB2B 1J1PH 1N6QH 3KXFA 4GAJH 2AV7B 5DQDL 1A7QL 3QEHA 1IEAA 4WW2F 4M7ZC 5E1HB 3VFNA 2OQJA 1NSNH 4I3SH 4LSDA 2RIKA 4ZXBD 3EOAB 3OJVC 4JO3H 1KIQA 4YXKL 3BD3A 4FNLL 5JPMA 2DB8A 1KFAH 3FB8A 3AMLA 4HQQH 1X5AA 4HJJH 3GMQB 4CMMB 4NN6C 3T0EC 2HKFL 3QZWB 2J5LB 4XWGH 4J1UA 4A2LA 2V2TA 4PJBE 2MNUA 1K6QL 4XVJH 4JJHA 4WNQB 3O9WC 4U1HA 3Q6FA 4XPBL 2APTA 4LASH 2EXYC 3CVIH 4HLJA 3S35X 5I19H 2IWGA 4GUPB 1G84A 4U1GB 1AQDA 3IYLW 3MRHA 4TSBL 5F7EH 4EZMA 5IFJB 3RDTA 8CGTA 2YKLH 1ZHKB 2BVQB 2ADIB 3KLAB 3EJYD 4IMKA 3GSRA 3U36A 4ZPTA 2BNQD 4R4FH 1ZS8B 2H8PB 3I6KB 4JCLA 1IQWL 2AABH 1EZVX 3WL9A 4QRUB 1VKXA 4B7IA 4LEOA 4XMKL 1IFHL 1I7RA 1L7TL 3I84A 1QTYT 1I1AA 3O6MH 1QBLL 3HZMB 4FQXC 3HFMH 4ZFZA 1FFOA 1B9ZA 2ITDA 2FHFA 4G6JH 4W6WB 3AS2A 4HKJB 5I30L 2O93L 5AWNH 3LMJL 3ZT5A 1F2QA 4LSUL 4XP5L 4NQEB 4JFXB 4ZO8A 5FYLD 3QDMD 4OM1H 2EEBA 3S7GA 1NQBA 4PRHD 2BVPB 3QG6B 5DUPL 5FDWA 4FQQA 1X9QA 2DQTH 3HI5L 3FRUA 3RGVA 4M1CC 2DL2A 4NHCL 1YY8B 5EZJA 4WUUE 5F9WC 4E42B 1QFUH 3PDOB 4TVSa 1YJDH 5FF6A 4MZ3A 5FO8B 5ICZB 1NFDE 2ZUQB 3V4PH 5GZOD 1KJ3L 3HC4H 3ARBB 1EEUA 4ZOBA 1AHWB 5FYJE 3MLPA 1JNHB 3DIFB 1MHHB 4HEME 1NCTA 3A67L 1CDHA 3L1OH 5MI0C 1XF1A 3T8XA 4QHNA 3M17B 5GXBB 5KSBE 3GMOA 4X9FA 2FATL 4A6YA 4P46B 1PW3A 2PXYD 2VXSH 1N6VA 1MCWW 3QJFB 3MODL 3HNSL 4HXAL 1V3KA 3JWOC 3KPNA 5CEZL 5IK3A 3FQNA 1NGPL 3HHRB 1B6UA 4IRSD 3SCMC 5AAWA 1P69B 5D2NA 1RU9L 3EJZC 4ODUB 1XF5A 2FO4A 2EYTB 3TBSA 5F93C 1IGIL 2WZPD 1FAKT 4KVCH 5JTWA 1CDCA 2IC2A 3IFPA 4P2OC 4LQ1A 2BNRE 1CGSH 5F7MC 5T1MB 2B0SL 2LTQB 3UJJH 5GGQH 1QPXA 3ZSSA 4S1QL 5ESVA 1U3JA 2EH8H 3TVMA 4RISL 4PJDB 5K9QI 3L5WB 1EHLH 4QCIB 2GITA 5JHLH 5CJXA 3S88L 3QFJB 4HV8B 4Z7QF 3QIUB 2FB4H 4QY8A 1HK6A 5F6HI 4ENEC 3QCVH 3AFLA 4TRPH 1CIDA 3FQXA 4WUKH 2ZSWB 1K4CA 3PWVB 3MRMB 4HXBH 3O11A 2CMRH 2GTZA 3VXTA 1JNNL 4TUOA 1NLBH 3MRPA 5CZXD 4QRPA 2R1YA 4O9HH 2DI8A 2J4WL 1LE5A 5E8OA 1XGTA 3SKUD 4J8RB 4JPVL 4GRMA 2FGWH 3EYSH 3LKSB 4PJEF 1MEXL 3L3DA 3VXNB 1F42A 1KEMH 1XR9A 4G80A 1XGPA 5LCVH 3HMWH 1OGAE 1H15A 2WM0A 1WAAA 1BQHG 4WUUD 2FD6H 3O3AB 2K9UA 1T0MB 1P7QD 3MGOA 4X7SL 5FYJD 2J6EL 4C4KO 4DK3A 1TCRB 4M93B 3TNMA 4I3RH 1NJ9A 5FYLL 3TYFB 3A6OA 5DJDB 3ZL4L 1BQLL 3MRQA 5E8PA 3L5XL 4G7YH 2UY7A 4JANB 5T1LD 4KC3B 5ILTL 5K9KB 1KJ2A 5EBMA 1PEZA 4HCRL 1CFNA 2W9DH 5EG6C 1U3ZA 5GGSA 4PY7B 5E0QA 4JVWA 1X7QA 3NA9H 1FL5A 3KPOB 1KLGB 4OB5H 1A0QL 1RZIA 4F58L 4YE4L 5L7XL 2BNRD 4OF7A 2AJYH 2P48B 3D5OF 3LEVH 4XVTL 3RUGB 3WNNA 5A3ID 1JHTB 5F7YC 4KHTH 4JKLA 5CEXB 1OTSD 1J10A 5LGHL 3ARDC 3STLA 2FX7L 2YOCA 3G5VA 5C7XH 3T0XA 2OBGA 3WIIH 4TVPH 1S7RA 1DCLA 2R1XB 1A2YA 2D7OA 4XNYL 5HI3C 4N0FA 1KTLB 4UINL 1BQHB 1W72B 3LPWA 4PJFB 4ODBD 5MEQB 5JOPD 3QQ9D 1N3NB 4M1GL 1B0RB 4F8TA 5CIPH 4OCNC 2P44B 1A7OH 1I75A 4DN3L 1RUAL 1OGAD 4MA7H 4Y4FC 2GY5A 4XXDB 2H6PB 4ZS6C 4MCYB 2X5PA 3BRGC 2AK1L 2GJJA 1D6EA 2O5YL 1CDYA 1R3KA 2AXFA 3QUXC 1J0JA 4PB9H 4QHMA 3V8OA 5EDXA 3JV0A 4UT7L 5J6GB 2IBZX 3E8UL 4CVZB 1MHCA 3NCYS 4KXZH 5FAAA 3SPVA 2XWBB 4G9DB 3T3MF 1OAUL 4LAQH 1JWSB 3HB3D 2H2SC 3D0LB 1KCUL 4OD2B 1JPGB 4E9LA 4CRPA 1IE5A 3LEYH 2W65A 2NTFB 4RGNB 4S0SD 1PZ5B 1GGBH 1KT2A 4IRJC 4NO0D 2HMIC 4Y5YC 1I1FA 3S98A 5FYJL 2YSSA 1G7QA 2LVCA 1NCDH 5KOVC 1ZLUK 2H3NA 4O2CA 3QEUA 3V5DB 3IDJA 2QLVB 5EFIB 3IDIA 3VDBA 3MJ9H 2BSRB 1E6OH 4WFEE 1ONQA 1UGNA 1AJ7H 4JFZH 3PQYB 1EGJH 1QBAA 2EEAA 4UQ3A 1OP3H 1FFNA 3H42H 5GGUB 3RWIA 2LFGA 1U6AH 3RWJB 1FCCA 4XGZB 4HIHB 3BN9C 4JE4B 4GG6A 3L3KB 3CLFL 5ESAB 4PS4H 3C5ZB