4CL8A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 92
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cl8A00
2FZEA 3DMTA 3BHMA 3S55A 1UH5A 1BMDA 4KOAA 2PZKA 2HMUA 4Z3DA 5F1KA 1XA0A 3VC7A 5GZ3A 4R1NA 3D7LA 5IXSA 3NDJA 2CF6A 3RIHA 3QVWA 1GD1O 3GHYA 2B0JA 2WYUA 4XZ3A 4BKPA 1NQOA 5I9NA 5TIIA 1U7TA 4E5KA 1Y5RA 3RKUA 1YDEA 2TMDA 2F00A 5MGBA 3VTZA 2BFOA 1H6BA 3RUFA 4HFJA 2E82A 2X5OA 5A1TA 4WNIA 2G17A 4XX0A 1YJ8A 1LLUA 4IIUA 1I2BA 5TX7A 1H9AA 1IUKA 3NV9A 2D4AA 1XCBA 3COSA 3WGOA 2BGKA 3GEDA 1Y6JA 3W8DA 3SJUA 1H6DA 1QG6A 2EKLA 2VTDA 4CMHA 3RC7A 1CIVA 1K0UA 3WYBA 4PLGA 1YBMA 4OHUA 3QW2A 4BO2A 1P77A 5KVQA 4PVDA 4QFCA 4PIVA 4FN4A 5L7YA 1T2CA 3F1KA 4R9RA 3TF5A 1PJBA 3HDQA 1MFZA 2VZ9A 1V9LA 4BKRA 3WNVA 2W98A 3PYLA 1X0XA 3F47A 5L40A 1YGYA 4CMJA 3ZWVA 3DHNA 1PL6A 1DBVO 2JAPA 4TRMA 2VT3A 4MKZA 1Y8QB 1Z7EA 5KTKA 3KYBA 4RLSA 4DIFA 4GVXA 1YDWA 4ND1A 5FEUA 4R51A 1UXKA 1P1IA 4JP2A 5TF4A 1GTMA 4YQYA 4CPDA 2PGLA 1NVMB 4PLVA 2O50A 2PR2A 3H3FA 4JJGA 2B35A 4K6CA 5F1PA 4DLAA 1GZ4A 1S7CA 3NX4A 5A3JA 4HNHA 5JC8A 3HG7A 1ZMOA 4EW6A 3E5RA 4J6FA 4XCVA 2V6GA 3DAGA 3JQ8A 1R37A 4P4NA 3H5NA 3JTMA 5C7OO 1WPQA 3D4PA 1SEVA 4DLLA 1GR0A 3A4VA 4CL8A 3I6IA 2O3QA 3D5QA 1EBUA 1ISMA 1NYTA 2G0TA 4ONEA 3DBLA 3OQ6A 1A9ZA 4Q9NA 2ZCVA 1LRLA 4WPGA 2D0IA 4BQPA 1MGOA 2CNBA 3ZZNA 1NHGA 4ND3A 2LDBA 3AW9A 3BMQB 4ITUA 3H9UA 1SB9A 4B7XA 3G1UA 2V6BA 4FJ2A 1JQBA 3WR5A 1NP3A 4E2YA 5DOZA 1Z74A 1N2SA 4YJGB 1AXGA 4FCCA 2XOXA 4D45A 2C2YA 4XWYA 4GMFA 2Q2QA 1BRMA 1DFIA 3JQDA 2C29D 1U3TA 4A26A 1QSGA 3I3OA 4DYDA 3DZBA 4AJ4A 5KCZA 3S2IA 5CEFA 3AOEA 2E49A 3TZQA 3VH2A 4IINA 1UP6A 1Q0QA 2J3HA 4N5NA 2O4CA 2FZWA 5CG1A 2PFGA 4A73A 4DQXA 4CLEA 1IOLA 3CUKA 1AXEA 1B16A 3QP9A 5KJFA 5JCJA 1PTJA 1LDNA 5BSEA 3KO8A 1ZK3A 2P9GA 1CERA 2RH4A 4F3YA 3EMKA 4E31A 4AJKA 1J49A 3R0IA 2J3IA 4U0KA 4J9VA 4LN1A 2ZYAA 2OO5A 3W6ZA 1WWKA 4BB6A 1UJMA 2AG5A 4DXHA 2Y0CA 4NU6A 3RJ9A 2GN8A 5AXAA 5G2OA 2Y1EA 3UCXA 3ZW8A 3RVDA 3WS7A 4CM5A 2CDCA 4GMGA 1TEHA 2C59A 1ZMTA 4OAQA 2CSUA 5G0VA 2H63A 3QJ5A 1DDOA 4BNMA 1T4BA 3BAZA 4GSLA 4JIGA 4NFHA 1W6UA 4PVCA 2EEZA 1RYDA 3ZU2A 2GN9A 1SPXA 4A0SA 1RPNA 4E2WA 2P4QA 3F46A 4UUOA 1M6WA 4MOWA 2HCTA 1B8PA 1Q7GA 3HADA 4Z0TA 4GI2A 3HJAA 1ARZA 2OGUA 4G2NA 3L9WA 1SBYA 2QYTA 2LDXA 4GH5A 4TQGA 1BSVA 1X7HA 1B26A 2DAPA 3H2ZA 4KUEA 1R6DA 3DBLB 3JD1A 5IN4A 2G82A 4CL3A 4GSKA 1LSSA 1LQTA 3GMSA 3JQCA 3EZYA 3ZN2A 4GL4A 1QYVA 2GPTA 1PR3A 5L7WA 4YCAA 1UXIA 4TRJA 4DPKA 4PLYA 3BTVA 4YB8A 4PG7A 3IC5A 4MP6A 3RUIA 2EGGA 3IS3A 5EESA 1R0LA 1HDYA 5KKAA 4Z9YA 3C7AA 4L0QA 4CMEC 3DZIA 2GNAA 1ID1A 4IJKA 4NFYA 1Q1NA 1B8UA 1ORRA 4L4RA 3C85A 1E1MA 3WWZA 1YOVB 5JDIA 1HSOA 3ULKA 1LC0A 3L4SO 3TZKA 3U4CA 2NTJA 4IGFA 3WQQA 1GADO 5JBIA 1VSVA 3PDUA 3VDRA 4FFRA 3WQRA 1WXDA 3IDSA 3H3JA 4BO4A 4OOEA 4QQRA 4EBFA 2OZPA 2CUKA 4INAA 4MIEA 3O8QB 2EW2A 5B12A 4HBGA 2HJRA 4W6ZA 2I65A 4N5MA 2AA3A 3ZNQA 3K73O 1PZEA 3W4IA 1C0LA 2FPPA 4GLOA 1E7YA 3BMCB 4OJNA 5DDIP 4L75A 2IZ1A 1OC2A 3ANNA 5EINA 4NBRA 3MCVA 1LNQA 5G4KB 4E2XA 4UVEA 4PZEA 4RZIA 1Q7BA 2RHCA 3DONA 1AHHA 3HFSA 4YTEA 4IDAA 5L4SA 4KUGA 2E37A 1ZK1A 5J23A 3PI7A 2X23A 5DZSA 5CDYA 2GD1O 3OA2A 4PRLA 4HX5A 3GNSA 3WG9A 2Q49A 1GDHA 2C20A 1YJQA 4HP8A 4P38A 3RQSA 3HB4X 3PZRA 4IQ8A 1GYQA 1FDVA 2JD1A 3LF1A 3LT1A 3O26A 4HFRA 4KQXA 2NQ8A 3DZJA 4YRAA 4ND2A 3WSVA 1YWGO 1PL7A 3NGXA 4W82A 4TZKA 4B3JA 4G5HA 3VHRA 5I7VA 2R00C 3JYLA 1LBEA 2C5EA 4PRKA 4XGKA 4GQAA 1T25A 4FJ0A 2NU8A 4ALIA 1K6IA 3L77A 4IUYA 1WP4A 1U5AA 2V65A 2XF8A 3DFZA 4NDNE 3M1LA 1IYZA 1C0PA 5FI3A 3DAFA 1U1IA 1VC2A 3MTJA 1OI7A 1RM4A 2GRAA 1GPJA 4W9NC 3ZHYA 1LLQA 4BNZA 2DC1A 1DFGA 4FFLA 3V5NA 4RJTA 1ZW1A 4FGWA 4RL6A 1R4NB 3DBRB 3RFVA 3TJRA 1I24A 1AHIA 1B3RA 3SBOA 2D8AA 4AJEA 2VWQA 5G4KA 5L95A 4XJSA 3E5MA 1R12A 1WVGA 3OF2A 2ZTMA 4BNYA 5AQ1A 3DZHA 2ZK7A 3M2PA 4AVYA 4UUNA 1T24A 1Y8QA 1N9GA 3VPXA 2EIHA 2B4QA 2PKQP 4BNHA 1NFFA 1O0SA 5EJ2A 4E30A 1F17A 3JYPA 2AXQA 4Q3DA 4QXMA 2IDZA 3DAPA 1LSOA 1ZSVA 1VI2A 2FP4A 3GDOA 1EDOA 3JQAB 1RM5A 4UUPA 1M66A 3IUSA 3NJ4A 1ZSNA 1DRWA 1UXGA 2B4RO 3I1JA 1Q7CA 3ONDA 3UKOA 4ILKA 5ITVA 4PGFA 3JQ7B 4J43A 4Q3AA 1PJTA 5EN4A 4YAJA 4E21A 4R68A 1ONPA 1B15A 3KUXA 3PDJA 1GV1A 3HFGA 4A10A 1HZJA 4RVDA 4NI5A 4YAEA 3H5RA 1X7DA 3FWZA 4WLFA 4J4TA 4MINA 3PJGA 2NV6A 4NMHA 5JY6A 3OHSX 3ZWNA 3WICA 2YW9A 4CM9A 4ZQFA 5JY1A 2AMFA 4FIZA 4OXKA 3R3SA 4E5YA 2VUTA 1LRJA 2XPCA 5H81A 3GNTA 2C5AA 1M75A 4E5PA 3SEFA 5L4LA 1E7MA 1MG5A 4WEQA 4FDAA 1IB6A 1D1SA 2PGDA 1G1AA 1PZHA 3INTA 4CM7A 1YB4A 2CFCA 2OMEA 1EZ4A 4RPKA 3WOHA 2VQ3A 4QT0A 1FDWA 3P2OA 1WMAA 3HNPA 4ZHSA 3FI9A 2GZ3A 2PD6A 3I6QA 5IF3A 4TSKA 2Q4EA 3PIDA 4LVUA 1UDBA 1I3KA 3GG2A 1F0YA 3ZWCA 1KIFA 1CQIA 3KVOA 4Y98A 3KYCA 5A9TA 4UUMA 2BD0A 1JVBA 2D2IA 3RROA 1I8TA 4FBGA 2PGJA 4R69A 5ENVA 4TRNA 2X7HA 1HWYA 1H2HA 4BO6A 3GQVA 3HE3A 3UCFA 5A5FA 1Q0LA 5B1YA 5G0TA 4EYEA 1AUPA 1YRLA 5CPBA 5FYDA 3W8EA 5BQFA 4IZHA 2NNLD 1DC4A 3WQSB 2GF2A 4M8SA 1KVUA 3UN1A 5AYVA 1XG5A 5IFLA 2HDHA 1R15A 1VKNA 1SC6A 4Z9XA 4J91A 1NFQA 3VPFA 1ZEMA 2NVWA 4DYVA 4II3A 1B2LA 4PLWA 1EK6A 1R0KA 4XKJA 5AXBA 4X54A 5B4UA 1M2WA 1X14A 3AJRA 2EF1A 3MJCA 3KBOA 3JQ7A 1M6HA 1U8FO 5DCYA 5IZCC 1I3LA 3VH3A 3VKVA 1OZAA 1E6UA 3I4FA 3NT2A 4XIJA 1HE4A 3CXRA 4L74A 4L73A 1WZEA 5C37A 1DAPA 4EJ6A 3UFXA 3UICA 1TB4A 1O95A 2HRZA 1BVUA 1HE3A 4TWRA 1IPFA 1JKJA 2IODA 3K6JA 1U3VA 1BDMA 5JPIA 4E5MA 1O9BA 1I3NA 3EVTA 4DQVA 3U4DA 3NTOA 3VZRA 2C0CA 2WD7A 4RVSA 2HK8A 4IBOA 4IPTA 4XDYA 5IZCA 1HF3A 1TT5B 3BYZA 2V6FA 3CZRA 3TWOA 4MIOA 4AJ2A 4IZIA 3IUPA 4BNXA 4AJOA 3GGPA 3MZ0A 3ANMA 4R16A 1XIVA 3UH1A 3WGHA 3FBGA 4W4TA 4JP3A 4TRRA 1A4IA 2X0JA 3SC6A 1NQTA 3OM9A 4D0SA 3DEYX 2AEJA 4MDHA 4LSMA 2YHIA 1A5ZA 1E1LA 5A9SA 5F1OA 3V1UA 5CG2A 1JKFA 4GX5A 4RF5A 4IDFA 1TA4A 1H6AA 2VNSA 4UEJA 4AG3A 1PIWA 2ZB4A 4NG5A 2CD9A 1KVTA 2PZJA 1O89A 4M55A 2EGHA 2BELA 2WJPA 1MLDA 1ULSA 3KV3O 5T64A 3DFUA 2VT2A 5I8ZA 1PZGA 1CETA 4CMAA 1P0FA 2DTDA 1O5IA 3CH6A 1A9YA 4R54A 1L7DA 5ILOA 1PJ2A 2IEBA 3ZNNA 3CSDA 4WCFA 1SZJG 4QFDA 3C8MA 3Q6IA 1I0ZA 3SJ7A 2VHZA 4E12A 1UXJA 2Y1GA 4BNKA 3Q2KA 2PD3A 5C7IO 4BQRA 2HMVA 4OL9A 4DREA 1IHXA 2EWMA 3V1TC 1GFSA 1EUZA 4R5MA 4YYZA 4XQGA 2X0RA 4R3WA 4UVIA 5IZ4A 1ZO8A 4LK3A 4IQ0A 4OIMA 1ZUD1 4JQCA 4FJ1A 1ENPA 5TT0A 2GSDA 4R1UA 2D5AA 3GY0A 1NWHA 1Y9EA 1HZZA 3E9MA 4CM8A 1E3SA 3VKUA 3KSDO 4RVUA 5DOVA 1XWFA 1YL7A 2HUNA 3AUSA 3W1VA 1T4DA 2A94A 2I6TA 3TZHA 3DL2A 2O3TA 2ZIZA 4D3SA 3OJLA 4XIYA 4ND4A 3DZKA 1G0OA 1EUDA 4RQUA 3LT4A 4CLRB 1YQDA 4B7UA 3GG9A 3FHLA 3QRWA 3V1YA 4XYLA 1ZXLA 2DTEA 3GFBA 5AOVA 3TDKA 2JD0A 2P5UA 3E9NA 3LT2A 1P45A 2R00A 5A04A 1P33A 1T2DA 2YYYA 3K92A 1LSJA 4Z0PA 5JMPA 2FR0A 2CVZA 1FJHA 4B79A 3LF2A 5JAZA 2EHDA 2ZB7A 1X0VA 1H6CA 3BMNA 4A03A 4B3IA 1DXYA 3H5AA 3RFXA 4CM6A 2P5YA 1C3VA 2FSVA 2OBYA 4QEDA 2QZ9A 2OL4A 1Z7BA 3GEGA 5DN9A 3RUEA 3LC1O 3TNLA 1MXFA 2J5QA 4IDEA 3LQFA 4EJ0A 2IRWA 1YXMA 3DQPA 4AJLA 5TT1A 3ZWBA 5AVOA 3F3SA 4GX1A 4H7PA 2EP7A 1SB8A 1E6WA 3OQBA 4E3ZA 4HV4A 5HA5A 2BI7A 1OOEA 4CQMA 5JAIA 3AWDA 5C5IA 2CY0A 4G65A 1KVQA 3AUTA 1MFPA 4FQ8A 1HSZA 3D1LA 4XDZA 1S6YA 5KOIA 1EVJA 2CDBA 5KNLA 4CQLA 4ZICA 4CV3A 2FMUA 2O2SA 1HETA 4R01A 2BH9A 5FI5A 3U0BA 5IG2A 3UUWA 1DRUA 3P5SA 1CYDA 3FPLA 1C1XA 2NLOA 2P9CA 3WBFA 1LX6A 3I9OA 3ZU3A 2FOIA 4E33A 1XQ1A 3GR6A 3JQGA 1JLLA 5FFFA 2VYNA 4TKLA 4BKOA 1Z75A 5KVVA 5JDIC 4TKMA 1TLTA 2OUIA 1ZJZA 3W4JA 1QLJA 2IE0A 4IS2A 2FRDA 1GPDG 1NTOA 4J7CA 3L6DA 4GKBA 4RQTA 1KOLA 3VZPA 3I23A 2HO5A 1XSEA 1A72A 3PHIA 4RPJA 2WD7B 2OHXA 3L6EA 3DZFA 3JQ6A 1YOVA 3DDNA 3FCOA 4N54A 1VLLA 3N58A 4BV8A 5L3ZA 2WEKA 2I5PO 3DWFA 1QV7A 1IPEA 1E3JA 5U1PA 3GVHA 1NR1A 5FWNA 3H8VA 5L51A 3BIOA 1L7EA 2I67A 2PZLA 3A14A 4BMNA 5IXYA 2PKRA 4CR7A 4J4BA 5CFZA 1H2BA 5THKA 2NU9A 3U4IA 4IDCA 2NU7A 5EQDA 1DO8A 3KEOA 1MA0A 2B4TO 3BTOA 3DBHA 1UDCA 1PJ3A 1B14A 1ML3A 3GZNA 3WGGA 2EJVA 2OP1A 3GC6A 2ZJ0A 1U2GA 4Z6KA 5KIAA 2XXJA 2PH3A 2IXAA 4FFNA 4WLVA 8ADHA 1P74A 3LDHA 1AGNA 5THQA 1XQ6A 5ICMA 1E1KA 1VJTA 5I7SA 2HJSA 3ETEA 1X13A 1LJ8A 5JMWA 4ALJA 3ZHBA 4LCEA 2D1YA 2QHXA 4WOKA 3PEFA 1CJCA 1NPYA 3WGYA 1J6UA 3GVXA 3KHUA 1N7GA 1J5PA 3RBXA 4Q3EA 2DM6A 3WFIA 4PLCA 1BXGB 1EVYA 4I1IA 1ZVMA 2VHVA 4OOFA 4DUPA 4MKRA 2HMWA 2NM0A 4P4GA 1JDJA 1Z45A 3IAHA 2B5VA 4FD3A 3GRKA 1JTVA 2GN4A 1UR5A 1LDEA 1ZEJA 4QSMA 2I9PA 3PK0A 1PQPA 2C07A 1JWBB 2YY7A 4BNWA 1IE3A 2DBRA 3G17A 3WLEA 2W90A 1V6AA 4IM7A 3B1FA 2DQ4A 3GRPA 2RH8A 1KS9A 3ZWYA 1BTOA 4RCVA 4IDBA 5CDTA 5K0ZA 3UAGA 3KYDA 2BRUA 5IJZA 3RFTA 3VDQA 3JYOA 1B3BA 2Y1CA 4S1VA 2GYYA 3IKVA 5B37A 4RVHA 2I3GA 2EP5A 4OKNA 4YJHB 2JCVA 3IP3A 3LZ6A 1KVSA 3HQ4O 4JBGA 3DOCA 4MVJA 3JQFA 5AXCA 1WW8A 2YFHA 1A71A 3MJ4A 4L4XA 3ZDFA 4J7UA 1U28A 2YUTA 5DBIA 2Y0DA 2BGMA 3JYQA 1E6EA 4WJZA 4NK5A 3ZWAA 1K2WA 4II2A 1WDKA 5JYEA 4R1SA 4ZU3A 1QYCA 2W2KA 2Y1FA 5TRTA 1KEUA 1WDMA 1W73A 3WGZA 2CZCA 1ADGA 4NR0A 2X0NA 4Z0HO 4YT4A 3ADOA 4J1SA 3VPSA 4CR8A 4YVFA 1U4OA 1UXHA 2NVBA 1H5QA 4GGOA 4BMSA 4CLDA 2X9VA 1BW9B 2AQIA 5U4QA 5I9LA 4DMLA 1NPDA 3P19A 3BMOB 4WCDA 3GNQA 1HRDA 1XEAA 5DBFA 4A5OA 2ZYDA 1HE2A 3KLPX 1LSUA 2Q1UA 1U7HA 5A03A 2X9GA 3LSYA 3D3WA 2GZ2A 3CZMA 3JQBA 2Y93A 3S2GA 1DIHA 5HM8A 2QYSA 2WMDA 4N7RA 2D59A 3QQPA 3HWRA 3L6OO 1E3LA 3JD2A 5IDXA 4UEKA 4XB1A 3IL2A 5TQVA 1YL5A 3HDJA 3FR7A 3PTZA 2P9EA 2HU2A 2J8ZA 5COAA 4PCVA 2WSBA 4S3MA 3KSUA 3WTCA 4NBUA 5ITWA 1D4FA 3JQGB 3UVEA 1ISJA 1UP7A 1HDXA 4KDFA 4Y8VA 3W6UA 2HK7A 4P4LA 2NVUA 4EUFA 3E48A 3BHIA 5JC1A 4BGEA 3CPSA 3VPGA 3AFMA 4E5NA 4W99A 4K28A 3B20A 3NRCA 4GVLA 4XGNA 3DO5A 2IZZA 2JFGA 3TZ6A 4EITA 3JQBC 3C1OA 4EZBA 1GU7A 5EPOA 2WWRA 3FF4A 1X7GA 1LC3A 4J1QA 3WLFA 4I9NA 2I3AA 2C7GA 2Y68A 3Q2IA 3R3JA 3EHEA 3L4BC 2HKIA 1LI4A 1E7WA 3A1NA 1ZCJA 3CEAA 3H9QA 1E5LA 3VVCA 4F6CA 1V3TA 1YKFA 3KYDB 4J0FA 1ULUA 4WK6A 1CWUA 1D8AA 4PFJA 3VH4A 3RC2A 4O0LA 1LTHR 1LRKA 3IJPA 3PJFA 4BVAA 1YO6A 3RC1A 3FBTA 1LU9A 3K2EA 1HXHA 3HDYA 4GKVA 3ITKA 1YH3A 1GQYA 1PGQA 1YB5A 3BMCA 4WEOA 5A3VA 3WIDA 3GZNB 1DC5A 2QRLA 4Y6PA 3WYCA 3WIEA 5L7TA 4FFOA 4M87A 7MDHA 1R4MA 1DJQA 5HS4A 4XEHA 4QTZA 3JV7A 1DLIA 4W7HA 4WCFC 4M54A 3ZU4A 5LDGA 2DPHA 3ZW9A 1PWXA 2FHSA 4FOOA 5EERA 5DBGA 4MVJF 1ISHA 1HLDA 1H9BA 2YJZA 4J1NA 1G6KA 1LLDA 3K96A 3OJFA 4DPLA 3AI1A 2ZQZA 3LLVA 3R6DA 5HBRA 4YR9A 1OBFO 3IJRA 5BSFA 4JCOA 4AJJA 4BO8A 5A06A 1FDTA 1HLPA 3FN4A 4A27A 1I01A 3FNEA 2QZZA 3VVBA 1BGVA 3BA1A 4OYRA 1BXKA 3T4EA 1BDBA 3IQDB 1D7OA 2X6TA 5ER6A 5IDQA 2X22A 4HY3A 1HT0A 4E4YA 4PLPA 2PK3A 1ISIA 3WWYA 2GO1A 1N92A 1KY4A 4XYEA 4E13A 3GK3A 3ENKA 4WLEA 5F21A 4MVJE 1XELA 1LDMA 4BNJA 4ZD6A 1VL6A 2P68A 3WMWA 5F3RA 3K8ZA 2CVOA 4BIIA 5DT9A 3K2BA 5B4VA 3G3EA 1W4ZA 4KUHA 3AI3A 4KTTE 4ZQBA 4CV2A 3ABIA 4O1MA 4HWKA 2ZTLA 1ZK2A 1QYWA 3AI2A 1TVEA 3BMQA 4XGIA 3FWNA 1U3WA 4I5EA 2QIOA 4L76A 4G81A 4BNUA 4Q39A 4M49A 2AE1A 4PLFA 2VRBA 3DXFA 2DVMA 3KM0A 4TVBA 4BO3A 2VUSA 4BV9A 4RZHA 4WLNA 4BO9A 4BNFA 3LLSA 4ESOA 4CMGA 3ROMA 2VZ8A 3T7CA 3U3XA 1MB4A 2DUWA 4YJGA 1CEQA 3EW7A 1Z6ZA 3KOUA 1GUZA 4KTVE 2XAAA 2BMAA 4ROSA 4J90A 2FWMX 4DBZA 2W2KB 2IEDA 1I33A 1WMBA 4BS9A 2EKPA 3S1LA 4GX2A 3HN2A 3RUAA 5ILGA 3TSCA 1RM0A 4URFA 3TRIA 2TMGA 3NUGA 4AL4A 4PG6A 3U62A 1IZ9A 3ITDA 4NQZA 1N5DA 3AM5A 3NJ8A 3TPCA 1XU9A 4MPDA 2HLPA 4F6LA 3FRJA 5U9CA 1SO8A 1GEEA 4D44A 2VCYA 1DOHA 1IHYA 4H16A 5K6AC 3ZWPA 4J2OA 2WD8A 2Q50A 3IP1A 4CMKA 5JYDA 2GZ1A 1N1GA 1MC5A 1YS4A 4AJ1A 3QV1A 4N5LA 3H7AA 1Y81A 2WYWA 9LDBA 1JKIA 2NADA 5JAMA 1HYGA 3KB6A 3ONEA 2QRJA 1GCUA 1K6JA 3TZCA 4RPLA 1R0SA 3OETA 1K3TA 4GLLA 3I52A 2O23A 5KJEA 4OM8A 4RF4A 3WGQA 5JXWA 2VWHA 4KQWA 4PG8A 3M2TA 2Q2VA 3Q0EA 4BNGA 3C7DB 3QWHA 4XYMA 1Y1PA 1SCUA 2Y66A 3WYEA 3ZV5A 5K6AA 1XR3A 4Z9FA 1JU9A 3GN2A 2ZATA 4YXFA 1C1DB 1QYDA 1Y8RA 4CODB 5HTOA 1Y9AA 1VJ0A 4GWKA 5TGDA 2GDZA 4GAEA 3MTGA 4DC0A 1V8BA 1LUAA 2E48A 1YQGA 3VH1A 1JWAB 5F5NA 2VYND 3ICCA 3U9LA 5JS6A 3OICA 1Q2XA 1P0CA 4EUEA 3WNQA 1XGKA 1O8CA 1UP4A 5G0UA 4MP8A 3O8QA 4PLHA 5I9MA 4GWGA 1XHLA 2DBQA 3OH8A 1OMOA 3I83A 3G0OA 4BNNA 5HRUA 4IDDA 2Q1TA 4XYBA 1AN9A 1DJNA 3DMYA 3IKTA 3C7CB 4UAGA 4MVJD 1GCOA 3EDMA 3JYNA 3K30A 3RCBA 3INGA 4PLTA 1PJSA 4BNTA 1SAYA 3MWEB 1A27A 3E18A 3FSRA 1GZ6A 4KWIA 4TMFA 4YQZA 4CM4A 3NT5A 4AJPA 4XRRA 4MP3A 4OH1A 2YDXA 1AE1A 1JAYA 4W9NA 3G49A 3MOIA 3OEYA 1BHSA 1OFGA 1LQUA 4NJOA 1QR6A 1DHTA 2X9NA 4IXTA 3HSKA 3QVXA 1PJLA 3ZCXA 5L4NA 1GYPA 1DPGA 2POQX 4C7KA 4DRYA 5L9AA 3MJVA 3C24A 1VJ1A 2PV7A 5AXDA 3RWBA 1MG0A 2Q46A 3K31A 2HAEA 4JBIA 3AY6A 4WLUA 1ISFA 1C1DA 1UUFA 3VAZA 5KWEA 4PG5A 4BHTA 4E32A 4O59O 4WASA 4L4SA 3FR8A 1GQQA 1OC4A 4P8RA 1PJQA 3Q9NA 4GX0A 3JQAD 3GVCA 4E6PA 4R41A 4CM1A 3EY4A 5C3MA 2UV8A 4EEZA 4PG4A 3KTDA 3SLGA 2WE8A 4EJMA 5JO0A 1T1SA 2ZB3A 1WDLA 3FNGA 1E7RA 3I9MA 4B4OA 4K6FA 4LMPA 3H4VA 1Y7TA 3OECA 3STHA 2NU6A 4I08A 4DPMA 1X1TA 4YT5A 1GEGA 2VWGA 1GZ3A 4Q3CA 2Y99A 4U6SA 5BSGA 3EUWA 3LK7A 4BL5A 3BMNB 1SEPA 4ALLA 3QE3A 4NZ9A 4HUJA 2ZQYA 1SOVA 3AOGA 1YBVA 3N7UA 2E6UX 1VSUA 5L53A 2V7PA 1BVRA 4Y67A 3WFJA 2JJYA 3EGOA 3DTYA 5KJ6A 4BB5A 4XB2A 3EVNA 3AUUA 4LSWA 5F5LA 4HKTA 3IIEA 2X0IA 3L4BA 3IMFA 1N1EA 1DAOA 1O6ZA 2PH5A 3WJ7A 4NU5A 2EG9A 2O48X 3N74A 4AJHA 3E8XA 2ZCUA 4RDHA 1HDZA 2W2LD 4QX6A 4DA9A 3DR3A 4BGVA 3TQHA 1JN0A 3RU9A 2B69A 4L8VA 4CQLB 4ZQEA 3DOJA 3H65A 4FS3A 3F5QA 3ASVA 3WXBA 5LCXA 2VHWA 4LCJA 2DFVA 1I5RA 5A9RA 2RAFA 2B37A 1X15A 3GGOA 4CM9D 5JDCA 1BXZA 2Z1MA 3TL3A 3WB9A 3NAQA 1NQAO 5L45A 3OIGA 4U5QA 1KVRA 2O4UX 5A4DA 2BGLA 3HDHA 1MX3A 2G1UA 4FW8A 4BGUA 3BMOA 2JHFA 3DOOA 4R1TA 4PN3A 4FPXA 1K5HA 1ZKMA 4LRTB 4F46A 3FNHA 3TOXA 1EK5A 1TT5A 2Y1DA 3E6AA 2FSSA 3EC7A 3NGLA 4CM3A 4MJLA 3PP8A 1CRWG 4JN6B 3S8MA 5JSFA 2W2LA 1I3MA 1HE5A 5G0SA 4HXYA 1I30A 3JQEA 4OKIA 5MDHA 4NJMA 2PA3A 4BOYA 5K9ZA 3JQ9A 1E0DA 2DPGA 2GLXA 3B1JA 1NQ5A 4TZTA 4C7JA 3QSGA 4WCFB 1NVTA 1ZH8A 2VNAA 3G1TA 3LC2O 3PYMA 4I5DA 1HDCA 4RDIA 1UZNA 3FTPA 3Q1LA 4CUKA 3E9QA 1U9JA 4P22A 4ND5A 2Q99A 1ONNA 3KRTA 4CLOA 4U7WA 3U4HA 3DBRA 3M6IA 1ISGA 4AJNA 1W0CA 4DGSA 3OJ0A 4CQMD 1Y5MA 2OORA 4ZGWA 5CP8A 2C82A 3KYCB 1DIGA 1M67A 5T6BA 3H9JA 3SVTA 1FF9A 3ZWWA 1ZIDA 4YEDA 2DBZA 4WE3A 4D7AA 2WDZA 5B4TA 3QY9A 3JCZA 1ADCA 3LT0A 4R5HA 1RJWA 1WNTA 3ONFA 4WECA 4XJTA 5DP1A 1VKOA 4AFNA 1P31A 1VE9A 2PTGA 2YHIB 3GEMA 4CM4B 4NH4A 3K9QO 2W4QA 1DSSG 4FFPA 3CIFA 4NBVA 2GUGA 3X2EA 5IAAA 9LDTA 3ST7A 3ROQA 1KC3A 4IJWA 4J49A 1N9GB 4Q3NA 1YE3A 3OA0A 1IY8A 2JCYA 4OMUA 4CLRA 3D3WB 3GUCA 1E3IA 1N7HA 4YAKA 1I2ZA 2EXXA 1F06A 4CV0A 2Y05A 2I66A 2CF5A 1T1RA 5GZ6A 2AEMA 2Y1OA 5T8KC 1IZ0A 4A7PA 4YAGA 2X58A 2IXBA 3UW3A 3GN1A 2VHXA 3U09A 4PLZA 3PQDA 3ZI0A 4OGWA 3LVFO 1B8VA 1PZFA 4CLHA 1QKIA 1KYQA 1U4SA 2AQ8A 1QMGA 2IYOA 3UF0A 5I8WA 3MEQA 2Q1WA 1MXHA 4J16A 4BGIA 4BO0A 4NJMB 2EV9A 3TN7A 2QG4A 2EKQA 1P1HA 1PWZA 3MJTA 3PGJA 4KWHA 1B0AA 1GUFA 1LXCA 3CMMA 5BT9A 4BNLA 1NASA 4JX8A 5EL0A 3ZV6A 3ZHXA 1P44A 4XD2A 1EUCA 3QVSA 3AFNA 1PQUA 3PJDA 4E0BA 3PYXA 1DRVA 1YL6A 4OQZA 2NSDA 3QWAA 2QRKA 1F12A 3A28A 3I5MA 6LDHA 2FY8A 3GHHA 3T7EA 4BNVA 4O63O 1E92A 1ZSYA 1KERA 4RPHA 1NX6A 3DBVO 4D46A 4WNCA 4CM8B 1E5QA 1ZFNA 3L07A 4IDGA 3TOZA 5CEJA 4W7IA 4KZPA 4CV1A 3TL2A 1UZLA 1DHRA 1PGPA 3PQEA 2HRBA 1HDGO 2VYVD 2QX7A 2Z5LA 3AM3A 4OXYA 4YWJA 3T4XA 3JD3A 1R16A 4KP7A 2B36A 3GA0A 4QO8A 3OEWA 1E1NA 4BO1A 2VN8A 5JLAA 4CMIB 3EAGA 1R66A 3UXYA 2H6EA 3RASA 3F4LA 2HSDA 5TJ9A 2NUAA 4HADA 4YDRA 4J9UE 4XQCA 1V35A 1PGJA 4RF2A 5T5QA 4HFNA 1YVEI 1LEHA 2GN6A 1Q0HA 4IQGA 3QLJA 5G0WA 1D3AA 2WTBA 2AG8A 2DUUA 4JBHA 3H9EO 1I32A 3ZNOA 3E82A 5T67A 1RYEA 2ZYGA 3V8BA 3WTBA 1I2CA 4MVJM 3U49A 1ONOA 4IXWA 4LW8A 4U8GA 5G4LA 4OSOA 2JFHA 1R4NA 3JD0A 1VM6A 3TFOA 1P1FA 1HKUA 1F8GA 1T2FA 2Q3EA 4HFMA 5I7FA 1Z73A 1EQ2A 3FTNA 4FFMA 5JNLA 2Q2WA 3RBVA 2DBVO 4BNIA 3C1TA 4GBJA 1PL8A 1ZJYA 3G79A 4MO2A 4UVHA 3NT4A 5TNXA 3L9XA 1NR7A 2VYVA 4O6VA 3NDRA 3HUDA 3RSHA 3GLQA 4D3DA 4Y9DA 4XRGA 4RVFA 2GERA 4IJVA 2HMSA 1KETA 5EIOA 4FB5A 1FDUA 3AUAA 3F6YA 4IS3A 4CQMB 3JSAA 3PJEA 4ID9A 4J7XA 1T2AA 1XLTA 1G0NA 4K9DA 4TROA 1C0KA 2NTVA 2NACA 1Z82A 1M76A 2YFQA 3A9WA 3H6KA 4D3FA 5H82A 4DQUA 3DC2A 1MUUA 3PVZA 2ZTVA 2Z1NA 3ENNA 3ZU5A 4D42A 1DC3A 1WAMA 3WGTA 2RBEA 4I5FA 4MKXA 4RLHA 4B4VA 2YQ4A 2FPGA 5H83A 5JFOA 4D0RA 4EDFA 3JQ8B 1YBAA 3OIFA 4TVOA 3I9KA 4CUJA 2A35A 2G5CA 1KEWA 4XR9A 2C54A 1SNYA 4HNGA 2I99A 4R4JA 1T26A 3DHEA 4UREA 3ETGA 3DTTA 5TC4A 1PS9A 1T2EA 1NBOA 1NWCA 5CAEA 4QO7A 4YJFA 3CMCO 1VPDA 2BKAA 3ZWXA 3DBHB 4ZRNA 4R3NA 2NWQA 1NAHA 2NTNA 2P4HX 3MJSA 1V3UA 3GVIA 5JAQA 4CR6A 1A7AA 1NPTO 4CLOB 4DL9A 4GGPA 2DLDA 2P2SA 1JW9B 1UAYA 3QA9A 1D1TA 2PZMA 2O3JA 2C7VA 3O4RA 5ADHA 2Y0EA 1DB3A 1K6XA 3OJOA 2VHYA 4JLWA 1HYEA 3GUYA 4YJDA 3KETA 1QP8A 3WX0A 1QORA 1CDOA 2CVQA 2H9IA 2Z95A 2EW8A 1QXSA 2PNFA 4YRBA 4CLXA 3FPCA 3WGIA 5FF9A 4LVCA 3ANLA 3S2FA 1ENYA 5JO9A 3TFQA 4DBVO 4FC6A 1WZIA 3ORFA 1EVIA 2B5WA 2FR1A 1JVSA 1UAGA 5EQFA 1GL3A 3F4BA 4D79A 3L0DA 1U2DA 3W8FA 3JQAA 2FR8A 4B8WA 2O3UA 1HDOA 2D3TA 2HK9A 3GPDG 3IOYA 5I7EA 4I9HA 4Y6SA 3HB5X 2YQ5A 4A2CA 1I36A 2ET6A 2VTEA 4IGEA 3CINA 3C3XA 5BNIA 4RO0A 3KXDA 1HTBA 1EQUA 5CDUA 1PGNA 3PHGA 1KEVA 1E3WA 3RBZA 3O38A 1EE2A 2JAHA 3PHJA 3VZQA 2NQTA 2GR9A 3UOGA 3I4CA 3ZWMA 3ROPA 2GASA 2W8ZA 3D4NA 2X5JO 3VPHA 1LDYA 2ILTA 4RVGA 6ADHA 3OMLA 3ZV3A 3MOGA 4UEOA 3NTRA 1ADBA 1LDBA 2WYVA 3CE6A 1KY5A 3GH3A 3RU7A 3PGXA 2NVUB 2J3JA 1GV0A 1ENZA 1PU2A 5T57A 1HL3A 2CDAA 2X1HA 2Y67A 1DLJA 3ZNPA 4LISA 1WLYA 4GPD1 3NEPX 1I10A 1JAXA 2O7QA 4KMSA 1Y8RB 3OIDA 2RIRA 1PGOA 2YZ7A 1KBZA 4BUCA 2VZ0A 4QUKA 3S2EA 4CMEA 1XKQA 2BLLA 4O5OA 4YJFB 3A06A 2RCYA 3OQ1A 1UDAA 1NNUA 5CHEA 4FOSA 4DLBA 3PHHA 2DFDA 1PQWA 4JJFA 4L9RA 5KJ1A 2ZTUA 3MJEA 3QVOA 4JXKA 3LYLA 3Q11A 4KDEA 4MVJG 4NK4A 2VOJA 2PY6A 3BTSA 3O9ZA 4RV9A 3ZV4A 4ZQGA 3GZ4A 3LU1A 5IN5A 2IYPA 3SXPA 1HDRA 4M89A 5A05A 1LA2A 4WUVA 3WBBA 5CPFA 2AQKA 3DZGA 5C7LO 3SLKA 1LLCA 2UYYA 5TSDA 2WE7A 1PSDA 1EVZA 4JK3A 4XYGA 4ALMA 5JCXA 1OAAA 4U0JA 3PWSA 4ZN6A 3R1IA 1YQXA 2JL1A 3QHAA 5ICSA 4MVJP 1GY8A 3KEQA 2JKVA 2GCGA 8LDHA 1H94A 3GDGA 4YAIA 1PS8A 4OSPA 4YPOA 3I9NA 2EERA 5TS3A 5LDHA 1MP0A 5KKCA 1XYGA 1DEHA 3BZUA 3KSZO 3QVTA 2VRCD 4J2HA 4EI2A 3PHLA 3P2YA 3PQFA 4E2ZA 3MWDB 2BFAA 1VL0A 4CMIA 3VZSA 4Q3BA 2AW5A 4M86A 5COBA 3UGKA 5ES3A 3B1KA 1X1EA 1J4AA 4YACA 1VL8A 3BXXA 1L1FA 3UCEA 5T8KA 2PLAA 3JQ9C 4NBWA 1P3DA 4IMPA 1MC4A 3EYWA 4UVGA 4Y6RA 3GAFA 3Q9UA 1VRWA 3PFFA 3KLMX 1SOWA 4JNKA 3RJ5A 2P91A 4D43A 3GFGA 1F14A 1CQJA 3GAZA 3W4KA 1E7SA 4UULA 5BR7A 2DTXA 2Q4BA 2H1SA 3D0OA 2XXBA 3GVPA 4WKGA 2HQ1A 3RI3A 1P1RA 3GGGA 3PXXA 4JGBA 4J4HA 1QV6A 4FSHA 2OFPA 3AOEC 4EGFA 3QWFA 1DFHA 1K89A 1JA9A 4LMRA 5JE8A 4DVJA 5A9SB 2VOEA 5CEEA 4ALNA 1BW9A 2AE2A 3OSUA 3D3EA 5JDCC 2X86A 3GPIA 2X5KO 2YHUA 3PWKA 3QIVA 3OP4A 3ZWOA 1HEUA 1C14A 3CTMA 4BKUA 2QQ5A 2R6JA 2IZ0A 3ZGYA 2JCXA 4DIOA 1SMKA 1NAIA 3D64A 3PLRA 3O03A 4NIMA 2ZKLA 5BNTA 4B8ZA 1A4UA 2E4AA 2G76A 4FC7A 4QECA 1KEPA 4NPCA 1NHWA 1BG6A 2ZJ1A 5BNFA 3H2SA 4DIBA 3KZVA 2FPIA 3PZBA 2HMTA 1MV8A 2PD4A 1GYRA 4YT8A 2PKQO 4IJUA 3QWBA 3WMXA 2OP0A 2F1KA 3I9JA 3RUDA 1DIAA 3B70A 2SCUA 4FGSA 1FDSA 4MIYA 5A02A 3FD8A 3AM4A 4WOJA 3LC7O 4XR4A 2R2GA 3X2FA 3SX2A 3ADPA 2BI8A 3JD4A 4JROA 2JD2A 1NFRA 2O3SA 5CDGA 4ZRMA 3GOHA 2J3KA 2RHRA 3ICPA 1FK8A 4CJXA 2O3RA 1TXGA 3VOSA 4YT2A 4XQ9A 4LRSB 3NTQA 3WJAA 3RAJA 3SC4A 4RPGA 2OXIA 3PFWO 1C1XB 3NDIA 5JW6A 3ON5A 3PPIA 4ALKA 1PR9A 4CUZA 1P1JA 1PJCA 3AU8A 4J0EA 1EE9A 1E3EA 3F5SA 4DMMA 1V3VA 2OBNA 2OOSA 4RF3A 2Q1SA 3I9LA 3GMDA 1BWSA 1V0JA 4I8XA 3RKRA 3AY7A 1E7QA 1QRRA 4I5GA 4H15A 4OXNA 5DP2A 5IDWA 5BSHA 5TLSA 1DC6A 3FNFA 4OO3A 1H93A 3BHJA 3Q3CA 4XQEA 2YV1A 3GT0A 4NHEA 2DU8A 3PLNA 2VUUA 1XDWA 4PZDA 3V2HA 4B4WA 3F9IA 1H0KA 4EEXA 3CKYA 4RORA 1NM5A 3VTFA 1R4MB 1ZXBA 1EMDA 3HZZA 3ROKA 2A9FA 2GGSA 1A7KA 2Q45A 1EFKA 5EMHA 3ZHZA 4CMCA 5A5EA 1RWBA 2CMDA 4U6QA 5CDSA 3PWZA 2O2YA 4YRDA 4IY1A 2A4KA 3F1LA 4ZQHA 1PJ4A 4FR5A 1TI7A 4NFSA 3U5TA 1PEDA 4I9UA 4WGGA 1QYXA 3OBBA 2YV2A 5GY7A 4B7CA 2UAGA 3C1AA 4Z3KA 2UUOA 1KC1A 3DMTC 4OQYA 4B3HA 5ER9A 5GMOA 2JFFA 5TJHA 1YONA 1GQ2A 5KVCA 1ADFA 3RUHA 3GDFA 1YB1A 2X8LA 2JHGA 4XA8A 4C4OA 1EFLA 4BO5A 1F8FA 2J5KA 4EUHA 1HYHA 3NYWA 4AICA 4BMVA 4UVDA 1P9LA 1ZK4A 1O94A 3D5TA 4H3VA 4JJIA 2UDPA 3EK2A 3V2GA 1ZZEA 2WM3A 1RKXA 1U5CA 2VWPA 2UVDA 1E77A 3EZLA 1W8DA 1FMCA 4J3FA 4NBTA 4R9SA 2X4GA 5IDYA 1N8KA 4IMRA 1QLHA 1GUYA 1BXGA 1U8XX 2YV3A 3B6ZA 2A92A 1ZK0A 3WDSA 3AU9A 1IULA 4ZA2A 4B4UA 1C0IA 2PWZA 3INRA 4K1LA 2BHLA 4YJHA 1DIRA 4AJIA 1DIBA 4M1QA 2V6MA 2ZB8A 7ADHA 1EDZA 3ETDA 3OJEA 5DCUA 4BO7A 3E1KA 3PIIA 4K26A 3P7MA 2J5RA 1EBFA 5KVSA 3AK4A 2D5CA 1FXSA 3DB2A 1CF2O 4DTIA 2AQHA 3ASUA 2J6IA 3HHPA 5KJCA 3AY3A 3BTUA 3PRJA 1ZBQA 2I76A 1PX0A 1UZMA 3DHYA 3GF4A 4WLOA 3HN7A 5COQA 2AEFA 3RD5A 4RGBA 3WSWA 1B7GO 4YBZA 3JQFC 5DULA 5GZ1A 1NVGA 4DWVA 5DNAA 2C2XA 3UHAA 2QW8A 3NKLA 4BKQA 1IL0A 1PS0A 1RM3A 4LGVA 3D4OA 4NNJA 4PZCA 5ENDA 5HS6A 5LC1A 4MVJI 1U3UA 2BFPA 2DT5A 1ZNQO 1EEHA 2O7SA 2BFMA 4ZVVA 3QWIA 1J0XO 3ZH2A 1XU7A 4YA6A 3RUCA 2VRCA 2H5LA 2YDYA 4D41A 4F45A 3H9GA 3E03A 4N18A 1GAEO 1ENOA 4ZJUA 2B83A 1E3WB 1NXQA 5DCWA 2EJWA 2UUPA 1P1KA 3M1AA 2AHRA 4IIVA 1TT7A 2BF7A 1LDGA 3V2UA 4CMBA 4MVJH 2DKNA 3OFSA 2FN7A 3RC9A 4J1TA 5HWSA 5DF1A 5JCJD 4DC1A 3K5PA
chains in the Genus database with same CATH superfamily
5ELXA 1LPMA 4CKYA 3O6VA 4RHFA 4TOIA 5F7XA 4KIUA 4UU0A 2NG1A 1PTKA 1XZNA 4AN4A 1KQ3A 1UH5A 5C4IA 4I3FA 3SDSA 2A9QA 2PZKA 4Z3DA 3QHQA 2WWGA 5F1KA 5CJJA 1EP9A 4L4ZA 5GZ3A 1JEYA 2VSXA 3D7LA 5IXSA 3ETLA 4DABA 2R3SA 2CF6A 3RIHA 4ZJZA 3I3SR 2WYUA 1X70A 1PDWA 4B6EA 4BKPA 3LPDA 1G7TA 4DLZA 5FOXA 3RKUA 1PBNA 1YKGA 1EM8A 2F00A 2K7ZA 2TMDA 5DHFA 2Q0QA 3EIUA 3FGPA 3H2KA 2I80A 5IT5A 1NYQA 5MGBA 3DS8A 2G5TA 5TF0A 1DOAA 2VC2B 3ORQA 3MRVA 1KMIY 4M9CA 2H1OA 4E07A 1YR6A 1D2MA 2QENA 3U7QB 1LLUA 2VA9A 1I2BA 1VLVA 1EUQA 3UFXB 1IUKA 2BAGA 1JR3D 1ZH6A 2D4AA 2VEDA 1DG9A 3RB8A 2X8AA 1TYZA 3SI7A 5ISMA 5M7EA 5FTNA 3FSEA 5J5VA 3E58A 3C15C 4DMUB 4E7OA 4DV7B 5DPMA 1YS6A 4I6EA 4LIPD 2GHQA 1NM5C 3UJPA 2FN9A 1QG6A 2ZWVA 1DBWA 3DNMA 4CMHA 3TRHA 1CIVA 2XTAA 4Z53A 3IUYA 4OHUA 3AF3A 4TLDA 5H1YA 5IARA 4C29A 1VHJA 2BFEA 4B47A 5JZVA 5L7YA 1T2CA 3UPDA 4R9RA 1I4OA 5H02A 3TF5A 2VZ9A 1XEWX 2NUTB 1X0XA 3UQYS 3IE1A 3CRNA 5JWHA 2KE5A 4QPNA 1PL6A 2VT3A 4L27A 1Z7EA 2F7SA 1AV7A 1O87A 3FVQA 4TXHA 2V8OA 3KYBA 3FUWA 1IDN1 2YXLA 4RLSA 4KMOA 1SU6A 3PR3A 1M34A 1FS6A 1RAFA 1V8FA 4FQ5A 4DE5A 4X62B 3HR7A 5BSTA 521PA 4M99A 5TF4A 3UWOA 1H1DA 4AI6A 3ABSB 2IIVA 2PGLA 5B1SA 1GFZA 1NVMB 4EB0A 3H3FA 4JJGA 2HQOA 4BXOB 2C2KA 4K6CA 3AR5A 3LQKA 1SVUA 1T29A 3MCAA 4GKAA 1Q19A 2I78A 4X1OA 4DLAA 1TIKA 4R9NA 5AUQA 1GZ4A 1YRYE 2CLMB 2VDLB 2JGNA 5ALZA 1MOZA 5FI0B 4I4TA 2E4YA 2WI8A 4DMKA 1JTEA 5H3HA 2BI4A 3SR0A 1ZMOA 3S28A 2OHOA 1YA4A 2HHLA 4NS1A 4XCVA 2V6GA 3JQ8A 3GLVA 4P4NA 1E89A 2NSJA 3TQIA 3FIJA 4HZGA 1GPLA 3I6IA 2QL9A 2W6CX 1MO5A 1IIBA 4R0NA 1NYTA 2AH5A 2G0TA 2VDOB 1PZXA 1SY7A 3OQ6A 5CK5A 4Q9NA 1YZLA 2FZCA 3LPAA 4IIYA 4C0JA 2PJRA 4LHYA 2RHBA 4UQLA 3BL6A 1A7JA 4UOEA 2B3DA 1QK4A 5I8PA 2C7QA 1YQQA 2Q3JA 4YLYA 4ND3A 5EA2A 4KR7A 4MS3A 3BMQB 5L6LB 4RADA 4N7JA 4C2AA 4R0MA 4RSMA 1MCZA 1OV6A 2BMJA 4FJ2A 1T5TA 3P2IA 1CS0B 1KFEB 2FG6C 1QBKC 2O1WA 1HQDA 1OFUA 1Z74A 4ZAYA 2P4UA 4YJGB 2E87A 2XE6A 2DUNA 4FCCA 3R5KA 5EUBA 3L7CA 4E14A 2FSHA 4NDZA 4GMFA 4QBKA 4RFSB 5E6RA 1QP7A 2BEUA 2O05A 3DBOB 3GJ7A 1U3TA 2RKWA 3D0RA 3FDZB 4N3NA 1YZFA 1YDHA 2Q2NA 1X3SA 4DYDA 2PLFA 4UPEA 3L7NA 5KCZA 3CZ9A 1AKWA 1A0OA 2C7RA 2DKOA 4UTPA 4B3DA 3AGQA 1BOFA 3AOEA 2E49A 2KBEA 3ISVA 1UP6A 2J3HA 3HH8A 3ZQ4A 4Q24A 3WMFA 3EH2A 1DTWB 2FZWA 4DLTA 4Q7LA 3C7KA 5CG1A 5K3OA 3PC8A 1GDTA 1P60A 2VTKA 3QVGA 1II8B 4CLEA 2H9AA 4DQXA 2JFVA 1TAHA 3CUKA 3PUZA 2IUFA 4RKFA 5FTJA 4C1BA 1AXEA 3QP9A 2P2YA 3SC3A 3AFGA 1PLJA 1LDNA 2Q6IA 2I34A 2AX4A 3W5HA 1Y4AE 4J0HA 1QF9A 1RWNA 1E1QD 2RH4A 3LG2A 4E31A 3STXA 5KTRA 4U0KA 3U7GA 4BRWA 5IWAB 5L3RA 3NHAA 1USWA 5J4VA 2AG5A 5CIYA 4KEAA 4DXHA 4X24A 4NU6A 2NQ2C 5A1JA 1MORA 1XTBA 1QGAA 5AXAA 2GPBA 4Q18A 4LFCB 3UCXA 3RAEC 3WS7A 2JCBA 4JLBA 3O47A 1TKBA 1TEHA 1JG2A 1XNGA 5ALUA 3TD2A 1T15A 4OAQA 5G0VA 1F4LA 3QJ5A 4BQQA 1UFOA 1OFUX 1UOOA 4L5JA 1DUIA 5FAKA 4BNMA 3ZDZB 5A0TA 3HHEA 2PVPA 1R8XA 4GSLA 4XI9A 1W6UA 2H7VA 4AMUA 2WA2A 2GN9A 2D2XA 2WG2A 2XNHA 1SD1A 1RPNA 3WLPA 3F46A 1ULAA 4ZMSA 4MOWA 2HCTA 3K15A 4AXBA 1S3FA 2CXOA 4ZI3A 2I6QA 1ARZA 1TJYA 2H2GA 4IJ6A 5TPWB 3UK7A 1IN7A 2QBYB 4N3AA 5LXTA 3DLIA 2QYTA 5LB4A 1BU8A 1ZH4A 1EX7A 3TQTA 4EFDA 1B26A 1XZ8A 2XCOA 3FFBA 1D04A 3H2ZA 1R6DA 5F98A 5ECYA 3PCRB 4YCDA 5HIJA 4L5IA 4YJ2B 4GSKA 1LSSA 3FKQA 3ZHCA 1GHTA 1PWHA 3UUEA 2O59A 1NQVA 1M7GA 3WDLA 1PR3A 2OFWA 3MWKA 5ERGB 1UPFA 1CU1A 3FCCA 4MRVA 1KTVA 3B9PA 4KFCA 3VKHA 3DEZA 1V3QE 4EB6A 3COJA 1M6VA 4AZ0B 1J22A 1R0LA 4LOIA 4BLRA 2RAVA 4Z9YA 2XE7A 3EEBA 3ZW7A 5IYZA 4HLCA 4BVJA 5HRAA 3U3DA 1UBMS 2ZM6B 3BXOA 1ORRA 3WWZA 2C58A 10MHA 1YOVB 3E7XA 1HSOA 1L4LA 2D8MA 3TZKA 3LAWA 3QOFA 4CG1A 4RENA 5HW0A 5LQRA 4FGZA 3GEBA 3P2KA 1EWQA 1K66A 1VSVA 3PDUA 3N8GA 4WKOA 5LMCA 4FFRA 2C4MA 3P4UA 1L4UA 4KE8A 4FNMA 4ZAVA 4EBFA 4QQRA 4DV1B 4QPZA 2ZP1A 1YZQA 3O8QB 1RRFA 4K9SA 5B12A 1W85A 1QP0A 4O2BB 4W6ZA 3GUZA 1ZWLA 5IULC 1XNJA 2AA3A 4JQSA 4CGZA 1TL7C 1E79A 4ZVLA 1JIJA 5GV8A 1AH2A 4UXHA 1SWVA 5DDIP 3FSGA 4L75A 2WFMA 2ZS7A 3AV0B 4DHWA 5CA1F 1W44A 1Z62A 5EINA 4EY6A 1NJ2A 3UJ8A 5ULLA 3WK7A 1OYOA 1KL7A 3K9GA 2RHCA 3AF6A 4UAVA 4AZTA 4IUCS 4N8EA 2V59A 1OTXA 1UEJA 3OFND 4MQFB 1CY2A 3GELA 2W5UA 2P79A 2VATA 1YI8A 1MBZA 1DKUA 2R4TA 1C29B 1WF6A 2JGFA 2RGNC 5KNDD 5J23A 3KSBC 1ODSA 4OX9Y 2QG9A 2X23A 2AD5A 4AW9A 1EA7A 4N82A 1IH8A 1R0ZA 2DPMA 2GZRA 5B1DA 3FJOA 4PRLA 1O0BA 1AQUA 4C06A 4X3PA 2G77B 3SICE 2WPDD 1GDHA 3QUAA 4A23A 1YJQA 3HS3A 4HP8A 4P38A 1KR5A 3GO4A 5K8IA 1JEOA 1GYQA 3O26A 1RT9A 5IH7A 1R8SA 3ZIDA 4OI0A 4YRAA 4B87A 3K70B 3SIPA 4ND2A 1Q6YA 2A9RA 1VMAA 3EAFA 4HK4A 4QG7A 2LRHA 4ZO7A 1XJ5A 3AYXB 3NGXA 4LPKA 4G5HA 3R7AA 4XWOA 1WIWA 2BM0A 4L1KA 2F1JA 4PHCA 4P5EA 2JI9A 4U2GA 4KFTA 1DEKA 3JYLA 1B76A 1CS0A 2V58A 1RBMA 4GQAA 4XIIA 4M36A 2F17A 2NU8A 3T34A 2VSYA 3B53X 4RBNA 3VSEA 1RC8A 1QFSA 2HIAA 4ZWNA 2OCIA 1T4GA 1U5AA 3BB3A 3DFZA 3U60B 4DCGA 1UJ6A 5FI3A 4BLWA 1ZRHA 2OPBA 1JLLB 2BR5A 3BQMB 1US8B 3MTJA 1OI7A 3NATA 5E9QA 4HLNA 3KZOA 3ZHYA 1SIBE 3WGMA 3LQ1A 3VSAA 2Q7XA 3P0JA 2P9QA 3V5NA 4A15A 1EVLA 1K7YA 4RJTA 1ZW1A 5KKNB 5EIWA 3U4QA 4FMCB 2F2TA 1LZKA 3MSXA 3RFVA 3TJRA 4AY4A 1AHIA 1SXHA 4KK3A 3ZKWA 4AJEA 3R3VA 1O4VA 4FTWA 1QFJA 1R6BX 1NVFA 5EE1A 4L6CA 4KAFA 4XJSA 3PA8A 5B2FA 1DV2A 3KB1A 2G40A 4LRWA 3UOWA 5CDFA 2IXFA 5AQ1A 3PNVA 2ZK7A 4AVYA 5GGXA 1FQOA 1JG7A 1Y8QA 2ZYVX 3UENA 4TYQA 1N8TA 2HCBA 2Q9UA 1FUEA 2BEWB 3AJ9A 1U6KA 2YVQA 1NFFA 1O0SA 4IKPA 2A9OA 4Q0MA 1XTUA 2AR9A 4E30A 5DV9A 1GTG1 1XUOA 1GZSA 1PKXA 1SBHA 2FQXA 4Q3DA 3TXAA 3AL3A 2IDZA 4G4SO 4QXMA 2JGDB 3JWGA 4K88A 3W5VA 2FSVC 2QTBA 4FOLA 2FP4A 1A9TA 4LNHA 2WR8A 4AYXA 4D9NA 3LHSA 4O4LA 1SCNE 2WIKA 3AC0A 4N0DA 2WRZA 2WDPA 1VKJA 1FEZA 1D2GA 4M76B 1DRWA 1UXGA 2B4RO 3I1JA 3ONDA 5IVIA 4DJJA 2F62A 2PUAA 5K8CA 5AVJA 2NO6A 3JQ7B 4DJTA 1RU3A 1ZGBA 4K8RB 3EOZA 2RK6A 2AIRA 3MCWA 4R68A 2HYIC 1ONPA 1B15A 3KUXA 1TD1A 4QUHA 2GPYA 3UV3A 1GV1A 2P78A 4BFXA 4A10A 2ZI7A 3Q3HA 1WUJS 2M1XA 2R6GA 4MI1A 4NI5A 4YAEA 3TI9A 3UT6A 2BC9A 2ZUVA 3T7AA 3U1VA 1KI9A 1KYVA 4ZPJA 2Y0PA 5KAPA 4DF3A 1EFAA 5EWJB 3RT9A 3ZK8A 3UJNA 1U0NA 1CJUC 2YW9A 3SBDA 2HFJA 4DNQA 5JS7A 2IXDA 3BE6A 2LCFA 4FE4A 3B9RA 3R3SA 3GEIA 4EZIA 1FX1A 2XPCA 3WAGA 1QS0B 2GEVA 2OQIA 3GNTA 3KOXA 4RWZA 3CR3C 3RS7A 1FTGA 5L4LA 1TA0A 2HO4A 4O4HA 1MG5A 2HPHA 2ZRMA 4FHFA 2J9ZB 4GM1A 2BKEA 3S2YA 4FDAA 2PGDA 1D1SA 2BW0A 4EHBA 1PZHA 4LYEA 4CM7A 3QKSB 2OD9A 2DB3A 1EZ4A 1Q1EA 1SGWA 2R5FA 3D3KA 5AKYA 5FL3A 4XUGB 2G4VA 3NTVA 2H1HA 2ZE8A 3CLHA 4KACA 4NE7A 4B3MB 4QTYA 1JHOA 3K6KA 4JB2A 4QT0A 3UOAB 1MB2A 3FI9A 4C78A 1L5QA 4MRPA 4UTNA 1U04A 2Z4RA 4P4SB 5E8JA 5CB4A 5KYXB 1E8NA 1LWNA 1UM9A 2V9PA 4Q4AB 5KYNA 1UKEA 4ARAA 2BM9A 1OV4A 1CB7A 3EULA 4AKTA 1RXCA 2PUVA 2QRPA 4YLEA 1I3KA 3S44A 3SIRA 4PY2A 1E2QA 1XLTC 3U4MA 2KLBA 4TV9F 3ZWCA 1L3CA 3NVAA 1FTYA 1CQIA 1MOPA 1UKVY 3CRQA 3KVOA 3KVYA 3AEUB 3T7SA 3PFBA 1ZOSA 1WF3A 3T5PA 2JFUA 5A9TA 4YMUA 2V74B 2BD0A 3JAWB 5KSWB 2IHVA 2JGAA 4R69A 2FPKA 1BKYA 1TZ2A 2H85A 1F6BA 4H4EA 4BO6A 5IAOA 3HE3A 4URZR 5DYTA 3RSZA 3CE9A 4O4JF 2IQIA 4P33A 2IOHA 4ZYXA 1WOYA 4G9BA 5IJ0A 5K3AA 3A37A 2O8FA 2P4SA 1ETUA 2Z2JA 4Y1FA 4EMUA 1EA5A 4AWBA 4Z3OA 1R15A 3KB8A 3G9XA 3LQYA 2F3UA 1TAGA 4J91A 4ETNA 1T36B 1NFQA 4R0VA 2C9YA 3H1BA 4II3A 3HY4A 3TNDA 4XKJA 1EJ2A 4AS3A 2CLHB 3DT9A 1H4VB 3ZBUA 4HEA6 1KTIA 1W76A 2JGJA 3KTOA 1RQPA 1X14A 1WXGA 2BFBB 2RKBA 1MJHA 1M2NA 3DO8A 3TAUA 1M6HA 5A4FS 5JNVA 2IS1A 3N2LA 5IZCC 1T9BA 2VAXA 1MD9A 2FW6A 1I1QB 3ACBA 3OJWA 4LBWA 3ZDXB 5FOQA 1OZAA 1TVKB 2FV8A 3NT2A 5C8YB 2PX6A 1WS6A 1WZEA 1E69A 2ZRCA 1UINA 4KJZA 4MS4A 4G4GA 4X7PA 1JFRA 1P9NA 1GNQA 1OWMA 1AUQA 1M6NA 4TWRA 1JKJA 5FB3A 3VDQA 4LZNA 1S2GA 4F84A 1CZNA 4TVSA 4DLUA 4M0EA 2JEOA 3IGFA 2HTFA 4TUYA 1I3NA 4DQVA 2OBXA 2JJ1D 2WHPA 3DEFA 1C4XA 3NTOA 4U7FA 2NPIA 1Y1SA 4EF4A 1XPUA 5ALWA 3RT7A 5FI1B 1R0XA 2VK2A 4RVSA 3TH5A 1PI3A 2P3SA 3LE8A 4KSCA 3A3NA 1N2XA 2EX1A 1J8VA 4IPTA 3MMZA 4XDYA 2QN7A 3NAZA 4EDHA 2ACVA 2C4KA 2V6FA 1LVUA 2VK4A 4REQA 1V9SA 3CCCA 4GP7A 5GIOE 2H4JA 3MZ0A 3EIOA 1E98A 1XIVA 421PA 4W4TA 3O73A 2X0JA 2XYPA 3AR8A 3N70A 4KN6A 3R7NA 4KSYA 3GRYA 5DM0A 4AIRA 4YRMA 3TL6A 2WF5A 3HY3A 5HKOA 1ZOPA 4MDHA 4RHXA 3ZHRA 1E1LA 5A9SA 3WLHA 2GF9A 3RH0A 4PNEA 4UTRA 1JHMA 3V1UA 4QEKA 4F2PA 1JKFA 4GX5A 5J1TB 2VS1A 2VNSA 3VR1A 4W5HA 3FY4A 3KJHA 3GB9A 5ERXA 5F3DA 1HH4A 4TL6A 1PIWA 3JWEA 1VKHA 3F4KA 4NG5A 3UAZA 1IIRA 2CD9A 3OZRA 4QPCA 2IHBA 5E7QA 4RULA 3N9IA 3HCBA 1O89A 3PNYA 3PQCA 4M55A 1PNRA 5GV7A 3QENA 3DFUA 2WMYA 1PZGA 4TMTA 3IUQA 4IH1A 4CMAA 4L50A 5F2OA 3CLSD 4QD3A 1O5IA 1T5DX 1A9YA 4C08A 2D0OB 5ILOA 5JG7A 4D96A 3DUWA 3L43A 4DG5A 1YC2A 3CSDA 3IPYA 5LDDC 2H9YA 2MWMA 2JFNA 1ZU5A 3JAKB 1QK3A 3L6UA 4EJ2A 4QFDA 3LHKA 2IZ6A 4FGKA 3RSFA 3WP0A 4WIAA 1O6CA 3KFVA 3RG2A 4E12A 2ZT5A 2JASA 1UXJA 3KZKA 3QVMA 3Q2KA 4MUHA 1SOMA 2HMVA 3Q10A 2W2OA 4XM1A 1TF5A 4C30A 1RAIA 2CZQA 2RI0A 3M4JA 4M0DA 1KOGA 2P65A 3V1TC 4OH7A 2X0RA 4I14A 4UVIA 5IZ4A 2RBGA 4IQ0A 4BJHB 3IDZA 3PGVA 2Y1WA 3HXKA 2FZ5A 2GSDA 3QTTA 2D5AA 1NWHA 4U1RA 3E9MA 4XGQA 1HV8A 4D3ZA 4F6RA 1TJPB 3CZPA 3VKUA 3EH1A 5CFMA 1E61A 1ML4A 2HUNA 1T8WA 2XIJA 1K1EA 3IPRA 2ZIZA 3RRBA 3ZE7A 3S1SA 1H05A 1DCFA 3ZD9A 1T1EA 5FWDA 3RR2A 4X45A 4W8GA 1G0OA 1EUDA 2OB1A 4D1YA 2AC7A 4CLRB 2B92A 1EPUA 4R1OA 3FHLA 4OHCA 4HDSB 5DIZA 5DK4A 2IUSA 1OVMA 3EAQA 3TXXA 3TZEA 4XYLA 1SN7A 4BAZA 2P35A 2ZWAA 1VGRA 4D8WA 1K8QA 2JD0A 3TDKA 1P0IA 3K5HA 3JALA 1EIWA 1ZGGA 4U4AA 3DTVD 4N47A 2JIZD 5CMLA 2X0FA 2REBA 4FUQA 3L1IA 4NVRA 1JHYA 1P45A 3H6GA 1EGQA 3NORA 3I6YA 3UAVA 1T2DA 3FDFA 5IS2A 2M1ZA 1FOEB 2YYYA 5AKJA 5JMPA 4KPEC 1J0BA 1HYQA 3KR0A 4Y2RA 1BMQA 1SHJA 1GL9B 4IQ4A 4FHGA 5KNDA 1WZ2A 3DAHA 4B7ZA 4K9LA 1Q50A 1DXYA 2WVAA 1YR9A 3RFXA 4B3IA 1C3VA 1K6MA 2FSVA 3CLKA 1DX4A 2FEAA 2D62A 2QZ9A 1QH8A 2TS1A 2GEKA 2X13A 1DV1A 1IN6A 1UIMA 3B3QA 3HA2A 2P1ZA 2VKQA 1MXFA 2QRGA 3IB3A 3DKVA 3LC1O 3LQFA 3TNLA 4GYJA 4L5AA 5I9TA 1V2HE 4G41A 1N77A 3ZK7A 1YXMA 1BHQ1 3DQPA 4TTQA 5TT1A 2NYRA 1JEQA 4MHTA 2ID4A 1YB6A 4H7PA 4OU5A 2WWWA 2VLIA 4IIHA 4J0DA 4RACA 2EP7A 4DR2B 2AMVA 3OQBA 4E3ZA 4HRVA 4KL8S 1WTAA 3UJDA 3WO0A 2BI7A 2QTAA 1TNDA 1UBTS 1M34E 1FUYB 4M8LA 3U40A 4Y7DA 5J2TA 2FDRA 3K94A 4B45A 5JAIA 1BEUB 3DP7A 3IUJA 1CVRA 1Z4MA 4HRAA 4JZKA 3NWPA 5LM3A 1TU4A 3LPLA 3LUDA 5LWHA 1ODJA 1JP7A 1KVQA 3B3JA 1ZA2A 3HKEB 2ETVA 2HQRA 1CE8A 2EKDA 3AUTA 3STWA 3ZR4B 9ATCA 4N6GA 5BSVA 2XGJA 1OREA 1S6YA 5HUHA 1G41A 1EVJA 4CQLA 1CB0A 1TM7E 3DFKA 2BH9A 4OJMX 1YRWA 3U0BA 3QFFA 3P5SA 3FPLA 1G8FA 3PUVA 4URXR 3NH9A 4H17A 1W88B 5FUWA 5LQCA 2FOIA 5KNCD 3GR6A 1DARA 2FPLA 5EWMB 3DJFA 3HYCA 4J0IA 4HGPA 2GHIA 5JNSA 1S2DA 1P6UA 3K0BA 5JDIC 2C1XA 4MB6A 3DULA 1FFAA 1XXHE 4HRXA 1EJ0A 4DIKA 3CRW1 5A3RA 3S8YA 4LMBA 2G9ZA 2FRDA 1GPDG 4D9FA 3L6DA 2WA1A 5BYBA 5EJIA 1KOLA 3I23A 2QJFA 1IJKA 2ZVQX 3A26A 3L0OA 4TQ9A 4DCPA 2O8VA 2VJLA 4PO3X 1VIDA 4KLRA 2X8JA 2FU5C 1YOVA 4N54A 2F43A 4LKRA 1GPMA 3SJAA 5IM4A 1VLLA 2BJWA 1XQYA 1PLKA 3LKZA 1C9DB 4PANA 2RHLA 5E6SB 3QIAA 3ER9A 4WI1A 1E3JA 2FFBA 2COUA 4LZOA 2C96A 3VYTB 1LD3A 3H8VA 2EDCA 3SVLA 1BA2A 1WV1A 1NXTA 3MAGA 3BIOA 2QF7A 3AEQA 1E8DA 5F7ZA 1XVIA 3H4MA 1L7EA 2Z3WA 1RKBA 2N42A 2GEFA 3A14A 3L0ZA 4NDAA 2XEDA 4TN5A 3N2GA 4BAGA 3GJZA 2O0MA 5BWBA 1PFVA 5LP6A 1Z7YA 3Q1KA 3HKBA 4B3TB 3T38A 1O7JA 4IDCA 1NJ5A 1DO8A 2Z2XA 4URUR 3GYBA 4ZHQB 1IZZA 2B4TO 3DBHA 1UDCA 2EARA 4G0XA 3CVVA 1ML3A 1JXAA 3GZNA 1OX4B 1EAMA 3PXBA 1N5LA 1GM5A 3MHPA 1U2GA 2Y0BA 3C41J 4FYMA 5BNZA 3I42A 4JHXA 4YCCA 2IXAA 1F20A 3LDHA 3BH6A 4IDPA 4RJ2A 1L4EA 1YHYA 2ZLBA 2F1OA 3HP4A 2BBWA 5I7SA 1DGQA 1G8GA 4IIJF 1VIAA 5EIFA 3W78A 5JJBA 4LCEA 1G38A 2ENWA 2J59A 1V45E 1ZX1A 3PEFA 4JVSB 1OKKD 4EPXA 3V9AA 2PMKA 4HTAA 3DDUA 1NPYA 2ATEA 4XQ0A 3ZLBA 721PA 1U2GC 2ZIUB 1DG3A 1VCMA 1Q44A 1GPH1 3OWHA 3TYXA 3R9IA 4C20A 4PLCA 1CUYA 2Q29A 1UBCA 2VHVA 1BN6A 2QDXA 1G7RA 2O7VA 3BJRA 3LCMA 5BSKA 2JJQA 3AO0B 2HMWA 1TF2A 1OI4A 1A98A 1ZESA 2HBZA 4DEVA 3GRKA 2RH9B 3K70C 2XH8A 3F0TA 1NJSA 3A0UA 4RTOA 2XVAA 4AY6A 4AN0A 3GLHB 2I9PA 1JWBB 2O06A 4BNWA 3FFXA 3WLEA 2DXIA 1UBSB 5KTMA 1V6AA 1OXXK 1EFPA 1TGYA 2O2DA 3B1FA 2K2QB 3MD9A 3EZ9A 1FMLA 2RH8A 3UNXA 3KELA 1OU4A 2VKTA 5K3BA 5DO9A 4RCVA 1Z2PX 2ZRLA 5BYAA 1XZIA 3CJQA 5K0ZA 3K9FC 3R23A 2AOWA 2BRUA 5IJZA 4K3UA 2JBWA 1ZL0A 3EIXA 2ACEA 3JYOA 3L18A 1B3BA 2FMIA 1CQXA 1EH5A 3E70C 4Q9DA 4S1VA 4YGYA 3N2ZB 5EEHA 3WGJA 2V7XA 4RVHA 4YUAA 1V16A 2I3GA 4Z5XA 3A10A 1T8UA 2BJVA 3OC6A 3BDIA 1KVSA 1N0UA 3G2PA 4YJ2F 1G8SA 5P8WA 1T5SA 1G20E 1SQFA 1UWCA 1U28A 4J7UA 3EZGA 3FZGA 5K6TA 2BGMA 5K3DA 3NVMB 4IDHA 4H7HA 3ZVLA 1Z3CA 3QU9A 1WDKA 3WYFA 4IFBA 1NLYA 2CJWB 3CPHA 5TRTA 2ZBVA 4N8DA 1C7FA 4HBZA 1K8RA 1UBHS 3BBPA 3DP9A 1SCDA 2WMOB 3GRAA 1SCBA 4YVFA 3QLVA 1YT5A 3PVCA 1RQGA 4F3KA 1RC1A 1ZCAA 3OC0A 1H5QA 4GGOA 3AUXA 2G09A 4CLDA 1T9CA 2JFOA 5LBUA 4N48A 1NRJB 3FIUA 5EIAA 5BO5A 4DMLA 4FMDB 2ORED 5HKLA 3WDMA 4AK9A 1PR4A 1KYWA 3DVRX 1R5OA 2BFBA 1W4BA 3VVMA 4RVOA 4ZT4A 4XVHA 2Q1UA 4A2WA 1OT3A 1U7HA 5A03A 5I9IA 1HZZC 3LSYA 4ATNA 2ZOSA 2XLCA 1J0CA 3CZMA 4PC6A 5M34A 1TAUA 3G82C 5DN6D 2HLDD 1DIHA 2VDKB 3IODA 3LY5A 4LNAA 4N7RA 3H11B 2D59A 3QQPA 3Q3VA 4RD4A 2W42A 1E3LA 2XT0A 1L7BA 3RLIA 1JYSA 3KJXA 4Q6BA 3TW8A 5ARBA 4D8VA 5TQVA 1N6HA 4REMA 3OURA 4X90A 3QQ5A 3G85A 3FROA 4G89A 1PAUA 1Y6ZA 2HU2A 2KBFA 1CY7A 3OG9A 3R7WB 1OE0A 3SS9X 1XTSA 1ZNYA 4NBUA 2CXXA 4KPYA 8MHTA 1D4FA 1YTLA 2H17A 3PXUA 1USUA 2KQUA 1YKSA 2C95A 3W6PA 2BYTA 2GZSA 3CLUC 2Q0HA 3M5DA 2KX7A 2I6FA 2ZJ7A 3RUPA 5E4FA 3BHIA 1DKLA 2N3ZA 4XVRA 1NT2A 5JC1A 3ZKWB 4FYPA 4E5NA 3AIMA 3IXMA 4X20B 1OX5A 4J8PA 2C7BA 4GVLA 4XGNA 2ZZNA 2XCIA 3K35A 2BSAA 3M0EA 3U7JA 2EFJA 3C1OA 2GXQA 3JQBC 5CURA 4ZOBA 3W6NA 1O1YA 3GFPA 1G8PA 2WVGA 4HAVA 4HGYA 2IDMA 3BE8A 4HXEB 4W5WA 1X7GA 3HPQA 3HXLA 4F86A 3CVWA 4I9NA 2Y68A 3BRWA 3K2QA 2ONCA 4B3GA 5FUMA 5LQAA 3CEAA 1TJ5A 3IAM6 2HFKA 1RBYA 2H4FA 4FMCF 1A1VA 1E1CA 1TF7A 1GGEA 2BKXA 2LIPA 2F3PA 1CQWA 1C41A 5DGDA 4FEYA 2QRZA 2Y1LA 3L82B 2OVFA 1YKFA 4IUDS 4QWMA 1VECA 1Z4IA 4J0FA 1E60A 4WY2A 3OU7A 4KX3A 1NSYA 3I39X 2JGRA 3I2FA 1CWUA 13PKA 3PDCA 1Z83A 1SUBA 2EDAA 1H42A 3RC2A 1JJAA 3SM3A 4HPWA 2PUJA 3SSAA 2CB0A 1SOAA 2H59A 1VDMA 2MTBA 1JDZA 3FBTA 3K2EA 3ZUPA 1HXHA 1X1BA 5JQGB 4MYTA 3MB8A 4B0OA 4UC0A 3MUNA 4RAOA 1XVVA 2ZWOA 4FHEA 4YQFA 2G06A 3SY8A 4ARSA 4Z9BA 3BMCA 5BNWA 4WEOA 3GZNB 2I71A 4V0NA 3SYLA 2QRLA 3URKA 1GRVA 4G85A 4RKRA 2BUBA 5L7TA 1O03A 1ESNA 1YB2A 3OFNA 5D5PA 3S5JA 3QPVA 5EZYF 1IJEA 1KKLA 4XEHA 1FYVA 1PK9A 5FPYA 3ND6A 5NLLA 4FZ5A 4M54A 3FJYA 3NW9A 3RF6A 1QGED 2B4YA 3ZPXA 4K40A 3ZW9A 1ZR4A 4IIEA 4FOOA 2OEPA 4HGRA 3TLAA 2YASA 4PONA 2CC2A 4MQFA 4BLTA 1ISHA 3OBIA 1JXMA 1CW2B 1DRJA 4XB6B 5CW1A 2YW2A 1HQCA 5IASA 2CKMA 4OL0A 3OJXA 1H4TA 5AWFC 3VR5A 1OYVA 5HBRA 4YR9A 2ASVA 1OBFO 2XB8A 3IJRA 4AURA 5BSFA 2VPIA 1O08A 4AJJA 1M2KA 3FN4A 4K6MA 1I01A 4A0FA 4RD0A 1CY6A 4BFSA 5FKJA 1CUUA 2WAXA 5SYMA 4D9IA 3T4EA 2PMWB 1SUDA 3NWOA 4H77A 3S70A 2VSFA 2X6TA 2RJ3A 5LOVB 1VJDA 3MRTA 2LWIA 4E4YA 1D4ZA 3WWYA 4TV9B 1GLGA 3GK3A 4E7PA 4YLGA 2VPZA 2O1EA 2J9XB 4WLEA 5LQMA 4QIHA 3LJKA 1B1AA 2P6OA 3M6UA 1N2CA 5SZHB 1TK9A 1PL0A 4LE1A 5AM4A 4NEGA 2HMAA 3VU8A 1WZCA 1S5PA 2C3OA 2OGWA 4NZNA 2A1UB 2RGWA 2VRWA 5K0LA 1OXMA 2A30A 5B4VA 3G3EA 1W4ZA 1Q5PA 2QLBA 2V45A 5DX1A 3V4OA 3ABIA 4HWKA 2REQB 5EHZA 1QYWA 5D8DA 1W59A 1H8EA 2YTZA 4JGGA 4X1IB 5F1YA 4I5EA 2QIOA 3NIGB 4RESA 3UIEA 3VX3A 3EA0A 4CZ2A 3SF8B 1W5BA 1ZM7A 2E89A 2PGOA 4JUIA 4M49A 3UWPA 2XT9A 1WXEA 1RRCA 4B6FA 3R44A 1SIOA 5FA5A 1Q0SA 3KM0A 3KT8A 4FIDA 4RZHA 3P94A 3QKUA 4BNFA 1CVIA 4ESOA 2ZR0A 3RKSA 2Q5JA 3ROMA 1QDUA 1JIUA 2I62A 1XZJA 5DIFA 2DUWA 4BEBA 1CEQA 2VSQA 3KOUA 1GUZA 4YREA 2XAAA 4KPGA 3F5FA 4J90A 4LWZA 3ABRB 1JJFA 1FNBA 1XE3A 4INOA 1QVZA 4G25A 4RY8A 4ZVPA 1I33A 1PHPA 1WMBA 4RANA 4BS9A 3LXRA 4MYDA 1ZN8A 3V7NA 5ILGA 3TSCA 1Z7WA 2EBHX 3IP6A 4BLOA 2HA2A 3OM0A 2ODWA 1GPUA 1KYXA 4IH4A 5AKZA 1E20A 3WY9A 2YVUA 3QG5A 3IEMA 3AVVA 4IRUB 3FGNA 3DDWA 4NMMA 1RZVA 4M1ZA 5BQXA 4JI2B 4IR7A 1XU9A 2BEJA 4EO7A 2IYNA 3HLKA 3FE2A 3FYTA 1NNLA 1SO8A 1I7SB 1GNRA 2I7CA 5E6UA 5KAMA 4DCCA 2DY1A 4H16A 3X1DA 4AYTA 4F4HA 1F60A 4ETMA 5K6AC 1MNQA 2YRWA 1U1FA 5DLDA 5I3CA 1ZNWA 3FZQA 4LC1A 3ZWPA 2R1TB 2WD8A 4R71A 4I1OA 4CMKA 1S2LA 4K2AA 2FR8C 1WULS 1MC5A 4QQFA 4AJ1A 4LZWA 5BR4A 3I92A 5EHXA 1G63A 4I19A 2R11A 2BZ1A 2D2FA 3F6PA 3LX4A 3IAS6 1EVEA 1A88A 4D9HA 2YJ3A 2D2EA 2WJWA 3KB6A 1J00A 1R64A 3BD8A 5DNWA 1K6JA 1OLXA 4IO1A 1TK3A 1FP7A 4LYGA 4GLLA 1NDHA 3I52A 2O23A 2J30A 4OM8A 4RF4A 4O4JB 5JXWA 5F7JA 1VG0B 2PKEA 2QTVA 2VWHA 3PQ3A 2Q2VA 2XWSA 2CJFA 3E7FA 3Q0EA 1N0IA 2FQ1A 1EFUA 1ZHHA 5BQPA 1Y1PA 5FV7A 5EZYA 2DUJA 4AP5A 3HPRA 5BRAA 3O8OA 3ZV5A 3GV0A 1NVUQ 3NNDA 3M4YA 3RVJA 1CSEE 1FPMA 1MOSA 2QPLA 1BWQA 3I6ZA 2FCRA 4WJKB 3UEOA 3T3HA 4ZDWA 1Y8RA 1NG9A 2XUZA 2IYAA 4JU8A 1FFHA 4CODB 1WVIA 3NFYA 3R76A 4A8JC 2W2NA 3SWWA 4DKJA 4DEYA 1XTKA 1QZ3A 4G5QA 5I9SA 5TGDA 4NCBA 2PX2A 3MTGA 2LUOA 1WW2A 4P6VF 3NLLA 2B2NA 1P6XA 2B9VA 2OGZA 1KYTA 1O5OA 1ZRNA 2G63A 1L4FA 5HM6A 1IMJA 1FUIA 3RAPR 2AC2A 3NBXX 4OHPA 4EUEA 1O8CA 3WJ2A 5IHXA 1T2UA 2MSCB 4MP8A 3K09C 4PPQA 5I9MA 2IH2A 2YCBA 4OHWA 3RTEA 3QG1A 1XHLA 2QJWA 3M3PA 5LB2A 5I47A 4YP6A 5HNKA 4U2FA 3Q88A 5HRUA 5CB6A 3K0HA 4RZSA 2C1EA 3FH0A 3IKTA 4N9QA 2XUDA 4XEUA 1FL9A 3K4HA 2YVLA 3OM1A 4WACA 3CUEF 4KO1S 2XRFA 2IYTA 3JVUA 1IAQA 3LM8A 4K5QA 4UBOA 1CPYA 1NF3A 4Q4LA 1PYGA 3E18A 3SYNA 3ZCRA 3R75A 1GZ6A 1UOQA 1OJLA 3HC7A 4TMFA 2FWNA 4XRRA 1GZ5A 2APJA 3VYRB 3DMPA 3LVQE 4N65A 3MOIA 5C53B 2XGSA 3F7TA 1CLUA 1TKAA 3JATA 4G0OA 1RBQA 1Z68A 3UT5A 1YRQA 1S3SA 2CLDX 1DPGA 2POQX 2AOVA 3MQ4A 5MN4A 1EXWA 3MLEA 3DV0B 2JVIA 3MJVA 4P1ZA 3T95A 3TZLA 4CTKA 4E6EA 3C24A 2PV7A 1MG0A 3L02A 5EMKA 3GAMA 3MUEA 1DEAA 4F5EA 4R2HA 5DNVA 3TAXA 2IBSA 1FJGB 1JWLA 3O9VA 4HWPA 4E32A 2SKEA 4O59O 4QZVA 1Z12A 5E2IA 3PDIA 2ZXUA 5FBLB 4XWWA 3KT0A 4GX0A 2I91A 4JP8A 3B1XA 1XF9A 3H0CA 1T4CB 2H2IA 3R0ZA 3SD7A 2AUMA 1DKPA 2ZYWX 3NANA 3IT1A 1RRPA 2WE8A 4UPVA 1G7SA 3SLGA 3W8NA 4XCQA 1WDLA 3FNGA 2PCLA 3CLTD 1Q21A 3EVAA 2Z9BA 5AQEA 4KIGA 5JIBA 2IX3A 5LNK1 4AZSA 1DCTA 1ZIOA 1Z2AA 3A70A 3RLFA 1GLVA 2EZTA 3E84A 4OX9B 4YT5A 3O84A 4DLXA 4LAFA 5IYZF 3QEMB 3KS9A 2FI1A 2ABWA 1XEFA 3A4TA 4MJXA 1F8UA 2E4XA 2Y99A 2GOYA 1LLFA 5H7XA 5JV5A 3LK7A 5EP1A 1I2AA 3UWSA 1OVGA 1SEPA 1P4JA 3W5DA 4NJEA 3DTNA 1KAGA 4JJ7A 3EDRA 4NZ9A 3UATA 4ALLA 1NV9A 1PUIA 1Z6YA 2FUKA 4HUJA 3TBHA 4C87A 2ZBGA 1EP1B 3VQTA 3N7UA 1VSUA 3KE8A 1NJGA 4ZVQA 1UWVA 1TRKA 2PUEA 2RB4A 1XZBA 2AFIE 4ZYTA 3DV2A 1HA3A 3KV1A 3SKYA 3DTYA 4OFBA 3SM9A 5LLTA 5B57C 3GCGA 3AUUA 5D1NA 4HDNA 3QXHA 3OTIA 2UVQA 1RWMA 4HKTA 1XLVA 4C2BA 4MARA 5LBTA 2CNWD 5DGCA 4FILA 1JPUA 2X0IA 4A91A 3KUUA 1KDRA 3I9V6 5FWYA 1DAOA 2PH5A 3NXKA 4PC7A 3DD1A 3EMBA 3HDVA 2IBMA 2O48X 3F6SA 4NU5A 4M1EA 4QUIA 4LHWA 2LXNA 5HOEA 3JVVA 3DM9B 4AJHA 4RDHA 4D4LA 1XCJA 2NXJA 3KR9A 1HDZA 1S02A 3BG5A 4RXUA 1WPXA 5EQTA 2PNJA 1EZZA 3OLZA 5CLHA 4HVLA 3L84A 3RU9A 4KQ6A 1RRVA 3L7YA 1YS1X 2ODQA 4B6JA 5GTDA 4DILA 3ZXUB 3DOJA 3F5QA 3ASVA 1NLZA 3HXQA 5LCXA 5KYGA 1NBMD 4KGZA 4LCJA 3R8CA 3GGOA 1X15A 1XQ9A 5E3JA 1EESA 1BX0A 3OIYA 3G89A 1YR3A 3TL3A 3KHSA 3D4BA 5HRCA 1U0EA 1V8DA 2QP4A 1VE7A 3NAQA 4Y2XA 3EGXB 4G23A 2MOKA 1DWPA 2GQ0A 2O4UX 4J2TA 3LDAA 5A5GA 3C3CA 4FW8A 2BZSA 5FJJA 5YASA 4BGUA 2X5XA 3BE5A 3DOOA 2TRSB 4R1TA 4G1BA 3TOVA 4DUYB 3WL3A 3O7WA 3FCSB 2RJNA 3THXA 4KXXA 5IKMA 4COKA 4F46A 3TOXA 3T5DA 3UMFA 3L0YA 4BXOA 1SXJD 2JGEA 2FSSA