4CL8A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
251
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 92
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cl8A00
4FJ1A 3SXPA 3BMCA 3FWZA 4ZRNA 1X1EA 4MVJG 5I7VA 3I9JA 1E1LA 3O26A 4J1QA 1OZAA 1E6UA 4XYEA 1D7OA 3AJRA 3WYEA 2X22A 4BO9A 3ITDA 4ESOA 1ADCA 1LEHA 2ZKLA 5H82A 4AVYA 1IHXA 4ZHSA 5A06A 4H3VA 2YV3A 3GRPA 9LDBA 2Y93A 4QUKA 2DPGA 2EJVA 2NTJA 4R51A 1EUDA 1L7DA 4LRSB 5AVOA 5J23A 1E3SA 4BNTA 4EUEA 1YB1A 3NV9A 5I7FA 2DTDA 2ZYGA 3AUSA 4KUHA 4BOYA 1NWCA 1J4AA 4RVFA 1X7GA 1ZK2A 1PZGA 4L8VA 5JCJA 5A3VA 1PL8A 3D3WA 3BMOB 4NU5A 5ER6A 2AE1A 3QQPA 4DPMA 4E2YA 4S3MA 5KNLA 3CMCO 1VLLA 1T2CA 3EK2A 2EKQA 5BNIA 3ADOA 4Y6SA 3G49A 4J49A 4U0KA 5K0ZA 4FC6A 2FWMX 2QZZA 3DHNA 3FR8A 3GGOA 4RL6A 2QQ5A 1CRWG 4BUCA 1PJ3A 2X0NA 1AUPA 2R00A 3UF0A 1ML3A 4W7IA 4H15A 1AXGA 1GYQA 5I8ZA 3HN7A 3VPSA 8LDHA 1D4FA 2DQ4A 1UR5A 4G2NA 2FMUA 1N9GA 5H83A 2NM0A 3C8MA 2E6UX 2FRDA 5KOIA 1MXFA 3E9NA 5DCUA 2XPCA 2O3JA 1DIRA 2VCYA 3DBLA 3NRCA 4CMEA 4ZRMA 5EMHA 1PWZA 1K5HA 5T64A 1HTBA 4DPLA 3GMSA 5L51A 3C7CB 3RUEA 4ND5A 2RAFA 1RM5A 4K1LA 1XIVA 3U49A 1KYQA 2QRLA 2P9EA 2WYWA 3OMLA 3RWBA 4RLHA 1LSSA 2CNBA 3H8VA 3L4SO 4FFOA 4YEDA 4UVHA 4LVCA 3I9MA 2HMUA 1YS4A 4JXKA 3GGPA 4GMFA 3FHLA 3QVWA 4Y67A 4DIFA 4GX1A 3TN7A 3K92A 3E1KA 3PEFA 1O95A 4GX0A 3HE3A 1JQBA 3WJAA 4CM3A 3B6ZA 3VHRA 1FK8A 3ONEA 4LCEA 4O0LA 3M2TA 4RF5A 2ZYDA 1GD1O 5AXAA 1SBYA 1H6BA 4CR8A 5BSHA 1C3VA 3AFMA 3D0OA 2Y0EA 3KXDA 4GX2A 3U5TA 5BR7A 1QRRA 5TRTA 1ZK3A 2Y1GA 2QZ9A 2JD0A 1UXIA 3S2EA 4AG3A 3DTTA 1HDCA 2DKNA 4KTTE 5TIIA 1MFZA 2C7VA 1ZXBA 1DC4A 4NH4A 1R15A 1MA0A 1I3KA 2HMVA 1QV6A 1JN0A 2EEZA 2IRWA 4IUYA 2FPPA 5JY6A 5EQDA 1WZEA 4JBGA 1I32A 4CM8A 4A2CA 3E5RA 2QYTA 2CZCA 3H2ZA 3RKRA 3NDRA 1ZFNA 4CMJA 4XRGA 5F1KA 3G3EA 3NEPX 3PLRA 3X2FA 1BVRA 1NHWA 1QLHA 1B8PA 1I01A 4Z6KA 3JQBA 1DAOA 3K30A 4PIVA 3UAGA 3UCFA 3I23A 4CM1A 1B2LA 3I52A 3W8FA 1H94A 3AFNA 5KJ1A 4M86A 1KC1A 1KC3A 5MGBA 1QYCA 2CDBA 4GGPA 2CF5A 4NFYA 3SLGA 3ST7A 5IG2A 4WLVA 1KS9A 1YVEI 3I3OA 4EI2A 1Y9EA 5JAMA 1IY8A 1E3WA 4ZVVA 2P68A 3H65A 5T57A 5THQA 3CH6A 2GNAA 4IGEA 4BNLA 2VWQA 1P44A 2ZQYA 3OIGA 4MP3A 3D1LA 4ZQHA 3PHJA 2Q49A 2IYPA 4MVJA 1QV7A 5FYDA 1YJQA 3LSYA 1I10A 4RLSA 4A10A 2EF1A 2V6BA 4GGOA 3V5NA 2HAEA 1ZUD1 3SEFA 4LSMA 4CM6A 1E7SA 4HX5A 1ULSA 1HE2A 1ZZEA 3GN2A 1QXSA 2X5KO 1UAGA 3C85A 1ISGA 2D1YA 5A04A 1QR6A 2G76A 1P0FA 1HE4A 3AM3A 4OKNA 5AXCA 4P8RA 2VRCD 3HN2A 4IZIA 3GOHA 1D8AA 4RZIA 4Y8VA 2GYYA 1P1FA 2YHIB 3DHYA 5CEFA 3JQFC 5LDGA 2R00C 3ZHXA 4IS2A 3TPCA 1KVRA 1HSOA 3UCXA 3C1AA 1TVEA 4N18A 3UH1A 5B12A 4WNIA 3ZNNA 4H7PA 4YACA 1B8VA 2ZTUA 2J3IA 1SC6A 3RFVA 1M76A 2HRZA 1Z74A 3QVOA 1DSSG 5JDIC 2DC1A 3QWFA 3WIEA 1OOEA 1HYGA 5ENDA 3T7EA 2V6GA 1TB4A 4ZA2A 3W8EA 3JYOA 4TRJA 1XSEA 4HBGA 3H3FA 1V9LA 1B14A 2OBNA 3M1AA 1HL3A 2Q1SA 2VUUA 2ZB4A 2LDBA 2NACA 2HK9A 4E31A 2E82A 1TLTA 1WVGA 3TFOA 2I5PO 4MOWA 4J4BA 4CV2A 3OFSA 4BB5A 4IDBA 4MIEA 1NQOA 5CEJA 2NTNA 4MO2A 1PJ2A 3QWBA 3DZHA 3M1LA 4GSLA 1FDSA 4FFMA 4NR0A 5CAEA 3VZRA 1CETA 3QLJA 2QRJA 4QFDA 4UVDA 5F1PA 1F14A 4BO1A 2X0IA 5C3MA 2VT3A 3PK0A 4N5MA 2Y1DA 3A14A 1EK6A 3DZIA 1J0XO 4KZPA 3WYBA 2PH5A 2CSUA 2W98A 2GR9A 4OOFA 3ROMA 4CLDA 1C0IA 2VYVD 1LSJA 2H5LA 1GCUA 1XHLA 3FN4A 2FR8A 4G65A 3PGXA 3AM4A 4ZICA 3GUYA 1C1DB 1ISHA 4YB8A 3U4CA 4YR9A 1DJNA 3TF5A 4W4TA 2X0RA 3FTNA 1UP6A 5HTOA 3GVPA 4B8ZA 4CODB 2YW9A 3DZBA 3R0IA 4E3ZA 3KYDB 4YJFB 4R16A 4CL3A 4GQAA 1OC2A 1GYPA 2GF2A 1R4MB 3N7UA 4FPXA 2H6EA 5TX7A 4L75A 2YV1A 1U1IA 2BFAA 4IJKA 5B1YA 2B37A 4F6LA 1ZKMA 1OFGA 1LNQA 5F1OA 4E0BA 1PJLA 4GBJA 3RCBA 4NJMA 5IZCC 2HQ1A 3KHUA 2Y1EA 2X9GA 4PLGA 3F46A 1A5ZA 2C5EA 3RROA 4D46A 3PHHA 5KJFA 3A4VA 3ZWBA 4ZQGA 2ILTA 1GR0A 2BGKA 2YFHA 4XRRA 3HFGA 3K8ZA 4IMRA 3DBVO 1A4UA 3KM0A 3IOYA 2YV2A 4M87A 1VRWA 2O23A 2WD7B 4II3A 4R54A 1YOVA 3PQFA 4YJHB 1LSOA 2YZ7A 2E48A 3S55A 4N54A 4IDFA 3LQFA 1Y8RA 2A94A 3F5SA 5TSDA 3BZUA 1I33A 3S8MA 3RUDA 2Q99A 3KYCB 4PVCA 1HYHA 2JAHA 2LDXA 4U6SA 3JQ9C 3KETA 2GN9A 2O2SA 4PG6A 3HDJA 2D5CA 4D3DA 3DMYA 5COQA 1NVGA 1DC3A 1RJWA 2D5AA 1FMCA 1V3VA 2E49A 3JYPA 3KSDO 3BTOA 5ENVA 2WEKA 4GMGA 5HRUA 1DOHA 2PGJA 1GTMA 1MLDA 1NX6A 3P5SA 4CMBA 3GZNA 2VWPA 4M49A 3H9GA 4R4JA 3PYMA 5JXWA 1ZH8A 1O5IA 2B69A 4E13A 2SCUA 3DBRA 5DNAA 5LCXA 3TZCA 4NBUA 4URFA 3AM5A 3VAZA 4YQZA 2GO1A 5DOZA 3JQAB 1I3LA 2PK3A 1DHTA 2C20A 4UUOA 4JBIA 4CM4A 1V35A 4CMGA 2H1SA 3QJ5A 1SCUA 1YJ8A 2G17A 2EV9A 4D0RA 3L9WA 4J16A 3PVZA 1T2AA 3LF2A 3MEQA 1LLUA 1W6UA 1NP3A 2PLAA 4DREA 2D3TA 1IZ0A 3L4BC 3NTOA 5EN4A 1XU9A 3JD0A 3R6DA 5JYDA 2HSDA 4IMPA 2BD0A 2AMFA 2EP7A 3DL2A 4WNCA 1B26A 1UDBA 2EG9A 4IDAA 4IDGA 1N5DA 4UVIA 3GHHA 1NAIA 4W9NA 3F47A 3LC1O 5L4SA 3RBVA 2J3JA 3E8XA 1KEUA 3TOXA 5DCYA 1GPDG 2YQ4A 1K89A 1YO6A 4Y9DA 2I3GA 3ZNPA 1U8XX 2WJPA 4JBHA 4BGVA 2HK7A 3Q2IA 1TEHA 4I9NA 1OAAA 4MDHA 4DC1A 4ZQEA 1T24A 3AUAA 2BFPA 4Q3AA 1KEVA 3Q3CA 2GSDA 4J6FA 3VPHA 2J5QA 4YT4A 1ZJYA 1JTVA 4CQLA 3JQAD 4R1TA 3PLNA 4BO6A 1YWGO 1AXEA 2BGMA 1KVUA 4QO8A 1C0PA 1JWAB 3IDSA 3OBBA 2PD3A 4TKMA 3Q11A 4BKQA 1U5AA 5F3RA 1I8TA 1SPXA 2YUTA 4QXMA 2W2LD 4QSMA 2GCGA 2WYUA 1K3TA 3R1IA 1Z45A 2YDYA 3JQDA 3K9QO 4YRAA 2JFFA 1B15A 4L4XA 2VQ3A 1PIWA 2PWZA 1ONOA 3JQ7B 4LISA 2NLOA 3I5MA 4U6QA 2R6JA 1ZCJA 5CDSA 2ZQZA 3BHIA 1AE1A 4KQWA 2P4HX 1DDOA 1X0XA 3EAGA 5TS3A 4PZCA 4YBZA 5K6AC 4Z3KA 5JDCC 5ITVA 3UOGA 5L45A 2W8ZA 4J7XA 3W6ZA 1TI7A 2CVZA 3TRIA 1E5QA 4A7PA 1PGQA 1E7QA 2I65A 1DRUA 4I9HA 4XGKA 5JY1A 1IULA 4AJPA 2FPGA 2RIRA 5K9ZA 3QRWA 5JAIA 3FBTA 3BYZA 4OKIA 4ID9A 3U0BA 4R1SA 4IQ8A 1E77A 4AICA 3LF1A 1SEVA 2J3KA 4JIGA 1W0CA 3KSZO 1EQUA 3L6OO 5DBFA 5A9SB 4JJGA 4M89A 2J5RA 4P4NA 2PZLA 3BTSA 1TT5B 3BIOA 4O63O 3BA1A 4BNWA 3NT4A 4AJLA 4P38A 4WCFC 4RVUA 5TNXA 4WCFB 3GNTA 3QWHA 4RVHA 3V2GA 4UUMA 1PQWA 5AQ1A 4XGIA 4IS3A 3ZWYA 4I5GA 4JK3A 5MDHA 2WTBA 4DYDA 4QO7A 1SB9A 4IXTA 4AJ2A 4CLEA 2Y67A 3IIEA 2DM6A 1K6IA 3UKOA 4AJIA 3K5PA 4JCOA 4BL5A 3LC2O 3GDFA 4I5DA 3ZI0A 1I36A 2GD1O 3PIIA 1DB3A 1DXYA 4XJTA 2BHLA 2W2KB 3JD4A 3CXRA 4UVEA 3WYCA 1NVMB 3GFGA 2NVUB 3GEGA 2PY6A 5T8KA 2WD8A 2JKVA 3FRJA 2EW8A 5TF4A 3IKTA 3WGHA 4W99A 2WDZA 2I67A 4CLOB 5JC8A 5JYEA 2JJYA 2HKIA 4RVSA 3GG2A 1MC5A 4HFJA 1BW9A 2ZJ1A 3B1KA 4BKUA 5COBA 3AOEA 3MJ4A 1U9JA 4MP6A 3ZWPA 2ZB8A 4CMHA 4FW8A 4M55A 3L77A 3VTFA 3RC9A 1PQPA 1Q7GA 1YB5A 3GEDA 1IB6A 1WW8A 4I9UA 5DZSA 1YL7A 2I3AA 3V2UA 4BGIA 4MVJH 4IDDA 1U3UA 4PGFA 4TWRA 1LQUA 3V1YA 1CIVA 1V8BA 4XYMA 4NFSA 5T5QA 1K0UA 3W4KA 3IL2A 1NR7A 3C7AA 2UV8A 3GNSA 2OMEA 2O2YA 1C1XB 4OIMA 2IDZA 3BTUA 1F06A 3IUSA 3BMQA 1JAXA 1IL0A 4J4HA 4CQMB 4DLBA 3ROPA 3WNQA 1NQAO 4WOJA 4DBVO 3OJLA 3RBZA 3ZN2A 4BGUA 3STHA 2JFGA 4DC0A 1EUZA 1A72A 4PLYA 4Z9FA 2NWQA 1JDJA 5IZ4A 1R4NB 1PEDA 3GK3A 1DC5A 1BXZA 4PCVA 3W8DA 2DUWA 3WDSA 1A7AA 1PU2A 1GQQA 1DIHA 2ZTLA 4YCAA 5JBIA 1QG6A 2Q46A 2Q1TA 2C07A 2EXXA 5C7LO 3WGZA 3I6IA 3W4IA 3QVXA 3IP3A 3NJ8A 4LVUA 2AEJA 3Q6IA 3B1JA 3JV7A 1LSUA 4FJ2A 1DC6A 4FB5A 2X5JO 3ZZNA 1OMOA 1P1KA 9LDTA 1I3MA 1I5RA 2NU6A 2RBEA 4J2OA 3QW2A 1I0ZA 3NDIA 1H2HA 2HDHA 3PDJA 2B5WA 2D4AA 4AJ4A 3ZWMA 4YDRA 4CQMD 1KERA 4AJHA 4CLRB 3TQHA 3TL2A 3ENNA 4GL4A 5FFFA 5JNLA 5HM8A 2VOEA 3GH3A 4LN1A 4AJJA 2AHRA 1I2BA 1M2WA 3AI2A 3H5NA 5C5IA 1EMDA 5C37A 2UVDA 1V6AA 4FFRA 1EE9A 2NNLD 2I6TA 2B4TO 3AY3A 3OICA 1OBFO 3AY6A 2VNAA 4Q9NA 1WNTA 2JCXA 2VTEA 1L7EA 3OM9A 4DMLA 4KTVE 4BNMA 4OSOA 2PV7A 1QYWA 3UW3A 1R37A 1B0AA 4R01A 1NPYA 2YDXA 3QP9A 3RBXA 3ADPA 2NQ8A 1BMDA 3PFWO 4TROA 3PPIA 1GEGA 4E30A 5JLAA 2GUGA 4KUEA 1YE3A 3B20A 4PLFA 2BFMA 5CPFA 4LW8A 3TZQA 4YAIA 1Y1PA 3PP8A 4BO5A 1NFRA 2FOIA 2GRAA 3QVTA 1Z7EA 5A03A 3RJ5A 1GUFA 2Q1WA 1Y6JA 5CDUA 1P1RA 2C2XA 4R5HA 1QP8A 3I9KA 5IN5A 4N7RA 3EW7A 3C24A 1KVQA 4L73A 1JU9A 4Q3BA 5JPIA 3GY0A 1P1IA 1QYXA 4FFPA 4EUFA 5G0SA 1UZMA 2JD2A 4E32A 1T25A 4BNFA 2C29D 1HDRA 2AQ8A 3Q0EA 4YJGA 2ZB3A 3GC6A 2B83A 2E4AA 3P7MA 4PG7A 2Y66A 4D0SA 3UFXA 1BG6A 1H6AA 1DIAA 4A73A 4A0SA 2YHIA 4K28A 4DLLA 1U8FO 2VT2A 3OJOA 4TMFA 3MTGA 4NBVA 3DMTC 1HZJA 6LDHA 1C0KA 2I99A 3INTA 3ZWNA 4PG8A 3OHSX 4GKVA 2EP5A 3D4OA 7ADHA 2X9NA 4UAGA 3WICA 2Q4EA 3WR5A 3DOOA 1YONA 5KKCA 4AJNA 3KLMX 3QVSA 1N2SA 3O8QB 1I3NA 3AI1A 1ISFA 1H2BA 2Q2WA 3NT2A 3ETGA 3Q9NA 1ZBQA 2GN6A 4F45A 5HS4A 4R9RA 5KVVA 4PLWA 3CE6A 4DA9A 1DRWA 2DTEA 4RPJA 3O38A 2G5CA 3NYWA 3CPSA 3Q9UA 1LQTA 3DXFA 4NJOA 3GGGA 1SB8A 3IJPA 2AE2A 3B70A 2EW2A 4ALMA 2ZJ0A 3WTCA 1HEUA 1T4DA 2IXAA 4YA6A 1NHGA 1ZK1A 3W6UA 1P31A 2Q3EA 4WLEA 1GU7A 4B3JA 2IZ0A 4HNHA 5I9NA 4XQ9A 3WQRA 1V3UA 1GL3A 4BNIA 2O48X 3GLQA 4R5MA 4HXYA 4ZJUA 1Y5RA 1P1JA 4CM9A 2PKQO 2X1HA 4OYRA 4WCDA 3TJRA 1YL5A 1SO8A 4II2A 1DPGA 3DBHA 2IODA 5DBIA 2ZCUA 2BF7A 3I4FA 1C1DA 3B1FA 3PHIA 4C4OA 4XWYA 1A71A 4ALNA 3LT0A 4W6ZA 4P4LA 5FF9A 4TVBA 5T67A 1LDMA 5KIAA 3KB6A 4FJ0A 5IXYA 1X13A 5EESA 3U3XA 4MPDA 4Z9YA 5HS6A 2HLPA 3HB5X 3NDJA 5A9TA 3O03A 4Q39A 4K6FA 1M6HA 3WOHA 4NIMA 1SNYA 4ALLA 1P3DA 5BT9A 3VKVA 4B4OA 4ND4A 3WWZA 5JMWA 3OIFA 1R66A 3ZWOA 1EDOA 1KEPA 2GLXA 4L9RA 1V3TA 4BNXA 2VHVA 4XX0A 1E1MA 3A1NA 1F12A 2IEDA 4ROSA 3PRJA 1KOLA 1WMAA 2Y68A 5FI3A 5JS6A 1JW9B 2WD7A 3D3WB 3H2SA 3NUGA 4OL9A 2YY7A 5DDIP 1OI7A 2X6TA 3ASVA 4CLHA 4J7CA 1XQ6A 4XJSA 4L0QA 5ICSA 1X7DA 1ZW1A 1GY8A 3T7CA 4B7XA 1MC4A 2IZZA 1O0SA 3NTRA 2X4GA 3RU7A 4IM7A 3MCVA 4B79A 3UHAA 3IJRA 1EQ2A 4RPGA 4O59O 3MJCA 1ISIA 1MGOA 2J8ZA 4DQVA 1NR1A 4XEHA 5G4KA 3JQ8A 3GDOA 3OECA 1EE2A 3U4IA 3TSCA 3HFSA 1E92A 1GZ3A 1BXKA 2O7SA 2VZ0A 5L7WA 5AXDA 1ENYA 4CMEC 5HBRA 4BNZA 4FFNA 4EITA 4XB1A 4HFNA 1Y81A 1YDEA 4TSKA 2OHXA 4YAKA 4NG5A 2C59A 3LYLA 4FC7A 1A27A 3NT5A 2OL4A 4QECA 3V2HA 1XYGA 5JCJD 1WWKA 3KO8A 3RSHA 4R69A 2BH9A 4JQCA 4FFLA 3BXXA 3E18A 2DBZA 4J2HA 3FNHA 4NK4A 3HADA 1ARZA 4K9DA 1VJ0A 2UAGA 4YVFA 4DIOA 3AU8A 4WPGA 1GFSA 1PWXA 3DZKA 3QWAA 1GCOA 4E5MA 3MJEA 2RHRA 1PGPA 5JAQA 1HSZA 3FNGA 3ZU2A 1UJMA 3TFQA 4D43A 1LDNA 4NQZA 5I9MA 4J4TA 1X0VA 1Y5MA 3ASUA 3OA2A 1EDZA 1ZNQO 3I4CA 1T4BA 3GVCA 2BMAA 1NASA 3RUIA 5THKA 1GUYA 1FXSA 1NYTA 2X8LA 3WJ7A 3RD5A 1VI2A 4RVDA 4D41A 1LU9A 4IINA 2P4QA 4R41A 1HF3A 3ZDFA 4BMVA 2NU7A 3EY4A 1N92A 2I66A 5H81A 3RVDA 4CM8B 3GZ4A 1M6WA 4PZEA 3WS7A 5I7SA 4ND2A 3RI3A 4XDZA 5GMOA 3ZCXA 2NTVA 3E5MA 3PI7A 3LT4A 1BXGA 2QHXA 1QORA 3D64A 3JQBC 1T1SA 4BO2A 2PR2A 3UN1A 3EUWA 3C1TA 3I6QA 2DBVO 5KKAA 2EKPA 3HHPA 1WXDA 1KEWA 4IJUA 4Y98A 3L6EA 2CD9A 4HADA 4CR7A 4BKRA 1UXGA 5KJCA 5JCXA 3CZRA 3DB2A 3ZV5A 4NBTA 2DLDA 5IAAA 4YJDA 2B36A 2BI7A 3MJVA 5G4LA 1JKIA 3I83A 3DAPA 3WX0A 3GAFA 5TC4A 1FDTA 5EIOA 3NTQA 4UULA 1R16A 2WSBA 1ZK4A 3JTMA 5BNFA 2CY0A 2QYSA 1AGNA 3WIDA 2DFVA 3ZHYA 1IPEA 4KWHA 1H93A 4B4WA 1ADFA 1NNUA 3EMKA 4IBOA 1LLDA 3FNEA 3G17A 4CMIA 3BHMA 4LSWA 1FDWA 3ABIA 1B16A 4ALKA 3GUCA 1CWUA 3S2IA 1IUKA 3E48A 5A9SA 5JE8A 3GHYA 2QIOA 4CMKA 4WK6A 4IDCA 4EUHA 1YBVA 1TT5A 3OSUA 1ZEJA 2X9VA 4FN4A 4OJNA 5KJEA 4E5KA 1E7YA 1LLQA 3QIVA 1GADO 3NKLA 2VN8A 4J7UA 4PVDA 3E03A 2VYND 3ORFA 4DBZA 3GVHA 1C14A 1R0LA 4GI2A 3H9JA 4BS9A 3PJDA 4PRKA 3RASA 3AOGA 3ROKA 2TMGA 3L0DA 4IGFA 2PTGA 3E9MA 4Y6PA 4I08A 1ZMTA 2NU9A 1Z6ZA 4BNHA 2PNFA 1J6UA 4MVJD 1WPQA 1S7CA 4RO0A 3ETEA 3WSVA 2Y99A 1A4IA 1YXMA 1RM0A 1PJSA 2AG5A 5IDYA 2FSSA 4DPKA 1WZIA 1UDCA 2YHUA 4ALJA 5AOVA 5CDYA 1Z73A 4M1QA 3TZKA 4TKLA 3VVBA 5TT0A 1X15A 1VL8A 3LC7O 4A5OA 5A05A 3C3XA 1B3RA 1IPFA 4BQPA 1LA2A 2EIHA 2HJSA 2OORA 3KEOA 2O3RA 4ILKA 1H0KA 3H9UA 1Q7CA 3EGOA 5C7IO 5GZ6A 5A9RA 4L74A 1UXKA 1HDXA 2BI8A 1WLYA 4EEZA 3VH4A 4MIYA 1JVBA 4UVGA 5I8WA 3RUFA 1YBMA 4NDNE 4RF4A 1NFFA 1QKIA 1XKQA 4D44A 4JLWA 1HKUA 1UXJA 2Q50A 4KWIA 2VRBA 5G2OA 2XXBA 1DHRA 3IQDB 3PJGA 3VH1A 1U2GA 1EVZA 3F3SA 3K31A 4BNUA 3ANMA 4YPOA 1LUAA 2XAAA 4JP3A 1ZXLA 2PD4A 4E33A 4WLFA 2B4RO 1H6DA 5TT1A 3WB9A 1M66A 1LRLA 5G0UA 1XELA 3KOUA 1HWYA 5JW6A 2NU8A 2AQHA 3E82A 1ZEMA 2QRKA 4NJMB 1JVSA 1CYDA 5TJ9A 3H3JA 1PTJA 2RH4A 3VZQA 1ENOA 4IJWA 2FHSA 2CFCA 4JN6B 2IE0A 3DEYX 2JCYA 1R4NA 3LLVA 3DZJA 1ULUA 3PHGA 1R6DA 2UYYA 4DTIA 1VKOA 4R1UA 2HUNA 4FOOA 3N74A 4KDFA 5EINA 3ZWVA 3ZWAA 4EW6A 1NTOA 3EVTA 1RKXA 1EBFA 4CM7A 4MVJI 1I30A 1YOVB 3FWNA 4OOEA 4E21A 2Y05A 2NQTA 3D5QA 4R9SA 4HWKA 4J43A 2PGDA 4AJKA 4XQEA 2VUSA 1GDHA 2O3TA 2D59A 4RPKA 4RZHA 3VH2A 4E4YA 1CQJA 1R12A 1SMKA 1ONNA 3JCZA 1DLIA 3M6IA 3PZBA 5ER9A 4D3FA 2HJRA 3LLSA 4KQXA 2BLLA 2P9CA 4IZHA 2DVMA 4J0EA 4E5NA 2AQIA 4BIIA 2O3SA 1I2CA 4UUPA 1UP7A 4BKPA 2G82A 1IZ9A 4E5PA 5EPOA 1ZO8A 4UUNA 5DP2A 4B3HA 1DLJA 1O8CA 1PJCA 3WBFA 2EJWA 4H16A 1Z82A 4WLUA 4CLRA 1VSVA 1KIFA 1M67A 1MFPA 3KSUA 2X86A 1PJBA 3GZNB 4CLXA 1T1RA 3L6DA 4PLZA 3FD8A 2XF8A 4MKZA 4OQZA 5ES3A 1AN9A 2EERA 1V0JA 4MKRA 4E6PA 4PLVA 4RPHA 1CERA 2ZTMA 4Y6RA 4Z0HO 1ISMA 5KVCA 1DAPA 3IUPA 4LGVA 1HYEA 3ZNOA 4NPCA 5IDXA 4IQ0A 2B4QA 2J5KA 3D3EA 4WOKA 3KRTA 5ITWA 5TLSA 2DPHA 3WGGA 1SZJG 3HG7A 1E7RA 1XLTA 3MTJA 1O94A 3WTBA 4DVJA 1J5PA 1WDKA 2D2IA 3VPGA 1T2FA 4QFCA 1UZLA 5AXBA 5HA5A 3LT1A 2ZTVA 5ADHA 1R0SA 3AW9A 4R1NA 3RU9A 4CR6A 2OP0A 2Q1UA 4B3IA 5LDHA 2GN4A 4CUJA 4RVGA 3H5RA 4DQXA 3GRKA 3IC5A 1NPTO 2D0IA 3JQ6A 1H6CA 2VHXA 3HDQA 1P0CA 1HE5A 3LU1A 3PFFA 5DULA 5JSFA 4XYBA 4W9NC 2ZB7A 3BMOA 1BGVA 3VTZA 3I9LA 1WP4A 3ZGYA 1WMBA 3ZU5A 3GMDA 4BNNA 1U4OA 4XQCA 4PFJA 3PIDA 3CKYA 1ADGA 3OF2A 1GZ6A 3IAHA 1G0NA 4J0FA 1F0YA 1XR3A 3HQ4O 1PR9A 2P5YA 1BTOA 4JJIA 4O6VA 1VSUA 2JHGA 1TA4A 1U7TA 3U62A 4BQRA 3K73O 4CQLB 4IPTA 3DQPA 3JQEA 3WGOA 4EZBA 4N5LA 1RM4A 3VZSA 1K6JA 5G0VA 2PD6A 4B4VA 2X5OA 2ET6A 1Y8QB 2O4UX 1VE9A 3RC2A 3MJTA 1LI4A 4BNJA 5A3JA 1GEEA 4XYLA 4YWJA 4MVJM 3WBBA 1MB4A 3VKUA 1JA9A 3DWFA 3RJ9A 4J1TA 4WE3A 3KYBA 5KCZA 5JO9A 3DFUA 5BQFA 2HMSA 1EK5A 3HB4X 3VOSA 4YRBA 3K6JA 1MP0A 3O8QA 3ZV6A 5GZ3A 1NQ5A 4YRDA 1E1NA 4XDYA 2CUKA 3MOGA 4EDFA 3U4DA 3WLFA 5L53A 5A1TA 1T26A 4CUZA 3V1UA 5KWEA 4BKOA 1FF9A 3F6YA 3NGLA 4OO3A 1EBUA 3WQQA 4WUVA 5ICMA 2C82A 2J6IA 4TRRA 2P91A 4R3WA 3RUCA 2GPTA 3GN1A 1GQ2A 4BO8A 3AU9A 3WLEA 3NGXA 2VZ8A 3UVEA 2NVWA 4WEOA 4BV8A 4XQGA 3F1LA 1PSDA 5DP1A 3MWEB 2PA3A 1ISJA 4OMUA 5JFOA 1C0LA 4OGWA 2PFGA 3AY7A 4EJ6A 2F00A 2HMWA 4XIJA 1SAYA 2PKRA 3CTMA 3SC6A 4WECA 3WFIA 4AL4A 5JO0A 2P5UA 2POQX 4L76A 2AEFA 4FD3A 4MKXA 2OO5A 1XQ1A 2F1KA 1HDZA 2C7GA 2OZPA 2VNSA 3JQGB 1O9BA 3AUUA 2VRCA 3GVXA 3M2PA 1E5LA 2ZK7A 2VHWA 1Q0LA 2O50A 2H9IA 3ZWWA 4Z3DA 1ADBA 1ZMOA 3EC7A 3GDGA 1OC4A 2YYYA 1U28A 1Z7BA 3IP1A 1UAYA 5L7TA 1YBAA 4QEDA 1Q0HA 5T8KC 5DT9A 3UXYA 3V1TC 5DN9A 4U0JA 4IIUA 4ZN6A 3OIDA 4EYEA 1Y7TA 4NU6A 4RGBA 4BB6A 4EJMA 4DQUA 3KTDA 1NM5A 3T4XA 3RC1A 2WYVA 3ZW9A 4F6CA 1BW9B 4KUGA 5CEEA 3AOEC 4G81A 1YQGA 4GWKA 3JQCA 3SVTA 4UEKA 3IKVA 1B8UA 4YAGA 5CFZA 4JNKA 1YQDA 3GA0A 4NBRA 4PLPA 5B37A 1ENZA 1LRJA 1N7GA 2YFQA 2JD1A 3DZFA 1PL7A 5G0TA 5JMPA 3WGQA 2NVBA 1PZEA 4CMCA 3OEYA 3RIHA 4EBFA 5BSEA 1QMGA 4GLLA 2PKQP 4WASA 2PZKA 5CP8A 1GYRA 2DBRA 4UREA 2Q2VA 4GVXA 4XZ3A 4BNKA 5KJ6A 4RJTA 4OXKA 1JKFA 5A5EA 2W90A 2CMDA 4AFNA 1DJQA 4OH1A 1E7WA 4DRYA 3U09A 5FI5A 1QYDA 4BO7A 3JQFA 2JAPA 3UCEA 3A28A 3BMQB 4GLOA 1KBZA 2VYVA 1P45A 3DFZA 4YT2A 1GPJA 2I9PA 5KVQA 4J1NA 4UEJA 3RFXA 4F46A 2VUTA 1L1FA 5JDIA 3WSWA 1O6ZA 4Z0TA 1RYDA 4MVJF 5DF1A 2FY8A 1ZVMA 1KVSA 1NWHA 1F8FA 1LX6A 1ORRA 4I8XA 1IHYA 1GZ4A 2GZ2A 4J1SA 3DO5A 2Q45A 3FF4A 1JLLA 3KZVA 4A27A 2E37A 2AEMA 4MJLA 1Q0QA 1X1TA 3C1OA 3F4LA 1E3JA 4X54A 4TZKA 3WGYA 1T2EA 1UXHA 3MOIA 2DUUA 1N8KA 2W4QA 1E0DA 3P19A 5L9AA 3V8BA 1DFGA 3INGA 3SX2A 3DAFA 5IF3A 3WGTA 2X23A 1NXQA 5EQFA 1ID1A 2OOSA 3TDKA 3UGKA 3LVFO 4ND3A 3ZWXA 3I9NA 3VVCA 1MV8A 1G0OA 3DOCA 4IY1A 1TT7A 1XEAA 3SJUA 2FZEA 1TXGA 1U5CA 1HDYA 5TGDA 2GZ3A 5U9CA 3D5TA 4LK3A 4U5QA 3ULKA 3BMNB 1E3IA 4F3YA 2OXIA 1RYEA 1E3LA 1EUCA 3EHEA 5F5NA 2GDZA 4BMSA 4PG4A 1W4ZA 4ONEA 1EFLA 3KYDA 4NMHA 4YJFA 3BMCB 3ETDA 5IXSA 4NHEA 1PZHA 1R4MA 3DDNA 4DYVA 3MWDB 5I7EA 4MVJE 2WE8A 1PS8A 3PWKA 1ZIDA 2HRBA 1LLCA 1HRDA 2XXJA 4HKTA 4PLHA 4CV3A 1BDBA 4E2ZA 1XCBA 5IZCA 2A4KA 2VOJA 3I1JA 4CM5A 1XWFA 1MG5A 3S2FA 3EDMA 1HETA 1LDGA 3WMXA 5BSGA 1WDLA 4B7CA 4OXNA 2OBYA 1DIBA 1J49A 1RM3A 1MUUA 1NQTA 2HU2A 4XYGA 4R3NA 2CVOA 1BSVA 1SEPA 1YKFA 1LDEA 4BO0A 3H9EO 4BMNA 1ZSNA 1DO8A 3K96A 4CUKA 2VYNA 4U8GA 1ZK0A 1X14A 1F17A 4YQYA 1PS9A 4HFRA 1H9AA 5TJHA 3JYNA 4YJHA 1PQUA 2Q2QA 3F9IA 4BO4A 1F8GA 4DWVA 3OA0A 2FPIA 1HLDA 2FR1A 3C7DB 4S1VA 3KYCA 5CDGA 4I5FA 4K26A 4FOSA 4O5OA 3FTPA 4R68A 3RC7A 2HMTA 3JQ9A 5U1PA 2GASA 2Z5LA 5C7OO 3QA9A 3K2BA 3GFBA 4FDAA 2ZATA 2EKLA 2O3QA 2OFPA 5L3ZA 4BV9A 2Y1FA 2DFDA 4D45A 4BNGA 1N9GB 2JCVA 1A7KA 4IIVA 1D1TA 1YH3A 2UUPA 2V6MA 2RHCA 3SBOA 4ITUA 2VHZA 4YJGB 1CDOA 1EZ4A 3E9QA 3DHEA 4MVJP 3DBLB 3JD3A 2V6FA 1KVTA 3PWZA 2Y0DA 1HT0A 3RKUA 5IDWA 3COSA 3WQSB 2WM3A 4Q3CA 3H6KA 2GERA 4RV9A 4Q3NA 3RUHA 4ALIA 4NZ9A 1T2DA 3JQAA 3PYXA 1BVUA 2FSVA 5FEUA 3PHLA 5L4LA 3QWIA 3GPIA 1ZSYA 3NJ4A 3F1KA 3TZ6A 5JC1A 1IYZA 3PYLA 1LJ8A 1U3TA 1PS0A 4RDHA 1ENPA 1PX0A 1EFKA 2VHYA 3GR6A 3TWOA 3GPDG 2EHDA 4C7KA 1KY4A 2W2LA 1IOLA 4D79A 3L4BA 3ZHZA 2Y1OA 4PLCA 3O4RA 2DBQA 3G1UA 4XD2A 2B0JA 4I5EA 4BO3A 1Y9AA 3CIFA 3OH8A 4PZDA 3PTZA 4D7AA 3KUXA 3PQDA 2C5AA 1BRMA 4FGWA 5T6BA 1BWSA 4RPLA 1G6KA 2AA3A 3CZMA 3JYQA 1UUFA 4FBGA 1HZZA 4YAEA 1N1EA 4KOAA 4B7UA 1YRLA 4BNYA 5I9LA 5AYVA 2AG8A 4IQGA 1RWBA 4GPD1 3DAGA 1DFHA 3ITKA 4ZU3A 3H9QA 3CUKA 4LMPA 1GUZA 4E2XA 1EEHA 4GSKA 2GGSA 1SOVA 2ZIZA 2A9FA 1PL6A 1R0KA 2TMDA 3DBHB 2WE7A 1UP4A 2EGHA 2QW8A 2UUOA 4FGSA 3WG9A 1PJQA 4JJFA 3FPLA 3H7AA 5B4UA 2X58A 2YJZA 3PWSA 4GKBA 2A92A 2VWGA 3GT0A 3HUDA 3ONDA 2AXQA 1GAEO 1VM6A 4FCCA 4M8SA 5CPBA 1W73A 3X2EA 3ZWCA 2ZYAA 4HY3A 3GG9A 1E3WB 1RPNA 3JQ7A 3CEAA 1BHSA 1DBVO 3P2YA 1HXHA 1ZSVA 5F21A 2OGUA 1P74A 1VC2A 5K6AA 4OM8A 5JDCA 4J90A 1AHHA 5DBGA 1HLPA 3EZYA 4M54A 3CINA 1E6WA 1U4SA 1FDVA 5L95A 2O7QA 1LBEA 3GNQA 1NAHA 2QX7A 3CMMA 3ICPA 3R3JA 4TRMA 5IDQA 2IYOA 2D8AA 3PDUA 4CM9D 2DTXA 4P22A 3E6AA 3DR3A 1M75A 4BVAA 3ENKA 1FDUA 2GZ1A 2O4CA 3WXBA 3AWDA 2CF6A 4DMMA 3OP4A 4WEQA 2V65A 3SLKA 1LRKA 4Z0PA 2FZWA 1UZNA 3JYLA 1AHIA 3U4HA 5L40A 3FBGA 3FNFA 3VPXA 2JL1A 1QYVA 5EL0A 4NK5A 1KETA 5BNTA 1U3WA 4ZD6A 1EVYA 4KMSA 3D7LA 4EJ0A 5EJ2A 2C2YA 2CDAA 2Z95A 3FSRA 4WCFA 5DCWA 1VJ1A 5BSFA 4PLTA 5G4KB 3JQ8B 4AJOA 2X7HA 4HNGA 4EGFA 4OSPA 1VJTA 4MP8A 1PGNA 4DLAA 1NBOA 2A35A 3ICCA 5EERA 1MXHA 3W1VA 2XOXA 3HDYA 3LT2A 1K6XA 1X7HA 3EYWA 4K6CA 1GV1A 1Q1NA 4E2WA 4O1MA 2W2KA 3Q2KA 4UEOA 4J9VA 1E6EA 1MG0A 2EWMA 5CG1A 2NVUA 5LC1A 4CV1A 5L4NA 2RCYA 2OP1A 1P9LA 4JROA 4U7WA 1XGKA 1NFQA 2CVQA 2BFOA 1GQYA 3OQ1A 4CLOA 3KVOA 5HWSA 3DC2A 3PGJA 5IN4A 4FQ8A 4RF2A 3OETA 4RORA 3GVIA 3BTVA 3RQSA 4LMRA 2NADA 1E3EA 4Q3DA 5A02A 3R3SA 4J91A 4DXHA 1IE3A 4WLNA 5U4QA 4XB2A 2OUIA 4BHTA 3SC4A 4CPDA 2B5VA 2H63A 4J9UE 4DL9A 3O9ZA 3F4BA 1I24A 4QT0A 2DAPA 3N58A 4Z9XA 1UDAA 3TZHA 1CEQA 4YT5A 3ZV4A 3A06A 4IJVA 2B35A 1WAMA 2G0TA 1LC0A 1QLJA 2DU8A 4JGBA 3SJ7A 3IS3A 1XG5A 3PQEA 3DTYA 4HFMA 4FR5A 4KP7A 2PGLA 1C1XA 4D42A 4PN3A 1DRVA 2X0JA 4NBWA 2G1UA 1LDBA 2JFHA 4XKJA 1JAYA 4RF3A 4CQMA 3QE3A 1P33A 1VL6A 4IXWA 1CQIA 2IXBA 2QG4A 5B4TA 3HDHA 1QSGA 4YYZA 3GF4A 4D3SA 4L4SA 1BXGB 4GVLA 2EGGA 3WFJA 1HDOA 1Y8QA 1YL6A 4DUPA 1H9BA 4HUJA 4P4GA 5ILOA 3HNPA 3RUAA 3S1LA 3F5QA 4GWGA 1HDGO 2FR0A 1NVTA 3FR7A 4MINA 5CG2A 5JAZA 4ZQFA 1EVJA 3OJEA 3OJ0A 3HWRA 4DGSA 3JSAA 3VC7A 1S6YA 4XR4A 2IZ1A 5IJZA 4YTEA 1VPDA 2GN8A 3QSGA 2YQ5A 3KBOA 2HO5A 5GZ1A 1Y8RB 2BGLA 3KEQA 3IMFA 4OXYA 5COAA 3ZU4A 3OJFA 4EEXA 4OAQA 3BAZA 1JKJA 1DIGA 3L9XA 3U9LA 3GAZA 2NUAA 4L4RA 3G0OA 1U7HA 4NNJA 1A9YA 1YDWA 5A4DA 4XCVA 4AJ1A 2PZMA 3WNVA 2JHFA 1UH5A 2ZCVA 3TOZA 3ON5A 2Z1MA 3D4NA 4W82A 4CMIB 2FP4A 4WJZA 3KLPX 3G79A 1HE3A 1LC3A 4A26A 4Q3EA 3RFTA 4DIBA 3D4PA 4JX8A 5DOVA 3TL3A 3DBRB 1CF2O 5FWNA 3ANLA 2P9GA 1KY5A 7MDHA 1YGYA 4TZTA 3VDRA 1FJHA 5B4VA 2Q4BA 2V7PA 4CM4B 3ANNA 3JQGA 3FCOA 2IEBA 2NSDA 1K2WA 5TQVA 1WDMA 2Z1NA 3K2EA 1G1AA 3ROQA 5CDTA 3FI9A 1PR3A 1SOWA 3GEMA 3EZLA 3QHAA 4LRTB 4AJEA 4G5HA 3KV3O 2Y1CA 4TQGA 1P1HA 1JWBB 2HK8A 3GQVA 1XDWA 4QQRA 3VZPA 4B4UA 2VTDA 1A9ZA 3P2OA 3ZH2A 3VDQA 2VZ9A 4XR9A 2RH8A 3JD2A 4RQUA 3Q1LA 4WKGA 2HCTA 1ONPA 4GH5A 4XGNA 2BKAA 2P2SA 3H5AA 1LXCA 1D3AA 1Z75A 4WGGA 2DT5A 3MZ0A 3ZHBA 1YQXA 4YXFA 3PXXA 1PZFA 4LCJA 3OQBA 1O89A 5KTKA 3LDHA 4J3FA 5L7YA 2O3UA 4MIOA 4IDEA 4W7HA 2R2GA 2Y0CA 3G1TA 3I9OA 4CJXA 1VL0A 2UDPA 3VH3A 3HZZA 1MX3A 1PJTA 3EVNA 5ILGA 2C0CA 4RCVA 1DFIA 3ZV3A 1ZJZA 3HSKA 1VKNA 3AI3A 2BELA 4RQTA 4BGEA 4E5YA 3FPCA 8ADHA 3TNLA 3W4JA 5A5FA 4JP2A 3VPFA 3DZGA 1Q7BA 4GX5A 2WWRA 4PG5A 4CV0A 1E7MA 3INRA 3DMTA 3JD1A 3PZRA 2AW5A 4NFHA 4CMAA 1B3BA 4QTZA 3L07A 5G0WA 1LTHR 4N5NA 4HV4A 4QX6A 4CL8A 1N1GA 4YT8A 3PJFA 3DONA 1W8DA 3ZU3A 2J3HA 1D1SA 1PGJA 3OEWA 3QV1A 4FIZA 4YAJA 3WMWA 1U2DA 4I1IA 1B7GO 1PGOA 2PH3A 5GY7A 3UICA 6ADHA 1GV0A 3NX4A 3RAJA 1H5QA 1PJ4A 3A9WA 4PRLA 3BHJA 4B8WA 4OQYA 1LDYA 2CDCA 4A03A 3MJSA 4BNVA 5KVSA 4WLOA 1N7HA 3DOJA 4FS3A 3HJAA 3AK4A 3S2GA 3LK7A 4ZQBA 1DEHA 1E1KA 3UUWA 3LZ6A 4TRNA 3PJEA 1CJCA 4E12A 1YB4A 2BRUA 4XIYA 1XA0A 4ND1A 5IFLA 3AUTA 3ONFA 2AQKA 1NPDA 3T4EA 1P77A 5F5LA 3ZW8A 4NI5A 3OQ6A 2NV6A 4FSHA 4HP8A 3NAQA 3ZNQA 1XU7A 4TVOA 3WGIA 3QY9A 2C54A 1EVIA 3CSDA 3WWYA 4C7JA 4OHUA 2VWHA 1U3VA 4GAEA 3BMNA 4XA8A 4ZGWA 1Q2XA 2FN7A 3H4VA 2PZJA 1BDMA 4INAA 4KDEA 2I76A 5CHEA 2WMDA 4RDIA 1I2ZA
chains in the Genus database with same CATH superfamily
2BHTA 2O59A 3O8BA 5EMJA 3KCQA 3FWZA 3ASYA 3NG1A 5CB4F 1E1LA 3JAKB 4J1QA 1YR9A 1OZAA 5LA6F 1E6UA 4R7TA 5B58T 4PZZA 4KRGA 2BKUA 1BVYF 1D7OA 1VHTA 2HU5A 3E4CA 1RLTA 1L4FA 5F7ZA 2IW1A 3VYWA 3WYEA 4PXYA 5EIWA 4NJEA 1IHXA 1SU4A 1B23P 4H3VA 1GL9B 3DE7X 2Y93A 3UATA 1MTOA 4YYEA 1PD1A 4QUKA 2DPGA 2EJVA 3R76A 3C45A 1EUDA 5K4AA 2DE0X 3WYDA 5C5EA 1E3SA 1RYNA 3RANA 4D4GA 2VO1A 4EUEA 5AESA 4AG5A 3NV9A 4C3ZA 1U1GA 2PHZA 2XYGA 4N49A 5AH0A 4R2HA 5GPBA 4KUHA 4F92B 3C3CA 4BOYA 1JAZA 1NWCA 1U8EA 2J7PA 3QELA 4HMQA 4WA7A 4YRIA 5EJEA 1ZK2A 3N6RA 2JFZA 3G89A 4L8VA 2RKWA 5A3VA 3QFTA 2JVJA 5LBIA 3C70A 3BMOB 1MO6A 5ER6A 4Z49A 3QQPA 4DPMA 4E2YA 1R9GA 1QP4A 1F5NA 4DY4A 5CVTA 1PUIA 1XZHA 1T2CA 3LM8A 3G49A 4J49A 5K0ZA 3S1AA 1IHPA 3A1CA 3KR1A 4Z0NA 3JRXA 2B9VA 3GGOA 4UTNA 2QL5A 1CRWG 5BSUA 2DP4E 1WJGA 3CZ5A 1YTUA 1NC1A 3UF0A 3SQNA 2O8CB 5ETJA 1AXGA 5I8ZA 4QLBA 3HN7A 4ZI7B 1VFPA 1CQPA 2FXIA 2PRJA 2NUTB 2WU1A 4BMZA 1C7QA 3QVMA 4YRQA 1N9GA 2NM0A 2C4HA 3WZLA 5JV5A 2VJBA 3BN3A 1LLFA 5BV0A 2XV1A 3ZE0B 1O94D 1P2GA 4LHXA 4O1IA 4UTPA 3DBLA 3NRCA 3HKDA 4GIBA 3B3AA 3MXOA 4ZRMA 5EMHA 1PWZA 3VZCA 2F17A 1E2BA 3IPLA 4QDJA 4A8JA 1JA0A 2AJ8A 2QRNA 2RSLA 2A14A 4DPLA 5L51A 2NZWA 2J6HA 3DFKA 3I5AA 3NZEA 4PX3A 3RRMA 3U3OA 3A2NA 4L4YA 4XDHA 4A92A 5LZ2A 2MSLA 2P9EA 3RGWS 1E1QA 3QFHA 4GBED 5BRJA 5DLQC 2H0QA 3IAXA 4Y67A 4YI3A 3USES 5ADVA 3DOIA 4HWRA 2WIDA 2XTAA 3CKLA 5K4GA 1OIXA 4MRMB 1NBWB 4TMKA 2RHMA 5AW6A 4GX0A 3PEFA 3GPBA 4UDOA 4WBXC 1JQBA 2P1RA 3MWGA 5AJTA 3WJAA 2A1TS 4BN5A 1DWQA 4I1PA 3MD0A 4D8YA 3Q4GA 1JV2B 4KE6A 5EFZA 2P9TA 2IX9A 1YZUA 2Q6OA 1THGA 3LKDA 3FWPA 3M0EA 3H87A 3D0OA 3U5TA 1E5XA 4R0NA 3KELA 4QLAA 4XWTA 1KO5A 1V39A 3GMIA 1ZK3A 1I9GA 3ISJA 1Z5VA 2WIBA 1BYIA 1US8A 3S2EA 1VCNA 3K9WA 4AG3A 1J1ZA 5DW0A 3CEPB 2CYCA 2DKNA 4KTTE 4MV0A 3JQPA 5K0FA 1IBCA 3EY9A 4YJ2B 1H2FA 1ZXBA 2C7VA 1DC4A 2OM6A 1R15A 2OFXA 4JUDX 3D81A 1Y9JA 1GKUB 1QV6A 3ELBA 1L3BA 4UHJA 4OB8A 2FPPA 1U9IA 1WZEA 4MWGA 3DBIA 3SJZA 1Z5UA 4RENA 3E5RA 4LYJA 2OLEA 2CZCA 2QYTA 3H2ZA 3V00A 5IF9A 2OAQ1 3RKRA 3NDRA 4XRGA 3ZLJA 1T2NA 3FUWA 3HO8A 3R5SA 1R88A 5DWDA 3D7NA 4FMBB 3NEPX 3PLRA 3X2FA 2BEKA 1QLHA 5LOVF 1M2NA 3IUNA 4EG0A 3BZWA 1DAOA 1U63A 4RYLA 4UM9B 2PXAA 3D02A 1L5YA 3VKWA 2VSXA 3U37A 3B52X 3AH8A 5JJIA 1TPYA 2QENA 2VDWA 1HNZB 2WHPB 3HA2A 5KJ1A 4DV2B 2J87A 3UWDA 3ELUA 1KC3A 4R1MA 2PXHA 4N9QA 3IX7A 2CF5A 3A9TA 3ER8A 3NIGB 1JALA 2CNLA 1OX4B 2Y2UA 4WLVA 1NI4B 1GARA 3I3OA 2L2QA 3OOJA 2IBMA 5DBEX 3HM2A 1IY8A 5JAMA 3DJFA 4Z53A 3EGEA 4YECA 3LL7A 3D8RA 3LUBA 2Q1XA 2QTMA 3ACBA 1EP9A 4DZTA 4BNLA 1VE1A 1P44A 2VWQA 5FPTA 1D6NA 3TW4A 1NM5C 2ADFA 1CSEE 3BPSA 10MHA 3EFBA 3BQNB 1YJQA 4Y9SA 3RYTC 2NSLA 5TPZD 3EZNA 7ABPA 1N8NA 3LKVA 4RLSA 1Z0DA 2EF1A 3TRHA 5BRAA 5IUNC 1KYTA 2V6BA 2HAEA 4Z4GA 1XDSA 2JHCA 3AESA 2X1VA 4M1KA 1NYLA 3SEFA 1NATA 3QBVA 1JIQA 1HE2A 1ZZEA 3AF0A 3A7EA 3GN2A 3TE6A 3OIUA 1D1QA 3C85A 4PC1A 2E2WA 4B40A 1N2OA 2FZ4A 1D8TA 4JLPA 2DR3A 4ZTUB 3KTOA 2XMCA 4YRFA 1O54A 4W9RA 3AM3A 4WW0A 3HKCA 2VJMA 4P8RA 1S1CA 4ZT4A 4IZIA 4EGQA 1NU6A 1D8AA 4LQCA 4RZIA 3VV3A 1USUA 2GYYA 2Q3JA 1P1FA 1DX9A 2W2QA 1CZKA 2DEUA 1QCZA 3RH0A 1W36D 4V24A 5DM0A 5B3KA 5KREA 1JFVA 3HJNA 1F48A 1PN3A 1J22A 2OD7A 3PU6A 2OYCA 4UTOA 3W5HA 2HWWA 1M76A 2HRZA 3WGUA 1BIFA 3MGBA 5GGXA 1NDQA 2YASA 2DC1A 2GCIA 2Z2ZA 1VLQA 3PHCA 1RRMA 4E88A 1HYGA 1QIMA 1YIOA 3C4QA 4PIMA 2WI8A 4ZA2A 4DDWA 2B2CA 3JYOA 4TRJA 4UBIA 4ENPA 3F8WA 3H3FA 4HBGA 2UU9B 2C42A 1UMDA 1VE6A 3VDNB 3TE7A 1Q17A 2Q1SA 5DHSA 2BJVA 2NACA 3I8XA 4KWTA 1TLTA 2AFHA 2PBLA 1UIRA 2I5PO 4YUXA 4CV2A 2ORVA 1RXEA 2PX5A 3Q0TA 4MIEA 2ZBGA 5CEJA 2ZDGA 4MO2A 3R7BA 1PJ2A 1ZNZA 3DZHA 3M1LA 1ESEA 4HDSB 4OHRA 1CETA 4KQMA 4QBKA 4ZIRA 1UBUS 3ZJ5A 1E1CA 1L4KA 2IUTA 4UVDA 4EQZA 3SXJA 1BJTA 4LDZA 1I5EA 1R0RE 2G7ZA 1EVLA 1XKTA 1CEXA 3QE0A 2IYXA 2VT3A 1QDEA 3PK0A 7YASA 2XB2A 1Y3IA 3MOSA 4KZPA 3V4PB 3WYBA 1ID8A 2W98A 4R1QA 1JBEA 1QJ4A 4HN9A 1UBOS 5FYQA 3KD2A 1RVV1 2LVBA 1MPXA 3LGAA 2H5LA 4RMIA 4U7TB 4FHGA 4Q9HA 3UW1A 2FR8A 1BQ3A 2I29A 3AM4A 4KMRA 4FKMA 4Q4CA 3AEQA 4YB8A 1YIDA 1DJNA 2VP6A 1UP6A 5HTOA 1A2BA 3GVPA 2W11A 4GL2A 3A6EA 4QM6A 1DBRA 1QRDA 3DZBA 1XMXA 4YJFB 4R16A 2AVDA 3E61A 2RHBA 4N4AA 2H18A 1GYPA 2IDMA 5A0TA 4P5DA 4FPXA 2GDJA 1JG3A 1P7WA 3DKPA 5M04A 2OCXA 3BK7A 1WVMA 1QHNA 1U1IA 2DSTA 4V2UA 4IJKA 4Q4DA 4W1QA 4F6LA 4LXXA 3AR2A 1OFGA 1LNQA 5F1OA 3SHWA 4AYWA 1MB2A 3RCBA 2OAGA 2C77A 4NJMA 2F67A 5IZCC 2HQ1A 3KHUA 3M5CA 1AN0A 4CDGA 5CCEA 4MV8A 4HZUB 3ZBTA 4PLGA 3A9CA 2VPPA 3OCXA 1GZVA 1SD5A 4D46A 2C92A 4DEXA 1Z6XA 4Y2GA 2BGKA 1Y1QA 2XUFA 2Z2XA 2QTZA 2XD4A 4F0JA 4IMRA 3DBVO 4AO7A 4BFSA 1T3ZA 1A4UA 2IDKA 3VU3A 2YIMA 4P7KA 2NMVA 1EWTA 2R8EA 4YMHA 2GESA 2XKKA 5B1IA 3TXYA 3IAM1 4B3CA 4K6KA 4UD2A 3S55A 5HQJA 2A94A 2P2YA 3D8HA 4PYNA 2XNDD 1H2WA 4ESVA 4CZ2A 4I7EA 4W5WA 2Q99A 3V8RA 1BWPA 2WAMA 4GE3A 4FGJA 4NU0A 4FONA 4BLVA 2D2XA 2JAHA 5HFAA 2AR9A 2O2SA 4PG6A 2HWYA 1CZLA 3HDJA 3NWBA 2RI0A 1K3UB 2Y1LA 3Q7QA 4TL8A 5COQA 3TAHA 5HUHA 4NOLA 2QTAA 1Q1GA 1I4DD 4GR5A 1IK4A 3MJRA 4X0EA 3RT7A 3SYMA 2XCTB 4ETIA 2FRXA 4ME6A 1T3TA 2GRJA 4PTYA 3UQZA 5HRUA 2Q6IA 1V4VA 2E5WA 3EZ2A 3IEPA 5DU2A 1NX6A 3HP4A 1F4VA 2M6RA 4U2EA 4LWPA 2XCLA 3GZNA 4JP1A 4OI2A 3AVOA 4XW2A 2LP4Y 3H9GA 5EY5B 4NEHB 2YWRA 5A3SA 4KJZA 3WLSA 5FULA 1O5IA 2R8BA 4V0KA 1GM5A 4E13A 5LCXA 4Q9LA 1ZWKA 1WSWA 3PB3A 3OFJA 4EI7A 4NBUA 2GJ4A 4JYPA 4E4RA 2FQXA 1MC1A 3B5IA 4O4LF 5F76A 3AVXA 1J2JA 2P2ZA 5DOZA 3FPAA 2W83A 1O0CA 2NP7A 3FF1A 5JVDF 5J3JA 4MA5A 4RPCA 1YJCA 4BLOA 1P7VA 4N82A 3QJ5A 4PO1A 2HJVA 5E2IA 5B3LA 5E1MA 1KORA 2EV9A 4D0RA 1Y7IA 3N2NA 1M34B 3QI7A 1G98A 3ICWA 4NESA 1OILA 2GYVA 3MEQA 4C2BA 4Q34A 2D3TA 1NG1A 3NTOA 5EN4A 3V97A 1R8JA 1XU9A 5K5EA 3TOSA 4DNOA 2JEYA 1E3TA 4IMPA 1ULAA 3DL2A 2C9OA 4ZYZA 3PLAE 1WQ4A 4HEA1 3RABA 2P2CA 1KI3A 3CRW1 3O8OB 4GI5A 1N5DA 3OOWA 4MDFA 1F2DA 3DW1X 3LC1O 2Q5LA 5IBQA 3QPAA 4PTZA 5C31A 4LYAA 3RBVA 5JQGA 3J81A 1ZH6A 5ELMA 5F52A 1KEUA 2BBWA 4JYAB 1Q3TA 1RDFA 5DCYA 1AMUA 1TM5E 1C7FA 1GSOA 2QUZA 2VCHA 3TSAA 3ZNPA 4YRMA 5BQ3A 3W5UA 2F3PA 4W5NA 3UPTA 1XK6A 4IRXA 4WKBA 4M1YA 1MT3A 5BSWA 3WXMA 2OC9A 2HK7A 4YCJA 1FY2A 5IAEA 2Q27A 4HWPA 1E4EA 4I9NA 1OAAA 1BNCA 1T24A 4IEFB 1Y0BA 1CJKC 4YX9A 2BFPA 2OG2A 1C4OA 1K4KA 4Q3AA 3VNRA 2NV2B 5EPEA 2YIDA 4HATA 1UBNA 4JASB 1QVWA 2J5QA 4L78A 5EXEA 4H0CA 1OJ7A 3AV3A 3JQAD 2FFJA 4R1TA 3IB6A 4KL8S 1VZ2A 2FEPA 3QMVA 4K6GA 4BO6A 1W9HA 4IDNA 4LF9B 3P9ZA 2BM0A 2C1EA 2HUPA 3TCXB 1JWAB 3O6VA 1T10A 4TWZA 3VRHA 1LBHA 4ZANA 4NV0A 3WYAA 3Q11A 2QMOA 1U5AA 4OU5A 5F23A 1L4EA 4OGKA 1SPXA 1SCDA 1TCAA 2YUTA 1X7WA 3PXAA 1XD9A 5DYTA 1N33B 3I61A 4KQ6A 3IEMA 2VPQA 5TE9A 1CUZA 4F4UA 2F8TA 1Z45A 2JFFA 4NE2A 1UANA 4ESHA 4L4XA 5E6SA 5JSZA 3P26A 3CF0A 1AURA 1XDUA 3UB2A 1PIWA 1GU0A 3BX1A 4HNSA 5BR1A 1FP4B 4LISA 5B36A 2CNDA 3O2JA 4X6UA 4ZT6A 1VXOA 3T1VA 1A9TA 4GKKB 3RSOA 4OLJA 3W5IA 5TS3A 5JNTA 1A8UA 2EU8A 3GRFA 3A1FA 4IDOA 4MS1A 2OGWA 3UHJA 4Z3KA 1U90A 1PCXA 4I4TF 1S3SA 3MGKA 2QU8A 4YR7A 3C4JA 2Q29A 4X63A 2IELA 2QGNA 3WKBA 5F4ZA 4CKXA 2HEGA 1NVAA 3Q3EA 2ZOSA 5ALTA 2RGUA 3AXTA 1E5QA 4NG4A 3TTYA 4EY6A 4Q7QA 4ZHQF 3GH1A 4RK7A 4A7PA 4O4HF 4A8PA 2WK1A 5EJGA 2W2PA 4I9HA 1T8TA 2FF7A 4XGKA 4BECA 3BICA 4R05A 4AJPA 2C58A 3RSFA 1DUVG 1QQ6A 3QRWA 3U0BA 3X44A 5CVVA 1Z17A 4AU1A 4IQ8A 5J5AA 4AICA 1IJBA 2VUIB 4RA9A 5HX7A 4RTMA 3ESDA 3FSEA 1W0CA 3HVKA 2NX2A 1GU1A 3MBOA 5A9SB 4CTNA 3Q40A 3D2CA 4KMOA 4DS3A 1VBKA 3RTCA 2PZLA 2CHQA 2QUKA 3BTSA 3GARA 5HNKA 1NQUA 2JCBA 3NT4A 1Z6YA 3DZDA 5I6DA 4P38A 4RVUA 4RVHA 2ISQA 3ESBA 5CT9A 5AW8A 1E64A 1B0PA 1U7ZA 2H2GA 4KWCA 5C2JB 3DMFA 5ECGC 3SVZA 1DEKA 5K0BA 4QO7A 5FOQA 1SB9A 1II8A 3DEAA 5HILA 4EB3A 2B3TA 2AT1A 2DM6A 2XHEA 2ZYIA 4BL5A 2ODWA 3QBDA 2VXBA 3TBFA 1DO2A 1IG3A 1DARA 2OWDA 3W5DA 5BSRA 2M1ZA 3AJ9A 1VMIA 1YB6A 2GD1O 3VX4A 4R1OA 4I2VA 3A1SA 2OXCA 4NPAA 1SC1A 2W2KB 4HLUA 4RAQA 3RS9A 4AO8A 4S1WA 1U80A 1VDZA 5IMBA 5JBNA 1E32A 2LIVA 4N3BA 2Q8PA 3A9RA 2WD8A 2RGGA 3KL2A 2Q3DA 3LUGA 4W99A 2XT9A 4CLOB 3EMBA 4DV7B 2QE7D 4RNCA 1XPJA 1QF7A 5ISMA 4JIMA 4RCZA 3KIPA 4N3AA 2M98A 2YKGA 4OKSA 3U3DA 2NO9A 3AOEA 1DIOB 1QQ5A 1EKXA 3MJ4A 4JVLA 5AK4A 1P60A 3A32A 4YCNA 1QFXA 2HTFA 1LPBB 1G21E 2R66A 2UXDB 3HO6A 1UMBA 2L19A 2WOJA 1Q7GA 3GEDA 2NO5A 1IB6A 1WW8A 1L5GB 1Q1QA 4FHEA 5E8RA 1W34A 1IRXA 1G38A 2GK7A 3A0RB 4EO9A 4NZYA 4X84A 3H1PA 3E7PA 1KHHA 5HIAA 1LQUA 4WJLA 1V8BA 1RKBA 2VNJA 4DV5B 2I91A 5BVHA 3G0BA 3U7QA 1U2SA 3IL2A 1NR7A 3C7AA 2OMEA 3AI7A 2IDZA 2XB9A 4LSZA 4E5SA 2QG9A 1Q20A 5CBPA 5KZMB 3E3OA 4J4HA 3RSGA 5CDFE 2X8BA 3R74A 3UJCA 4OUDB 4RSRA 2FW9A 1GTSA 2R5WA 3WNBA 3UMSA 5CXUA 3R5FA 5K09A 4TYYA 4OHCA 3U3MA 3N6VA 4YQFA 2JBHA 2VBGA 3G6KA 5I51A 2SNIE 5DIZA 1G19A 3P9NA 1A72A 3OJCA 4QEZA 5A5DA 2O5EA 4CU2A 3JRWA 2NWQA 2ZJ4A 4ZMBA 2YZGA 1JDJA 3CPHA 4KX5A 3G82C 1PEDA 3GK3A 4EFLA 1DC5A 5BWLA 1XHEA 2HJWA 3LQKA 1KAMA 4WXHA 4X85A 3RW9A 1PU2A 1GQQA 1DIHA 1BZYA 3LT5A 5JBIA 2A67A 1CP3A 4G4SP 3FPKA 1GPH1 3PEUA 5C7LO 3I6IA 4PF1A 5L8VA 1KWKA 2OO3A 5IM4F 1AU9A 1SXHA 3DWIA 3E81A 3NJ8A 2QG6A 4LOLA 4KMMA 2C9BA 5JNWA 5DE3A 1G5HA 5IT0A 1LSUA 2VXCA 1XPUA 3Q3GE 1DC6A 4KU4A 5T3YA 4YBRA 2VSNA 1XFDA 4CF3A 4J2OA 3ZI7A 4JR2A 1ZHFA 1I0ZA 1YJXA 3ZKWB 2CHVA 2HDHA 2C4TA 4FYHA 1N9ZA 1PSWA 3H2YA 4D9MA 1R18A 1Z68A 2XDQA 1YR7A 3L01A 2PLFA 3CUVA 2HT6A 1CUXA 1DP4A 4IFBA 4YDRA 1W49A 1R8YA 3B1WA 3TQHA 1PTKA 4I0WB 1N5JA 4Q6BA 5BQXA 3CRZA 4X7MA 4MITA 2PRIA 4FI3F 4CT5A 1VMAA 1GGVA 4M0FA 3GOQA 4FCVA 1PHPA 3RF6A 1TQHA 1VG9B 2AD5A 4KIWA 1M2WA 4RHCA 3AI2A 1ZS9A 2R9VA 2X13A 3PF9A 3QYJA 4IJMA 4JQZA 3CLRD 4QJ5A 3TK1A 4A4DA 4RD6A 1VYTA 2Q0XA 4DE5A 1P39A 2UVDA 3N3AC 4N39A 2ONKA 3UAWA 1FDIA 1MJGM 2IYEA 3H11A 3T7KA 4JUCA 3OICA 3IE0A 1YS6A 1NJGA 2I4LA 4LX8A 4TYNA 3AY6A 4BQQA 1AG9A 4NV1A 3L7IA 4M7RA 5CM9C 4DW8A 2VTEA 3IBFA 4Y1GA 4AWBA 3PUJA 3KFVA 3OM9A 2A1UB 3BMXA 4AZ3B 3LO5A 2VT6A 4DLTA 3RSLA 4F4IA 3SS8A 2O6HA 1CW2B 5KOJB 1CHNA 1Z29A 2NUBA 3GLVA 5CR9A 1MW9X 2PV7A 2MSCB 3UW3A 3ZXIA 4Y2YA 1WCV1 1IQRA 1G291 1LZKA 1HLGA 2QV0A 2XX3A 4YQEA 3RREA 1U31A 1JG4A 3IBSA 1EB9A 3S40A 3AF6A 4AS1A 1PR0A 3TEJA 5JWRA 5AT1A 1WPXA 2QTHA 3PFWO 5EKDA 2VAWA 3VKGA 4B45A 2CXRA 3PPIA 4EX6A 1U8CB 4E30A 1WMDA 4WACA 3JASB 2FEKA 2J4CA 4JU9A 3B20A 3OZUA 3PCXA 4PLFA 4RNDB 2J9GA 3T9CA 1PJRA 1PEYA 3OQIB 3FZEA 4QTTB 3TZQA 1YS1X 1VHWA 2GEJA 2IYQA 1L5HB 4R83A 4YAIA 2AGVA 3HGQA 3F7MA 1SGWA 2GRAA 3H19A 1ML4A 3C15C 3HEMA 1Z7EA 3JZDA 3NHLA 3QVTA 4FU0A 5A03A 2XGJA 3PEEA 4NP6A 3RJ5A 1GUFA 2Q1WA 1Y6JA 5CITA 1OLOA 5C18A 2XB6A 3D8NA 4AXBA 3GAMA 3DLHA 2WFLB 1TEXA 2FEXA 2GJ8A 1ETHA 1M0SA 4B76A 1P1IA 1QYXA 3B8EA 4X7PA 1T25A 2WIKA 4MW1A 1NF8A 3QKSB 4EHHA 1ZCFA 3IP6A 1KKUA 3N86A 1HDRA 2AQ8A 2YW2A 4P92A 2QRZA 4C7MA 5AM2A 4EG3A 3OQJA 4KQEA 1O2DA 3D6JA 4FYMA 1IZZA 1XALA 1KMCA 2YXLA 4D0SA 1B42A 5LYJA 4A73A 2YWEA 1D2NA 4YFYA 1G21B 2MWMA 3A36A 1U8FO 2A58A 4LJ8A 3SDSA 3L4JA 3C1UA 3FNQA 3DMTC 6LDHA 1PYGA 3QY0A 5I48A 1A9OA 4A2PA 5KEIA 4MAMA 3RIGA 4XH9B 3ROEA 2WHXA 3ZWNA 1C9KA 1SZCA 2XYPA 3CB4A 3FFBA 3OHSX 1ILWA 1CHDA 1F9EA 1ZIOA 2EP5A 1YSCA 2I2CA 1U0GA 4GKVA 4ZT5A 2X9NA 2G08A 3LNTA 3WICA 1A4XA 4MI3A 5KKCA 4A6XA 3TTWA 1H2BA 1N3LA 1RZ3A 2XNHA 2XIJA 5D85A 2ZE5A 4RV5A 5DW3A 4TLLB 3GPLA 1U2DC 1W88A 5NULA 4PLWA 2VHQA 4XFJA 3SYNA 5GM2A 1WU7A 2GKSA 2ZJ3A 1P5FA 2H4JA 2ZRNA 4GZMA 4RPJA 4A6PA 3HJTA 4ER6A 3O38A 2JGFA 3NYWA 3CPSA 4MKIA 4AQDA 1AB5A 1UMCA 3DXFA 2JIRA 2IY7A 2NO7A 3C3BA 5IBRA 5CB4A 5LA6A 3ZK7A 2GAJA 2BM1A 2O0MA 3SSNA 3ESRA 3FMVA 4ALMA 2ZJ0A 2VJDA 4HEA6 4RKRA 1G5QA 4EB6B 2I2XB 5BMVB 4BYGA 5HSGA 3WTCA 1HEUA 1UKYA 1T4DA 2G1JA 2IXAA 3O4JA 4TXMA 4YA6A 3UMRA 5JCOC 1A8IA 3WWPA 4JMLA 3TKYA 3DE0X 2XWQA 4CI0B 2IZ0A 1OCEA 2VQ6A 3DFFA 4YC7A 2ZUDA 3V4FA 1FPQA 5FTLA 2IQ5A 3EVCA 1GL3A 1G8SA 3KHKA 4PC2A 3GLQA 3A1WA 4XUDA 2ZJ6A 3D7RA 4XPIB 3RRFA 3UTDA 4DV1B 1Y5RA 2ARKA 5P21A 5DBHX 1QVAA 2X1HA 1HL7A 4CT4B 1MO5A 1SO8A 1L5NA 3TGPA 3WLMA 1UPUA 3DBHA 3BXFA 5LD2B 4Z4FA 1GGFA 3I4FA 4LQ4A 2VG8A 3B1FA 3X1YA 4C4OA 5C8YF 1A71A 4ALNA 2RGXA 3O3OB 3LT0A 4KFSA 4W6ZA 3OU2A 4ZOCA 3M4NA 2V7QD 1ZGHA 3VAYA 2OY0A 1DG3A 4DWOA 2OHHA 1YNOA 2R62A 4FJ0A 3FY4A 1BN6A 1JAIA 5EESA 2H4ZA 2HQRA 3U3XA 1MJNA 4G86A 2CJXA 4GI3A 4JUFA 4XLZA 5A9TA 2X1MA 4TXNA 1TJNA 2AJTA 3RS5A 4D9EA 4K6FA 1EI9A 1EWKA 1M6HA 4NIMA 3PQ5A 4ZVLA 3L4KA 3E58A 3O93A 4ALLA 3VKVA 1JHXA 1UWCA 2RBGA 3QBTA 2OK8A 3INYA 4NBLA 5CJJA 2G09A 5EIBD 1KZHA 3R41A 2I0FA 3CN9A 1TW2A 3BD9A 4YUVA 3VR2A 1Z9BA 1EDOA 4X1IB 3KDPA 4L9RA 4UDYX 3QTTA 5A1JA 1L7MA 1HE8B 4B6SA 2ZROA 3I76A 1VI6A 5BYAA 1N2CE 1E1MA 1WCWA 3A1NA 4IYRA 1YT5A 5T7BA 2CNOA 3PRJA 1CB7A 3SY8A 3O9MA 1WMAA 1ZD5A 2BSAA 5JS6A 4BZQA 1V2GA 4DHWA 1JW9B 2PRKA 3F90A 2WD7A 4L5CA 3RPEA 3N7AA 2B8EA 1NRXA 3SVLA 2YY7A 4NX2A 1OI7A 1RPZA 1ZVVA 3ASVA 4CLHA 3KVRA 4OA5A 2PMBA 5KYXA 1ZW1A 1Q92A 1WETA 1GY8A 4F2WA 3NBAA 5L6MB 3NTRA 4CCYB 4FFBB 3LYHA 4O59O 1T3SA 4C4AA 3ZXSA 1MGOA 1FYFA 4FDVA 2W4MA 2XD9A 2D7DA 8MHTA 4A82A 1YNSA 1A1SA 2AOVA 2WM9B 3GJRA 3JQ8A 3GDOA 3MBIA 2ZR8A 2NZ8A 3ZDXB 2B1QA 1TADA 1I4TD 2FRDC 3EXG1 4PFQA 5GV7A 1WABA 1FNSA 2B78A 3C8HA 3DE4X 4XWAA 5FWYA 2ODAA 1YJBA 4LXYA 1V7CA 5L7WA 5AXDA 3QM1A 1J33A 1ENYA 2P30A 2PUHA 2F55A 2PGNA 2YYSA 1LBIA 3BSYA 4EITA 4PBTA 5IKXA 3KHTA 4ENSA 1GAJA 1YDEA 3D1JA 2OHXA 3KZNA 4TSKA 3ZQKA 4ZO7A 4EVIA 5J47A 5K6TA 5GADl 3T7SA 4L4UA 4TLBA 4JXJA 4PHFA 2O06A 1CUUA 5SYNA 1XYGA 2QBYB 1WWKA 2HT1A 2CJFA 2GN0A 4LJ4A 1VG1A 2VDKB 4Z2AA 4H0NA 3TECE 2W6ID 2WKRA 3FNHA 4NK4A 3HJUA 2AVNA 4K9DA 1U7WA 1UM9B 1KMHA 1XKXA 4Q4HB 4DJEC 1I2AA 1H22A 3KTAB 3NOVA 5LOVA 5IM5A 3AU8A 2PGAA 3ZDBA 1PWXA 1C7JA 1KO4A 4OQLA 3QWAA 3N5KA 4DARA 3THYA 5DMXA 3MJEA 3AZQA 3AF3A 2WWVD 3T3GA 5DSTA 4WBNB 3ZU2A 5I7HA 4XFKA 4D43A 4DJ5X 4BGDA 1LDNA 1JECA 3AHGA 1SY7A 4R2WA 4IIBA 2HF8A 4S35A 4NEQA 4ZTBA 2PBZA 5H1YA 1Y98A 1CDZA 2ZUBA 1Z0KA 3M6XA 4DMRA 1G55A 4MWBA 1YA6A 4GUDA 2X8LA 3QFSA 3WWDA 1QCYA 1VI2A 1LU9A 4G25A 2ZAMA 1JJIA 2Q6LA 3L8YA 2JW5A 2P4QA 4B0PA 2J9ZB 5K3FA 2VH5R 4BMVA 3A2KA 3PNPA 1N92A 3WYGA 4CM8B 4F3NA 3GZ4A 3T9BA 3WS7A 3GEEA 4ND2A 4QC2A 4XDZA 2ERCA 5EHXA 1TQDA 4C7XA 1I5OA 3KFXA 4UMFA 2HO4A 4HVTA 2PUGA 4JLVA 1FFYA 4QODA 1R0BA 2QHXA 3G2LA 1QORA 4BO2A 2GZDA 2FW6A 1XXHE 3EUWA 3HCEA 3UNXA 3TG2A 5KKAA 1OXBB 1Z3CA 2IKQA 2W6JA 5B6PA 1I80A 2IP1A 3MTQA 2BEWA 2BFWA 1MJHA 1KEWA 4N3CA 4Y98A 4YO7A 5TPWB 2AXNA 4TSRA 1PYOA 3SN6A 1RE1A 2R84A 5CIWA 5J4VA 1U2ZA 4ODIA 2QR3A 1ZH2A 2ZUSA 3CZRA 1QFJA 3DB2A 3OTIA 1HQDA 3P9QA 2QN6A 5IAAA 4YJDA 4L8FA 1T6YA 2V55B 4QUGA 4MS4B 1KAEA 1KBOA 2IYNA 2V97A 3RAEC 1QQ7A 1G5FA 5LZ5A 2W58A 1X1BA 4HN2A 1QTNA 5IWAB 5F5XA 5IVKA 1NLZA 1FDTA 3DE6X 4L5JA 1R16A 4UTXA 2WSBA 2L0XA 4KVAA 5BNFA 2ON6A 4J03A 4C07A 3S0JA 3B1XA 1J00A 3UJ7A 3ZOZA 5LR6A 1EVEA 3ODGA 4IIEA 2JIDA 5DWVA 2WKPA 2DFVA 3WIDA 2PQ6A 1BQ4A 5BN5B 2RC5A 5LUAA 3B6IA 3DCNA 4DV0B 2QVZX 5B55A 3GD5A 5CX1A 1MVLA 1XLVA 4IIYA 5AVXA 1KGDA 3DEJA 1UJ6A 1VIYA 2QLNA 3QU5A 1LLDA 3FNEA 4DEYA 3UK7A 3EGVA 1FDWA 4X3PA 4B3TB 3GUCA 2ZKIA 1CS0A 2FEMA 4KIGA 5IT4A 2Q3BA 4WZZA 2CV0A 3AIOA 1OXKB 5JE8A 4II7A 3HXTA 1ES9A 1WV0A 2XTMA 2VPXA 1TO2E 4WK6A 1YBVA 1TT5A 3TR0A 3UK6A 2X9VA 4FN4A 1T4GA 1E7YA 1LLQA 1XBTA 3BIWA 3KJFA 3MIIA 4JLOA 4EGAA 2WQ7A 2VN8A 4MXDA 4MZDA 4PVDA 1AK2A 2OHIA 4M38A 3TDNA 3WMFA 3GVHA 4YUAA 3PQ7A 4XOUA 4BMPB 4GI2A 4AS3A 5CLQA 3H9JA 1G5PA 3D4IA 4LBWA 4AF7A 4OB7A 3EF1A 4PRKA 3RIXA 3RASA 5LU9A 3HMKA 4L3OA 3ACCA 3L0DA 3CW9A 4IGFA 3E9MA 1ZI6A 2QZPA 4B47A 1MC8A 2HLDD 4I08A 4P4TA 4U5XA 4DG5A 1V8PA 3UM9A 4EF6A 2CT8A 1RXIA 4R8KA 2DGDA 1J6UA 4HI0E 1XTPA 3C3JA 3EZ7A 4XAQA 4FYPA 4AMUA 4RO0A 4DOMA 2IGBA 2WOOA 2YJ3A 3HABA 5IVDA 3BZBA 1KFJB 1P62B 5PGMA 3A4YA 3BJIC 3IEUA 3ZXYA 2DQKA 3WE7A 3T1HB 1DPFA 3ZJUA 4ND8B 4BDSA 5CDYA 3I5XA 4NLLA 1DXOA 2IC5A 1HG1A 1RYZA 3D2LA 2WG0A 3EPKA 1RTKA 1BCSB 2J48A 2PU5A 3TZKA 5EHQA 4F9GA 2HHLA 1XB2A 1F2UB 1RE0A 4EI8A 3R6GA 1FSPA 1H2AS 4A5OA 2ROQA 2PUCA 5A05A 1SXJD 3C3XA 2AS0A 4FEEA 1B3RA 4MVYA 3GCDA 3B3GA 2PM8A 1FTQA 3B13B 3DXXA 3EODA 2O3RA 1VKHA 3HKBB 1H0KA 3H9UA 4ILKA 2XGSA 1YR3A 5A9RA 3T9FA 2BI8A 4AB1A 2VHUA 5K8LA 4UVGA 5B58C 3E9CA 2OUKA 4JBNA 2X41A 3GRRA 1XKQA 5ICFA 1Q74A 4Q0MA 3GUVA 5CFZA 2H06A 2Q50A 1XZFA 2Z04A 4JB2A 4MYUA 5ULLA 3RT1A 4D96A 2VK2A 4JEHA 3OC6A 1RAAA 5G2OA 3WSTA 1CF4A 5HIJA 4WZBE 3K7EA 4D9HA 3U13A 821PA 5BV8A 4ARSA 3KJQA 1Z5NA 4BX8A 4X9XA 4YY3B 3FB1A 1P5RA 4HRXA 1JZTA 5FV7A 3F74A 3WB9A 2EZ4A 4BQIA 3IQEA 4FZJA 1HWYA 1I51A 4X91A 1KJQA 2C2WA 1GTG1 2NU8A 3TLCA 1KF0A 1JVSA 1EFVB 4G1FA 4CCWA 4D7AA 1QE5A 4DLNA 2O8VA 3PCTA 3K6SA 3H3JA 3RVLA 4ENVA 3NR2A 3LX4A 3VZQA 1M0EA 4IJWA 3DMNA 5AVQA 5JUWA 2C9CA 2IE0A 3BGSA 4WT7A 1R4NA 1ZRMA 3I6MA 4LSGA 1EFPB 2W2MA 4RZ2A 2PS1A 1GWNA 1QOPB 1YHYA 2AOTA 2LCIA 5A7FA 3ZWVA 2WAXA 3CRRA 2VDJA 4KDFA 4RZSA 5EINA 3ZWAA 1OH8A 3EVTA 5ECYA 2VA8A 3TZBA 3DOEA 4O4LA 1P75A 1YOVB 1DDIA 2PSSA 3FWNA 2QMEA 4D9JA 4HWKA 3QLTA 2GHRA 2M9MA 1M5RA 5JVDA 1G4AE 1XXHB 1R0YA 4XQEA 2VUSA 1P3Y1 2O3TA 2D59A 4RZHA 4ZZ0A 2IYTA 3WGJA 2EL7A 1RMTA 4F4HA 1IAVA 5D00A 4ZYUA 1LK7A 5K8VA 1DKQA 3AEZA 3G9XA 3PZBA 2FWPA 5ER9A 5TEVA 2HJRA 1JGTA 3UAYA 2WUEA 4Y2QA 4J0EA 2AQIA 1RLOA 3VNBA 1YR2A 2Y9PB 2G82A 2NZXA 3CUYA 4LE2A 2J3LA 4W5TA 2BE7A 4Y1RA 1KO1A 4FCTA 4MWTA 4ARZB 1O8CA 2K2QB 3WBFA 2EJWA 3LW7A 4BLQA 1VSVA 1KIFA 2X86A 3LUFA 3KEFA 5DX8A 1SC4A 4ASUD 1DCTA 4RXUA 4YDSA 5FR2A 3ELYA 2IHNA 1QO7A 2CHGA 3PXEA 4WZAA 4FYWA 1LFDB 3FDJA 2ZRJA 4FE3A 3OZXA 4QTYA 1V0JA 1E2IA 1GKYA 1QNLA 2CE7A 2ISCA 3MTBA 3DUFA 1CERA 1JZQA 3PGMA 1SK9A 1ISMA 1SWVA 4BV2A 2FWBA 2YH2A 1HYEA 3IUPA 3NOQA 4HX2A 3TLMA 4NPCA 5E6RA 3LA8A 5M3BA 3OU7A 3RFFA 1V1JA 3VR4H 3KRTA 5ITWA 1EZ1A 4CG3A 2QVYX 3U4MA 1UWLA 2I34A 1E7RA 3OPMA 3NBYC 1VG0B 1L5ZA 1O94A 2BY4A 1C7RA 2JH8A 1QLWA 1ZGZA 1KJ8A 2DX7A 4YIKA 1B0ZA 5AXBA 1UZLA 1O9GA 2IYYA 2WABA 3LT1A 5E3HA 4FNOA 3ZJYA 4L0DA 1QAMA 5ADHA 1WX1A 2C5SA 2OHJA 3N75A 4UPVA 4XSGA 4I1VA 4AECA 3NTVA 4B3IA 5AVTA 2YICA 4CUJA 4BEWA 5B53A 4BTEA 3GRKA 4V0OA 2B8NA 1NLMA 1SOAA 4BKMA 2JJQA 3JQ6A 1Y7LA 2VHXA 5FPPA 1NOIA 4KNVA 4JI1B 4OI4A 1KEEB 5DTRA 4L72A 4EYGA 3C3MA 3F7NA 1T5TA 3VTZA 3I9LA 1OX6A 1R8XA 1SHZA 5CVDA 1WMBA 3GQBB 3MWLA 3KZ1E 2HEIA 4KR3A 4PFJA 3PIDA 4O1HA 3QPDA 2XVAA 2XRMA 2C2GA 3F5MA 1KL7A 1IM8A 5K03A 1G0NA 4QOHA 3SCZA 3ZK9A 3HQ4O 2E7ZA 1U8UA 4K0KB 3H2KA 2G77B 2Q9AA 4UNNA 4I4TA 2ZSFA 2P5YA 1BTOA 1N0HA 4JJIA 1WCXA 2DRIA 2IHVA 4N12A 1N2IA 2JHGA 4CCAA 4WERA 2H54A 4C76A 2Q8QA 1AQNA 1SQ6A 1XVAA 2G71A 1R1DA 2VS1A 3GDWA 4BQRA 4ENTA 1LF5A 4ZHQA 1NBME 4F4JA 5A3QA 3I04M 2JLCA 5JAUA 3PUIA 4IPTA 4O4HA 3WGOA 5EIXA 4AUMA 1IY1A 3AKCA 3N7TA 2PD6A 1O6BA 4FMDF 1Y8QB 4TX1A 1QH8A 2WZBA 3O8DA 4RGVA 3IHLA 3ABSB 2AX4A 1KPGA 3OPVA 1G2PA 1K6EA 5K01A 4BNJA 5A3JA 1GEEA 1FJGB 4NOJA 1AT1A 4FILA 2IS6A 3KV1A 4YWJA 4FWTA 1KAOA 3OY7A 3VKUA 3HXQA 1T9BA 1JT2A 1IY9A 2XTZA 1GP2A 4F5YA 3BRQA 3OE1A 4PPYA 3PJRA 4J1TA 3SHQA 3KYBA 2O0KA 1WDWB 2ZJ7A 5JR3A 3EH1A 2HMSA 1EK5A 3VOSA 2XKAA 1X1RA 1Y4UA 2JF0A 3ZV6A 4HDOB 4LUCA 5JRZA 2JLBA 1E1NA 1U8YA 3C3AA 2C5GA 5I45A 2P3OA 4WZBB 1MHPA 1JKJB 1EJ0A 2WT8A 3D6HA 5DK6A 3SOZA 1YCFA 4EDHA 5CFQA 1T26A 3AP3A 2CBXA 3QLUA 2EZTA 4H7HA 5EZQA 4HT3B 1BFDA 1K8XB 5KWEA 3QEBZ 4OO3A 1EBUA 1L4LA 1LGYA 3SSAA 4E1AA 4WUVA 1ZRHA 2C82A 1CY7A 4BFVA 4LJAA 2P91A 4R3WA 2GPTA 3HJFA 4QPPA 1GQ2A 1KP3A 2HIAA 5CJPA 3QF4A 4QKQA 4OI0A 3UVEA 5KYWB 3JTEA 1LZLA 4BV8A 2O2XA 2FPGB 4JDPA 2X5XA 2M6KA 3ELWA 4PC7A 2OHFA 4Y7DA 3AO0B 3F1LA