4CL8A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 92
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cl8A00
3MJTA 4HKTA 5A9RA 1PJ2A 3U4HA 4OSPA 1DPGA 4JN6B 2Q4BA 3AUTA 4W9NC 2C07A 4DBVO 3BTVA 4CM1A 4OHUA 4E5NA 5JXWA 2ZJ1A 3JSAA 3CMMA 4XIYA 4DA9A 1S7CA 4YVFA 3ULKA 3OQBA 4YJGA 1E7RA 5U9CA 5C7OO 2OBYA 4ZQHA 3GMDA 2O3JA 4MVJM 3WYEA 2FR8A 2WSBA 1MA0A 3NV9A 3KEOA 3STHA 5JSFA 2AQIA 5A5EA 5FEUA 3I5MA 2DBQA 1H93A 3GAFA 4NBRA 3WFJA 4HFMA 2VNSA 1QLJA 3U5TA 2PA3A 4ND2A 2H6EA 3AWDA 2AHRA 3KLPX 2YQ4A 3HQ4O 1XA0A 3BIOA 3RUEA 3LC7O 2QRJA 3JQEA 1P0CA 4OXYA 2Y67A 1Q2XA 3VTZA 1UXHA 1ZJYA 3I3OA 2Y05A 5BSEA 2BFMA 3WQQA 4D42A 5COQA 4IJVA 3KRTA 2B69A 2DFVA 2WE8A 4WCDA 3K92A 1VJTA 1HSZA 3A4VA 3LK7A 4YRBA 4ZQFA 4N7RA 1I30A 4IDCA 5KVQA 2RH4A 2GDZA 5A03A 4J1NA 3ZNNA 4J43A 1PZHA 2W98A 1LTHR 4CMHA 4NPCA 1U3UA 4UVDA 5L7WA 2AQ8A 3TNLA 5HTOA 1H6CA 4Z0HO 3AFNA 1F06A 1I32A 3JQ7A 4MJLA 4OKIA 2BI8A 2C54A 2E49A 1UXJA 1HDXA 2ZTLA 1PX0A 3FR8A 3PIDA 4BMVA 3ZV4A 3I6IA 3IDSA 4L4SA 4BNHA 3G1TA 1E92A 4KDFA 5FF9A 3MTGA 4TROA 4KQXA 4D3FA 4O63O 4AJOA 3SC6A 1LLDA 2PH3A 3SBOA 4BNGA 2X9NA 2EV9A 2Q50A 5TIIA 4R9RA 3VPGA 3TFQA 1JW9B 3TRIA 1HE4A 1U1IA 3OFSA 2GRAA 4XQ9A 1A5ZA 4GKBA 2IZ1A 4EI2A 4YT4A 1D4FA 4II3A 2XXJA 4WCFC 3VVCA 3WGGA 3PFWO 1PL7A 4LW8A 4R4JA 3D4PA 4G81A 3LU1A 2WD7A 4EJMA 4IQ0A 3IP3A 1E1NA 5IJZA 3L0DA 2VWHA 2VOJA 4Q3NA 2EWMA 2WYVA 4NU6A 3N74A 4RF4A 2WEKA 5IDWA 3SLGA 4ZRMA 3GDGA 1DC4A 2G82A 1B7GO 2J6IA 3OIDA 3Q0EA 4I8XA 1Y1PA 3A1NA 2NM0A 1K89A 3L4BC 2D0IA 3O26A 2H5LA 1ZXLA 3L6EA 4TVOA 5JDIC 1NHWA 5C3MA 4D3DA 1UUFA 1MFPA 3QLJA 2YHIB 3PIIA 2CDBA 3FNEA 4YCAA 1XEAA 3D3EA 5JO9A 2D3TA 1P0FA 1CF2O 1VKNA 3H9QA 1PZFA 3DBRB 5L53A 1X13A 1GZ3A 5JS6A 1E7SA 4LISA 5EQFA 2BKAA 5TJHA 4DBZA 1GL3A 4B4VA 4E31A 4U0KA 2EGGA 1IY8A 4ILKA 1KS9A 4R3WA 1M6HA 1A9YA 2I6TA 4AJ2A 3BMOA 4BKPA 4II2A 4DPLA 3H7AA 1JTVA 4JBHA 1NFRA 1HDYA 3QJ5A 5KTKA 1O8CA 3PXXA 3PGJA 2VOEA 1UP4A 2H1SA 3PWZA 1NPDA 1GYPA 4XGIA 1BW9B 1JQBA 3NDJA 4PVCA 3QP9A 2AQHA 1U2GA 4FC6A 4E33A 4FBGA 5B12A 4CMEC 3FN4A 3LT2A 1MXFA 5TJ9A 4DL9A 5L4SA 3IS3A 2VWQA 5JDCA 3INTA 3TZHA 3C1OA 4UVEA 4FFNA 4RPHA 3LDHA 3FBGA 1HTBA 4U0JA 3QWHA 4QO8A 3HADA 2QZ9A 3G1UA 2Y1GA 1D8AA 3I9MA 4M87A 1DXYA 4YJFA 1CDOA 3PFFA 4OL9A 4DPMA 2JFFA 3NTOA 3UCFA 3ETGA 4TRRA 1B3BA 2B35A 2B4QA 2POQX 4Y6SA 1PEDA 2Q45A 3HSKA 3I1JA 4N5LA 4DUPA 4RORA 3SC4A 2IXAA 3NGLA 4A0SA 1Y7TA 4BNZA 4L0QA 5I9MA 2HRBA 1LA2A 1R4NB 4BO9A 3AY3A 1BG6A 3H9GA 4BNXA 2EGHA 3AFMA 5ENVA 3UGKA 2VWPA 3GH3A 4CM3A 4E12A 5CEJA 2P9EA 1N2SA 4IDDA 3DBLA 4D79A 3EK2A 4UVIA 3PDJA 2IYPA 4HNHA 1C0KA 4TWRA 4BO5A 3BTOA 1J0XO 3NJ4A 1QSGA 5JNLA 5ER9A 1I2CA 1HZZA 5K6AA 2DBRA 1JKFA 3ROQA 5AXDA 1TT7A 4EGFA 1HETA 1B8VA 2O48X 1VPDA 2C7VA 4L8VA 1U7HA 5BT9A 4J4TA 3S2FA 2OP0A 3MJEA 2YYYA 3TDKA 2PK3A 3UN1A 1ZVMA 4K6FA 1P1KA 3RD5A 1X1EA 3OQ6A 4W99A 4IUYA 2DTXA 4GLLA 1T2EA 1U4SA 3C7CB 1DLIA 4IPTA 4TRMA 3ZWNA 1DHRA 3GZNA 4Q3DA 1EFLA 3U0BA 1VKOA 3FNHA 2V6GA 4O1MA 1GDHA 1RYDA 4Y98A 1FDVA 3GNSA 1MP0A 4Q9NA 1U4OA 5JPIA 4PZEA 3T4XA 4WOJA 4IXWA 2AQKA 2P91A 3ST7A 4CLOB 2NTNA 3S55A 1Z75A 4RF3A 1IB6A 4DMMA 1TT5B 5HM8A 1XDWA 3BMNB 1EFKA 1M75A 1DLJA 3PRJA 2LDBA 2BFAA 1SB8A 2OUIA 2Q99A 2J3JA 3K6JA 2GCGA 4PZDA 5CPFA 4RLSA 5TS3A 3MJVA 4LN1A 2JJYA 1I8TA 3O03A 4E2ZA 3CTMA 3CZMA 1BXZA 3G49A 4E3ZA 4UULA 1I2ZA 3COSA 3ZHXA 3VAZA 3EZYA 2AE1A 3WFIA 3WIEA 1WVGA 3LZ6A 2Y1OA 2I76A 1GZ6A 2E4AA 3OJOA 4PLPA 2EF1A 1YDEA 5LC1A 3GG2A 3V1UA 2CDCA 2O3QA 3CKYA 1YL5A 4J0EA 2ET6A 1K5HA 5EL0A 4J2HA 1QYCA 4P8RA 1XSEA 2XF8A 3UF0A 1WNTA 5TGDA 3DHEA 3C1TA 4PG5A 4QQRA 2GYYA 4DGSA 3IIEA 1YQXA 1ZXBA 4EYEA 3VH4A 4E2XA 3WIDA 1EDZA 4PLVA 1Q0HA 3CSDA 3IOYA 4GX5A 3O38A 3I83A 2NTVA 1HZJA 3CUKA 4R1NA 5ICMA 3OJFA 5U1PA 2DPGA 3FSRA 5TSDA 3RWBA 5IZCA 3R6DA 4IJKA 5T67A 1VI2A 4YWJA 5JBIA 1Z74A 3Q6IA 5DP2A 2X23A 1NXQA 1RPNA 4AJNA 3ZV5A 1M6WA 4UEJA 3RUIA 4YRAA 3S2IA 2F1KA 1KYQA 4WLEA 1CRWG 3PJFA 2YV1A 4MPDA 4TQGA 1UP7A 2C0CA 4NQZA 3ZWPA 5CDSA 1QV6A 1HRDA 3U3XA 2FN7A 4Z9YA 1U7TA 4IJWA 4A10A 4ND3A 5T6BA 4D3SA 2P2SA 2Q2WA 3VH3A 3LT4A 4YQYA 3G0OA 2I67A 1V6AA 2Y0DA 1WLYA 1NFFA 2O2YA 3WB9A 3JQ8B 1SC6A 4W6ZA 1DIRA 4RQTA 1ISFA 1GR0A 1IL0A 2B0JA 3KV3O 2FPGA 4GSKA 4GX1A 4WK6A 1PZEA 2GERA 3HE3A 5F21A 1LLQA 1CEQA 4N5MA 3DDNA 1J49A 4BNKA 1ZSNA 2IODA 1PGOA 4IDGA 4BNVA 1YDWA 1LSUA 2DFDA 1BVUA 2B36A 4HY3A 1H9AA 1X0XA 5KKAA 1GU7A 2ZQZA 4BO6A 1WMBA 1HLPA 4GX2A 3C8MA 3PWKA 4OJNA 5G0WA 3GNQA 1N5DA 5I7FA 3GPIA 4NR0A 5DBGA 3ZDFA 4CODB 4QFCA 5JFOA 3NT4A 1H5QA 4WCFB 3W6UA 1IPFA 2OBNA 4B8ZA 2I5PO 2J5KA 3OETA 1DDOA 1IHXA 3OICA 3RBZA 4PLFA 1YE3A 1A72A 2F00A 2YHIA 1D7OA 4WJZA 4PZCA 2AG5A 2C29D 2NNLD 1VL6A 2D1YA 3DBRA 5JC1A 4YJHB 3QV1A 4P4GA 3WBFA 3SX2A 3GUYA 3KTDA 2BGLA 4DLBA 3RVDA 2UDPA 1A71A 4IMRA 1NFQA 3MJ4A 1OMOA 1IE3A 2OORA 4OGWA 2QQ5A 1XCBA 3F9IA 3HDQA 3PI7A 3Q2KA 1CYDA 4ND1A 1SAYA 3X2FA 4TZTA 1SOVA 3GOHA 2QX7A 3DB2A 3PLRA 4JK3A 4XZ3A 4CMBA 1JAYA 3DFZA 4Z3KA 1YKFA 2X6TA 3UFXA 1BW9A 1NQTA 4DIOA 2CDAA 4NU5A 4K6CA 2FMUA 2E82A 2HK7A 4N5NA 1VC2A 2P5UA 5BSFA 3K73O 3VZQA 3PHGA 4ZQEA 3D7LA 3QWBA 1N8KA 3RU9A 1AHIA 2VYNA 4MP6A 4BO8A 3H8VA 5FYDA 1U5CA 3WMWA 1R0SA 2D2IA 7MDHA 3ZU5A 4J0FA 3A06A 4GVXA 3DOCA 2O3UA 5BNTA 1WW8A 2OO5A 1ZNQO 4MVJA 1GQ2A 1X14A 5C7IO 1FJHA 3JCZA 4OAQA 3GFBA 3V2GA 1R37A 4IQGA 1B16A 1PQPA 3JYOA 3JQBC 2IEBA 1AUPA 4TSKA 5CEEA 3NTRA 4I5GA 1Z45A 4K26A 4M54A 4OXNA 1K2WA 1WAMA 2ZQYA 3C85A 2E6UX 4J4BA 3DAFA 1SMKA 3ZU3A 1JWBB 4HV4A 3HFSA 4R51A 4DMLA 1R4NA 4FFOA 1T4BA 3AOEA 2RCYA 5JYDA 1G1AA 2UUOA 3H5NA 3RI3A 4J91A 4KWHA 4GMFA 3RKRA 3K2EA 1GQYA 4U8GA 1OZAA 2TMGA 3RC2A 4BV8A 4AJ4A 2B5WA 1I3NA 2JCVA 4XX0A 5IDXA 3AM4A 4CV1A 2Q1SA 1C14A 3HHPA 2PH5A 2EP7A 3IJRA 5AQ1A 1HDZA 5ADHA 3UVEA 3AI1A 4P22A 4FJ1A 1H94A 3RFXA 3PYLA 3GR6A 1W6UA 2VRCA 2A35A 5JCJA 4W7IA 4RVSA 4MIEA 5CDTA 1NVGA 4BV9A 3BMCB 4NZ9A 1RYEA 4IBOA 3I9JA 2Q2VA 3F46A 3EUWA 3NKLA 4EUFA 2HK9A 2V7PA 3F5SA 3AK4A 5BNFA 5LDHA 1FMCA 1GD1O 5TLSA 3WX0A 3G79A 4L73A 4RCVA 3AU9A 1EUCA 3A14A 5EIOA 3AY6A 3HN2A 3I9KA 1ZCJA 1NBOA 1GV0A 2O4CA 3LSYA 4DYVA 2GGSA 4WEQA 4OMUA 4XJTA 2DAPA 4KWIA 1RWBA 1YXMA 2GLXA 4K28A 4BNUA 3DOOA 5CDGA 3W8EA 1YOVB 3DAPA 2EHDA 2GZ2A 3S2EA 2VHWA 1C0PA 1TT5A 2YJZA 4FFPA 5U4QA 3KETA 4Z6KA 3BMNA 1PGJA 4TMFA 2B4RO 4EUEA 2IE0A 1NVTA 2P5YA 1E1LA 1KBZA 4UUNA 4BHTA 1AXGA 1QKIA 1RM4A 2QZZA 1ZK0A 5EJ2A 1I33A 3WGTA 2PV7A 5B37A 1PSDA 1YB1A 4BKRA 2DVMA 1EBUA 1BMDA 4EUHA 4BNFA 2E48A 4W9NA 2GSDA 1E6WA 3RSHA 3K8ZA 5DOZA 4D44A 1UR5A 2JL1A 4WASA 1SZJG 1XIVA 3GGPA 5KWEA 1HDRA 5C5IA 1H0KA 1YQGA 4F6CA 2YFQA 1I3LA 2R00C 4B4WA 3WGOA 4XB1A 1T1SA 4RPJA 5KKCA 3D5TA 2NVUB 2FY8A 2BD0A 2HRZA 2VRCD 3PYMA 1J5PA 3KO8A 4U7WA 4LRSB 5AXAA 3ZV6A 5JCJD 1Z6ZA 1R4MB 4WE3A 1NR7A 3JQFC 3TSCA 4RDHA 4B8WA 3W8FA 3ZHBA 2AEFA 4A26A 1T2AA 3DZIA 1RKXA 1EBFA 3HB4X 3ZNQA 3N7UA 4PG4A 5LDGA 1UDCA 1ZEMA 4EEZA 1G0NA 5A9SB 3QVOA 3GC6A 1S6YA 4G5HA 3PP8A 3F4LA 4LSMA 2ZYAA 1R16A 2X22A 1SNYA 1IUKA 3OF2A 5A9TA 3KSZO 4CLDA 4BOYA 2B4TO 3EVTA 5ILGA 4AVYA 4B7XA 1WMAA 2FHSA 4S3MA 3SJ7A 3JYPA 4G2NA 2BGMA 3PGXA 3I9NA 1Q1NA 3I23A 1LBEA 3IQDB 1DBVO 3JQ8A 2X86A 4NBVA 4J49A 5B4TA 1ID1A 2VT3A 2EKPA 5C7LO 1PQWA 1WZEA 5ILOA 5BNIA 4R41A 4B3IA 4NNJA 4Y8VA 3DZKA 1PWXA 3WGHA 4CL3A 2YV2A 2Y0CA 4MKRA 3MOGA 1P33A 2Z95A 3JQCA 4WNIA 2DLDA 3BYZA 3MWEB 4EITA 3VKVA 1YJQA 4OKNA 1TA4A 2I65A 3VDRA 5A3JA 2BI7A 3TZQA 4DVJA 3BAZA 3GN2A 4GL4A 3KUXA 1ISIA 3P19A 1Q7BA 4FDAA 3U62A 4WCFA 2IEDA 3KYBA 3RC1A 4XKJA 2X9VA 1UZMA 2Q49A 4A73A 3FI9A 4NJMB 2BMAA 1BXGB 1O6ZA 4MDHA 5KNLA 1UDAA 3NX4A 1BWSA 2NU9A 1ZSYA 2PZMA 5DT9A 4RQUA 4ZD6A 1QG6A 2PLAA 2J5QA 5CG2A 1K6JA 1IYZA 4YJHA 4YEDA 1B26A 1R66A 3KM0A 1QV7A 5ENDA 5ITVA 2Y0EA 3L4BA 4MIOA 1JKIA 4I9NA 2JCYA 2BHLA 1KVQA 3E6AA 4H7PA 4UEKA 1OC4A 4QECA 2IYOA 2DKNA 3AJRA 1QR6A 3P2YA 5L4LA 3K2BA 4IXTA 2HMVA 2PTGA 1LX6A 1IHYA 1B0AA 4MINA 3VDQA 3GRPA 2XOXA 3H3JA 1JWAB 4ONEA 4IM7A 3INRA 1EVJA 2YY7A 5K9ZA 4PVDA 1Y8QB 4R5MA 1LRLA 2ZB7A 1NAIA 3PVZA 4FGSA 1QRRA 5DCUA 4MP8A 1P3DA 3DBHB 4ZA2A 1Q0LA 4WKGA 3KBOA 1EK5A 3JQ9C 1BSVA 3PZRA 4Q3CA 3H2SA 4GX0A 3ZN2A 4DTIA 5F1OA 1KEPA 4HXYA 3D1LA 2G76A 4Z9XA 3ZWCA 3AM3A 5ES3A 2C2XA 2Y93A 4AJJA 1XU9A 5F1KA 1Y5MA 4A03A 1F8GA 2VHYA 3VPXA 4CMEA 8ADHA 3GGGA 2AA3A 3GVCA 1F8FA 1LRKA 3FWNA 3SLKA 4QEDA 4CUZA 3TQHA 4XQCA 2ZTVA 5KOIA 5BSGA 1LEHA 4JLWA 1LQUA 2CUKA 1YQDA 2JFGA 5FI5A 2FR1A 1E5LA 5TX7A 3R3SA 3JQGB 1T2DA 3O4RA 5BQFA 3U09A 2W90A 3DR3A 6ADHA 3VH2A 1E1MA 3JD3A 2PY6A 1JKJA 3QY9A 4B3HA 3E03A 3BMQB 4QSMA 2DUUA 3H65A 4FOSA 4G65A 1XGKA 1YWGO 2J5RA 4F6LA 3OMLA 2B83A 4UEOA 1ADGA 5JAIA 2PKQP 1E6EA 3D0OA 4JJFA 4GI2A 5F5NA 5HA5A 5TQVA 3UHAA 4D46A 5J23A 3QRWA 3CZRA 3HG7A 5JE8A 1EK6A 1Y9AA 4E5YA 4DIBA 2BF7A 3JQ6A 2UUPA 3BMCA 4J90A 2HMWA 1PJBA 4Q3AA 1QYVA 3M1LA 4P38A 1YL7A 3LQFA 3JD0A 5DBIA 1MC5A 4OIMA 1N7GA 4IINA 3WWYA 2EW2A 4CMIB 2AG8A 2IDZA 3BHJA 3SXPA 3RASA 1FF9A 1P1IA 2C7GA 3H2ZA 1BHSA 3JQAA 3E18A 4ZN6A 2E37A 1LDYA 3AM5A 1CJCA 2NLOA 1YL6A 2FWMX 4ZQGA 5EERA 1O5IA 3PQDA 2GZ1A 3IL2A 1YOVA 3TZKA 3DMTA 1KVSA 3WTCA 3IKTA 3ZWYA 1X7HA 1P9LA 1AGNA 1KETA 4MO2A 2V6FA 1DAOA 1EQ2A 4ALJA 4PLWA 2TMDA 5CDUA 3EGOA 1UH5A 3DHNA 4ZICA 2J8ZA 2NUAA 2HAEA 3UW3A 3F5QA 2WJPA 1MG0A 2GN8A 1A7KA 4Y9DA 5A06A 2PGDA 4NI5A 3AUSA 1XHLA 4R1SA 4D7AA 4ZGWA 2DT5A 2Q1UA 3E5MA 4NIMA 1V3TA 1Z7BA 2C5EA 2ZATA 3GUCA 4I08A 1V0JA 1VJ1A 4J7CA 4K9DA 1A7AA 1ADCA 3G3EA 4YA6A 1EVZA 2VT2A 1UJMA 4YT8A 5G0TA 3TL3A 4M49A 5G4LA 2HQ1A 1TB4A 4HUJA 3QWAA 2OP1A 3GDOA 1DEHA 1B3RA 3FCOA 2WMDA 1GY8A 3FR7A 3OEWA 3F3SA 2NVUA 4PCVA 5JDCC 4YAGA 1R15A 2I3AA 2J3IA 3DMYA 2XPCA 1R4MA 4UUMA 1PS9A 3VVBA 5DCWA 1PJSA 3TZCA 3ZWAA 2I66A 3GFGA 4YQZA 3GNTA 3ONEA 3JD1A 2XXBA 3H3FA 3K5PA 4ND4A 1SEVA 2C2YA 3U49A 3WLEA 4J1QA 4AJLA 4MVJG 4RDIA 4XR4A 5MGBA 4J9VA 2P4QA 1LSJA 1VM6A 2QRLA 4IS3A 2LDXA 1M2WA 1JN0A 2SCUA 1JVSA 3QVTA 1X7GA 3TJRA 1U3WA 4AL4A 5A9SA 1MG5A 1BTOA 3EAGA 4XYEA 2A92A 4D41A 3LT0A 3AY7A 4FIZA 1LRJA 1OI7A 2Y99A 2BH9A 4FJ0A 4L76A 4ZU3A 3GHHA 3C7AA 3M2TA 1U3VA 4PLCA 4GH5A 4JIGA 2A4KA 1JDJA 1HDCA 1Y6JA 3JD2A 4NBWA 5THKA 2IXBA 3V5NA 4GMGA 3EY4A 4A2CA 4FFRA 3D5QA 2ZCUA 2YDYA 4EJ0A 1EUDA 2O7QA 4I1IA 3QE3A 3NT5A 3R1IA 2H9IA 4UVGA 1M76A 5KVSA 4OH1A 5HS6A 3G17A 3F1KA 1UXGA 3RC7A 4XA8A 2Q1TA 3CH6A 5IG2A 1LLCA 4BGVA 5AOVA 1TLTA 1E3JA 4KMSA 5K6AC 2HJSA 2QG4A 6LDHA 4NJOA 3BXXA 5GZ1A 4HWKA 1E77A 2DBZA 5IFLA 3E82A 3BZUA 3MTJA 3PJDA 1KIFA 1HF3A 3B6ZA 1OAAA 2GF2A 3QVWA 1O9BA 1PZGA 2JKVA 2EXXA 1O89A 3DZBA 3DONA 2P9CA 5H83A 3PQFA 1JVBA 3HDJA 4INAA 4FC7A 3VZRA 2UYYA 3ICPA 3RKUA 4IMPA 5A1TA 3KYCB 2NU7A 4H15A 4MVJP 4XJSA 1M67A 2OHXA 4I5EA 1F12A 1FDSA 4CQMB 3TOXA 1GCUA 1C0LA 4NJMA 5EINA 2X9GA 5I7SA 1BXGA 1IZ0A 2CZCA 3JYLA 4BNTA 1MGOA 5G4KB 4NBTA 3KOUA 2EKQA 4TRJA 1Q0QA 2AEJA 4YJDA 1ULSA 1U5AA 3ZU4A 5KJCA 4Z0TA 1IZ9A 2QHXA 2W4QA 1ISMA 1SB9A 4JBIA 2Q46A 4H3VA 3IAHA 2IZ0A 1X0VA 2WYUA 2HMSA 1L7DA 1HSOA 2C20A 4PG6A 4KQWA 2VYVA 4RO0A 3MWDB 5MDHA 4YYZA 1K6XA 4M86A 4BNWA 4BKUA 2JFHA 4GPD1 5G0VA 4M89A 3TL2A 4OSOA 3BTSA 2PWZA 1O0SA 1TI7A 4E21A 2Y1CA 2ZJ0A 3C1AA 3VC7A 4NH4A 2G17A 1P45A 1QYWA 1Y8QA 3ANNA 5CFZA 4YRDA 2X4GA 3NGXA 3RQSA 1T24A 2DU8A 4PLHA 1GPJA 3DBHA 1YH3A 2CY0A 2OZPA 5H81A 1KVUA 3C24A 4FPXA 3WMXA 2BFPA 3ANLA 3ASUA 3PEFA 3LLSA 2C59A 2FZWA 2FSSA 3WNQA 1PS0A 1HT0A 1FDUA 1Z7EA 4J7UA 3T4EA 2AEMA 3OSUA 1B15A 3WG9A 2GO1A 2JAHA 3VOSA 2BLLA 2FOIA 2CNBA 4E2WA 4J1TA 1BDBA 5KJ6A 5KJEA 3LF1A 3CXRA 1VL0A 1MC4A 5THQA 4CPDA 1YVEI 4ZRNA 1O95A 4PLTA 5TT1A 5TF4A 2PNFA 2ZIZA 1LLUA 2ZTUA 3OP4A 5DOVA 4KUEA 2GASA 3DZJA 2FPPA 3RUDA 1EDOA 3ZWMA 5DDIP 4IQ8A 2X5OA 5JY1A 3LC2O 1AXEA 4WGGA 3M6IA 3OH8A 5CP8A 4BQPA 4Y6PA 3JQGA 1B14A 3LVFO 5FFFA 4DWVA 9LDBA 1ZSVA 3Q9UA 1PR9A 2V6MA 4BNIA 2CF5A 2HU2A 4W82A 3UKOA 1YO6A 3BMQA 4GWKA 2FPIA 3LLVA 4E5MA 2WD8A 7ADHA 5CEFA 4DQVA 1ZO8A 4W4TA 4J16A 1I36A 4DPKA 1DJQA 1NTOA 1E3WA 3OA2A 1BXKA 3AI3A 5JAMA 3WSVA 4Z3DA 4GKVA 1H2HA 2CVZA 5A02A 3PJGA 3KB6A 1QYDA 3ENKA 1AN9A 3M1AA 5JC8A 1ZH8A 1E3LA 4CM4B 4TZKA 3ROPA 3RBVA 5I7EA 2G5CA 4CM8B 2RHRA 4WLVA 5CDYA 5H82A 4CMIA 4H16A 4MIYA 1QLHA 1FDTA 1XWFA 1KEUA 3DL2A 4J6FA 5DP1A 2GZ3A 4I5DA 3GGOA 4XYGA 1KEWA 4E2YA 2D8AA 1RM0A 3U4IA 3DXFA 3ZU2A 1DRWA 3WLFA 1DRVA 2EERA 2OGUA 3X2EA 4ALKA 1PL6A 3GG9A 4PRKA 2Q2QA 4FSHA 1MXHA 5L9AA 5KIAA 3GVHA 3F47A 2FR0A 5AVOA 3WOHA 4YR9A 4OQYA 1LDEA 4FFLA 4L74A 1XLTA 5L3ZA 2EEZA 1W8DA 3D4OA 5G0UA 5I8ZA 2VNAA 3AI2A 1DSSG 3NEPX 1ZK3A 4D0SA 4B7CA 4QTZA 4YAKA 3OM9A 1SPXA 5L51A 1YS4A 3KSUA 1CERA 4BO4A 4ZQBA 4O6VA 3ZZNA 2UV8A 4JP3A 5I9NA 1ZJZA 3MJSA 3PPIA 2OL4A 4LRTB 5L7YA 3FPLA 5IDYA 2GN4A 1NYTA 1HYGA 2I9PA 5EN4A 3I9OA 1LSSA 2YHUA 3GEGA 1OC2A 4UUOA 2ZKLA 1Q7GA 3PHIA 4IGEA 4XQGA 1WPQA 2HK8A 4KDEA 3H5AA 2VUTA 3R3JA 3UUWA 3WGIA 1RJWA 4XCVA 1CETA 1LDGA 4CM9A 1P1HA 4ND5A 4BKQA 3DTYA 1EVYA 3OIGA 1VL8A 1NQAO 3K96A 1IOLA 2Q4EA 1V3UA 4E13A 2VYND 1PU2A 2ZTMA 4WLNA 1N1GA 4XB2A 4OM8A 4E5KA 2PD3A 3M2PA 1ZEJA 4I9UA 1VJ0A 3JQAB 4MP3A 3OJEA 1LNQA 1NPYA 3H5RA 1H6BA 3JV7A 3L9WA 1EQUA 1HXHA 4MVJD 2OOSA 4JP2A 4ROSA 4PLYA 4BS9A 2ZB4A 3HB5X 3NTQA 4DREA 3I6QA 1T4DA 3GVPA 1NQOA 2VZ9A 8LDHA 4E5PA 1ORRA 4N18A 1PJTA 3KLMX 3WGQA 4LGVA 3AOEC 2WDZA 1V35A 4IGFA 4M55A 3K9QO 5T8KC 2HDHA 3KYDB 1Z82A 2OFPA 1Y5RA 3UICA 5ER6A 1W73A 2EIHA 3F4BA 3INGA 3Q2IA 1ZK2A 3GZ4A 1HDOA 4TKLA 3FTNA 2I3GA 4HFNA 1NWCA 2P9GA 1OFGA 4IZHA 2QYSA 3WXBA 4F45A 1JU9A 3QVSA 3HDHA 2Y66A 4CM5A 3GA0A 4DQXA 4BO1A 4CV2A 3PHJA 4I9HA 1B8UA 4Z0PA 5ICSA 3S1LA 1JLLA 5BSHA 4ALIA 1W0CA 3PLNA 2WYWA 4FJ2A 5LCXA 4NMHA 1DFIA 4MVJE 1O94A 2Y1EA 3W4IA 1KOLA 4NHEA 3W4KA 1DIAA 3PDUA 4JJIA 3VHRA 4J3FA 4CM9D 2ZYGA 4PG7A 4BUCA 4X54A 3D4NA 3LT1A 1LDMA 5EMHA 1YJ8A 1TXGA 3KYCA 3WJAA 1U8FO 3H9JA 1VLLA 2DQ4A 3E8XA 3MOIA 4TKMA 3T7EA 1B2LA 4CQMA 1GZ4A 1PL8A 3LF2A 4XDZA 3RUAA 1MFZA 5HS4A 4FD3A 5L45A 3UH1A 3VPHA 5B4UA 5IN4A 3NJ8A 5G4KA 1QMGA 3B20A 1GAEO 3GVIA 3K30A 2EW8A 3RUCA 4CLEA 1LQTA 1VSVA 1I5RA 1LSOA 3GDFA 1H6AA 2YV3A 3DOJA 2X1HA 2YDXA 4JNKA 5I8WA 4NG5A 5DN9A 1DOHA 1NQ5A 4OQZA 2NTJA 1ZFNA 3ZWBA 3TZ6A 3HDYA 4Q3BA 1P1RA 1XELA 4AJPA 1C3VA 1B8PA 2A94A 1ADBA 4TRNA 2HO5A 2W8ZA 3RAJA 4CV0A 2PKRA 4RGBA 1ADFA 3CIFA 1X7DA 3IP1A 3RFTA 1QXSA 1LXCA 1E7QA 5DBFA 1HE5A 3L9XA 5JLAA 2VZ8A 1GFSA 1G6KA 3F1LA 3ABIA 5TT0A 4E32A 4UREA 5IF3A 1XQ6A 3RC9A 3LYLA 4EDFA 4KOAA 1VRWA 1C1XB 1XKQA 4L4XA 3KZVA 2BGKA 3VTFA 1NASA 3KHUA 3U4DA 3OQ1A 1Y9EA 1E7WA 4HX5A 4RVFA 1ENPA 5L95A 5I9LA 4PG8A 2GPTA 1UP6A 2OMEA 3GHYA 3ENNA 1GUYA 4DC1A 3WNVA 3WDSA 5A04A 2AE2A 2DM6A 3ONFA 4XR9A 3IKVA 5DF1A 3V2HA 1T25A 4EEXA 3CEAA 3GT0A 4BVAA 3JQ9A 4ID9A 1D1TA 4MKXA 1NPTO 3GAZA 4XYMA 3VZSA 1E1KA 1EE9A 4F3YA 1F0YA 2Y1FA 3VPFA 4CQMD 3HN7A 4BO2A 1ONNA 4S1VA 3ZV3A 4WLFA 3ROMA 1PGPA 3RUFA 5IDQA 1GYRA 2NQ8A 2OXIA 4B7UA 3RBXA 3RIHA 5L40A 1PJLA 3DWFA 4BMNA 2EG9A 1PR3A 3NT2A 4BGEA 5JDIA 1KVRA 1WDKA 3FF4A 3MJCA 2ZB3A 4CLXA 2NADA 1M66A 4R1TA 1YB5A 2P68A 3PK0A 3ONDA 2O3RA 4HNGA 5COBA 4OYRA 1KERA 4U5QA 3GMSA 4B4OA 1N7HA 2X5JO 3A9WA 3QWFA 4XGNA 1ZK4A 1MB4A 1KC1A 1PGNA 3DZGA 5G0SA 2JHFA 4RJTA 1YGYA 3EC7A 3OJ0A 3ON5A 1Y8RB 4RPKA 3QWIA 3V8BA 4RVDA 3ITKA 4DIFA 4BNLA 4XQEA 2X0RA 4FN4A 4GGOA 4GSLA 4DLAA 1PJ4A 1SCUA 4CM4A 1ZZEA 4YT2A 1CQJA 4M1QA 1LU9A 1MV8A 3Q11A 4AJHA 4CM8A 4RVHA 1YRLA 1EMDA 4BNJA 1HKUA 1W4ZA 1UDBA 3O9ZA 4UVHA 3P2OA 2CD9A 4FCCA 5AXCA 5DCYA 3GEDA 5TRTA 1LDBA 4NFHA 3BHIA 2D5AA 3JQDA 5B4VA 2NVBA 3KSDO 4Y67A 5EPOA 4ITUA 4O59O 4P4NA 1D1SA 2O3TA 4WLUA 1P44A 3VH1A 5HRUA 3FNFA 4HP8A 3IJPA 2VCYA 2G1UA 1TEHA 3CINA 4HADA 2O23A 3W1VA 4ZHSA 1IULA 1PJQA 5FI3A 3W6ZA 2CMDA 4KP7A 1ML3A 3BHMA 4GWGA 3L6DA 3UXYA 2GUGA 4Q3EA 2EP5A 4CLHA 2CFCA 2HCTA 3E1KA 2PGLA 3OA0A 4GQAA 1Q7CA 3WR5A 4K1LA 5G2OA 4XRGA 5ITWA 1ENYA 1N92A 3QVXA 1X15A 4WLOA 1T2CA 4U6QA 1LUAA 2VN8A 3UCXA 4R5HA 1DIHA 1E3WB 4NK4A 2AXQA 2Z1MA 3ORFA 1WP4A 4I5FA 4AJ1A 1AE1A 1V8BA 4O0LA 3GPDG 4U6SA 1MUUA 2NWQA 3ZWOA 4FGWA 2YZ7A 3RU7A 2DTDA 3AW9A 3OEYA 2Z5LA 3VPSA 4QUKA 4RZHA 1N9GB 2HKIA 5EESA 4MVJI 3HUDA 4YBZA 2EKLA 4CMJA 5T57A 3MEQA 5HWSA 1F17A 1NM5A 2PZJA 3QA9A 1WDMA 2A9FA 1CWUA 2HJRA 4BO7A 3U9LA 2VZ0A 4C7KA 1BRMA 1UXKA 3QIVA 4RLHA 3MZ0A 2V65A 2JCXA 2WE7A 4WECA 2W2LA 4XWYA 3V1TC 1KY4A 4MOWA 2NV6A 4BO3A 3DC2A 2C5AA 2EJVA 3TOZA 3NUGA 4GGPA 1FDWA 4RL6A 3RJ5A 3ADOA 1RM3A 4BNYA 3W8DA 3RJ9A 4B79A 4EZBA 1ARZA 3ASVA 2O3SA 3HJAA 4JX8A 1YBVA 4RZIA 1K3TA 3KYDA 2GNAA 1V3VA 4L9RA 1J4AA 3GN1A 1U3TA 4GAEA 4IY1A 3ICCA 3S8MA 3K31A 4J9UE 4R1UA 4CUKA 3WWZA 3KEQA 1ONOA 2HUNA 2QYTA 3CPSA 3FNGA 1I01A 5B1YA 1DC6A 1EEHA 1H6DA 1BGVA 2O4UX 3L07A 4IS2A 4F46A 1LC3A 2H63A 3OBBA 4E0BA 4GVLA 2VUUA 4YACA 1XR3A 4PN3A 3SEFA 4FFMA 1WDLA 3WICA 2X0NA 2DUWA 5KVCA 2O7SA 2RHCA 5IAAA 3WGZA 4A5OA 2GD1O 1E7YA 4CR7A 3TN7A 3OECA 1OBFO 2VUSA 3DHYA 3EHEA 1NVMB 4IZIA 1UZLA 2W2KB 5AXBA 3D3WB 2JAPA 3ADPA 1AHHA 3LC1O 3JQAD 2VHVA 2CF6A 2YW9A 1I3MA 4JROA 4CMAA 3PHLA 1DIGA 3DZHA 2DC1A 1E3EA 3I52A 1C1DB 4A7PA 4R3NA 1KEVA 1CQIA 1I24A 1DC5A 2W2LD 1GCOA 4P4LA 4ALMA 3DMTC 2HSDA 2CSUA 3V1YA 3R0IA 4DLLA 1GYQA 4JBGA 1NNUA 3ZHYA 4LVUA 1NWHA 3DO5A 1BDMA 1FXSA 4XYLA 1GEGA 4HFRA 3H9EO 4NFSA 1GEEA 2B37A 4C7JA 3SVTA 4LSWA 1EZ4A 1C0IA 5CHEA 3IMFA 1E7MA 1U8XX 1ISHA 4NFYA 5L4NA 3ROKA 1ONPA 3ZWXA 1ISJA 1NP3A 3PJEA 5F5LA 3DQPA 1K6IA 2CVQA 4LK3A 4ALLA 2PZKA 5JMWA 2I99A 1KY5A 4KUHA 5CAEA 2YFHA 1C1XA 1GUZA 5T5QA 4JXKA 2X8LA 1ZBQA 1A9ZA 4PLGA 4A27A 2V6BA 5JW6A 1L7EA 3AUUA 4DC0A 4PLZA 1PGQA 4AFNA 5TNXA 1J6UA 4IIVA 3E5RA 4BGUA 5JAQA 2QIOA 2AMFA 3O8QB 4YDRA 3BTUA 2NQTA 2VQ3A 4DRYA 4RF5A 4YAIA 2WM3A 1HE2A 2NACA 1P1FA 1ISGA 2HMTA 4FR5A 4WOKA 3GF4A 1NAHA 1TVEA 3FHLA 2P4HX 4IDFA 3TPCA 2HLPA 5KCZA 4KTTE 3WYCA 5JYEA 4MVJH 2X7HA 1PS8A 4XRRA 3UCEA 5A5FA 4RVGA 1MX3A 5JY6A 4R9SA 2JHGA 2NU8A 4ALNA 2NU6A 4Z9FA 2PKQO 4CLRB 4CQLB 3I4FA 2RBEA 2X0JA 4J1SA 3ZH2A 4IDAA 1XG5A 4OOEA 3HWRA 3ITDA 1EE2A 3DBVO 2Y1DA 2DBVO 1VE9A 2RH8A 3ANMA 4BNMA 4ESOA 3PYXA 2D59A 3PWSA 2R6JA 1G0OA 2IRWA 3B1FA 1XQ1A 4BB5A 2ZB8A 4D43A 1FK8A 2R2GA 3B1KA 3CE6A 1DAPA 4IIUA 4AICA 1A4IA 4FQ8A 2ILTA 1Y81A 3HFGA 4XDYA 4XYBA 1Y8RA 2IZZA 2WWRA 4BO0A 1T26A 3E48A 4YJGB 4MVJF 1ZK1A 3VZPA 1ULUA 1P31A 5KJ1A 4LMPA 4KZPA 4R16A 3EVNA 4NDNE 2BFOA 4JJGA 4XD2A 5DULA 4AJEA 5FWNA 3GY0A 4MKZA 4FB5A 3PZBA 2DTEA 3A28A 1DB3A 2CVOA 4CUJA 3DZFA 3B70A 4CV3A 4NBUA 1U9JA 2EJWA 2X0IA 2Y68A 3AUAA 2X58A 5GMOA 2RIRA 1UAYA 2GR9A 3WJ7A 3ZCXA 1E3SA 1P77A 1I3KA 3NDIA 4R54A 4LMRA 2FP4A 3WSWA 5I7VA 1KC3A 1ZKMA 4RPGA 4BB6A 4PRLA 3NDRA 2VWGA 3EZLA 4PGFA 3DTTA 5DZSA 1GADO 5IZCC 1NX6A 1YONA 4CM7A 3E9QA 2GN9A 4B4UA 3HNPA 4AJKA 1I2BA 1T1RA 4YTEA 3GEMA 5TC4A 2PD6A 1NHGA 2ZYDA 3UAGA 2JD2A 1L1FA 3WGYA 4CR8A 4CJXA 4GLOA 4LCJA 4XIJA 3ZHZA 3QQPA 9LDTA 5JCXA 1LI4A 3JQBA 3NYWA 4UAGA 2VTEA 4QX6A 1DIBA 1OOEA 4L75A 4BQRA 2FRDA 4CL8A 1EVIA 3TFOA 3S2GA 3JQ7B 1EUZA 4PIVA 1DHTA 2VYVD 5JAZA 1I10A 3WQSB 4RF2A 5KVVA 1QYXA 1V9LA 3WS7A 4BGIA 1N1EA 1SOWA 1YBMA 4JCOA 3ZWWA 1I0ZA 4YPOA 4OO3A 3JTMA 3NAQA 5IZ4A 3UOGA 2QW8A 4YAJA 2PD4A 3DFUA 4FS3A 4AJIA 1R0KA 3ZWVA 1E3IA 3TF5A 3FRJA 4XEHA 5F3RA 4E4YA 4D0RA 3IUPA 1H2BA 1MLDA 2O50A 4J2OA 3H9UA 4RVUA 1N9GA 3WQRA 4GBJA 3AU8A 2X5KO 2JD0A 1A4UA 2D5CA 3B1JA 1YB4A 3EMKA 4JGBA 1X1TA 1R0LA 5COAA 4DYDA 3GLQA 1DRUA 3GQVA 4N54A 5IXYA 3W4JA 4ZJUA 3V2UA 3KVOA 4RPLA 1DC3A 2UVDA 2VTDA 3F6YA 1JA9A 5AYVA 4CR6A 4C4OA 1UXIA 2FSVA 4NK5A 2D4AA 1YBAA 2UAGA 1SBYA 2WD7B 5CPBA 3RFVA 1E0DA 2J3HA 2PR2A 3AOGA 3WYBA 4IDBA 3P7MA 1PJCA 5IXSA 2J3KA 1Z73A 5GZ6A 1SO8A 2PGJA 1D3AA 3QW2A 3JYQA 3FWZA 2AW5A 1UZNA 2RAFA 5BR7A 4JQCA 4L4RA 1K0UA 1T2FA 3Q3CA 2FZEA 2XAAA 3IC5A 3H4VA 3L6OO 1LC0A 4FW8A 1QP8A 5KJFA 1PJ3A 1A27A 1UAGA 3SJUA 2ZCVA 3RUHA 3FTPA 4BIIA 2PZLA 1XU7A 1NR1A 5T8KA 1WWKA 3FD8A 4QO7A 5EQDA 5T64A 1GV1A 1HYEA 4E30A 4QXMA 4YB8A 2Q3EA 2YUTA 4HFJA 4EBFA 5K0ZA 1XYGA 4QT0A 2BELA 3I9LA 1PWZA 4BL5A 1F14A 1E5QA 3I4CA 3PQEA 2G0TA 3BMOB 3JD4A 4Q39A 4R68A 3ZW9A 2WTBA 3EW7A 1DJNA 4BMSA 1HL3A 3GVXA 1PIWA 2VHZA 3DAGA 3OJLA 2R00A 3E9NA 3OIFA 1JAXA 2W2KA 3D3WA 1U2DA 2HMUA 1P74A 3ETDA 3Q1LA 1SEPA 3ZW8A 4HBGA 1ZMOA 4B3JA 3PHHA 1LJ8A 5HBRA 2B5VA 5GY7A 3DEYX 4FOOA 4IDEA 4CMGA 1ZIDA 3JQFA 3L4SO 5JMPA 2BRUA 4YT5A 4O5OA 4OXKA 3ZNPA 1RM5A 3PTZA 1C1DA 4WEOA 4WUVA 1WZIA 5IN5A 4YAEA 4XGKA 3N58A 4YJFB 1ZW1A 3RCBA 4BNNA 3E9MA 4WNCA 1VSUA 5CG1A 4M8SA 5A05A 1R12A 3ZGYA 4W7HA 4DQUA 2Z1NA 3ETEA 3CMCO 4R69A 4AG3A 4Y6RA 4D45A 3VKUA 1CIVA 2C82A 3NRCA 1BVRA 1HWYA 1DFHA 4CMCA 1HYHA 1QORA 1PTJA 2NSDA 2Q1WA 2YQ5A 4CLOA 4BKOA 1ENZA 4J4HA 1HE3A 2JD1A 3H6KA 2PFGA 3C3XA 4URFA 3QHAA 1ENOA 4R01A 4KTVE 3DBLB 3FPCA 3HZZA 1IPEA 3L77A 4PFJA 4DXHA 5C37A 4KUGA 3JYNA 4EJ6A 4YXFA 1ZMTA 3Q9NA 1P1JA 3BA1A 5JO0A 3MCVA 4TVBA 3U4CA 3WBBA 4CM6A 3OHSX 1DFGA 1PQUA 3T7CA 1R6DA 1WXDA 1U28A 4LVCA 5A3VA 3O8QA 4CMKA 3IUSA 1DO8A 1LDNA 1GPDG 3C7DB 3EDMA 3D64A 1E6UA 5DNAA 2ZK7A 3TWOA 2GN6A 4OOFA 1HLDA 2DPHA 4J7XA 5F1PA 5L7TA 4EW6A 1GUFA 3KXDA 3QSGA 2O2SA 1HDGO 1H9BA 3EYWA 3FBTA 3WTBA 1ZUD1 2NVWA 2VHXA 3ZI0A 1GTMA 4CQLA 4UUPA 1KVTA 4CLRA 3P5SA 4QFDA 5A4DA 3GK3A 1GQQA 3ZNOA 4IJUA 3GZNB 4ZVVA 4E6PA 3RROA 4LCEA 2VRBA 5GZ3A 2QRKA 4RV9A 1HEUA 4WPGA 3GRKA
chains in the Genus database with same CATH superfamily
1OASA 5ECGC 3LDUA 3MJTA 4HKTA 4KL8S 5A9RA 5H5JA 3BG5A 4OSPA 4IRXA 4JN6B 3QFSA 4KVGA 4LTMA 3QKUA 2Q4BA 3HLKA 3R3VA 1FFXB 1UT5A 4DBVO 4E08A 4OHUA 2QTAA 3UANA 2BF4A 5JXWA 3OTHA 3C48A 4UU7A 1ZD8A 1S7CA 1EHCA 2PMFA 1P72A 3DEAA 1L4KA 1X3LA 4EUNA 3OQBA 4LNUB 4MKIA 2FGJA 4S05A 2OCIA 4YRRA 4PO3X 1ZM7A 3QM1A 1ABFA 1U0LA 1XJWA 4ZQHA 4RQAA 5DM70 2I0FA 3TG8A 1MA0A 5A4AA 2QRMA 3SWWA 4H60A 4UD6A 2AQIA 5A5EA 2GKSA 3Q7RA 1P7ZA 2DBQA 2IYQA 1GSIA 3H2BA 3UA4A 2HREA 3FFAA 4NBRA 3HXQA 4BWYA 3BERA 3GRRA 3OU6A 2PA3A 4CEHA 1EFTA 3FJYA 2AN3A 1KR5A 4RD0A 2B0CA 1HL7A 4M98A 3KLPX 2YQ4A 3BIOA 1E79A 2XDQA 4HK4A 3LC7O 3ZCUA 5SYAA 3F49S 1LKZA 2VUHB 1QDUA 5IAJA 1N0UA 1L4MA 1VFPA 2Y67A 3VTZA 1YA4A 1UXHA 4UHKA 4EVQA 4B6EA 3D81A 3PQ4A 2WWIA 4LDQA 4D42A 1U6IA 2L19A 5I9IA 3AEQB 4ENPA 3KRTA 3IR6A 3TAXA 3LBFA 4WN3A 1W581 2ADOA 3GMTA 2P69A 4MRVA 1Q19A 1VJTA 3A4VA 1IHUA 4ZQFA 1M73E 5K8JB 4KAAA 1I30A 3RSFA 2QI9C 3VR4D 2BLNA 3K0BA 1SKBA 5DHFA 2OO3A 2A7XA 4OQLA 5KVQA 1L4HA 2PS9A 3D8RA 1PF7E 1ZM3A 2GDZA 2NXJA 5A03A 4H6VA 4ND7A 4P7JA 1GAWA 4J1NA 4J43A 4L22A 1O0CA 3GLGE 1PZHA 4CMHA 3NEAA 1KI4A 5KX5B 1P2GA 3V80A 1IN4A 1EFUA 3VHXB 2FUG6 5L7WA 1NXWA 4F8EA 1QIEA 5K0BA 2JI9A 3CZ4A 4MJLA 4OKIA 2ZDQA 1V71A 1NP7A 1SZPA 3HUFA 5K03A 4P3YA 4B82A 2TYSB 1PX0A 3LJKA 4QIHA 2MR6A 5EIBD 5B1HA 3OBIA 5M2QA 1UPAA 1PEKE 1HUQA 2YXEA 4G67A 4AF8A 5B6JA 3FR8A 3DJYA 1QC5A 1ZUHA 2QR3A 2W83A 1SA0A 2ZULA 4O8ZA 4ZHQB 5LJIA 1E92A 2ETXA 3WWCA 1DGQA 4WK4B 5FF9A 3SHQA 1YRAA 4D3FA 4OLBA 4AJOA 1G8PA 5SY6A 4C2BA 1P0PA 3OZRA 1VLMA 5JZMA 1W7AA 3BUSA 2X9NA 2H3EA 5LZ9A 2XZOA 3BRQA 1W9HA 4II7A 4GOLD 3EN0A 1CDEA 1FNBA 2AFIA 3F8TA 4B2IA 1JW9B 3TRIA 1HE4A 1C7EA 4B1FA 2XKBA 3HXPA 5BQ5A 2GRAA 2ZVPX 1A5ZA 4GKBA 1LH0A 3ET4A 2IZ1A 2RGCA 4YT4A 1EI9A 1TECE 3GDHA 4ROTA 4RJIA 4ZDIA 2QTBA 2VQ6A 3KJXA 3FMPB 4GGMX 4WCFC 2XMGA 3EISA 4HAUA 3WGGA 3DPUA 3CH4B 4CDNA 3WADA 2J48A 1LPSA 1RRGA 4QPPA 5P21A 4JI1B 4RZXA 4YAOA 4CG0A 2N75A 3L0DA 4RABA 4C0WA 5KOJB 2O0LA 4QKQA 1SKAA 3CLVA 2CLLB 3L0YA 5EJ5A 1TQHA 3N74A 4E1BA 1V2GA 2WEKA 3B2QA 4IWYA 2B2CA 3WGNA 4ZRMA 3ND7A 1J20A 3H8JA 3I8XA 3PC7A 5EI5A 3SAJA 4ZCPA 1B7GO 3NBFA 5JSKA 1MRSA 1Y1PA 3BFXA 5DBEX 2NM0A 1HORA 4EFLA 3MXTA 4PFKA 3H2IA 4BN4A 1EDBA 3L6EA 3P27A 5FTWA 3DWGA 1J39A 4IKOA 4D3DA 2EP8A 3QLJA 2YHIB 1DEOA 1WUJS 2C57A 3B13B 3OTQA 1U31A 2PIDA 3D3EA 2D3TA 5JO9A 1SHUX 4YP0A 1VKNA 3H9QA 1PZFA 4IXMA 1B0ZA 1X13A 4OBWA 1ZPDA 5ALKA 3HMKA 1LW7A 2G4VA 2HF8A 3EQ7A 4Q9JA 1VBNA 2BKAA 1AZWA 4DBZA 2BV3A 3TZBA 1ECLA 4EUSA 4GZLA 2QL6A 3D0RA 4Q1DA 3HNOA 4ILKA 4R3WA 2VTBA 1NXOA 3P2EA 1WU7A 4EGCB 3CRNA 3PTAA 3ZDBA 2AZMA 3RVOA 4YJKA 3F2IA 3FHTA 2A84A 4JOBA 3AQIA 4II2A 4R1MA 2FE4A 3EIOA 4B44A 1E2IA 3QJ5A 3PD1A 3THOA 3WE7A 5F23A 5K8VA 1JJBA 2OQIA 4ZO4A 3AILA 3PGJA 2XYPA 1R0BA 1NPDA 4MDEA 3UFXB 1BW9B 1Z4PX 4GT1A 4HEHA 3N28A 1PO7A 4JQSA 2A0WA 4PVCA 3B7WA 1W36D 1XCJA 4CNBA 2LBPA 3GJ5A 3BXOA 4FBGA 4B87A 1APBA 2HOQA 3A1SA 3JWPA 5TJ9A 1SD1A 3DWEX 4DL9A 3PUVA 2VWQA 4UFOA 2G5GX 1J06A 3DMFA 3INTA 4GBED 4CWAA 3C1OA 3DFFA 4FZ3A 1ZZGA 3FDFA 3LDHA 4GZ3A 1NGSA 1FYEA 1TD9A 1TFUA 4HGRA 1OGJA 4QULA 4U0JA 4WESA 1RJ9B 5CIWA 3ZY4A 1DCKA 3LCCA 1C9YA 4MRMB 4ETWA 1Y3BE 2ZM5A 3AF3A 2RGNC 3G1UA 1D5CA 2QZPA 5F51A 1VMEA 4GMKA 2EZTA 4FFSA 3SFTA 1AMOA 1ATZA 3LA8A 2CEAA 3K70D 1II8A 5CYOA 4DLNA 2F8TA 4DPMA 2WWVD 1Y0BA 3QVVA 4TRRA 1NG9A 4XFJA 5BN5A 3KWJA 3OVMA 2ALJA 4GZMA 5EHGA 1X94A 4LPSA 4LOAA 3MPUA 1PEDA 4OHMA 2Q45A 3BBLA 2A57A 3RBAA 2F4NA 1HQDA 4RORA 2QD4A 4AIRA 4QVIA 1CUWA 3ZZTA 2IXAA 2Z8YA 1Y7TA 2PCLA 3MLAA 4GNRA 4BNZA 3PEYA 1FRQA 2HRBA 1U3FA 1QIKA 1U8CB 1VP9A 1R4NB 3GAAA 3LP6A 4HUQB 1U0OC 2CKDA 3H9GA 4OLHA 4QBKA 3SD7A 3DAYA 2JIRA 1D2CA 1BGXT 2GFHA 3VKHA 3GH3A 3FYUC 4E12A 4JKOA 3PE3A 3LTNC 2NO7A 4IDDA 4D79A 4LWQA 2QNRA 4PQYA 3UUFA 5IHPA 4HNUA 2V7BA 4BO5A 3EGWA 5FTLA 2QLNA 5ILQA 1F0PA 1OX4B 1ZP6A 3ROFA 1NI4B 1JV2B 3X1ZA 3TGLA 2Q5EA 3BQMB 3I6BA 5JNLA 3KKKA 1MN6A 1M6EX 1NVFA 2GBCA 2VXCA 2WKSA 3BJMA 1KI6B 3LZDA 5D1HA 2R6ZA 4P81A 2W70A 3REQA 3B53X 1DXHA 4YASA 2X13A 4PSAA 2DBRA 5B1IA 2PQ0A 3UV3A 3ROQA 4CIVA 4PN7A 5IM4A 4CEIA 3OSZA 1NM5C 4R2HA 2C42A 1U1CA 3YASA 3BL6A 3C5CA 1B4DA 3SMQA 1XMXA 1TUIA 2VCHA 4K81B 3X1MA 1B8VA 4IOKA 1U7HA 5BT9A 3QU9A 2QUAA 4HRVA 4LUCA 2QAIA 1D9ZA 3B5IA 3LQKA 1RQGA 1MENA 2YYYA 4F6RA 3EVBA 4JAVC 1RP7A 1R4AA 4K6FA 4BGDA 1P1KA 3EGXA 5BURA 1K8QA 2I33A 1X1EA 3RD5A 4W99A 1ZAYA 2EARA 4TT3D 2JLRA 2R4UA 1V96A 2WFLA 5AJTA 1FFYA 1U4SA 4JL5A 3OU2A 5TXGA 3C7CB 3TTWA 1L8AA 3V32A 1EUCB 2C4HA 3ZWNA 1XZBA 2I2XB 2Q28A 4K0RA 2GYWA 2YCBA 1GG5A 2FVYA 4H77A 3U0BA 5EZYB 4G5FA 2GCEA 4O1MA 5IH3A 3PS9A 4Y98A 5L6MB 3G13A 1P7VA 4YUYA 1R0ZA 2OFXA 4PZEA 2FWRA 2WUVA 2C99A 2OAQ1 4LYYA 4WOJA 3S1LA 3TB6A 2P91A 3BILA 1XI2A 2HHJA 3ST7A 3U9SA 1U5BA 3ZDQA 4C6HA 3PFHA 2NTNA 2UZIR 3SZOA 4RF3A 3ZJTA 2VZLA 1NF8A 2QY9A 4CI9A 4DMMA 5ALWA 3PRJA 3DNPA 4QNMA 3OZGA 1YIAA 4KQMA 4LOLA 1T5LA 1SB8A 1Y3CE 2Q99A 2QTCA 4XWOA 1V1RA 3URKA 1NLUA 3FYSA 2QSJA 4LX8A 3FZEA 2HYIC 5ELLA 1T9GS 4PGHA 3MJVA 2PH1A 1OCEA 4HSGA 4JT2A 4LN1A 5M7EA 1EHYA 4E2ZA 4CIBA 2PUDA 1T6YA 4RY0A 4B2LA 5IUKC 1BXZA 2GN1A 2AN1A 3G49A 4EA9A 3AVVA 3G2IA 2WHQA 2X0FA 3UATA 1I2ZA 4EPRA 5KVAA 1C29B 2WBLC 2ZZKA 1YR8A 3NYQA 5IK2A 3VAZA 4BU0A 1FE8A 3EZYA 1E89A 1TGYA 3FWYA 5AM5A 2V4ZA 5B1DA 3VO9A 3HXKA 1SBQA 3WFIA 1WVGA 4GMDA 2G08A 4MB2A 1IG3A 3U9TA 1GZ6A 3PDCA 3T35A 1D4ZA 4MARA 3AV0B 1YDEA 4RX1A 1QS0A 3VYTB 2O06A 4K2HA 4J0EA 2ET6A 2WIJA 4RKRA 1E2DA 1EVEA 3PNKA 3PUJA 4J2HA 1QYCA 3ZLUA 3K15A 5B1EA 1SQGA 3ZC3A 1XSEA 1AB6A 1ZMXA 2XF8A 4LYHA 4XM0A 1KOJA 1XMPA 1AY0A 3UF0A 2ZSFA 2V03A 4QQRA 4DGSA 1Y3DE 1BHO1 2JFOA 3IIEA 4QLBA 1Q74A 5DU2A 4YP7A 4GW3A 3ZV7A 4C1NA 3KFLA 5C8YA 4C7MA 1EJ0A 4EYEA 4EUKA 1BDJA 1QIFA 5LQJA 1Q0HA 4QBTA 1ES9A 3IOYA 2CFRA 3LQRA 4M0FA 3O38A 3I83A 2Q3DA 1JDSA 2XVAA 1F6WA 3ABSB 1W1IA 3CUKA 3P4UA 3ZGLA 4QBGB 4RY9A 3QK7A 3OJFA 2V74B 4OI2A 2J3DA 4EKIA 4JJEA 4K9KA 3SHWA 5ISMA 1QCZA 3IEIA 5TSDA 4MUBA 2P8SA 3RWBA 4B6QA 4FXOA 3SK0A 4DR4B 1NSYA 1UBKS 1VYUA 3KB1A 5T67A 1I6WA 5JBIA 1Z74A 5K2MA 2ZITA 1K1EA 4R7TA 2X23A 4X7PA 2ZKIA 1M6WA 1Z4OA 1JS1X 4UU1A 5DM60 4BX8A 4ZAWA 2YICA 2J45A 3SQWA 2JPDA 3HV2A 5CJPA 2DWOA 1WM1A 2F1KA 3VU9A 3U0VA 4WLEA 4ZOBA 2J0UA 2QWXA 3MWGA 4TQGA 1PLKA 1UP7A 2QTWB 3VYSB 2JLWA 4M9SA 3W2FA 1FYVA 1HRDA 2VF8A 1R3UA 2KBEA 4DNPA 4A10A 4G0QA 2FAXA 2G9QA 5DTJA 1Z36A 2P2SA 4NXNB 4GR5A 2QLTA 4FR0A 4EG6A 2ZAIA 1VECA 1Q2UA 3LT4A 4P53A 1J23A 1PSWA 3VV2A 4H3KB 1DE0A 4JZKA 2Y0DA 2ZJ5A 5BRNA 3A6GA 3P52A 3R0XA 4JB8A 2E5FA 1TQ4A 3V1LA 1P61B 1SC6A 3JQ8B 3WA7A 3TTSA 1DIRA 4AMVA 1SK9A 1DJMA 2WIAA 5K99A 5HTKA 4GSKA 3CKLA 4GX1A 4IZ6A 3E1GA 3HE3A 3IMEA 3LIIA 3JRNA 3TVYA 4FI3C 4JODA 4N5MA 4MGYR 5BW6B 1C2YA 4DKXA 1TA0A 1OBVA 2CXNA 1SN7A 3F7TA 4N9WA 2O2JA 4HY3A 2HQOA 3KJNA 1GU7A 2F1OA 2ZQZA 4JYAB 1K7YA 4IP0A 4FE3A 3PPWA 1RWKA 2GB4A 3C8MA 5FADA 2W58A 4OJNA 3GNQA 1MZPA 3PA8A 1N5DA 2E6KA 4FWIB 5JBNA 1GT91 2HB6A 3ILYA 1VHLA 5HFAA 1F48A 1M5TA 5IPFA 4MTCA 3EYAA 1X74A 3W6UA 1IPFA 1T34A 2OBNA 4JP5A 3OZFA 1M1UA 3KB8A 1UOOA 4OFBA 2UVQA 3QKSB 1DDOA 5F2OA 1NVBA 1OH7A 1E9FA 2X3YA 1K66A 3NATA 4LXGA 4PC6A 4EB3A 2FEPA 1A72A 1KEEB 1KQGA 3K0EA 2CYBA 2F00A 3TLGB 1URPA 3QMVA 4PC3A 2R1TB 4PZCA 2OHGA 4MW5A 1LJLA 5HZKA 5IEBA 1VL6A 3NHRA 4BFXA 5JC1A 3HEMA 1F7UA 1C3XA 1KXZA 2HWWA 2XQKA 2ZI6A 2J08A 3FSGD 4TWAA 2ZU6A 2C0PA 2VK8A 4ZAYA 3PD7A 2B8WA 2QQ5A 3CO0S 4YV0A 3F5FA 5CTJA 1EGMB 2IH5A 3EUEA 2H08A 2OC4A 2QX7A 2G5TA 4G9GA 5I3ZA 1IZ7A 1HO3A 3BDAA 5EJ9A 3OKCA 4KDRA 1OZ0A 4UARA 1E18A 2XCSB 1E2BA 1YKFA 3OOWA 3RU3A 1NQTA 4ENRA 2X0DA 5CW1A 2RMKA 3U4QB 2EG5A 2ISCA 4K6CA 2I6XA 2KJQA 4KSCA 3DMHA 2SHKA 4K3VA 3ZY2A 4DEXA 1VMAA 1XN4A 2E82A 2CE2X 2HK7A 1VC2A 2VJYA 3MTEA 2NQ2C 5BSFA 1XRJA 1FOEB 4JVLA 4D7AA 2FZKA 1ITZA 5DLYA 5FYDA 1SR8A 4J7AA 1AMNA 4JEHA 3AFOA 3ZU5A 2AUNA 1LGYA 2YH2A 4GVXA 2O3UA 4KH1A 2OQ2A 4FZ5A 5F2EA 1XT6A 2J07A 2OO5A 3P20A 5IYZF 4CTMA 3I5AA 3L0CA 4UD2A 4X94A 3RTEA 1FJHA 4WCVA 1IM8A 1US8B 3BT7A 4YYEA 4LC0A 1HBJA 4JUDX 4IQGA 5J4HA 3ZHTA 1L5WA 1SXJE 1TC2A 3D2AA 3FTDA 3JYOA 3LHKA 4CKWB 3EARA 2FMFA 4TSKA 2F7SA 3G6KA 4Z4QA 2P2DA 3H1EA 2DEUA 1K2WA 1WAMA 2HA3A 5JAHA 2JDIA 3U6BA 2F3TA 3TX2A 2E7ZA 1EX6A 5FA8A 4KYTA 5CDHA 4R51A 3GLFE 4K9RA 1G7RA 3TXAA 4QZVA 1CQXA 3A32A 1G66A 2AK2A 5JYDA 1G1AA 2Q3JA 5D51S 5JT1A 5LUAA 4J91A 1KFBB 4ZO7A 1KSJA 1G3UA 3LW7A 2K87A 3BWXA 4U8GA 1GQYA 4DR3B 3FTQA 1TTTA 3V9PA 3MERA 3BRWA 2JZNA 3DNMA 2B5WA 1I3NA 1N6RA 1JIIA 1I4WA 1KO1A 2FW9A 2Q1SA 1YQUA 3HHPA 4RMGA 3AKYA 3VKGA 3IJRA 5D85A 1KA9H 4MRNA 4PQRA 3KAPA 4Q5IA 5K51A 5ADHA 1ZYUA 4NECA 4P22A 3BWCA 1L7XA 2RE8A 2ZRLA 3TQOA 3RFXA 2X2FA 3DCNA 2B8JA 2C31A 3SDBA 2A35A 4HDKA 4TSRA 3QE4A 1QOPB 1G2OA 2IYYA 4N12A 4W8OA 5J2UA 4OUKX 1NVGA 4DSUA 1GCIA 1PRYA 1S2OA 4NZ9A 4P34A 4TYPA 4BV9A 3SJBA 3SIRA 4EYOA 4P36A 1KAQA 2ORYA 3GIWA 3V8NA 2QVLA 1WCIA 2Q2VA 3WLOA 3NKLA 1U1EA 1YZNA 5LDHA 3HRKA 4QD3A 3HKDB 1FMCA 1MX5A 3V00A 2WTEA 4CYMA 1JXAA 3CW9A 5TLSA 1MRZA 2YC2C 1VG9B 3AU9A 3P2IA 2H2AA 1VG1A 5EIOA 2H16A 3T1TA 3AY6A 1ZCJA 3EXHC 3QLEA 4S35A 1J56A 2O4CA 5ECWA 5D1NA 4C07A 5LMCA 1NJ6A 5ICFA 2VNJA 2QX8A 3X0DA 2JK0A 3TNFA 4YJ2A 1JEYB 1QGED 1VHDA 4JT8A 3H42B 2WV9A 4K28A 2O52A 3DOOA 4R05A 3UK2A 3KT6A 2CLEB 1DOZA 4M7RA 4QRIA 1FDOA 2I3BA 1GHTA 1PL0A 4I4LA 2X1MA 2JIZD 4BLSA 2G07A 3MQFA 2ZBEA 4NYJR 2X6QA 3BMNA 1WB5A 1HMPA 1R0YA 3MK31 5LMNB 4HLQB 1FLNA 4EUEA 3RVSA 2QTNA 1EK0A 1NVTA 2C98A 2DUNA 2P5YA 3OWOA 4TS1A 2P9BA 3TPFA 3WGTA 5C5EA 1MGPA 2QZZA 2I1QA 3U3JA 1ZD1A 5B37A 1WTCA 1SU8A 1TZKA 4GOMD 3RYIA 5K01A 2YWGA 3O75A 1EBUA 5LZ4A 4ZYWA 4D4GA 3DMPA 4BNFA 1D6MA 3EXIA 5FLYA 3DD5A 3T94A 3GLHB 5I5EA 4AMUA 1R00A 1UC4B 2HA7A 5DOZA 4YLYA 1TZCA 3DE2X 3T9AA 3GFRA 1AK1A 4WASA 5F5XA 3TKLA 1XIVA 4ENVA 5KWEA 4M38A 2YN4A 1H0KA 1YQGA 2ADMA 2YFQA 4ZOCA 3LQ1A 2R00C 3WGOA 2WC1A 5LZ5A 1ZJJA 3WO0A 5HIJA 2ZIFA 1RXEA 3D5TA 1UQUA 3MCWA 2NVUB 4F4UA 1Y1LA 1Z63A 2AOVA 3EA5A 4LRSB 3ZV6A 2PGIA 4MI6A 4TUYB 5BOSB 2EKZA 2ZQ5A 3QUAA 3N2ZB 4UCQA 4DW8A 1R4MB 5DYNA 1YHNA 1XMQB 3JQFC 5K1ZA 1NW6A 4NZOA 1JE0A 1YACA 2EYUA 4DUGD 2CXRA 2ZREA 4LY0A 1EWRA 3AB7A 3AJEA 3SPXA 1SIWA 3CUTA 4QHYA 4DA0A 4LRYA 5K6RA 3G02A 3QUTA 1YKGA 5I45A 4PG4A 3HCDA 5CD1A 2GPSA 1W59A 1HURA 3TH5A 4XW2A 1Z5OA 1DTEA 1JXQA 1N1MA 1TYEB 1H69A 3GZTB 1GQSA 3K6KA 2QMQA 2WTAA 4Y18A 4N6NA 2D4HA 1TA9A 1OJLA 4MS3A 1L5SA 1I1OA 1KDOA 5CB4B 2X22A 4IVNA 3THXA 4RV5A 1SNYA 2HD4A 3EB9A 4TSFD 3AUKA 4Q9IA 1IUKA 2FPWA 4S1NA 4TS4A 5A9TA 2O8DA 2XWSA 5HUJA 1CUDA 1T5IA 3OFNA 4L2IB 1JQEA 1YC2A 3IP5A 4FYWA 3R7FA 4CF6A 5ILGA 5TMDA 2PO7A 1SHKA 2FHSA 3PE6A 4S3MA 3BL5A 3SJ7A 4FFDA 3UYKA 2Q5QA 4OHKA 4G2NA 5CH3A 1T8SA 3I9NA 3K32A 3ET5A 1GGFA 1DBVO 1BRTA 1AGYA 4GP9A 1ID1A 3GJ8A 4BQEA 5IUNC 3EGVA 1CNFA 1WZEA 2AZ4A 3LE8A 1JHMA 2P90A 3F7NA 1PEYA 4NNJA 4QYMA 4B3IA 2C7QA 1OJ7A 4ZZIA 2YV2A 3KD3A 2Y0CA 1FP4B 3MOGA 1YIDA 4EITA 4RCZA 4AD8A 3C6ZA 3VKVA 5B64A 1TX4B 1NJGA 1RXYA 1YB7A 2PX4A 4MIKA 2MMCA 5CGZA 3EZ2A 4S1WA 4KI7A 5DNEA 2PPVA 4BEBA 5K05A 1RFLA 4GM1A 1CUSA 1KORA 2D2FA 2MOKA 3VI4B 4Q18A 3GP3A 3P19A 4F2DA 2PS1A 4RD1A 3PNBA 1KGSA 1B2RA 1RQPA 1QKJA 2EJUA 1Q83A 2IEDA 4ITVA 4WCFA 2HIHA 5EE1A 4EFDA 4XKJA 3MTDA 2X9VA 3OEED 3ICVA 2PFSA 5AP9A 2BMAA 3T4PA 2A9QA 5REQB 4AULA 3HBLA 1OZFA 5JZ9A 4ASUD 1ZSYA 1JL3A 4QJ5A 2RHWA 3IOBA 5EIBC 5CG2A 1HGXA 3JZDA 2JJ2A 2M1ZA 1IYZA 3M70A 3AC0A 4HOYA 4YJHA 1OT5A 2AFHB 3H2HA 3JAWA 5K8LA 4B31A 5KYYB 1B26A 5ENDA 1VE3A 1IZYA 5J2TB 2Y0EA 3HJCA 1PNVA 4NARA 1C4XA 2PSJA 3EH1A 4QDXA 1WCXA 3ZDCA 2E85A 2JI4A 3Q0IA 2ORED 5C1DA 1RZ3A 4WH0A 2DKNA 2JIDA 1KZHA 1ZA2A 4EW3A 1A4XA 3CX6A 1LPBB 5IWAB 1IHYA 3MIIA 4W63A 4MINA 1WKBA 4BMZA 5CVDA 3VDQA 2WLTA 3TIIA 2YUIA 4UBLA 4O8CA 2AX4A 5AHOA 5DK6A 3GRPA 1QQTA 3DG9A 3H3JA 3KPYA 2ZU0C 4HL6A 4IM7A 4JUAA 5GV8A 3MYRA 3B5JA 3PSAA 3QEMA 4R5MA 5MF6A 1ECCA 1LZLA 4LDAA 1DS6A 2ZB7A 1NAIA 3CH7A 3L7IA 1JTEA 3P9IA 5DCUA 4MP8A 1P3DA 1FBNA 3EFOA 3UXMA 1M0EA 4WKGA 2AWNA 1HQCA 1EK5A 2D1SA 4TMWA 4DTIA 4RA6A 2ODNA 4XQ0A 1J0AA 5F1OA 4OI0A 1XTRA 3ZWCA 5J4YA 2FU5C 2H7YA 1VZ3A 3O1HB 4N7MA 3AZOA 2I3ZA 2Y93A 1XCPA 1XU9A 2IE8A 2ATEA 2VJMB 3GUHA 1Y5MA 3B3FA 3I0NA 4ZAVA 1Z39A 2VHYA 3UOWA 5JFTA 2GK7A 1IATA 2PPLA 2AA3A 2MHCA 1F8FA 3GVCA 3REFA 1OXMA 2FRVA 1RC1A 1NYRA 4HDSA 1NOIA 3FWNA 2SKDA 4QEDA 3TQHA 2DY0A 2Q6LA 3TNDA 1N78A 3T3GA 4FSDA 2ZVDA 5E9JA 1S3GA 5A5VA 1QP4A 1G20B 1VIVA 1C1HA 5ALSA 5C51B 3ZDRA 2FWBA 2AZXA 1BX3A 4R71A 4FX2A 1I9GA 1KOFA 1E5LA 4GQIA 3IIKA 4ILEA 4EH1A 2C9ZA 1KZYC 1XZFA 3V97A 3JQGB 2JK1A 3I73A 4RZSA 5ALRA 4EJSB 3AMVA 5BQFA 1SXHA 2W6IA 3DKKA 1E1MA 5BYAA 2PY6A 2R751 5AKGA 1Z13A 3V7FA 1JQKA 3OZVA 2VH2A 4N9QA 3GRAA 5E3HA 5IM4F 1F20A 4I1UA 4JBYA 4H17A 4LF6B 4G65A 1XGKA 3SZMA 4QTYA 1Z0AA 3H9BA 4B3SB 1CUUA 4JMPA 4CGYA 4F6LA 2B83A 5DRYA 3ZHQA 5JAPA 3HFRA 1ADGA 1JHQA 3D8NA 3M0EA 2VDQB 2IDJA 1W36C 1X8KA 2PKQP 1T3HA 2GKGA 3FYUA 5TQVA 3T9BA 4XPZA 3UHAA 1XZQA 3RRJA 5J23A 2ZW9A 3CZRA 5DYIA 3ZCRA 3SX0A 3J7AC 1UBMS 4K5QA 5FLEX 1AA6A 1EK6A 2B20A 2ZIVB 4A3SA 2UUAB 2PN1A 4DIBA 3ME5A 1TZJA 5LQAA 4J90A 1R0CA 2V45A 4CBVA 3IILA 3KT8A 3NLLA 1Z37A 2XMRA 4RFVA 2YR0A 5EP3A 1YS6A 1Q21A 5DBIA 2ZWPA 1GU1A 5KQMA 1GPWB 2JBAA 1CP2A 2WOOA 3WWYA 2EW2A 2QVCA 1MO3A 3L5KA 3K70C 4JI4B 3OI7A 4COKA 1R5OA 3ROZA 1P1IA 1UT8A 2C7GA 1M2EA 1TYDE 2NYRA 4CU5A 3BCSA 4DIMA 3H2ZA 1BHSA 3WLHA 3ZI4A 3NHPA 3RJTA 2OV6A 2E37A 1LDYA 3FB4A 2DR0A 3AFHA 4MV3A 1KP3A 3GLIA 3Q8KA 5KZMB 2FZGA 2WHRA 3G8DA 4QBFA 4KQKA 3U26A 4BB9A 1NVEA 3PQDA 2HO4A 2GZ1A 3AINA 3IL2A 2OCXA 3CSUA 3NJRA 3TZKA 1KVSA 1X9GA 2AN9A 2AWOA 3KZ1E 5HIMA 4L0DA 3ZWYA 1RTKA 1R8QA 2V6FA 3WK8A 5FTNA 4M9UA 5C1OA 2IX9A 1EP1B 1V9CA 1Y5IA 2REQB 3EGOA 4PLWA 3O1LA 4IVRA 4X8LA 4F3RA 2J8ZA 3GB9A 1BDHA 3NC1C 1FMJA 3UW3A 3KYJB 1WY5A 3LOUA 4L78A 3F97A 2RHDA 3O95A 4I4NA 1MG0A 2GN8A 4F84A 3CBGA 2QUBA 3ANTA 3OZDA 1JR6A 1JMVA 5EGNA 1E2EA 2H52A 1Z8HA 3E2IA 4TV8A 4N3GA 3ZGXA 1KQOA 2VNKA 2YY6A 2EBFX 3GI1A 3QFCA 4LYDA 1A98A 2E1PA 2Q4OA 1G7SA 4F3TA 1ZUIA 2XHZA 4GNKA 5L3QA 5T4BA 4AAYA 1GL7A 1IHPA 2XE6A 5G4LA 3UHJA 1KI8A 3K20A 3QWAA 1Z2OX 3B9QA 5JW6A 1KO4A 1DEHA 4YGYA 4UNIA 2E2WA 3DHWC 3U7FB 3GRFA 2WMDA 3D7RA 3A9VA 3KJHA 3QBJA 4CDMA 1RRPA 1J7KA 2J31A 2Q8NA 4I1SA 5F2KA 5JDCC 2J0SA 1I6MA 3U49A 3ACDA 3MXOA 2COUA 4HF7A 1ORIA 1Z2NX 1WX1A 3IUQA 4CVNA 2R6R1 4V0OA 5DE3A 3TZCA 3KE8A 5EMKA 2OK8A 3VUEA 4HQLA 3UJPA 1VQ1A 4WA7A 3NM6B 2WHEA 4X54A 2B30A 3S1SA 4YQZA 3EE6A 1KJWA 1TCUA 1QHYA 3GNTA 4TLLB 3MBIA 4CN8A 3O74A 1E66A 4AJLA 5MGBA 3IVGA 2Y6VA 4MVJG 2YWDA 3C6KA 3QITA 1CZUA 2P4QA 2VQFB 1ESCA 4NL4H 4X1IB 4OJQA 1JN0A 2SCUA 4BX0A 3AEUA 3Q41A 2ZUFA 1X7GA 4P0PB 2AG1A 3U48A 4NAUA 4FBLA 3W90A 5A9SA 1MG5A 1U0EA 2D5BA 2WSIA 3OX4A 4KE6A 4F7WA 3KZXA 5DK4A 3HYLA 1LRJA 1E2MA 3C6YA 2XUDA 4IYJA 4L76A 3GX1A 1RQNA 4DIUA 3M2TA 3DZCA 1U3VA 1IVNA 3IH5A 4PLCA 2AI2A 1RVDA 2IP1A 3DVQX 1JDJA 1HDCA 2QZ4A 3I64A 4KGDA 2FF7A 2HH9A 2H0AA 4LK2A 3TRKA 2FZCA 4PWYA 1BKSB 2XBMA 4G6ZA 4GMGA 3UXHA 3ELBA 3PEVA 4Q7JB 5D00A 4D81A 4MVXA 5E2BA 3H1FA 2O7QA 4X62B 4K9QA 4NE2A 4L9SA 1A69A 2O1EA 3GO4A 4ZFNA 1CVLA 3R23A 4OH1A 5F7XA 3H6HA 4O1HA 1STOA 1TO1E 1UXGA 3RC7A 4XA8A 2ZYVX 1MDBA 5T3UA 4BGVA 2VLIA 3G2MA 4ENTA 3TFWA 1QK3A 1YDMA 1TLTA 1E3JA 3ZBUA 2XB8A 1T8UA 6LDHA 3U56A 4HWKA 3KPUA 5DLDA 3MWJA 1RMTA 3E82A 1CYEA 2WUWE 4QATA 5ERYA 4N76A 3KTFA 1TK9A 3E9YA 4WKCA 4D4LA 3LVQE 1JG2A 1HF3A 1OAAA 3HRHA 3QPAA 3P9YA 2VPTA 1BD4A 2EXXA 2GS9A 2ZGVA 1ONSA 3EY9A 4M0MA 5EWMA 5H83A 1SUPA 1S4QA 2ICAA 1Z12A 2K2QB 1KPHA 4F2HA 4YRQA 2IHKA 2NUTB 1JVBA 4D9JA 4POOA 2IHTA 3TSZA 1YB6A 2XZLA 1P39A 3ICPA 4QUIA 4EP1A 1PFWA 4MVJP 2GOYA 4U7HA 2XXAB 3DO6A 3UKJA 2O0MA 3PPYA 4BN5A 1YTLA 1GPLA 2B82A 2HDOA 2JVIA 3LFUA 1BXGA 5EINA 5I7SA 5CIYA 2QT1A 2O2ZA 1MGOA 5G4KB 1A76A 3NZEA 4I4CA 1ZESA 1PR2A 3EPPA 2R1ZA 4MS4B 1SQSA 2L17A 2Q5CA 3AKDA 3FCXA 3KOUA 3ND6A 4TRJA 2B4KA 4EFNA 4F3NA 3JRWA 1Q0QA 4ZVTA 1HOTA 1L5QA 5TMBA 1DKQA 3ZU4A 1KZ7B 4BP8A 3CUUA 4ND8A 3KUDA 1QWSA 1C3EA 3ZI7A 2XWQA 1SVIA 5BWMA 4BPBA 2Y76A 4P32A 2QE6A 5IXJA 4ER3A 1N3LA 2H4YA 1GGHA 1XXHB 2HMSA 2WYUA 3M7IA 1L1EA 4JJKA 4UUQA 3SYMA 4RZUA 4DV7B 2PUGA 2VYVA 3BMXA 1BAPA 2IY8A 4NCAA 3MWDB 1CP3A 2AR7A 2FJ0A 1EX7A 1YB2A 4ZDWA 4P3NA 4FYHA 3VC3A 4UBNA 3E9ZA 3CLUD 2I4OA 1O0SA 4N39A 2FLWA 2Y1CA 3C1AA 4E21A 1N0WA 4NH4A 2G17A 1P45A 4X6UA 3BORA 3DEKA 5T41A 2NT3A 3T34A 3K1JA 1ZNYA 1NSFA 4O0MA 2NZUG 1N5JA 2CHQA 2FPUA 1G4UR 3NGXA 4DAOA 1Y9DA 1GUBA 2CK3A 4WBNB 1NW5A 3DBHA 1YH3A 3C16C 5H81A 2LKDA 4ZOAA 2NUPA 3RH0A 1SK8A 1TQ8A 4D02A 2R6DA 2TSYB 4DNOA 5IT4A 4B3GA 3TQRA 3ASUA 3PEFA 4OFZA 2LUOA 3B3JA 3WP1B 4RGYA 3KS9A 5FIUA 3RTBA 2BUCA 1P2TA 1NX9A 2Q27A 2P9YA 4PHCA 3R7LA 2AXNA 1QFJA 3FI0A 2AMYA 3ZD8A 4V3CA 3AR8A 5FL7D 3WG9A 3EQZA 3VOSA 2FOIA 2CNBA 1Q12A 1BJTA 1GSHA 5CM8B 4Z86A 3ISTA 4KC0A 1NR5A 5KNDD 1F51E 1NT2A 5EWLB 1MC4A 2GEVA 4NY1A 4CKWA 5K3BA 4RQBA 2ANBA 4MYTA 4PLTA 4DQDA 2ZIZA 4BX2A 3AY0A 2ZTUA 4HH3C 5C1BA 1OYOA 2QROA 3QX9A 1SC9A 2GASA 3T5MA 1U11A 3CNNA 2FUEA 4X1KA 4KMOA 3OQVA 3ABZA 2I34A 3LC2O 4WGGA 4C3VA 1N5LA 3G9XA 1JHZA 3GT3A 3NEYA 1QAOA 2ILVA 5CP8A 4JVNA 4BQPA 1N0VC 4XWKA 4IHKA 4QUAA 3GLIB 2ZBRA 5EP4A 1FSZA 5FHRA 1DADA 2VBIA 1G21E 1T36A 2YV5A 3O47A 2CF5A 4NAHA 1QR2A 1DOAA 2O8NA 2ZTHA 3FIUA 4QUJA 2A59A 4W82A 5AKIA 3UKOA 5AD1A 2FPIA 3BX1A 3ZXIA 2Z2KA 2JEYA 5AK0A 3K0SA 3KAJA 4GRIA 2W8BB 7ADHA 4DAEA 4WN9B 1PUIA 1BN6A 5CEFA 5J2UF 1P4HA 2AF4C 4OQ4A 4ABYA 1GZ7A 2JH9A 2VSNA 3W0LB 3TW8A 5FHQA 2PAFA 4MJXA 4LA4A 1IJBA 1FRFS 2PYZA 4BLOA 5JAMA 3ER6A 4G97A 4GKJB 3EGCA 1RIFA 4CEJA 2CT8A 3AB8A 2CVZA 3SP1A 2F17A 4B4DA 1JMKC 3DD1A 1IDOA 3NBXX 3PJGA 3A4NA 4IYRA 1LBIA 3ENKA 1LVGA 2OMKA 1E3LA 1SCUB 1U2ZA 2AOUB 2PGXA 3ZE6A 2GHIA 3IPRA 2WAMA 3V7WA 3KJGA 5DHQA 1M5UA 3AYZB 2NO0A 4JQOA 4UM9B 4BKMA 5CDYA 1C4OA 4W9RA 3VR6H 3DL2A 2QTFA 2E3JA 4F60A 4XYGA 1KEWA 3LHSA 1CUVA 2YCLA 3A3YA 3UJDA 3DXFA 2JFPA 3SFZA 3RSSA 3AR5A 3ER8A 1O77A 5HOEA 2ZR9A 1C1YA 2OGUA 3E05A 1KK3A 3RS4A 3X2EA 4A36A 1EFRA 4HRAA 5E2IA 2ZI5A 1KH2A 2B1GA 4O4LF 1TYAE 1WDTA 2J09A 3NHKA 1IUPA 4JUIA 1SKYE 4C0HA 5L9AA 1G291 1GGJA 2REOA 3T6KA 5AVOA 4YR9A 4OQYA 4FFLA 3QELA 3RHZA 5K0CA 2YIVX 3FCAA 3GBPA 1NF9A 1G6Q1 2QM0A 4MWTA 1MTOA 1GUDA 4QTZA 5IAEA 4BMYA 2Q4RA 2R6AA 1U7DA 1W30A 2XTZA 3IQXA 1N1DA 4ZOLB 4O6VA 4ZQBA 3Q7SA 4G9EA 1QGAA 1KZ6A 5BN4A 3NOXA 4B47A 4JP3A 3P4YA 2OORC 4AY2A 4JB0A 4UU8A 1B23P 1ZJZA 2V9CA 4P1ZA 3K1TA 3W06A 1ADYA 2HIGA 4H1TA 4LCBA 2AMJA 1MNQA 2Q5LA 3A27A 3F6CA 1XTPA 4QPDA 4ZCMA 4HZUB 2XZTA 1OGIA 1SBZA 3L8GA 4REQB 4DJFC 1UEXC 2V5UA 3AFIA 1DNPA 1UMDA 2J0VA 3EBOA 3HACA 4BNDB 3COVA 3VXKA 1CV2A 2ZT8A 1YR9A 1XZGA 1YQWA 3E2PA 1OC2A 3GEGA 3PHIA 1Q7GA 3BB4A 4UUOA 4ZT2A 5JMOA 5LP6C 2VUTA 4HGNA 1TEXA 4MYRA 5F73A 3THWA 4XCVA 5JHHB 4HTFB 1OA0A 4YRLA 4CM9A 4E94A 4BKQA 2WB2A 2G8NA 2HLNA 3RJZA 3LSTA 2FSVC 1IOLA 4C76A 3L93A 3TW4A 5IVDA 3BFKA 3ANSA 4OM8A 1QCYA 2X40A 1B6TA 3O9MA 2C77A 5AK3A 4EGQA 1CK4A 3D0KA 4OQXA 4OHCA 5F33A 1LNQA 3IQZA 3JV7A 1H6BA 3L8MA 4KR3A 1G6HA 2IS2A 4MVJD 3GFVA 2XTAA 2BKEA 1QUFA 3H87A 4JP2A 1G60A 4K1XA 3INYA 1KU0A 1Q1QA 4CT5A 3KOXA 1YZFA 1Q0SA 3HB5X 2SICE 2D62A 3SG0A 3COYA 3GVPA 5HCNA 5E1MA 3PXCX 2IWRA 5LM3A 8LDHA 5C8ZA 3DYBA 1WG8A 4IRMA 1IN7A 4RA9B 1AV6A 2P11A 1PJTA 2C00A 2E89A 3KLMX 4MJ3A 3Q3GE 3WGQA 4E51A 4P5DA 3WGVA 2J5XA 4QTXA 2YL2A 2G25A 3EEBA 3V42A 3ETLA 2I4IA 1Z82A 1QH9A 1UOQA 2OLKA 2OFPA 1Q3HA 5BQPA 1Y5RA 1NBMD <