4CL8A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 92
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cl8A00
4CMEC 2DLDA 3I4FA 3I5MA 3G1UA 3MOIA 4NNJA 5JBIA 2X9NA 4YTEA 2DBZA 5HRUA 4YCAA 5F1PA 1KY5A 4U7WA 3AI2A 3AOEC 3GAZA 3HNPA 1V35A 1T1RA 4I9NA 3F4BA 5BSHA 4YB8A 2O7QA 3C3XA 2Q1UA 1N5DA 1VC2A 1PJ2A 2DUWA 2DVMA 1IHYA 4PG6A 2PKRA 1MUUA 4O6VA 4BNFA 2WD8A 2GCGA 3OJOA 4ESOA 2BLLA 3O8QA 3PJDA 2ZTLA 4U5QA 1UDBA 4Z3DA 4DPMA 1IE3A 1UP7A 1DO8A 3EMKA 3FBTA 4UVHA 5A06A 3GZ4A 2BF7A 3R0IA 2W2LA 2GZ1A 4AL4A 2BI7A 2QRJA 1IPFA 5ENVA 1B7GO 5T5QA 3AUUA 2P9EA 3QWFA 4J1NA 3D0OA 4PLTA 3BMCB 2JAPA 2VT3A 4IDDA 4OAQA 1B16A 4TRNA 4URFA 3JYLA 1CERA 1JLLA 3U62A 4DIFA 4U6SA 1D1SA 4XB1A 1JVBA 1QLHA 2VWHA 3DAFA 2VT2A 4K6FA 1EK5A 3QWHA 1H9AA 4XKJA 4CR6A 1PGQA 2WWRA 2CSUA 3DMTA 4J16A 2AEJA 2RH8A 1P33A 3RC9A 1ZFNA 3IIEA 3GGGA 4DPKA 2AG8A 5BNFA 5DF1A 1ML3A 1X13A 3FTNA 1H6AA 3FI9A 1DLJA 4MP8A 4XGIA 2VNSA 4IQ8A 1EQUA 1BGVA 5BSEA 2FPGA 4J2OA 1U3TA 3WS7A 5L53A 1XDWA 5CAEA 1U28A 1ULUA 1M6WA 5BQFA 3PWKA 3QVSA 3GN2A 2VN8A 2ZJ0A 1E7WA 2OUIA 3ZNQA 3JYOA 1D8AA 3ZWXA 4BO2A 4R9RA 2HLPA 2QG4A 4UVDA 3GC6A 4CQMA 3LT2A 3CZRA 4HUJA 1XCBA 3VH4A 1VL0A 1HRDA 1E1KA 4YAKA 3EGOA 5C5IA 3MWEB 1XYGA 1ZK0A 4A0SA 4FC7A 4RDIA 4NJMB 5MDHA 4GSKA 4PGFA 5ENDA 5U1PA 4INAA 4Z9YA 5IJZA 1DEHA 4Z0HO 4CV2A 1G0NA 4BUCA 3PDJA 4I8XA 5L40A 2NTVA 3OFSA 2Q4EA 4IS3A 1LSOA 3FNHA 5B4TA 4R9SA 1LLDA 4J1TA 3DL2A 3WX0A 4PLZA 3VH1A 3HFSA 1T2AA 4BNHA 1VPDA 1E3EA 2Y1CA 3L4BA 3WG9A 5I7FA 2AQIA 3Q9NA 2Y0CA 4OOEA 2FSVA 4D41A 4OXKA 4E2WA 2GNAA 3S2EA 4N54A 1GPJA 1QV7A 9LDTA 4J9UE 3ONFA 5DNAA 3RC7A 4M55A 1E6UA 4NJMA 1A27A 4I5DA 4WOJA 1UUFA 3F47A 4RLHA 4CM3A 1H93A 2IEBA 5IAAA 4GL4A 3WBBA 3GVPA 3KEOA 4UEKA 1DRVA 5G0VA 3U09A 3ZV6A 4BNTA 4UUPA 3K92A 3QVTA 4GPD1 4BL5A 5IXSA 4CM8B 3KTDA 1UJMA 3RVDA 2YQ4A 3HZZA 1WMAA 1WW8A 4CMCA 4AJ1A 2PD3A 3BHMA 2PFGA 3B1JA 4CR7A 4MP6A 1HYEA 1XEAA 4J7XA 4Q3DA 3JYNA 1PWZA 1PSDA 1EEHA 1Q7BA 5COAA 4ZRNA 3MJTA 5TX7A 5A5EA 4OH1A 4XYLA 2I6TA 3HDJA 4RF3A 3TF5A 3PVZA 2IXAA 3KXDA 4XJSA 4CLXA 2QRKA 1UXGA 3DFUA 4FFOA 3QVXA 1AHHA 4FJ0A 2HK8A 4LCEA 2ZYGA 4KQXA 1HE3A 3ZNPA 1NQAO 4Y6SA 2YHIA 2QX7A 4IQ0A 3GUCA 3ZZNA 4GKBA 2Y68A 2BGMA 4IDCA 3IOYA 3V2UA 1PL6A 2WDZA 2GF2A 3W1VA 4GBJA 5G2OA 4CL3A 3BHJA 4FSHA 1G0OA 4JN6B 2C5AA 3IP3A 1F06A 4NBUA 3WYEA 3WGYA 1DFIA 1Y5RA 2C20A 4G81A 3PFFA 2GERA 4DC1A 5L4NA 1B8PA 1KBZA 3IJRA 3PHGA 1TEHA 2DBVO 4EEZA 3PPIA 4TKMA 4F45A 3WMWA 1Z73A 2AEMA 2VHXA 3JQAA 3OA0A 1DC4A 1VL8A 3JYQA 3RUAA 4Y8VA 3W6ZA 3MJEA 1NFFA 3W4JA 1NHGA 2QRLA 3MJSA 4AJHA 3AW9A 1UP4A 2E6UX 4YT8A 3PJFA 1IYZA 4Q3BA 5KJEA 4LISA 4XD2A 4BNVA 1R4MA 3HB4X 1VJ1A 3RI3A 4R1UA 4XWYA 3ZWWA 3I52A 5I9MA 3F5SA 4Y9DA 4QX6A 4YT5A 3G1TA 5F5NA 3C24A 3WTBA 4PLYA 1NP3A 1U3VA 2HCTA 3AY3A 5CDYA 1AXEA 1NPYA 3VVBA 3AK4A 3B1KA 1J49A 2E37A 4M87A 4CM7A 1LLQA 3JQ8B 5JDIA 3UOGA 3DFZA 1ISMA 1PTJA 1SZJG 2E82A 1RYDA 3HB5X 2G1UA 4LMRA 1DC6A 3QWIA 2ZKLA 2VOEA 2X0IA 1WAMA 2V6MA 4XQEA 4KWHA 4Y67A 3ZW8A 4PLWA 1A7KA 1PQUA 1QR6A 3GRPA 1DHTA 2X58A 4JCOA 2AQHA 2O4UX 3I6QA 2Y1OA 4BGIA 4L8VA 2DFVA 3DHNA 3WYBA 1DIAA 2Q49A 3TL3A 4CM5A 2JCYA 2YY7A 4WE3A 1YQDA 3UXYA 1IB6A 3HDHA 1WDMA 1JW9B 1YJQA 2UUPA 4J90A 4NBWA 1ISIA 3ZWOA 3SJ7A 4YRAA 4PRKA 1LNQA 3JQ7B 1XWFA 1PL8A 4XR9A 2Y0EA 5F21A 1ZK1A 1IZ0A 3RASA 4BO5A 1U1IA 3G0OA 3QY9A 2OZPA 1I8TA 1P1FA 2V7PA 3KSDO 2NQ8A 2WE7A 1S7CA 3NDRA 4GH5A 3RUIA 3RSHA 3DTYA 4L0QA 1T2FA 4HFMA 3WGZA 4HNGA 5AXCA 3H5AA 3DZHA 2HKIA 2IEDA 3W8EA 3ZDFA 3VH3A 4FGWA 4CMHA 5EL0A 3VOSA 2HUNA 3Q1LA 2EJWA 4B3IA 2D1YA 3PHHA 1EDOA 5KVQA 1WWKA 3ZN2A 3ICPA 2R6JA 3C7AA 1P1HA 2CVOA 2GN8A 5FWNA 5JC1A 2GN9A 1ZSVA 3E9NA 1A71A 1ZMOA 4YJGA 4R5MA 5HS4A 2X0JA 5L7WA 4GAEA 4E21A 4GKVA 2SCUA 1X0XA 2B5WA 5G0SA 4DTIA 2JHGA 5A9SA 1PS8A 2ZB8A 4UEOA 5CP8A 1LSSA 2Y1GA 4CLEA 4ND5A 2OBYA 2Q2QA 4ND1A 4E5KA 4ZRMA 3OF2A 3OQ1A 1ZIDA 4CUJA 4UAGA 1NBOA 3LT0A 3PXXA 4RVSA 3QV1A 3LDHA 2EWMA 4BO6A 1WXDA 3H3FA 4P38A 5U9CA 4EJ6A 1JVSA 3WGIA 3TJRA 3ASUA 5JDCC 1P1KA 2I3AA 2HSDA 2C29D 4I9UA 2LDBA 3RU9A 2AHRA 5FI3A 3CEAA 3BMCA 3INGA 4PRLA 3EK2A 3JD3A 2I5PO 2FR1A 5IDXA 3OQ6A 2YFQA 4YT4A 3LK7A 4JBGA 5A9RA 3FR8A 4RGBA 2P2SA 5A9SB 3BHIA 2O48X 4CUKA 1YH3A 1OI7A 2C82A 2JD1A 3QQPA 5A3VA 4A73A 3RFXA 4WLFA 3ZWPA 3TDKA 4OOFA 5BT9A 4I1IA 3U49A 1F12A 1QLJA 3KYCA 3M1LA 4BHTA 3DZKA 3RUCA 2PH3A 4YJHB 2AE1A 3AM5A 3AUAA 2UYYA 3D4OA 1J0XO 2NU6A 1U4OA 2PLAA 4E2ZA 2AW5A 1LI4A 3RUEA 5KJFA 3B20A 1LLCA 5DCUA 3K2BA 5HBRA 4CLOA 4IDFA 2FR8A 1UH5A 2NVUA 5IFLA 4XDYA 3RCBA 4F46A 4FC6A 1I2ZA 2CF6A 3FWZA 3M2PA 1UDAA 3S2FA 1AHIA 3WOHA 1ADFA 3GAFA 4WEOA 4DQUA 4P8RA 4CMBA 2W2KA 2PZLA 2VYVD 2O3JA 2VYND 2X23A 5KVCA 2IODA 4KZPA 4TVOA 4M49A 3FRJA 4DC0A 4QXMA 2FOIA 1R4NA 4YWJA 5JSFA 3FN4A 4R41A 4NH4A 1R12A 3EYWA 2X0NA 1MFPA 3PYXA 1A4IA 5A03A 4YAGA 2IRWA 5ES3A 1F8GA 3G49A 5EJ2A 4RPHA 3O4RA 2DUUA 3U0BA 3UCXA 2JAHA 4ALMA 3ZV3A 4BGEA 5JY6A 4RZIA 4L9RA 4JGBA 4R1TA 2A92A 2IE0A 2PKQO 4B4UA 3ETEA 4RPKA 1K6XA 3OJLA 5JYDA 3HSKA 5A04A 5EMHA 3IL2A 3NRCA 2Y0DA 1KEUA 4IZIA 4CV1A 1NXQA 1QSGA 1YRLA 3JQFA 1VM6A 3KVOA 5U4QA 1SEVA 3NT4A 2D8AA 4I5GA 2ILTA 3V2GA 3Q11A 5HWSA 2P5YA 4M54A 2DBQA 1F8FA 1TT5A 1NQTA 3L0DA 4GMFA 3VKUA 2PR2A 4AJEA 4D79A 4M1QA 3FPLA 1M6HA 3A06A 4FW8A 5AYVA 1PX0A 4KWIA 1ONNA 1H5QA 4IBOA 4IDAA 2G5CA 3S2GA 4WCFC 4EGFA 1EBFA 3E5MA 3WBFA 1PGPA 3AUTA 4Q3NA 2DM6A 3DHEA 4AJNA 4IMPA 3VKVA 1PS0A 2NV6A 1Z6ZA 4YJHA 1ENZA 3NEPX 4DIBA 1ZJYA 2C54A 4W82A 4JXKA 1XELA 2Q99A 2B0JA 1YL6A 1E92A 1DIHA 1RKXA 2F1KA 2HMWA 5IN4A 1E3LA 3KSZO 4U0KA 3DBRA 3MJCA 2NQTA 1R0SA 1TT5B 3ZHBA 3KO8A 2PK3A 4CLOB 1I3KA 1Q7CA 4GX2A 4I9HA 4O1MA 3WIDA 2HMSA 1UAGA 3R3SA 3FWNA 3CKYA 1O8CA 3ZWCA 1ZK2A 2B4RO 1RM3A 7ADHA 1YL5A 5EQDA 1YS4A 4D3SA 2VHWA 2NVBA 5T67A 4CM4A 1OC4A 2AQ8A 1BVUA 1I3MA 1BWSA 2A94A 4ZQFA 1BXKA 3MJVA 1A7AA 2Q1WA 2HK9A 3L6DA 2Z1MA 3PRJA 3KSUA 1R4NB 3GEDA 4DGSA 1GYQA 1ZEMA 4IIUA 1JWBB 5ICMA 3PZRA 4I5FA 5F5LA 4ZD6A 4BO0A 1P1RA 3OH8A 3ROQA 3W4IA 2EEZA 4HKTA 4K6CA 2VRCD 1ZBQA 3D4PA 4CJXA 3LF2A 2B5VA 3ZHYA 4Y6PA 4WKGA 5TNXA 4BO4A 1HSOA 1GZ4A 2YJZA 4IQGA 4PVDA 4KOAA 3TOXA 1BSVA 2FMUA 2BD0A 3K2EA 3WGGA 1EVIA 1HE4A 3IKTA 1P0FA 2WYUA 5EINA 5TGDA 3ZU5A 3OMLA 4XYEA 5ILGA 2HMVA 3OBBA 3UW3A 4TZKA 3WWZA 3PP8A 1GEEA 3GZNA 3JQDA 1C1XA 1N7HA 5CPFA 4BNMA 4UVGA 5A5FA 1NR7A 1Z82A 1GQ2A 2NWQA 1EVJA 4A2CA 3OM9A 2DPHA 4PIVA 2NU8A 3GN1A 3L9XA 3ANNA 2DPGA 1X7GA 2X9VA 4BNKA 2HRBA 1HTBA 2YHUA 1ARZA 2P4QA 4BV8A 1LSUA 2VNAA 3COSA 1LQTA 2DFDA 4BGVA 4FJ2A 2P4HX 1Z7EA 1LQUA 2IZ1A 4A10A 2O3UA 2D3TA 2PNFA 4LRTB 2A35A 3TZQA 3NTRA 1DDOA 1P0CA 1PIWA 1Q2XA 2BMAA 3N7UA 4ID9A 5JE8A 3S2IA 1W6UA 3PHIA 4Z6KA 4PZDA 4GWGA 1XA0A 1NR1A 3KYBA 1KS9A 4RPJA 2Y1DA 4L4RA 1N2SA 4DYVA 1JN0A 1ZKMA 3LYLA 5L4LA 1UR5A 1HZZA 1ID1A 5CG1A 4DMLA 4J4BA 1QYVA 4A03A 3WNQA 3S1LA 5B12A 1X15A 1QYDA 4LSMA 1LTHR 1VL6A 3RU7A 1E1MA 3Q0EA 4YRDA 5ITVA 3FD8A 2UDPA 1SCUA 1NNUA 3LC2O 2ZB4A 3H9EO 4A5OA 5TS3A 1SMKA 4UEJA 1GYRA 1VSVA 5DBFA 4FN4A 4YJFA 2X5JO 3CMMA 4CM4B 4EI2A 1N9GB 5I8ZA 5F1KA 4E2YA 2VUUA 3K6JA 3FHLA 1P3DA 4E33A 2C7VA 5IZCA 4N5LA 1GUFA 1D3AA 3ZWBA 4ILKA 4YEDA 3VDQA 3D3WB 3DBHA 5DCYA 4WUVA 2VUTA 3VPHA 3JQFC 3VDRA 2AEFA 4L74A 2YZ7A 4MIYA 2E48A 1NVGA 2V6GA 3E8XA 3PJGA 1OZAA 3UFXA 1O5IA 1B3RA 1RM4A 2HMUA 1FDWA 4Z9XA 4ALNA 1E7MA 3INTA 3Q6IA 2OL4A 5G4KB 1BDMA 3MCVA 4PG5A 3WQQA 1FK8A 5TT0A 3FNFA 4GI2A 1PJQA 3JQ9C 3ETDA 4IS2A 1NM5A 3P19A 4ITUA 1RM5A 1U3WA 4DREA 4XYBA 1R16A 3WFIA 1YOVB 2Y67A 4L73A 4WGGA 5G0WA 3TZ6A 5G0UA 5K6AA 5KNLA 1C1XB 4FR5A 3AWDA 4DLLA 2IZZA 3OICA 3UF0A 2C2XA 3GPIA 4MIEA 1EVZA 1KYQA 4BO9A 2PH5A 2Q2VA 1HDXA 1LRJA 5TSDA 1UZLA 1Q7GA 1VI2A 2QZ9A 4E5PA 3PTZA 2C07A 3JQAB 4D43A 4BV9A 4P4NA 3FBGA 1UAYA 3WXBA 2EW2A 1TA4A 1K6JA 3DB2A 4XGNA 1LDGA 4LGVA 3TFOA 5HS6A 4IM7A 3HN7A 3MZ0A 3HE3A 3JQGA 2QHXA 2DQ4A 3BMNA 4HX5A 4WLUA 4IGEA 3V1TC 3DZIA 4KUHA 4OQZA 4RPLA 4L4SA 3TN7A 5MGBA 2EKQA 4RQUA 4HP8A 4YXFA 1ZH8A 2ZJ1A 1Z75A 2P9GA 3ONEA 1GZ6A 4HFNA 1BXGA 3WIEA 2D59A 2J8ZA 5DZSA 5TC4A 1CIVA 1W4ZA 2NTNA 3R3JA 4BB6A 3F3SA 1PQPA 5GZ3A 4UVEA 3ENKA 3QRWA 4F3YA 4F6LA 2CMDA 1A9YA 3TRIA 2VCYA 3JD2A 1KVQA 1M66A 2JHFA 1LJ8A 2Q45A 2P9CA 5L7TA 4BO7A 2B37A 1ISHA 1E3IA 4YYZA 3PHLA 1SBYA 3H5RA 4MKZA 5KJ6A 5KWEA 4KUEA 3C85A 5T8KC 3SJUA 1UXJA 3PWZA 4TQGA 1UXIA 1HL3A 3PHJA 1I36A 2QQ5A 3RFVA 1M76A 1R0LA 2WMDA 4J9VA 3ULKA 3NYWA 1NFQA 1XGKA 1LRLA 4TSKA 2OP1A 1YQGA 4MVJD 2VZ8A 2XOXA 1GQQA 3Q3CA 4R1NA 1MXHA 4MJLA 5DP2A 4X54A 1Y8RA 2J6IA 2H6EA 2PKQP 4JBIA 2YYYA 1HSZA 3ZU2A 3TQHA 1JKJA 4M8SA 3WYCA 2NLOA 2W98A 1I3LA 2X86A 3AI3A 4CM1A 1ULSA 1XU9A 2V65A 3C8MA 3GPDG 1LBEA 1NPTO 4CR8A 4N7RA 2ZCVA 5JAMA 1Y9AA 2XXJA 4K1LA 4E3ZA 4OSPA 3GHYA 4FB5A 4OMUA 4R3NA 3HDQA 4KDEA 4YDRA 3ZHZA 1MC4A 4D46A 5C7OO 1ISGA 3ZWMA 5CHEA 2HAEA 1YVEI 4IDGA 2GN6A 4QEDA 1LXCA 1A72A 1X1TA 2CF5A 3AOGA 3BMQA 1MLDA 4RV9A 2NU9A 1WLYA 3DAGA 3K5PA 3E6AA 5CDSA 3FR7A 3GMDA 5DN9A 4QO7A 3OIDA 4BQRA 2Q3EA 3RWBA 2RIRA 4XYGA 4YJGB 1EDZA 2O3SA 1B2LA 4U8GA 3DZFA 2D5CA 4BQPA 4PFJA 4J91A 2PGDA 3CINA 1YBVA 3Q2IA 4GVXA 4ZQGA 2G76A 1PJSA 4ZQHA 3VVCA 5I7VA 3ZV5A 4IJWA 1X14A 5JY1A 1EE9A 3LZ6A 3DQPA 1OAAA 5DULA 1NQ5A 5JDCA 5EERA 1PR3A 1LX6A 2BRUA 2GASA 1T25A 1QXSA 1V9LA 1I32A 4J7CA 5FYDA 3S8MA 1DAPA 2JFHA 3ON5A 1PS9A 3JD1A 3LT1A 4FGSA 3DONA 1V3TA 1BHSA 3AU8A 3GQVA 2PGLA 3U4CA 1L1FA 4AVYA 3P2OA 4GQAA 3WMXA 4EYEA 4WNIA 2YDYA 2YQ5A 3UHAA 5COQA 3SLGA 4FFPA 4U0JA 4J1QA 1H6CA 3M6IA 4WLVA 1DRWA 4FOOA 3VZRA 3VH2A 4JJGA 3GVIA 5K6AC 4MVJG 2C7GA 4G65A 2OGUA 3GT0A 4GX0A 3RUHA 5KOIA 2GUGA 1YWGO 3OETA 3T7EA 4WEQA 1WZIA 1LC3A 4JJIA 4CODB 4AJPA 3CE6A 4MINA 3E18A 1T2CA 4LCJA 1FDSA 3CTMA 4BKRA 3E9MA 2VUSA 1P9LA 4DPLA 2H9IA 2GSDA 4PG4A 3SC4A 4HADA 1ADGA 2J5KA 2DKNA 2CVZA 5JXWA 3G3EA 2R00C 3F1LA 3RJ5A 4J4TA 2OP0A 1NTOA 4PLFA 2BKAA 4AJ2A 4BOYA 1GR0A 1YXMA 3NUGA 5T57A 3F1KA 4Y6RA 2QW8A 4R16A 4KUGA 2I65A 1HYHA 2TMGA 4WLNA 4CQLA 2A4KA 2O4CA 5ITWA 1JAYA 4H15A 4TRMA 5KKCA 2CNBA 3C7CB 3E1KA 1ZMTA 2JCXA 2VTDA 2X8LA 3ITDA 3NV9A 3KEQA 1N1EA 3WLEA 1G6KA 4RJTA 2PA3A 2A9FA 1ADCA 1XIVA 3OEWA 2Q1TA 4PLGA 4QQRA 1PJLA 2EERA 4FIZA 2CY0A 1PR9A 1KETA 2JKVA 3UGKA 4AJ4A 1DOHA 1H6DA 3GLQA 4XYMA 5H81A 3AJRA 3FPCA 4ALLA 1N7GA 4YQYA 1IHXA 2P5UA 4JROA 2X0RA 3KHUA 1AXGA 2P91A 4WECA 1DAOA 5A3JA 3ZWAA 3DXFA 4DA9A 2Z95A 2NTJA 4YJDA 3WICA 2QYSA 2ZQZA 4CMIB 4CQMB 4EEXA 1ONPA 5LDGA 2VOJA 1R37A 3GY0A 1EUDA 3KV3O 1NFRA 1PZGA 3X2FA 4AJKA 3PDUA 1YBAA 2Z1NA 4O0LA 4QFCA 4B3HA 3N74A 5EIOA 4D7AA 3A14A 4YACA 1TT7A 3IUSA 3JV7A 2Q50A 4O63O 2PZMA 1EFKA 3PGJA 4NFSA 1GPDG 2EJVA 3F46A 2YV3A 2O23A 4JP3A 4YPOA 2G17A 3GR6A 4R69A 4JK3A 1DJNA 2X4GA 1WZEA 3AOEA 4LMPA 1HDCA 4NG5A 3M2TA 3GH3A 1Y7TA 1B14A 3GG2A 1RPNA 1SEPA 2CVQA 3DBHB 3QLJA 4KP7A 4RF4A 3H4VA 4BO1A 4E4YA 4A27A 3DBRB 4MIOA 1JQBA 5C37A 3ABIA 4NPCA 1W0CA 4II2A 3FNGA 3GDOA 2ZTUA 5JC8A 2W4QA 3RKUA 3NTQA 2AG5A 1EUCA 1P44A 4XRRA 1T24A 5CEEA 3HHPA 5L9AA 1YONA 2HDHA 3VPXA 2FPPA 1RM0A 3RD5A 1LDNA 1TB4A 3ZNNA 3LVFO 3FTPA 3JSAA 1ZZEA 1FDTA 1C1DB 4ZGWA 1F14A 3DC2A 1WDKA 2ZB7A 5K9ZA 1X0VA 4HFRA 1N8KA 4B4OA 1XQ6A 1PWXA 1J6UA 1F17A 2EIHA 2Y66A 3O8QB 4RCVA 3PLRA 2D2IA 4CQLB 1LC0A 1GAEO 4NZ9A 4WCDA 1T1SA 1HDZA 3JQAD 4FBGA 1DHRA 3B6ZA 3QSGA 4E5YA 5KVVA 3D3EA 2AXQA 1C0LA 2Y99A 3R1IA 3DMTC 1YB5A 3RC2A 1O95A 4BNYA 4DBZA 4BGUA 1OFGA 4R4JA 1PZEA 3JQGB 4BNNA 1PGOA 4TVBA 1UXHA 5IZ4A 4TRJA 1WDLA 3PQFA 1E3SA 2R2GA 4XRGA 3WJ7A 1MX3A 1C1DA 3PJEA 4NMHA 4ZN6A 3GZNB 1R66A 1BXGB 2FN7A 4ZICA 3DZGA 5TJ9A 2UVDA 1I2BA 5B1YA 5IDYA 3A28A 1ZK4A 5IDQA 3PGXA 3PYLA 1XQ1A 1ENOA 2BH9A 2OBNA 4BKOA 1BTOA 1M75A 1XSEA 2DTXA 4WLOA 1ISFA 3V2HA 3RFTA 4HWKA 5B37A 3TNLA 4A26A 4YR9A 2B4QA 3WGTA 4CM6A 1GV1A 4I5EA 3HDYA 5FF9A 5ER9A 2RBEA 3ADPA 1F0YA 3TSCA 3C1TA 1LRKA 1KEPA 3QJ5A 1A9ZA 1K0UA 3O9ZA 3PIDA 5JAQA 1BRMA 1RJWA 3LF1A 3HG7A 4BVAA 5ILOA 1ZXBA 3TZCA 2YW9A 4YAIA 2PV7A 5H82A 4OQYA 3AY7A 1Y8QA 3RJ9A 3KYDA 1U3UA 2POQX 4NU5A 2C2YA 4A7PA 4KTVE 1M2WA 4OM8A 1LU9A 3EZYA 4J4HA 4BNWA 1ADBA 1Y8RB 2VWQA 3RROA 5KJ1A 8ADHA 3D4NA 3U4IA 1HDRA 4P4LA 1UXKA 4YT2A 4MKRA 3GNQA 2HQ1A 1HXHA 1Y6JA 4CUZA 3NJ4A 3WTCA 2D5AA 4YJFB 4MO2A 3WQRA 1HDOA 4ALJA 4B8ZA 4DUPA 2ZQYA 1E3WB 3FCOA 3GNSA 3R6DA 1DJQA 1N1GA 1SOWA 1IPEA 1TLTA 4QSMA 4E31A 4W99A 1DC3A 2GYYA 3NDJA 4NK4A 4E5NA 2J5QA 4K28A 2O2SA 4HNHA 1KVSA 4E30A 3L6EA 2CDBA 4J1SA 4B4VA 3KOUA 3BMQB 3DWFA 3IDSA 4J49A 4IZHA 1FJHA 1CEQA 5FEUA 1HDYA 4RF2A 1Y81A 4KDFA 5TLSA 1T26A 2VZ0A 3E48A 1VLLA 2WYWA 1X7HA 3DBVO 3PYMA 2VHZA 3BTOA 3B1FA 4RVDA 4DLBA 2X6TA 1CETA 2FR0A 3KM0A 2WEKA 3DBLB 4NFYA 2NU7A 3DTTA 1R0KA 3LC7O 3DZBA 4MVJH 1PGNA 3NTOA 4AJLA 1QRRA 2P68A 3JQ9A 4R3WA 5L3ZA 2I66A 1KIFA 5ICSA 4LSWA 2LDXA 2I3GA 1NHWA 3PI7A 2FY8A 4Q3AA 2JFGA 4EJ0A 3SX2A 5FI5A 4RF5A 5DDIP 4B7UA 2EHDA 1VKNA 1WP4A 1FXSA 3ST7A 3M1AA 1YOVA 4EITA 1SC6A 2VYNA 3NGLA 3Q9UA 1U5AA 2H63A 1D1TA 3DZJA 3H2ZA 4ND3A 2YHIB 4PVCA 2BI8A 1B0AA 4GMGA 4S1VA 4TZTA 2J3HA 3GGOA 1MC5A 1QORA 1S6YA 3AM4A 5GZ1A 1C3VA 1RYEA 4Z9FA 1BXZA 3JTMA 1HE2A 3LQFA 1E5QA 1LDBA 1NWHA 4G5HA 4MVJP 4MDHA 1ORRA 1XLTA 3AM3A 2CZCA 1T4DA 3I9KA 4Q3CA 5IDWA 2Y05A 3HUDA 4W7HA 3E9QA 4CLDA 4NU6A 3JQEA 5H83A 4JJFA 1A4UA 1HWYA 5AVOA 3RBXA 3H6KA 3BMNB 2Q4BA 3T7CA 6ADHA 3GHHA 1GV0A 1BVRA 1LDYA 1ONOA 1GUYA 2X5OA 3W8FA 1QKIA 3MOGA 4NFHA 1DRUA 5DOZA 5TT1A 5A1TA 1J5PA 4B3JA 1IY8A 3NT5A 3F9IA 2J5RA 4XGKA 3ZCXA 2NNLD 3AY6A 3JQ7A 4Q3EA 1I33A 2GZ3A 3D1LA 5COBA 2FZEA 2HO5A 3NT2A 4TKLA 1I01A 4RO0A 3C1OA 3WQSB 2ET6A 1TVEA 3PQEA 4AFNA 1WNTA 4MP3A 3QIVA 4CLRA 3AUSA 2BELA 1DIBA 5CPBA 3DMYA 1R4MB 5GZ6A 1HETA 5G4LA 1DFGA 2DTEA 4RORA 2OMEA 2PD4A 2VYVA 3H5NA 3QWAA 1TXGA 5IXYA 2VWPA 5DP1A 5HM8A 4NBTA 3WLFA 3KYCB 1Q1NA 3AU9A 3VZPA 4EZBA 1B26A 5F1OA 4C7JA 1YDEA 5KJCA 5JCXA 3EW7A 2B35A 3U9LA 3JQ8A 3RQSA 2B69A 1I10A 1SO8A 3RUDA 3HADA 2EKLA 2PZJA 3QP9A 2GLXA 1QMGA 5I9LA 4RZHA 3DBLA 4XIYA 3H3JA 1I30A 1IL0A 3ASVA 4W9NC 3VAZA 3ZWYA 3V5NA 3WJAA 2PGJA 5JMWA 4W9NA 4CMIA 4CL8A 1JU9A 3ROPA 2X7HA 3JQBA 3JD4A 2WTBA 3MTGA 3SBOA 3ZU3A 5KVSA 2EGHA 3I9LA 3JQBC 4XJTA 4BMSA 4CMGA 1ZK3A 3GVCA 4C7KA 1P1IA 3VC7A 4GGOA 1NWCA 3TL2A 2IZ0A 4KQWA 3WWYA 1YBMA 1YE3A 4IJKA 4B7CA 4BKPA 2Y1EA 3WGHA 2UV8A 2GO1A 3GGPA 4D0RA 2W8ZA 3FSRA 4RL6A 4B7XA 1I5RA 3GUYA 3ROMA 4U6QA 1ZUD1 4BNGA 2AA3A 3D3WA 3OIGA 4BMVA 4FFLA 3RUFA 2B4TO 3WGQA 4XCVA 1JDJA 1VRWA 5A05A 5CG2A 2XPCA 1U7TA 3D7LA 3O38A 4P22A 4D42A 4WPGA 1X7DA 4J0EA 1O89A 1E77A 3EZLA 3LLVA 4BNUA 2C0CA 3LU1A 4J2HA 4RVFA 4H16A 4CMAA 1CWUA 1VSUA 4NK5A 1QP8A 1LDEA 3IQDB 4II3A 4DVJA 1VJ0A 3CUKA 4M86A 1FF9A 2EP7A 4XDZA 2HJSA 2HMTA 3EDMA 4UULA 4G2NA 4TRRA 4ALIA 1W73A 3SLKA 4UUMA 1P74A 3ANLA 3NJ8A 5DCWA 4CM9A 1OOEA 3DEYX 4DYDA 5HA5A 1YQXA 4I08A 3H9GA 4XEHA 3OP4A 3GMSA 4AJIA 3RAJA 4DXHA 2DTDA 4NI5A 1LEHA 4DWVA 1QYCA 1PJ4A 5J23A 4YAEA 2AE2A 3DAPA 3F5QA 4YQZA 2O3QA 5EPOA 3RBVA 2ZCUA 4IUYA 2IDZA 1Z7BA 4D45A 4BKQA 4DQVA 2DT5A 2W2KB 3AI1A 1E6EA 4ZJUA 3WDSA 4YRBA 3H7AA 1NVTA 1KVTA 5AXBA 1HKUA 2XXBA 4XX0A 1DFHA 3EC7A 4QFDA 4N5MA 1T2DA 4EDFA 4GX1A 2FRDA 3PLNA 1BW9A 3K31A 4QTZA 3I9JA 4FOSA 3CPSA 3E5RA 1EE2A 4OHUA 4IMRA 2FHSA 3BA1A 1XG5A 4WJZA 1Y9EA 1MB4A 1GZ3A 1MA0A 1M67A 3T4XA 4TMFA 4E2XA 2IYPA 4WOKA 5JCJD 1DB3A 3HJAA 3VHRA 1WPQA 2B83A 4QO8A 3I9MA 5L4SA 1Q0HA 2V6FA 4QT0A 5JAZA 1KEVA 1YB4A 3UCFA 4EUHA 2RHRA 1I24A 2WJPA 3VTFA 3DDNA 2E4AA 5LDHA 4PG8A 5TQVA 1RWBA 4WK6A 4AG3A 3ONDA 2DU8A 1IULA 4WNCA 4BNXA 1PL7A 3OSUA 4R54A 4DIOA 5JFOA 1CQIA 4NR0A 1B8UA 3ANMA 4IPTA 3STHA 3HFGA 1YB1A 4GX5A 4EUEA 4PLCA 2CDAA 1FMCA 4NIMA 4K9DA 2EV9A 4XQGA 3GF4A 2O3TA 1E7RA 1UZNA 1MGOA 4B79A 5KCZA 1E0DA 4KMSA 1ZVMA 4W4TA 2NSDA 3INRA 3VZSA 5I7SA 3TPCA 1V6AA 4D3DA 4GGPA 1IZ9A 2QZZA 1GQYA 4LK3A 4ND4A 4P4GA 5LCXA 5T8KA 4CV3A 5KTKA 3GFGA 1ZO8A 2ZYDA 3CMCO 1JKIA 3F6YA 4OXNA 2FSSA 4YA6A 2QYTA 4AJOA 4CMEA 7MDHA 3OA2A 3KLPX 4LRSB 5BR7A 1K89A 1E1NA 3HQ4O 1EBUA 3WB9A 2Q46A 3ZGYA 2OO5A 3D64A 3SC6A 4CV0A 5L95A 5JS6A 3I23A 3GFBA 3WSVA 3ZW9A 1E3WA 1N92A 3GVXA 2XAAA 2C59A 5L51A 1LUAA 1V0JA 1T4BA 1CYDA 3KBOA 2NVWA 4WASA 4B8WA 3WNVA 2ZATA 3TFQA 2UUOA 4HY3A 4OYRA 3DR3A 4GLLA 3SXPA 1P1JA 2XF8A 4BS9A 1NAHA 4WCFA 4R1SA 2ZK7A 3UAGA 4JQCA 1L7EA 2VHYA 3CSDA 1YDWA 1H2HA 4H3VA 3H9JA 2X9GA 1LLUA 1O9BA 3D5QA 3RBZA 5JCJA 5KIAA 1Z45A 5L45A 3L07A 4BIIA 1HT0A 1BW9B 3SEFA 1H2BA 2DBRA 1SB9A 2EW8A 2UAGA 5DT9A 1P45A 1EK6A 3GK3A 4NBVA 5JO9A 1DLIA 1HYGA 3E82A 4YBZA 4D0SA 1SOVA 2YV2A 3JQCA 4NQZA 2WSBA 1I3NA 1ENPA 4XQCA 4MVJF 3IAHA 2NVUB 2V6BA 1VKOA 3NDIA 3AFNA 2GN4A 4GLOA 3EHEA 4CMKA 3B70A 2O3RA 5IF3A 4Z0TA 4K26A 1NQOA 4L76A 4J0FA 1SAYA 1J4AA 2RH4A 3EVTA 5EQFA 4DBVO 4XZ3A 4IY1A 2FWMX 1E1LA 4PLVA 1U7HA 2CDCA 1P77A 1V3VA 3OECA 3L9WA 1KVUA 1DIGA 4ZQEA 1XU7A 1WVGA 3RKRA 4FCCA 1H0KA 3S55A 1PZFA 4O59O 1DC5A 3RC1A 2WYVA 3UUWA 4E32A 3VPGA 2Y93A 3C7DB 4R68A 4UUOA 2W90A 4CMJA 3K8ZA 1ZSYA 3K30A 3T4EA 1D4FA 4RLSA 5JMPA 1UZMA 1V8BA 5TIIA 2J3JA 3I9NA 2RAFA 2YFHA 3ITKA 1HEUA 1GYPA 1BMDA 4GWKA 1W8DA 3BTUA 3OJEA 3TWOA 3W4KA 3W8DA 3WGOA 3BMOB 4OJNA 2BGLA 2JJYA 4OXYA 3ADOA 3I6IA 4RQTA 3ZI0A 1D7OA 4BKUA 2IYOA 5C3MA 2ZTVA 4DL9A 3BZUA 5IG2A 3NAQA 4FJ1A 4ALKA 4E12A 3VPFA 2X22A 1K2WA 3KLMX 2NADA 4M89A 3QVWA 1KY4A 2Y1FA 4N5NA 3VPSA 2OHXA 4L4XA 3X2EA 3U4HA 1B8VA 3NX4A 1EMDA 2R00A 3GEGA 3ENNA 1Y8QB 3GRKA 1Q0QA 3P7MA 1GU7A 4IDBA 4J3FA 4PCVA 5DBIA 4WCFB 4R5HA 3E03A 2O2YA 3A9WA 3H8VA 3IKVA 1Y5MA 2JD2A 1R6DA 1DBVO 1N9GA 2ZB3A 3RIHA 3ZHXA 2HRZA 1L7DA 3C1AA 4FD3A 4PLHA 2Z5LA 1PJBA 5B4UA 5JAIA 3L4BC 3GA0A 1ZNQO 1JWAB 1PGJA 3BMOA 3I4CA 4J43A 4J6FA 1GY8A 1QYWA 1E7QA 2J3KA 2ZTMA 2EP5A 1AN9A 5G0TA 1AGNA 1MP0A 2E49A 3DOJA 4XB2A 4F6CA 2C5EA 4IDEA 4RPGA 3U5TA 2BFAA 4NHEA 1PJ3A 5IN5A 1AUPA 3WR5A 1QG6A 3EAGA 4TROA 4UREA 2PZKA 4IIVA 3CXRA 4N18A 3H9QA 5LC1A 5JO0A 1JAXA 3SVTA 1V3UA 3MWDB 4FPXA 1KC1A 3MEQA 5AXDA 5JPIA 2ZIZA 1HLPA 5JW6A 4XQ9A 1VJTA 4IXTA 4JX8A 1MXFA 4CM8A 4NJOA 3PQDA 1NYTA 4BMNA 2HK7A 1KEWA 4PZCA 4JLWA 3DHYA 9LDBA 2VTEA 1VE9A 4BO3A 3OHSX 3ROKA 2NUAA 4LVCA 3EUWA 4H7PA 2PWZA 3BTSA 1A5ZA 2EGGA 1YGYA 2I67A 2OFPA 4B4WA 4DLAA 3GDFA 1XKQA 2QIOA 2HJRA 2GPTA 5GY7A 5EN4A 1NAIA 3UKOA 4OSOA 1GCOA 5KKAA 3A1NA 1ZW1A 1EUZA 2VQ3A 3A4VA 4BNJA 4JP2A 2GDZA 3V1UA 3EVNA 4BNLA 2G0TA 2GRAA 4E6PA 3BYZA 1JTVA 3GG9A 5I7EA 3UCEA 4W6ZA 4FQ8A 1E5LA 1I2CA 1CQJA 4ND2A 1O6ZA 4RVGA 4LW8A 2DC1A 1FDVA 3I1JA 4OGWA 3KB6A 5JNLA 5TRTA 2TMDA 4BNZA 1HDGO 2AMFA 2YDXA 2IXBA 2DAPA 3OIFA 4FFNA 4MPDA 1EQ2A 3K9QO 5BSFA 3JCZA 1E6WA 1CRWG 3OJFA 3PEFA 4IGFA 4OL9A 4YVFA 1X1EA 3V1YA 3KUXA 3BAZA 2GGSA 3KETA 3QVOA 4TWRA 2EF1A 3I3OA 1PJTA 1B3BA 3LC1O 2VRCA 5G4KA 1H6BA 4R51A 4EW6A 3L6OO 5CDTA 1Q0LA 4WLEA 4RVUA 1KVRA 3BXXA 1BG6A 1XR3A 1YO6A 4OKIA 5BNTA 4FS3A 5CFZA 2CUKA 3CH6A 4D3FA 3D5TA 5ADHA 5T64A 3ORFA 4UUNA 4ZA2A 4IXWA 1NASA 3HWRA 3QE3A 2GZ2A 3HN2A 1U8FO 2J3IA 2O7SA 4OIMA 3JD0A 4XA8A 5JLAA 4E13A 3FNEA 3AFMA 4RVHA 4LN1A 2H1SA 1YKFA 1GFSA 1U2GA 2GR9A 2EXXA 2BFMA 1P31A 5A02A 5GMOA 3BIOA 3IC5A 4ZU3A 3QHAA 4EJMA 4ZQBA 1IUKA 1K5HA 5JDIC 2AQKA 4MVJA 3ZWNA 2YV1A 5THQA 3GDGA 2RHCA 1U8XX 1H94A 1Z74A 1U4SA 4GSLA 2OXIA 1Y1PA 4Z3KA 3DO5A 3OEYA 3DOOA 1KOLA 5CDUA 1C0KA 1GTMA 2EG9A 4LVUA 4L75A 5F3RA 2Q1SA 3G79A 1I0ZA 1YJ8A 5AOVA 2FP4A 5T6BA 3ETGA 4RDHA 1ENYA 4PLPA 1R15A 2JD0A 3QWBA 1LSJA 2GD1O 2HU2A 1EZ4A 3CZMA 1PQWA 4PN3A 2BGKA 3KYDB 4Q9NA 1XHLA 1TI7A 3QW2A 4Q39A 1LDMA 3Q2KA 3H9UA 1C14A 1OBFO 1DXYA 3O26A 3P2YA 4GVLA 3OQBA 1BDBA 1C0IA 2OOSA 3PFWO 4MVJI 3GNTA 6LDHA 1NVMB 1EVYA 4UVIA 4CQMD 1UDCA 1OC2A 5A4DA 3OJ0A 5DOVA 2H5LA 1H9BA 1CDOA 3N58A 1O0SA 4PZEA 3GVHA 2PD6A 1QYXA 4IJUA 5EESA 3ZU4A 3JYPA 4R01A 1UP6A 1B15A 1GL3A 1C0PA 1HE5A 3K73O 4YAJA 4CLHA 3EY4A 1E3JA 1CF2O 3PIIA 5C7LO 3KZVA 4Z0PA 3WSWA 3FF4A 1PEDA 2JL1A 4HFJA 4BO8A 2CFCA 1SNYA 1HLDA 1ZXLA 3L4SO 1HZJA 3F4LA 3IMFA 4J7UA 5CEJA 1CJCA 2JCVA 5A9TA 3UVEA 2WM3A 1AE1A 4KTTE 4PG7A 2BFOA 3LSYA 4OKNA 1E7YA 4JBHA 2G82A 4OO3A 5TJHA 1SPXA 1NPDA 2X1HA 1E7SA 3ZV4A 3QA9A 1U2DA 3UN1A 4QUKA 5L7YA 2O50A 2WD7B 3KRTA 1GEGA 2RCYA 1ISJA 3PK0A 2FPIA 1K3TA 4S3MA 5BSGA 1KC3A 4ONEA 4XR4A 1DPGA 1PU2A 2VZ9A 3H2SA 3P5SA 4FDAA 5I9NA 2Q2WA 1U5CA 1NX6A 3PWSA 1GADO 3U3XA 5K0ZA 5ER6A 3GEMA 3U4DA 4DRYA 5CDGA 4JIGA 1EFLA 3GOHA 3LT4A 2PTGA 3O03A 1KERA 5AXAA 3IS3A 5AQ1A 4MOWA 3W6UA 4ZHSA 5BNIA 4Y98A 3L77A 2VWGA 3V8BA 1FDUA 1GD1O 4FFRA 3NKLA 1MG5A 1ZJZA 3IP1A 4BNIA 3LLSA 3TZHA 3TOZA 8LDHA 1YL7A 4MVJM 1JA9A 2BFPA 4E0BA 1K6IA 1MG0A 2NACA 1T2EA 4NBRA 2I76A 1U9JA 4DMMA 4NDNE 1JKFA 2JFFA 3G17A 3I9OA 4CPDA 5I8WA 3I83A 2FZWA 1MV8A 3MJ4A 5CEFA 1DIRA 3ZNOA 1GCUA 4C4OA 1HF3A 1PJCA 1ZEJA 1MFZA 2WE8A 4CLRB 1IOLA 2W2LD 2CD9A 4HBGA 2VHVA 4MVJE 5C7IO 1ZSNA 1WMBA 2X5KO 5TF4A 3VTZA 3ZH2A 2YUTA 5HTOA 3K96A 5THKA 1DSSG 4O5OA 3DOCA 3PZBA 2D0IA 4HXYA 4MKXA 4E5MA 3UICA 1LA2A 2I99A 4DQXA 1SB8A 4IJVA 1GDHA 4IINA 4HV4A 3MTJA 2F00A 3WFJA 2NM0A 4AICA 4FFMA 3IUPA 4D44A 4BB5A 5FFFA 1PZHA 4EBFA 4W7IA 4ZVVA 4AJJA 2PY6A 5JYEA 4CM9D 3VZQA 4JNKA 1ZCJA 3JQ6A 3UH1A 3ICCA 1OMOA 2OORA 2WD7A 3CIFA 3IJPA 2VRBA 2ZYAA 5DBGA 2D4AA 2BHLA 1G1AA 2EKPA 4XIJA 4EUFA 1O94A 3NGXA 5B4VA 1QV6A 4QECA 3TZKA 3ZWVA 4ROSA 1GUZA 5IZCC 3BTVA 3H65A 2I9PA 2B36A
chains in the Genus database with same CATH superfamily
2DLDA 2EJCA 3HRIA 1ZR2A 2AJ8A 1CRZA 5DM0A 3QU7A 1VJ5A 3NDBB 4PFSA 1L3CA 2PYZA 4UBMA 4EA9A 2BY4A 1WKCA 4RKRA 2CW5A 4YTEA 1QYRA 4Q4DA 4YJ2B 2DBZA 3AHDA 1L5KA 3UYKA 4BRUA 5LJLA 2UXDB 4RELA 3DF7A 2CKDA 3LJKA 4B75A 1G5HA 3LH5A 4Z4HA 5K3SA 1NW6A 2ZIAA 4JQYA 3INYA 3AI2A 3CPJB 3DT8A 3AOEC 3K4HA 3NTLA 4Z9AA 3IJ5A 4ZU1X 4EZIA 2AFVA 2WT9A 3HNPA 3P32A 4LRWA 2IV7A 5DHPA 3AMVA 2PUTA 3UV3A 621PA 1MIOA 1QIDA 3TVYA 2BJVA 1WO8A 2Q1UA 1GPMA 3EGCA 3H2IA 1FYWA 3CNQS 2W70A 1A7JA 3K0AA 4WBNF 3KWFA 2V7WA 5BOSB 3OJOA 4ESOA 5T7BA 3O8QA 2NZVG 3GMIA 3CV3A 4M8LA 1GZUA 2SHKA 3CEHA 4IKOA 5EP2A 3FBTA 2Z57A 3GLKA 3PC4A 1L8QA 3GZ4A 2BF7A 2ZBDA 3MF4A 3QFCA 2W2LA 4JUBA 2JFQA 4MUFA 4XWTA 4QDOA 5TR9A 3I8XA 3IEVA 2QOEA 2CE2X 3EUAA 3EQ7A 4G9EA 5ENVA 2V7XA 5EE9A 2WT4A 3UK6A 2A1TS 3A3YA 3K9FC 2GO7A 4MYRA 1NBME 3TW6A 4BLWA 3OTQA 3AL0C 3P71T 1DCMA 3MWLA 3QWFA 3PQ4A 3D0OA 4PLTA 1ZH2A 2VFAA 3TI7A 4L85A 3TNYA 1X1QA 4L5CA 2F3TA 2PUHA 4OAQA 4PC7A 1P5HA 3L0IB 3T9EA 4URFA 4GOXA 1CERA 4Z2YA 3U62A 3WRXC 4U6SA 1PBTA 3UJBA 2PHZA 4C20A 2WP8J 4FMCF 1I7PA 3HWX1 1EK5A 2DQYA 4URVR 1N5JA 2PJRA 1T9AA 4XEUA 1PGQA 2VBIA 4J16A 1EB8A 4O29A 2VJMB 3C43A 2PAFA 3MCZA 4OMDA 1BWPA 1Z28A 5ALMA 2QU8A 1O94D 3TD6A 2JGEA 1JB9A 1IIRA 3GEPA 5BNFA 4DPKA 1ML3A 2GHQA 1CV2A 4NEGA 2GEJA 2AGVA 4A8PA 1O95C 2HA5A 1DLJA 4MP8A 4Y0VA 1NIPA 3TKYA 4EELA 1BGVA 3BL6A 4IRMA 5B58T 5BWNA 1GTRA 1Y1TA 4QU8A 3LWBA 4G6ZA 4REMA 5AJVB 2AVDA 1XDWA 5FR2A 3IT2A 4IH9A 2D1TA 3VSCA 5CAEA 5BQFA 3ETJA 2FPLA 5A5DA 3QEMB 2I87A 2AFHB 3GN2A 5HBGA 2RGXA 1CTQA 1C3JA 4K0KB 2OUIA 1M6VA 1I80A 3OKFA 5F3WB 3JYOA 3L8FA 2D7CA 4BO2A 2WVGA 2XSZA 2QG4A 3H5TA 2FEXA 1XYYA 3USES 3CA8A 2H1FA 3OOHA 4II7A 1DDIA 2Z5VA 1VL0A 4Q12A 3VJKA 3ECCA 5C5IA 3ND6A 1ECCA 1U6JA 2VPPA 2ATXA 1MAUA 1F4PA 3CO5A 1R0ZA 3IQEA 5ENDA 1L5VA 1D0IA 3M3PA 4FB4A 3ZWDA 5IJZA 2RK3A 5CXSA 3ZVRA 5AOCA 4BUCA 3L8GA 3FUTA 2Q27A 4I8XA 4M7PA 4XLTA 3E9YA 1FP4B 4IS3A 1I6MA 4F9TA 2TMYA 4QUGA 2PX5A 4ESHA 5I6DA 4QHYA 1AKVA 1KK1A 3U3KA 1JH8A 3VH1A 1SXQA 5J63A 1N5KA 3ZBQA 1NXTA 1N8NA 2DX7A 1RE1A 4ND8A 2OHHA 1GVNB 2NUTB 2P6MA 1Z2NX 1ZRSA 2IYRA 1I2DA 3COPA 4JJAA 4PAWA 2PGOA 4E2WA 5KOYA 3DMGA 1QV7A 3TLGA 5BV2P 5JSKA 1AU9A 3Q10A 1H8ED 5E4YA 2AYXA 4NJMA 1V45E 3TBHA 1AQYA 3IPYA 1W0JD 4WN9A 2OZLA 3D5EA 3Q0IA 4HXGA 5ALRA 4MW6A 2IEBA 2HV9A 3GB9A 3CJTA 4RJIA 2ZRIA 1S3SA 1A88A 3HYTA 1JIVA 1G3IA 2R6R1 3LY9A 3MXOA 3R5XA 1SPBS 2DT8A 4MCAA 3WYFA 4BNTA 4UUPA 3IUEA 4GPD1 4BL5A 3LA8A 3BC1A 1UJMA 2Q4RA 1JUDA 1DS6A 5DYGA 5IBPA 1K8XB 3WMEA 5C35A 1M7HA 1G7SA 3QYAA 4TYPA 1E6LA 5D7NA 3BHMA 4WNAA 1ESEA 4CMCA 4L9SA 1W29A 3BE8A 4F1KA 1XEAA 2B3TA 1NI4B 3DJYA 1GU0A 1QFZA 2GPSA 3AONB 1TTTA 4YUZA 2VZLA 4QT4A 1PSDA 1Q7BA 1T9GS 4QTXA 5DTMA 1XAGA 3LAWA 1KDPA 3HDJA 3TF5A 4MWEA 4M8IA 3PVZA 3KXDA 1HNXB 4Q24A 1CUHA 3C14C 4S1PA 5CLFA 1EGVB 1NN5A 4FFOA 1AHHA 2GFQA 3BWEA 3JZMA 4HQ6A 3UAVA 5KNBA 4Y0NA 5F23A 4KQXA 3GWGA 3ZNPA 2PEZA 4C6TB 3E9EA 4Y6SA 2AK2A 3BXPA 2QP9X 1ICIA 4JB3A 3M5PA 1WV1A 4JKYA 3DEFA 3KAJA 2HSGA 1N1DA 1RCUA 2RHDA 2Y68A 2ZI5A 4Y9UA 1Z0JA 3VHLB 1AS3A 2FHPA 1PLKA 3FAKA 3H75A 3PV0A 3Q72A 5K0GA 2V7UA 2Y8EA 1KDRA 1KL7A 2Y77A 3P0RA 4GBJA 5DRTA 1G4UR 1STOA 5JROA 4PXSA 1MC1A 4CL3A 4HEA1 1U1GA 4R1OA 1GDDA 4FNAA 1YFKA 4RU1A 4DLTA 1XJCA 3ORRA 4JN6B 4O1HA 5AVVA 4NBUA 2NUPB 4UBNA 4OB8A 1QX3A 5KTNA 3PFFA 2HWUA 4N3CA 3AKYA 2GERA 4DNQA 5AVRA 3AIMA 3CJQA 1IZZA 4GU5A 1RRKA 2DPYA 1KBZA 1OCEA 1UJ5A 2P30A 4EEZA 2R0QC 2PUVA 4KXUA 4WZAB 4MWCA 4RTLA 1KZYC 4ZAFA 1T5BA 5FWXA 4YRRA 3RUAA 1V4VA 1E4YA 2H2HA 2ZWOA 1LV7A 3GBPA 1OIVA 4TZ0A 4RTKA 4OYHA 1BE6A 2FLVA 3Q7IA 5H4GA 1NHGA 3MJSA 1W5SA 3Q3IA 2E5LB 1KZ9A 3S5UA 1U0RA 1QUFA 1KEEB 3JAWA 1WOMA 1MVOA 1Q1GA 3BJRA 4AJHA 1UAAA 4FUQA 4B48A 3PIRA 3PJFA 4FINA 1NQXA 4OQLA 4HD8A 3RAPR 2YV4A 3AZQA 4Q3BA 5KJEA 3DNMA 3FHCB 3FOBA 1FMTA 3ZD8A 4ZAVA 2YYAA 3HB4X 4QXQA 3SXJA 4MYSA 3GEIA 3I09A 1A5TA 4R1UA 4XWYA 5K0LA 2WIJA 5I4KA 5I9MA 2LIVA 1R74A 2JDID 2J6CA 1DZIA 5F5NA 3LECA 4ZT2A 4KQHA 1DADA 4Q9LA 3IX7A 4YV1A 2R8EA 4PLYA 1VB3A 3AY3A 2Q4DA 4EA6A 4GG1A 5BN3A 3S2YA 2XUQA 1AXEA 3BH7A 4UNRA 4CFSA 3O90A 3SBXA 3B1KA 3HKEA 3K8YA 1E6MA 3RJMA 4LI0A 3NP9A 3OUZA 4LZOA 4OFWA 3EFOB 3O4VA 1OB2A 1ZIXA 4UHKA 1US8B 4YJ2F 4QDZA 1SZJG 4GWLA 2HX1A 1DAIA 1ZU5A 2G25A 1J22A 3HB5X 4ZVLA 5TXGA 3RABA 5A4AA 2G1UA 3QWIA 2ZKLA 4J3NA 2X0IA 3A2LA 1WAMA 4URUR 5K09A 1Z08A 3FM9A 4H60A 5DV9A 4MVXA 3GRPA 4CL0A 1AO3A 1JDZA 2M2IA 3IAAA 4TUYB 2P3LA 1YJCA 4BGIA 4PNZA 3DHNA 2J32A 1XP8A 1BJKA 3AJEA 2Q49A 1CJKC 2WSMA 3TL3A 4EABA 2WSYB 3BH0A 2JCYA 5K9ZA 2PTHA 3UXYA 2Q8PA 3HDHA 4IRXA 4FNGA 1CE8B 2UUPA 16PKA 3O6VA 4J90A 4LRQA 5AKZA 4C14A 4EHJA 1QHHA 1X8KA 1LNQA 4MQUA 4NYMR 2A0UA 4LC1A 1P2DA 1W6RA 2XQFA 4KRYA 2WTNA 2Y0EA 1COWD 2A6PA 4UNPA 3RASA 1YRWA 3MINB 4UNNA 3WK5A 3G0OA 4DQDA 4QEKA 4F3CA 2OZPA 3OPMA 4PBSA 2UZ1A 2RHGB 2PWYA 3KSDO 2VPQA 4CEJB 3FZGA 1PRYA 3E23A 1VYUA 2YMQA 4KVAA 2CXUA 3RSHA 2GAIA 3DTYA 4L0QA 3TX2A 2N3ZA 4C4YA 3WGZA 1WDWB 3OZ7A 4HNGA 2WY2D 4UEQA 3U13A 3BIJA 3D59A 3W8EA 3VH3A 4MUGA 2WMYA 2QDXA 2CFOA 2CKMA 2VCEA 4FKBA 3W5UA 1HX7A 4FIDA 3PHHA 1EDOA 4NKRA 3JAKB 4KPUB 1HZZC 2G77B 3SJZA 4ZCRA 1WL8A 3IEIA 2B8EA 2PO7A 1NJSA 3TGLA 2VDNB 1FUEA 1HA3A 1R4AA 3C7AA 3AY0A 5E4TA 3UB4A 3ZDRA 3NHPA 5JC1A 4UPDA 1MORA 1ZSVA 3X1JA 1A71A 2CWDA 4IWYA 1FYDA 4RGVA 1HEYA 3WV5A 2G40A 5HPYB 1P2TA 5HS4A 5L7WA 4P0PB 3EFEA 3B3JA 3FGPA 4E21A 3LFUA 3PT9A 2SCUA 5EP3A 2HADA 4KREA 3E5NA 1TPYA 2VEOA 4O2BB 2RHTA 2VTBB 1H66A 1BJTA 3DDOA 1Q16A 2AMVA 4DTIA 1J39A 3SFTA 5A9SA 1Y80A 3R8FA 1HOTA 3C5CA 1AGYA 3JATA 4CLEA 5KNDD 2OBYA 3BWVA 3DMPA 1V7CA 1FP2A 2GETA 5CX1A 2PWAA 2I7CA 1T1JA 5K5EA 1HQCA 2I33A 3OQ1A 1YZUA 2OUKA 3VYSB 2C9CA 7ADHA 4YIHA 3VR0A 4RVSA 4QBKA 2X42A 2EWMA 2QROA 2XMSA 1TW3A 1OILA 1WXDA 2ACEA 1JVSA 2YXEA 3M6LA 2NQ2C 3F90A 1RPAA 1XU4A 2X14A 1KY3A 3ASUA 1P1KA 4MR8A 5DGHA 4B2YA 1E8NA 2QTLA 2R1TA 2VF2A 2LDBA 3UJAA 4JENA 2RGCA 4ZXPA 3INGA 1XJ5A 2M6KA 1C1YA 5JV5A 2I5PO 1KP3A 2YWDA 4MW4A 2FR1A 4RSMA 4WX2B 3QUTA 5D1NA 4F06A 3HXOA 3T52A 4G86A 3LK7A 3QJYA 5FA5A 4JBGA 4B47A 3S28A 1U7UA 4PS0A 3K0HA 1CT9A 4MZXA 1YH3A 1R8QA 1U2ZA 3ZLJA 1PT9A 1J9ZA 4MYDA 4HLCA 4JSTA 2H2DA 4BP1A 4BVHA 1PK7A 1TIPA 2ZROA 5EKXA 4ZHQF 3HK2A 5ELLA 4I1IA 4F84A 1FS6A 3M1LA 1U99A 3F8TA 4RHUA 2H4XA 1EYZA 2GAFA 5ALVA 4I1YA 3DR5A 5M3BA 1IUNA 3T5TA 4DRZA 2O2JA 1TRHA 3PHBE 4LHEA 5EIXA 4PYIA 2WU0A 3AUAA 4B45A 2UYYA 4JLDA 1U4OA 2PLAA 1K27A 1X92A 4QZVA 5JAPA 1V5EA 2Q6IA 3R4VA 3RUEA 4MRAA 4DUYB 2C2OA 1BWRA 5CAEB 4R2MA 1BS1A 3MLEA 4D3YA 1DBWA 1MPXA 2OWDA 2G0NA 4LV5B 1E9EA 3BFJA 4MWTA 4CLOA 3N7TA 3CY6A 1CJTC 4DV6B 4OFXA 4XDYA 1WXWA 1P19A 2ZBVA 3LBNA 4F46A 2QR2A 1ZA1A 3DE5X 2ZSEA 4R31A 1II9A 4C7XA 4EUNA 3DWGA 2WIFA 2RI0A 4FC6A 1I2ZA 1U04A 1P61B 1PL0A 1U9YA 1DARA 1AHIA 2BGTA 3GAFA 3M2PA 4G0YA 4GLBA 3NAZA 2OLKA 2W2KA 5D6OA 4AZWA 3QMWA 1PYDA 2PZLA 2UVPB 2VYVD 2O8BA 5AHRA 1NN3A 4HYTA 5AW5A 2WFZA 4XJVA 4TVOA 2SNIE 4IFEA 1ZUIA 3RYHB 3WL7A 1DT5A 4DC0A 3L41A 4JR0A 3E3MA 1UK8A 1TUEA 2FOIA 2YOGA 4ZCLA 5K3FB 4Q93A 1E20A 4JL6A 3TL6A 4LWPA 4FFBB 1I4LD 4YWJA 1E3MA 3RS5A 3EYWA 5L3RA 2PL3A 4NPHA 4UUMA 3CRW1 4AZ0B 3VDMA 3PYXA 4Q00A 4RGQA 1A4IA 1OWMA 2KMLA 4HWSA 5A03A 5K4HA 4I8DA 2XEXA 3N8GA 4UTZA 3I04A 1Q50A 3RF7A 3NBUA 2NV0A 3QPVA 4Q1VA 3CB2A 4RANA 2ZOSA 4LUCA 3IO3A 4RPHA 2A88A 3Q8WA 5G02A 1M1YA 1TU3A 3IHWA 4IV5A 2QE7A 3KLBA 4K88A 3Q40A 1R0BA 2JNWA 2IS4A 3ZV3A 3EIOA 4K9RA 4AK9A 1Q3KA 5JY6A 1QH1B 1JNYA 3OC0A 3GEEA 1KAEA 2QMUA 3F6PA 3MXTA 1P80A 2A92A 4JGBA 5E1DA 5AJUA 4B4UA 3ETEA 2CJPA 2D0DA 3LHKA 3KKOA 4V39A 4IIBA 1Q91A 2OZLB 5JYDA 3HSKA 4BQFA 1XVTA 1R6TA 2H48A 1R0YA 2O0JA 3NRCA 5EMHA 4JUFA 5FQOA 2VA9A 2Y0DA 3D6JA 1KEUA 3OZVA 4AY6A 1JH9A 4IZIA 4OATA 1NXQA 1QSGA 3V4FA 2B7CA 3JQFA 2QD4A 2F4VB 3EVAA 1LGYA 1PW7A 2JB9A 2R65A 4HR7A 4I5GA 1BDJA 3NT4A 4UPVA 5E6SA 5F5XA 3V2GA 2P8JA 2Y1KA 1V48A 2P5YA 2GCOA 1E18A 4M54A 3TSZA 3C3CA 4E4RA 2PRKA 4TVKA 4GMFA 3LWDA 2C04A 2PR2A 1EP1B 5AYVA 4NICA 2XGMA 1ADJA 1S1MA 1OWLA 1TMKA 4GR4A 4KWIA 2P0AA 5ALDA 2JBAA 4IBOA 4QDJA 2H1IA 3MWFA 3N0XA 1BROA 5CK5A 4MHOA 4XLZA 1K8YB 4F93B 3F74A 2RD2A 2RHMA 6ABPA 5LP1A 4Q3NA 1WCWA 3UJ9A 4KFSA 2IYYA 1RZUA 3HL0A 3REGA 2NW6A 4OYYA 2H1OA 4B6EA 1U2RA 4DJ5X 2B98A 4TLLB 3WO1A 5C1OA 2NV6A 1Z6ZA 2OO7A 3FSJX 4YJHA 4YFVA 1ZJYA 1YZFA 2AIRA 3PC8C 2LR0A 3CRNA 1MB9A 4OKSA 2GXUA 4JXKA 4DLVA 1J5XA 2B0JA 4YCLA 5LP6F 1E92A 1DIHA 4IEFB 3VUFA 3EX7C 1GAXA 3LUDA 2ACKA 2FMKA 3IAEA 1L5NA 4W5NA 1FC0A 4UD2A 1MJGA 2FFJA 1R0SA 1V6SA 2NQTA 3R8XA 3VAAA 1E9FA 1AZWA 3C6YA 2XRZA 2O7RA 3ZCRA 2OMKA 1I4OA 4OXIA 3KCQA 2V54A 4K6KA 1IWPB 2IV3A 1GP2A 2C84A 4TMYA 2I55A 3ESCA 3R3SA 3FWNA 1NBIA 2QORA 3CKYA 5CX4A 4JI3B 1SC9A 1YL5A 4CM4A 3ZXUB 1A76A 2O06A 1OC4A 2VLIA 2M1ZA 3DSRA 1LF5A 3I64A 3NH9A 4IH4A 4ZQFA 2F3RA 1A7AA 1Z9BA 3MJVA 3M70A 1J42A 3TMKA 1F2UA 3ESAA 4K9KA 1RFLA 3HDVA 4HN9A 4D0NA 1MOQA 2CHVA 4D8XA 1TECE 1LS1A 4KWCA 1VB5A 4DGSA 4LWQA 3IVXA 4WOCA 3IAUA 4IIUA 5HG0A 3L46A 4QELA 4BO0A 1C7QA 2R8ZA 3OH8A 4A36A 4YJ3A 3IUJA 5CYPA 5AR1A 1JVNA 3QPDA 2VRCD 4K6CA 3UWSA 1K8RA 1LZLA 1QS0A 1JSRA 3CR3C 1G41A 1OXMA 1E9BA 1J7JA 2B5VA 3IT1A 4Y6PA 2ZE8A 4BO4A 1GZ4A 3AH8A 2JS7A 2ZREA 4IQGA 4KOAA 3WGGA 3K2EA 3DXYA 1LK0A 1E3DA 4N3GA 1YTLA 3G9ZA 3HU2A 4OUDA 5LA6B 2NMVA 1IU9A 4L8GA 1FDIA 5GQSA 3D02A 4PO9A 3HPQA 2O8CA 4RE5A 1P0FA 3OZUA 2IZ6A 2WYUA 1SD2A 2NX2A 4MMZB 2ZJBA 4XYEA 3OBBA 4BP9A 2FEKA 3JASB 2E7ZA 4Q7EA 3WWZA 1GEEA 4PE5B 4CGZA 4UM7A 1C1XA 1EDBA 1W88A 5CPFA 5DTEA 1JAZA 4FZJA 4YN3A 4E7OA 5JNUA 1CUGA 1R9NA 1GQ2A 1I5OA 1Z82A 2NWQA 3O2NA 5DX1A 4A2CA 2AKEA 2CLKB 2DPHA 4A3SA 3KYJB 4OH7A 3GN1A 3L7KA 2HTFA 2O1XA 3L9XA 1T0BA 3DE6X 3NJRA 4BNKA 4BZQA 1JEYB 4AXBA 3JAMA 1ARZA 2DE0X 1N6RA 4P58A 4WJLA 4UTPA 2XMDA 2YRFA 3A1EA 3GCWA 4OBEA 3OU7A 2NP6A 1UODA 3GLTA 4K8RB 3EZNA 1JX6A 1L5HB 2LIPA 1XQ9A 4FJ2A 4MI9A 1YSCA 3VJMA 3IPLA 1Z7EA 4TUYA 2EJTA 4WOPA 5CH5A 3GPBA 4LVOA 2F8SA 3WRWA 5DEOA 3R4CA 4QUEA 3FYCA 4WXEA 3RQIA 4GE3A 1XFDA 1W6UA 3LSTA 3PHIA 4UOQA 3W2FA 2RE8A 1KKMA 3EC1A 5AUQA 3RG8A 2FQ1A 1JA0A 2ZJAA 5CVEA 1KZ6A 4L4RA 1N2SA 3TK1A 3T7SA 4AX4A 3TD9A 5L4LA 3KKKA 1ID1A 3MINA 3WVNA 4OEHA 4C29A 4J4BA 5CG1A 1QYVA 3KJZA 2LZ0A 2PBZA 3EARA 3QG1A 2VP9A 3P0EA 5B12A 4EPWA 2J9RA 3BICA 4WZBA 4G5GA 3LPCA 1WZNA 3N2YA 4YRDA 5ITVA 3KBBA 3DVLA 3FD8A 1LQ2A 1EFTA 1SCUA 2HBRA 3V7UA 2D7DA 1EWQA 4DUZB 2ZWPA 3DBOB 4IGIA 4JIMA 4MB6A 4RNCA 5EJ7A 2FUG6 1JJBA 4TPKA 5AH0A 1VSVA 2EF0A 3SF8B 4D96A 3A6LA 5LXTA 1CZUA 1K6EA 2IELA 4FOLA 3RRXA 1AX9A 4ZEMA 5M29A 2C7OA 1T0IA 1XD2A 1NF9A 2PM8A 4C0SA 4I4TB 2VUUA 4HVCA 4F3KA 1OI2A 4X45A 2R8BA 1P3DA 4E33A 1SD1A 3E81A 4N5LA 4CQNA 3PQ5A 4LXIA 1D3AA 4BC1A 1EJ2A 4ED9A 3ZWBA 3VDQA 4HWOA 5LZ4A 1G5TA 4MUNA 1RRGA 1GXSB 2AEFA 2YZ7A 4L74A 5AM3A 1SCAA 1FFEA 4Y2UA 2V6GA 2P2YA 4X1IB 3L6CA 2EU8A 1QM5A 3COYA 4NVRA 1FSSA 1PFVA 4GPEA 1RM4A 2GWRA 4L07A 1Z5UA 3R0XA 1I4EB 3E9DA 3GIDA 5IJWA 5TQJA 2Y76A 2CT8A 3NPAA 1U9IC 1XDGA 1KEZA 4DSAA 5JZMA 5CX1B 3FNFA 3ZIUA 1PJQA 3ETDA 1NW7A 4MKHA 4KR0A 3C6QA 3QLUA 3H0KA 4IIEA 4POAA 4V2IA 1V8PA 1U3WA 3AUKA 3K35A 4K03A 3ZIAD 4DREA 4MH0R 2Y67A 3M6MD 4L73A 1OYWA 2HLDD 3EXHC 5G0WA 3SSNA 3U80A 2KWIA 4PX2A 5JPCA 3HDTA 2V74B 2IZZA 3OICA 1G4HA 3HJBA 3L01A 3UF0A 1V7QA 5H9VA 3URKA 4A2PA 5LQNA 1YC5A 1DO0A 1TEVA 1UC4B 1T2UA 1LRJA 5TSDA 1GDTA 3M49A 1VI2A 1LPMA 5DYIA 4KOEC 4E5PA 3WAGA 1P2FA 3PTZA 3FMIA 4MUJA 1E6KA 3JQAB 4D43A 4AW9A 2OHJA 1TD9A 1TO2E 4MGIR 2Z8YA 3WXBA 4FYMA 4UC0A 1K6JA 3JVDA 5BPFA 4XGNA 3FDIA 1I3CA 2XVXA 4D8UA 2CL5A 3MZ0A 3GJ3A 5AI4A 3RM3A 3V8VA 4E1AA 3BMNA 1CUFA 3N0RA 4KUHA 5FXMA 4O4JB 4K6OA 1WBDA 2EKZA 1KDTA 1Z29A 4Z4GA 5EIAA 5IX8A 4GYWA 1L9KA 1T9ZA 3TN7A 4W5HA 4EHHA 1FVXA 2AOUA 2JI6A 2VR1A 3H99A 5DHTA 3S7TA 1GZ6A 1BXGA 3WIEA 5EHNA 4ABYA 3NETA 2ZQ5A 5IT4A 1P5JA 2N47A 2X15A 1LWOA 5TC4A 2Q4TA 1F2VA 2VSNA 2WWVD 4BB6A 2ZAMA 3D8RA 3K6KA 4GR9A 4UVEA 4F3YA 1PTJC 1AA6A 1J7KA 1NL3A 1P3Y1 3O92A 1A9YA 5D5HA 1I7SB 1RXIA 1KVQA 1GITA 3GFSA 4NEHB 4FP9A 1M66A 4OSEA 4DCVA 5LQKA 4H1UA 1LJ8A 2Q45A 4UAUA 1J9EA 4TTAA 4BO7A 1Q7EA 2B37A 1E3IA 1U2QA 5A4JA 1WHTB 2ZFUA 4L4YA 5A0TA 2YZNA 1G59A 7REQA 3H5RA 5IAOA 5KJ6A 4RY0A 3FF1A 2AN3A 1D0SA 2X5XA 4YI3A 5ALPA 1NYLA 1FMFA 3FKQA 1TYCA 4G3XA 5J40A 3PHJA 5AK4A 1ZP6A 4YLYA 4XUEA 1TUGA 5CD9A 2WOOA 3QBJA 1II8A 5BSKA 3PEEA 1T5TA 2NT3A 3GLFB 4J9VA 3ULKA 3U81A 1EM8A 1LRLA 1O08A 2YC4C 2IDJA 3SSAA 1D07A 4B6RA 4EYSA 4Z4FA 4QDUA 1R8YA 2Q6KA 1XMIA 5DP2A 4V1CB 4AZTA 4JBIA 1BE0A 1CUCA 1HSZA 2VUHB 1BVHA 3DH0A 1XRPA 4JUAA 3E9RA 3L92A 1H2XA 1ZWLA 2WVHA 1MB3A 3UHPA 2BBSA 2Q3FA 3WYCA 2NLOA 3NHMA 3BK7A 4RMJA 1I3LA 2X86A 2QRVB 3EA5A 4X00A 2QM7A 3QBVA 4WOBA 1XU9A 3EXAA 3O4GA 3OQJA 3GPDG 1NPTO 3PFHA 4CR8A 1Y7IA 3UJNA 3A1VA 2ZCVA 2VZEA 1CHDA 4QARA 3TJMA 2P6RA 1BZYA 2XXJA 1Q1BA 2E9SA 2ZIUB 3GGDA 4TGLA 4E3ZA 4OSPA 3GHYA 2I91A 4TYYA 4B85A 1V95A 1ECLA 1IG3A 1QZ3A 2Q5FA 1FX0B 1N5IA 3OIUA 4HZIA 4OUKX 1Y33E 3MQFA 2F62A 5C7OO 5E6UB 1ISGA 4LGMA 3HVRA 2QT1A 2A2ZA 2I03A 5KHAA 3D54D 3LY7A 4PGGA 3TLBA 1G8GA 4DMFA 1OFVA 3QYFA 4IDGA 3NIDB 1LLFA 3IBFA 4RJJA 2OXRA 2A9VA 3HEAA 4OXQA 1G9XA 2GZRA 2CF5A 2V3VA 3AOGA 4M88A 1MLDA 5A6VA 4RV9A 4JJ6A 2NU9A 1WLYA 1RQNA 3NHFA 5FORA 3T1QA 1RRCA 2ZZMA 4UDOA 3FR7A 6GPBA 3SQMA 2CXQA 2I8AA 2WF5A 3OIDA 5EWJB 5KTRA 1WRBA 1NT2A 3P20A 4JP1A 2Y92A 2D06A 4YJGB 5JXHA 1EDZA 2RHBA 2O3SA 3SDSA 3RC8A 4U8GA 3L8HA 1XYVA 4DT1B 4PGMA 3WNBA 4U39A 1USUA 2E5WA 4L1KA 2JBHA 2IV2X 4JSYA 2QTWB 2QIPA 1YBVA 4X3CA 4L3VA 4GVXA 4MPPA 4ZQGA 1FPMA 1H1LB 5K2MA 4WXMA 4G8DA 5B57C 5DXJA 3VO2A 4TV9B 3VVCA 4UBKA 3ZV5A 4GOND 1VRVA 4HDOB 1Q6ZA 2FZKA 4AG6A 1EE9A 1JFLA 1LK5A 4EHDA 2R7MA 4TTQA 3ZD6A 2I54A 5IT9A 1QO9A 4WVLA 2Z6AA 5CJ2A 2CXTA 3HYNA 2JFHA 3ON5A 3PD0A 3JD1A 2OSVA 2AKYA 2O8DA 3GQVA 3K05A 3EHDA 1H0RA 4QU5A 4V0RA 1YZGA 3DMHA 3NCTA 4GQAA 1B0PA 4KH1A 2YDYA 3WMXA 3HYCA 4ENTA 3FI0A 3AVOA 3UHAA 3CGGA 1ZIOA 2C31A 3KDAA 4HEHA 4B44A 2JJ2D 5KBYA 1H6CA 1COZA 2XECA 4TL7A 3A1WA 4RHEA 3VH2A 3MOSA 3JWPA 2FQQA 4JJGA 5K6AC 1RCFA 4E88A 1OKKA 2IHYA 2C7GA 3B9PA 4NJEB 1RYHA 4ARZB 1N2XA 2XITA 4O4IA 3RUHA 4NP6A 2G3YA 5KOIA 1LVUA 2RG7A 4ZEOA 3FKSA 4EJSC 1W75A 2DULA 2O2DA 2VJLA 3PXGA 1JJ7A 3KHKA 4Q6WA 5KI6A 1WZIA 1VL5A 2H5JA 4D4LA 5J47A 1M54A 1NC1A 2V7QA 2ZUVA 3IURA 5EC8A 4CODB 5BWMA 4JV5B 1NW5A 4MINA 2AZMA 3E18A 3L6UA 4GPIB 3Q3GE 1Z0AA 3B1ZA 4KKVA 4LCJA 3CTMA 1O96B 3E9MA 4JOCA 3LTEA 1AF4A 2H9IA 2LXNA 3HXTA 4WHMA 4IF4A 3SC4A 3ILYA 4DR2B 1KGDA 2H7XA 2J5KA 1REQB 3HY4A 4MVCA 2JHCA 2QENA 2BF4A 5K8VA 1OLSB 4AJ2A 1UANA 4UDXX 1YXMA 3L7OA 3MERA 3T5AA 3CBQA 3NUGA 1DX9A 1RYBA 2QW8A 3TAHA 1J00A 5EPEA 1NVAA 3RS3A 4NLLA 3S6JA 3GUUA 4QLBA 1EA5A 1YR7A 2C78A 2CNBA 3F0TA 3WE7A 2FQWA 1CJVC 2H2IA 1FQJA 2VTDA 3ICVA 1YB2A 3DEJA 3ITDA 4KPGA 3NV9A 4TV8B 5AKGA 3S99A 4X5OA 1N1EA 2PZBA 4GZ6A 3ZV7A 4EVIA 1G6KA 1O9HA 3KHSA 5E9JA 4C3OB 4YMTA 3UENA 3GRZA 2DUNA 5K0FA 2Q1TA 5GOZA 2P40A 1GWNA 2EERA 5HNKA 1VSQA 4LMBA 3N2ZB 2V7VA 3H1GA 4ZDIA 4MV9A 5CNMA 3UGKA 1ZISA 1H6DA 3GLQA 4CKBB 3TRFA 4KG7A 3WLPA 4D4MA 1HMPA 3FPCA 1KOFA 2HHAA 3LRXA 3WKAA 3AERA 3CXUA 1ZVKA 1IJBA 2Q7XA 3AFHA 2QUJA 5JSZB 3THXB 4WECA 3EF0A 1DAOA 3JPYA 3O73A 4G37A 4CEHB 1O0BA 2VBFA 1CRQA 1OF1A 3DXFA 5JVDF 2CNKA 4X8OA 3WICA 3AVUA 3AEQA 2MMGA 2OXEA 4DS3A 3G13A 4DZRA 4DABA 4EEXA 1J56A 1GZVA 1JAIA 2VDLB 1DINA 3R23A 4KSYA 3K5WA 2Q3MA 3OKCA 2M9MA 2J3DA 1HFKA 2QTNA 1ESZA 4M0MA 1NFRA 1PZGA 4AJKA 1TCAA 4MRRA 2L2QA 1TVKB 1YBAA 2V9CA 2Z1NA 4QFCA 3WY9A 5EIOA 4C4XA 4WXYB 1EGAA 3U1TA 3AVYA 2ID9A 2Q50A 1XJ0A 1P81A 2PZMA 1HL7A 1KQ3A 1FFGA 2J9GA 3BGOS 3PGJA 2I2XB 3IQHX 1ZOPA 2EJVA 2ZUDA 3F46A 4TKVB 4YBRA 3T7TA 3WIOA 2O23A 2VDPB 1HNNA 2G17A 3R5HA 4B0PA 4ZMSA 5TMPA 1Z25A 4JK3A 3HVJA 4KV7A 1OHHA 4OK3A 2IYNA 1Y3HA 4K9OA 5FOVA 1AS2A 4X1OA 3AOEA 1EA7A 1A7UA 1HDCA 3BXEA 2Z4SA 3M2TA 4LMPA 2JAQA 5DN6D 4URHA 2GDJA 3QH4A 1CDEA 1KAOA 2I2BA 1FB5A 1NUQA 2ZSDA 1RPNA 2CVQA 4G8CA 1ZM2A 2GVNA 3G6WA 4EEKA 5E9AA 1PDOA 4ABTA 4WTOA 2KW5A 3H4VA 2IE8A 3OOSA 4X1IA 5ICFA 3EIQA 3E9ZA 2OV4A 1RC8A 3LLUA 1YC2A 4GC5A 1CUVA 1TCUA 1VJCA 1HFWA 3ABIA 1W0CA 2XCLA 3OFVA 1EJ0A 3QVGB 5FL7D 3OE7D 1TAQA 2ZTUA 3RC3A 2JG3A 4R8KA 1P44A 4JC4A 5JXGA 3EZGA 5LMZA 3MPUA 1J25A 3VPXA 3ZNNA 4RFSA 1PG2A 5MN6A 4EGCB 4QULA 3WOVA 3FTPA 2CUZA 3NIWA 1ZZEA 5G1PA 3PFNA 1WB5A 1SXJC 1WJGA 1GAJA 3H2KA 4G0OA 5A3SA 4E11A 3K70D 4HGOA 1DC8A 1E2FA 2LVBA 2ZB2A 3W5CA 4QXPA 1F14A 4M6WB 1E32A 4M1YA 2FQXA 4D3FA 4JBYA 3BDIA 4FT4A 4KODA 4K9SA 4KBYA 1XOIA 1T2NA 2EIHA 2FSGA 2HXYA 4K8OA 1EHIA 3I0ZA 3O3NB 4RCVA 2RI1A 2W58A 4B73A 4DV5B 2QA5A 2XMRA 4LYJA 3JQAD 1D04A 4HHEA 1DHRA 3T9AA 2R7LA 1JWLA 1EUYA 1QFMA 3D3EA 3R3XA 2AXQA 3RGGA 4F86A 1GZDA 2CLSA 4DUGA 1NU8A 4H1HA 4J16C 1Q2UA 3O21A 4RMIA 3W3AD 2XUDA 1S2IA 2O8VA 4J7AA 3KVYA 3RC2A 3DLTA 4BNYA 1CIPA 1VP3A 3L7CA 3FUCA 1OZFA 1L4FA 4RSHA 1Q6YA 1RWXA 3FA2A 1JSXA 3I12A 3PTLA 2OFFA 4RA9A 5IZ4A 2OBXA 1H2YA 3KEFA 2RBKA 3AXSA 4B6FA 3FTDA 1RPZA 3W5AA 4AI6A 4DNFA 4DG8A 4Q3KA 3RJZA 1C1DA 1J0DA 4MUAA 2FWNA 2QN8A 3GIWA 3GZNB 5CR9A 2FN7A 1BXGB 3OIVA 2QV7A 4FDUA 2EWVA 5B1YA 1YZYA 1XXHE 1QJCA 1AK1A 4C2TA 3IESA 3OQIA 4ER7A 4QJ3A 1U0NA 2BH9A 1Z47A 2PLWA 4OQNA 4JNCA 3O4FA 4JVLA 1S8OA 2WU8A 3IT3A 4WN9B 3OESA 4MCIA 4YR9A 1Z0SA 4MVWA 2B4QA 1H8EA 2PKXA 3I04M 4CHGA 4CM6A 3K0BA 1RBQA 1QIKA 1QGYA 4PYNA 1F0YA 2JJ1D 3A31A 3DKVA 2CEKA 4I55F 4XW2A 3TSCA 1WUTA 2PL9A 4X62B 3QJ5A 2V3CC 1K0UA 1Y6QA 3FDJA 3O9ZA 4JY7A 1TUIA 4B81A 2OEPA 1UPXA 1MIHA 4NMWA 5KB3A 4NAHA 2QVGA 5EWMB 1ND5A 1QVRA 2BFBA 5CVVA 4QU9A 1ISSA 3F8SA 5HGXA 5H82A 3UWMA 2G9RA 1P2SA 2JA1A 3AY7A 2IKQA 2J6BA 5CXUA 3PUIA 1KYVA 2C2YA 3EQ9A 2C5LA 4BX0A 2FJ0A 1LU9A 1TRKA 3DG9A 4RW0A 4WERA 1UQTA 3AHHA 3HR8A 2JLRA 1EBBA 3HBFA 4Y6QA 3U4IA 1HDRA 1POXA 2PKEA 4HAWA 4P4LA 2B7BA 2GK4A 2UYHA 3GNQA 1GGEA 1HXHA 1Y6JA 2XUGA 3NHKA 8ABPA 5AW6A 1TF5A 3V4RA 1S4QA 4RD3A 1PHRA 1BGWA 4GZ3A 5E1MA 4EG1A 5EE1A 4MO2A 1NLZA 2NVOA 3DV2A 3P9YA 4LYGA 4CF4A 1V1JA 3FPAA 4P2GA 1VPWA 2ZQYA 2OE2A 3T3GA 4ZOAA 1FU8A 3R6DA 4QJ5A 5BQPA 3SEQA 5GJBA 4DUGD 1YR9A 3EEQA 2YHSA 1FP7A 2HU8A 5JJCA 1H4QA 3NASA 4IIYA 3A4IA 3G5LA 3NDJA 4HUTA 2NUPA 1H8HA 2Q8QA 1L4KA 2HCRA 4UHFA 2P7HA 5T4HA 2ZYRA 5KPJA 2VYFA 3FTFA 1IZ7A 3NBXX 2MYNA 3N2GA 4L6CA 4E30A 1QDUA 3HLKA 3L05A 3QENA 1NBEA 1JHQA 2PO5A 3KOUA 4H7FA 4UHEA 4DN6A 1CEQA 2DP4E 2PVCA 5FEUA 4MUYA 4KDFA 2JH3A 5TLSA 5J2UA 1KJQA 2VZ0A 3JXEA 5FWXB 5FBKA 2OPBA 3TDNA 3H5OA 3DBVO 4LTMA 4MPJA 2AKAB 4Q05A 1KSGA 3B1FA 2HEIA 4M60A 1JR3A 2DLCX 5HKBA 4V0SA 3TW8A 2XD9A 5LZ2A 1DV2A 1I4WA 3A6JA 2XDQB 1XK7A 3DBLB 3AV0B 2NU7A 4KQ9A 5CB6A 3GP8A 4GP9A 3LRPA 1OE0A 2QLNA 3DZBA 1OH8A 4MVJH 5EWLB 4NTZA 2XB2A 2PZ8A 1QRRA 1CLUA 1SHZA 3NYQA 1E3QA 1KIFA 4RCZA 5ICSA 3L0PA 1OA0A 3PF9A 3USZA 4NOLA 5LB4A 1NHWA 5K51A 2FY8A 1K8ZB 1TQ2A 2E1RA 3HUEA 1HTTA 2JFGA 3NEJA 4ARAA 4EJ0A 2QM3A 1IQRA 1LWNA 1E9CA 1ST3A 2VPWA 3SZOA 4EPYA 1IEQA 4RF5A 4NV0A 5E7IA 4G2TA 1XA4A 5DWQA 1FU7A 4A6DA 3GO4A 4RFVA 4OP3A 3ST7A 3ZEIA 1QE5A 2BGNA 5AW8A 1J2RA 1KH2A 4F91B 1T9KA 3MS2A 3K1AB 4DEXA 1SC6A 3Q9UA 2QVZX 4GHWA 4Z53A 5JSYA 3U4QB 1L7XA 3DUFA 4S1VA 4DCJA 5DXFA 4TZTA 4Y0AA 3MM4A 3AM4A 2VK2A 3R5SA 3ELDA 3QOYA 4JT8A 5CT4A 4PWYA 3JTMA 1ULHA 1D2RA 1SVMA 1HE2A 4X20A 1NWHA 5AJHA 1PG0A 4DKXA 5H5JA 3NYIA 3B9BA 3ETNA 4ER0A 2B94A 1T4DA 3RHSA 5IDWA 3WKEA 5KTYA 2FDXA 1WKVA 1XMJA 2BGIA 1RSZA 5E7MA 4F9EA 4RLFA 3FDFA 1HWYA 2ODAA 3A6GA 4G41A 4IDOA 3PNLA 3TLMA 4CF3A 4AB1A 1U2GC