4CL8A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
251
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
molecule tags Oxidoreductase
source organism Trypanosoma brucei brucei
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
total genus 92
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cl8A00
3I9JA 1EFLA 1W8DA 1GEEA 1WP4A 4J4TA 5HM8A 4EZBA 5I7SA 5AYVA 4XDYA 4M49A 1CWUA 2IYPA 2PGLA 1OMOA 2Q45A 5T6BA 2DPHA 4ZA2A 1E92A 3WNQA 4QFDA 3H5RA 4I5GA 1E6EA 2DBRA 4JIGA 3C85A 1LRJA 1HLDA 1IHYA 5ER9A 5TX7A 3ONDA 1GZ3A 4ONEA 4BKPA 5JDIA 2AW5A 1Z45A 2VYNA 4YRDA 4K26A 3Q9UA 4KMSA 2NV6A 5IDWA 1D7OA 3HB5X 1NPTO 1Z74A 4BO2A 2Y67A 3DHYA 1UUFA 4GAEA 4XWYA 3I9LA 1TI7A 1YS4A 4W4TA 2DVMA 5L4SA 1SEVA 4NFYA 4UEJA 4J7CA 5I7VA 3O8QB 1HF3A 1G0OA 1WVGA 2OFPA 1SBYA 4NU6A 1WDKA 3DHEA 4PVDA 1DAOA 1DLIA 2YUTA 4FOSA 2HJSA 5A05A 4NFSA 2HQ1A 1EQUA 2RHCA 4LGVA 3AFMA 1B14A 3RUFA 5T8KC 3O26A 1VKNA 5DP1A 3FPCA 1VSUA 2FP4A 2OO5A 1PJ2A 2PKQP 4GMFA 3E82A 4IIUA 3CH6A 3OJFA 2CVZA 4CL3A 2HK8A 5G0UA 3KETA 4ZGWA 4WOJA 2ZTVA 3A28A 4I5FA 4L73A 2WD8A 3ASUA 4Q3BA 1J5PA 3WJAA 2OOSA 1U1IA 1XQ1A 2BFPA 4B79A 4LISA 3G49A 2LDBA 1LBEA 3RUCA 2Y1OA 4E30A 1U28A 3BXXA 3D5QA 1E5LA 2WYUA 4N7RA 3RVDA 1IYZA 1DFHA 2DC1A 2HAEA 4R1UA 4R54A 1N9GB 2GASA 1P45A 5COAA 2GF2A 3MTJA 5KVCA 3DXFA 4DUPA 1LEHA 2EIHA 1TA4A 1I01A 4K1LA 3E8XA 1L7EA 1JWBB 2W2KB 3DMTA 3RJ5A 4B7XA 1I36A 1KEUA 3UOGA 4UEKA 3ZWNA 1YOVB 3JD4A 4MDHA 4XA8A 1XKQA 4OH1A 1C3VA 1Q7GA 1O5IA 1X7GA 5HWSA 4EEXA 2W8ZA 2E6UX 1P31A 5TRTA 3AM4A 4YTEA 4BUCA 1A9ZA 2ZK7A 5IXYA 2Y1CA 1YL6A 1VSVA 4D43A 4OYRA 5CDSA 2QW8A 3EVNA 4Z3KA 3VZQA 4R1SA 4I8XA 1LDEA 3NDJA 2RCYA 4BKUA 4B7UA 3WQQA 3ZV3A 2JJYA 3QP9A 4PLHA 3V5NA 3R3JA 1HL3A 4IY1A 4K9DA 1ISMA 3QHAA 3MTGA 1B0AA 3BMQB 1EUDA 1WLYA 1HWYA 5KJCA 1T2EA 3QE3A 4GQAA 2OBYA 1U4SA 5JE8A 4WLOA 4LRSB 1I30A 4TKMA 4YJHB 3ZHYA 4YR9A 5I9NA 3S2IA 4NK4A 2NNLD 4AJKA 3HN2A 1GR0A 2CFCA 1ENZA 1N1EA 4EJ6A 3DZFA 1DPGA 2J3KA 1RYDA 5IG2A 2NVWA 2G0TA 3ZNPA 3X2FA 1Y7TA 4EJMA 2IODA 1W0CA 3D4NA 1LSOA 1U3VA 2OP1A 1I8TA 3EDMA 3UXYA 3FBTA 3WOHA 3TOXA 4E5PA 1UZNA 3HSKA 4LVCA 3ZHZA 2Q3EA 2NQ8A 1N1GA 3ZV5A 1HDRA 5MDHA 5K9ZA 4O1MA 4UVDA 3JQAD 3K8ZA 4BO7A 1P3DA 2Y93A 1SB8A 2YYYA 1I2CA 3JYQA 4D3DA 3ZWYA 1T4DA 3LC7O 3L4BA 1PS8A 3CPSA 4GGPA 3V2UA 1DLJA 2FSSA 4CQLB 4JQCA 3HJAA 1UXKA 3FNHA 1K6JA 2I66A 3TDKA 3H3FA 1AXEA 5K6AA 2X0RA 3D64A 1YOVA 3JYOA 4RQUA 1CETA 1GYPA 1HDZA 4KQXA 4OIMA 4EUEA 5KNLA 1EK5A 4IS2A 3VZPA 2YV1A 2DUWA 4IDCA 4W7HA 5B12A 1I3LA 2PD4A 4ZQHA 5TC4A 4U6SA 4R41A 1ZSYA 5TJHA 4J4BA 1SPXA 1WDLA 5I8ZA 4Z0PA 4ND2A 3SEFA 3JQ9C 3I23A 1I2ZA 5EN4A 4XR4A 1Z7BA 5AXCA 4CJXA 4BO1A 4BMNA 4J9UE 4A27A 5DN9A 1Y8QB 1CJCA 4WKGA 4D42A 1TB4A 2B4TO 2QYSA 2V6MA 1QG6A 4URFA 3ZWXA 1EUZA 2NTJA 1YL5A 1HLPA 2H5LA 1IZ9A 3TWOA 1BG6A 2GO1A 1YXMA 1U7TA 4NBUA 1GEGA 1M76A 1JDJA 2VHZA 1HYHA 3RUDA 3ZWVA 3GDOA 2D0IA 2NU8A 3AUTA 3RKUA 3DFZA 1LLQA 2PZMA 3IJRA 5L40A 1NWCA 2XPCA 2BELA 4YQZA 1UP7A 1SAYA 1PL7A 4TVBA 2ZYDA 4UVGA 1UAGA 2VRCD 3KSDO 9LDBA 4B4UA 3JYPA 2C5AA 3O38A 2PD6A 4YT8A 2Y1DA 2O48X 3VVCA 4CMEC 5FFFA 2CNBA 3B6ZA 3C1OA 3ZDFA 5ADHA 1X7DA 4W9NA 4I5EA 2XXJA 4IS3A 2I9PA 3JCZA 4TQGA 1NBOA 4RVSA 3E9NA 4L8VA 3OECA 1Q0LA 2AHRA 2YQ5A 1HE2A 2FWMX 4CV3A 2ZATA 2VNAA 1VLLA 2ZB8A 3I9MA 1X1EA 5JNLA 3IUPA 2OXIA 4W82A 4BGVA 4MP8A 3WYBA 1D1SA 4Z0HO 5IZ4A 2YDXA 4A0SA 3LT4A 2OGUA 4BKRA 2D4AA 4CLOA 3I6QA 3COSA 3LU1A 4WCDA 2FPIA 3P7MA 4AG3A 2I65A 5K6AC 1GQYA 2FN7A 2IEDA 4W6ZA 2VYVD 4NNJA 2PZKA 4LSMA 3WDSA 4CV2A 1C0KA 3INRA 4S3MA 4Z3DA 1B2LA 4RPGA 2PTGA 3BZUA 3O9ZA 1HEUA 1MV8A 1F14A 3TZQA 4MVJF 3RBZA 3OEWA 5TLSA 5TS3A 3EY4A 4YJGB 5I9MA 1CRWG 1DC5A 2X58A 1P74A 2CMDA 3WBFA 3H2ZA 3ST7A 5CFZA 4RCVA 4MO2A 3TQHA 4YDRA 2ZB7A 5DCUA 1PQPA 2OL4A 3R3SA 3U62A 1U2GA 1GUZA 2UDPA 3IOYA 1Z6ZA 1ZEMA 2Y1EA 3ZH2A 2X86A 3LYLA 1ISIA 1D1TA 4HADA 1YVEI 1Y9EA 1WNTA 3O03A 5G0VA 2GN6A 2HSDA 2WD7B 4NMHA 2J5RA 1R4MB 3QJ5A 3ETDA 2P5YA 2W2LA 5CP8A 3TRIA 3PQEA 4BNWA 3RBXA 2X9GA 1A4UA 1PTJA 1SOWA 2HRBA 2W98A 4ND4A 4UEOA 3UCXA 3UKOA 5BSEA 3U09A 4U7WA 1GU7A 3JQAA 1VI2A 4ZQEA 2PGDA 3GNQA 3PQFA 1PZHA 2XAAA 3OHSX 1RM0A 3MJ4A 3PJDA 3E9QA 1CDOA 5U1PA 1EZ4A 1SMKA 2JCYA 1EQ2A 4IBOA 4DBZA 4DC0A 3IS3A 4PG8A 2AE1A 4X54A 3JSAA 3PHJA 4RZIA 2O3TA 3M1LA 3H65A 3BAZA 4YEDA 5KVVA 1NTOA 2H63A 4BNHA 4E3ZA 1AN9A 1I3MA 2ZTMA 5EIOA 4CM4A 3OA0A 2IXBA 3ZHXA 5AVOA 1DBVO 2FR0A 5JMPA 3RIHA 4CMHA 2AG5A 1NVGA 1BGVA 3OJOA 5THQA 5I7FA 1T26A 2GCGA 3WMXA 1PJLA 3ICPA 4I08A 3F5QA 1WAMA 2JD2A 2VWPA 4G2NA 4OOEA 2X0JA 4R69A 1PL8A 1MUUA 1LC3A 2GZ2A 3PEFA 4IGFA 1P0CA 2O2SA 1U3UA 3FD8A 5IJZA 3FTNA 4RVFA 4CMCA 1P1RA 3HB4X 1TLTA 2DPGA 4GSLA 1N8KA 3UCEA 4B4OA 2C54A 4CM9A 2NVUB 4FJ0A 4CPDA 1NQTA 1HDYA 4YT5A 2VHYA 3PFWO 5BNTA 3FPLA 4DQXA 3RJ9A 3R6DA 1NQOA 2WMDA 2FOIA 5IDXA 3BMNA 4M89A 3VKVA 3VVBA 3H9QA 2G1UA 2V7PA 4HNGA 1CQIA 3RUIA 1FF9A 3PP8A 4YB8A 1VJ1A 3NT4A 3M2TA 2NWQA 1ZO8A 3DHNA 3SLGA 3A06A 2OHXA 4PRLA 2F00A 4E5MA 1H0KA 1E1NA 2PD3A 5KVSA 1LDYA 1XWFA 4GX5A 3HZZA 1J6UA 3KHUA 4OGWA 3V1UA 3GHYA 2NUAA 1XEAA 4OKIA 4RZHA 1ZSNA 3CSDA 1QMGA 2AQHA 2D5CA 1XA0A 1Z75A 2A92A 3GGGA 1AGNA 3RUAA 4YPOA 1OAAA 3ZGYA 4YJFA 1BDBA 2Q1SA 3ROPA 4OKNA 1ZK1A 3UF0A 3KLMX 1XG5A 1VM6A 4MJLA 4WK6A 5G4KB 4XR9A 2OUIA 2Z5LA 3S8MA 4FFPA 2AA3A 3U49A 4QQRA 1GY8A 5C7IO 2YHIB 4II2A 4CLEA 5FF9A 2DAPA 1YDWA 3HDHA 1KS9A 2EKPA 1PZEA 1WDMA 1ZK4A 3BMCA 1O89A 1XDWA 2GERA 4GSKA 3GVPA 4PLVA 4PLTA 3OIFA 3QA9A 1Z73A 3EGOA 3ZU5A 2C59A 2C29D 2DFVA 3ANNA 3QRWA 3PIDA 1RYEA 1HSZA 4U5QA 2HUNA 1V3TA 2JAPA 4W99A 4L4RA 3R1IA 1Q7CA 3FI9A 4J1SA 3MJTA 3QWIA 1TT5B 3WGOA 1SOVA 4CM6A 2Q2WA 3AK4A 3D5TA 4HKTA 3WGTA 2ZYAA 1DHTA 1NAHA 4JJGA 4DTIA 3DO5A 4WGGA 1X14A 3JQDA 2JD0A 4FBGA 1DC6A 1NFFA 1UXGA 4AJJA 2NADA 4Q39A 5CDTA 3OBBA 2BI8A 1YQXA 5BSGA 4EGFA 2HKIA 2ZQZA 2E49A 4OAQA 4P4LA 4MVJE 2B69A 3M6IA 3WYEA 2DQ4A 1R4MA 5TJ9A 1ISGA 1GYQA 2ILTA 1U9JA 4PLWA 5DOZA 1UP6A 1P1IA 4J43A 2C5EA 4KTVE 2D1YA 4FJ1A 1R4NA 3U9LA 2BFMA 1GQQA 1NVMB 3CMCO 1N92A 5L4LA 2YFQA 1D8AA 1LDMA 2HMTA 2YV2A 2Q1WA 3PLNA 2IXAA 3FNFA 2V6BA 3WQRA 1UP4A 2WYVA 4GVXA 4MIYA 1T2AA 1PJ4A 3MCVA 3HFGA 4IDEA 5JCJA 3EAGA 1OC2A 3BMQA 4NJOA 3RROA 4D0RA 4FC7A 2RH4A 4XKJA 4L76A 1F12A 1LRLA 3A4VA 4GLOA 5CG2A 2EKLA 3VC7A 1ZNQO 4I9UA 2PKRA 2ZCVA 3WGHA 3HG7A 2ZKLA 2TMGA 3G1TA 1B8VA 2ZB4A 4J16A 4II3A 4MVJG 3IL2A 3GH3A 2Q50A 3H5NA 3WQSB 3QVTA 4WLUA 1IY8A 2ZB3A 5EESA 3H6KA 1ORRA 2QZZA 3VAZA 2NU9A 1K2WA 2WSBA 1XHLA 1ZKMA 1B7GO 3PHHA 3T4XA 3RC1A 3DOOA 3ETGA 3K92A 3WSWA 2VHXA 4YACA 3AU8A 4OSPA 3NT5A 1DHRA 3DBLA 3ZWPA 1UR5A 3JQ6A 5BNFA 1GCOA 3ZWOA 2FPPA 3DAGA 2VYVA 1ONOA 4ZN6A 3E9MA 4M86A 5GY7A 1EDZA 3H9JA 1BMDA 2FHSA 3CTMA 3DAFA 2B4RO 4UUOA 4J90A 1IB6A 4J9VA 3NAQA 3PRJA 2CF6A 2DBZA 3ICCA 3S55A 1PJSA 4WNCA 5C37A 4BO3A 3PLRA 4TZTA 3WGZA 2QIOA 4EUHA 5FI5A 2Y1GA 2B36A 3OA2A 5T57A 3Q11A 5C7OO 3F9IA 3TFOA 3TF5A 1N7GA 2VT3A 5EL0A 3U4HA 1MXFA 4EUFA 3OQBA 4M87A 3FHLA 3ONEA 4RF4A 4HBGA 1CYDA 1K0UA 3INTA 4R9RA 3OJLA 3AI3A 4NI5A 5DULA 1JAYA 3I4FA 3KUXA 1QV7A 4OQZA 4U0JA 5GZ6A 3W1VA 3JQBA 4ND5A 2E37A 2SCUA 4JLWA 4OJNA 3VZRA 3JQFA 4XQ9A 4YAGA 3QVWA 5F5NA 3L6DA 4NH4A 4WJZA 3WGYA 1ENYA 2R00A 3BMOB 3RFVA 1KC1A 2RH8A 2W90A 3VTZA 1AUPA 2FR8A 2BMAA 3GFBA 5A5EA 4DREA 2EV9A 3VH3A 3H5AA 3L77A 3H4VA 1U8FO 4CM3A 4YCAA 3Q1LA 4LK3A 3A1NA 1T4BA 1FJHA 2NU6A 1U4OA 3F47A 3DZBA 1G0NA 2H1SA 3Q2KA 3DMYA 1ONNA 2ZTUA 4BHTA 5JYDA 4IXTA 3BTUA 3JYNA 3OIGA 2JFFA 3BYZA 5THKA 4EBFA 4PLFA 4MPDA 4RGBA 1YBMA 3F1LA 4W9NC 4A5OA 4YJGA 4AVYA 5L7TA 1VRWA 1QYCA 4K6FA 4RPLA 1D4FA 3GAFA 3QVOA 1R4NB 3ZWMA 3VH1A 1DFIA 4CQLA 3NT2A 1ML3A 1HDCA 4R5MA 5LDHA 1KVQA 3IUSA 4DPKA 1I5RA 2WTBA 4MP3A 5IZCC 3I5MA 3B1KA 4FCCA 2DU8A 3DZHA 2AXQA 2JL1A 1ISJA 1LSJA 2EP7A 3IKVA 2HK9A 2B5WA 5JW6A 1WPQA 2QYTA 3AOGA 1LXCA 1QYXA 1A27A 4BB6A 5JY1A 1H6DA 4J2OA 4DVJA 4R5HA 2O7SA 1GFSA 4DQVA 5L45A 3ZU3A 1FMCA 2Q2QA 1NHGA 1GQ2A 3OJ0A 4A2CA 4AJNA 3ZWCA 4AJPA 3PWZA 1YGYA 8LDHA 1V9LA 1PS0A 2P4HX 1LDBA 2O3RA 3CIFA 1DFGA 3E5MA 3ORFA 3PDUA 3PDJA 1WZEA 3O4RA 3GMDA 3R0IA 4FOOA 4WLFA 5ER6A 1NHWA 1AE1A 1NQ5A 5H81A 2EERA 1DRVA 2DTXA 3K9QO 3NYWA 4RF3A 1KETA 1ULSA 3S1LA 4NPCA 4ALJA 1IHXA 1M2WA 4YBZA 4KP7A 4WLVA 4Q3EA 2C7VA 3PYLA 5TT0A 1UXHA 3IDSA 4D45A 4UREA 5TNXA 1BXZA 3D3WA 3A14A 3DTTA 9LDTA 2O4UX 2R00C 2IYOA 3KYDB 4LSWA 1E3IA 1EVZA 3L07A 4D3SA 3VH4A 2YV3A 3TPCA 1A4IA 1R66A 4CMKA 3IQDB 1OZAA 4BNIA 1YE3A 4XIYA 4YVFA 4TWRA 4OHUA 4RVHA 1ZK0A 1AXGA 5MGBA 4D44A 4ZQGA 1KEVA 3STHA 4Q3NA 1JVBA 5BR7A 4J1QA 4QO8A 2HU2A 1R0KA 3LT1A 1CF2O 2WDZA 3DOCA 1V3VA 5HA5A 4OXNA 2J6IA 4JK3A 4RF2A 1BHSA 4H7PA 4MP6A 1IE3A 1M6WA 3H7AA 5A9TA 3I9NA 5FWNA 3PK0A 4PLYA 2PH3A 4BQPA 5JCJD 2J3HA 3CUKA 5H82A 2O3QA 1E3JA 3GK3A 3VPSA 5HRUA 1PGJA 3ZU4A 3JD0A 3OMLA 3WJ7A 4BO4A 3JQ8A 3Q0EA 5B4UA 4NG5A 1PR3A 4R1NA 2VHWA 1FK8A 3NJ4A 3DFUA 2WM3A 4IMPA 2XF8A 3KOUA 4LRTB 3AUSA 3JD2A 5LDGA 4KDFA 1BWSA 1E77A 2IZ0A 4XYBA 4CQMB 3TL3A 4DXHA 1OC4A 3PI7A 5DBGA 1M75A 2EJWA 2GZ3A 3MOGA 3HUDA 3TJRA 5G4KA 2EHDA 3LVFO 3AY7A 5KKCA 3CINA 3DMTC 3I3OA 4GLLA 4B3IA 3V1YA 3D4OA 1EVJA 1JN0A 2C2XA 2RBEA 3OICA 3U4CA 4GL4A 4YRBA 1HYGA 1EK6A 3VOSA 1XU7A 4CR8A 1FDTA 1KY4A 3DAPA 3GF4A 1CIVA 4BNNA 3E1KA 1X1TA 1ZBQA 1O95A 4MKZA 4LMRA 5F21A 4CV1A 2AEMA 3EYWA 4HUJA 4H15A 2Y0CA 4OXYA 5BNIA 2BGMA 1VE9A 3BHJA 4CLDA 4FFOA 1HT0A 1YB4A 2VZ0A 4BV9A 1ADBA 3OH8A 4RV9A 4CUZA 4DA9A 5A06A 3WMWA 2O23A 1P1KA 4GWKA 3PJFA 4RF5A 5DBIA 4CMJA 3BTSA 1ULUA 1JWAB 2QRJA 2R6JA 4LCJA 4J2HA 4IQGA 5JPIA 4L4SA 1ZUD1 1GL3A 4E31A 4IZIA 4PG6A 1YQDA 5ICMA 5T8KA 3H8VA 1H94A 5L95A 1WMBA 1GDHA 1KVRA 2BLLA 1JKFA 1XELA 1FDWA 2I76A 2BFAA 3W8EA 1SNYA 2O3UA 4BMSA 1D3AA 4RPHA 1XR3A 1E6WA 2HK7A 5TT1A 3DTYA 3PZBA 4TSKA 3TNLA 3FNEA 2PKQO 3CXRA 1KY5A 3DQPA 5CAEA 3GUYA 4R9SA 1DRUA 3BMCB 2CDAA 2HRZA 4UVHA 2GD1O 1LTHR 3WIDA 3AU9A 2AEFA 3NTQA 5CDUA 3K2EA 4BOYA 2WE7A 2X5OA 1K89A 3IIEA 4CV0A 3M1AA 4YAEA 2VT2A 2PLAA 3GVXA 3LSYA 5DBFA 1I3NA 5ENVA 2BF7A 4Q3CA 3KYDA 4C7KA 3GEDA 3B1JA 3WX0A 2ET6A 2HMVA 4A03A 1QYWA 1UDBA 2NQTA 4Q3DA 4YAIA 4GX1A 5T64A 1NPDA 3RCBA 3F4BA 1VKOA 2CZCA 1MXHA 1VL0A 4IQ8A 3DL2A 1C1DB 1EFKA 1XGKA 3UGKA 1BTOA 1TT5A 1HDOA 4NJMA 2PZJA 2P91A 4IJVA 2CD9A 3PGXA 5FYDA 1NPYA 2IZ1A 3OETA 2PV7A 2A94A 4TMFA 4CQMD 1M66A 1G1AA 1JVSA 4OL9A 5BSHA 3AJRA 4R3NA 3SVTA 1MFZA 3GN2A 2BI7A 3ONFA 3V2HA 4WECA 1ZXBA 1BXGB 3W4KA 5CG1A 1XU9A 3JQ7A 4XDZA 3C3XA 2DTEA 4BNUA 3GRKA 2CDCA 1BDMA 1HKUA 1ADCA 1EVYA 3AUAA 3NTRA 5JDCA 2GYYA 1PWXA 1YRLA 4GH5A 5JC1A 5U9CA 1WW8A 1K6XA 1GV0A 3UVEA 1X0XA 4GVLA 1NM5A 3VHRA 4RPKA 5EMHA 1IPEA 1Y8RB 1UXJA 4AJ4A 4WLNA 1B15A 1BVRA 4DRYA 7MDHA 4FIZA 2UUPA 3LC1O 3LT2A 3OQ6A 1YJ8A 1NR7A 1DO8A 4FW8A 1QYVA 3IMFA 4NIMA 4FSHA 3HQ4O 3PYMA 2OBNA 4QTZA 4AJLA 2P9GA 4J1NA 4PG7A 3CZMA 4BIIA 1KVTA 5GZ3A 3ADOA 1HDXA 1N2SA 1QKIA 3QSGA 4NBTA 1IOLA 2B4QA 4DGSA 2B37A 4CMIA 1LUAA 1BW9B 4KZPA 1T1SA 4TRRA 1SC6A 1H6AA 4XYGA 4QEDA 5IZCA 1LJ8A 3RBVA 3U4DA 2A4KA 4FC6A 4PLCA 1KVSA 4B3HA 1E1MA 2GSDA 4GMGA 4Q3AA 4DPLA 3H9GA 3MJCA 4BKQA 1YBVA 3AY6A 1SEPA 3DB2A 4F3YA 1KVUA 1O94A 3RC7A 1T25A 1RWBA 2NM0A 3NGLA 3KSZO 5KJEA 4BKOA 1LI4A 1F06A 2PY6A 1T2FA 3Q3CA 2ZQYA 3C7DB 4JXKA 3H3JA 4L74A 2RAFA 4CLOB 4PZDA 1E0DA 3ANMA 4OMUA 4P22A 4OOFA 5KVQA 4O5OA 3MOIA 3NRCA 4IZHA 4AJHA 1IUKA 1I2BA 2EP5A 5FI3A 3T7EA 2HCTA 2GRAA 3EUWA 4HFJA 1E6UA 2JFHA 1ZXLA 3OM9A 1M6HA 1KBZA 1SCUA 2V65A 4UVIA 2GN8A 2Y1FA 4MOWA 4MKXA 4XYEA 2Z1NA 2QG4A 3D4PA 3W8DA 3O8QA 2FMUA 5JAIA 1ZMOA 2O2YA 3DDNA 4F6LA 3PWKA 4P8RA 3JV7A 2I6TA 4Y8VA 4ZD6A 3K31A 3RASA 4MVJP 1X13A 5JMWA 2EGHA 3QQPA 4DQUA 3ENNA 5A02A 2DT5A 2GUGA 3DWFA 3WXBA 4DLAA 4Z6KA 2GNAA 4CLRA 1PJ3A 3VPHA 4JP3A 3JQBC 2X7HA 3VZSA 4YT2A 3NV9A 1KEWA 3OEYA 4KWHA 4HY3A 4B7CA 2ZJ0A 5AXBA 2F1KA 5TF4A 4DYVA 3MEQA 2NTVA 3KVOA 4QX6A 4CM9D 5T5QA 3AFNA 4BNTA 1GPJA 4JCOA 1Y1PA 1IPFA 3RUHA 4ZICA 1Q1NA 2ZTLA 3GGPA 3C8MA 1PWZA 3LK7A 3G79A 2I3GA 3WB9A 4QXMA 5AOVA 5KTKA 3ON5A 4E33A 2Q99A 1YH3A 4CODB 2BKAA 2TMDA 3JQ7B 4IUYA 4IINA 1HE5A 2P5UA 1KOLA 2EF1A 3DOJA 3JQEA 2YQ4A 5EPOA 4CUJA 3KSUA 4ALIA 2JKVA 3CKYA 3WBBA 1YJQA 2YJZA 3VPFA 1RM4A 2AG8A 4ID9A 4BNGA 4NBRA 2C0CA 5DT9A 1MGOA 1ID1A 2Y0EA 3EHEA 1H6BA 4R1TA 4MVJD 1WZIA 1LLCA 4FN4A 4LN1A 1ENOA 3IC5A 4EITA 4OQYA 4GBJA 1B8PA 3Q2IA 4JBGA 5F3RA 3FWZA 4O0LA 3PVZA 5BQFA 1B26A 1QP8A 4FS3A 4JX8A 3PGJA 3T4EA 4G81A 4L75A 3RAJA 1RM5A 1K3TA 1PR9A 1ADGA 2Z1MA 3LF2A 1P1FA 4CM1A 2BGLA 4IJWA 4RVDA 3WNVA 4BNXA 4E5KA 2OMEA 3GFGA 5JAQA 3ZNOA 4IDFA 3KZVA 2FR1A 2FPGA 3OSUA 4WCFC 1P0FA 5CPFA 1VC2A 3ASVA 4FFMA 1R15A 1LA2A 2C07A 3GPIA 3I4CA 1YDEA 3AI1A 3GZNB 3F1KA 2GGSA 4ND1A 4QO7A 1QLJA 2C20A 1GV1A 3GY0A 3D0OA 3GOHA 4Y9DA 4YQYA 3B1FA 3DBRB 1XCBA 4IDDA 1FDUA 1DAPA 2PFGA 5BSFA 5A04A 1Q7BA 2DBQA 1LSUA 4MIOA 3PXXA 3ZU2A 4I5DA 3AM3A 1F17A 1Y6JA 3KYCB 1ZCJA 3WS7A 1GUYA 3NTOA 4ESOA 2ZIZA 2G17A 2VCYA 4RQTA 4J6FA 3HHPA 2EGGA 4L9RA 1YKFA 4XYLA 2VHVA 3ROKA 4JROA 3I9KA 3BTOA 3GRPA 3IJPA 4I1IA 1B3BA 4YJDA 4HWKA 4ZRMA 2DBVO 3U0BA 3T7CA 3ITDA 3QVXA 4W7IA 1X15A 1LLDA 5U4QA 1U5AA 4ALKA 3A9WA 2Q2VA 2QHXA 3GUCA 1U7HA 1VPDA 4HP8A 1YBAA 1E7YA 3ANLA 1BW9A 3C7AA 1VL8A 1UJMA 5L53A 4N5MA 3C1TA 2GLXA 3UICA 4JBHA 4TZKA 4PVCA 2E82A 4EJ0A 1W4ZA 5C5IA 2ZYGA 3ZHBA 3ZW8A 5AQ1A 2GR9A 1JKIA 3G17A 2JFGA 1EDOA 3RQSA 4PN3A 4GWGA 2X5JO 1CEQA 2HO5A 3FF4A 3VPGA 3KTDA 1Y8QA 3RC9A 4FQ8A 3GQVA 2EW8A 4Z9YA 3RI3A 3QWBA 1KERA 5GZ1A 4L0QA 3DBLB 1I32A 3OP4A 3W6UA 1HSOA 1NX6A 3RFTA 3TSCA 3G1UA 5KJFA 3LDHA 3QW2A 4GGOA 4C4OA 1ZW1A 3TL2A 2GZ1A 3VTFA 4CM8A 1O8CA 1XIVA 5COQA 3TZHA 3WG9A 4N5LA 3C24A 2P68A 4JP2A 5DOVA 4KUGA 3PYXA 4U6QA 3DBRA 4MINA 1GD1O 4FGWA 3FWNA 1R16A 4UVEA 1MC4A 3DC2A 3C1AA 1RKXA 4PG5A 1N5DA 3L4SO 3RD5A 3L9XA 4ZQBA 5JXWA 1E3EA 3KB6A 1XQ6A 3MWDB 4XX0A 1R12A 2BFOA 4XQEA 1H2HA 5T67A 3MWEB 3TZCA 3GVHA 5TSDA 2X8LA 5EINA 4MVJM 4DMMA 2DFDA 4NJMB 1UZLA 2C82A 4RLSA 4B3JA 2FY8A 3MJSA 1GTMA 5IDYA 1UDCA 4PG4A 4CLHA 1P9LA 2UV8A 2XOXA 4J7UA 5H83A 2C2YA 5B4TA 1HDGO 4CQMA 3K5PA 4RO0A 1PX0A 4DWVA 1UZMA 4XEHA 4O59O 2NTNA 4IXWA 1TEHA 1QXSA 1T2CA 5KKAA 4NZ9A 3KXDA 2RHRA 1PGPA 4JN6B 4MVJI 3NJ8A 5F5LA 4ZU3A 4E5YA 1EVIA 2EKQA 4Q9NA 2WJPA 4N18A 2OZPA 3V8BA 2EWMA 2VRBA 4M8SA 2QRLA 3CE6A 3GA0A 2NACA 2YFHA 2JHFA 2Q1UA 4BVAA 4E6PA 4HV4A 1ISFA 3G3EA 1U8XX 4DIBA 2EEZA 3KEOA 2B83A 5JY6A 1P77A 3PTZA 5K0ZA 2O7QA 2O4CA 4N5NA 1IL0A 2BRUA 1PS9A 2X6TA 5CEFA 2Y99A 4M1QA 1NYTA 3S2EA 1C1DA 4QECA 5TGDA 1KC3A 4XD2A 2HMSA 4IM7A 5KIAA 1UAYA 3UUWA 2B35A 1T24A 2QQ5A 2X23A 4BNYA 1PQUA 1U3WA 2CDBA 4CUKA 5G2OA 1I24A 2OP0A 1HXHA 1NWHA 2J8ZA 3FTPA 1MC5A 1Z82A 2VYND 4B8WA 1E5QA 1Y9AA 2X9NA 4Y6PA 4ZVVA 3E18A 4J3FA 3HADA 2YHUA 4NFHA 1DIGA 1M67A 1PZFA 1ZVMA 3FSRA 3I9OA 4NHEA 3ETEA 4CL8A 4JGBA 2VUTA 1QLHA 1V0JA 2NSDA 3GR6A 2G76A 3SX2A 5DF1A 3SLKA 4HX5A 4HXYA 3DONA 4WCFB 4BO6A 4CR6A 4Z0TA 4OM8A 4RDHA 3EC7A 4CMEA 4Y67A 1HRDA 4R51A 3OQ1A 1E7MA 1N7HA 3K6JA 1E3LA 1P33A 1V6AA 3QWFA 3TZ6A 4BGIA 1K5HA 3ZV6A 4S1VA 1E3WB 3GG2A 4FR5A 3WSVA 4UULA 1EEHA 2VN8A 1C1XA 3ROQA 5A9RA 4J4HA 4CLXA 4NR0A 4D0SA 1GZ4A 3WICA 4GX0A 1H2BA 2YHIA 1TVEA 4ZHSA 1R0LA 4F46A 2EXXA 2X9VA 1B16A 3P5SA 1I10A 3UAGA 3IAHA 2CSUA 4KDEA 4AJ2A 3AUUA 1PGNA 3IKTA 3L6OO 3W4JA 5JLAA 4NK5A 1OI7A 4PCVA 4QT0A 4GKVA 1DIHA 2X0IA 5JS6A 4WEOA 4E13A 1I0ZA 1ZH8A 2HJRA 4MKRA 5A5FA 4PZEA 3DZGA 1P1JA 5IDQA 4N54A 3OJEA 4TRMA 4BL5A 5JSFA 3C7CB 3QV1A 4F6CA 4KQWA 2FRDA 1PGQA 3LF1A 1FXSA 1EBFA 2UVDA 3GHHA 1SB9A 1C0IA 1B3RA 4IDBA 5JDIC 4RVGA 2UAGA 3AM5A 3CEAA 4BNFA 1NFRA 1EUCA 3PHLA 5LCXA 4CM4B 1NR1A 3H9EO 5TIIA 2Y68A 4LCEA 4E0BA 3GG9A 2I99A 3ZNNA 1F8FA 2IEBA 4XZ3A 4MVJA 3I1JA 3PJEA 1KYQA 3RKRA 3ULKA 2PR2A 3INGA 3OIDA 2G82A 4Y98A 2BD0A 3ZV4A 4IIVA 5F1PA 3U3XA 1XSEA 5A9SB 4HFMA 1WXDA 1U2DA 2J3IA 4ALLA 1JTVA 3PWSA 5G0SA 5L7WA 1NFQA 1A5ZA 3L9WA 4YWJA 1ARZA 4JJFA 2X22A 1ISHA 3F3SA 3D3WB 2YZ7A 3JQ8B 4LMPA 1A7KA 4R01A 4EDFA 4E2YA 1HTBA 3QVSA 3TFQA 3H2SA 3HDJA 4F45A 5EJ2A 1ZMTA 4EYEA 1F8GA 2Z95A 5DCWA 3AI2A 4AJ1A 3S2FA 4XB2A 1L7DA 3DBVO 3HFSA 3QIVA 4IQ0A 4G65A 1LDGA 1E1LA 1YL7A 5DP2A 1YB5A 2EJVA 1E7QA 4B4WA 1LNQA 3X2EA 3Q6IA 2DLDA 1CERA 3V1TC 1G6KA 2NU7A 1LQTA 4HFRA 3WGQA 1GAEO 5EERA 1DXYA 1LQUA 4BGUA 4NQZA 1GCUA 4YXFA 1E7RA 1GUFA 3PJGA 2X1HA 2G5CA 3B20A 4JBIA 1W73A 5DZSA 3ZW9A 3RU9A 2W4QA 1LSSA 2VNSA 4DPMA 1YONA 4YRAA 1DIRA 2X0NA 3HNPA 2PZLA 2AQ8A 3OF2A 4WPGA 2VZ9A 4YT4A 4I9HA 3NUGA 1DEHA 3PIIA 3I6IA 4E21A 5JYEA 1AHIA 1E7WA 3KYCA 3LT0A 1P1HA 4KTTE 3GC6A 3WIEA 2Q4EA 4GX2A 3EVTA 4J91A 3S2GA 1HE3A 2X4GA 5JO0A 3ZCXA 2PA3A 3HDYA 1A7AA 1B8UA 5IXSA 3WFJA 5L9AA 1X7HA 4PRKA 4UUMA 1L1FA 5ILGA 1P44A 2PNFA 3F6YA 3UHAA 3BA1A 4P4GA 4A73A 3DBHA 1U3TA 3PHGA 3PQDA 1C14A 5L4NA 1IZ0A 1PJCA 2P4QA 2VQ3A 1XLTA 5G4LA 1T2DA 2RIRA 4Z9XA 1QSGA 5HS4A 4R68A 5C3MA 5DCYA 4RL6A 4NBVA 1PJQA 1H9AA 2UYYA 3ZZNA 1HETA 4BQRA 5IN4A 5KOIA 2WD7A 3PHIA 5A4DA 4RVUA 4BS9A 5J23A 3NDIA 4QFCA 3GDGA 5JDCC 1A72A 4BO0A 1EE2A 1QV6A 4O6VA 3FBGA 3W8FA 1E1KA 1MX3A 1PU2A 3EW7A 3UCFA 3GVCA 4CMBA 3GNTA 3GN1A 3WTBA 5B4VA 2VTDA 1I33A 1GADO 1MP0A 3K2BA 3KEQA 4BMVA 1E3SA 3K96A 5L7YA 4D41A 1MG5A 3VPXA 1R37A 5I8WA 4YAKA 3TN7A 1DC3A 2JAHA 4IMRA 3I83A 4CM8B 3GAZA 4HFNA 3ROMA 4ALMA 1BSVA 3DZIA 4Y6RA 3GMSA 4K6CA 1PSDA 2BHLA 4BV8A 4U8GA 2I67A 1JW9B 4TRJA 4CM5A 1UXIA 4TVOA 1JAXA 1ZIDA 1BRMA 1Y81A 3FR7A 5CHEA 5JAMA 4IPTA 5DDIP 4NDNE 4XGNA 3WGIA 3E03A 1YO6A 4CMAA 2A9FA 5HTOA 4RORA 2J5QA 1JKJA 4FDAA 4MIEA 3NKLA 4DL9A 4DC1A 2E48A 1DSSG 4ZJUA 2BH9A 2XXBA 5IFLA 2YDYA 3OFSA 1UH5A 4GKBA 4XJTA 4XRGA 3DEYX 4CR7A 4WOKA 4YYZA 4Z9FA 8ADHA 2D8AA 5A9SA 2WE8A 1GPDG 3F5SA 1DJQA 3HN7A 2DKNA 4R4JA 3WR5A 5G0TA 3WGGA 4OXKA 4AFNA 2WYWA 4J0FA 1I3KA 2QX7A 3VKUA 4AJIA 2YY7A 2O3SA 1JA9A 2DUUA 1H6CA 3FCOA 2CY0A 1DIBA 4TRNA 3PPIA 4BGEA 2VZ8A 3KO8A 3BIOA 1JU9A 1MG0A 1K6IA 4ZRNA 3RC2A 1O6ZA 4BB5A 5KCZA 3VDQA 1O0SA 3ITKA 4FFRA 1V3UA 5A1TA 3AY3A 4KUEA 2PGJA 3V2GA 3CZRA 2LDXA 4I9NA 3ZN2A 1A71A 3PFFA 4K28A 1T1RA 3BMNB 3EMKA 4XB1A 3ADPA 3JQFC 1R0SA 1S6YA 2Q49A 4E2ZA 2VOJA 1EE9A 3DZKA 1EMDA 3QY9A 3LC2O 4XYMA 1DRWA 3N58A 1LDNA 1Y8RA 2R2GA 5FEUA 1OOEA 3VDRA 4D7AA 1OFGA 3CMMA 3FNGA 5C7LO 1BXGA 1ZSVA 4YJHA 3ABIA 3L0DA 2X5KO 4A7PA 3FR8A 2IRWA 4FFNA 1SO8A 4JNKA 1LU9A 2NVUA 2V6FA 1C0PA 2Y0DA 1VJTA 1UDAA 1O9BA 5KJ1A 5ITWA 2VTEA 1DJNA 2P9CA 2JHGA 1ENPA 1DB3A 3SXPA 1GZ6A 4A10A 1Q0HA 4IJKA 1Q2XA 2Y66A 3QLJA 3GDFA 6LDHA 3MJEA 1KEPA 3N7UA 3JTMA 3NEPX 4PLGA 3GEMA 4BO5A 4XJSA 4DLLA 2FZWA 1PJTA 4MVJH 1WMAA 5LC1A 4C7JA 2B0JA 4BNJA 2W2LD 1NXQA 2EW2A 5KJ6A 2BGKA 3WWZA 4ROSA 2IZZA 5TQVA 3WLEA 4M54A 3LLSA 3RU7A 3F46A 1LLUA 1J0XO 2E4AA 1DC4A 4R3WA 3ENKA 3WTCA 1PEDA 1SZJG 2D3TA 1NNUA 1QR6A 1OBFO 4J1TA 2PWZA 2H6EA 4H3VA 2I5PO 4FB5A 4QSMA 4D79A 2VUSA 3JD3A 1VJ0A 2JD1A 5AXAA 3EZLA 2QRKA 1PJBA 5IN5A 4AICA 1AHHA 4D3FA 1PZGA 3KLPX 4BNVA 5B1YA 3FN4A 2OORA 2AE2A 4XRRA 1HZJA 5A03A 5ITVA 4ALNA 1ZK2A 3KRTA 5I9LA 4IJUA 4RLHA 4B4VA 2ZJ1A 4GI2A 5CPBA 1R6DA 5CDYA 1H9BA 1J49A 3RUEA 4YAJA 2GPTA 2Q46A 3L6EA 4TROA 4YJFB 1W6UA 1KIFA 4P4NA 2VOEA 3RFXA 3B70A 3F4LA 3QWAA 3E6AA 4KWIA 5JCXA 4CLRB 1ONPA 4EW6A 3UFXA 5HS6A 3WLFA 3KV3O 4E2WA 3ZWAA 1RJWA 3U5TA 1S7CA 4PGFA 3BHIA 2Q4BA 4FFLA 4XGIA 5L3ZA 2B5VA 2YW9A 3P19A 5CEEA 4E4YA 2GN9A 2ZCUA 4BNMA 3D7LA 1ZJYA 4NU5A 4EI2A 2VUUA 4AJEA 1QYDA 1RM3A 1C1XB 2EG9A 3GZNA 4IDGA 3D1LA 2Y05A 4E32A 1ZZEA 5IF3A 4B8ZA 1H5QA 1ZFNA 3BHMA 3NGXA 1V35A 2AQIA 4BO9A 3NX4A 2POQX 5JBIA 2IE0A 2AEJA 4IGEA 4BNKA 4L4XA 4BNLA 3EK2A 4CM7A 5I7EA 2C7GA 4P38A 3SC6A 3RWBA 5ES3A 4DYDA 5F1KA 4R16A 3GLQA 5EQDA 4BO8A 5JC8A 3U4IA 3GT0A 2CVQA 3KBOA 1Z7EA 3W6ZA 5L51A 3ZWBA 1DOHA 4PFJA 3QWHA 4OSOA 2JCVA 4WNIA 1GYRA 2FZEA 2NVBA 4DIFA 4DBVO 3JQGB 3JQAB 1NVTA 4WCFA 1NQAO 5BT9A 2P2SA 4BNZA 3WFIA 2O50A 3LQFA 5ILOA 2AQKA 1WWKA 3HDQA 1JLLA 1LRKA 3LZ6A 3IP3A 1QORA 3BMOA 2P9EA 3UH1A 4LVUA 4TKLA 2V6GA 5A3JA 1MFPA 4RDIA 1E3WA 4RJTA 4A26A 4XCVA 3AOEA 3H9UA 1IULA 4FPXA 4HNHA 4RPJA 2O3JA 1PIWA 1BXKA 2J3JA 2W2KA 5EQFA 1LX6A 2HDHA 5JO9A 1PQWA 2VRCA 4QUKA 4D46A 2PK3A 4INAA 2QZ9A 4WE3A 3ZI0A 2AMFA 3PZRA 2UUOA 3W4IA 3L4BC 3K30A 4H16A 5COBA 3G0OA 1VL6A 2A35A 4Y6SA 4WASA 5CEJA 2DM6A 1J4AA 3GEGA 3RSHA 3SJ7A 4PLPA 3BTVA 3AOEC 5JFOA 3MZ0A 3KYBA 5A3VA 3UW3A 5F1OA 4CMGA 1ADFA 3GPDG 4XGKA 4E2XA 2D5AA 4DMLA 3GVIA 5CDGA 5G0WA 1DIAA 2GN4A 2VWGA 3DBHB 4M55A 5B37A 5AXDA 2VWHA 3P2YA 2PH5A 3GNSA 4G5HA 4EEZA 3DR3A 1NP3A 1BVUA 4NBWA 5IAAA 2GDZA 5HBRA 5ICSA 3UN1A 1HZZA 1PGOA 1NAIA 3I52A 3LLVA 4WLEA 3M2PA 1YB1A 1TXGA 3IP1A 3NDRA 4ITUA 4FD3A 4UUPA 4XIJA 4IDAA 1HYEA 4YA6A 1Y5RA 4KUHA 1Q0QA 3JYLA 2DTDA 2HMUA 4AJOA 1U5CA 5JAZA 1ZJZA 2NLOA 4J0EA 3D3EA 3ZNQA 3K73O 3HWRA 3MJVA 1JQBA 1Y5MA 4GPD1 1NASA 4AL4A 1E7SA 3HE3A 4PZCA 3WWYA 1YWGO 4JJIA 1N9GA 4LW8A 4FGSA 4ILKA 2D2IA 3SJUA 3WYCA 1ZK3A 1DDOA 3AWDA 4J7XA 1C0LA 4KOAA 3JQCA 3P2OA 1ZEJA 1FDSA 1A9YA 4E5NA 4DLBA 6ADHA 1HE4A 3SBOA 1CQJA 3GGOA 1FDVA 3E5RA 1V8BA 4DIOA 2IDZA 4ZQFA 2CVOA 5DNAA 7ADHA 2D59A 1MA0A 4UUNA 3ZWWA 2H9IA 1QRRA 1EBUA 2HLPA 4J49A 1YQGA 4XQGA 5GMOA 3JD1A 3Q9NA 4E12A 1MB4A 1RPNA 1X0VA 2WWRA 3EZYA 4WUVA 4OO3A 4ND3A 2I3AA 1F0YA 3N74A 1PL6A 4PIVA 4U0KA 3SC4A 3VH2A 4O63O 4UAGA 1TT7A 2HMWA 2VWQA 3KM0A 4PLZA 2Q1TA 1XYGA 4WEQA 2J5KA 3AW9A 4CMIB 4XQCA 3DZJA 3TZKA 2CUKA 2FSVA 1MLDA 2CF5A 3FRJA 4FJ2A 1H93A 3JQGA 1LC0A 5ENDA 3TOZA 5KWEA 2WEKA 3E48A 2JCXA 3JQ9A 3GZ4A
chains in the Genus database with same CATH superfamily
4N7BA 1T8TA 4YASA 4A91A 2FPMA 4J4TA 2CXTA 4ZFNA 3BF8A 4FDUA 2FETA 5CBPA 1R8QA 2MSDB 2ODAA 4P6VF 1G4UR 3MWLA 3LZDA 2FPSA 2QAGC 1DJPA 5T6BA 2P69A 3PL1A 1E92A 4Y2GA 3QE4A 4ZA2A 4JLJA 1E1QA 3WNQA 2EW1A 4ZK2A 3AEKA 1DKUA 1E6EA 1OXBB 2CBGA 3DCIA 3C85A 4R9NA 4REQA 5DWVA 4X94A 1N6HA 1P72A 5ER9A 1ILWA 1V95A 3ONDA 1GZ3A 1X80B 5TX7A 1Z0UA 4YV1A 2AW5A 5TDHA 5F78A 5CFOA 5JDIA 3S2SA 3LE8A 2ATXA 2CYCA 2NV6A 3IE0A 4UHEA 4YMHA 1XX6A 1D7OA 1TD9A 3UWDA 3HB5X 4LJ9A 2WSYB 5D85A 2FVYA 3BD9A 3N2NA 3L8EA 3T3DA 5B1EA 1AH2A 4AKIA 3ISTA 1AZLA 2AV6A 1VHWA 1VKJA 4XWYA 3UYKA 1TGVA 4KAXA 1ATZA 2DVMA 3JWEA 4G36A 4NFYA 1ANKA 1OILA 4J7CA 3P9SA 4Y7DA 5FD8A 3ZTTA 3PI6A 4DNQA 2OFPA 2Y2VA 1OE0A 3AF3A 1GKKA 3V6LA 4C6RA 4NU6A 2JVIA 3DHEA 4DJ5X 1TUGA 1U0OC 5DHSA 1H22A 4MQ4A 1CT9A 3OJXA 1W44A 3FOFC 1JIUA 4LEIA 5E95A 3W1EA 2HQ1A 1Z62A 5KPDA 4BMYA 2WUFA 4DS3A 3WXMA 3O26A 4QGFA 3QKUA 3OOYA 4XW2A 4EG0A 2FP4A 3R9XA 3CH6A 2ONKA 4JB3A 1SVOA 3K20A 1EB8A 5AKJA 3EYAA 3UHOA 5KKNB 3ZTWA 1R6AA 1E9BA 1UDRA 2F4NA 2Q6TA 4DCCA 2IVZA 4S05A 3K8YA 4L73A 2WD8A 3ASUA 3A9TA 3R5HA 3MCTA 2GNOA 3OY2A 4Q3BA 4QIHA 1E5VA 1CQWA 1XCGB 3CV3A 1LGYA 3NCHA 4GBED 1U1IA 2YHSA 4B46A 2X2FA 4ZMBA 4B79A 3AVQA 3ZBUA 1VLVA 3V8MA 3QFHA 2Y1OA 1KFCB 1W94A 1XF1A 2AW3A 1DFHA 1GZVA 1XC7A 2DC1A 4R1UA 4R54A 1N9GB 3WIOA 2C1XA 2GF2A 1U7WA 3F6EX 3PEVA 2YVLA 4LOKA 4DUPA 2W4MA 2OSVA 5FX2A 2CV2A 4DMHA 4K1LA 3VO8A 4RENA 4MW2A 3E8XA 4E14A 4EPTA 1L7EA 1U0LA 2QPAA 3DBOB 3DMTA 4ZU1X 3RJ5A 5BVGA 5BN4B 4KR7A 3FYUA 2CLMB 3UOGA 4GM1A 4I3HA 1X7XA 4C3VA 4DLWA 1XKQA 4OH1A 2H1OA 2C03A 1BEZA 1ZD4A 2C4TA 4ON9A 2WPNA 1C9YA 3OKAA 2E6UX 1C30B 1P31A 1WU8A 1RDFA 1BROA 2H2FA 2ZK7A 3EE6A 4OJKA 1Z4JA 4D0LB 3B7GA 4HGYA 3USES 5AUNB 5CA1B 2QW8A 2WNIA 4A8JC 3KU4A 3QUCA 5HKLA 1NW8A 1QJCA 1P2BA 1LDEA 1PT8A 1TMKA 4FWBA 4B7UA 1WJGA 3ZV3A 1ZU4A 2Z3VA 1SRRA 2JJYA 4N0DA 3EH2A 3R3JA 4MULA 1HL3A 4PLHA 4UBMA 1ISMA 1M1NA 2BYTA 1FIUA 4LMAA 2PUGA 5GJBA 3CLRC 4MRNA 2XNHA 2VF2A 1RFGE 3MT0A 1KO4A 1T2EA 4GQAA 3CUWA 1H9CA 3GRUA 1GZ5A 1S01A 1M74A 1TZBA 1E2NA 2QJWA 1K66A 3E9ZA 1I30A 4M99A 1P4AA 5UKDA 1WMEA 1OD6A 4NK4A 2NNLD 3N2KB 1GR0A 5B1DA 4HSGA 4FMDF 3PUZA 4QUDA 4US2R 1UMBA 1CR4A 1NW5A 1P9WA 3DZFA 3SQMA 4KITB 4OHYA 4IH1A 3P9NA 1QS0B 1RRKA 4M4SA 2FJUA 2Z3ZA 3HP4A 1CDZA 4QULA 1K7YA 2YXDA 3RRZA 2EZUA 5A3SA 4ZEMA 4EJMA 1OI4A 1KDRA 3D4NA 1H0RA 2G5PA 1LSOA 3ZE8A 2OP1A 4J0IA 3LUHA 4MS4A 3H05A 3FBTA 2ZP1A 4HUQB 4LRXA 2B1JA 3OM0A 4E5PA 2CBXA 5PGMA 4B2PA 1UZNA 2DWQA 2XJ4A 3UK2A 4G26A 5F4BA 2CNOA 4O2BA 1MAVA 4N3NA 1YASA 1N1GA 3ZV5A 1HDRA 2N1MA 4MA5A 2C3PA 4LRWA 4OV6B 3K8ZA 1P3DA 4LHSA 1RE0A 2Y93A 4MUAA 5K0LA 1I2CA 4BU1A 4G89A 2VAWA 4FUTA 5DGTA 3OZIA 3UV3A 5ALNA 3F9RA 3RJZA 3ZWYA 2W2MA 3HR7A 2VBIA 2P6RA 3V2UA 3CF4A 2FSSA 3WQBA 5I5GA 3DKKA 5DCLA 3FNHA 1K6JA 2AGVA 5DRTA 4YIHA 2WJ6A 3G0GA 1BXRA 3VR3D 3VZBA 2X0RA 1VJRA 1W36B 1WE2A 4GUDA 4TYMA 2H4ZA 2QD5A 4RQUA 1CETA 1GSAA 2QRPA 4KQXA 3GROA 1T2NA 2Z8XA 1I51A 3BXPA 1UK6A 2Q1XA 4IS2A 4PGAA 1AKWA 1PZMA 3VZPA 2DUWA 3GFVA 4EFKA 4NBNA 1AZSC 1ZH6A 2ZB2A 2ZBPA 1XP8A 3R6WA 2PS3A 4R41A 3GRCA 2VJBA 2E2WA 3QFCA 1KO5A 5FPYA 1RPZA 4MUBA 3WZMA 3SYNA 4BZPA 4DNPA 1L1EA 3GI1A 1Q1GA 1XQXA 4Z0PA 3OAAA 3D0QA 1QTQA 4KYIB 3H9BA 5EN4A 1RHRA 3JRWA 5AXCA 3JASB 4CJXA 2I80A 5T4EA 1Q7TA 4NZMA 1CJCA 1UBEA 4WKGA 4D42A 1TB4A 2QYSA 1Z5NA 1QG6A 3DT8A 4NDAA 1RPTA 3H5IA 2OA0A 2YVUA 1IZ9A 4FBMA 2P2LA 3CLKA 4GQBA 3U2QA 4OVKA 4YRKA 3MHTA 3GLSA 1GEGA 3IPXA 4KNYA 3DB1A 2ID4A 1QIGA 2FQQA 4Q3OA 3RRYA 3W3ZB 3AW8A 2OC9A 3P9PA 4MQMA 4UATA 1CQIB 2D0IA 4GI3A 2WTNA 3RKUA 4QNNA 2J07A 2O14A 3A6FA 4I9GA 2PZMA 4LC0A 4MYSA 5BUZA 1K8XB 2XPCA 5L40A 2I4RA 2O8DB 3PUHA 4GQIA 2V3CC 3A27A 1PL7A 3T06B 2ZYDA 2DCMA 1F48A 1QO0A 3MGKA 3PFHA 5LMZA 4OJQA 5DM0A 3O38A 4EEKA 2JLRA 2FK7A 2Y1DA 3I39X 4OLJA 1AQNA 1Q3TA 3I01A 1KYXA 2MR5A 2QT9A 4ER5A 4DEVA 2JASA 4JUIA 5AICA 1STOA 4JYAB 1J8VA 1XTKA 3ZC3A 4TQGA 1UODA 1LX7A 1KO7A 4RVSA 1X8LA 3KFXA 4QAQA 4X7RA 4A5SA 1O2DA 2FWMX 2I0FA 2ZATA 4PN7A 1EIZA 3I9MA 2W6ZA 3CISA 4CGYA 5JNLA 3IUPA 2IYLD 1DKNA 3O7MA 1E66A 4LKOA 3WYGA 4WBNA 4F4HA 4MP8A 2X0EA 3WYBA 1IVSA 4MYDA 1D1SA 2W6JA 1R8XA 2FQWA 3PTLA 3K0CA 1DXOA 4A0SA 1IBLB 3LT4A 2OGUA 4X45A 4BKRA 4DM3A 4CLOA 2FB9A 1KP3A 3R3YA 1CUEA 4TTQA 3DFMA 2YL2A 1G66A 3ANSA 4KVAA 4AG3A 3R76A 2Q1YA 5K6AC 3RODA 1GG8A 4YCDA 1Y34E 1EVLA 2IEDA 3PUYA 4PAMA 4R2LA 4W6ZA 5K0TA 1Y7HA 4LJSA 2NUPA 2FV8A 1ZY2A 3QQ5A 3TOCA 2AJ8A 2PZKA 1U2GC 2QZJA 4UDYX 3VNSA 1OXMA 5B6JA 2GESA 2GSWA 3VKWA 2PTHA 4D6XA 4A1FA 5CXSA 4A36A 3BZUA 4UD2A 3KPUA 2H9AA 3T3MB 1MV8A 2VZEA 5EMNA 4NEQA 3TIVA 3TZQA 3TG8A 3OE7D 2X3UA 3RBZA 1MZPA 1XCOA 6REQB 3GBSA 3GLFA 1I6WA 1SWVA 3KTOA 4LJ8A 3FGPA 3VHLB 2PUTA 1GUBA 1F1JA 1BH6A 1DC5A 2QENA 4Z99A 5I9MA 7ABPA 3RTGA 1P74A 1JTFA 4PHCA 2Q7XA 5DTRA 3ST7A 2ZRBA 4RCVA 3TQHA 1E9CA 3U6BA 3RPEA 5DCUA 1F4LA 2YXNA 4M9QA 1ECCA 5E7IA 1GUZA 4C05A 2PNJA 3P26A 4Z1MD 2QTVA 1UPBA 5E9QA 1IN1A 4URHA 2FN4A 1R0RE 2X86A 1Y5NA 3VNAA 1Z22A 1N5JA 3DE6X 1XDUA 5G0VA 1AQJA 3A25A 3EWIA 2GVNA 1TCVA 1PHRA 3A4IA 1OBOA 4NMHA 4OMFG 2VJMA 5H02A 4D0NA 3AF6A 4HLNA 1G7TA 4YY3B 4LXIA 3T8YA 3ETDA 4BRSA 1Z7GA 2OXEA 1IC6A 1TQ2A 1YQQA 2JFQA 4Y1RB 2WZBA 3OIUA 1XTJA 1YR2A 2YHBA 3PQEA 4TXJA 4X1IB 5BVHB 1P7VA 2WJWA 3F90A 4UEOA 1MF7A 2C5FA 3USZA 1I5OA 2P7HA 4CDGA 1RJEA 4JJAA 1RHQA 2Y1LA 1DUVG 4LY6A 4LY9A 5DEOA 4AKTA 2C7RA 3AKYA 1HT3A 2IF2A 1V26A 2IU6A 2P2NA 3JQAA 3Q3EA 2GHQA 4LY0A 5BQXA 5CFMA 3GNQA 4POAA 3SP1A 4Y2RA 5FUWA 3OHSX 4BDTA 1YK1A 2O1WA 3BFXA 5EHXA 4H17A 1RSZA 3SYTA 1M0WA 1AKNA 1EQ2A 1SMKA 2IOHA 2QTGA 2JJ1A 3WK6A 3H4IA 3FMPB 1KXZA 4X54A 2DECA 4IUBS 4PZLA 3FVWA 3WFZA 3D2CA 4BEJA 3RASA 5J5VA 4KRYA 1R3UA 4WXEA 4R1OA 4RH1A 2QTWB 4ADSG 3ZBQA 4CG0A 3WQHA 1IFXA 4ZU6X 2V9ZA 2IXBA 3F98A 4LXYA 5AVOA 2FR0A 1TVKA 5JMPA 1I4EB 3RIHA 1CB0A 1BGVA 1FYVA 1Z4PX 4OREX 1JHZA 1P6QA 1T26A 5DW3A 3LBYA 2VK4A 1UPUA 1T0BA 1XT6A 4D8YA 4PGMA 2A1UB 2VJLA 3NBFA 4G2NA 4RZUA 4X41A 3WB0A 3CU5A 3PUKA 4R69A 4EK9A 1CPYA 1VE3A 2XQFA 4E3WA 3E1SA 3I28A 3ISVA 5FNVA 3QPDA 1U3UA 1PR2A 3D8UA 3MTIA 3GP5A 5H0IA 4CMCA 1P1RA 4FZVA 1FP2A 1GQFA 4Q7QA 5DGIA 4ZCMA 2F4VB 4CM9A 5AVYA 3E5HA 3R44A 3IPAA 3R3VA 1INLA 1E4YA 3GJ4A 1EWKA 4H1WA 1W1IA 3F97A 2SICE 4K2AA 5AVJA 3NO4A 4NH0A 3FPLA 1NMZA 3R5XA 2IYXA 4N03A 3VU1A 4QT4A 4MQEA 4ZVLA 3FW1A 3BXHA 5IDXA 3BDVA 2NPFA 7REQB 3CLSC 5TR9A 1MVOA 4E08A 4G67A 5HCIA 2G04A 4H6PA 1JU4A 3UC9A 3G59A 3KEFA 5TVKA 3VKVA 2EWVA 1J2YA 2D5BA 3LUDA 3VVBA 4NTZA 3HXQA 3P2IA 2H4JA 4OK5A 4HNGA 1CQIA 3VFDA 3KL4A 3KSRA 2D1TA 1FTWA 2BKUA 5AM0A 3E2IA 3FHCB 3RUIA 3TBHA 1Z36A 3NT4A 4ZO6A 3KD3A 2GXQA 2NWQA 2ZQ5A 3A3OA 1C81A 3DFIA 3SLGA 3UJ3X 2AOUB 2RHJA 4P86A 3WRWA 3QXJA 4LOAA 1II0A 4LNUA 5KVSA 1XWFA 3W3AA 2NUTA 3KHUA 2V97A 1CZNA 1XZDA 4YV7A 5K01A 2R6ZA 1C7IA 4X8HA 4WWHA 5JVDA 4XWGA 3EVBA 1U90A 2A92A 2PWPA 4YPOA 2YOHA 3VBCA 1NIJA 5FJIA 5DNYB 2XE8A 3KVRA 1XAGA 2EG5A 3DUFA 3JWHA 1JP7A 3C6ZA 3LWZA 4X3OA 3ROZA 5FEMA 5J5AA 4EJ2A 1KEKA 2VJKA 3TX6A 1WZ2A 1FOEB 4MJLA 5EXXA 4DLVA 5AK3A 3F7TA 1Y5IA 4CIBA 4XR9A 5SYNA 2OUIA 1OAOC 5EHIA 4FFPA 2L42A 4WK0B 5C7IO 2YHIB 4II2A 4TS3A 4BWGA 1USWA 1OFTA 3OCUA 3FTEA 2DAPA 4D6YA 1IQUA 3HDHA 4NEGA 3DZDA 1KS9A 3AJDA 1WDMA 2EKPA 4LDNA 1XDWA 1GIAA 1ZNYA 3BXEA 5HOQA 4PLTA 3WIBA 3B6JA 4GGMX 4IJMA 2P2GA 3OIFA 2GEJA 2QVXX 4IKPA 5LBIA 4ANFA 3QA9A 4M0FA 3NOOA 4M36A 3T34A 1Z73A 4ZTUB 3DMDA 2WHPB 3L3BA 5BSRA 4FT2A 1PUIA 2WUWE 4X66B 5DLEA 3ESYA 2HIAA 4U5QA 3UAYA 4FFBA 1V3TA 2CXXA 2YVQA 3O1IC 1ABFA 1UC9A 5EYPA 3ZX5A 3E4CA 1DPFA 1J2TA 3QWIA 3WKEA 1TT5B 2YCLA 3L4JA 1Z28A 3L0OA 3D5TA 3S5UA 4MVCA 5FBKA 3B9PA 4JJGA 4P58A 1JAIA 4DTIA 1V9CA 2G25A 4WGGA 4D02A 3FGZA 1E62A 1ODLA 5A71A 3KKLA 1DC6A 1FP4B 1UL1X 4AY2A 1NFFA 2W0SA 2W6OA 1YB6A 3LQ1A 2NADA 1ZJJA 4IV8A 3SSMA 2H2AA 2XJ9A 2WMOB 3IQFA 4NDZA 1KDVA 4OAQA 2ZQZA 4EGQA 1CYEA 4Q48A 1DBWA 1RHJA 1VGQA 4WACA 2B69A 3TBKA 4B85A 1GLVA 2ES4A 2R4TA 2ZRMA 4AKSA 3CRRA 4LCBA 1ISGA 1GYQA 2X3FA 4DCSA 5I45A 5K0JA 2HT1A 4GXNA 3O8DA 1DGQA 4ISBA 1P1IA 3Q15C 3C39A 1SOUA 3UMVA 4JQOA 1CDEA 1JQAA 1CFJA 1SU7A 2Q3HA 1RQGA 1NVMB 1L7VC 3FDJA 4AD8A 3B8EA 5CUQA 4F9EA 2X5NA 5FA8A 2O59A 2CWWA 4RQBA 1D8AA 2HMTA 4QEZA 1EPUA 4YMWA 3PLNA 4WADA 3KKQA 2DRIA 2JC3A 2YRWA 1UP4A 2C2WA 2P6NA 3KQMA 4D4LA 3TI9A 3KSBC 1T2AA 1PJ4A 3L0CA 3FIUA 4OM7A 2VSQA 5JCJA 4YPVA 1L3CA 5MFZA 3CG0A 2PUFA 1GUAA 4FC7A 2D1FA 5BSWA 4PCUA 1H4VB 4ZHQF 2AJLI 1LRLA 1DAMA 1YE5A 2ECPA 2EKLA 3A4VA 4FYKA 4L5AA 1CZOA 2HI0A 1ZIPA 1XBTA 1JSXA 4J16A 4PYQA 3TLEA 2AEEA 2OWDA 3GH3A 3NAZA 16PKA 4M83A 3QVTA 1M0TA 3G8AA 1L7QA 2CLEB 2PYZA 3H6KA 2B8TA 3WY9A 3VAZA 1JV2B 3FYCA 2M32A 1ZKMA 1K97A 1T1IA 2DR3A 3FPSA 3PHHA 4X9XA 4LF8B 3HC7A 1FVXA 1XRRA 3WSWA 5DWQA 1IH8A 5LLDA 3ENZA 4OSPA 3MLEA 4ZO8A 3TAHA 3OO0A 4Q93A 4AROA 4ZV4A 3VYWA 3ZWOA 1QVWA 1GCOA 5BNFA 2FPPA 1EXMA 2JJMA 1A8PA 2RB4A 4P81A 3ZXSA 4BJ1A 3OQMA 2VT7A 3E9MA 4G5SA 3R3UA 5KDDA 1Z8DA 4L4YA 2BMWA 3H9JA 2OV3A 1N7IA 3LL7A 5DEIA 2JIDA 2ZYSA 4Y9UA 2RGYA 4EW2A 2UYQA 3JVUA 3PQ4A 3RQIA 2CF6A 1L8AA 3ICCA 1I6MA 2I34A 5DHQA 5KS2A 2I2CA 2PYDA 4FHZA 4TZTA 1O54A 3QLVC 2QIOA 1RAAA 2JI8A 1SUEA 4PO9A 2VPTA 5E6RB 2VZLA 3V97A 4HWTA 4LBWA 2B36A 5T57A 3AQIA 4FGUA 3TFOA 3TF5A 4L5YA 4HLUA 3SQDA 5AESA 1UKEA 4FXOA 5FUMA 4HQLA 1TFRA 3SZ3A 4DLPA 2FW9A 5HBGA 2CD7A 1OSNA 5J4YA 2OD2A 4YMVA 3HJHA 3DO6A 4JGIA 3FHLA 1LI5A 4TT8A 4HBGA 4ZT7A 3RSFA 4AMBA 5CXQA 3KQKA 1CYDA 1K0UA 1OLUA 1H4TA 3INTA 4Q24A 1M6YA 1SG0A 3GLKA 4MYUA 5TARA 3R8CA 1JAYA 1SQFA 2I22A 3KUXA 1ZUHA 4XM1A 4MW9A 2W83A 5JI2E 3W1VA 3JQBA 2JLYA 1Z35A 2G28A 4ND5A 4JLWA 4BLQA 4XWWA 3QZUA 4XQ9A 3QVWA 3BXOA 3EXHA 2PKYX 1B0ZA 3TINA 2R00A 1VCMA 1NKSA 3KUKA 3RFVA 1KC1A 2RE8A 3B13B 4OQLA 4TM8A 1PLJA 3TCNA 1QP0A 1Z15A 2W90A 5U4XA 3O90A 5HZMA 2RBGA 2HA5A 3GFBA 1P91A 3O93A 5C5EA 3LKBA 2PANA 1H2XA 2R6AA 1JEQB 3FZGA 4NOMA 1YR6A 1QFSA 1U8FO 5AW4A 5J2TB 1U7UA 4U1RA 3MTDA 3UWMA 3DF9A 4QG3A 1FTYA 2DGDA 2NU6A 3D3KA 4NYJQ 3VU9A 4OQQA 3DZBA 1G0NA 3Q3JB 2H1SA 3C41J 5HCUA 4ZEVA 4BHTA 2BDTA 4M0MA 1KJQA 2VDJA 3V33A 1E8DA 3OIGA 5THKA 1XWIA 4RGBA 1J56A 2A6PA 5EP3A 3F1LA 3KAKA 5F2NA 4A5OA 4PNHA 5L7TA 3R7WA 1KR5A 4MMXB 3THYB 1QYCA 4R9VA 1EAYA 3WC4A 3TKYA 4F97A 4E03A 1JDTA 1M8GA 1TO2E 1VL5A 1USVA 2OO3A 2ZUDA 3AUFA 3GAFA 1PR5A 5CIQA 1HNWB 5DTJA 2DKOA 3CRMA 2CXSA 2IY9A 2P6OA 3WV5A 4B8YA 3HYNA 2OCPA 4ND6A 4ZOLA 4UQOA 4ZVMA 3ESZA 3NT2A 1REQA 3OZCA 1IDOA 3GLHE 3OEHD 5TGZA 4F7WA 4DR6B 1Z2CA 3LHDA 1HDCA 2XKAA 1NVVQ 1TM7E 4MWDA 4MP3A 2ZFUA 1M3SA 5K8VA 2JGAA 3T61A 4MCJA 1ECPA 2AYYA 2WQZA 4FQ7A 3PUIA 4YRRA 3DV2A 3H1EA 2HU8A 3EEOA 3MFYA 4JDUA 2HK9A 4KIJA 3NYRA 4ZALA 3AOGA 1CTQA 3MSCA 1H0SA 1OFHA 4PRYA 3L1VA 5C5CA 1G8SA 3G13A 4W5NA 3MINA 1PV2A 3L5KA 4UUQA 1S2NA 1E5XA 1EFRD 4M76B 4LPKA 1UM9B 3PX3A 1GQ2A 4OU4A 3MXOA 1QMPA 2ZUFA 1Y1RA 3PWZA 1YGYA 2J33A 3PHCA 4NS1A 4LY3A 4MQ5A 4X3CA 3CIFA 5IM4A 1DFGA 3TTTA 3PDJA 4X20B 3R0IA 2GJ8A 1I80A 1Q7EA 4DCMA 2QS9A 3P20A 2EERA 5AKHA 1UKYA 1XJWA 2NZYA 3L7DA 2X9QA 2ACEA 2CUNA 5K3BA 1U80A 1JPVA 2WHEA 1XJ5A 4ZMRA 2GTHA 4Y6OA 3ZZMA 3PVSA 2ZM5A 4YQFA 4FEEA 3OIVA 4KP7A 2XBMA 2QD4A 3ILYA 4WLVA 2DB3A 3G2NA 3QLEA 1UXHA 3DOHA 2HPHA 2JGLA 4D45A 4UREA 4MLZA 2N3ZA 5FUXA 1T10A 4IDNA 1BXZA 5CLQA 5F76A 5TNXA 1L5GB 2O8FB 5T6MA 4CCYA 5KVQA 3KYDB 4GBGA 3RC8A 5SZKB 5HKKA 4AUMA 3ZJVA 1C4WA 1A1SA 1K9VF 1ZJ4A 2C1ZA 3EIEA 3V6MA 2ERYA 3EEFA 2PZ8A 3WADA 1K63A 1NJGA 1UDXA 2P1DA 2ZRCA 3Q7EA 4QRIA 5B6PA 3BE5A 1QDUA 3IQDB 4D4GA 2JGJA 3W90A 3LV8A 4G09A 4IO0A 5DNEA 4ZGGA 3GA7A 4JI7B 1IRIA 2HNAA 2KBFA 3PR2B 3C0KA 4B3XA 4OHUA 2HYIC 2E1RA 1XU4A 2DYKA 5JYBA 4D44A 2GKGA 1AG9A 1ABBA 1RKVA 3D1JA 3IDAA 5B2EA 4ZMSA 3ZBTA 5JD4A 2P6MA 3AP1A 4KE7A 4WFJA 2WDZA 3DOCA 3P9CA 3ZYZA 5FDFA 1KI9A 4OXNA 1IN6A 3IPCA 4JK3A 3RRMA 1BHSA 4H7PA 1DZ3A 3EF0A 4R6XA 3H7AA 3GU3A 4WZBE 3CX3A 4LHWA 5DLDA 5A9TA 2XOKD 4YUAA 3HO6A 2BEJA 3GEPA 1NYQA 4I19A 2PH3A 5C9ZA 2X8JA 3PKZA 3FUXA 4MR7B 3W34A 3ZCVA 3B7PA 1EHIA 1O95D 2O3QA 2VNHA 4LECA 1IY9A 1DCTA 3ER6A 5FBZA 1QANA 2HJGA 2PO5A 2SNIE 2EJTA 1SULA 5HRUA 1MO6A 2BZGA 3MGGA 2BE7A 4RDXA 3JD0A 4D99A 2P11A 1LPPA 1JKXA 1H1TA 3KP1A 3Q0EA 2WWGA 3FHOA 4MB2A 4NG5A 4ZCSA 1NC3A 4Y2VA 4U39A 4HEQA 1C4XA 2WM3A 2WR8A 1W4CA 4IMPA 3JD2A 1Q0UA 5DGHA 3KKKA 3QPVA 2IZ0A 4XYBA 4I8IA 4R83A 1ZPDA 3PI7A 3OQVA 3AKCA 1DCMA 2E89A 4G1VA 4QGBA 4KQHA 5GJVC 5A5DA 4RVCA 1TOAA 3AESA 3CPEA 3ELUA 5G4KA 1W5SA 4D9NA 4MQ6A 1Y4ZA 2ZR0A 4B9AA 2Q6KA 4B6FA 4GLLA 1NDUA 4YP7A 5F23A 3PWTA 1LNSA 1ZZGA 3REFA 3WL8A 4B3IA 3IE1A 4Z49A 3Q8KA 4QVKA 5EVCA 5I7WA 5JV5A 1TO1E 4MI3A 2CT8A 1U11A 2PUJA 2C2XA 4RPIA 3BGIA 4XWKA 4GL4A 4QJIA 4KR3A 4YRBA 3EG5A 2BBTA 1EK6A 2OPBA 4HC4A 2AUMA 1CUXA 4Q1AA 1RRGA 3K5HA 4CR8A 4KXXA 4ZQCB 4BNNA 1W7AA 1ORWA 2I54A 1T3ZA 3G2IA 4MKZA 2VP5A 1DJMA 2AEMA 5C53B 1C80A 2GZAA 3GD5A 4PYMA 1HNNA 2Y0CA 1JIIA 1NUPA 2BGMA 221PA 1G21A 4GF5A 3N2GA 4P33A 2QN2A 2H65A 4FFOA 4R7GA 3V8EA 1JHPA 3FHJA 3U6KA 4ARCA 3RGGA 4G5OA 3OH8A 3D6NB 1MQ8B 3M6VA 2O23A 1P1KA 1RADA 1Q6ZA 1N2CA 4UPVA 3JARA 4QLOA 2PH1A 1JH9A 4GWLA 1A0OA 3UWOA 4IQFA 3I3SR 1JWAB 1E6CA 1X8KA 5AJYA 4BFSA 3ETJA 4LCJA 5JPIA 1CHDA 1DTWB 2CKMA 3SKXA 4E31A 1QVVA 1CFZA 2REOA 4RTQA 1NV9A 1H94A 3NHPA 4TKZA 5JWHA 3RS3A 3SOPA 1I7QB 1NMSA 1QGZA 1FDWA 1Z0AA 2I76A 3ZKWA 4C6TA 4ZZ0A 5KPJA 4JKIA 3VAAA 4Q9JA 3LRPA 5AD1A 2AD1A 1KIMA 2QN6A 3G82C 3TTXA 1GO2A 4GXQA 3M6UA 1ILEA 5LP6F 3L84A 1RAIA 3IO3A 3Q41A 3QTTA 1WHTA 5CAEA 3GUYA 5GJCA 5JNUA 2HCRA 1Y3CE 4JUDX 2CDAA 3DDSA 4K9RA 1WUYA 2GD1O 1GU0A 4QLBA 2AEFA 1WMFA 3N53A 1DI0A 3M83A 1PFVA 1Z4KA 2IUSA 1DWPA 2CXPA 2IGTA 2WE7A 3CNQS 5HP4A 3QU2A 4MMZB 5SZIA 3K1AB 5TQ2B 4CV0A 3Q8LA 1DQPA 2A4MA 2G0NA 2GZHA 1RLIA 2Q9AA 2ZYRA 5HF6A 1QX4A 2XGGA 4ZYTA 4G6ZA 1NOJA 1Y8CA 4D9MA 4WKOA 1OT3A 4EZEA 4E09A 4C7KA 3EPKA 1VYUA 3WX0A 1E4EB 3HVUA 3KK0A 1Z08A 4YAIA 2WSSA 3KUDA 3AINA 4BRWA 1BMFD 4PWYA 2GEBA 4MNTA 4XOIA 1NPDA 3ZIAD 1K3FA 1E98A 2HMYB 2YWJA 1JG3A 1L7NA 3F5MA 3F4BA 3NBKA 3L7NA 1MXHA 2XECA 4JU9A 4ZT4A 2ORED 3DL2A 1XLWA 1YDMA 3QYAA 2QE6A 3OFJA 3N5KA 2YFKA 2P91A 5BW6B 5K09A 5FYDA 1NPYA 2XHEA 3OE1A 4X8MA 2PV7A 1CEXA 4LJ7A 3QVUA 4OL9A 5LLSA 2IITA 4F3KA 2P5SA 4OYHA 2RGBA 3HP1A 5BT8A 5ICEA 4H1VA 3GN2A 1RQPA 1E2KA 1TJ5A 2P1RA 3QU9A 3V2HA 3OQNA 2DF8A 4PSUA 1P75A 4EF5A 1KWGA 3COYA 1GGNA 1XU9A 4MRPA 2PSFA 1FNNA 4PSDA 4R2MA 4AAYA 3RNOA 1FLDA 3E7XA 3GRKA 4K9PA 1HKUA 1ADCA 1EVYA 3MRXA 5BSUA 3ZCSA 1AQ6A 1V16A 2HWYA 3GA5A 5E9AA 2GYYA 1E8MA 5AVRA 1L7PA 3RLIA 1PWXA 5JC1A 4GH5A 1XVTA 1WW8A 2GFHA 1W5FA 1BO6A 2QSZA 3DPIA 3L05A 2HIGA 3BL8A 5CM2Z 5AOAA 3LPMA 4GVLA 3R3WA 4KACA 1IPEA 5EMHA 1M5TA 1LK7A 2B1QA 3K71B 2BEVB 1UXJA 1RRCA 2CNWA 1H5NA 1B15A 1MN6A 2YYSA 4DRYA 5AW6A 2ZVPX 3C5EA 2J6CA 3FTQA 3TXXA 4DFDA 1GNQA 3LC1O 3OQ6A 3PA6A 4O2BF 1CZKA 1NR7A 1DMRA 1RABA 3AV0B 5EWJA 5TEVA 4NIMA 4FSHA 3SF8B 3HQ4O 4ZK6A 2GB4A 4OAPA 4QTZA 3ER8A 3O4HA 4N41A 4V0ME 1I3CA 4NV1A 2XMSA 1JFSA 3WGJA 2XT9A 1XNQB 3C48A 3LPDA 1Z2DA 2BSQA 1JMKC 3BRWA 3P71T 3O8CA 3MXTA 1LCIA 1IOLA 2B4QA 1JQDA 1DG1G 2AH5A 2OGWA 2R8RA 3IQEA 4H7FA 4DGSA 3NIWA 4ZJPA 3HVRA 4K03A 1VI5A 4KZPA 1MIHA 1EJ6A 2H54A 3AFHA 5LXTA 1FX1A 3HM9A 1H6AA 3TD9A 3EVGA 4PQEA 1BWQA 2A4KA 3DW1X 1KVSA 2GSDA 3Q4GA 3WWCA 2NO7A 1GA1A 4N4AA 3QIAA 1I4LD 1KJJA 1YBVA 5HG0A 4F93B 4QAJA 4HZUA 3KD2A 4KKXB 2WT4A 1U8YA 3C74A 4NCBA 5EXPA 2V4MA 1RWBA 1D8TA 2QG9A 4ZVUA 3SMQA 3ZS8A 2DY1A 4FHEA 4BKOA 1DOAA 2JAXA 1T2FA 1JLRA 1TAQA 4BEBA 4EGAA 1JSLA 1JHVA 5K51A 5KYWB 4IXMA 4L74A 1CY1A 1G5FA 2RAFA 2VDQB 3PXDA 4MUGA 2J67A 3RT7A 4A8PA 4CLOB 2AC4A 4M0KA 5D7BA 3FJ1A 4TLEA 3MOIA 4AJHA 3OOSA 1UM8A 1XEFA 2EP5A 2X76A 3TXYA 2JI4A 3EUWA 4GRAA 4KXUA 3ZLUA 2VVTA 4NV0A 2X7XA 2G1PA 3A4LA 1M6HA 1KBZA 4NJEB 1R27A 2V65A 1X80A 4UVIA 4MOWA 3WZ2A 2EZ4A 3TLBA 2D8MA 2OGSA 2Z4SA 5KNCH 3HCEA 3D4PA 4D9CA 4HNQA 1US8B 1JFRA 1DRKA 4OHBA 3ZXXA 3JV7A 1G6HA 2C2MA 3F3YA 1VKRA 2GK6A 5AKGA 3WWDA 2O06A 2YWCA 2WAAA 5JMWA 1U9IA 2ZKIA 2XCSB 5DV9A 4DQUA 5A02A 2XSZA 4ZOLF 3GCGA 3UENA 3EULA 1TTQB 2GNAA 1M2JA 1NXTA 4PCLA 3VPHA 4O4LB 1MPTA 4O3MA 1K8RA 2X7HA 4HATA 3VZSA 2WB2A 2KMLA 1KEWA 3ECSA 3NV9A 1YBFA 2ZE8A 3OEYA 4UE3S 2CXRA 3U4AA 1UMKA 5JRZA 3AP3A 3QMWA 2H4FA 2F1KA 2WU0A 4P2BA 3CRVA 5LUBA 1ZCFA 2KLBA 3MEQA 4C4YA 4HAUA 4DYVA 4HYTA 1J8YF 2EATA 4G0WA 2WKQA 1QFXA 5CYFA 4WXRA 4ZZ2A 3PNBA 4QX6A 4JI0B 4HWGA 1G55A 2EZTA 3DFFA 4URWR 2JFUA 4NXMB 1A9PA 5WRFA 1M33A 121PA 5BN1A 1GPJA 3BD7A 2PMFA 4ND7A 3EXAA 2O5VA 3TUJC 1KNXA 3W0LB 3C3MA 2A2ZA 1LF5A 5IJWA 1BRTA 1X9GA 2ZS7A 3GGPA 5BVHA 1CR0A 4V02A 2K7ZA 4K88A 5FLKA 3G79A 3Q8WA 1AQUA 4XX0B 4QXMA 5AOVA 5KTKA 3NM6B 3ON5A 4QNRA 1EIWA 4ZQIA 4L0CA 1QYIA 4CODB 2QGNA 2TMDA 5LQRA 3FYDA 2H7XA 3GL9A 2BSXA 5F2OA 4DSTA 1MORA 2B8JA 3U3ZA 2A57A 4EMTA 5EWLA 3ZJTA 4RKQA 3RVBA 1MU0A 3C5VA 4JGGA 3GLIA 2YWFA 1Y7PA 3UJ8A 2YJZA 2BC9A 3VPFA 2B98A 1UKBA 2HSGA 4NBRA 1O87A 4C5BA 1EFPB 2BN4A 1MGOA 4DKJA 4IIGA 1ID1A 4W1RA 2EFEB 3GPCA 3HCRA 1WZIA 1FMFA 7MHTA 1HE8B 1PFKA 4PHHA 3IC5A 4EITA 1M1YB 1B8PA 1GQRA 3BE4A 5JS8A 2EL9A 4LVOA 2XTNA 2NV2B 4IX9A 5F3RA 1EP1B 3MUFA 4JOBA 4NOLA 3D8TA 3S28A 1MB0A 2PL1A 3V7NA 4ZI2A 3PC8C 2JGDA 4FNGA 1B26A 3M70A 5BQFA 1WUIS 1KQFA 5JSUA 1Z6GA 3JAMA 3TW0A 1K7CA 4JASB 5F9MA 3LWNA 1V45E 2EX4A 3ONNA 3VSCA 4I4NA 1EDBA 3VQTA 5HXAA 3IQGX 1RM5A 2ANBA 3FOCA 1UM9A 3FSJX 3NETA 1UT6A 3LF2A 5D87A 2BGNA 1P1FA 3C4VA 1Y48E 3E27A 4JQSA 1VMEA 1X7ZA 4IHAA 3L7LA 2D7DA 4WFQA 3SDZA 3GFGA 4X63A 3ZNOA 4IDFA 4P5EA 3ER9A 2XMRA 4I1SA 4RKWA 3PEWA 1H8EA 3OSUA 1P0FA 4EG6A 3MCWA 4R2KA 1VC2A 3DKIA 1T6ZA 4IOKA 1P62B 1VLQA 2QRNA 1V5EA 3HKEA 4BATA 1Z06A 1MNQA 4TOIA 4QO7A 4MVXA 5JVDB 1E0AA 1UBFA 3M5CA 4JYMA 2ZIWB 5G02A 1UMDB 2A84A 4F2DA 3U1BA 4DABA 3KDPA 1GNTA 3PQ5A 1PVVA 2H85A 2QVGA 4IDDA 3R9IA 2EZ9A 5BSFA 3I5XA 3QEKA 3UTCA 1LSUA 1S4QA 5AMXA 3UKDA 2E18A 3PXXA 1Y6FA 1DEXA 5EXDA 1KF0A 4FKBA 4GZMA 2RK3A 3IHKA 4A4DA 4EO9A 1DBSA 1SCKA 3AM3A 3QOFA 1QCZA 2BEWB 5JRJA 3V7FA 4U2EA 1RNLA 3HEBA 1OXKB 4EHAA 3WS7A 3DAOA 1RI5A 2UZIR 4O4IF 2G17A 4DG8A 2C8VA 2YIDA 1NUHA 1WV0A 4TWBA 4B6RA 1GA6A 1NYRA 1JHYA 3BTOA 3IJPA 4I1IA 5H3CA 1OI2A 1XRJA 3RYFB 1JBKA 1KMMA 3X43A 1N33B 1S8NA 4HWKA 4KQJA 2QTMA 1QVRA 3KU1A 3U0BA 1V1RB 3ITDA 1K75A 3LY7A 2BTQA 2PMCA 1V2HE 4NBKA 2V03A 1OQAA 4RZXA 2ZUSA 4DGQA 2Q2VA 5I4CA 2HRCA 2QE7D 1J0AA 3GUCA 5REQB 2J0VA 1D0SA 4B82A 5FBWB 1EI9A 5BQPA 4AI6A 1QX3A 3C7AA 1J5XA 4WKNA 3M9LA 3SKVA 1T0PA 3OTOB 3DUFB 4DC9A 3LWDA 4B35A 1CJUC 2ECQA 2VH5R 1PQYA 2W5UA 2I6GA 4M22A 2E82A 3OT1A 4DCNA 2HF8A 5C5IA 1W88B 1RVV1 3EF1A 4OJMX 1BQ3A 5EUQB 3TD2A 2XVYA 3ZHBA 4AP5A 2AN1A 1JKIA 3G17A 5AQ1A 5LQCA 5FADA 4KIUA 2Y9PB 1PT6A 4LDPA 3KTDA 4AUKA 5BMOA 2WUEA 4H1UA 2WA2A 4N3AA 2W70A 2FMTA 4AK9A 3DVQX 2J6BA 2CLHB 3QUSA 4L0QA 1G9TA 1I32A 3NFRA 4CKCB 1NX6A 3RFTA 2CHEA 2HFKA 5KJFA 3LDHA 3QW2A 2HQRA 2I6XA 5JQWA 2GDJA 4LYEA 2NSYA 1VYHA 2YJGA 2PBFA 1NT2A 2KE5A 3KKOA 4RYDA 2WWFA 4CM8A 1XIVA 3OF5A 4HB3A 5COQA 3TZHA 1P29A 2W2VA 3PXAA 2ZUEA 2P68A 1DJOA 5K3CA 4C5AA 5DOVA 1H69A 4BFTA 4OMCA 4MINA 4TYPA 3VNUA 1HYQA 3LP6A 4FGWA 3FWNA 4NCHA 2VDLB 1SC1A 4IIJF 3BL6A 1DT3A 3RFCA 4F38A 1N57A 4UVEA 2LKDA 3DC2A 4BX8A 4RH0A 1J8MF 3KOYA 1MBZA 3C1AA 4PG5A 1HI9A 1RPJA 4WX2B 1XXHA 2I29A 4AMYA 1BE8A 2FEOA 3L9XA 4A2PA 2UZ0A 1JG4A 3ZI4A 5C8YF 1AQLA 4HVAA 4S1OA 4MKHA 4XX0A 1R12A 2LTAA 3C6YA 5DLYA 1FP1D 5I7OA 1LBTA 3V1NA 1XF9A 1SM4A 2B2CA 1ZRHA 3EF3A 1WCYA 5C7YA 1E0JA 1M2VA 1L1RA 1WXHA 4EECA 1II8B 3H1GA