4CL8A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 92
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cl8A00
1PJLA 3IQDB 4WEOA 1TB4A 2X1HA 5JMPA 4E31A 3BHJA 5IZCC 4HUJA 3U09A 4ALIA 2J5KA 4J90A 2PGJA 4XCVA 5A5FA 4WGGA 4OYRA 1KYQA 2ZB4A 4AJOA 4X54A 4UULA 5I8WA 3EDMA 3UH1A 4B3IA 1E1MA 4NU6A 2C0CA 3E9MA 4G65A 1D1SA 3BTOA 3GVHA 1E7WA 3JYPA 1LU9A 3VPHA 2TMGA 3U4CA 3GC6A 4E3ZA 5H83A 4F45A 5I7EA 5BR7A 3VTFA 3EC7A 3MJ4A 1OFGA 5CEJA 3ICPA 1MP0A 4G81A 1H2HA 2PGDA 1BGVA 4UVDA 4YJHB 5LC1A 3VKVA 2X8LA 3NTRA 3H5RA 1IHXA 5TT0A 5A06A 1QKIA 1FXSA 3ZU4A 4ALKA 5ICSA 3ZWNA 4RVHA 3I9JA 4YAIA 2E82A 3KYDA 5FWNA 1QYCA 4K26A 4BNZA 3ROPA 3QQPA 4BGEA 2IYOA 1LTHR 1ZSVA 5I9NA 4YWJA 3UUWA 3FWZA 4FB5A 2OGUA 4YT8A 4OKIA 3HG7A 1EFKA 3LC7O 2Q49A 3C1TA 3GEGA 1JVSA 3F5SA 4HNHA 4W7IA 3VZPA 4EDFA 1E3EA 4JK3A 2EG9A 2Z1MA 4NDNE 3KB6A 2E4AA 2QW8A 1ENPA 2BMAA 2BKAA 5JNLA 3AFNA 3WFIA 3F47A 2VHXA 3HQ4O 3NAQA 4J7UA 1L7DA 4KWIA 5TX7A 2BI8A 4CM9D 1UP7A 2YV2A 1ZCJA 4NH4A 4QTZA 4TQGA 4TVOA 2Q4BA 1V3TA 1QYWA 3B1JA 2DT5A 1SCUA 4GVLA 2HRBA 2NM0A 2PA3A 2PZJA 3CKYA 1PGJA 3AUAA 1X14A 3JD2A 3W4JA 3F9IA 1U8XX 1GR0A 3IKVA 3IC5A 1LBEA 1HF3A 2EKLA 3TJRA 1VLLA 1VJTA 5F3RA 3D64A 3ZN2A 1OAAA 1G0NA 1HEUA 2Q2VA 1ISJA 5IDXA 4CV0A 4EZBA 1WZIA 1Z7EA 2HMWA 3AY7A 5F21A 4YA6A 4EW6A 5JY6A 1XWFA 5I7FA 4INAA 1H6BA 3ST7A 3NJ8A 1FDTA 9LDTA 4BNVA 5JW6A 1DO8A 1LRJA 4CM3A 1R4NA 3WX0A 2J8ZA 4BNFA 4ZA2A 2AEJA 3BMCA 1VM6A 3D4NA 3RKUA 3VPSA 1ORRA 4MIEA 3V1YA 2PZKA 3DL2A 3V1UA 1I0ZA 2I3GA 3K2BA 5ER9A 4DIBA 3GN1A 2VUUA 3JQ9A 4QX6A 2WDZA 3E48A 1ZEJA 3BTSA 3ZI0A 1T1RA 2P9GA 3AU9A 3G1UA 3QVSA 4CR6A 3FWNA 3ASUA 3L0DA 3N74A 5JY1A 2B5VA 1B2LA 4DGSA 4A27A 4CL8A 2C2XA 4MINA 1H2BA 4B7CA 3DHYA 3PQEA 3GQVA 4E13A 3VZSA 3WICA 4HWKA 4NPCA 4YAJA 3RROA 3ZV5A 1WXDA 2CVQA 3A4VA 3GH3A 4FR5A 4QXMA 2VN8A 4CM8A 4E5YA 4BNJA 2G76A 2BFMA 4L9RA 1BTOA 1P44A 2NU6A 2R6JA 4IZHA 3ICCA 3OM9A 4LRSB 4B4VA 3JD1A 4PIVA 2G5CA 1U3VA 2PD4A 3I23A 4XKJA 2FSSA 4BO7A 2VYND 4ID9A 4FIZA 1IY8A 1E92A 2TMDA 4U0KA 1NR1A 3GNTA 2Y68A 3QVOA 4EUEA 1B15A 3RUHA 1HSZA 4E30A 2WYVA 3BMQA 2Z1NA 1DC6A 4RPGA 5T57A 1RKXA 3OH8A 4Y6SA 1QP8A 4JQCA 4A03A 3IOYA 2JFHA 3RJ5A 3ONEA 4IBOA 3VKUA 3U5TA 4UUNA 3FHLA 4DL9A 5H81A 3RAJA 4JXKA 2O3QA 4MKRA 1LA2A 5IN5A 5J23A 1AHHA 2OHXA 3VZRA 2Y05A 1TI7A 5TSDA 4IJUA 1ZK4A 4KWHA 1L1FA 4AJPA 4Z9FA 1D7OA 1QYDA 3H65A 3IUSA 2AEMA 2IZ0A 4KUHA 2O3SA 2EKQA 4I5FA 2VTEA 4BNHA 2DUUA 3NV9A 2CVOA 5JO9A 3H7AA 2UYYA 3ADPA 4WUVA 4BB5A 3JQAB 5K9ZA 3GZ4A 1ADCA 4B4WA 3GFBA 5BSGA 2VOJA 4P38A 3K9QO 4DXHA 4UEKA 5L7TA 3OA0A 1H6DA 1KEPA 2Y0CA 4OXYA 1N1GA 1HKUA 3C7AA 2X9NA 1KY5A 1G6KA 3BMQB 3D3WA 4QUKA 5JAQA 1P0FA 4JJIA 4BQRA 2WWRA 1SEVA 4P8RA 3WGOA 3F6YA 5KVSA 4XGKA 5ADHA 5ENVA 4J4TA 3STHA 3PHJA 4R41A 3LDHA 3WTBA 3VAZA 3B70A 1BWSA 2GERA 1QYXA 3VTZA 1N7GA 1F0YA 1U3TA 1ADBA 2DBZA 2FR1A 1MLDA 2B5WA 1NFFA 1M2WA 2FOIA 1KVSA 2RHRA 4NK4A 5DOZA 2PGLA 5BSHA 2IEDA 2D5AA 3LU1A 1H94A 2EJWA 5EIOA 1IL0A 1F8GA 1CETA 3GGOA 4IM7A 1FDWA 4II3A 1WDMA 1YBMA 2PWZA 4YACA 3UCEA 3ZWYA 4I5EA 2ZYGA 4D3SA 4QO7A 2VCYA 1ZSYA 5IXYA 5CHEA 1T26A 1VKNA 3PVZA 4L73A 4XQGA 1BMDA 4MP3A 3BHMA 2DTEA 3GDFA 1HZJA 2QYSA 1E1NA 4NFHA 3WG9A 4CMIA 1F06A 5AXBA 2NTVA 1Y81A 2VOEA 1K89A 1JAYA 1I30A 1SBYA 3INGA 3DHEA 1MFZA 1R4MA 3A28A 3LT4A 4IPTA 5IF3A 3AK4A 4ZJUA 4PZCA 4XD2A 3KOUA 1DBVO 3PHIA 4Z3KA 1T2EA 5JDIC 4CLRB 4FJ2A 3DAGA 5TT1A 3DHNA 4Q39A 4AL4A 5T67A 1JW9B 3E5RA 4UEOA 4A7PA 3ETDA 1NVMB 1EK6A 4R1SA 4I5DA 4M87A 3EY4A 1CYDA 1NM5A 2IYPA 3E9QA 4Z6KA 1F8FA 2NVUA 3GEDA 1TVEA 3GEMA 1XDWA 3FR8A 1GL3A 4YRAA 2GCGA 3O26A 3S2FA 2NWQA 3VPFA 4U6SA 1QV6A 4BNGA 5IAAA 3RBVA 2A35A 4DLLA 4DUPA 4W99A 3LLSA 2CZCA 3U3XA 3I9NA 5JDCA 4ZQGA 4IIVA 2DBRA 3OJ0A 4BNTA 1OC4A 3HDQA 4NK5A 5TC4A 1BDMA 1O89A 3OJLA 4N18A 5CDTA 1DFGA 3JQCA 1HXHA 4CM1A 5FEUA 3OETA 3FF4A 1XSEA 4Y98A 1DLJA 2GN9A 5LDHA 3VH1A 1GU7A 1I5RA 2IXAA 1WVGA 4GQAA 3D3EA 5JYEA 4UUOA 1BHSA 2JD0A 4LGVA 4XWYA 2EP7A 1MC4A 1WP4A 1ZMOA 4JLWA 3WDSA 4E5PA 1ISGA 5BQFA 4Y67A 5CDYA 2E48A 3OFSA 4R4JA 2I76A 1UDBA 3U62A 4IXWA 3BMNA 2VTDA 3PTZA 3AJRA 1YXMA 3DR3A 1RYEA 3D7LA 2H6EA 2I6TA 3PRJA 3S8MA 5TF4A 3T7CA 4FOOA 2CMDA 4BMVA 1LC0A 3PFWO 1NHGA 3MJCA 2PY6A 4R69A 3RUIA 3TWOA 1MXHA 2F1KA 4EI2A 1Z6ZA 5I9LA 4GAEA 1CQIA 3OJEA 4QFCA 2O3TA 4F46A 1E5LA 1N2SA 4R54A 3A06A 1T24A 1H0KA 2V6FA 3GR6A 3OIDA 4FD3A 5AXDA 3NTQA 3W8FA 3WMWA 3DZGA 4IMPA 3C7DB 2WE7A 4IGEA 5KTKA 1SEPA 1HZZA 1AGNA 1LNQA 3EZLA 2CFCA 3HHPA 1T4DA 1UP4A 4ZICA 5IJZA 1GUZA 4E2YA 1Y9AA 5CPBA 3GAZA 3DMYA 4AJNA 3SJ7A 2EJVA 3QWIA 3D4OA 2X0JA 4RVDA 3R1IA 4CM4B 3T4XA 1P33A 2IODA 1YB5A 3D0OA 4RDIA 1ZZEA 4PZEA 1I2CA 2ZK7A 1NPDA 2Y1OA 3I4FA 3JSAA 1JKJA 1YKFA 4XR9A 2QHXA 1O9BA 1FJHA 2POQX 4E5KA 3H5NA 4Q9NA 1CRWG 2VHVA 4LMRA 1LLUA 1XHLA 3O38A 2VWQA 1WDLA 1GUFA 3I5MA 1EBUA 4L0QA 5F1PA 3RKRA 5JSFA 1MG0A 5DP2A 3GMSA 1SAYA 4XQ9A 1ZH8A 5H82A 1Z74A 4D3DA 4H16A 2DLDA 4XJTA 4F3YA 4YQZA 4OQYA 1DFHA 1O95A 1UXGA 2RCYA 4A73A 1UXHA 4CMEA 1IPEA 3Q2IA 2JCVA 3KYBA 4EJMA 2Y1EA 2GZ3A 2VWGA 1K5HA 3V2GA 4NBVA 2OUIA 3DZBA 2BGKA 5DT9A 3RQSA 1IB6A 1Q2XA 4RVFA 3K92A 4PRKA 3IS3A 3M6IA 4R3WA 2I9PA 2OMEA 1HRDA 4XRRA 3TDKA 2PK3A 3C85A 3UCFA 2O3JA 3HFGA 1OC2A 1YDWA 1YJQA 2YDXA 3ZNPA 1LRKA 3ETGA 1K0UA 4IJVA 1KEWA 5HS4A 4MOWA 1JWBB 3ZCXA 4BIIA 5F1OA 5U4QA 4ALLA 1Y8QB 2V65A 3OJFA 1R0SA 3ZU2A 4TKLA 5COQA 3RIHA 1VC2A 3LZ6A 1HETA 3R3SA 2ZYAA 1X13A 4FDAA 4ZRNA 1YQDA 2NNLD 1NNUA 5GY7A 5L95A 2HAEA 4E2WA 5A9TA 3GDGA 5JDIA 1A7AA 4BNXA 4YJFA 4XDYA 1RM3A 2YQ5A 3TF5A 4TSKA 3KLMX 5COAA 1WDKA 2X9VA 5I7SA 3PIIA 2P5YA 5AYVA 4CMGA 1GEEA 4KQWA 4J1NA 1J5PA 4NG5A 4CM5A 4UVGA 1U3WA 1HWYA 2Q4EA 3DMTC 5KOIA 4KDFA 2PH5A 4UAGA 3H2SA 4CM9A 2AQIA 1GZ6A 3DBLA 5JC1A 4AJ4A 3AI3A 3L9XA 3PJEA 2J5RA 4Z0HO 3AM3A 4YAEA 5EESA 3DOJA 1B26A 1R12A 4O59O 3TZHA 2C20A 4GWKA 5T8KC 2DAPA 4AICA 1KVRA 4GX2A 1QORA 5IZCA 3RWBA 3S2GA 1KEVA 1BW9A 3O8QB 3B1KA 1UJMA 1PIWA 2O7QA 4CLOA 1O94A 3WNQA 4WLNA 2AEFA 4DC0A 2Q46A 3ANMA 1U4SA 4XIYA 4CUZA 4WCFB 3S2EA 4BO4A 5GZ1A 3EMKA 4B4OA 3NKLA 4BGIA 3JV7A 3QVTA 1EEHA 5BNTA 4ND1A 2JHFA 5JFOA 1L7EA 3GY0A 3WGTA 1ZXLA 1UH5A 4OJNA 4WNCA 5JPIA 1E6WA 4E21A 3ZZNA 2JKVA 3G1TA 3ENNA 4Q3AA 3U4DA 4BO6A 1ZK2A 2VZ9A 1UR5A 4TRMA 2ZB3A 2P4QA 1I01A 1V8BA 1U8FO 1M66A 4TVBA 2CD9A 5ENDA 4HXYA 2FRDA 2SCUA 2GN6A 4QEDA 3KRTA 4Q3NA 2JHGA 1GYPA 4IDGA 5KVVA 1PJTA 4LN1A 5DNAA 3PWKA 3PEFA 4J4BA 2HK8A 2Y1FA 4LVCA 3UOGA 4U0JA 3L6OO 4MPDA 3Q11A 3ONFA 5ES3A 3HWRA 2AQKA 4RF3A 2O50A 3H9QA 1E7YA 2QX7A 2GO1A 4E4YA 4S3MA 2QRJA 1T2CA 1XGKA 2X23A 3AU8A 5FF9A 1ADFA 2XOXA 3ON5A 3I6QA 3O8QA 4OSPA 5GMOA 3VC7A 4ND3A 1T4BA 1XELA 2Q99A 3EZYA 2DKNA 4AFNA 3WSVA 3IKTA 5IDWA 4J16A 1CDOA 1P31A 5DN9A 1HSOA 2PKQP 1KVUA 5DBIA 3RC2A 3G3EA 4R5MA 1P0CA 3AUSA 4YAKA 4ND4A 1XKQA 4MVJA 3VHRA 3MEQA 5IDYA 1ZIDA 4XYMA 1R0LA 6LDHA 4P22A 2PKRA 1Q7CA 3JQBA 2XXBA 3PYXA 3O9ZA 5KVQA 1WMBA 3CTMA 1S6YA 4JCOA 4EEZA 3PIDA 4R3NA 4K1LA 1V9LA 2ZQYA 3CSDA 3OQBA 5IG2A 2NACA 4WPGA 3I83A 4AG3A 3SC6A 4XZ3A 4BO3A 1CQJA 5L3ZA 4L4RA 3H3JA 4CM8B 2W2LD 1LDNA 4RVSA 2J3HA 1GAEO 4LSWA 4D0RA 1CWUA 3JQGA 4FJ1A 2Q1TA 1MUUA 1KVQA 1I36A 2FZEA 4YDRA 2D3TA 4H15A 3ZNOA 4PLVA 5ER6A 4IDEA 5COBA 4CUJA 5L4LA 4XIJA 3IP3A 4FFLA 2B35A 1ENZA 4BMSA 1NPYA 4IY1A 3H9JA 2X9GA 5G0SA 1ZXBA 3WBBA 5AQ1A 3H5AA 4JBIA 3WWYA 4TRJA 4DQXA 3RUEA 2JCXA 3K8ZA 1CIVA 2B37A 1ZVMA 4WKGA 3G17A 4BNMA 1DIHA 1HLDA 3QRWA 1YGYA 3PFFA 1HYEA 3S2IA 3UXYA 3PWSA 5DCWA 2VHWA 2FWMX 1I24A 1T25A 2EF1A 2C5AA 1BXZA 3VPXA 1CF2O 1YOVA 2X22A 4FOSA 2W4QA 3FNFA 3HN2A 4KQXA 1ZSNA 3JQFC 3PPIA 2EERA 2EGGA 3C8MA 3E82A 3ZW9A 3ANLA 2AA3A 3WGIA 5KIAA 5JLAA 4DMMA 1P1JA 1ARZA 1LC3A 2DQ4A 4NR0A 1ZNQO 3GMDA 2BGLA 1HDCA 3JQAA 4OOFA 4WNIA 3E9NA 3AI1A 3FD8A 3WYCA 4YPOA 5KWEA 1KBZA 1AHIA 2ET6A 4B4UA 2JCYA 5DBFA 1NFQA 4YJDA 3UF0A 2OXIA 1EUDA 1PU2A 5HA5A 5K6AC 1MG5A 3L4BA 1LDGA 1X1EA 2D2IA 3WLFA 4TRRA 3WYBA 3MJSA 4WECA 2AXQA 3JD0A 1R4MB 4KUGA 4AJEA 3E1KA 4HBGA 3AOEA 4IS3A 4DQVA 4GLLA 3PJFA 3JQFA 5DCYA 1YBVA 5IZ4A 3PZRA 4RO0A 1YONA 4WOJA 3ZHBA 1LI4A 1PTJA 1P1RA 1U7TA 4GI2A 4UUMA 2BI7A 5KJ6A 4E6PA 3H8VA 2ZYDA 1I8TA 1N9GA 3KYCB 1YO6A 4RZIA 3ZDFA 3E18A 3O4RA 3JQ8B 4E12A 3ZWMA 2NTJA 4C4OA 2EEZA 4IDCA 3W6ZA 5TLSA 2Q45A 1PEDA 4NU5A 4CMEC 5L7WA 4MVJF 1C0KA 1NR7A 1UDCA 4MIYA 1N9GB 3DOCA 4ND5A 1U28A 3DAFA 1EE2A 4A10A 1Q7GA 4UVHA 5TQVA 2VZ0A 1U7HA 4AJKA 3TL3A 5JS6A 5JCJA 4HKTA 1BXGB 1GY8A 1TLTA 4HFRA 3CH6A 5HWSA 3JTMA 2QYTA 1EK5A 1NQAO 2ZB8A 3DZKA 2ZCVA 1A72A 4BO5A 2I5PO 2NUAA 1ISIA 1B16A 1N5DA 4Z9YA 1IUKA 2GSDA 4CL3A 3OJOA 1E7RA 2HMUA 4E33A 1N92A 2EHDA 2J3KA 4QT0A 3WNVA 5DP1A 3F4LA 2YZ7A 3ZWCA 3LLVA 4BV8A 4EJ0A 3TOZA 4RPJA 1LSJA 2VHZA 3ZWXA 3WTCA 1S7CA 4WCDA 1MFPA 1DEHA 1V35A 1U2GA 1I3LA 1Y5RA 1P77A 4Z0TA 2IDZA 1IZ0A 2FP4A 4RL6A 5L4SA 4PGFA 3RFXA 2A4KA 4DBZA 3WOHA 3AM4A 4RVUA 2Q50A 3DDNA 3RASA 4IDFA 5DULA 1EQ2A 4BNYA 2O3RA 3G49A 4QECA 5T5QA 1FDUA 3JQ7A 3WQRA 2HDHA 4A26A 2D59A 3SLGA 2V6MA 4YJGB 3ASVA 3GNQA 5CAEA 1E5QA 3UKOA 4ZHSA 4Y9DA 3ZWWA 3QHAA 4PLHA 1WWKA 2QZZA 3KM0A 5DOVA 1DIGA 4HX5A 3UGKA 3IMFA 3UFXA 2BFPA 2P9CA 4MVJE 4YRDA 2X0IA 1M6WA 3GHHA 3QE3A 3GPDG 1P1IA 5B1YA 4RPLA 4HY3A 3PWZA 1C0IA 4ESOA 4U7WA 2VNSA 5JDCC 4CODB 4MVJM 4CV3A 3NGXA 2W2LA 3QA9A 1GADO 3TZ6A 2GF2A 5B4UA 3LT1A 3CZMA 2GUGA 3CEAA 3ROKA 1GYRA 2YHIB 4KMSA 3ZHXA 3QY9A 4NFYA 3VZQA 2OO5A 1B8UA 2BELA 3SVTA 4CQLB 2DPGA 4ZD6A 1R66A 1EBFA 3SX2A 1X1TA 1SB8A 3NYWA 1NVGA 2YY7A 4J7XA 5G4LA 4R1TA 1I2BA 3EK2A 1TXGA 1LDYA 3DOOA 1K3TA 4B3HA 4XQCA 4XQEA 5F5LA 1NASA 3JQ9C 4Y6RA 1O0SA 3SBOA 5CDSA 5GZ3A 3JYNA 1LQUA 3CXRA 3KV3O 3K5PA 4PN3A 1Q7BA 4PG5A 1QSGA 3PP8A 4EEXA 4BS9A 4LW8A 3OP4A 4Q3BA 1ZK0A 4J91A 3DZFA 3DXFA 3TZKA 4NJOA 2LDXA 3DBHB 3MWEB 3R0IA 1PQPA 1X7DA 3AM5A 3PQDA 4ZGWA 1Y6JA 2I3AA 3OBBA 3FNEA 1ZW1A 3ZNNA 3W4IA 5L53A 2EKPA 3E8XA 2HO5A 2FMUA 3AOEC 2O2SA 1HDXA 2VUTA 4WE3A 5JCJD 3W6UA 1EDZA 2NVWA 2V6GA 5HRUA 4GPD1 4EUHA 2VUSA 4NNJA 2JD1A 3FPCA 3FI9A 1ZEMA 2V6BA 3F3SA 1YL5A 3QWFA 1E3WA 2DVMA 5FYDA 3W8EA 3SC4A 4JX8A 3KXDA 3V2HA 2P68A 1XIVA 3WQSB 1I32A 2UUOA 4KUEA 1DC4A 5FFFA 2VRCD 4PLWA 3NJ4A 3BMNB 1UXIA 2RIRA 2H1SA 3P19A 4RPKA 1I2ZA 1LRLA 4PLTA 4PVCA 4HFMA 4MVJG 5DZSA 4BHTA 3AI2A 5I7VA 4P4GA 4E2ZA 5A03A 4W6ZA 3ZNQA 1GYQA 3JQ7B 1YE3A 3GUCA 4NHEA 4GSLA 1T1SA 3E03A 5T64A 3KYDB 3ONDA 3ZHZA 4PLPA 5KJCA 1GDHA 2DU8A 4D45A 2E37A 3GF4A 5EERA 3H3FA 1SZJG 1GQQA 3UHAA 4QSMA 4JNKA 2NQTA 3HN7A 4J9UE 5G0VA 4ALMA 4BO8A 1EVIA 3DWFA 4PLGA 2NU8A 3SLKA 4GKVA 3NUGA 4MP6A 2Q1WA 2RHCA 4M54A 5IN4A 4ITUA 3GG9A 4JGBA 4RLSA 2X7HA 2ZB7A 2ZTVA 5LCXA 1RM5A 4O1MA 2D5CA 2VWPA 2P91A 1WLYA 2PZLA 3EYWA 3MOGA 2HRZA 3WIEA 3B20A 3AOGA 4DC1A 4EYEA 1ONPA 4R1UA 1FDVA 4R9RA 4PZDA 1DRWA 3CZRA 1H93A 4MVJI 1D4FA 1EUCA 3KUXA 4I5GA 4BO9A 3KLPX 3VVBA 4GX0A 1EQUA 4W9NC 2V7PA 1EUZA 4IDAA 3WGZA 4D44A 3WGHA 1GZ3A 1ZKMA 1PJSA 2A9FA 1V3UA 3GRKA 1EZ4A 1MB4A 1XLTA 1JVBA 4O6VA 5B4TA 3U4HA 5A9RA 1Y5MA 3A14A 3RUAA 1AUPA 1E1LA 1PWXA 2BHLA 1LLDA 1ZK3A 1OZAA 3K30A 3GFGA 3Q3CA 1Z7BA 2QG4A 2C5EA 1HE4A 1RPNA 1LDBA 1BVUA 3UAGA 3CIFA 4XGNA 3WFJA 2NV6A 1ZMTA 1M76A 3DZJA 5G4KB 3FBTA 5A5EA 4E5NA 5MGBA 4G5HA 5TGDA 3DFZA 3EVNA 1SNYA 5JMWA 2VT3A 4FFRA 4RORA 1KVTA 3T7EA 1E3JA 3KSZO 1BW9B 2UV8A 4XYEA 2AHRA 5A4DA 1LXCA 2C7GA 1XR3A 2R2GA 3OF2A 3GK3A 4NFSA 4WOKA 3HNPA 4EUFA 4G2NA 4L4XA 2G1UA 3G0OA 1DRVA 3DBLB 1GPDG 5DBGA 4TZKA 3S1LA 2OP0A 3CMMA 2W8ZA 3TFOA 4Q3DA 5L45A 2H9IA 4IINA 3OQ1A 3FRJA 1I3MA 3UN1A 4WK6A 2Y66A 3IDSA 2Y93A 3EW7A 2FY8A 3TOXA 1O6ZA 3L07A 1PS9A 5A1TA 4H7PA 4CMJA 3PQFA 1U9JA 2HKIA 4IQGA 3ZHYA 1SO8A 3RI3A 3I3OA 1U5AA 3CMCO 3E6AA 4WLFA 4YT5A 4NBWA 3PYMA 3IUPA 5B37A 5JBIA 3VVCA 4CLEA 1DJNA 3P5SA 2AW5A 4KTVE 1HT0A 2AG8A 1QLJA 2O48X 3C24A 4GH5A 2VZ8A 3WWZA 4D43A 2C07A 3COSA 2JAHA 3GDOA 4GLOA 3WGGA 4DVJA 3RU9A 2NLOA 4FC6A 5THKA 3OECA 4AJJA 2QZ9A 4BNLA 1SOVA 1W0CA 2QRLA 3L9WA 3VDQA 3RJ9A 4IQ0A 5ILGA 3U49A 3L4SO 4Z0PA 5A9SB 3PHHA 4NBUA 5C7OO 1JU9A 2YUTA 1Q0HA 1PZFA 3W8DA 1AE1A 4B8ZA 4K6CA 2PFGA 2AG5A 1HL3A 2C54A 3WS7A 1C1XA 2GGSA 3C1OA 5U1PA 1JA9A 2B83A 1TT5B 2G17A 2D8AA 4B7UA 3FN4A 1EFLA 2P4HX 3F5QA 3UICA 3ZV3A 3QSGA 4EITA 2EXXA 3TL2A 2EV9A 4D0SA 3P2YA 1JN0A 5FI3A 1PR9A 4IUYA 4DYDA 3GT0A 4BO1A 3KSDO 4UUPA 4RZHA 1SB9A 2UDPA 3BA1A 1NYTA 4OH1A 4DIOA 3JYLA 4ND2A 4EGFA 4BV9A 4CLDA 1ZK1A 1N7HA 2B4RO 1EMDA 4HADA 2OOSA 4ZN6A 4CJXA 1JKIA 2A92A 3QJ5A 1P1FA 4BKUA 3JQDA 2Y99A 3AUUA 3KBOA 3DTTA 4XR4A 5KNLA 3ABIA 1W6UA 2BGMA 2CNBA 3BXXA 4RDHA 1Z45A 1MXFA 2C59A 3M2TA 2HMSA 3QVWA 1I3NA 3TQHA 3RD5A 4CMKA 4XGIA 3QV1A 1Y1PA 2VWHA 2D0IA 3LT0A 1NXQA 1DHRA 2DBVO 1NP3A 2YDYA 2BFOA 2GN8A 2GN4A 4YVFA 4CV2A 1K6XA 2WYWA 4WLUA 2X5OA 6ADHA 3PI7A 5A9SA 3ULKA 3MTGA 5THQA 3MTJA 3LC1O 2D4AA 1HDYA 4J0FA 1BXGA 3IAHA 4L76A 5CEEA 5HM8A 1C1DA 1A4IA 3DONA 3VPGA 1X7GA 1GCUA 4NJMB 2A94A 1LJ8A 4DYVA 3HADA 2Q2QA 3JQ8A 3LF2A 1PZHA 1EDOA 3H2ZA 2XAAA 5AXCA 3BHIA 3KTDA 4BKOA 2HQ1A 4TZTA 4BKRA 1XQ1A 1R37A 1O8CA 4UREA 2WEKA 3ETEA 4IGFA 3V8BA 3GHYA 4XB2A 4Y6PA 1CEQA 3HFSA 4GL4A 5EQDA 4XEHA 4DLBA 3D5TA 1JDJA 2YFQA 3PYLA 1VSVA 1NPTO 2EGHA 2FN7A 3PGXA 1PGNA 4LMPA 1JQBA 2O23A 1DSSG 1BSVA 1XEAA 2W2KB 1IULA 2CSUA 2JFFA 4MP8A 3PZBA 3ZWBA 3DBRA 2FPGA 4FSHA 2J6IA 2CDAA 1XCBA 4H3VA 5HS6A 3F1LA 4E32A 3BMOB 4FFOA 4HFNA 2WM3A 4ZQEA 4J49A 3RC7A 3N7UA 2AQHA 3HZZA 4AJHA 4YTEA 3I9LA 1H6CA 1ZJZA 3KZVA 5A3VA 3PLRA 4IDBA 3I9OA 3NRCA 4O5OA 1DLIA 3B6ZA 3Q1LA 4BQPA 4CMBA 4OSOA 1RJWA 3NTOA 4IDDA 4RGBA 1A27A 5FI5A 3RBXA 4J6FA 3V5NA 1SPXA 1PJQA 3BAZA 4CLXA 4I8XA 2LDBA 2BD0A 2WE8A 2DFDA 3CUKA 5A05A 1HE2A 3I1JA 5EMHA 1K2WA 2JD2A 3A9WA 3LSYA 4YRBA 1C3VA 1NFRA 2PTGA 2JJYA 3LT2A 4FFNA 4FN4A 3ZW8A 1WZEA 1VJ0A 4J9VA 2NTNA 2OORA 3KETA 3SEFA 2YV3A 4RVGA 2X0RA 2PKQO 4BO2A 4D41A 1C1DB 3KYCA 3X2FA 1JTVA 2GR9A 1KEUA 1NAIA 4Z3DA 2X86A 3NT4A 2Y1CA 3IJPA 1E6EA 1DOHA 5JYDA 4MJLA 1KY4A 4P4NA 4U5QA 1EVZA 2I99A 3AW9A 5TIIA 5K6AA 3K6JA 4ZQBA 3MJVA 4PG4A 4CQMD 4BL5A 5KVCA 4RF2A 3GVCA 1ADGA 2OBNA 4KOAA 3AY6A 1UAYA 1D8AA 4YEDA 2Q2WA 1C14A 3JQGB 1FMCA 1U5CA 1DDOA 4BMNA 2DPHA 1HYHA 1LDMA 4J2OA 4P4LA 4KTTE 3L6EA 4MO2A 5JE8A 1CJCA 3ZWAA 4OAQA 1E3WB 3BIOA 2HLPA 1KOLA 2WD7B 1PJ2A 2NVUB 1VI2A 1W8DA 4WCFA 4BOYA 4OO3A 1GFSA 4R1NA 2OP1A 2IZ1A 4YCAA 1F14A 4IJWA 1DAOA 2OFPA 5CG2A 3WXBA 2PZMA 3QIVA 2CDCA 4M1QA 2J5QA 1R16A 1ULSA 4YQYA 5EN4A 3DBVO 2YV1A 4N5LA 3QWHA 3TRIA 3GVXA 3TZCA 5JCXA 4BO0A 4BB6A 3GNSA 1Y7TA 4FBGA 2Y0DA 2VRCA 4TWRA 3JD4A 7ADHA 1GV1A 1IYZA 3WQQA 4OMUA 1E1KA 3DAPA 4CQLA 4J0EA 5F1KA 3RC1A 2WJPA 2WD7A 3K2EA 1GV0A 4CPDA 2YHIA 1UDAA 5L40A 2ZJ1A 3C1AA 5BSEA 4MVJP 1LSOA 2GPTA 5ITWA 3PDJA 1DC5A 3I4CA 4Y8VA 1ZJYA 2EIHA 3QWAA 4RCVA 1XG5A 1PWZA 3INRA 3FTPA 4E5MA 4N54A 3EVTA 1OBFO 2Y67A 3ZV4A 3FSRA 1IZ9A 3EAGA 2AE2A 4YJFB 2AMFA 1OOEA 2CUKA 1NQ5A 3QLJA 5AOVA 1P1KA 3OA2A 4A2CA 3MJEA 5JC8A 5TNXA 1WMAA 2ZIZA 4BNKA 1HYGA 1E3LA 1GQ2A 2O7SA 1X0VA 2IXBA 3TZQA 1PQUA 3M2PA 2JFGA 2WTBA 3DZIA 2P5UA 4RQTA 4YXFA 5ICMA 2DUWA 1YB4A 3LYLA 3F46A 1YRLA 4OOEA 4Q3CA 2FZWA 3KVOA 1PZEA 1QV7A 1A71A 1YWGO 1YL6A 3U4IA 3GAFA 3OICA 2ZTLA 3WB9A 2B36A 7MDHA 2UUPA 4PG6A 4CQMA 1VJ1A 1RWBA 4U6QA 3RFTA 5C7LO 4CLOB 3IP1A 3R6DA 3K96A 3WLEA 1GPJA 2YW9A 4GMGA 3LF1A 4B79A 5KKCA 2X5KO 1H6AA 3RSHA 3T4EA 1PL8A 3BMCB 2ZJ0A 3JQBC 4XA8A 3QW2A 2F00A 4M86A 2FPPA 4CM6A 4YR9A 1JLLA 3OMLA 3NEPX 1A5ZA 3VH4A 2BH9A 2ZQZA 2AQ8A 4K6FA 3S55A 5K0ZA 1IPFA 3D4PA 4MVJH 3JQEA 3UCXA 4J7CA 1XYGA 1UXJA 3JYQA 4OL9A 1MX3A 3GOHA 5IFLA 4BKPA 1NX6A 1YS4A 2ILTA 1J4AA 3PK0A 5G2OA 5ILOA 3UVEA 2UVDA 1J0XO 3Q0EA 3U9LA 3AY3A 1WNTA 1N8KA 4B8WA 1UP6A 3HSKA 4IZIA 2EP5A 2VRBA 1YDEA 1HLPA 1B3BA 5IXSA 1PL7A 3L4BC 1Q0QA 3H4VA 5DDIP 3ZWPA 2DC1A 4J4HA 2C2YA 2HMVA 1RM0A 4GGPA 1XQ6A 4RQUA 2O3UA 2HK9A 2B0JA 3LC2O 4LSMA 4GX5A 1IOLA 5HTOA 1GD1O 4CQMB 2B4TO 2IRWA 5DCUA 1R15A 5BNIA 2GZ2A 2WSBA 3OIFA 3KEOA 1DIAA 2DM6A 1Y8QA 2HMTA 3PHGA 2GRAA 1QR6A 1X0XA 1Y9EA 3FR7A 1KETA 3BZUA 1P74A 4OKNA 1HDOA 1G1AA 1ML3A 1UZMA 4O0LA 4W82A 1PJBA 3ADOA 5CEFA 4OQZA 3TNLA 2RH4A 4JROA 4GKBA 4NIMA 1E7SA 1DHTA 4L75A 1E7QA 3E5MA 3DEYX 5LDGA 3TN7A 5BSFA 4BNNA 4U8GA 1AXGA 1GTMA 1Y8RB 1ZBQA 2J3JA 2PLAA 2E6UX 4Z9XA 2CY0A 3GVIA 2JL1A 4FCCA 1YQXA 4QO8A 5CFZA 4TKMA 3WJ7A 1DPGA 5GZ6A 4C7JA 2QQ5A 3HB4X 3RUDA 3ZU5A 1SC6A 4R01A 1B0AA 1LEHA 3DMTA 4ZRMA 3RU7A 5KKAA 4RLHA 3EGOA 1M67A 3MZ0A 2VT2A 2RAFA 5KJFA 1CERA 2DFVA 3INTA 1VPDA 4JN6B 1F17A 1D3AA 4I9NA 1ZO8A 3RC9A 5EINA 4N7RA 1SOWA 3VH2A 1JAXA 1I3KA 4JBHA 2ZKLA 5CDGA 2OZPA 4RJTA 1LLCA 4DTIA 4IIUA 1BXKA 4WLVA 5JAIA 1C0PA 4YYZA 5CPFA 3GGGA 4DLAA 3DBRB 4D42A 1T2AA 1OI7A 2X6TA 1PGQA 2W98A 4CV1A 1ZFNA 2FSVA 3KEQA 4A0SA 4URFA 1R4NB 1NQTA 4B7XA 3NDJA 3GG2A 3ZU3A 5ITVA 1R6DA 1LX6A 4PLCA 4AJ2A 2C29D 3CPSA 3D5QA 3UW3A 4L74A 4LRTB 8ADHA 2BRUA 2I67A 4TMFA 1V3VA 5TRTA 1U3UA 2DBQA 3ZGYA 5G0UA 2OBYA 2Z95A 1LSUA 1TT5A 3PJDA 1DB3A 3DTYA 3JQAD 5B12A 4LVUA 4AJIA 3P2OA 1YOVB 2Y1DA 3GLQA 1T2DA 4M55A 4OXKA 1NHWA 1NAHA 3F1KA 1B8VA 1KC1A 1M75A 5HBRA 2VYVD 4I9HA 1A9YA 1HDRA 2VYNA 4BNIA 3PHLA 1WW8A 2ZTMA 3NX4A 4ZU3A 5BT9A 1W73A 4YJHA 4GBJA 2OL4A 2YHUA 4XDZA 4NQZA 3PGJA 2UAGA 3MJTA 4JBGA 4WLEA 1DAPA 2RH8A 2ZCUA 4KDEA 4PG7A 1UZLA 3CINA 2XPCA 1NQOA 4IMRA 2NQ8A 3IL2A 4E2XA 1A9ZA 2CVZA 2GLXA 2GZ1A 2QRKA 3C7CB 4JJFA 5I9MA 4RV9A 2YQ4A 2PR2A 2X5JO 3SJUA 4EJ6A 1TA4A 2VNAA 1XU7A 4LISA 1E7MA 1OMOA 3I9KA 3V2UA 5A02A 2WYUA 1UXKA 1PSDA 2H63A 3LVFO 4R9SA 3H9UA 4J1TA 3HUDA 2EWMA 1YBAA 1K6IA 1M6HA 3B1FA 3DO5A 4FJ0A 3PJGA 4HFJA 2EW8A 3AWDA 3NT2A 4ALNA 4BGUA 5U9CA 4MIOA 4MKXA 1C1XB 5EPOA 4BNUA 1MGOA 4M89A 1FDSA 1FK8A 4BKQA 1VL0A 5KJEA 3D3WB 3SXPA 3ZWOA 4FFPA 1J6UA 4JP3A 4YT2A 1VSUA 3U0BA 2FR8A 1VRWA 4BVAA 1UUFA 4XRGA 3M1LA 1KS9A 4IQ8A 4I9UA 1GZ4A 3N58A 3H9EO 1PJCA 4NMHA 3JCZA 1YH3A 1QG6A 2D1YA 5G4KA 2G0TA 1H5QA 2HJRA 2R00A 1DC3A 2WD8A 3Q9NA 1LLQA 3MOIA 1LDEA 4FPXA 1ULUA 2W90A 3WYEA 1DRUA 4WCFC 2P9EA 3QP9A 4A5OA 5C5IA 4DRYA 4J3FA 1WAMA 4HNGA 3PXXA 3EUWA 3ZWVA 2VQ3A 1HE5A 1Z82A 3DFUA 4MKZA 4ZQFA 4K28A 1JWAB 1I33A 4FFMA 4ZQHA 3RFVA 2PH3A 2O2YA 5TJHA 5I8ZA 1I10A 3AFMA 3PDUA 2ZATA 4BNWA 2DTDA 4JP2A 4ILKA 1VL8A 4XB1A 4R16A 3WJAA 5TJ9A 2IZZA 4OM8A 4ZVVA 1HDZA 2HCTA 5KCZA 4FGSA 2VHYA 4YJGA 1BG6A 4K9DA 1JKFA 3O03A 1QYVA 2IEBA 3JQ6A 1NWCA 2WMDA 3NGLA 4DIFA 1ENOA 4LCJA 5F5NA 1GCOA 5C7IO 4F6LA 1KC3A 3JYOA 1PGPA 2HSDA 4CMCA 4CMHA 9LDBA 1VE9A 4ROSA 1V6AA 1B7GO 3JD3A 4TROA 2NSDA 1BRMA 2IE0A 4JJGA 5AVOA 1D1TA 4D46A 3LQFA 2BF7A 5JAZA 1O5IA 2RBEA 1E0DA 2X58A 2GYYA 4LCEA 3BMOA 2NADA 3NT5A 1AXEA 3DBHA 4NI5A 1VKOA 3OSUA 1UAGA 1YL7A 1U2DA 4E0BA 3I6IA 1PQWA 4PCVA 1KIFA 1BDBA 1PX0A 2GDZA 2ZTUA 4FW8A 3L77A 4BGVA 4WLOA 5AXAA 4JIGA 2Q1SA 1VL6A 1T2FA 1QRRA 2PD6A 4DMLA 4W7HA 4DPMA 4D79A 1DFIA 1PZGA 3HDJA 2B69A 4YBZA 2CDBA 4I08A 1QXSA 1PS8A 2EW2A 3KHUA 3QWBA 3WSWA 1G0OA 1LSSA 1HTBA 4GWGA 3RUFA 3HB5X 1GUYA 1ONNA 2W2KA 4J1QA 3WIDA 4RF5A 2I65A 3KO8A 4PLFA 5BNFA 2JAPA 2FHSA 3BTVA 4RPHA 5EQFA 3BTUA 5TS3A 5IDQA 3RUCA 4PFJA 4GMFA 4YB8A 3RVDA 3VOSA 3WGQA 1A4UA 4FGWA 3GVPA 1GQYA 1NWHA 3H6KA 4D7AA 1TT7A 4WJZA 3PLNA 4UVIA 4KP7A 3HJAA 1R0KA 1XU9A 4PG8A 1N1EA 3AUTA 2YFHA 4CR8A 5C3MA 2G82A 3ORFA 3WGYA 1P45A 4W9NA 4XYLA 3M1AA 3FCOA 3DB2A 1E3IA 1B14A 3RCBA 1SMKA 4CMAA 3H9GA 2P2SA 2Y1GA 1ENYA 4FQ8A 4I1IA 3GUYA 1GEGA 4RF4A 1NTOA 4Q3EA 1IE3A 4CR7A 1LQTA 1W4ZA 1H9AA 4ONEA 2B4QA 5JXWA 1PJ3A 8LDHA 4AVYA 5JO0A 4XYBA 5EL0A 1X15A 3OEWA 4EBFA 1ISMA 3P7MA 5KJ1A 3GZNB 1ONOA 2FPIA 1X7HA 4R68A 1ISHA 2PD3A 3GRPA 4J2HA 3GA0A 1TEHA 3F4BA 3ITKA 1EE9A 2X4GA 2C7VA 1ISFA 2NU9A 3ZH2A 5CDUA 4D3FA 3NDRA 2O4UX 1LUAA 4KZPA 4M8SA 4OGWA 3CE6A 4CLRA 4YT4A 1YQGA 4M49A 1E6UA 3C3XA 2XXJA 2PV7A 1K6JA 3HDHA 1MV8A 1NVTA 4NBRA 4CMIB 5B4VA 5T8KA 3WMXA 5EJ2A 5L51A 2VYVA 3KSUA 4NZ9A 2DTXA 2CF5A 4OXNA 5G0TA 3I9MA 4NBTA 4GX1A 4IJKA 3TPCA 3LK7A 4XYGA 3BYZA 1QMGA 4GSKA 5CG1A 3IJRA 3OQ6A 1Y8RA 3OHSX 5CP8A 3ROMA 4UVEA 4BUCA 3DC2A 4J43A 4WASA 3FBGA 2YYYA 1PGOA 1HDGO 3L6DA 4IS2A 4DA9A 4F6CA 1J49A 4C7KA 3HE3A 2BLLA 1PJ4A 4R51A 3W4KA 1YVEI 3A1NA 2O4CA 1F12A 3TSCA 4IXTA 3DZHA 5DF1A 3R3JA 4YAGA 3DQPA 2Y0EA 1FF9A 3OIGA 4HP8A 4W4TA 4XX0A 3MCVA 2FR0A 4FC7A 3ZV6A 5A3JA 3VH3A 4S1VA 5L9AA 4HV4A 3VDRA 3GPIA 3FPLA 1IHYA 3Q9UA 1P1HA 4PLYA 1YB1A 4GGOA 2HK7A 3G79A 4NJMA 4B3JA 3ENKA 1MC5A 1DXYA 2PNFA 1C0LA 1Q0LA 1WPQA 2XF8A 4MDHA 2NU7A 4CUKA 3FNHA 1NBOA 1A7KA 1B3RA 2HU2A 4J1SA 4DPLA 2Q1UA 3V1TC 2HJSA 1QLHA 4TRNA 3GZNA 2J3IA 4QFDA 4QQRA 3X2EA 1BVRA 5C37A 2Z5LA 4AJ1A 4PRLA 4II2A 4N5NA 5L4NA 3ITDA 3FTNA 4DWVA 4MVJD 1H9BA 1XA0A 4FS3A 2C82A 4O63O 4OHUA 2NVBA 1E3SA 3I52A 1UZNA 4GVXA 2QIOA 1EVJA 3GN2A 2HUNA 3RBZA 1B8PA 1ID1A 1Z73A 3Q6IA 4XJSA 1KERA 4DREA 3TFQA 4CM4A 4DPKA 4UEJA 1DIRA 1P9LA 3D1LA 1Z75A 2YJZA 4R5HA 4ALJA 1PR3A 3K31A 3K73O 4WEQA 3HDYA 3IIEA 1HE3A 3Q2KA 4CLHA 5T6BA 2GD1O 3ROQA 4DQUA 3QVXA 2I66A 5A04A 1Q1NA 2GNAA 4L4SA 5G0WA 5JAMA 3WBFA 1E77A 4N5MA 1PS0A 1DJQA 4PVDA 4DBVO 2Q3EA 3W1VA 5MDHA 1RYDA 3NDIA 1P3DA 2CF6A 1MA0A 2H5LA 3MWDB 1AN9A 4AJLA 3WR5A 4OIMA 2BFAA 3GGPA 1V0JA 3OEYA 2X0NA 1PL6A 1RM4A 2AE1A 5L7YA 1EVYA 3ANNA 4PLZA 2GASA 1YJ8A 1DIBA 4CM7A 1U1IA 1ZUD1 4LK3A 3FNGA 2E49A 1U4OA 2R00C 3EHEA 4L8VA
chains in the Genus database with same CATH superfamily
1G8SA 1PJLA 3C6ZA 3IQDB 5LR6A 4K0RA 1AU9A 1TB4A 2R6CA 3KFXA 2X1HA 1ZCBA 4HX9A 5JMPA 1E62A 2E85A 2OQRA 3LRTA 3L7AA 4JC4A 5FBZA 5F9MA 3RRNA 9GPBA 1XL1A 4ALIA 4W1QA 4J90A 5DHTA 2JZCA 1KI9A 4UCXA 4BQIA 3SF8A 2BKUA 1I7QB 1PYOA 3L06A 4WGGA 1XDZA 1OX5A 2H4YA 2VNKA 3O4JA 5TGZA 2PZFA 4X54A 4EGAA 2D06A 2ZR0A 3TYXA 2I6QA 1L4UA 3EDMA 5AJWA 2Q41A 2ZJ5A 3U3JA 4E22A 5J4LA 1QH9A 4ZALA 5GVSA 4AWAA 2MYTA 2Z43A 3MXTA 3BTOA 1OREA 3GVHA 1FFBA 1LU9A 4DXDA 5FWDA 1UM8A 5EWLA 1COWA 3U4CA 3WNCA 1EHIA 4OLHA 4UARA 3ZY2A 4IG4A 5BR7A 2IEGA 5F35A 3TSYA 2O5VA 3VTFA 3UT5A 5IBCA 4B3MB 3EC7A 3HB7A 4M9UA 5B6IA 3MJ4A 1OFGA 1QHXA 1RKVA 1O57A 4JR2A 1BROA 1DAIA 2OFXA 2QJTA 4YJHB 1EM8B 1BGVA 5CIQA 5B3LA 3IFSA 5TT0A 1NRJB 2VJDA 1LBHA 1FXSA 1K88A 1DADA 2WF9A 3RG2A 4AKTA 2BISA 2F1RA 4AP5A 2GCPA 4Q4HA 1GA1A 3ZHRA 2QRGA 4YAIA 4QBFA 1AO0A 1N6KA 4YP9A 5I9IA 5K4GA 1QYCA 4K26A 4RKWA 3HL4A 3ROPA 1DBWA 3P9NA 2NUPB 3G0BA 5K3BA 3WGJA 4EHBA 5JJLA 1UPXA 1J8DA 4NABA 4TV9B 3UUWA 4FB5A 4YT8A 4OKIA 5AJHA 3HG7A 3VR5D 4HVCA 3C1TA 2UUCB 4D98A 2A88A 1M5UA 4OI4A 1QIMA 2A30A 5IVDA 4EVRA 3F5SA 4LZAA 4LWQA 4QM6A 2FRDC 2J31A 2Z1MA 4NDNE 3K9HA 3PGKA 5AKYA 1WXIA 2E4AA 3KB6A 3OZXA 1YZQA 3X1ZA 1ZOLA 2XWPA 3I73A 4PGGA 4TS1A 5KPDA 3ZTWA 5C8YB 3NIFB 2C4KA 2VHXA 3F47A 3TVTA 1VDMA 1N2CB 1UADA 1L7DA 3UG7A 4F8YA 2HJ9A 2R8XA 4RA9A 3P4XA 1VL2A 1SKQA 4JB2A 5DJ5A 4BQSA 1Y98A 4D57A 2IHNA 3GAMA 4BRZA 5T3YA 1UP7A 2WKPA 5D6OA 1CY1A 4NH4A 3O2SB 3B9QA 1Z3IX 3B1JA 3K7EA 2RG7A 1ACMA 2DT5A 5FPQA 5DGTA 4GWLA 5FLYA 5C5DA 2D4HA 2O6HA 4M9QA 2H9AA 5AMXA 5WRFA 1S3SA 2NM0A 3CKYA 4RD0A 3IQZA 1PGJA 3ZVKA 1X14A 1JFSA 2VBIA 2FVYA 4WXRA 3VAAA 2EX1A 4A23A 4XJVA 2DUNA 3PDIA 1LBEA 1YUNA 1GRRA 1VLLA 1JE1A 1VJTA 2ACVA 2CWDA 4EHIA 1E2QA 3HI6A 3ZN2A 5IC5A 5AUNB 1XNQB 4CV0A 2Q4OA 1WZIA 4EZBA 1ND6A 2X5XA 4JB8A 1EE1A 5ICGA 3I0ZA 2CLDX 4DR6B 3R74A 1F0NA 4Z8XA 1T9DA 4EW6A 1ZL0A 2QSUA 1CJSA 1RPZA 5H59A 2P9YA 3ZDQA 2YQZA 4NBKA 4QTTB 4BNVA 4X6YA 5JW6A 4F4IA 5A71A 1GL7A 2AG0A 4DDTA 3FA2A 5K3SA 1Z5UA 4O4JB 5EKTA 4S05A 4BNFA 3BMCA 1VM6A 1Z5VA 2VATA 1Z17A 3VPSA 2XQGA 1E2MA 2ANBA 3IE1A 2JJ8A 4JA0A 1Q1QA 1FDIA 1PFUA 1CLUA 2CK3A 2GVNA 4KMRA 5ER9A 1ZC3A 2R1VB 1X1DA 1OX4B 1U0JA 3AIOA 4QX6A 1VCIA 4WZAA 3UHJA 4GPIB 1K08A 1XLTC 1UBUS 1XTBA 2H1HA 2OV4A 4LXYA 3ASUA 3N74A 5FWXB 2XGOA 2B5VA 4IJ6A 1B2LA 1RBZA 2ZAMA 2WM8A 1ZVJA 2RDMA 3HPQA 3Q15C 1Y80A 2ZT7A 3VC2A 3Q1KA 4RMNA 4UBMA 5CB4B 5THXA 2NSYA 3I4LA 3KQSA 5L3VA 2NN3C 2RARA 4FFWA 3ZK7A 4Z5XA 2O0MA 4D4HA 4DY4A 3RROA 3KKKA 1JQDA 3P9QA 3RVRA 2BGNA 1NJFA 2C9ZA 2NVOA 3HVIA 4B73A 1U1DA 4R83A 4DIKA 5AW8A 3L8EA 3PB3A 4MV4A 4E5YA 1ZINA 2PL9A 1F2TB 2OBBA 3CRQA 4XCQA 1P44A 3I5UA 1V9SA 1R0WA 1U81A 1XZHA 1XZMA 4IZHA 4O0MA 4W5HA 1UQUA 4B4VA 4BUZA 4OHYA 1G8PA 1ZWLA 3BSWA 2PD4A 2XGGA 4BO7A 4B9EA 1JSLA 3ZDCA 1D5WA 1X7WA 4H4EA 4R0VA 3BXFA 4I1VA 1ZQ1A 4O4HF 4OUDB 4U0KA 2O2CA 3ZY5A 3GNTA 2WU0A 1T43A 3BX1A 2WYVA 4NU0A 4EW2A 1N6HA 1OWPA 1DC6A 1FW6A 2PUBA 3DNMA 5FBKA 3OH8A 3AJAA 4LVNA 3IOYA 4A03A 3RJ5A 1KORA 4P7KA 1Q0SA 3BSYA 3KQMA 3QKSA 2A9RA 3GDHA 3O94A 3VDMA 3WGKA 4GOND 2ENUA 4FFBA 1KFCB 1W2WB 1OYVA 4UUNA 5E8RA 5BV1A 3AYZB 4G5YA 3FHLA 3SQDA 5INTA 1H2WA 2ZDQA 1LNZA 4OJMX 4Q0MA 3RQIA 5C8ZA 2BRUC 2O3QA 4PO3X 1LA2A 2H0RA 2VSXA 2XNCA 3QLEA 3E0XA 4ERNA 2OHXA 2E4XA 3AGQA 1N2ZA 4K6KA 1TI7A 4DSUA 4X8OA 1I2DA 3GFTA 5A5VA 4Z9FA 3V8EA 1D7OA 1O3YA 4PYLA 3JVEA 2F1OA 1NV9A 4XGRA 4ZU1X 4KUHA 1CZLA 4F6CA 5H9WA 1DWQA 2O3SA 4I5FA 4WA7A 2I2XB 2O1SA 4YMTA 1KOGA 1XCMA 4EG1A 3HNOA 3T52A 4WUVA 1N4DA 4Q01A 4INOA 2J4DA 1A9OA 2BC9A 3JQAB 4L28A 1QB7A 1XZJA 1QMPA 3GFBA 3KU1A 5BSGA 2Z09A 4P38A 2Z0MA 4ROTA 4QDKA 3U13A 4B2PA 4UEKA 3OA0A 1H6DA 4OXYA 4I36A 5JASA 5HVNA 4OQEA 3CX3A 3ODGA 3A6JA 3MLBA 1MC8A 4A4DA 4Z4QA 3ZS8A 4JJIA 4L8GA 3SHFA 2VAMA 4AUNA 5K3OA 1IM2A 4HYQA 1W1UA 1F7VA 1SEVA 1KA9H 1EP2B 5KVSA 3KJIA 3PL5A 5LKAA 5IAGA 2Q62A 3P0IA 5DLPA 4J4TA 3R6TA 1N9ZA 4UATA 3STHA 4GXNA 5BW4A 2R8EA 3HBLA 3ZIAD 4NE9A 4OIFA 3TW8B 1BWSA 2Q21A 4KIWA 4BRWA 3WYGA 2Q29A 3RT1A 3NHYA 4G89A 3V8NA 4DSAA 1DQRA 1GL9B 1RACA 3O3CA 4QOSA 1M1NA 1A4XA 4YBRA 3IEVA 3L7BA 1AKMA 1U3TA 2YXEA 3QI2A 2RH9B 4MW1A 2Y1KA 2FR1A 4NAVA 1MLDA 2R4UA 3B6JA 1UBMS 1CNEA 4MRRA 1KVSA 4NK4A 2IEDA 3C3MA 3NBYC 4NFLA 4DA0A 2W6PA 3PUXA 1BX3A 3EXFA 3ZCTA 2PSEA 3EEIA 1RWPA 5D5QA 1FDWA 4GGMX 4MA5A 1XRSB 1ZY2A 1V7CA 4YJ2F 1AG9A 1LJLA 4DMHA 1YFKA 1XHFA 2ZYGA 3R5XA 1ZSYA 3Q6NA 2OKGA 4IEFB 1CRZA 1NF2A 4QWWA 3BHMA 1M6EX 3BD7A 3W5AA 1MAWA 2PX3A 2WYHA 2W5UA 4HRAA 2HU8A 1HZJA 3RYTC 1QIIA 4PNPA 1XRNA 4LDAA 3S70A 3I2HA 3OZ7A 4WKOA 4KXFB 4U2DA 4ZI7F 3PFNA 1TX4B 2HLHA 1K89A 3QZUA 1JAYA 1I30A 5LYJB 3UJ3X 1R4MA 3A28A 2VPPA 4IPTA 1NW4A 3V8MA 2VXCA 5IF3A 3WLNA 1PR4A 1WXGA 4PZCA 3KOUA 3PHIA 4DJEC 3QEOA 1ZLYA 3UGQA 1NZDA 4CLRB 1VSTA 4J16C 2QUAA 3SDZA 3I05A 4MV3A 5TT1A 4BFUA 4DV2B 2L82A 3T3IA 1ELOA 1T4CB 1FNSA 2EW1A 1AZTA 4UEOA 4WERA 3C3KA 2MSDB 3S8EA 5EVCA 4M87A 4MITA 3U40A 3F67A 2IYPA 1C9EA 1GZVA 3E9QA 4I4IA 3GEDA 2X8AA 5K20A 1BS1A 1TVEA 3GEMA 1XDWA 1ZRSA 2AZDA 1GL3A 4M7WA 4EQ6A 3LXUX 3D6MA 5EIBD 3GFSA 4HQFA 5KYVA 3U80A 1C30B 2A35A 3LLSA 4H31A 2R1TB 4Q24A 1TK9A 3I9NA 1LF0A 4ZQGA 2IUUA 5JS2A 3U3XA 1MZPA 4OHZA 3AO0B 1T5OA 4G5OA 3HDQA 2GCIA 4KXXA 1Q77A 2O54A 4HAIA 2IXEA 2HV8A 3KT3A 4GDFA 4EIWA 3FF4A 1XSEA 3NJRA 4HX2A 1EQAA 1FEZA 4RTPA 3DE4X 4F04A 2ORED 1XKXA 3KELA 2DKFA 2H1LA 1D4OA 1MIOB 4RSMA 3UMCA 3D3EA 3PNOA 3EZ9A 4XWOA 2PUWA 1JIJA 2X4IA 1TMKA 2FEXA 3DT8A 1WPXA 3MWDA 3R7DA 3WMRA 1HM5A 1ZMOA 5HZHA 4ZI7A 5EJ6A 2O2DA 2EL9A 2XMZA 2E48A 1O1YA 2O52A 3NHWA 4R4JA 4U00A 5HP4A 3OZVA 3ORRA 2X7JA 4MEAA 1TTHA 3PTZA 4MV7A 4FYXA 4EOGA 1RYEA 2IYNA 1WF6A 2H6EA 2ESRA 3CNBA 1K7SN 3PRJA 3S8MA 3TS1A 4ZV4A 2VK4A 2YZNA 4L9AA 1KFJB 2CMDA 2IZOA 3BIWA 3JAWA 3PFWO 4ZK2A 2PY6A 3AUFA 2OBXA 4R69A 3HVRA 4A8JA 1E94E 4GBMA 1JQEA 5MFZA 3TWOA 5I9LA 1Z6ZA 3QGMA 4G0NA 2OHHA 3VV2A 1V71A 3OJEA 3PUJA 3LBNA 2DUMA 3P97A 5JEEA 3A06A 3NBUA 3ER9A 2RAUA 4BMXA 3I01A 5DEIA 2V4UA 3PVSA 3KZKA 1YHNA 4Z51A 2JI7A 4Y1FA 4IGEA 5KTKA 4J75A 4MQ4A 2BKXA 4FX2A 1MZVA 1XDDA 4MWTA 4DEVA 1OXSC 1W88A 4EKYA 1T4DA 1UP4A 1U8TA 1NN0A 4NS1A 4P1ZA 1N75A 3BL6A 2VPYA 4UM5A 2IUFA 2P30A 3MLAA 1B8OA 3TMYA 2X1VA 5D6NA 4EO7A 3SJ7A 3QPBA 4OAPA 1XMQB 3VFDA 2AN1A 3QWIA 2E87A 4EGSA 4L57A 4YXWA 3ZLTA 4QJ4A 3IP6A 3T0GA 3ZU2A 1ZJJA 2A67A 3IA2A 4JR1A 2BUBA 3ROTA 3JSAA 1RLIA 4C29A 4WFJA 3EEYA 3IPAA 4JLNA 2QHXA 4XR9A 5CGZA 1KQFA 2WKWA 3PXAA 3EFOB 5JWRA 2JVKA 3IPXA 1O9BA 3K94A 3OMXA 4EA9A 3VJRA 1JLSA 2XUGA 3TIFA 1CRWG 5FPSA 2VHVA 1JDZA 2PBRA 1LLUA 1XZDA 3FPBA 3O38A 4K9NA 4L0QA 1EBUA 5JH7A 3RKRA 4ESEA 5KSOA 4Q9LA 2H3HA 1LBSA 3I6ZA 4QG7A 1VCNA 1Z74A 4AO7A 4L7QA 4BJ3A 4BVBA 4XJTA 4F3YA 3ERCA 3O3NB 4YQZA 2VHCA 4U8HA 4LJ7A 3MT7A 1HURA 1DFHA 1O95A 4FNOA 2Z5FA 4GM4A 2CJPA 4OQYA 4ZAVA 1FP6A 3G6WA 1NQXA 3JVVA 3B8EA 3IR5A 3OZEA 1EK1A 4FHZA 1IPEA 2JCVA 4AIIA 4DR7B 4CN8A 3U7FB 2Q9BA 3RBAA 2GZ3A 4JEHA 4NZOA 1GSOA 1I80A 1K5HA 3GCGA 3V2GA 4LF7B 3JALB 1AZWA 4ER7A 5LNK6 4UNIA 4ABYA 5IUNC 2XUDA 1XHEA 1IG0A 2BGKA 3QKTA 1RJGA 1GA4A 2I1QA 1A1VA 1G38A 4RVFA 2YC2C 1E4VA 3M6IA 4CNQA 1HC7A 4RAOA 2F7SA 1ZGHA 3EEFA 1QC5A 2QPTA 4RZSA 1OIVA 2R8RA 3QNUA 4S12A 4TX1A 4XRRA 1UKCA 3TDKA 3O4IA 4H08A 4O8CA 1OB2A 1XAIA 2HPZA 2ZE6A 3AJ9A 3ES9A 1LW7A 3LJKA 4KODA 3B9RA 3ZIUA 2R5NA 1KEWA 5T7BA 2I71A 1JWBB 4TLLB 1XJ0A 3ZCXA 4JQYA 5LN1A 4DV3B 5I7WA 3GRCA 1GNTA 2WVAA 4HGQA 2QGNA 5FV7A 3OM1A 2VK8A 5DB4A 3RIHA 4D0LB 2WSSA 4MW7A 2BBTA 3I9V1 2CL7X 3EULA 4MLPA 3OTOB 2WG1A 1ADJA 1QH1A 3HCWA 3QX9A 4ID3A 2ZUFA 5AKZA 5L95A 4G09A 5KU7A 5FOWA 2HAEA 5DW0A 3K4QA 3TCNA 3TNJA 2R87A 5G40A 1I6MA 4C5BA 4FMDB 4XUGB 4YJFA 4XDYA 1S1MA 1SUPA 2FLWA 2RIPA 4TSKA 4WZBB 4C2TA 1NN3A 2P5YA 5DTJA 6Q21A 5FWYA 3CKKA 4X8LA 5AKXA 1J5PA 3O6VA 2NU8B 3DB1A 2Q4EA 2KBFA 4CM5A 1IWOA 3PNPA 4KDFA 3IUNA 4M8NE 2I33A 1T8WA 4GLBA 3PTLA 1VMAA 1KE2A 4CM9A 2G25A 1GZ6A 4K0KB 1BCRB 1K06A 2FH5B 1ECJA 3DBLA 4XUCA 2IE8A 4QGBA 5CNJA 2CV1A 5AVJA 1IOVA 2J5RA 2HWKA 4QOHA 2H2DA 5TE9A 2WHQA 2C5GA 3PNBA 4RENA 2FK8A 2EAUA 2JGDA 4MI1A 1GTL1 4DWWA 2J0QA 3P2IA 4O59O 1LCIA 3THWB 1T15A 2Q4RA 2C20A 4KXVA 4PPGA 3O2QB 4DHWA 2WWYA 2BW0A 3HCPA 3GQBB 4EYSA 1LVGA 3PF9A 2PCLA 5A4FS 3NWBA 5CVUA 3OMWA 3LSTA 3O8QB 5B7GA 5K0BA 1PIWA 1A8QA 1XJCA 2CXSA 4H6VA 4P5PA 3WNQA 1UJ2A 4ZZ1A 1J20A 2QE6A 4DC0A 1GZ7A 1DPFA 1U2RA 2J67A 3I30X 2J3EA 4NZMA 4E1VA 4XLLA 3STWA 5ADWA 3TFWA 5GV7A 2D74A 1ODSA 1GQRA 3LKDA 1JEAA 4HAUA 1GGVA 3JV7A 2VQDA 3EGXB 3TLZA 1VP3A 3DMHA 4BU0A 2DMRA 4HAOA 1L7EA 4L7VA 3WGTA 1ZXLA 1TIPA 3PVCA 4OJNA 3ZZNA 2J41A 1AS0A 2JKVA 4I50A 3ZHTA 3ENNA 3LVBA 1ESMA 2ONZA 3FCCA 3NEJA 3VJMA 2VZ9A 1UR5A 3NAMA 3O9VA 2Q07A 4B85A 2P4QA 1S3IA 4HYTA 5IMSA 3PT9A 3EJ6A 3H5OA 5FDFA 1SHJA 3UWSA 1N5JA 4RY0A 3NOVA 3WKDA 4I99A 2P6OA 1COWD 2HSWA 2CD9A 1TJYA 3H1GA 4HXYA 2W42A 4KR3A 3JASB 2PH1A 3DM9B 4QEDA 3KRTA 4YUAA 3MD0A 1KI6A 4R1PA 4DDVA 5D1HA 4L22A 4MWBA 4D3XA 4LN1A 5DNAA 5I01A 1M54A 4QUEA 3H5TA 1JV2B 3FNBA 3I1YA 4KBFA 2CEAA 1PJAA 1NMQA 3CVJA 4J4BA 4UTOA 2JIMA 3SKVA 2Y1FA 2WNHA 4LVCA 3WMEA 1J7KA 1RRFA 1USGA 4U0JA 3L6OO 3Q11A 2ECFA 4DQLA 5KSZA 3DTVB 3B6EA 2PS3A 3FMGA 5DXAA 1UBSB 2FR8C 2WUEA 3BF7A 3I0NA 4GRAA 1Y4DE 2GPYA 2QL6A 2E6KA 4I1SA 2ORVA 2WZQA 3RIGA 3TXYA 1PUXA 1CR2A 2C03A 1E7YA 2NV2B 2W22A 1E8NA 1ST2A 2QRJA 4YV0A 1RCUA 1FTYA 1N8TA 3AU8A 5FYQA 5IWCA 1KO1A 2FPKA 2XOXA 3VDXA 3B5JA 4RZ2A 4G97A 5J3JA 3UK1A 3GJ0A 1A7UA 3VC7A 1XDUA 3G2JA 3TLCA 1J24A 1M0WA 4MAFA 4ERXA 7AT1A 1FYFA 4IO1A 4QEKA 4AFNA 1EUYA 3WSVA 4LF4B 1KAMA 1OX4A 2JIQA 3CU5A 4J1TC 1CDOA 2V7QD 4CU5A 1HSOA 2PKQP 1ISRA 1KVUA 3MRVA 3G3EA 4BBJA 2O2EA 1OFHA 3P0RA 3VR4D 3KKOA 2H54A 2HF9A 4UHCA 1L9KA 1LNSA 4P22A 4Z0NA 5SYAA 4NJEA 3HKDB 3UBTA 5EJMA 3UMMA 4KN5A 5KVQA 1WMBA 2QP3A 4JCOA 4EEZA 3PIDA 4JI8B 3BG5A 2XMGA 1QHHB 1AHPA 1OT3A 3CSDA 3QX8A 3EA0A 4ZQIA 2NACA 3WI7A 1QUFA 3MAJA 3ZCSA 4WPGA 4B71A 1V4BA 2UUBB 3KKPA 3V8PA 1PKEA 1V5IA 3SNKA 2MYPA 2WD9A 3SHWA 4BO3A 5A4IS 1OYYA 1PWHA 1F4VA 1LDNA 2M9MA 2Q3HA 2QVGA 3LUKA 4QIHA 5CXSA 4FJ1A 1MUUA 2IYSA 4BGVA 2IHUA 4ZMBA 4PLVA 4AYWA 4IDEA 1MRNA 4ON9A 2QT9A 1FBNA 3BJZA 1EWKA 1H8ED 2B35A 2D5BA 4FFLA 5DBHX 4WN3A 3BE6A 1OFVA 3D6FA 3LCMA 1U0EA 2H17A 4GZ3A 4X45A 2F8TA 1G8JA 2F4VB 2PVCA 2VSYA 1O7JA 4IMJB 4AG5A 4GLJA 3G2PA 3ICWA 4JBIA 3Q10A 2QVLA 2PR7A 5H5JA 5CGQB 1I3OA 5K3DA 5JFGA 1SVSA 5JS8A 4GPZA 4TM8A 3IURA 4BNMA 3QRWA 3FKSD 2OILA 2VEOA 3MS2A 3S27A 3UENA 3PFFA 2XDYA 3LW7A 3PWSA 1IN6A 4BMYA 1BQEA 2VHWA 5DCWA 2HDWA 3NPMA 1IOZA 1SHLA 2EF1A 4N8EA 5E4FA 2CL6X 2WFLB 5A4AA 5ABPA 4U2EA 2GXQA 1I1QB 4NULA 2P5SA 3SQNA 4KQXA 2OT3B 2QX6A 3A2LA 2ROQA 2ENWA 3RT9A 4B8YA 5DNUA 1W44A 2E2WA 3BCSA 2J6HA 3IQXA 3WIVA 1QF9A 3NANA 4O4JA 5F2NA 3C8MA 1MF7A 1DG1G 3E82A 3SZUA 3WGIA 2AA3A 3KVRA 5KIAA 3TD6A 3PC8A 3SHQA 4DMMA 3P2MA 1TEXA 4RABA 1J33A 1USWA 3GLGE 1ORTA 2BGLA 1AB6A 3JQAA 2G5TA 2D13A 3E22A 3AI1A 4JKOA 5DVZA 3W3AD 2WZBA 2X15A 3FCEA 3UFBA 3E05A 3KOYA 2ET6A 2ZRIA 3MINB 4IOJA 1OXVA 2JAXA 3DV9A 4B4UA 2JCYA 1YCHA 2ZYRA 5KHOC 3AF4A 3AVOA 1PU2A 2ZSFA 1MG5A 3HHEA 1CE8A 1EDBA 4TRRA 1UBTS 1R4MB 3EGIA 4LDQA 5FPKA 1O4WA 4LJ5A 2XGSA 1REQA 4BVKA 2DERA 1S3FA 1O5TA 421PA 4Z4HA 3OOJA 2Y0PA 3DE3X 3IT1A 3EF3A 1KU6A 4C6TB 2GLTA 2ZWVA 1W4AA 2C78A 6CHYA 4QG3A 1Y1RA 3MF4A 3PZRA 3PC4A 2AMJA 1YONA 3LIPA 3OEHA 4IDOA 1U5BB 1P1RA 1YZLA 1M0TA 4UUMA 1P8AA 2BI7A 5KJ6A 3LX4A 3C97A 3HFJA 4HGOA 1R9JA 3H8VA 3AW8A 4D8VA 4E6PA 2O8DA 4LXQA 1FPQA 4IIGA 4RZIA 5J40A 1D7AA 1MH9A 3I6BA 3E18A 3G9QA 1A98A 2X9LA 3ZG6A 1FTGA 2LNDA 1D2NA 5DWDA 2QE7D 3JQ8B 1U9YA 3ZWMA 4E12A 2NTJA 3ND5A 2Q6TA 5HXAA 5TLSA 2Y4OA 4IDCA 1TU3A 2BCEA 3I01M 5ALRA 1PEDA 2ID9A 2H8GA 2X1LA 5L7WA 3KJNA 4MVJF 1IVYA 3U0VA 3RRXA 5DRTA 4AROA 1T9GR 1UDCA 3U1BA 1YZYA 2PBFA 1GZHB 4UVHA 2XTZA 3CLRC 5TQVA 2VZ0A 2A1TS 1U7HA 3TL3A 1CB7A 1DX6A 4JVSB 4QQNA 4YAFA 1NX9A 5ELXA 3HEBA 1Z83A 2BJWA 4H1WA 4OQMA 3K72B 5HWSA 4G23A 3X44A 4MROA 1CKEA 3A6PC 1U98A 5FHQA 2W70A 3H0CA 3MWYW 3NB0A 1ZD4A 1DIOB 2V8OA 2NUAA 1B4DA 1DC8A 1QTNA 4JLJA 1B16A 3HCCA 1U0NA 4TLEA 3UNXA 1MX9A 2GSDA 4CL3A 3OJOA 2HMUA 2EHDA 1XDGA 2GEJA 2PYDA 4K9KA 1PBNA 4QT0A 4C0JA 1T8PA 1YR8A 3ZGOA 4RPJA 2H57A 2VHZA 3C8ZA 3K8QA 3D6TB 3WTCA 1RRKA 4WCDA 3ZWXA 4BXOB 1DEHA 2EP8A 3L18A 1M0EA 1SBQA 1OBHA 1U2GA 3C3PA 3OQIB 4NATA 3ANSA 1P77A 5FUXA 2IDZA 1D2RA 2FP4A 4RL6A 5TARA 4HVLA 1UANA 3KKNA 3RFXA 1MX1A 4ILEA 2ZR9A 1JG7A 3WOHA 3AM4A 4N7MA 4B6FA 2IYQA 1UFQA 2YCBA 1C1HA 2OZVA 3DDNA 2EFYA 3OCVA 2IOQA 3RASA 1NURA 1GCAA 4YCJA 5DULA 5JATA 5JCOA 1E4EA 1FDUA 2WTAA 2IT1A 3WQRA 2FG6C 2D59A 3ORHA 1E3DA 4NYMQ 3Q85A 3S1AB 2V6MA 4W1SA 5DBEX 2H65A 4F2WA 1CNFA 5BOSB 5CAEA 3R9IA 4FCVA 1TU4A 2C3YA 2FZ5A 3ZWWA 3P0FA 4RC9A 3O4VA 1YFJA 4G67A 1P29A 4MVWA 3BE4A 1YVDA 4PLHA 2AS0A 1UEJA 2W0SA 4S1TA 3NC1C 4HX5A 4UQPA 3UGKA 2G6TA 3HJGA 2A14A 1P1CA 3FYDA 4MVJE 1IG3A 5JAUA 1M6WA 3UB3A 2QN7A 2MINB 1P1IA 4OFXA 1J07A 4IYRA 3AEKA 2BGRA 4R1QA 5IBQA 1GLVA 1C0IA 3NM4A 4TLDA 5HBGA 5JDCC 3F8SA 1J25A 4FYKA 1ZRNA 3OZSA 1WB5A 3IAUA 4OM7A 3HB0A 3NGXA 2W2LA 4X64B 1CY4A 2WINI 4HBZA 1XJ5A 1GFWA 3K1TA 3DVLA 1Z0ZA 4RH0A 4XUDA 2GK4A 2ZT8A 3U3OA 4C5CA 1G2IA 5B4UA 3LT1A 3H7IA 3CZMA 5P21A 3IT0A 5CLGA 1DKNA 2X2PA 1WMEA 3LDUA 3MD9A 2BEJA 1QGAA 4TSFA 4EHDA 2YHIB 1S4MA 4KMSA 3QY9A 5JI3E 3AWIA 5LWQA 1HNZB 2ZG6A 3KOWA 4JT8A 1TVKB 3SBEA 4EA6A 4OG2A 1X1RA 4ZT4A 1Z35A 3TW4A 3VUEA 4ZYVA 1ZM4A 1THGA 1K7YA 1S2NA 1SB8A 3O1LA 2ICAA 2RCNA 1Y1TA 4YN3A 3UTDA 2ZUEA 1XNHA 2W48A 3V55A 1I2BA 1TM7E 2ZWPA 1TXGA 2LTAA 1PDWA 3DOOA 4X1IB 3L93A 2XUZA 1CIJA 2NO1A 1E98A 1OA0A 5F5LA 3URKA 3PNYA 3EXIA 2DETA 4F2HA 3RC8A 1V5GA 4Y6RA 3IPLA 3JALA 2G4LA 1SUDA 4F3NA 3QUBA 3RVOA 2GARA 3HI4A 3KE9A 3U4MA 3FJ1A 2OFWA 3O8OB 4R2MA 3WIOA 3L1KA 1N5IA 3CXRA 2VQEB 2QN2A 2JJ1A 3LUDA 1Q7BA 4FT4A 4PG5A 1QSGA 5F78A 4BS9A 2ZS8A 1IDN1 1XMSA 3OP4A 4Q3BA 4V0NA 1ZK0A 4AZ0A 3DZFA 3ZXYA 1EHCA 3DXFA 1NI5A 1AV7A 2IOFA 2EOAA 4ZHQF 4M0UA 5JR3A 1N8SA 2IBMA 3AUYA 1CZHA 2PIAA 3FCUB 3MWEB 3A26A 3WOVA 1RT9A 5LDDC 2O5CA 4NOKA 2C84A 4FK8A 4W9MC 4KO8A 3ZJ4A 3SSAA 2HLNA 2I3AA 4D4MA 4R9NA 1C7RA 1OR8A 5BV8A 3L46A 3DOHA 1RZUA 2WZDA 4GICA 3C8HA 4LX8A 3EA4A 4Q5IA 2AN9A 5CH5A 3GLUA 1C3LA 5BSTA 1Y9ZA 3E8XA 2FMUA 1CX9B 1GUBA 2HI0A 5JCJD 1JHZA 3FWPA 4HSGA 4F6RA 1U9IC 1T5DX 1VJGA 2Y3IA 1KAQA 3CNHA 4MR9B 3V6MA 1MB2A 2H1OA 4I50F 4JEMA 2JD1A 2WFMA 1ZEMA 3D59A 1N3LA 3I04A 1F60A 1E3WA 2YZ2A 3QWFA 4A5SA 4F5WA 3C39A 1J1UA 4QGHA 4JX8A 1GNPA 3PGVA 3FTFA 3KXDA 1Y3DE 3FMVA 1FNMA 2HM7A 5KC8A 4IX9A 2Q9AA 3RS2A 2O8DB 5FA5A 5SYNA 3CZ9A 1II8A 3WQSB 1FZTA 3EBLA 3PD1A 3JPYA 3RRZA 3MIZA 2WIAA 1GFIA 2DPMA 5D85A 2OPBA 1DC4A 4OA5A 4FGUA 4KIGA 3IGFA 1UJ4A 2JFPA 5HKBA 2PUDA 4HNRA 1E9EA 4CETA 2WDPA 3NAZA 5B7QA 1D1PA 3K4PA 1E4OA 1KQ3A 4DDKA 1VI6A 4EQZA 4EF6A 3HCBA 4YFVA 3GARA 1IXSB 4HWSA 1RQGA 4X1KB 2C61A 4W6ZA 3H8WA 1GPAA 4BMZA 1E4EB 4LFAB 2IU4A 4GZ6A 1H05A 1MW8X 4IRUB 1I4WA 4YRRA 1T1SA 1JECA 2WF7A 4QAJA 5DM70 2VQFB 1YZVA 3KYDB 2BDUA 1TZCA 5ELMA 3VU3A 2FSVC 2P75A 4BZZA 1C7JA 2JGDB 2VNJA 2E37A 3GF4A 5EERA 3HH8A 3HSYA 3H3FA 3IQHX 3JWHA 3DMPA 4D8WA 5DSTA 4UM9B 2BEVA 5B1SA 3QLTA 4JNKA 2DX7A 3M49A 1J70A 4OQPA 4AMBA 1H69A 4BX3A 4N3GA 4J9UE 3HP1A 2WMOB 3BFJA 2QJOA 1DEKA 1G8FA 3DWFA 2PO5A 4EJ2A 3PE6A 1KO8A 2NU8A 1PD0A 2Q1WA 5E2BA 3ZGLA 1KR5A 2VDVE 5IN4A 3GG9A 4RLSA 4PPFA 2X7HA 4QGFA 4A6XA 2ZTVA 3IHLA 4R2HA 4UHEA 2YUIA 2YIDA 4J0QA 4O1MA 5BV7A 1T3HA 1PT8A 2I0FA 2NUBA 3A9TA 4GP9A 3B20A 2O8FB 2QI9C 1P4GA 1FFWA 1ONPA 4NQRA 5ALZA 1L8QA 1L4FA 2CLLB 1FDVA 4MQEA 4ZVPA 3RPEA 2ZIGA 3HJNA 4R9RA 5TR9A 1YC5A 2VDLB 3D4IA 4IHJB 3ZVLA 3AP2A 4UXHA 5TPZD 5BN3A 1D4FA 1FX0B 1OLSB 3IYLW 2Z6AA 1JH9A 5KU1A 2JF0A 5DYTA 2IS2A 4MW9A 1E1CA 2JVJA 4OFZA 4W5JA 5DLDA 2V7PA 5BW6B 3FW1A 4AF6A 5HZKA 3GPCA 4UEQA 1HE8B 3WGHA 5A4KA 2PUJA 1RXIA 4NAHA 4QRHA 1Z22A 2EF0A 4KYTA 3UV7A 5B4TA 3LQKA 2IWRA 3I92A 1M1YE 4DSZA 4ICIA 3BSFA 5A9RA 3ENZA 1E1LA 5LQAA 3EGXA 1Z68A 1EXVA 2BHLA 4Q00A 1LLDA 4HL6A 5KKNB 1E6KA 3DOFA 1OZAA 3K30A 3UWPA 1DO0A 1RTTA 4DTCA 4ZHQA 4IHJF 1SUWA 3Q3CA 1KDPA 4WJKB 3RVSA 4LBVA 2QG4A 2VYCA 3LCJA 3R3VA 2O06A 4XVCA 2BM0A 2MYUA 3WYAA 1U0FA 3DWGA 2AX3A 1NXVA 1ZMTA 1DDIA 1P3JA 4AZWA 3H5IA 2HT1A 1VDZA 5G4KB 3LY9A 1X1AA 4FHFA 3QF7A 4DUGD 2WAYA 1NW8A 5FA6A 3DFZA 4I4NA 3E35A 3I1FA 3G2OA 4JLOA 1SNYA 4Z9BA 1RZ3A 2VT3A 2PGXA 3ILHA 4FFRA 1FP4B 2WUVA 4Y2RA 1FVFA 5E1MA 4DLRA 3W04A 1KJYA 1CUGA 4CZ2A 2YOHA 1H2ZA 4MWGA 4LE2A 2ZWAA 1SQGA 5DV9A 2QVZX 4ZPXA 3VR6H 5A4DA 4BVFA 5LQKA 2C7GA 2IBSA 1XR3A 3FMOB 1JDBB 4PF1A 2ZRGA 4WOKA 1THTA 1M2VB 2XB6A 4EUFA 4G2NA 3DKPA 4AKEA 1SXJE 3G0OA 3DBLB 3OLWA 4QM7A 2DY0A 5DBGA 3T4PA 5FHRA 4F12A 1TD1A 4Y9TA 1IONA 1UMKA 3HYNA 2E4YA 2RI1A 2A0FA 3TFOA 1I5EA 4D0RA 2H9IA 1DJMA 1L5HB 4M38A 4PCLA 1JR3D 2F3PA 2ACKA 2QJWA 3D2AA 1II9A 5I7HA 3SSOA 1L8XA 2JS7A 3WNZA 2IZ6A 1AK9A 2Y66A 1I4TD 3IDSA 2YXBA 1RKUA 3GJZA 5HCIA 2R2AA 2ERCA 5AOAA 1ZAYA 3T7DA 1SURA 2KHZA 4HXFB 5A1TA 3C2QA 3SE7A 2ALJA 4FINA 4M1TA 3B1ZA 1FX1A 1XRPA 4J6EA 2Q8NA 4CMJA 5AVZA 5D86A 3G9UA 4C3VA 4MW5A 3QBJA 4NC9A 4RD2A 5IM5A 4KAAA 4YHBA 4Z9AA 3ZHYA 4ZCMA 3G9XA 1XD9A 1U5AA 3LUBA 3L02A 4MGKR 4HJXA 5JBIA 2R0QC 4F5YA 3VVCA 4R7TA 1DJNA 2P69A 2AW5A 1NKSA 1HT0A 4KTVE 1QLJA 4TTAA 1U1EA 3EDYA 4HDOB 2QV7A 3R5JA 4I50B 4GP7A 3OUUA 5EIFA 5HMMA 1AQIA 2FV8A 1KU0A 3WGGA 3IV6A 3TECE 3T0IA 4A0HA 3M4YA 2OVBA 4AJJA 2QZ9A 3LW8A 1WSWA 5IJ0A 1NOJA 1JALA 1IM8A 1KPGA 3RJ9A 1ICEA 1YZHA 2O0HA 1W36B 3BQMB 4H7EA 1JLMA 5C46F 1QHIA 5HGXA 3TQIA 5C7OO 1KDZA 2YUTA 4R3UC 4WX2B 5DTEA 3MYYA 3OP1A 3CCCA 3F3YA 4B8ZA 2OCDA 4K6CA 2TECE 1C9YA 2BFBA 1OQAA 2AG5A 3QPAA 1OJ7A 3BICA 1JIVA 2C54A 2UU9B 3P2KA 1YQ9A 2C5FA 3C1OA 1JA9A 3MUEA 1CRPA 1VPEA 2BKLA 3HXKA 1R5NA 4X3PA 3ACBA 1TADA 3Q8LA 4B7UA 2PQMA 2P4HX 3RRBA 2FQQA 2XVAA 3F5QA 3QKRB 1T6XA 4YO7A 3UICA 1NBIA 2EXXA 3LS2A 3NZEA 4L9SA 3TL2A 3LKZA 4KH1A 4MTLA 2X0EA 3LM8A 1XNJA 3PXDA 2IH4A 1NLYA 2XGMA 1HNWB 1PR9A 1SXJA 4BJ5A 1QQ6A 3DL7A 4AP6A 3I5YA 1ISPA 2XT6A 2SICE 3L40A 4RZHA 4DG9A 1DT5A 1ZN2A 4Y6OA 1T4CA 1SB9A 2UDPA 4OH1A 5JSHA 5SZHB 1NW6A 1US8B 4BX9A 1D9XA 2QX9A 3IP8A 2PQ0A 2JIBA 2WRZA 3HZHA 3JQPA 1EMDA 3L0CA 4HJRA 1Z0IA 4HADA 1XCPA 2OOSA 4ZN6A 5EMLA 3LDGA 4A0QA 5AD1A 3P9ZA 1JKIA 3Q87B 1DTWB 1Z2CA 1IZ8A 3T7AA 3EVCA 4BKUA 3AUUA 4XR4A 4H27A 3DTTA 1Z06A 4ZVOA 3EXEA 1UL1X 3WB1A 3L4KA 2Q8QA 4CTJA 2ZBQA 1Q1EA 3MMNA 4NXMB 2R1VA 2CNBA 4RDHA 1PW5A 2HMSA 3QLVC 3QXHA 4JH0A 4N40A 2W43A 3QV1A 1Y1PA 3ESAA 4IEIA 2D0OB 1SR8A 2D0IA 1XD8A 3CCFA 4Q18A 4UAVA 3SS8A 3FVRA 4ER0A 4YC7A 3TZBA 3ZLUA 4U4AA 4E3WA 2H85A 3AR6A 3G8AA 4WN9B 4YVFA 5DGCA 5A3QA 2QVCA 3NC0C 1XLUA 1K86A 2AI3A 5D01A 2WYWA 3H3XA 2ZCJA 1C8KA 3P9XA 4EAQA 2VP5A 1GU0A 4WBSA 1W5SA 1ZI6A 2X5OA 3P0JA 4JC5A 1ZNWA 3PI7A 4NPAA 2DFPA 1Z5OA 3KB1A 3QH4A 1Z2PX 5THQA 2FWIA 4XJXA 2OM6A 4MGZR 2ZSUA 4W5NA 2NU6B 1ZOOA 4J0IA 4J94A 4J0FA 1Q0ZA 4YRGA 3RYFB 5CEEA 2E4VA 4JXXA 1UMBB 2PGAA 1J8VA 1SJ9A 3P9KA 4HEJA 2IUSA 3L8YA 3NFRA 5AK3A 3VPGA 2YWJA 4MTCA 1YA4A 2OG1A 1IB0A 4RW0A 5BV0A 3HV2A 2VSFA 3K0FB 1O4VA 3OHMA 4NYIR 4DYVA 3JQ8A 1UZAA 1M2GA 4YONB 4QPPA 4OUKX 4JI4B 1EDOA 1EYZA 3H2ZA 5C8VA 3HR7A 4NNOA 5B7PA 4Z4CA 1U0GA 3BHIA 2CHGA 3SIXA 3KTDA 5AHWA 4BKOA 2HQ1A 3WP0A 3ZDDA 1HI9A 4TZTA 4ENRA 1QIGA 1DBSA 2CZGA 1N6LA 1O8CA 1QO9A 2AOUB 2YRWA 5J59A 2EC5A 4D0NA 2O2XA 4QYMA 1CQWA 4F4CA 2QYOA 2W6OA 3B13B 5KNCH 1CVRA 3LNTA 4XB2A 5JNTA 2D1FA 2Z6VA 4QICA 4WZ6A 5FT9A 4P4TA 5H02A