4CLAA

Alternative binding modes for chloramphenicol and 1-substituted chloramphenicol analogues revealed by site-directed mutagenesis and x-ray crystallography of chloramphenicol acetyltransferase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
213
structure length
213
Chain Sequence
b'MNYTKFDVKNWVRREHFEFYRHRLPCGFSLTSKIDITTLKKSLDDSAYKFYPVMIYLIAQAVNQFDELRMAIKDDELIVWDSVDPQFTVFHQETETFSALSCPYSSDIDQFMVNYLSVMERYKSDTKLFPQGVTPENHLNISALPWVNFDSFNFNVANFTDYFAPIITMAKYQQEGDRLLLPLSVQVHHAVCDGFHVARFINRLQELCNSKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE III CHLORAMPHENICOL ACETYLTRANSFERASE
publication title Alternative binding modes for chloramphenicol and 1-substituted chloramphenicol analogues revealed by site-directed mutagenesis and X-ray crystallography of chloramphenicol acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase (acyltransferase)
total genus 58
structure length 213
sequence length 213
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 1990-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00302 CAT Chloramphenicol acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 4claA00
4JN3A 4G2MA 4G22A 3U9BA 1XL7A 2II5A 1EAAA 1EABA 4G0BA 3B2SA 5KJUA 1QCAA 3MAEA 5DU9A 1SCZA 2BGHA 3U9FA 1DPCA 1EADA 1Q23A 5DUAA 3FOTA 2II4A 1DPDA 1PD5A 1XMCA 2RKVA 5KJSA 2E1VA 4CLAA 1EAFA 5FALA 1CIAA 1XL8A 1NOCB 4HVMA 1L5AA 5KJVA 5KJWA 2RKTA 2VSQA 2XHGA 1E2OA 4KECA 1DPBA 1Q9JA 2IHWA 2II3A 2CLAA 3B30A 5FANA 2I9DA 5T3EA 1XMDA 1EACA 2E1TA 5KJTA 3CLAA 2JGPA 4KE4A 4N72A 1C4TA 1EAEA 2E1UA 3FP0A 3L60A 2XR7A 4JN5A 1CLAA 2ZBAA
chains in the Genus database with same CATH superfamily
4JN3A 4G22A 2H4TA 3U9FA 1EADA 1Q23A 5DUAA 2RKVA 5KJSA 4CLAA 5FALA 2RCUA 2H3PA 5KJWA 2RKTA 2XHGA 1T7NA 1NDFA 2II3A 2CLAA 3B30A 2I9DA 1XMDA 1EACA 1C4TA 2FY2A 2XR7A 5FANA 2II5A 1EABA 3B2SA 1QCAA 1SCZA 2FY5A 2II4A 1DPDA 1PD5A 1EAFA 4HVMA 2DEBA 1NDBA 4EP9A 1DPBA 2FW3A 2FY3A 2E1TA 5KJTA 2E1UA 3FP0A 3L60A 2ZBAA 1T1UA 4G2MA 1EAAA 3MAEA 2BGHA 1DPCA 3FOTA 1XL8A 1NOCB 1L5AA 1NM8A 5KJVA 1E2OA 4EYWA 2H3UA 4EPHA 1S5OA 4KE4A 1EAEA 2FY4A 2FYOA 3U9BA 1XL7A 4G0BA 5KJUA 2H3WA 5DU9A 1XMCA 2E1VA 1CIAA 1NDIA 1T7OA 2VSQA 4KECA 1Q9JA 2IHWA 5T3EA 1Q6XA 3CLAA 2JGPA 4N72A 1T7QA 4JN5A 1CLAA
chains in the Genus database with same CATH topology
4JN3A 4G2MA 4G22A 3U9BA 1XL7A 2II5A 1EAAA 1EABA 4G0BA 3B2SA 5KJUA 1QCAA 3MAEA 5DU9A 1SCZA 2BGHA 3U9FA 1DPCA 1EADA 1Q23A 5DUAA 3FOTA 2II4A 1DPDA 1PD5A 1XMCA 2RKVA 5KJSA 2E1VA 4CLAA 1EAFA 5FALA 1CIAA 1XL8A 1NOCB 4HVMA 1L5AA 5KJVA 5KJWA 2RKTA 2VSQA 2XHGA 1E2OA 4KECA 1DPBA 1Q9JA 2IHWA 2II3A 2CLAA 3B30A 5FANA 2I9DA 5T3EA 1XMDA 1EACA 2E1TA 5KJTA 3CLAA 2JGPA 4KE4A 4N72A 1C4TA 1EAEA 2E1UA 3FP0A 3L60A 2XR7A 4JN5A 1CLAA 2ZBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JN3 A;  4G2M A;  4G22 A;  3U9B A;  1XL7 A;  2II5 A;  1EAA A;  1EAB A;  4G0B A;  3B2S A;  5KJU A;  1QCA A;  3MAE A;  5DU9 A;  1SCZ A;  2BGH A;  3U9F A;  1DPC A;  1EAD A;  1Q23 A;  5DUA A;  3FOT A;  2II4 A;  1DPD A;  1PD5 A;  1XMC A;  2RKV A;  5KJS A;  2E1V A;  4CLA A;  1EAF A;  5FAL A;  1CIA A;  1XL8 A;  1NOC B;  4HVM A;  1L5A A;  5KJV A;  5KJW A;  2RKT A;  2VSQ A;  2XHG A;  1E2O A;  4KEC A;  1DPB A;  1Q9J A;  2IHW A;  2II3 A;  2CLA A;  3B30 A;  5FAN A;  2I9D A;  5T3E A;  1XMD A;  1EAC A;  2E1T A;  5KJT A;  3CLA A;  2JGP A;  4KE4 A;  4N72 A;  1C4T A;  1EAE A;  2E1U A;  3FP0 A;  3L60 A;  2XR7 A;  4JN5 A;  1CLA A;  2ZBA A; 
#chains in the Genus database with same CATH topology
 4JN3 A;  4G22 A;  2H4T A;  3U9F A;  1EAD A;  1Q23 A;  5DUA A;  2RKV A;  5KJS A;  4CLA A;  5FAL A;  2RCU A;  2H3P A;  5KJW A;  2RKT A;  2XHG A;  1T7N A;  1NDF A;  2II3 A;  2CLA A;  3B30 A;  2I9D A;  1XMD A;  1EAC A;  1C4T A;  2FY2 A;  2XR7 A;  5FAN A;  2II5 A;  1EAB A;  3B2S A;  1QCA A;  1SCZ A;  2FY5 A;  2II4 A;  1DPD A;  1PD5 A;  1EAF A;  4HVM A;  2DEB A;  1NDB A;  4EP9 A;  1DPB A;  2FW3 A;  2FY3 A;  2E1T A;  5KJT A;  2E1U A;  3FP0 A;  3L60 A;  2ZBA A;  1T1U A;  4G2M A;  1EAA A;  3MAE A;  2BGH A;  1DPC A;  3FOT A;  1XL8 A;  1NOC B;  1L5A A;  1NM8 A;  5KJV A;  1E2O A;  4EYW A;  2H3U A;  4EPH A;  1S5O A;  4KE4 A;  1EAE A;  2FY4 A;  2FYO A;  3U9B A;  1XL7 A;  4G0B A;  5KJU A;  2H3W A;  5DU9 A;  1XMC A;  2E1V A;  1CIA A;  1NDI A;  1T7O A;  2VSQ A;  4KEC A;  1Q9J A;  2IHW A;  5T3E A;  1Q6X A;  3CLA A;  2JGP A;  4N72 A;  1T7Q A;  4JN5 A;  1CLA A; 
#chains in the Genus database with same CATH homology
 4JN3 A;  4G2M A;  4G22 A;  3U9B A;  1XL7 A;  2II5 A;  1EAA A;  1EAB A;  4G0B A;  3B2S A;  5KJU A;  1QCA A;  3MAE A;  5DU9 A;  1SCZ A;  2BGH A;  3U9F A;  1DPC A;  1EAD A;  1Q23 A;  5DUA A;  3FOT A;  2II4 A;  1DPD A;  1PD5 A;  1XMC A;  2RKV A;  5KJS A;  2E1V A;  4CLA A;  1EAF A;  5FAL A;  1CIA A;  1XL8 A;  1NOC B;  4HVM A;  1L5A A;  5KJV A;  5KJW A;  2RKT A;  2VSQ A;  2XHG A;  1E2O A;  4KEC A;  1DPB A;  1Q9J A;  2IHW A;  2II3 A;  2CLA A;  3B30 A;  5FAN A;  2I9D A;  5T3E A;  1XMD A;  1EAC A;  2E1T A;  5KJT A;  3CLA A;  2JGP A;  4KE4 A;  4N72 A;  1C4T A;  1EAE A;  2E1U A;  3FP0 A;  3L60 A;  2XR7 A;  4JN5 A;  1CLA A;  2ZBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...