4CLCB

Crystal structure of ybr137w protein
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
170
structure length
170
Chain Sequence
MVVLDKKLLERLTSRKVPLEELEDMEKKCFLSTFTYQDAFDLGTYIKNAVKENFPDKPVAIDISLPNGHCLFRTVTYGGSALDNDFWIQRKKKTALRFGHSSFYMGCKKGDKTPEEKFFVDSKEYAFHGGAVLIQSERSTYPYACLTISGLKQEEDHLMAVSSLIAFANE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of Ybr137Wp Implicate its Involvement in the Targeting of Tail-Anchored Proteins to Membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords UPF0303 PROTEIN YBR137W
total genus 46
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4clcB00
2A2LA 5CX7A 4CLCE 4CLCD 4CLCA 4NKPA 4CLCB 4BMWA 3FPVA 3FPWA 4CLCC
chains in the Genus database with same CATH superfamily
3MZFA 1YT4A 1BSGA 5EFWA 3UB6A 4Z9QA 3IHBA 4K0XA 2V8FA 1ONHA 4BLMA 4ME4A 4QHCA 4GHIB 3MKEA 3BECA 3JPUA 4Y2FA 1V9YA 4PMAA 4LGWA 3E4QA 3IQAA 4C6YA 3D9YA 1S4RA 3I7JA 3LI9A 4OH0A 1ES4A 4Y0UA 2PDRA 4MBKA 1ES5A 1YMSA 1XKZA 4PM5A 5CXWA 1MC0A 1K57A 3S7OA 4KQRA 4WEKA 2WGWA 4EUVA 4JGOA 1AWIA 4I38A 2OWJA 2VZWA 4H8RA 5EVIB 3IBJA 4KZ5A 4L0LA 1SHVA 1IKIA 3VP3A 3K2NA 2LB5A 3MXQA 5L09A 3LFVA 4HJ3A 2W3EA 2BG1A 2WKQA 4NXBA 3S7QA 1FCOA 2P04A 5FQQA 5HSQA 1YLPA 1JWVA 3ZNYA 5DFYA 1K57C 5TGFA 5HPIA 1BTLA 3CZDA 5FSRA 5HZHA 5AVFA 2O99A 5FI7A 2L4RA 1XJ6A 2EX6A 4MBHA 1NY0A 1K4EA 3FG8A 2KDKA 4KZBA 1FIKA 3BW6A 3IXDA 3MQOA 2OWHA 1W8QA 1OTAA 3A0SA 3E2LA 2Y4AA 4JF5A 3AGDA 2VEAA 5L10A 1ES3A 1BLPA 2RL3A 2M1CA 1N9NA 1IFQA 3LR4A 1Q2PA 4GCZA 4KUOA 3MQQA 4HEFA 3UE6A 3A3FA 4X25A 2JKTM 3VOZA 1GSWA 1K54C 4WZ5A 3VP2A 3IH8A 3OCNA 3HJKA 5A92A 3N4IA 5HPFA 3DTMA 1XX2A 2EXBA 4GD6A 1K0KA 3SH9A 1OJGA 2JBFA 4Y7PA 3MXRA 2HP6A 5I94A 4C3QA 4S2JA 4LFUA 3CUEC 4EU0A 1PNEA 3T1SA 2H0TA 3IT9A 5U47A 4HESA 4HH3A 4BD0A 2DRWA 4EBNA 4ARZB 1RP5A 4I39A 3UPPA 3GV9A 5FAQA 4IJGA 4RVAA 4FSFA 5GL9A 4PM9A 1K54A 3Q82A 4WZ5C 3VFHA 3TOIA 2P9VB 4IVKA 1NYYA 3LY3A 1OT9A 4R3AA 3OZHA 5F5YA 3T50A 3IX8A 4MLLA 1YLZA 1V9ZA 2XA7M 1L2SA 1K6RA 1IYPA 4YNRA 3VOYA 1BT5A 3JYIA 2ZMAA 2JKGA 2XGNA 2VK3A 3ZYTA 5EECA 3BQ8A 4O8GA 4X53A 5CTMA 3IF5A 1F5MA 4A5RA 3MMHA 4BBUA 3O88A 4MBFA 2R9WA 1XP4A 1K4FA 4Q0HA 3WS0A 1PIOA 5D3OA 3VMAA 3NBLA 1E4DA 2A3UA 3BRMA 1M40A 4S2NA 1PI5A 2QWSA 1G5UA 4X69A 4DE3A 1T1AA 3QP4A 2W0NA 4HH2A 2R9XA 2M7VA 4NXEA 3P7NA 5EE8A 4X6TA 2KLIA 4N92A 3LI8A 1W5DA 1Y54A 1ALQA 5HWTA 4QD4A 5J3WA 4OQ0A 4GHIA 3WS5A 3CLOA 4JXGA 3B3XA 4WF0A 4FTXA 1ZG4A 4BJPA 4JKTA 2HZ5A 3V50A 4ID4A 1MKMA 3IX4A 1EWZA 3QP6A 3RTYA 3OBFA 5FATA 1VHMA 4YINA 2WGIA 3BM6A 2EXAA 4R4SA 5CEDA 2ZD8A 2WZZA 4GD8A 5F69A 2D02A 5TFQA 5TBMB 2A24B 3T4QA 3EGXC 4XXRA 1H8MA 1OTIA 4P6ZM 4ARZA 4Q0JA 2WADA 1EI5A 3VE3A 5HAPA 4ZDXA 1ZKJA 4MEZA 3LUQA 2FFFB 5L2FA 5DF9A 3O86A 4OPRA 3EQUA 1LL9A 4IHQA 3BQAA 3C38A 1LLBA 2J3WA 4EQIA 1H5XA 5EOEA 4UA7A 4YFMA 1SKOB 2QHKA 1ZG6A 4YWZA 3BLMA 3N8SA 4WELA 1MY8A 2XRNA 3UPOA 3ZFZA 3F1OA 1S1YA 3UB9A 3K3CA 4U3TA 3NDGA 4HNBA 3D3OA 2HJ9C 3HLEA 1P97A 2D01A 3LIAA 5JYOA 3NIAA 5F1FA 1CF0A 1H3QA 4E3OA 4X55A 4BBVA 1D1JA 3T4LA 3SZTA 2J3TC 4R23A 2XLNA 3SOIA 1ZC2A 1HVBA 1HLUP 4MCWA 4NG2A 4X1LA 3QP8A 3GTCA 4M3KA 1L0GA 4II7A 5DVAA 2Y2QA 1JWZA 1KE4A 5EVIC 3G30A 2IWDA 4JGRA 4OOMA 4K0WA 3CAXA 5G4YA 3G35A 2XSSA 4UQIM 1OPXA 4H6JA 2V8CA 2YKHA 4CLCC 2PYRA 4OKPA 1JNUA 3S22A 4L9GA 2EWVA 3H7WA 2XD5A 4FUWA 1LL8A 2O9CA 3UE3A 1GHPA 5M19A 1YPRA 3AGEA 4GDNA 2Z2MB 2G2UA 4BMWA 1UWNX 5E2FA 1PRQA 4ZBEA 5DF8A 4JGPA 3GRJA 5GHZA 4UA6A 3MKFA 4XT2B 4GW9A 3KO6A 4P6ZS 3LEZA 2HF6A 1TEMA 2WKEA 4HBTA 3TSGA 2Q9MA 3ZG0A 3UMEA 1DJAA 3GVBA 3ZG7B 1RGZA 2FH5A 3PAGA 5F68A 4N9KA 5DJUA 5J8XA 4HI4A 1Z09A 1DRMA 4P6BA 4EV4A 2P08A 3QP2A 4X1MA 2E8JA 5HAIA 4N1XA 4CPKA 5HD3A 2PU2A 4IEDA 4OOYA 1JTDA 3L9KA 3RXXA 1NYMA 1PYYA 3Q1FA 4HP4A 3T1XA 3GR2A 4KENB 4ESPA 1N9LA 1BLSA 2V1AA 1S66L 4CLCA 2JC7A 3GMWA 4K08A 3HJIA 4WL9A 2PHYA 3DWZA 3C8CA 4BL2A 3EEHA 1DJBA 1MBLA 1I2WA 5CEBA 3NC8A 1W63M 3C7VA 2V1ZA 1LI9A 4F3LB 3ZQ5A 1YSPA 1NRJA 1ONGA 3CJMA 4Q0IA 5IT5A 1TF1A 3HLDA 3Q7ZA 1JTGA 2XR0A 3WS2A 3LR0A 2EX8A 1P0ZA 2GJ3A 4ETZA 3QNCA 1TS7A 2OAQ1 5AJGA 1XGJA 3OC2A 2XFSA 3ICYA 4DJ3A 1PWCA 1NRFA 4LRYC 4NETA 5FI6A 4GB7A 1FCNA 4XT2A 3RXWA 5E2GA 1YAXA 3FPWA 2PD8A 2QJ7A 1PW1A 1A0KA 2VV8A 2VX8A 1UWPX 1GCEA 4QB8A 5FQ9A 3OCLA 2VLGA 1H0MA 1L0DA 1S6RA 2QKPA 1LSVA 2V20A 1CEGA 1I2SA 3BY9A 2J8YA 4DF6A 3NHQA 1BULA 1YLJA 4ZTKA 4EUZA 3E4OA 4KQDA 4OQGA 5EUAA 2XFTA 3N8RA 1OMEA 4GN2A 2JN7A 4GS9A 2H5SA 1T1BA 4O7DA 5GLDA 4Q8IA 2HV1A 5A93A 5AQ7A 4OP5A 3ZG8B 3OLOA 2EA9A 4I3JA 1ACFA 4JBFA 4ZAMA 5CGWA 2GDNA 2HDUA 5HDCA 1IYOA 4QU3A 5GHXA 3T1RA 5HWWA 3PYPA 5TR7A 1JVJA 2G7UA 3UDIA 3VP4A 3IWOA 3KYEA 2VGJA 2UV0E 3DW0A 3PBNA 2ZMVA 2EWWA 3CUEA 4S2IA 4LV2A 4B88A 1I5QA 5HAQA 2H10A 1Y4OA 3GECA 3JVVA 4L9FA 2HPBA 2K7SA 2VGLS 4MN5A 3ZGAB 3LCEA 4E3JA 2ZOHA 4U0TA 4MMNA 2Y91A 2FZ0A 5HL1A 3HVFA 1N4OA 2OSUA 4KZ9A 3H82A 4E3MA 2C5WB 3MFXA 2WKPA 3WRTA 4LRXC 1YM1A 5CHUA 4PHTA 4L9EA 5MC7A 2Y79A 4ETXA 3VSLA 2WK0A 2WKIA 2WUQA 1ERMA 1F98A 4XUXA 1PW8A 2R78A 5M18A 4EERA 5CHJA 3H82B 1K56D 2WZXA 3LICA 3VFFA 3ZHHA 2KOIA 4IVIA 2V2FF 4WMCD 1GHMA 2LB9A 1VEUB 3IF6C 4R3BA 4D60A 2WKHA 2XQZA 3IWIA 1LL5A 3A3JA 3IXGA 3CPTA 3IXHA 1MWRA 3QP5A 5FDHA 3LIBA 2ZMFA 4NK3A 1OTDA 1M6KA 2V0UA 1Z6FA 3TJZC 1NLYA 2ZM0A 5GLAA 3S1YA 2VGLM 3V3SA 2H0YA 4JXVA 3G2YA 3RFBA 3VP1A 4G3KA 2Y59A 4R1GA 1FCMA 3FKVA 3HUNA 3CG5A 4EBPA 3OPLA 2ZQDA 4ZJ1A 4JLFA 2PR6A 2PR5A 2VV6A 3E98A 2GZAA 1WA9A 2XEPA 1HZOA 2K31A 1FQGA 3CITA 3NJAA 4LV1A 3MZDA 3IXBA 2A2LA 2PT7A 4Y0TA 4WMCA 4U0XA 3D4FA 4LLOB 3D72A 4GNUA 1NZUA 2EFUA 1ERQA 3HUMA 2C6WB 3P09A 5EV0A 2OV5A 4OPYA 4MN6A 5FQIA 3C4PA 2ZQ7A 4OVDA 4DXCA 1KE0A 5IU1A 1VQQA 3CHWP 1TDLA 1O7EA 4QJGA 2Y2PA 2Y2NA 3CPTB 1TS0A 3T4JA 1T18A 1MWTA 1XXMA 3PBRA 5FA7A 1H8ZA 2JHEA 3M6BA 1KVLA 3VP0A 3HLGA 3UMDA 4R4RA 3BY8A 4Y15A 5CGSA 5A8BA 4WM9A 3SW1A 1OTBA 4IUHA 2Y2KA 4OQIA 4EQ1A 1FR1A 3O87A 1RGYA 1ZHHB 3E0YA 3FC7A 4E3IA 4KZAA 3QHYA 1SKOA 4OQHA 5HD5A 2V0WA 1CEFA 1K55A 1P9RA 2DCFA 1YSQA 1IYSA 1O07A 1K6SA 1K38A 1RCJA 4I3AA 4FH4A 3QP1A 5GLCA 2O9BA 3MXSA 1PZPA 4KZ7A 2VA0A 4S2KA 2V1BA 2UWXA 3TE8A 1TD5A 4EETB 2A49A 4FH2A 3PBSA 1WYBA 1E25A 2ACGA 1PWGA 4EW7A 1MKIA 2DNSA 4S2MA 2OOLA 4QY5A 2HP9A 1F2KA 5EM1A 5HW3A 5G18A 4GDBA 5EVLA 5J4EA 3IF6A 5FAOA 2Y2JA 4KQOA 2ZQCA 3ZDJA 4NXGA 1OTEA 1MPLA 5GLBA 4B9OA 2PYPA 2OAP1 3Q7VA 4B4XA 4HHDA 1L0FA 1DY6A 3HLWA 5DKLA 4E3KA 3KSGA 3EEAA 3UE1A 4S2NC 3PBOA 3EQVA 3BFCA 3SS5A 2P7JA 4RYEA 1Y28A 1K55C 2Q0OA 1K56A 3BFGA 4UAAA 2KX6A 4JGQA 4N9LA 2WGWB 1ZTUA 2W3DA 3ZVTA 2Y8HA 3UO9A 1YKDA 1D06A 1MZUA 3S7NA 4E6XA 1OJ5A 2J9PA 5F6AA 1IOUA 1NJ4A 3UB5P 5DTSA 2QMIA 1KOUA 4GKUA 3OPRA 3NULA 1BYWA 3F1PA 2BASA 2O9AA 1W7FA 2RCXA 4GJ4A 5CTNA 5AVEA 3TW8A 2QJ5A 3W2ZA 4NXFA 3RJUA 1IELA 1WE4A 4S2OA 4DDYA 4DE0A 3TRCA 5DFXA 3NDEA 3G34A 5CGXA 4H6JB 1XFNA 3QNBA 4JF4A 2P74A 4IBXA 4Y17A 3ZNTA 4Y0OA 1IEMA 2BTFP 4CLCD 2NUPC 2ZQAA 3NI9A 3A3DA 2ZLYA 5CHMA 1CQAA 4EESA 5M1AA 5KSHA 5HWVA 4DDSA 5FEGA 3ITAA 3WS1A 5FDSA 2JE5A 4DJ2A 4EBLA 3FV7A 1CI8A 1OT6A 5EOOA 2Y2OA 3T12B 5L8MA 2VKSA 1XJ3A 3BEBA 1GSXA 4DRTA 1UGUA 5CX7A 5KZHA 3TG9A 1EROA 4DE1A 4LRZE 3BJNA 1IYQA 3SS4A 1P9WA 4BBTA 2GX5A 3IS2B 4RX2A 2A24A 2OLUA 3B42A 2ZJ9A 1FSYA 1CJFA 3A3EA 4BENA 1G6OA 3B47A 5FQJA 4D2OA 2ZL1A 5BOHA 1XA7A 1AXBA 3DTEA 3V3RA 4PM6A 3LIEA 2NUTC 2FFYA 2ZC3B 3KSFA 4Y3IA 4B93A 2Y2GA 4EEPA 3C2WA 4OPQA 2X71A 2PU4A 3IS2A 2ZC5B 1J9MA 4LV0A 1LHYA 3GDIA 3V39A 4MN7A 1GA9A 1CI9A 3R7WA 4K91A 5FASA 4R0QA 3GQZA 1W8YA 4PKYG 4E3LA 1SDEA 4FD8A 2X01A 3K3DA 3UDXA 4P87A 3P01A 4R3JA 2Y2MA 5EVIA 4OPZA 1HTZA 3NY4A 3U4LP 2XK1A 1LI0A 1QMFA 5A91A 2ZOIA 4P85A 1VM1A 2B02A 1F9IA 4LCMA 1G68A 1YQSA 3N8LA 4LENA 4O01A 3SH7A 3NOTC 1BLHA 4KG6A 3R4KA 1ESIA 4I5SA 4UHUA 3Q07A 3T1QB 5E2EA 3G2ZA 1SZVA 1MWUA 2W3HA 3LR5A 2W3GA 4WN5A 3LEQA 1LSWA 3N7WA 1DJCA 4GOGA 3WS4A 3C4OA 4Y5FA 5J7EA 3UB7A 2VJWA 3FYZA 3MS6A 3KYZA 4R6LA 3W8KA 3UB8A 2IWCA 4N1HA 2EX9A 1XJ4A 4EWFA 3PBTA 3MFDA 4S2PA 1XPBA 4I3IA 1PI4A 3LIFA 5DKKA 4OONA 1DP8A 3PR6A 3M2KA 1KDSA 3FKWA 3V5MA 4P0MA 1YMXA 2ZBBA 1G6AA 1T19A 3RH8B 3WWXA 1VETB 3M2JA 3UN7A 1MWSA 2L1MA 3T4SA 4E3NA 3EGDC 1XGIA 2YKFA 3HCYA 3PXPA 3PBQA 4E04A 2JKTI 5JYPA 4DKIA 5FI2A 3HUOA 3BWLA 2W1TB 5TBMA 3DWKA 4IBRA 5DF7A 4LV3A 3HLFA 3ISGA 2Q9NA 1GA0A 2HP5A 3DBAA 5FAPA 5FQMA 1YLYA 2W1RA 4ZRRA 2IA2A 4OOLA 4UQIS 2XA7S 5KIZA 2H28A 2ZQ8A 1WYCA 2Z2LB 5K5BA 1KGEA 1S67L 3OPHA 3S7PA 5FL3A 2J9OA 3MSHA 4DXBA 4JF6A 4QPRA 1E3UD 3PHYA 5F83A 5TJJA 3O3VA 1T1CA 5HL6A 3VV4A 1NXYA 2ZM8A 4QWOA 5EM0A 3ULFA 3F1OB 4DE2A 5EVID 3W4QA 4WZ4A 5HDDA 4G3VA 5EVEA 5HFOA 4KZ4A 4F3LA 5HDSA 4R38A 5F82A 5F1GA 2J7VA 3Q81A 1U60A 4JXWA 4IUKA 2HDSA 5DTKA 3R7WB 2J3TD 1SDNA 2HGVA 1QMEA 4EXOA 4PM8A 2J80A 4MDZA 3E2KA 4WLAA 3KX0X 5IHVA 2JKRM 1LT0A 2HDRA 3O5YA 1TS8A 3G4PA 2XDMA 4PPRA 3IBRA 1NWZA 4WYYA 4NEED 1K25A 2O0YA 3MZEA 3F1NB 4HJ6A 1EW0A 3KSIA 4BQMA 1LSXA 2WAEA 3AGFA 3IWQA 1BUEA 3SS3A 2WYXA 4WEJA 5EPHA 2WKRA 1SCWA 4XUZA 3MBZA 1S1ZA 3VOLA 3C7UA 1YLWA 4PAUA 2ZL1B 4YOFA 2X02A 3HL9A 5I5LA 5KMWA 4HP9A 4KZ3A 1KGFA 3CWFA 4RQ9A 2Y2IA 3C5AA 3FWLA 3H7WB 1FOFA 1NZOA 1FILA 2L0WA 3S4XA 2B5RA 4KG2A 3T4KA 4DN0A 1BZAA 3NCKA 3LYXA 4KUKA 2K2NA 2CMNA 3BLSA 3E4PA 1TS6A 2B18A 2PRFA 3LGOA 5E2HA 3M6HA 2QYBA 3MQ0A 1VB6A 4JXSA 3BFEA 3A3IA 3CMZA 3HLBA 2ZQ9A 2IWBA 4R70A 1KVMA 2Z6CA 3BFDA 3KSHA 4FCFA 4JPMA 3GSGA 4KZ8A 4CLCB 4HQAA 2PBYA 3NECA 1TDGA 5FEFA 1STZA 1L3LA 3V67A 1NLZA 4KZ6A 1L0EA 3NOPC 3VE4A 2ZM2A 4KQQA 3PAEA 3HBRA 2VV7A 5IS1A 4EEUA 4ZJ3A 5AQAA 4M4XA 4GZBA 1SKFA 1ODVA 2W3FA 2XROA 3MJQA 3IHAA 1PWDA 3SH8A 2JKRI 4GLQA 2Y2HA 4OLGA 1S4SA 1J3WA 4C75A 4OLDA 1FR6A 4HY8A 3UNWA 2AVXA 2XH9A 5A90A 2ZC7A 3EWKA 3W4OA 3IX3A 5DJTA 3ZCZA 4LCLA 2HJEA 1PZOA 5HARA 2PAVP 1VEUA 4UEYA 4E6WA 1X0OA 4BWIA 2B95A 2G2WA 5AQBA 2VGKA 4B4ZA 4MNRA 2I9VA 4GS9B 3UY6A 3W4PA 4RX3A 3ZG9B 3EOIA 3A0RA 2JCHA 1C3BA 4S2LA 1XJ2A 2V9AA 5C5KA 1KDWA 3UDFA 2XD1A 1ESUA 4WUJA 2PBDP 3HLCA 3BYDA 4CLCE 2OLVA 2I72A 5LBRA 1HD8A 1KE3A 3LR3A 4NKPA 1JWPA 4HBUA 4ZJ2A 5DTTA 1W63Q 1FSWA 2W27A 3DTIA 1H8YA 4BL3A 2WGVA 1DP6A 3P98A 3ITBA 3C30A 2HDQA 1G28A 3IF6B 3FPVA 3LY4A 1YLTA 2QZ6A 1W79A 2INWA 1ES2A 3T4OA 1N9BA 3FZCA 4HIAA 3U2AA 3WRZA 1MXOA 3ZG5A 5CRFA 1Q2QA 4BD1A 2XF3A 3CI6A 2Y2LA 3ZVWA 3N6IA 3G6OA 1N9OA 4HOIA 2BLSA 4Y13A 3PTEA 3OPPA 2W1TA 1IKGA 4CQHA 1KGGA 1XA1A 1GHIA 3T4TA 4X68A 5CERA 5AQ9A 3A0VA 5E43A 4PKYA 2JKFA 4HJ4A 3F1NA 4PM7A 4AFIA 2M7UA 3L7HA 2DMWA 4KG5A 5GHYA 4G3WA 1PFLA 5L07A 3VSKA 3MR0A 3UPNA 4WBGA 4OP8A 2MJ6A 1DP9A 1E3UA 1BLCA 2PD7A 3H9WA 2EX2A 3LO7A 3KYQA 3UE0A 3F1PB 3BFFA 5HX9A 2ZC6B 4CJNA 3IH9A 3B33A 5KSCA 3DTKA 4LPZA 2ZC4B 4UA9A 2GNXA 5FQKA 2Y55A 3G32A 2P9VA 3LIDA 4RA7A 3MF0A 3HREA 4X56A 3DAVA 3NOUC 2WAFA 1XFQA 1VETA 4F94A 4Z1WA 1CK3A 2E8IA 3Q7VB 4DMZA 5CECA 3OOVA 4O0PA 3G31A 2Z6DA 5G4ZA 2EFXA 1GSVA 2QPNA 3JVUA 1S0WA 4FOFA 1D7EA 4QY6A 2CC1A 1TVFA
chains in the Genus database with same CATH topology
2JKTI 1TS0A 3T4JA 4JGRA 1T18A 4OOMA 5EFWA 3PBRA 3UB6A 3CAXA 5G4YA 2JHEA 2XSSA 4UQIM 1OPXA 3BWLA 2W1TB 4H6JA 5TBMA 4ME4A 3UMDA 4GHIB 2YKHA 3BY8A 5A8BA 4CLCC 3SW1A 3DBAA 4Y2FA 2PYRA 2W1RA 1JNUA 4L9GA 4ZRRA 2IA2A 2EWVA 3H7WA 4OOLA 4UQIS 1LL8A 2O9CA 1OTBA 4IUHA 1V9YA 2XA7S 4EQ1A 3UE3A 1ZHHB 3E0YA 3E4QA 5KIZA 2H28A 3FC7A 1S4RA 5HD5A 2V0WA 5K5BA 1P9RA 3LI9A 4BMWA 1S67L 1YSQA 1UWNX 2PDRA 3S7PA 5FL3A 4I3AA 4QPRA 3PHYA 4JGPA 5TJJA 2O9BA 1T1CA 4XT2B 1MC0A 5HL6A 4GW9A 2VA0A 3KO6A 4P6ZS 3VV4A 3S7OA 2V1BA 2HF6A 3ULFA 3F1OB 4WEKA 5HDDA 3TE8A 4EUVA 4G3VA 3UMEA 4JGOA 1TD5A 4EETB 4I38A 2OWJA 2FH5A 2VZWA 3PBSA 5HDSA 4F3LA 4R38A 5F68A 4EW7A 3IBJA 5DJUA 4IUKA 4L0LA 4HI4A 2OOLA 3R7WB 2J3TD 1DRMA 2HGVA 2P08A 4EXOA 2J80A 3K2NA 4MDZA 2LB5A 5J4EA 4WLAA 3KX0X 3MXQA 4KQOA 2JKRM 5HD3A 3LFVA 4HJ3A 4NXGA 1LT0A 1OTEA 3O5YA 2W3EA 2WKQA 4B9OA 2PYPA 2OAP1 1TS8A 4NXBA 3S7QA 4HP4A 3IBRA 4HHDA 1NWZA 2P04A 4NEED 5HSQA 1N9LA 2O0YA 3F1NB 4CLCA 2V1AA 1S66L 5DFYA 5DKLA 5HPIA 3KSGA 4K08A 3HJIA 4WL9A 4HJ6A 3EEAA 2PHYA 1EW0A 5HZHA 3KSIA 5AVFA 2O99A 3C8CA 1LSXA 2L4RA 3EEHA 3PBOA 1XJ6A 4WEJA 2WKRA 3EQVA 2P7JA 1S1ZA 3VOLA 4PAUA 4YOFA 1Y28A 5I5LA 1W63M 3FG8A 2KDKA 4HP9A 3BW6A 3CWFA 4RQ9A 2KX6A 3MQOA 2OWHA 4JGQA 4F3LB 1OTAA 3A0SA 3H7WB 3ZQ5A 1YSPA 1NRJA 1ZTUA 4Q0IA 5IT5A 2L0WA 1TF1A 2W3DA 3T4KA 4DN0A 2VEAA 2Y8HA 3LR0A 2M1CA 1YKDA 1D06A 3LYXA 4KUKA 2K2NA 2CMNA 1MZUA 1N9NA 3S7NA 3E4PA 1TS6A 2B18A 1P0ZA 2GJ3A 1OJ5A 1IFQA 3LR4A 5F6AA 4ETZA 1TS7A 2QYBA 3MQ0A 1IOUA 2OAQ1 4GCZA 4KUOA 1VB6A 5AJGA 3OC2A 3MQQA 3ICYA 1KOUA 4DJ3A 3UE6A 4LRYC 4R70A 1BYWA 2Z6CA 2JKTM 3F1PA 2BASA 3KSHA 1GSWA 2O9AA 4GJ4A 5AVEA 4XT2A 4CLCB 1YAXA 3FPWA 4HQAA 3TW8A 2PD8A 2QJ7A 2QJ5A 3OCNA 3HJKA 3W2ZA 2VV8A 4NXFA 2VX8A 1UWPX 3TRCA 5HPFA 5DFXA 3OCLA 1STZA 3V67A 1NLZA 2VLGA 4H6JB 3NOPC 1XFNA 1LSVA 2QKPA 3VE4A 3BY9A 1OJGA 2VV7A 5IS1A 4EEUA 3NHQA 4M4XA 3E4OA 2W3FA 1ODVA 4KQDA 2XROA 4CLCD 2NUPC 3MJQA 3CUEC 4EU0A 2JKRI 4GLQA 1S4SA 2JN7A 4HH3A 4GS9A 4EESA 4ARZB 1T1BA 4I39A 5KSHA 4IJGA 4HY8A 2HV1A 4FSFA 5HWVA 3EWKA 3OLOA 4DJ2A 2EA9A 5DJTA 1OT9A 4R3AA 4I3JA 2HJEA 1OT6A 5F5YA 5L8MA 2VKSA 5HDCA 4UEYA 3T50A 1XJ3A 5HWWA 1X0OA 1GSXA 3PYPA 1V9ZA 2XA7M 1UGUA 4YNRA 5CX7A 4BWIA 4LRZE 3BJNA 2G7UA 1P9WA 4BBTA 2GX5A 3ZYTA 2I9VA 3IS2B 3PBNA 2ZMVA 4GS9B 3BQ8A 2A24A 2EWWA 4O8GA 3CUEA 3B42A 1F5MA 3MMHA 4BBUA 1G6OA 3GECA 3B47A 4Q0HA 3JVVA 3EOIA 3A0RA 4L9FA 2K7SA 2VGLS 4MN5A 1XJ2A 2V9AA 5C5KA 3LIEA 2ZOHA 2NUTC 4MMNA 3KSFA 4WUJA 2FZ0A 4Y3IA 2QWSA 4B93A 4EEPA 3C2WA 4CLCE 5LBRA 1T1AA 3LR3A 4NKPA 2W0NA 3IS2A 4HH2A 2M7VA 4NXEA 3P7NA 3H82A 2KLIA 3GDIA 3LI8A 4MN7A 1W63Q 3MFXA 2WKPA 5HWTA 2W27A 5J3WA 1DP6A 4GHIA 4LRXC 3CLOA 3C30A 3R7WA 4WF0A 1G28A 4PHTA 4L9EA 4BJPA 3FPVA 4PKYG 1MKMA 2INWA 3K3DA 3RTYA 5MC7A 3T4OA 3P01A 3OBFA 2Y79A 4ETXA 1VHMA 4HIAA 3U2AA 1F98A 2R78A 3CI6A 5F69A 4EERA 2D02A 2ZOIA 3H82B 5TBMB 2A24B 3G6OA 3T4QA 1N9OA 2B02A 3EGXC 1H8MA 1F9IA 3LICA 4HOIA 2KOIA 1OTIA 4P6ZM 4ARZA 4O01A 2W1TA 3NOTC 4Q0JA 3VE3A 3R4KA 4CQHA 4I5SA 3LUQA 2LB9A 3T4TA 5DF9A 3EQUA 4IHQA 3A0VA 3BQAA 3C38A 2J3WA 4PKYA 4HJ4A 2W3HA 3F1NA 3LIBA 3LR5A 2ZMFA 1OTDA 2V0UA 2W3GA 3TJZC 4AFIA 4WN5A 2M7UA 1NLYA 2QHKA 2DMWA 1LSWA 2VGLM 4G3WA 4YWZA 3MR0A 4WELA 2XRNA 3RFBA 4Y5FA 4G3KA 5J7EA 3UB7A 2VJWA 2MJ6A 3F1OA 1DP9A 2PD7A 3KYZA 4R6LA 1S1YA 3H9WA 3UB9A 3UB8A 3K3CA 3KYQA 2PR6A 1XJ4A 2PR5A 3F1PB 4HNBA 3PBTA 3D3OA 2HJ9C 1P97A 2D01A 2VV6A 3E98A 2GZAA 3LIAA 1WA9A 2K31A 3B33A 4I3IA 3NJAA 3CITA 3LIFA 5DKKA 4LPZA 1DP8A 3PR6A 2A2LA 2PT7A 2GNXA 1H3QA 4LLOB 3D72A 3LIDA 4BBVA 3MF0A 3T4LA 3NOUC 2ZBBA 1XFQA 1T19A 2J3TC 3RH8B 4Z1WA 4DMZA 3OOVA 4O0PA 2Z6DA 4MCWA 5G4ZA 2L1MA 4MN6A 3T4SA 1GSVA 3EGDC 2YKFA 3HCYA 3PXPA 3PBQA 3JVUA 5IU1A 4FOFA 4E04A 1D7EA 4II7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A2L A;  5CX7 A;  4CLC E;  4CLC D;  4CLC A;  4NKP A;  4CLC B;  4BMW A;  3FPV A;  3FPW A;  4CLC C; 
#chains in the Genus database with same CATH topology
 3MZF A;  1YT4 A;  1BSG A;  5EFW A;  3UB6 A;  4Z9Q A;  3IHB A;  4K0X A;  2V8F A;  1ONH A;  4BLM A;  4ME4 A;  4QHC A;  4GHI B;  3MKE A;  3BEC A;  3JPU A;  4Y2F A;  1V9Y A;  4PMA A;  4LGW A;  3E4Q A;  3IQA A;  4C6Y A;  3D9Y A;  1S4R A;  3I7J A;  3LI9 A;  4OH0 A;  1ES4 A;  4Y0U A;  2PDR A;  4MBK A;  1ES5 A;  1YMS A;  1XKZ A;  4PM5 A;  5CXW A;  1MC0 A;  1K57 A;  3S7O A;  4KQR A;  4WEK A;  2WGW A;  4EUV A;  4JGO A;  1AWI A;  4I38 A;  2OWJ A;  2VZW A;  4H8R A;  5EVI B;  3IBJ A;  4KZ5 A;  4L0L A;  1SHV A;  1IKI A;  3VP3 A;  3K2N A;  2LB5 A;  3MXQ A;  5L09 A;  3LFV A;  4HJ3 A;  2W3E A;  2BG1 A;  2WKQ A;  4NXB A;  3S7Q A;  1FCO A;  2P04 A;  5FQQ A;  5HSQ A;  1YLP A;  1JWV A;  3ZNY A;  5DFY A;  1K57 C;  5TGF A;  5HPI A;  1BTL A;  3CZD A;  5FSR A;  5HZH A;  5AVF A;  2O99 A;  5FI7 A;  2L4R A;  1XJ6 A;  2EX6 A;  4MBH A;  1NY0 A;  1K4E A;  3FG8 A;  2KDK A;  4KZB A;  1FIK A;  3BW6 A;  3IXD A;  3MQO A;  2OWH A;  1W8Q A;  1OTA A;  3A0S A;  3E2L A;  2Y4A A;  4JF5 A;  3AGD A;  2VEA A;  5L10 A;  1ES3 A;  1BLP A;  2RL3 A;  2M1C A;  1N9N A;  1IFQ A;  3LR4 A;  1Q2P A;  4GCZ A;  4KUO A;  3MQQ A;  4HEF A;  3UE6 A;  3A3F A;  4X25 A;  2JKT M;  3VOZ A;  1GSW A;  1K54 C;  4WZ5 A;  3VP2 A;  3IH8 A;  3OCN A;  3HJK A;  5A92 A;  3N4I A;  5HPF A;  3DTM A;  1XX2 A;  2EXB A;  4GD6 A;  1K0K A;  3SH9 A;  1OJG A;  2JBF A;  4Y7P A;  3MXR A;  2HP6 A;  5I94 A;  4C3Q A;  4S2J A;  4LFU A;  3CUE C;  4EU0 A;  1PNE A;  3T1S A;  2H0T A;  3IT9 A;  5U47 A;  4HES A;  4HH3 A;  4BD0 A;  2DRW A;  4EBN A;  4ARZ B;  1RP5 A;  4I39 A;  3UPP A;  3GV9 A;  5FAQ A;  4IJG A;  4RVA A;  4FSF A;  5GL9 A;  4PM9 A;  1K54 A;  3Q82 A;  4WZ5 C;  3VFH A;  3TOI A;  2P9V B;  4IVK A;  1NYY A;  3LY3 A;  1OT9 A;  4R3A A;  3OZH A;  5F5Y A;  3T50 A;  3IX8 A;  4MLL A;  1YLZ A;  1V9Z A;  2XA7 M;  1L2S A;  1K6R A;  1IYP A;  4YNR A;  3VOY A;  1BT5 A;  3JYI A;  2ZMA A;  2JKG A;  2XGN A;  2VK3 A;  3ZYT A;  5EEC A;  3BQ8 A;  4O8G A;  4X53 A;  5CTM A;  3IF5 A;  1F5M A;  4A5R A;  3MMH A;  4BBU A;  3O88 A;  4MBF A;  2R9W A;  1XP4 A;  1K4F A;  4Q0H A;  3WS0 A;  1PIO A;  5D3O A;  3VMA A;  3NBL A;  1E4D A;  2A3U A;  3BRM A;  1M40 A;  4S2N A;  1PI5 A;  2QWS A;  1G5U A;  4X69 A;  4DE3 A;  1T1A A;  3QP4 A;  2W0N A;  4HH2 A;  2R9X A;  2M7V A;  4NXE A;  3P7N A;  5EE8 A;  4X6T A;  2KLI A;  4N92 A;  3LI8 A;  1W5D A;  1Y54 A;  1ALQ A;  5HWT A;  4QD4 A;  5J3W A;  4OQ0 A;  4GHI A;  3WS5 A;  3CLO A;  4JXG A;  3B3X A;  4WF0 A;  4FTX A;  1ZG4 A;  4BJP A;  4JKT A;  2HZ5 A;  3V50 A;  4ID4 A;  1MKM A;  3IX4 A;  1EWZ A;  3QP6 A;  3RTY A;  3OBF A;  5FAT A;  1VHM A;  4YIN A;  2WGI A;  3BM6 A;  2EXA A;  4R4S A;  5CED A;  2ZD8 A;  2WZZ A;  4GD8 A;  5F69 A;  2D02 A;  5TFQ A;  5TBM B;  2A24 B;  3T4Q A;  3EGX C;  4XXR A;  1H8M A;  1OTI A;  4P6Z M;  4ARZ A;  4Q0J A;  2WAD A;  1EI5 A;  3VE3 A;  5HAP A;  4ZDX A;  1ZKJ A;  4MEZ A;  3LUQ A;  2FFF B;  5L2F A;  5DF9 A;  3O86 A;  4OPR A;  3EQU A;  1LL9 A;  4IHQ A;  3BQA A;  3C38 A;  1LLB A;  2J3W A;  4EQI A;  1H5X A;  5EOE A;  4UA7 A;  4YFM A;  1SKO B;  2QHK A;  1ZG6 A;  4YWZ A;  3BLM A;  3N8S A;  4WEL A;  1MY8 A;  2XRN A;  3UPO A;  3ZFZ A;  3F1O A;  1S1Y A;  3UB9 A;  3K3C A;  4U3T A;  3NDG A;  4HNB A;  3D3O A;  2HJ9 C;  3HLE A;  1P97 A;  2D01 A;  3LIA A;  5JYO A;  3NIA A;  5F1F A;  1CF0 A;  1H3Q A;  4E3O A;  4X55 A;  4BBV A;  1D1J A;  3T4L A;  3SZT A;  2J3T C;  4R23 A;  2XLN A;  3SOI A;  1ZC2 A;  1HVB A;  1HLU P;  4MCW A;  4NG2 A;  4X1L A;  3QP8 A;  3GTC A;  4M3K A;  1L0G A;  4II7 A;  5DVA A;  2Y2Q A;  1JWZ A;  1KE4 A;  5EVI C;  3G30 A;  2IWD A;  4JGR A;  4OOM A;  4K0W A;  3CAX A;  5G4Y A;  3G35 A;  2XSS A;  4UQI M;  1OPX A;  4H6J A;  2V8C A;  2YKH A;  4CLC C;  2PYR A;  4OKP A;  1JNU A;  3S22 A;  4L9G A;  2EWV A;  3H7W A;  2XD5 A;  4FUW A;  1LL8 A;  2O9C A;  3UE3 A;  1GHP A;  5M19 A;  1YPR A;  3AGE A;  4GDN A;  2Z2M B;  2G2U A;  4BMW A;  1UWN X;  5E2F A;  1PRQ A;  4ZBE A;  5DF8 A;  4JGP A;  3GRJ A;  5GHZ A;  4UA6 A;  3MKF A;  4XT2 B;  4GW9 A;  3KO6 A;  4P6Z S;  3LEZ A;  2HF6 A;  1TEM A;  2WKE A;  4HBT A;  3TSG A;  2Q9M A;  3ZG0 A;  3UME A;  1DJA A;  3GVB A;  3ZG7 B;  1RGZ A;  2FH5 A;  3PAG A;  5F68 A;  4N9K A;  5DJU A;  5J8X A;  4HI4 A;  1Z09 A;  1DRM A;  4P6B A;  4EV4 A;  2P08 A;  3QP2 A;  4X1M A;  2E8J A;  5HAI A;  4N1X A;  4CPK A;  5HD3 A;  2PU2 A;  4IED A;  4OOY A;  1JTD A;  3L9K A;  3RXX A;  1NYM A;  1PYY A;  3Q1F A;  4HP4 A;  3T1X A;  3GR2 A;  4KEN B;  4ESP A;  1N9L A;  1BLS A;  2V1A A;  1S66 L;  4CLC A;  2JC7 A;  3GMW A;  4K08 A;  3HJI A;  4WL9 A;  2PHY A;  3DWZ A;  3C8C A;  4BL2 A;  3EEH A;  1DJB A;  1MBL A;  1I2W A;  5CEB A;  3NC8 A;  1W63 M;  3C7V A;  2V1Z A;  1LI9 A;  4F3L B;  3ZQ5 A;  1YSP A;  1NRJ A;  1ONG A;  3CJM A;  4Q0I A;  5IT5 A;  1TF1 A;  3HLD A;  3Q7Z A;  1JTG A;  2XR0 A;  3WS2 A;  3LR0 A;  2EX8 A;  1P0Z A;  2GJ3 A;  4ETZ A;  3QNC A;  1TS7 A;  2OAQ 1;  5AJG A;  1XGJ A;  3OC2 A;  2XFS A;  3ICY A;  4DJ3 A;  1PWC A;  1NRF A;  4LRY C;  4NET A;  5FI6 A;  4GB7 A;  1FCN A;  4XT2 A;  3RXW A;  5E2G A;  1YAX A;  3FPW A;  2PD8 A;  2QJ7 A;  1PW1 A;  1A0K A;  2VV8 A;  2VX8 A;  1UWP X;  1GCE A;  4QB8 A;  5FQ9 A;  3OCL A;  2VLG A;  1H0M A;  1L0D A;  1S6R A;  2QKP A;  1LSV A;  2V20 A;  1CEG A;  1I2S A;  3BY9 A;  2J8Y A;  4DF6 A;  3NHQ A;  1BUL A;  1YLJ A;  4ZTK A;  4EUZ A;  3E4O A;  4KQD A;  4OQG A;  5EUA A;  2XFT A;  3N8R A;  1OME A;  4GN2 A;  2JN7 A;  4GS9 A;  2H5S A;  1T1B A;  4O7D A;  5GLD A;  4Q8I A;  2HV1 A;  5A93 A;  5AQ7 A;  4OP5 A;  3ZG8 B;  3OLO A;  2EA9 A;  4I3J A;  1ACF A;  4JBF A;  4ZAM A;  5CGW A;  2GDN A;  2HDU A;  5HDC A;  1IYO A;  4QU3 A;  5GHX A;  3T1R A;  5HWW A;  3PYP A;  5TR7 A;  1JVJ A;  2G7U A;  3UDI A;  3VP4 A;  3IWO A;  3KYE A;  2VGJ A;  2UV0 E;  3DW0 A;  3PBN A;  2ZMV A;  2EWW A;  3CUE A;  4S2I A;  4LV2 A;  4B88 A;  1I5Q A;  5HAQ A;  2H10 A;  1Y4O A;  3GEC A;  3JVV A;  4L9F A;  2HPB A;  2K7S A;  2VGL S;  4MN5 A;  3ZGA B;  3LCE A;  4E3J A;  2ZOH A;  4U0T A;  4MMN A;  2Y91 A;  2FZ0 A;  5HL1 A;  3HVF A;  1N4O A;  2OSU A;  4KZ9 A;  3H82 A;  4E3M A;  2C5W B;  3MFX A;  2WKP A;  3WRT A;  4LRX C;  1YM1 A;  5CHU A;  4PHT A;  4L9E A;  5MC7 A;  2Y79 A;  4ETX A;  3VSL A;  2WK0 A;  2WKI A;  2WUQ A;  1ERM A;  1F98 A;  4XUX A;  1PW8 A;  2R78 A;  5M18 A;  4EER A;  5CHJ A;  3H82 B;  1K56 D;  2WZX A;  3LIC A;  3VFF A;  3ZHH A;  2KOI A;  4IVI A;  2V2F F;  4WMC D;  1GHM A;  2LB9 A;  1VEU B;  3IF6 C;  4R3B A;  4D60 A;  2WKH A;  2XQZ A;  3IWI A;  1LL5 A;  3A3J A;  3IXG A;  3CPT A;  3IXH A;  1MWR A;  3QP5 A;  5FDH A;  3LIB A;  2ZMF A;  4NK3 A;  1OTD A;  1M6K A;  2V0U A;  1Z6F A;  3TJZ C;  1NLY A;  2ZM0 A;  5GLA A;  3S1Y A;  2VGL M;  3V3S A;  2H0Y A;  4JXV A;  3G2Y A;  3RFB A;  3VP1 A;  4G3K A;  2Y59 A;  4R1G A;  1FCM A;  3FKV A;  3HUN A;  3CG5 A;  4EBP A;  3OPL A;  2ZQD A;  4ZJ1 A;  4JLF A;  2PR6 A;  2PR5 A;  2VV6 A;  3E98 A;  2GZA A;  1WA9 A;  2XEP A;  1HZO A;  2K31 A;  1FQG A;  3CIT A;  3NJA A;  4LV1 A;  3MZD A;  3IXB A;  2A2L A;  2PT7 A;  4Y0T A;  4WMC A;  4U0X A;  3D4F A;  4LLO B;  3D72 A;  4GNU A;  1NZU A;  2EFU A;  1ERQ A;  3HUM A;  2C6W B;  3P09 A;  5EV0 A;  2OV5 A;  4OPY A;  4MN6 A;  5FQI A;  3C4P A;  2ZQ7 A;  4OVD A;  4DXC A;  1KE0 A;  5IU1 A;  1VQQ A;  3CHW P;  1TDL A;  1O7E A;  4QJG A;  2Y2P A;  2Y2N A;  3CPT B;  1TS0 A;  3T4J A;  1T18 A;  1MWT A;  1XXM A;  3PBR A;  5FA7 A;  1H8Z A;  2JHE A;  3M6B A;  1KVL A;  3VP0 A;  3HLG A;  3UMD A;  4R4R A;  3BY8 A;  4Y15 A;  5CGS A;  5A8B A;  4WM9 A;  3SW1 A;  1OTB A;  4IUH A;  2Y2K A;  4OQI A;  4EQ1 A;  1FR1 A;  3O87 A;  1RGY A;  1ZHH B;  3E0Y A;  3FC7 A;  4E3I A;  4KZA A;  3QHY A;  1SKO A;  4OQH A;  5HD5 A;  2V0W A;  1CEF A;  1K55 A;  1P9R A;  2DCF A;  1YSQ A;  1IYS A;  1O07 A;  1K6S A;  1K38 A;  1RCJ A;  4I3A A;  4FH4 A;  3QP1 A;  5GLC A;  2O9B A;  3MXS A;  1PZP A;  4KZ7 A;  2VA0 A;  4S2K A;  2V1B A;  2UWX A;  3TE8 A;  1TD5 A;  4EET B;  2A49 A;  4FH2 A;  3PBS A;  1WYB A;  1E25 A;  2ACG A;  1PWG A;  4EW7 A;  1MKI A;  2DNS A;  4S2M A;  2OOL A;  4QY5 A;  2HP9 A;  1F2K A;  5EM1 A;  5HW3 A;  5G18 A;  4GDB A;  5EVL A;  5J4E A;  3IF6 A;  5FAO A;  2Y2J A;  4KQO A;  2ZQC A;  3ZDJ A;  4NXG A;  1OTE A;  1MPL A;  5GLB A;  4B9O A;  2PYP A;  2OAP 1;  3Q7V A;  4B4X A;  4HHD A;  1L0F A;  1DY6 A;  3HLW A;  5DKL A;  4E3K A;  3KSG A;  3EEA A;  3UE1 A;  4S2N C;  3PBO A;  3EQV A;  3BFC A;  3SS5 A;  2P7J A;  4RYE A;  1Y28 A;  1K55 C;  2Q0O A;  1K56 A;  3BFG A;  4UAA A;  2KX6 A;  4JGQ A;  4N9L A;  2WGW B;  1ZTU A;  2W3D A;  3ZVT A;  2Y8H A;  3UO9 A;  1YKD A;  1D06 A;  1MZU A;  3S7N A;  4E6X A;  1OJ5 A;  2J9P A;  5F6A A;  1IOU A;  1NJ4 A;  3UB5 P;  5DTS A;  2QMI A;  1KOU A;  4GKU A;  3OPR A;  3NUL A;  1BYW A;  3F1P A;  2BAS A;  2O9A A;  1W7F A;  2RCX A;  4GJ4 A;  5CTN A;  5AVE A;  3TW8 A;  2QJ5 A;  3W2Z A;  4NXF A;  3RJU A;  1IEL A;  1WE4 A;  4S2O A;  4DDY A;  4DE0 A;  3TRC A;  5DFX A;  3NDE A;  3G34 A;  5CGX A;  4H6J B;  1XFN A;  3QNB A;  4JF4 A;  2P74 A;  4IBX A;  4Y17 A;  3ZNT A;  4Y0O A;  1IEM A;  2BTF P;  4CLC D;  2NUP C;  2ZQA A;  3NI9 A;  3A3D A;  2ZLY A;  5CHM A;  1CQA A;  4EES A;  5M1A A;  5KSH A;  5HWV A;  4DDS A;  5FEG A;  3ITA A;  3WS1 A;  5FDS A;  2JE5 A;  4DJ2 A;  4EBL A;  3FV7 A;  1CI8 A;  1OT6 A;  5EOO A;  2Y2O A;  3T12 B;  5L8M A;  2VKS A;  1XJ3 A;  3BEB A;  1GSX A;  4DRT A;  1UGU A;  5CX7 A;  5KZH A;  3TG9 A;  1ERO A;  4DE1 A;  4LRZ E;  3BJN A;  1IYQ A;  3SS4 A;  1P9W A;  4BBT A;  2GX5 A;  3IS2 B;  4RX2 A;  2A24 A;  2OLU A;  3B42 A;  2ZJ9 A;  1FSY A;  1CJF A;  3A3E A;  4BEN A;  1G6O A;  3B47 A;  5FQJ A;  4D2O A;  2ZL1 A;  5BOH A;  1XA7 A;  1AXB A;  3DTE A;  3V3R A;  4PM6 A;  3LIE A;  2NUT C;  2FFY A;  2ZC3 B;  3KSF A;  4Y3I A;  4B93 A;  2Y2G A;  4EEP A;  3C2W A;  4OPQ A;  2X71 A;  2PU4 A;  3IS2 A;  2ZC5 B;  1J9M A;  4LV0 A;  1LHY A;  3GDI A;  3V39 A;  4MN7 A;  1GA9 A;  1CI9 A;  3R7W A;  4K91 A;  5FAS A;  4R0Q A;  3GQZ A;  1W8Y A;  4PKY G;  4E3L A;  1SDE A;  4FD8 A;  2X01 A;  3K3D A;  3UDX A;  4P87 A;  3P01 A;  4R3J A;  2Y2M A;  5EVI A;  4OPZ A;  1HTZ A;  3NY4 A;  3U4L P;  2XK1 A;  1LI0 A;  1QMF A;  5A91 A;  2ZOI A;  4P85 A;  1VM1 A;  2B02 A;  1F9I A;  4LCM A;  1G68 A;  1YQS A;  3N8L A;  4LEN A;  4O01 A;  3SH7 A;  3NOT C;  1BLH A;  4KG6 A;  3R4K A;  1ESI A;  4I5S A;  4UHU A;  3Q07 A;  3T1Q B;  5E2E A;  3G2Z A;  1SZV A;  1MWU A;  2W3H A;  3LR5 A;  2W3G A;  4WN5 A;  3LEQ A;  1LSW A;  3N7W A;  1DJC A;  4GOG A;  3WS4 A;  3C4O A;  4Y5F A;  5J7E A;  3UB7 A;  2VJW A;  3FYZ A;  3MS6 A;  3KYZ A;  4R6L A;  3W8K A;  3UB8 A;  2IWC A;  4N1H A;  2EX9 A;  1XJ4 A;  4EWF A;  3PBT A;  3MFD A;  4S2P A;  1XPB A;  4I3I A;  1PI4 A;  3LIF A;  5DKK A;  4OON A;  1DP8 A;  3PR6 A;  3M2K A;  1KDS A;  3FKW A;  3V5M A;  4P0M A;  1YMX A;  2ZBB A;  1G6A A;  1T19 A;  3RH8 B;  3WWX A;  1VET B;  3M2J A;  3UN7 A;  1MWS A;  2L1M A;  3T4S A;  4E3N A;  3EGD C;  1XGI A;  2YKF A;  3HCY A;  3PXP A;  3PBQ A;  4E04 A;  2JKT I;  5JYP A;  4DKI A;  5FI2 A;  3HUO A;  3BWL A;  2W1T B;  5TBM A;  3DWK A;  4IBR A;  5DF7 A;  4LV3 A;  3HLF A;  3ISG A;  2Q9N A;  1GA0 A;  2HP5 A;  3DBA A;  5FAP A;  5FQM A;  1YLY A;  2W1R A;  4ZRR A;  2IA2 A;  4OOL A;  4UQI S;  2XA7 S;  5KIZ A;  2H28 A;  2ZQ8 A;  1WYC A;  2Z2L B;  5K5B A;  1KGE A;  1S67 L;  3OPH A;  3S7P A;  5FL3 A;  2J9O A;  3MSH A;  4DXB A;  4JF6 A;  4QPR A;  1E3U D;  3PHY A;  5F83 A;  5TJJ A;  3O3V A;  1T1C A;  5HL6 A;  3VV4 A;  1NXY A;  2ZM8 A;  4QWO A;  5EM0 A;  3ULF A;  3F1O B;  4DE2 A;  5EVI D;  3W4Q A;  4WZ4 A;  5HDD A;  4G3V A;  5EVE A;  5HFO A;  4KZ4 A;  4F3L A;  5HDS A;  4R38 A;  5F82 A;  5F1G A;  2J7V A;  3Q81 A;  1U60 A;  4JXW A;  4IUK A;  2HDS A;  5DTK A;  3R7W B;  2J3T D;  1SDN A;  2HGV A;  1QME A;  4EXO A;  4PM8 A;  2J80 A;  4MDZ A;  3E2K A;  4WLA A;  3KX0 X;  5IHV A;  2JKR M;  1LT0 A;  2HDR A;  3O5Y A;  1TS8 A;  3G4P A;  2XDM A;  4PPR A;  3IBR A;  1NWZ A;  4WYY A;  4NEE D;  1K25 A;  2O0Y A;  3MZE A;  3F1N B;  4HJ6 A;  1EW0 A;  3KSI A;  4BQM A;  1LSX A;  2WAE A;  3AGF A;  3IWQ A;  1BUE A;  3SS3 A;  2WYX A;  4WEJ A;  5EPH A;  2WKR A;  1SCW A;  4XUZ A;  3MBZ A;  1S1Z A;  3VOL A;  3C7U A;  1YLW A;  4PAU A;  2ZL1 B;  4YOF A;  2X02 A;  3HL9 A;  5I5L A;  5KMW A;  4HP9 A;  4KZ3 A;  1KGF A;  3CWF A;  4RQ9 A;  2Y2I A;  3C5A A;  3FWL A;  3H7W B;  1FOF A;  1NZO A;  1FIL A;  2L0W A;  3S4X A;  2B5R A;  4KG2 A;  3T4K A;  4DN0 A;  1BZA A;  3NCK A;  3LYX A;  4KUK A;  2K2N A;  2CMN A;  3BLS A;  3E4P A;  1TS6 A;  2B18 A;  2PRF A;  3LGO A;  5E2H A;  3M6H A;  2QYB A;  3MQ0 A;  1VB6 A;  4JXS A;  3BFE A;  3A3I A;  3CMZ A;  3HLB A;  2ZQ9 A;  2IWB A;  4R70 A;  1KVM A;  2Z6C A;  3BFD A;  3KSH A;  4FCF A;  4JPM A;  3GSG A;  4KZ8 A;  4CLC B;  4HQA A;  2PBY A;  3NEC A;  1TDG A;  5FEF A;  1STZ A;  1L3L A;  3V67 A;  1NLZ A;  4KZ6 A;  1L0E A;  3NOP C;  3VE4 A;  2ZM2 A;  4KQQ A;  3PAE A;  3HBR A;  2VV7 A;  5IS1 A;  4EEU A;  4ZJ3 A;  5AQA A;  4M4X A;  4GZB A;  1SKF A;  1ODV A;  2W3F A;  2XRO A;  3MJQ A;  3IHA A;  1PWD A;  3SH8 A;  2JKR I;  4GLQ A;  2Y2H A;  4OLG A;  1S4S A;  1J3W A;  4C75 A;  4OLD A;  1FR6 A;  4HY8 A;  3UNW A;  2AVX A;  2XH9 A;  5A90 A;  2ZC7 A;  3EWK A;  3W4O A;  3IX3 A;  5DJT A;  3ZCZ A;  4LCL A;  2HJE A;  1PZO A;  5HAR A;  2PAV P;  1VEU A;  4UEY A;  4E6W A;  1X0O A;  4BWI A;  2B95 A;  2G2W A;  5AQB A;  2VGK A;  4B4Z A;  4MNR A;  2I9V A;  4GS9 B;  3UY6 A;  3W4P A;  4RX3 A;  3ZG9 B;  3EOI A;  3A0R A;  2JCH A;  1C3B A;  4S2L A;  1XJ2 A;  2V9A A;  5C5K A;  1KDW A;  3UDF A;  2XD1 A;  1ESU A;  4WUJ A;  2PBD P;  3HLC A;  3BYD A;  4CLC E;  2OLV A;  2I72 A;  5LBR A;  1HD8 A;  1KE3 A;  3LR3 A;  4NKP A;  1JWP A;  4HBU A;  4ZJ2 A;  5DTT A;  1W63 Q;  1FSW A;  2W27 A;  3DTI A;  1H8Y A;  4BL3 A;  2WGV A;  1DP6 A;  3P98 A;  3ITB A;  3C30 A;  2HDQ A;  1G28 A;  3IF6 B;  3FPV A;  3LY4 A;  1YLT A;  2QZ6 A;  1W79 A;  2INW A;  1ES2 A;  3T4O A;  1N9B A;  3FZC A;  4HIA A;  3U2A A;  3WRZ A;  1MXO A;  3ZG5 A;  5CRF A;  1Q2Q A;  4BD1 A;  2XF3 A;  3CI6 A;  2Y2L A;  3ZVW A;  3N6I A;  3G6O A;  1N9O A;  4HOI A;  2BLS A;  4Y13 A;  3PTE A;  3OPP A;  2W1T A;  1IKG A;  4CQH A;  1KGG A;  1XA1 A;  1GHI A;  3T4T A;  4X68 A;  5CER A;  5AQ9 A;  3A0V A;  5E43 A;  4PKY A;  2JKF A;  4HJ4 A;  3F1N A;  4PM7 A;  4AFI A;  2M7U A;  3L7H A;  2DMW A;  4KG5 A;  5GHY A;  4G3W A;  1PFL A;  5L07 A;  3VSK A;  3MR0 A;  3UPN A;  4WBG A;  4OP8 A;  2MJ6 A;  1DP9 A;  1E3U A;  1BLC A;  2PD7 A;  3H9W A;  2EX2 A;  3LO7 A;  3KYQ A;  3UE0 A;  3F1P B;  3BFF A;  5HX9 A;  2ZC6 B;  4CJN A;  3IH9 A;  3B33 A;  5KSC A;  3DTK A;  4LPZ A;  2ZC4 B;  4UA9 A;  2GNX A;  5FQK A;  2Y55 A;  3G32 A;  2P9V A;  3LID A;  4RA7 A;  3MF0 A;  3HRE A;  4X56 A;  3DAV A;  3NOU C;  2WAF A;  1XFQ A;  1VET A;  4F94 A;  4Z1W A;  1CK3 A;  2E8I A;  3Q7V B;  4DMZ A;  5CEC A;  3OOV A;  4O0P A;  3G31 A;  2Z6D A;  5G4Z A;  2EFX A;  1GSV A;  2QPN A;  3JVU A;  1S0W A;  4FOF A;  1D7E A;  4QY6 A;  2CC1 A;  1TVF A; 
#chains in the Genus database with same CATH homology
 2JKT I;  1TS0 A;  3T4J A;  4JGR A;  1T18 A;  4OOM A;  5EFW A;  3PBR A;  3UB6 A;  3CAX A;  5G4Y A;  2JHE A;  2XSS A;  4UQI M;  1OPX A;  3BWL A;  2W1T B;  4H6J A;  5TBM A;  4ME4 A;  3UMD A;  4GHI B;  2YKH A;  3BY8 A;  5A8B A;  4CLC C;  3SW1 A;  3DBA A;  4Y2F A;  2PYR A;  2W1R A;  1JNU A;  4L9G A;  4ZRR A;  2IA2 A;  2EWV A;  3H7W A;  4OOL A;  4UQI S;  1LL8 A;  2O9C A;  1OTB A;  4IUH A;  1V9Y A;  2XA7 S;  4EQ1 A;  3UE3 A;  1ZHH B;  3E0Y A;  3E4Q A;  5KIZ A;  2H28 A;  3FC7 A;  1S4R A;  5HD5 A;  2V0W A;  5K5B A;  1P9R A;  3LI9 A;  4BMW A;  1S67 L;  1YSQ A;  1UWN X;  2PDR A;  3S7P A;  5FL3 A;  4I3A A;  4QPR A;  3PHY A;  4JGP A;  5TJJ A;  2O9B A;  1T1C A;  4XT2 B;  1MC0 A;  5HL6 A;  4GW9 A;  2VA0 A;  3KO6 A;  4P6Z S;  3VV4 A;  3S7O A;  2V1B A;  2HF6 A;  3ULF A;  3F1O B;  4WEK A;  5HDD A;  3TE8 A;  4EUV A;  4G3V A;  3UME A;  4JGO A;  1TD5 A;  4EET B;  4I38 A;  2OWJ A;  2FH5 A;  2VZW A;  3PBS A;  5HDS A;  4F3L A;  4R38 A;  5F68 A;  4EW7 A;  3IBJ A;  5DJU A;  4IUK A;  4L0L A;  4HI4 A;  2OOL A;  3R7W B;  2J3T D;  1DRM A;  2HGV A;  2P08 A;  4EXO A;  2J80 A;  3K2N A;  4MDZ A;  2LB5 A;  5J4E A;  4WLA A;  3KX0 X;  3MXQ A;  4KQO A;  2JKR M;  5HD3 A;  3LFV A;  4HJ3 A;  4NXG A;  1LT0 A;  1OTE A;  3O5Y A;  2W3E A;  2WKQ A;  4B9O A;  2PYP A;  2OAP 1;  1TS8 A;  4NXB A;  3S7Q A;  4HP4 A;  3IBR A;  4HHD A;  1NWZ A;  2P04 A;  4NEE D;  5HSQ A;  1N9L A;  2O0Y A;  3F1N B;  4CLC A;  2V1A A;  1S66 L;  5DFY A;  5DKL A;  5HPI A;  3KSG A;  4K08 A;  3HJI A;  4WL9 A;  4HJ6 A;  3EEA A;  2PHY A;  1EW0 A;  5HZH A;  3KSI A;  5AVF A;  2O99 A;  3C8C A;  1LSX A;  2L4R A;  3EEH A;  3PBO A;  1XJ6 A;  4WEJ A;  2WKR A;  3EQV A;  2P7J A;  1S1Z A;  3VOL A;  4PAU A;  4YOF A;  1Y28 A;  5I5L A;  1W63 M;  3FG8 A;  2KDK A;  4HP9 A;  3BW6 A;  3CWF A;  4RQ9 A;  2KX6 A;  3MQO A;  2OWH A;  4JGQ A;  4F3L B;  1OTA A;  3A0S A;  3H7W B;  3ZQ5 A;  1YSP A;  1NRJ A;  1ZTU A;  4Q0I A;  5IT5 A;  2L0W A;  1TF1 A;  2W3D A;  3T4K A;  4DN0 A;  2VEA A;  2Y8H A;  3LR0 A;  2M1C A;  1YKD A;  1D06 A;  3LYX A;  4KUK A;  2K2N A;  2CMN A;  1MZU A;  1N9N A;  3S7N A;  3E4P A;  1TS6 A;  2B18 A;  1P0Z A;  2GJ3 A;  1OJ5 A;  1IFQ A;  3LR4 A;  5F6A A;  4ETZ A;  1TS7 A;  2QYB A;  3MQ0 A;  1IOU A;  2OAQ 1;  4GCZ A;  4KUO A;  1VB6 A;  5AJG A;  3OC2 A;  3MQQ A;  3ICY A;  1KOU A;  4DJ3 A;  3UE6 A;  4LRY C;  4R70 A;  1BYW A;  2Z6C A;  2JKT M;  3F1P A;  2BAS A;  3KSH A;  1GSW A;  2O9A A;  4GJ4 A;  5AVE A;  4XT2 A;  4CLC B;  1YAX A;  3FPW A;  4HQA A;  3TW8 A;  2PD8 A;  2QJ7 A;  2QJ5 A;  3OCN A;  3HJK A;  3W2Z A;  2VV8 A;  4NXF A;  2VX8 A;  1UWP X;  3TRC A;  5HPF A;  5DFX A;  3OCL A;  1STZ A;  3V67 A;  1NLZ A;  2VLG A;  4H6J B;  3NOP C;  1XFN A;  1LSV A;  2QKP A;  3VE4 A;  3BY9 A;  1OJG A;  2VV7 A;  5IS1 A;  4EEU A;  3NHQ A;  4M4X A;  3E4O A;  2W3F A;  1ODV A;  4KQD A;  2XRO A;  4CLC D;  2NUP C;  3MJQ A;  3CUE C;  4EU0 A;  2JKR I;  4GLQ A;  1S4S A;  2JN7 A;  4HH3 A;  4GS9 A;  4EES A;  4ARZ B;  1T1B A;  4I39 A;  5KSH A;  4IJG A;  4HY8 A;  2HV1 A;  4FSF A;  5HWV A;  3EWK A;  3OLO A;  4DJ2 A;  2EA9 A;  5DJT A;  1OT9 A;  4R3A A;  4I3J A;  2HJE A;  1OT6 A;  5F5Y A;  5L8M A;  2VKS A;  5HDC A;  4UEY A;  3T50 A;  1XJ3 A;  5HWW A;  1X0O A;  1GSX A;  3PYP A;  1V9Z A;  2XA7 M;  1UGU A;  4YNR A;  5CX7 A;  4BWI A;  4LRZ E;  3BJN A;  2G7U A;  1P9W A;  4BBT A;  2GX5 A;  3ZYT A;  2I9V A;  3IS2 B;  3PBN A;  2ZMV A;  4GS9 B;  3BQ8 A;  2A24 A;  2EWW A;  4O8G A;  3CUE A;  3B42 A;  1F5M A;  3MMH A;  4BBU A;  1G6O A;  3GEC A;  3B47 A;  4Q0H A;  3JVV A;  3EOI A;  3A0R A;  4L9F A;  2K7S A;  2VGL S;  4MN5 A;  1XJ2 A;  2V9A A;  5C5K A;  3LIE A;  2ZOH A;  2NUT C;  4MMN A;  3KSF A;  4WUJ A;  2FZ0 A;  4Y3I A;  2QWS A;  4B93 A;  4EEP A;  3C2W A;  4CLC E;  5LBR A;  1T1A A;  3LR3 A;  4NKP A;  2W0N A;  3IS2 A;  4HH2 A;  2M7V A;  4NXE A;  3P7N A;  3H82 A;  2KLI A;  3GDI A;  3LI8 A;  4MN7 A;  1W63 Q;  3MFX A;  2WKP A;  5HWT A;  2W27 A;  5J3W A;  1DP6 A;  4GHI A;  4LRX C;  3CLO A;  3C30 A;  3R7W A;  4WF0 A;  1G28 A;  4PHT A;  4L9E A;  4BJP A;  3FPV A;  4PKY G;  1MKM A;  2INW A;  3K3D A;  3RTY A;  5MC7 A;  3T4O A;  3P01 A;  3OBF A;  2Y79 A;  4ETX A;  1VHM A;  4HIA A;  3U2A A;  1F98 A;  2R78 A;  3CI6 A;  5F69 A;  4EER A;  2D02 A;  2ZOI A;  3H82 B;  5TBM B;  2A24 B;  3G6O A;  3T4Q A;  1N9O A;  2B02 A;  3EGX C;  1H8M A;  1F9I A;  3LIC A;  4HOI A;  2KOI A;  1OTI A;  4P6Z M;  4ARZ A;  4O01 A;  2W1T A;  3NOT C;  4Q0J A;  3VE3 A;  3R4K A;  4CQH A;  4I5S A;  3LUQ A;  2LB9 A;  3T4T A;  5DF9 A;  3EQU A;  4IHQ A;  3A0V A;  3BQA A;  3C38 A;  2J3W A;  4PKY A;  4HJ4 A;  2W3H A;  3F1N A;  3LIB A;  3LR5 A;  2ZMF A;  1OTD A;  2V0U A;  2W3G A;  3TJZ C;  4AFI A;  4WN5 A;  2M7U A;  1NLY A;  2QHK A;  2DMW A;  1LSW A;  2VGL M;  4G3W A;  4YWZ A;  3MR0 A;  4WEL A;  2XRN A;  3RFB A;  4Y5F A;  4G3K A;  5J7E A;  3UB7 A;  2VJW A;  2MJ6 A;  3F1O A;  1DP9 A;  2PD7 A;  3KYZ A;  4R6L A;  1S1Y A;  3H9W A;  3UB9 A;  3UB8 A;  3K3C A;  3KYQ A;  2PR6 A;  1XJ4 A;  2PR5 A;  3F1P B;  4HNB A;  3PBT A;  3D3O A;  2HJ9 C;  1P97 A;  2D01 A;  2VV6 A;  3E98 A;  2GZA A;  3LIA A;  1WA9 A;  2K31 A;  3B33 A;  4I3I A;  3NJA A;  3CIT A;  3LIF A;  5DKK A;  4LPZ A;  1DP8 A;  3PR6 A;  2A2L A;  2PT7 A;  2GNX A;  1H3Q A;  4LLO B;  3D72 A;  3LID A;  4BBV A;  3MF0 A;  3T4L A;  3NOU C;  2ZBB A;  1XFQ A;  1T19 A;  2J3T C;  3RH8 B;  4Z1W A;  4DMZ A;  3OOV A;  4O0P A;  2Z6D A;  4MCW A;  5G4Z A;  2L1M A;  4MN6 A;  3T4S A;  1GSV A;  3EGD C;  2YKF A;  3HCY A;  3PXP A;  3PBQ A;  3JVU A;  5IU1 A;  4FOF A;  4E04 A;  1D7E A;  4II7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...