4CLCB

Crystal structure of ybr137w protein
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
170
structure length
170
Chain Sequence
MVVLDKKLLERLTSRKVPLEELEDMEKKCFLSTFTYQDAFDLGTYIKNAVKENFPDKPVAIDISLPNGHCLFRTVTYGGSALDNDFWIQRKKKTALRFGHSSFYMGCKKGDKTPEEKFFVDSKEYAFHGGAVLIQSERSTYPYACLTISGLKQEEDHLMAVSSLIAFANE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of Ybr137Wp Implicate its Involvement in the Targeting of Tail-Anchored Proteins to Membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords UPF0303 PROTEIN YBR137W
total genus 46
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4clcB00
3FPWA 4CLCD 4CLCA 4CLCE 4NKPA 4CLCB 4BMWA 3FPVA 4CLCC 5CX7A 2A2LA
chains in the Genus database with same CATH superfamily
1SZVA 4NK3A 3T4SA 2PU2A 3LO7A 3JVVA 3GMWA 1MBLA 4EESA 2Y8HA 4RQ9A 1Z6FA 2BASA 5D3OA 4OPQA 2XGNA 3UE1A 3CMZA 5EVIC 1SHVA 4R70A 4NEED 2V1ZA 4L9EA 3G34A 3EOIA 3MQ0A 4DE2A 3QP5A 4KZ8A 1MWRA 3N8RA 2Y91A 2W3EA 1YT4A 1TS8A 1FCMA 1OTDA 1PWGA 4DXCA 5DJTA 1GSVA 2QWSA 2Y4AA 1NYYA 4L0LA 4LENA 4R3JA 2WKRA 1YLJA 1XJ2A 2B95A 3KX0X 2WUQA 4QPRA 4PAUA 5DFXA 1QMEA 1HTZA 3A3FA 3WS5A 3UPNA 2FH5A 1BLHA 3G31A 4E3IA 2VK3A 4OKPA 2ZM8A 3DWZA 4LRXC 1XFQA 2NUTC 3ZVTA 1Z09A 3E2LA 4DE0A 3T4TA 2XF3A 4E3OA 2WKHA 4PM8A 2QHKA 1KDWA 5GLCA 1P0ZA 1E25A 1EROA 4Y15A 3T4KA 2VX8A 3WRTA 3EEAA 5HD5A 5IHVA 2EXAA 3RJUA 3WRZA 3HLEA 4Z9QA 2O0YA 1HVBA 1XGIA 2A2LA 1SCWA 2W1RA 4FCFA 4MBFA 1Q2QA 4PKYA 1ALQA 3VFFA 5L2FA 2LB5A 3DTKA 3NOPC 2JKTI 4EUVA 1H8MA 5AVFA 1UWNX 1K56A 3CPTB 2FFYA 1JNUA 5G18A 3C7VA 3OPHA 3FPWA 3S7PA 4CQHA 4N92A 1D1JA 1FOFA 4YNRA 2XRNA 4JBFA 2HPBA 4GD6A 3KYEA 4GNUA 4GW9A 5CRFA 1IYOA 3MFXA 2V2FF 1H3QA 5A8BA 4DE3A 3DWKA 2I9VA 3GV9A 2Y2GA 5TFQA 2YKFA 2IWBA 3ZG8B 2E8JA 4RX2A 4MN6A 1SDEA 5HDDA 2XDMA 4MEZA 1N9NA 1DY6A 1SKFA 1TS6A 2WGWA 3E0YA 2WKPA 1G28A 2W27A 5FQJA 1YMXA 2K31A 2BLSA 4KG5A 4KUOA 4H8RA 4OQ0A 5L10A 4NXBA 2ZC7A 3V5MA 4CLCB 2VGLS 4ZJ3A 1O7EA 3BLSA 4JLFA 2Y2QA 5A93A 3HCYA 2R78A 3BEBA 3N4IA 1F9IA 2XD1A 4BD0A 2ZBBA 4WN5A 2JE5A 3LYXA 1N9OA 1PRQA 3C38A 2IWDA 5HW3A 3Q81A 3NIAA 3S1YA 2PD8A 3ZFZA 1E3UA 4WF0A 5IT5A 5E2HA 1BTLA 1W8YA 2Y2KA 2XA7M 3C4PA 4Y17A 5DTTA 2JKRI 2ZQCA 2NUPC 3Q82A 4KZ5A 2VKSA 2Y59A 1K25A 1DP9A 4DMZA 5DVAA 2DMWA 1T1BA 4G3KA 4XT2B 3LR0A 4I3JA 4JGQA 1NLZA 4EBNA 2PD7A 3RFBA 2EX8A 4DF6A 3V67A 4MBKA 5HFOA 3F1OA 3A0VA 2C5WB 3SS4A 3DTIA 5FDHA 1TEMA 5FAPA 5I5LA 3G35A 4MN5A 3W8KA 2DNSA 1ESUA 2ZMAA 3K2NA 3P98A 5EVIB 2XA7S 4WELA 4GN2A 5GLBA 5HPFA 2X71A 1HD8A 2O9BA 4UA6A 3S7QA 2JN7A 2EX2A 3TG9A 4GJ4A 1L0EA 5J7EA 2GNXA 4OQIA 3PBRA 2G7UA 2Y55A 3VFHA 1T1CA 5FI7A 1KE4A 2WAEA 4DJ2A 4E3MA 2HP5A 5CHJA 4E3JA 3UB9A 5EV0A 2QJ5A 3QNBA 1XFNA 1TS7A 4Q0JA 2OAQ1 2XD5A 4KZ6A 3F1PB 4JF4A 1VM1A 1KOUA 2WGIA 4FTXA 5CHUA 2V1BA 3UN7A 2V9AA 4X25A 2Q0OA 2J9OA 4DDSA 2ZQAA 4R6LA 1MY8A 2QJ7A 4WBGA 5CEDA 5L8MA 4CLCE 4S2KA 4JGOA 4EXOA 2Z6DA 2W3FA 5J4EA 4PM5A 3OOVA 4IVKA 2RL3A 3NC8A 1MC0A 3NY4A 2QZ6A 3Q7VB 4R1GA 3GDIA 3LIAA 5TGFA 3H82A 1XJ6A 5TR7A 2EX6A 1OTEA 2ZM2A 4XT2A 4Q8IA 1OJ5A 3CAXA 4U3TA 1XJ4A 1AXBA 1KDSA 3G6OA 1PWCA 5F6AA 2L4RA 3LR5A 4HEFA 4LV1A 3C5AA 1KVMA 5LBRA 4Y0TA 1YMSA 3GR2A 4OONA 4R3BA 3U2AA 5FATA 3FKWA 1XA7A 1GHPA 1JWPA 4DDYA 2H0YA 3LEQA 3IWIA 4KG6A 3C30A 4HP9A 3T4QA 1OTIA 3VP2A 1NZUA 2PYRA 3Q7ZA 4BMWA 1S1YA 2VV7A 2EFUA 5A92A 3ZG5A 5HAIA 4D60A 5EOOA 3SS5A 2BG1A 2WAFA 1D06A 2KDKA 1BLPA 2Y2LA 3VOLA 3UB6A 1DRMA 5HL6A 1TF1A 3IBJA 4KZ9A 3ZG0A 1T19A 3UDXA 5JYOA 1TVFA 1XKZA 3S4XA 3NI9A 1UWPX 5FSRA 4BL3A 3D72A 3MR0A 5IS1A 3DAVA 2JBFA 3HBRA 1NRJA 3IXHA 4NXFA 1K55C 1VEUB 4B9OA 1MWSA 5HARA 3W2ZA 2Y2HA 1YLPA 1V9YA 2PRFA 3UPPA 4ID4A 4LRZE 4Y0OA 5F69A 2HZ5A 2Q9NA 1T18A 3ZDJA 2Y2MA 4OPYA 2P9VA 1EW0A 2W3GA 3HUNA 3A3DA 4E6WA 3ZQ5A 3GRJA 1BUEA 4UA9A 4IBRA 4X68A 4OOLA 1NRFA 3EGXC 1KE0A 1ES4A 3B42A 1YKDA 1I5QA 1VQQA 1RGZA 1S66L 3GTCA 3FV7A 4HOIA 3AGFA 3V3RA 4BBVA 4WZ5A 1YSPA 2PBYA 3LIEA 1L0FA 5FAOA 4JGPA 4PM7A 3BJNA 5FA7A 2Y2IA 2UWXA 3CPTA 1Y28A 1KE3A 2KOIA 1NZOA 3GQZA 2ZD8A 4EW7A 2OSUA 3QP2A 5AQ9A 1ZKJA 2G2UA 4FH4A 1S1ZA 2DCFA 4Q0IA 1PI4A 3UE3A 5FQKA 5EPHA 4FH2A 3EEHA 3ISGA 1JWVA 1GHIA 1LI9A 5FEFA 2ZMFA 1LI0A 3ZCZA 1M6KA 3D4FA 3R7WB 1KGEA 3LY3A 5FAQA 4PPRA 3MJQA 5G4YA 1PI5A 5EUAA 3MXQA 3RH8B 1RP5A 1YLZA 5HWTA 4WEJA 3T4OA 2V0WA 2P9VB 5J8XA 5FDSA 3KSGA 4P0MA 3KYZA 3T50A 3P7NA 3LCEA 3PTEA 4ZTKA 3UE0A 3CITA 4E3KA 2ZLYA 1VEUA 1IYPA 2W1TA 4RX3A 5M19A 4EQIA 1OPXA 4LRYC 2INWA 3BY8A 2J8YA 1ZG6A 4G3VA 4HH3A 1CJFA 4HY8A 4KQQA 2V20A 2Q9MA 4AFIA 2JKTM 3MZEA 3HUMA 1CQAA 5F82A 4WEKA 3BYDA 5IU1A 3UB5P 4EERA 3IF6A 4JPMA 3H82B 5EE8A 5E43A 1ERQA 2EFXA 3OPRA 5CTMA 2W1TB 5HDCA 5DTKA 4WL9A 4G3WA 1GCEA 4B88A 1JTGA 4Y13A 5GHZA 4X1LA 3L7HA 5CGXA 4GHIB 1K57C 3SH9A 3SH8A 3PBTA 4KG2A 1K54A 3D9YA 5DFYA 3HJKA 4OH0A 3EWKA 3SH7A 2M7VA 3KO6A 4F3LA 4U0XA 3D3OA 3F1NA 2R9XA 4R38A 1STZA 2VV6A 3K3CA 5DTSA 3TOIA 2Z2LB 4LGWA 4GCZA 5HL1A 3MXSA 5EM0A 4QD4A 3ZVWA 2XEPA 2Z2MB 2ZL1B 3ZHHA 1FIKA 3MZDA 3H9WA 4QU3A 1Y54A 3LI8A 3NCKA 3Q7VA 2WKIA 4EETB 4F94A 4DE1A 1TDLA 1FILA 4PMAA 3MBZA 3T1QB 1KGFA 3Q07A 2P04A 4DKIA 3VSLA 3F1NB 3T1SA 4IBXA 3NULA 1VHMA 1XXMA 3UMEA 3B33A 1FCOA 3SS3A 1XPBA 4CPKA 1IELA 4MCWA 2WZXA 1FR6A 1PNEA 2PDRA 3F1PA 3MMHA 3C4OA 4FOFA 3CHWP 5M1AA 2OWHA 1FQGA 3N8SA 1DP6A 3F1OB 2WKEA 1NWZA 4KZ3A 3QP4A 4B4XA 3FWLA 3N8LA 4HESA 3UY6A 3UB8A 1O07A 1L3LA 4S2PA 4RYEA 4QY5A 1CI8A 2JKFA 5CX7A 3VP3A 1JVJA 5HWWA 4L9GA 3VP0A 1UGUA 5G4ZA 3HLCA 2GJ3A 3EQUA 5BOHA 4N1XA 5CGWA 3TE8A 5EVLA 1E4DA 2HV1A 1P97A 2ZQ8A 3JVUA 4X56A 4OLGA 1C3BA 1DP8A 3IF5A 2L1MA 2X02A 2VGJA 2YKHA 1W63M 1MWTA 3NOTC 1ZHHB 3CUEA 2W3DA 4NXGA 2VA0A 1LSWA 1LL9A 3OPPA 2XLNA 2K7SA 3M6BA 4DRTA 3IT9A 1SKOA 1PYYA 4H6JA 1DJBA 5CECA 3CI6A 2VGKA 4MDZA 3M2KA 1F98A 4I5SA 3HVFA 2QMIA 4OQHA 4UAAA 3LFVA 4S2NC 3BY9A 2GDNA 4D2OA 3OPLA 3ZG9B 1FSYA 3IX8A 1H5XA 4ZBEA 3E4PA 4JF6A 3KSFA 4L9FA 4HIAA 5FQMA 3VMAA 3UMDA 2OLVA 1BULA 3AGDA 4S2IA 1YSQA 2I72A 5AVEA 2J3TC 4X55A 1N9LA 4KENB 1NLYA 5HAQA 3FYZA 2GZAA 4E3NA 4FD8A 4R0QA 1IKGA 1HZOA 1LSXA 4GS9A 3W4QA 2JKRM 1TDGA 2QKPA 4X1MA 2XH9A 4Y5FA 1W79A 3HJIA 3V3SA 2J3TD 3IXBA 2ZOHA 4WM9A 1OT6A 4E04A 1F2KA 5A90A 4B4ZA 2H28A 2PR6A 3NDEA 1ES3A 4PM6A 5CXWA 2PU4A 1TD5A 1ERMA 1KGGA 5F1GA 3LIBA 4O0PA 1P9WA 1A0KA 1IFQA 3VOZA 3MS6A 2ZQ7A 3UNWA 4C6YA 4LFUA 3MXRA 4JXVA 3BFCA 1ES2A 4CLCD 5HD3A 3LY4A 5EECA 3SW1A 2H0TA 1ES5A 3IX4A 1J9MA 4DJ3A 2EXBA 2AVXA 3CJMA 3PAEA 4BBUA 4OPRA 3BRMA 2O9CA 2WADA 4MMNA 4I3IA 1PIOA 1OJGA 2EA9A 3N7WA 3T12B 4BWIA 1CK3A 2VZWA 2K2NA 4LCLA 4UA7A 3H7WB 3GECA 2D01A 3NOUC 4YWZA 3PBSA 1AWIA 3UO9A 1ZTUA 3IX3A 1BZAA 4S2JA 3IXGA 3MZFA 2ZQ9A 2MJ6A 1PZPA 2KLIA 3HUOA 2XR0A 3TRCA 4Y0UA 5GLDA 5KIZA 4GB7A 3PXPA 3A3IA 1XX2A 1S6RA 3UB7A 2H5SA 3ITAA 5CERA 3TJZC 4RA7A 2PYPA 2WYXA 3O87A 1WYCA 1BSGA 3EQVA 1ONGA 1CEFA 3I7JA 1ZC2A 1K6SA 2XK1A 4ETZA 3GVBA 3HREA 3NBLA 2V0UA 1XGJA 4JXSA 2PBDP 4X53A 4B93A 1GSXA 2IA2A 4BD1A 4K0WA 5FQ9A 1W63Q 3MKEA 4IJGA 5JYPA 4S2NA 1VETA 2LB9A 1FSWA 1LL8A 3IF6B 4LCMA 1W5DA 1VETB 4HHDA 3LIDA 4M3KA 1YM1A 3NDGA 3FPVA 5FQQA 4R4RA 2HDUA 5FEGA 1NY0A 3QP1A 4KZ4A 5DJUA 3E98A 3C7UA 3FKVA 1KVLA 2QYBA 5HAPA 4KZBA 1XJ3A 2Y2NA 3BLMA 3PHYA 5EVEA 2JHEA 5L09A 2B02A 3IBRA 3T4LA 3LUQA 4Q0HA 2G2WA 4K91A 2ZC4B 2WKQA 3BECA 3O86A 4EU0A 4WYYA 2A49A 4CJNA 3OCNA 4KUKA 4EV4A 2JCHA 1DJAA 2C6WB 3M6HA 3OZHA 1F5MA 3G4PA 5DF8A 4CLCA 3BQAA 2P7JA 3ZG7B 3G32A 2PHYA 1J3WA 2JC7A 4UQIM 2ZC6B 1W8QA 3DTMA 3DW0A 3P09A 1P9RA 2EWVA 2H10A 3LR3A 2E8IA 4WMCD 3LGOA 3MF0A 4WLAA 4GKUA 1OTBA 3KSHA 1VB6A 1MPLA 3A0SA 3ITBA 5CHMA 3ICYA 2VGLM 1SDNA 5EVIA 2XQZA 4P87A 3IS2B 1K6RA 3T4JA 1S4SA 3V39A 3CZDA 4QY6A 2V1AA 3FG8A 3L9KA 1M40A 5TBMA 3PR6A 3CG5A 3U4LP 1K38A 1T1AA 3WS2A 1H8YA 3G30A 3UPOA 1NJ4A 5TBMB 3LR4A 1CF0A 4Y7PA 2HGVA 4ZRRA 3NECA 2O99A 1OT9A 4GOGA 4GDNA 3T1XA 1IYSA 3DTEA 5E2EA 2J7VA 2ZC5B 4H6JB 3E2KA 4EBPA 4K08A 3UE6A 5CTNA 5F83A 4IVIA 1PFLA 4N9LA 2HJ9C 5F1FA 2ZM0A 1K55A 4GZBA 4YINA 5E2GA 2HP6A 2ZQDA 2W0NA 1XA1A 3ZGAB 4WUJA 5M18A 4A5RA 4OOYA 2VEAA 1K4FA 2EWWA 3RXWA 1NYMA 3S7OA 2M7UA 5FASA 3B47A 1V9ZA 4S2MA 4ME4A 4DXBA 4HJ3A 2A3UA 5HPIA 4ESPA 3GSGA 4EQ1A 2UV0E 4HQAA 1L0DA 4KZAA 4OP8A 4P6ZS 1L0GA 3IH9A 1JTDA 5K5BA 5AQBA 4BBTA 5KMWA 4C75A 1W7FA 1SKOB 5DKKA 4O7DA 3MKFA 2Y2PA 2Z6CA 3C8CA 3A3JA 3QHYA 3IWOA 4CLCC 3VE4A 4BLMA 4OP5A 2OV5A 1RCJA 2B18A 4UQIS 4Y3IA 5J3WA 3IWQA 3VP4A 4IHQA 5GHYA 1EWZA 1GA0A 4KZ7A 3TW8A 3R4KA 3JYIA 5F68A 1XP4A 2EX9A 4GDBA 4BENA 2J9PA 2ACGA 1N4OA 4MNRA 5CEBA 4IUKA 2ZC3B 2J80A 3QP6A 4PM9A 1S67L 3PBQA 5L07A 4C3QA 1S4RA 1GSWA 4S2LA 5F5YA 3HL9A 1YLWA 1K0KA 2GX5A 4NXEA 1NXYA 3HLGA 3WS4A 3W4OA 3MQQA 2P08A 1PWDA 4MBHA 4ZJ2A 5I94A 1DJCA 2WZZA 2ZL1A 3BFDA 2XSSA 3C2WA 4KQDA 1MKIA 5GHXA 2XROA 2HF6A 5EM1A 1WA9A 1YPRA 3IHAA 4P6ZM 4O8GA 3MQOA 2ZOIA 3WS1A 4F3LB 4M4XA 4II7A 3UDIA 1PW8A 3JPUA 2QPNA 2M1CA 2OOLA 1I2SA 4GHIA 3CUEC 4HNBA 5EFWA 1E3UD 4LLOB 5HDSA 3OLOA 5FL3A 2OLUA 4QHCA 5DF9A 2FZ0A 1LSVA 4HH2A 1MXOA 4GD8A 4ARZA 1EI5A 4E6XA 3M2JA 3E4OA 4N1HA 5KZHA 3V50A 4O01A 5FQIA 5A91A 4P6BA 1PZOA 4JGRA 3VSKA 3N6IA 1OMEA 3PYPA 2CMNA 1HLUP 2V8FA 2PT7A 2RCXA 1RGYA 3KYQA 1BLSA 4LPZA 5EVID 5EOEA 1MZUA 4I3AA 4OVDA 1ONHA 2A24B 3TSGA 3MSHA 1G6AA 4X6TA 1LT0A 3VP1A 4KQOA 2A24A 3CWFA 2X01A 5HWVA 4MN7A 4ZDXA 1IYQA 2IWCA 4WZ4A 3P01A 3Q1FA 4DN0A 4N9KA 1WE4A 2WGVA 4X69A 1I2WA 4OPZA 4UHUA 3IHBA 1K54C 4ETXA 1K57A 3AGEA 4JKTA 2JKGA 1LL5A 5DF7A 2HJEA 2ZJ9A 5AQAA 2Y2OA 4PHTA 4PKYG 4XUZA 3FZCA 3W4PA 3ZYTA 5HX9A 4ZJ1A 2OAP1 5HSQA 2Y2JA 3R7WA 2XFSA 4R23A 5GLAA 4E3LA 3SOIA 4EWFA 4BL2A 4KQRA 1MKMA 3PAGA 3O3VA 3PBNA 3VE3A 1JWZA 1ESIA 5AQ7A 1H8ZA 5TJJA 4QB8A 1K56D 4ZAMA 4EBLA 3H7WA 4S2OA 2VV8A 5FI2A 3B3XA 3EGDC 1X0OA 1S0WA 1N9BA 3BFEA 3LEZA 1IKIA 5GL9A 3LIFA 3IQAA 4HI4A 3HLFA 3PBOA 4NG2A 2CC1A 2ZMVA 2B5RA 4XUXA 1MWUA 2BTFP 4IUHA 4I38A 3HLDA 1OTAA 2L0WA 3HLWA 1YLTA 2O9AA 5C5KA 3IF6C 4XXRA 3DBAA 2PAVP 4MLLA 2KX6A 4OLDA 4OOMA 4QJGA 1U60A 1ZG4A 1BYWA 1CI9A 3LI9A 3OCLA 4GLQA 1G5UA 3WS0A 1GHMA 2PR5A 3WWXA 3A0RA 2W3HA 1CEGA 2DRWA 1GA9A 5AJGA 1Y4OA 3IS2A 1ACFA 4K0XA 1G6OA 4YFMA 4HBUA 1PW1A 4EEPA 2XFTA 4BJPA 1FCNA 1FR1A 1H0MA 3ZNTA 4GS9B 5DKLA 4WMCA 4HJ4A 3SZTA 1YLYA 4JXGA 4R4SA 3RTYA 3O88A 2HDSA 2P74A 4HBTA 4NETA 4LV0A 3FC7A 2V8CA 2R9WA 4IEDA 3LICA 4JXWA 2OWJA 5KSCA 4JF5A 1QMFA 4I39A 3UDFA 4QWOA 4NKPA 4FUWA 3MFDA 4LV2A 4Z1WA 1BLCA 3BWLA 1YAXA 3A3EA 4UEYA 4BQMA 3OBFA 1WYBA 4R3AA 5KSHA 2Y79A 1YQSA 1TS0A 3BM6A 3NJAA 4HJ6A 5FI6A 5MC7A 3NHQA 2WK0A 1LHYA 5CGSA 2WGWB 4FSFA 3IXDA 4EEUA 3E4QA 4WZ5C 3CLOA 3HLBA 3ULFA 4RVAA 4OQGA 3BW6A 3O5YA 2FFFB 2HDRA 1D7EA 3K3DA 4YOFA 3BFFA 1L2SA 3RXXA 4HP4A 3BQ8A 2D02A 1IOUA 2VJWA 3KSIA 1BT5A 3ZNYA 3VOYA 2VLGA 1K4EA 1Q2PA 2HP9A 5E2FA 3QP8A 1ODVA 1G68A 3IH8A 3S7NA 3VV4A 4Y2FA 5U47A 4LV3A 1LLBA 3T1RA 1IEMA 3BFGA 4U0TA 2HDQA 4ARZB 3G2ZA 3QNCA 5HZHA 3S22A 2J3WA 4EUZA 3G2YA 3OC2A 4P85A
chains in the Genus database with same CATH topology
3LIAA 2HV1A 1P97A 3H82A 1XJ6A 3JVUA 1DP8A 1OTEA 4HQAA 4XT2A 3T4SA 2L1MA 1OJ5A 4P6ZS 3CAXA 5K5BA 1XJ4A 3G6OA 3JVVA 4BBTA 2YKHA 5F6AA 2L4RA 4EESA 1W63M 2Y8HA 3LR5A 4RQ9A 2BASA 3NOTC 1ZHHB 3CUEA 2W3DA 4NXGA 2VA0A 1LSWA 5LBRA 5DKKA 2K7SA 4R70A 2Z6CA 4NEED 3C8CA 4L9EA 4H6JA 3EOIA 3U2AA 4CLCC 3VE4A 3CI6A 3MQ0A 4MDZA 1F98A 4I5SA 2W3EA 4UQIS 2B18A 4Y3IA 5J3WA 4IHQA 1TS8A 3LFVA 3C30A 4HP9A 3T4QA 3BY9A 1OTIA 1OTDA 3TW8A 3R4KA 5DJTA 5F68A 2PYRA 1GSVA 4BMWA 3E4PA 2QWSA 1S1YA 4L0LA 3KSFA 4L9FA 2WKRA 4HIAA 2VV7A 1XJ2A 4IUKA 2J80A 3UMDA 1S67L 3PBQA 3KX0X 1S4RA 1GSWA 5F5YA 1YSQA 5AVEA 2J3TC 1D06A 2KDKA 2GX5A 4PAUA 1N9LA 4QPRA 4NXEA 5DFXA 3VOLA 1NLYA 3UB6A 1DRMA 5HL6A 1TF1A 2GZAA 3MQQA 2P08A 3IBJA 2FH5A 1LSXA 4GS9A 2XSSA 3C2WA 2JKRM 2QKPA 1T19A 4KQDA 4Y5FA 2XROA 3HJIA 2HF6A 2J3TD 4LRXC 1XFQA 2NUTC 2ZOHA 1UWPX 1WA9A 4P6ZM 1OT6A 3D72A 4E04A 3MR0A 4O8GA 5IS1A 3MQOA 3T4TA 2ZOIA 1NRJA 4NXFA 4F3LB 2H28A 2PR6A 4M4XA 4B9OA 4II7A 3W2ZA 1TD5A 2QHKA 1V9YA 4LRZE 3LIBA 1P0ZA 4O0PA 5F69A 1P9WA 2M1CA 3T4KA 1IFQA 2OOLA 2VX8A 4GHIA 3CUEC 3EEAA 4HNBA 1T18A 5HD5A 5EFWA 4LLOB 5HDSA 3OLOA 5FL3A 1EW0A 2W3GA 5DF9A 4CLCD 3ZQ5A 2FZ0A 5HD3A 3SW1A 1LSVA 4HH2A 4OOLA 3EGXC 2O0YA 3B42A 4DJ3A 4ARZA 1YKDA 1S66L 4HOIA 2A2LA 3E4OA 4BBVA 4BBUA 1YSPA 2W1RA 3LIEA 2O9CA 4O01A 4MMNA 4I3IA 4JGPA 4PKYA 1OJGA 2EA9A 3BJNA 4JGRA 4BWIA 2LB5A 2VZWA 2K2NA 3PYPA 2CMNA 3NOPC 2JKTI 3H7WB 1Y28A 3GECA 2D01A 2PT7A 4EUVA 3KYQA 1H8MA 3NOUC 2KOIA 3PBSA 4YWZA 5AVFA 1UWNX 4LPZA 4EW7A 1ZTUA 1MZUA 4I3AA 1JNUA 3FPWA 3S7PA 2A24B 4CQHA 1S1ZA 2MJ6A 2KLIA 1LT0A 3TRCA 4YNRA 2XRNA 5KIZA 4KQOA 2A24A 3CWFA 4Q0IA 5HWVA 4MN7A 3PXPA 3UE3A 4GW9A 3EEHA 3MFXA 3UB7A 3P01A 1H3QA 4DN0A 5A8BA 3TJZC 2PYPA 2I9VA 2ZMFA 4ETXA 3R7WB 2YKFA 3EQVA 3MJQA 5G4YA 2HJEA 4MN6A 4PHTA 4PKYG 3MXQA 4ETZA 5HDDA 3ZYTA 3RH8B 1N9NA 2OAP1 5HSQA 1TS6A 3R7WA 3E0YA 2WKPA 1G28A 2V0UA 2W27A 4WEJA 5HWTA 3T4OA 1MKMA 2V0WA 4B93A 3PBNA 1GSXA 2IA2A 3VE3A 2K31A 1W63Q 4IJGA 4KUOA 3KSGA 5TJJA 2LB9A 1LL8A 4NXBA 4CLCB 3KYZA 3H7WA 3T50A 2VV8A 2VGLS 3P7NA 3EGDC 1X0OA 3CITA 3HCYA 4HHDA 3LIDA 2W1TA 3FPVA 1OPXA 3LIFA 2R78A 1F9IA 4HI4A 3PBOA 4LRYC 2INWA 2ZBBA 2ZMVA 4WN5A 3LYXA 3BY8A 1N9OA 3C38A 4G3VA 4IUHA 4I38A 3E98A 5DJUA 4HH3A 1OTAA 4HY8A 2L0WA 2QYBA 4AFIA 2JKTM 2O9AA 5C5KA 2PD8A 4WEKA 4WF0A 3DBAA 5IU1A 2KX6A 1XJ3A 5IT5A 4OOMA 3OCLA 1BYWA 3LI9A 3PHYA 4GLQA 4EERA 2JHEA 2XA7M 2B02A 2PR5A 3IBRA 3A0RA 3H82B 3T4LA 3LUQA 2W3HA 2JKRI 4Q0HA 2NUPC 5AJGA 2WKQA 4EU0A 3IS2A 2W1TB 5HDCA 4WL9A 4G3WA 1G6OA 2VKSA 3OCNA 4KUKA 4DMZA 1DP9A 2DMWA 1T1BA 4EEPA 1F5MA 4G3KA 4BJPA 4XT2B 4GHIB 4CLCA 3BQAA 3LR0A 2P7JA 4I3JA 3PBTA 4JGQA 4GS9B 5DFYA 1NLZA 4HJ4A 5DKLA 2PHYA 2PD7A 3HJKA 3EWKA 3RFBA 4UQIM 2M7VA 3KO6A 3V67A 4F3LA 3RTYA 3F1NA 3D3OA 3F1OA 4R38A 1P9RA 2EWVA 1STZA 2VV6A 3A0VA 3K3CA 3FC7A 3LR3A 4GCZA 3LICA 5I5LA 4MN5A 2OWJA 3K2NA 3MF0A 4I39A 2XA7S 4WELA 4WLAA 4NKPA 1OTBA 3KSHA 5HPFA 4Z1WA 3BWLA 3H9WA 1VB6A 1YAXA 3LI8A 2O9BA 3S7QA 2JN7A 4UEYA 3A0SA 3OBFA 4GJ4A 4R3AA 3ICYA 5J7EA 2GNXA 2VGLM 5KSHA 4EETB 3PBRA 2G7UA 2Y79A 1TS0A 3IS2B 3NJAA 4HJ6A 3T4JA 5MC7A 1T1CA 1S4SA 3NHQA 2P04A 2V1AA 4FSFA 4DJ2A 3FG8A 5TBMA 3F1NB 3PR6A 1T1AA 4EEUA 3E4QA 3UB9A 3CLOA 1VHMA 3UMEA 5TBMB 3LR4A 2QJ5A 3B33A 2HGVA 1XFNA 1TS7A 4Q0JA 2OAQ1 3ULFA 3BW6A 4ZRRA 3O5YA 2O99A 1OT9A 4MCWA 2PDRA 3F1PA 1D7EA 3K3DA 3MMHA 4FOFA 4YOFA 4H6JB 2OWHA 3F1PB 4K08A 3UE6A 1DP6A 3F1OB 4HP4A 1NWZA 2D02A 1KOUA 3BQ8A 1IOUA 2HJ9C 2V1BA 2VJWA 3KSIA 2V9AA 3UB8A 2VLGA 2W0NA 1ODVA 4WUJA 4R6LA 2QJ7A 3S7NA 3VV4A 5L8MA 4CLCE 2VEAA 4Y2FA 2EWWA 3S7OA 5CX7A 4JGOA 4EXOA 2M7UA 5HWWA 2Z6DA 4L9GA 3B47A 1V9ZA 4ARZB 2W3FA 1UGUA 4ME4A 5J4EA 5HZHA 4HJ3A 3OOVA 5G4ZA 5HPIA 2GJ3A 1MC0A 3EQUA 2J3WA 3OC2A 4EQ1A 3GDIA 3TE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FPW A;  4CLC D;  4CLC A;  4CLC E;  4NKP A;  4CLC B;  4BMW A;  3FPV A;  4CLC C;  5CX7 A;  2A2L A; 
#chains in the Genus database with same CATH topology
 1SZV A;  4NK3 A;  3T4S A;  2PU2 A;  3LO7 A;  3JVV A;  3GMW A;  1MBL A;  4EES A;  2Y8H A;  4RQ9 A;  1Z6F A;  2BAS A;  5D3O A;  4OPQ A;  2XGN A;  3UE1 A;  3CMZ A;  5EVI C;  1SHV A;  4R70 A;  4NEE D;  2V1Z A;  4L9E A;  3G34 A;  3EOI A;  3MQ0 A;  4DE2 A;  3QP5 A;  4KZ8 A;  1MWR A;  3N8R A;  2Y91 A;  2W3E A;  1YT4 A;  1TS8 A;  1FCM A;  1OTD A;  1PWG A;  4DXC A;  5DJT A;  1GSV A;  2QWS A;  2Y4A A;  1NYY A;  4L0L A;  4LEN A;  4R3J A;  2WKR A;  1YLJ A;  1XJ2 A;  2B95 A;  3KX0 X;  2WUQ A;  4QPR A;  4PAU A;  5DFX A;  1QME A;  1HTZ A;  3A3F A;  3WS5 A;  3UPN A;  2FH5 A;  1BLH A;  3G31 A;  4E3I A;  2VK3 A;  4OKP A;  2ZM8 A;  3DWZ A;  4LRX C;  1XFQ A;  2NUT C;  3ZVT A;  1Z09 A;  3E2L A;  4DE0 A;  3T4T A;  2XF3 A;  4E3O A;  2WKH A;  4PM8 A;  2QHK A;  1KDW A;  5GLC A;  1P0Z A;  1E25 A;  1ERO A;  4Y15 A;  3T4K A;  2VX8 A;  3WRT A;  3EEA A;  5HD5 A;  5IHV A;  2EXA A;  3RJU A;  3WRZ A;  3HLE A;  4Z9Q A;  2O0Y A;  1HVB A;  1XGI A;  2A2L A;  1SCW A;  2W1R A;  4FCF A;  4MBF A;  1Q2Q A;  4PKY A;  1ALQ A;  3VFF A;  5L2F A;  2LB5 A;  3DTK A;  3NOP C;  2JKT I;  4EUV A;  1H8M A;  5AVF A;  1UWN X;  1K56 A;  3CPT B;  2FFY A;  1JNU A;  5G18 A;  3C7V A;  3OPH A;  3FPW A;  3S7P A;  4CQH A;  4N92 A;  1D1J A;  1FOF A;  4YNR A;  2XRN A;  4JBF A;  2HPB A;  4GD6 A;  3KYE A;  4GNU A;  4GW9 A;  5CRF A;  1IYO A;  3MFX A;  2V2F F;  1H3Q A;  5A8B A;  4DE3 A;  3DWK A;  2I9V A;  3GV9 A;  2Y2G A;  5TFQ A;  2YKF A;  2IWB A;  3ZG8 B;  2E8J A;  4RX2 A;  4MN6 A;  1SDE A;  5HDD A;  2XDM A;  4MEZ A;  1N9N A;  1DY6 A;  1SKF A;  1TS6 A;  2WGW A;  3E0Y A;  2WKP A;  1G28 A;  2W27 A;  5FQJ A;  1YMX A;  2K31 A;  2BLS A;  4KG5 A;  4KUO A;  4H8R A;  4OQ0 A;  5L10 A;  4NXB A;  2ZC7 A;  3V5M A;  4CLC B;  2VGL S;  4ZJ3 A;  1O7E A;  3BLS A;  4JLF A;  2Y2Q A;  5A93 A;  3HCY A;  2R78 A;  3BEB A;  3N4I A;  1F9I A;  2XD1 A;  4BD0 A;  2ZBB A;  4WN5 A;  2JE5 A;  3LYX A;  1N9O A;  1PRQ A;  3C38 A;  2IWD A;  5HW3 A;  3Q81 A;  3NIA A;  3S1Y A;  2PD8 A;  3ZFZ A;  1E3U A;  4WF0 A;  5IT5 A;  5E2H A;  1BTL A;  1W8Y A;  2Y2K A;  2XA7 M;  3C4P A;  4Y17 A;  5DTT A;  2JKR I;  2ZQC A;  2NUP C;  3Q82 A;  4KZ5 A;  2VKS A;  2Y59 A;  1K25 A;  1DP9 A;  4DMZ A;  5DVA A;  2DMW A;  1T1B A;  4G3K A;  4XT2 B;  3LR0 A;  4I3J A;  4JGQ A;  1NLZ A;  4EBN A;  2PD7 A;  3RFB A;  2EX8 A;  4DF6 A;  3V67 A;  4MBK A;  5HFO A;  3F1O A;  3A0V A;  2C5W B;  3SS4 A;  3DTI A;  5FDH A;  1TEM A;  5FAP A;  5I5L A;  3G35 A;  4MN5 A;  3W8K A;  2DNS A;  1ESU A;  2ZMA A;  3K2N A;  3P98 A;  5EVI B;  2XA7 S;  4WEL A;  4GN2 A;  5GLB A;  5HPF A;  2X71 A;  1HD8 A;  2O9B A;  4UA6 A;  3S7Q A;  2JN7 A;  2EX2 A;  3TG9 A;  4GJ4 A;  1L0E A;  5J7E A;  2GNX A;  4OQI A;  3PBR A;  2G7U A;  2Y55 A;  3VFH A;  1T1C A;  5FI7 A;  1KE4 A;  2WAE A;  4DJ2 A;  4E3M A;  2HP5 A;  5CHJ A;  4E3J A;  3UB9 A;  5EV0 A;  2QJ5 A;  3QNB A;  1XFN A;  1TS7 A;  4Q0J A;  2OAQ 1;  2XD5 A;  4KZ6 A;  3F1P B;  4JF4 A;  1VM1 A;  1KOU A;  2WGI A;  4FTX A;  5CHU A;  2V1B A;  3UN7 A;  2V9A A;  4X25 A;  2Q0O A;  2J9O A;  4DDS A;  2ZQA A;  4R6L A;  1MY8 A;  2QJ7 A;  4WBG A;  5CED A;  5L8M A;  4CLC E;  4S2K A;  4JGO A;  4EXO A;  2Z6D A;  2W3F A;  5J4E A;  4PM5 A;  3OOV A;  4IVK A;  2RL3 A;  3NC8 A;  1MC0 A;  3NY4 A;  2QZ6 A;  3Q7V B;  4R1G A;  3GDI A;  3LIA A;  5TGF A;  3H82 A;  1XJ6 A;  5TR7 A;  2EX6 A;  1OTE A;  2ZM2 A;  4XT2 A;  4Q8I A;  1OJ5 A;  3CAX A;  4U3T A;  1XJ4 A;  1AXB A;  1KDS A;  3G6O A;  1PWC A;  5F6A A;  2L4R A;  3LR5 A;  4HEF A;  4LV1 A;  3C5A A;  1KVM A;  5LBR A;  4Y0T A;  1YMS A;  3GR2 A;  4OON A;  4R3B A;  3U2A A;  5FAT A;  3FKW A;  1XA7 A;  1GHP A;  1JWP A;  4DDY A;  2H0Y A;  3LEQ A;  3IWI A;  4KG6 A;  3C30 A;  4HP9 A;  3T4Q A;  1OTI A;  3VP2 A;  1NZU A;  2PYR A;  3Q7Z A;  4BMW A;  1S1Y A;  2VV7 A;  2EFU A;  5A92 A;  3ZG5 A;  5HAI A;  4D60 A;  5EOO A;  3SS5 A;  2BG1 A;  2WAF A;  1D06 A;  2KDK A;  1BLP A;  2Y2L A;  3VOL A;  3UB6 A;  1DRM A;  5HL6 A;  1TF1 A;  3IBJ A;  4KZ9 A;  3ZG0 A;  1T19 A;  3UDX A;  5JYO A;  1TVF A;  1XKZ A;  3S4X A;  3NI9 A;  1UWP X;  5FSR A;  4BL3 A;  3D72 A;  3MR0 A;  5IS1 A;  3DAV A;  2JBF A;  3HBR A;  1NRJ A;  3IXH A;  4NXF A;  1K55 C;  1VEU B;  4B9O A;  1MWS A;  5HAR A;  3W2Z A;  2Y2H A;  1YLP A;  1V9Y A;  2PRF A;  3UPP A;  4ID4 A;  4LRZ E;  4Y0O A;  5F69 A;  2HZ5 A;  2Q9N A;  1T18 A;  3ZDJ A;  2Y2M A;  4OPY A;  2P9V A;  1EW0 A;  2W3G A;  3HUN A;  3A3D A;  4E6W A;  3ZQ5 A;  3GRJ A;  1BUE A;  4UA9 A;  4IBR A;  4X68 A;  4OOL A;  1NRF A;  3EGX C;  1KE0 A;  1ES4 A;  3B42 A;  1YKD A;  1I5Q A;  1VQQ A;  1RGZ A;  1S66 L;  3GTC A;  3FV7 A;  4HOI A;  3AGF A;  3V3R A;  4BBV A;  4WZ5 A;  1YSP A;  2PBY A;  3LIE A;  1L0F A;  5FAO A;  4JGP A;  4PM7 A;  3BJN A;  5FA7 A;  2Y2I A;  2UWX A;  3CPT A;  1Y28 A;  1KE3 A;  2KOI A;  1NZO A;  3GQZ A;  2ZD8 A;  4EW7 A;  2OSU A;  3QP2 A;  5AQ9 A;  1ZKJ A;  2G2U A;  4FH4 A;  1S1Z A;  2DCF A;  4Q0I A;  1PI4 A;  3UE3 A;  5FQK A;  5EPH A;  4FH2 A;  3EEH A;  3ISG A;  1JWV A;  1GHI A;  1LI9 A;  5FEF A;  2ZMF A;  1LI0 A;  3ZCZ A;  1M6K A;  3D4F A;  3R7W B;  1KGE A;  3LY3 A;  5FAQ A;  4PPR A;  3MJQ A;  5G4Y A;  1PI5 A;  5EUA A;  3MXQ A;  3RH8 B;  1RP5 A;  1YLZ A;  5HWT A;  4WEJ A;  3T4O A;  2V0W A;  2P9V B;  5J8X A;  5FDS A;  3KSG A;  4P0M A;  3KYZ A;  3T50 A;  3P7N A;  3LCE A;  3PTE A;  4ZTK A;  3UE0 A;  3CIT A;  4E3K A;  2ZLY A;  1VEU A;  1IYP A;  2W1T A;  4RX3 A;  5M19 A;  4EQI A;  1OPX A;  4LRY C;  2INW A;  3BY8 A;  2J8Y A;  1ZG6 A;  4G3V A;  4HH3 A;  1CJF A;  4HY8 A;  4KQQ A;  2V20 A;  2Q9M A;  4AFI A;  2JKT M;  3MZE A;  3HUM A;  1CQA A;  5F82 A;  4WEK A;  3BYD A;  5IU1 A;  3UB5 P;  4EER A;  3IF6 A;  4JPM A;  3H82 B;  5EE8 A;  5E43 A;  1ERQ A;  2EFX A;  3OPR A;  5CTM A;  2W1T B;  5HDC A;  5DTK A;  4WL9 A;  4G3W A;  1GCE A;  4B88 A;  1JTG A;  4Y13 A;  5GHZ A;  4X1L A;  3L7H A;  5CGX A;  4GHI B;  1K57 C;  3SH9 A;  3SH8 A;  3PBT A;  4KG2 A;  1K54 A;  3D9Y A;  5DFY A;  3HJK A;  4OH0 A;  3EWK A;  3SH7 A;  2M7V A;  3KO6 A;  4F3L A;  4U0X A;  3D3O A;  3F1N A;  2R9X A;  4R38 A;  1STZ A;  2VV6 A;  3K3C A;  5DTS A;  3TOI A;  2Z2L B;  4LGW A;  4GCZ A;  5HL1 A;  3MXS A;  5EM0 A;  4QD4 A;  3ZVW A;  2XEP A;  2Z2M B;  2ZL1 B;  3ZHH A;  1FIK A;  3MZD A;  3H9W A;  4QU3 A;  1Y54 A;  3LI8 A;  3NCK A;  3Q7V A;  2WKI A;  4EET B;  4F94 A;  4DE1 A;  1TDL A;  1FIL A;  4PMA A;  3MBZ A;  3T1Q B;  1KGF A;  3Q07 A;  2P04 A;  4DKI A;  3VSL A;  3F1N B;  3T1S A;  4IBX A;  3NUL A;  1VHM A;  1XXM A;  3UME A;  3B33 A;  1FCO A;  3SS3 A;  1XPB A;  4CPK A;  1IEL A;  4MCW A;  2WZX A;  1FR6 A;  1PNE A;  2PDR A;  3F1P A;  3MMH A;  3C4O A;  4FOF A;  3CHW P;  5M1A A;  2OWH A;  1FQG A;  3N8S A;  1DP6 A;  3F1O B;  2WKE A;  1NWZ A;  4KZ3 A;  3QP4 A;  4B4X A;  3FWL A;  3N8L A;  4HES A;  3UY6 A;  3UB8 A;  1O07 A;  1L3L A;  4S2P A;  4RYE A;  4QY5 A;  1CI8 A;  2JKF A;  5CX7 A;  3VP3 A;  1JVJ A;  5HWW A;  4L9G A;  3VP0 A;  1UGU A;  5G4Z A;  3HLC A;  2GJ3 A;  3EQU A;  5BOH A;  4N1X A;  5CGW A;  3TE8 A;  5EVL A;  1E4D A;  2HV1 A;  1P97 A;  2ZQ8 A;  3JVU A;  4X56 A;  4OLG A;  1C3B A;  1DP8 A;  3IF5 A;  2L1M A;  2X02 A;  2VGJ A;  2YKH A;  1W63 M;  1MWT A;  3NOT C;  1ZHH B;  3CUE A;  2W3D A;  4NXG A;  2VA0 A;  1LSW A;  1LL9 A;  3OPP A;  2XLN A;  2K7S A;  3M6B A;  4DRT A;  3IT9 A;  1SKO A;  1PYY A;  4H6J A;  1DJB A;  5CEC A;  3CI6 A;  2VGK A;  4MDZ A;  3M2K A;  1F98 A;  4I5S A;  3HVF A;  2QMI A;  4OQH A;  4UAA A;  3LFV A;  4S2N C;  3BY9 A;  2GDN A;  4D2O A;  3OPL A;  3ZG9 B;  1FSY A;  3IX8 A;  1H5X A;  4ZBE A;  3E4P A;  4JF6 A;  3KSF A;  4L9F A;  4HIA A;  5FQM A;  3VMA A;  3UMD A;  2OLV A;  1BUL A;  3AGD A;  4S2I A;  1YSQ A;  2I72 A;  5AVE A;  2J3T C;  4X55 A;  1N9L A;  4KEN B;  1NLY A;  5HAQ A;  3FYZ A;  2GZA A;  4E3N A;  4FD8 A;  4R0Q A;  1IKG A;  1HZO A;  1LSX A;  4GS9 A;  3W4Q A;  2JKR M;  1TDG A;  2QKP A;  4X1M A;  2XH9 A;  4Y5F A;  1W79 A;  3HJI A;  3V3S A;  2J3T D;  3IXB A;  2ZOH A;  4WM9 A;  1OT6 A;  4E04 A;  1F2K A;  5A90 A;  4B4Z A;  2H28 A;  2PR6 A;  3NDE A;  1ES3 A;  4PM6 A;  5CXW A;  2PU4 A;  1TD5 A;  1ERM A;  1KGG A;  5F1G A;  3LIB A;  4O0P A;  1P9W A;  1A0K A;  1IFQ A;  3VOZ A;  3MS6 A;  2ZQ7 A;  3UNW A;  4C6Y A;  4LFU A;  3MXR A;  4JXV A;  3BFC A;  1ES2 A;  4CLC D;  5HD3 A;  3LY4 A;  5EEC A;  3SW1 A;  2H0T A;  1ES5 A;  3IX4 A;  1J9M A;  4DJ3 A;  2EXB A;  2AVX A;  3CJM A;  3PAE A;  4BBU A;  4OPR A;  3BRM A;  2O9C A;  2WAD A;  4MMN A;  4I3I A;  1PIO A;  1OJG A;  2EA9 A;  3N7W A;  3T12 B;  4BWI A;  1CK3 A;  2VZW A;  2K2N A;  4LCL A;  4UA7 A;  3H7W B;  3GEC A;  2D01 A;  3NOU C;  4YWZ A;  3PBS A;  1AWI A;  3UO9 A;  1ZTU A;  3IX3 A;  1BZA A;  4S2J A;  3IXG A;  3MZF A;  2ZQ9 A;  2MJ6 A;  1PZP A;  2KLI A;  3HUO A;  2XR0 A;  3TRC A;  4Y0U A;  5GLD A;  5KIZ A;  4GB7 A;  3PXP A;  3A3I A;  1XX2 A;  1S6R A;  3UB7 A;  2H5S A;  3ITA A;  5CER A;  3TJZ C;  4RA7 A;  2PYP A;  2WYX A;  3O87 A;  1WYC A;  1BSG A;  3EQV A;  1ONG A;  1CEF A;  3I7J A;  1ZC2 A;  1K6S A;  2XK1 A;  4ETZ A;  3GVB A;  3HRE A;  3NBL A;  2V0U A;  1XGJ A;  4JXS A;  2PBD P;  4X53 A;  4B93 A;  1GSX A;  2IA2 A;  4BD1 A;  4K0W A;  5FQ9 A;  1W63 Q;  3MKE A;  4IJG A;  5JYP A;  4S2N A;  1VET A;  2LB9 A;  1FSW A;  1LL8 A;  3IF6 B;  4LCM A;  1W5D A;  1VET B;  4HHD A;  3LID A;  4M3K A;  1YM1 A;  3NDG A;  3FPV A;  5FQQ A;  4R4R A;  2HDU A;  5FEG A;  1NY0 A;  3QP1 A;  4KZ4 A;  5DJU A;  3E98 A;  3C7U A;  3FKV A;  1KVL A;  2QYB A;  5HAP A;  4KZB A;  1XJ3 A;  2Y2N A;  3BLM A;  3PHY A;  5EVE A;  2JHE A;  5L09 A;  2B02 A;  3IBR A;  3T4L A;  3LUQ A;  4Q0H A;  2G2W A;  4K91 A;  2ZC4 B;  2WKQ A;  3BEC A;  3O86 A;  4EU0 A;  4WYY A;  2A49 A;  4CJN A;  3OCN A;  4KUK A;  4EV4 A;  2JCH A;  1DJA A;  2C6W B;  3M6H A;  3OZH A;  1F5M A;  3G4P A;  5DF8 A;  4CLC A;  3BQA A;  2P7J A;  3ZG7 B;  3G32 A;  2PHY A;  1J3W A;  2JC7 A;  4UQI M;  2ZC6 B;  1W8Q A;  3DTM A;  3DW0 A;  3P09 A;  1P9R A;  2EWV A;  2H10 A;  3LR3 A;  2E8I A;  4WMC D;  3LGO A;  3MF0 A;  4WLA A;  4GKU A;  1OTB A;  3KSH A;  1VB6 A;  1MPL A;  3A0S A;  3ITB A;  5CHM A;  3ICY A;  2VGL M;  1SDN A;  5EVI A;  2XQZ A;  4P87 A;  3IS2 B;  1K6R A;  3T4J A;  1S4S A;  3V39 A;  3CZD A;  4QY6 A;  2V1A A;  3FG8 A;  3L9K A;  1M40 A;  5TBM A;  3PR6 A;  3CG5 A;  3U4L P;  1K38 A;  1T1A A;  3WS2 A;  1H8Y A;  3G30 A;  3UPO A;  1NJ4 A;  5TBM B;  3LR4 A;  1CF0 A;  4Y7P A;  2HGV A;  4ZRR A;  3NEC A;  2O99 A;  1OT9 A;  4GOG A;  4GDN A;  3T1X A;  1IYS A;  3DTE A;  5E2E A;  2J7V A;  2ZC5 B;  4H6J B;  3E2K A;  4EBP A;  4K08 A;  3UE6 A;  5CTN A;  5F83 A;  4IVI A;  1PFL A;  4N9L A;  2HJ9 C;  5F1F A;  2ZM0 A;  1K55 A;  4GZB A;  4YIN A;  5E2G A;  2HP6 A;  2ZQD A;  2W0N A;  1XA1 A;  3ZGA B;  4WUJ A;  5M18 A;  4A5R A;  4OOY A;  2VEA A;  1K4F A;  2EWW A;  3RXW A;  1NYM A;  3S7O A;  2M7U A;  5FAS A;  3B47 A;  1V9Z A;  4S2M A;  4ME4 A;  4DXB A;  4HJ3 A;  2A3U A;  5HPI A;  4ESP A;  3GSG A;  4EQ1 A;  2UV0 E;  4HQA A;  1L0D A;  4KZA A;  4OP8 A;  4P6Z S;  1L0G A;  3IH9 A;  1JTD A;  5K5B A;  5AQB A;  4BBT A;  5KMW A;  4C75 A;  1W7F A;  1SKO B;  5DKK A;  4O7D A;  3MKF A;  2Y2P A;  2Z6C A;  3C8C A;  3A3J A;  3QHY A;  3IWO A;  4CLC C;  3VE4 A;  4BLM A;  4OP5 A;  2OV5 A;  1RCJ A;  2B18 A;  4UQI S;  4Y3I A;  5J3W A;  3IWQ A;  3VP4 A;  4IHQ A;  5GHY A;  1EWZ A;  1GA0 A;  4KZ7 A;  3TW8 A;  3R4K A;  3JYI A;  5F68 A;  1XP4 A;  2EX9 A;  4GDB A;  4BEN A;  2J9P A;  2ACG A;  1N4O A;  4MNR A;  5CEB A;  4IUK A;  2ZC3 B;  2J80 A;  3QP6 A;  4PM9 A;  1S67 L;  3PBQ A;  5L07 A;  4C3Q A;  1S4R A;  1GSW A;  4S2L A;  5F5Y A;  3HL9 A;  1YLW A;  1K0K A;  2GX5 A;  4NXE A;  1NXY A;  3HLG A;  3WS4 A;  3W4O A;  3MQQ A;  2P08 A;  1PWD A;  4MBH A;  4ZJ2 A;  5I94 A;  1DJC A;  2WZZ A;  2ZL1 A;  3BFD A;  2XSS A;  3C2W A;  4KQD A;  1MKI A;  5GHX A;  2XRO A;  2HF6 A;  5EM1 A;  1WA9 A;  1YPR A;  3IHA A;  4P6Z M;  4O8G A;  3MQO A;  2ZOI A;  3WS1 A;  4F3L B;  4M4X A;  4II7 A;  3UDI A;  1PW8 A;  3JPU A;  2QPN A;  2M1C A;  2OOL A;  1I2S A;  4GHI A;  3CUE C;  4HNB A;  5EFW A;  1E3U D;  4LLO B;  5HDS A;  3OLO A;  5FL3 A;  2OLU A;  4QHC A;  5DF9 A;  2FZ0 A;  1LSV A;  4HH2 A;  1MXO A;  4GD8 A;  4ARZ A;  1EI5 A;  4E6X A;  3M2J A;  3E4O A;  4N1H A;  5KZH A;  3V50 A;  4O01 A;  5FQI A;  5A91 A;  4P6B A;  1PZO A;  4JGR A;  3VSK A;  3N6I A;  1OME A;  3PYP A;  2CMN A;  1HLU P;  2V8F A;  2PT7 A;  2RCX A;  1RGY A;  3KYQ A;  1BLS A;  4LPZ A;  5EVI D;  5EOE A;  1MZU A;  4I3A A;  4OVD A;  1ONH A;  2A24 B;  3TSG A;  3MSH A;  1G6A A;  4X6T A;  1LT0 A;  3VP1 A;  4KQO A;  2A24 A;  3CWF A;  2X01 A;  5HWV A;  4MN7 A;  4ZDX A;  1IYQ A;  2IWC A;  4WZ4 A;  3P01 A;  3Q1F A;  4DN0 A;  4N9K A;  1WE4 A;  2WGV A;  4X69 A;  1I2W A;  4OPZ A;  4UHU A;  3IHB A;  1K54 C;  4ETX A;  1K57 A;  3AGE A;  4JKT A;  2JKG A;  1LL5 A;  5DF7 A;  2HJE A;  2ZJ9 A;  5AQA A;  2Y2O A;  4PHT A;  4PKY G;  4XUZ A;  3FZC A;  3W4P A;  3ZYT A;  5HX9 A;  4ZJ1 A;  2OAP 1;  5HSQ A;  2Y2J A;  3R7W A;  2XFS A;  4R23 A;  5GLA A;  4E3L A;  3SOI A;  4EWF A;  4BL2 A;  4KQR A;  1MKM A;  3PAG A;  3O3V A;  3PBN A;  3VE3 A;  1JWZ A;  1ESI A;  5AQ7 A;  1H8Z A;  5TJJ A;  4QB8 A;  1K56 D;  4ZAM A;  4EBL A;  3H7W A;  4S2O A;  2VV8 A;  5FI2 A;  3B3X A;  3EGD C;  1X0O A;  1S0W A;  1N9B A;  3BFE A;  3LEZ A;  1IKI A;  5GL9 A;  3LIF A;  3IQA A;  4HI4 A;  3HLF A;  3PBO A;  4NG2 A;  2CC1 A;  2ZMV A;  2B5R A;  4XUX A;  1MWU A;  2BTF P;  4IUH A;  4I38 A;  3HLD A;  1OTA A;  2L0W A;  3HLW A;  1YLT A;  2O9A A;  5C5K A;  3IF6 C;  4XXR A;  3DBA A;  2PAV P;  4MLL A;  2KX6 A;  4OLD A;  4OOM A;  4QJG A;  1U60 A;  1ZG4 A;  1BYW A;  1CI9 A;  3LI9 A;  3OCL A;  4GLQ A;  1G5U A;  3WS0 A;  1GHM A;  2PR5 A;  3WWX A;  3A0R A;  2W3H A;  1CEG A;  2DRW A;  1GA9 A;  5AJG A;  1Y4O A;  3IS2 A;  1ACF A;  4K0X A;  1G6O A;  4YFM A;  4HBU A;  1PW1 A;  4EEP A;  2XFT A;  4BJP A;  1FCN A;  1FR1 A;  1H0M A;  3ZNT A;  4GS9 B;  5DKL A;  4WMC A;  4HJ4 A;  3SZT A;  1YLY A;  4JXG A;  4R4S A;  3RTY A;  3O88 A;  2HDS A;  2P74 A;  4HBT A;  4NET A;  4LV0 A;  3FC7 A;  2V8C A;  2R9W A;  4IED A;  3LIC A;  4JXW A;  2OWJ A;  5KSC A;  4JF5 A;  1QMF A;  4I39 A;  3UDF A;  4QWO A;  4NKP A;  4FUW A;  3MFD A;  4LV2 A;  4Z1W A;  1BLC A;  3BWL A;  1YAX A;  3A3E A;  4UEY A;  4BQM A;  3OBF A;  1WYB A;  4R3A A;  5KSH A;  2Y79 A;  1YQS A;  1TS0 A;  3BM6 A;  3NJA A;  4HJ6 A;  5FI6 A;  5MC7 A;  3NHQ A;  2WK0 A;  1LHY A;  5CGS A;  2WGW B;  4FSF A;  3IXD A;  4EEU A;  3E4Q A;  4WZ5 C;  3CLO A;  3HLB A;  3ULF A;  4RVA A;  4OQG A;  3BW6 A;  3O5Y A;  2FFF B;  2HDR A;  1D7E A;  3K3D A;  4YOF A;  3BFF A;  1L2S A;  3RXX A;  4HP4 A;  3BQ8 A;  2D02 A;  1IOU A;  2VJW A;  3KSI A;  1BT5 A;  3ZNY A;  3VOY A;  2VLG A;  1K4E A;  1Q2P A;  2HP9 A;  5E2F A;  3QP8 A;  1ODV A;  1G68 A;  3IH8 A;  3S7N A;  3VV4 A;  4Y2F A;  5U47 A;  4LV3 A;  1LLB A;  3T1R A;  1IEM A;  3BFG A;  4U0T A;  2HDQ A;  4ARZ B;  3G2Z A;  3QNC A;  5HZH A;  3S22 A;  2J3W A;  4EUZ A;  3G2Y A;  3OC2 A;  4P85 A; 
#chains in the Genus database with same CATH homology
 3LIA A;  2HV1 A;  1P97 A;  3H82 A;  1XJ6 A;  3JVU A;  1DP8 A;  1OTE A;  4HQA A;  4XT2 A;  3T4S A;  2L1M A;  1OJ5 A;  4P6Z S;  3CAX A;  5K5B A;  1XJ4 A;  3G6O A;  3JVV A;  4BBT A;  2YKH A;  5F6A A;  2L4R A;  4EES A;  1W63 M;  2Y8H A;  3LR5 A;  4RQ9 A;  2BAS A;  3NOT C;  1ZHH B;  3CUE A;  2W3D A;  4NXG A;  2VA0 A;  1LSW A;  5LBR A;  5DKK A;  2K7S A;  4R70 A;  2Z6C A;  4NEE D;  3C8C A;  4L9E A;  4H6J A;  3EOI A;  3U2A A;  4CLC C;  3VE4 A;  3CI6 A;  3MQ0 A;  4MDZ A;  1F98 A;  4I5S A;  2W3E A;  4UQI S;  2B18 A;  4Y3I A;  5J3W A;  4IHQ A;  1TS8 A;  3LFV A;  3C30 A;  4HP9 A;  3T4Q A;  3BY9 A;  1OTI A;  1OTD A;  3TW8 A;  3R4K A;  5DJT A;  5F68 A;  2PYR A;  1GSV A;  4BMW A;  3E4P A;  2QWS A;  1S1Y A;  4L0L A;  3KSF A;  4L9F A;  2WKR A;  4HIA A;  2VV7 A;  1XJ2 A;  4IUK A;  2J80 A;  3UMD A;  1S67 L;  3PBQ A;  3KX0 X;  1S4R A;  1GSW A;  5F5Y A;  1YSQ A;  5AVE A;  2J3T C;  1D06 A;  2KDK A;  2GX5 A;  4PAU A;  1N9L A;  4QPR A;  4NXE A;  5DFX A;  3VOL A;  1NLY A;  3UB6 A;  1DRM A;  5HL6 A;  1TF1 A;  2GZA A;  3MQQ A;  2P08 A;  3IBJ A;  2FH5 A;  1LSX A;  4GS9 A;  2XSS A;  3C2W A;  2JKR M;  2QKP A;  1T19 A;  4KQD A;  4Y5F A;  2XRO A;  3HJI A;  2HF6 A;  2J3T D;  4LRX C;  1XFQ A;  2NUT C;  2ZOH A;  1UWP X;  1WA9 A;  4P6Z M;  1OT6 A;  3D72 A;  4E04 A;  3MR0 A;  4O8G A;  5IS1 A;  3MQO A;  3T4T A;  2ZOI A;  1NRJ A;  4NXF A;  4F3L B;  2H28 A;  2PR6 A;  4M4X A;  4B9O A;  4II7 A;  3W2Z A;  1TD5 A;  2QHK A;  1V9Y A;  4LRZ E;  3LIB A;  1P0Z A;  4O0P A;  5F69 A;  1P9W A;  2M1C A;  3T4K A;  1IFQ A;  2OOL A;  2VX8 A;  4GHI A;  3CUE C;  3EEA A;  4HNB A;  1T18 A;  5HD5 A;  5EFW A;  4LLO B;  5HDS A;  3OLO A;  5FL3 A;  1EW0 A;  2W3G A;  5DF9 A;  4CLC D;  3ZQ5 A;  2FZ0 A;  5HD3 A;  3SW1 A;  1LSV A;  4HH2 A;  4OOL A;  3EGX C;  2O0Y A;  3B42 A;  4DJ3 A;  4ARZ A;  1YKD A;  1S66 L;  4HOI A;  2A2L A;  3E4O A;  4BBV A;  4BBU A;  1YSP A;  2W1R A;  3LIE A;  2O9C A;  4O01 A;  4MMN A;  4I3I A;  4JGP A;  4PKY A;  1OJG A;  2EA9 A;  3BJN A;  4JGR A;  4BWI A;  2LB5 A;  2VZW A;  2K2N A;  3PYP A;  2CMN A;  3NOP C;  2JKT I;  3H7W B;  1Y28 A;  3GEC A;  2D01 A;  2PT7 A;  4EUV A;  3KYQ A;  1H8M A;  3NOU C;  2KOI A;  3PBS A;  4YWZ A;  5AVF A;  1UWN X;  4LPZ A;  4EW7 A;  1ZTU A;  1MZU A;  4I3A A;  1JNU A;  3FPW A;  3S7P A;  2A24 B;  4CQH A;  1S1Z A;  2MJ6 A;  2KLI A;  1LT0 A;  3TRC A;  4YNR A;  2XRN A;  5KIZ A;  4KQO A;  2A24 A;  3CWF A;  4Q0I A;  5HWV A;  4MN7 A;  3PXP A;  3UE3 A;  4GW9 A;  3EEH A;  3MFX A;  3UB7 A;  3P01 A;  1H3Q A;  4DN0 A;  5A8B A;  3TJZ C;  2PYP A;  2I9V A;  2ZMF A;  4ETX A;  3R7W B;  2YKF A;  3EQV A;  3MJQ A;  5G4Y A;  2HJE A;  4MN6 A;  4PHT A;  4PKY G;  3MXQ A;  4ETZ A;  5HDD A;  3ZYT A;  3RH8 B;  1N9N A;  2OAP 1;  5HSQ A;  1TS6 A;  3R7W A;  3E0Y A;  2WKP A;  1G28 A;  2V0U A;  2W27 A;  4WEJ A;  5HWT A;  3T4O A;  1MKM A;  2V0W A;  4B93 A;  3PBN A;  1GSX A;  2IA2 A;  3VE3 A;  2K31 A;  1W63 Q;  4IJG A;  4KUO A;  3KSG A;  5TJJ A;  2LB9 A;  1LL8 A;  4NXB A;  4CLC B;  3KYZ A;  3H7W A;  3T50 A;  2VV8 A;  2VGL S;  3P7N A;  3EGD C;  1X0O A;  3CIT A;  3HCY A;  4HHD A;  3LID A;  2W1T A;  3FPV A;  1OPX A;  3LIF A;  2R78 A;  1F9I A;  4HI4 A;  3PBO A;  4LRY C;  2INW A;  2ZBB A;  2ZMV A;  4WN5 A;  3LYX A;  3BY8 A;  1N9O A;  3C38 A;  4G3V A;  4IUH A;  4I38 A;  3E98 A;  5DJU A;  4HH3 A;  1OTA A;  4HY8 A;  2L0W A;  2QYB A;  4AFI A;  2JKT M;  2O9A A;  5C5K A;  2PD8 A;  4WEK A;  4WF0 A;  3DBA A;  5IU1 A;  2KX6 A;  1XJ3 A;  5IT5 A;  4OOM A;  3OCL A;  1BYW A;  3LI9 A;  3PHY A;  4GLQ A;  4EER A;  2JHE A;  2XA7 M;  2B02 A;  2PR5 A;  3IBR A;  3A0R A;  3H82 B;  3T4L A;  3LUQ A;  2W3H A;  2JKR I;  4Q0H A;  2NUP C;  5AJG A;  2WKQ A;  4EU0 A;  3IS2 A;  2W1T B;  5HDC A;  4WL9 A;  4G3W A;  1G6O A;  2VKS A;  3OCN A;  4KUK A;  4DMZ A;  1DP9 A;  2DMW A;  1T1B A;  4EEP A;  1F5M A;  4G3K A;  4BJP A;  4XT2 B;  4GHI B;  4CLC A;  3BQA A;  3LR0 A;  2P7J A;  4I3J A;  3PBT A;  4JGQ A;  4GS9 B;  5DFY A;  1NLZ A;  4HJ4 A;  5DKL A;  2PHY A;  2PD7 A;  3HJK A;  3EWK A;  3RFB A;  4UQI M;  2M7V A;  3KO6 A;  3V67 A;  4F3L A;  3RTY A;  3F1N A;  3D3O A;  3F1O A;  4R38 A;  1P9R A;  2EWV A;  1STZ A;  2VV6 A;  3A0V A;  3K3C A;  3FC7 A;  3LR3 A;  4GCZ A;  3LIC A;  5I5L A;  4MN5 A;  2OWJ A;  3K2N A;  3MF0 A;  4I39 A;  2XA7 S;  4WEL A;  4WLA A;  4NKP A;  1OTB A;  3KSH A;  5HPF A;  4Z1W A;  3BWL A;  3H9W A;  1VB6 A;  1YAX A;  3LI8 A;  2O9B A;  3S7Q A;  2JN7 A;  4UEY A;  3A0S A;  3OBF A;  4GJ4 A;  4R3A A;  3ICY A;  5J7E A;  2GNX A;  2VGL M;  5KSH A;  4EET B;  3PBR A;  2G7U A;  2Y79 A;  1TS0 A;  3IS2 B;  3NJA A;  4HJ6 A;  3T4J A;  5MC7 A;  1T1C A;  1S4S A;  3NHQ A;  2P04 A;  2V1A A;  4FSF A;  4DJ2 A;  3FG8 A;  5TBM A;  3F1N B;  3PR6 A;  1T1A A;  4EEU A;  3E4Q A;  3UB9 A;  3CLO A;  1VHM A;  3UME A;  5TBM B;  3LR4 A;  2QJ5 A;  3B33 A;  2HGV A;  1XFN A;  1TS7 A;  4Q0J A;  2OAQ 1;  3ULF A;  3BW6 A;  4ZRR A;  3O5Y A;  2O99 A;  1OT9 A;  4MCW A;  2PDR A;  3F1P A;  1D7E A;  3K3D A;  3MMH A;  4FOF A;  4YOF A;  4H6J B;  2OWH A;  3F1P B;  4K08 A;  3UE6 A;  1DP6 A;  3F1O B;  4HP4 A;  1NWZ A;  2D02 A;  1KOU A;  3BQ8 A;  1IOU A;  2HJ9 C;  2V1B A;  2VJW A;  3KSI A;  2V9A A;  3UB8 A;  2VLG A;  2W0N A;  1ODV A;  4WUJ A;  4R6L A;  2QJ7 A;  3S7N A;  3VV4 A;  5L8M A;  4CLC E;  2VEA A;  4Y2F A;  2EWW A;  3S7O A;  5CX7 A;  4JGO A;  4EXO A;  2M7U A;  5HWW A;  2Z6D A;  4L9G A;  3B47 A;  1V9Z A;  4ARZ B;  2W3F A;  1UGU A;  4ME4 A;  5J4E A;  5HZH A;  4HJ3 A;  3OOV A;  5G4Z A;  5HPI A;  2GJ3 A;  1MC0 A;  3EQU A;  2J3W A;  3OC2 A;  4EQ1 A;  3GDI A;  3TE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...