4CLOA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 94
structure length 251
sequence length 267
chains with identical sequence D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cloA00
2NU9A 4YJGB 2C82A 1OOEA 1LNQA 4XD2A 5JAIA 3INGA 3H65A 2EW2A 1GZ4A 3PYMA 5DP1A 4DUPA 4DC1A 1C3VA 1HT0A 3ZNPA 5JE8A 3M2PA 3H9GA 5TT1A 4GVXA 5G4KB 3IL2A 1Q1NA 2Y0DA 2R2GA 2DUUA 3F47A 3OMLA 3RKRA 4CM4A 3SLKA 1ISJA 3RCBA 4CR8A 1ONPA 4BGUA 4IY1A 4IZIA 3LC7O 4W82A 1MP0A 1ONNA 4L9RA 4CLRA 3PWZA 4TRJA 4GGPA 4TZTA 3VDQA 4BO6A 4FFLA 4M8SA 5B37A 3K9QO 3HNPA 2YYYA 3VPGA 1EUCA 2GZ3A 4NBWA 4PLFA 4E13A 4ND2A 1QRRA 3N7UA 3NJ8A 2YFQA 5JDIA 3HDYA 1ISMA 2X7HA 5KJFA 3QSGA 1FXSA 4UEOA 4Y98A 3ROPA 1CYDA 3TL2A 1YH3A 3WYCA 1M76A 2Q1SA 1FF9A 2V6GA 1SO8A 3WGYA 3TZCA 4NJMA 1EUDA 2PK3A 4LMRA 4ROSA 4EUHA 2I6TA 5THQA 2VRCA 2C20A 4YVFA 1XQ1A 3JQ6A 4Z3DA 4RLSA 1ADGA 4CUKA 5JC1A 1U3VA 4RPLA 1E7MA 3TFOA 3F5SA 1CEQA 4MVJA 4QO7A 4RQTA 2AEFA 4WCDA 4KTVE 2HK9A 1ZXLA 4GVLA 3LVFO 4RVUA 2O3SA 3NUGA 3H8VA 5T8KC 4N54A 5JSFA 2F00A 4CLEA 2R00C 4H3VA 4NDNE 1Y9EA 4DBZA 4NR0A 3FRJA 3DDNA 1JTVA 1GYRA 4OMUA 4BKRA 2H6EA 1EK5A 4ZJUA 1P1JA 2BHLA 4P4LA 4BNXA 3FSRA 3W8FA 1WW8A 2GSDA 3FI9A 3WICA 4G5HA 2HKIA 1PQWA 5DF1A 1XLTA 1UZMA 1NQTA 3O03A 2HK7A 5IDQA 1I36A 4I5DA 1ZO8A 3V5NA 3T4XA 1C0PA 3L6OO 1JW9B 5TC4A 1YOVB 3AOEC 1UZNA 1CJCA 1NWCA 3H9EO 4I9HA 1DBVO 2PNFA 2Z5LA 4OOFA 3AOGA 2GR9A 4XR9A 3WTCA 1P1RA 4O6VA 3VVBA 4CUZA 3ZWBA 1QP8A 4BO2A 2FOIA 3I9LA 1NAIA 1MUUA 3RU7A 4WNIA 4CMIB 4AJPA 2BFOA 1JWBB 3EZYA 1T4BA 2UDPA 2YW9A 4WASA 1GUYA 1R6DA 1U4OA 3ZWYA 1N9GA 5L9AA 4DXHA 1GAEO 4Q39A 1JVSA 4PLVA 3K96A 2W2LD 3O26A 1HE2A 3PDUA 4E2YA 1MC5A 1DRUA 1I33A 3I4FA 1U7HA 3WBBA 2W2KA 4YWJA 4WUVA 1E92A 1X7HA 1LSOA 2G0TA 3JTMA 3LC1O 4FDAA 5FF9A 3NTOA 3GG9A 4DMLA 2B5VA 4O1MA 3C7DB 1LJ8A 2EKQA 2Y1GA 4WOKA 2E49A 1PL8A 4PG8A 1ZH8A 2IE0A 3MOIA 5IDWA 1PGPA 2QYTA 4D7AA 5CDTA 2IRWA 1FMCA 2HMSA 3U4IA 3CMCO 4RPKA 2Q2VA 2X86A 2IYPA 4JX8A 7ADHA 4AJOA 1LLQA 3AOEA 1BDMA 1DDOA 1IPFA 2YY7A 3KOUA 1E1NA 3I6IA 2O2YA 4FW8A 3FR8A 1X1TA 3CE6A 5B4VA 3K2BA 4CMEC 1J5PA 2C7VA 4KUGA 2NM0A 3JQ9A 1DXYA 3R3JA 1PJLA 5F3RA 4XB1A 3EAGA 3VHRA 2I3GA 4BNJA 2FSSA 3VKUA 1E3SA 1JA9A 5B12A 4PRLA 1U8FO 3FN4A 3IOYA 3GPIA 1IB6A 4EEXA 4IDEA 4WLEA 2IEBA 4L4RA 2VYVD 3HZZA 1FDUA 1T1RA 2NTNA 4TSKA 2X0JA 3S2IA 2FR0A 3E6AA 3OEWA 3F3SA 4GMFA 1BXZA 4RDIA 4XX0A 4AVYA 1E3IA 1B8PA 2DBZA 3PEFA 1V3UA 5G0WA 2OUIA 1TT5B 1AHIA 1H6BA 3ZI0A 1X0XA 2ZYAA 3VVCA 4PN3A 4RCVA 4ALJA 1Y8QA 1GQQA 4XYMA 3C7AA 2X5KO 3IIEA 3MJEA 3ENNA 2ZTUA 2B69A 3TOXA 4IJVA 4CV3A 2EGGA 3WIEA 3W8DA 1MGOA 5L4SA 1LC3A 4IDCA 2I65A 3RFTA 5HTOA 1PEDA 4EJ6A 3RJ9A 4KP7A 2SCUA 4K9DA 4B79A 3IP3A 5FEUA 3W4JA 1PGOA 3OJOA 4K6FA 4QUKA 3QP9A 4DIFA 3RBVA 5G0SA 4CMEA 3GUCA 4HFMA 4B4UA 5KVVA 4I5GA 1PWXA 4TMFA 2HCTA 4WOJA 3VH4A 4H16A 5KJCA 4TZKA 4M55A 3BAZA 1LTHR 4Q3BA 3ITKA 2HSDA 4BGVA 1BSVA 2Q4BA 3VZRA 1A71A 4YPOA 1HDGO 2O7SA 4RPJA 1VJ0A 3ONEA 4MVJE 2HRBA 1B0AA 2DTEA 2QX7A 4YAEA 1TI7A 4IDBA 4RVDA 5FYDA 1QYWA 4R5MA 2EG9A 5HS6A 5IG2A 3K5PA 4A73A 3JQAB 3WNQA 3SEFA 5CDSA 4HBGA 3KXDA 1B16A 4UUPA 1ULUA 1QV7A 3BMOB 1GY8A 2PGDA 5HWSA 3NJ4A 3NGLA 2DLDA 3V2HA 5B4TA 3GRPA 1H94A 2Y66A 3GN1A 4Y8VA 3R0IA 4U0JA 3CINA 2OBNA 3STHA 3EZLA 1ZMTA 4LCEA 4EW6A 3W1VA 5KKAA 2W98A 1LEHA 2OORA 3ETDA 3LZ6A 2FSVA 2GLXA 2QIOA 4I9NA 2VRCD 2CDCA 4YAKA 3C7CB 3P2YA 2WE7A 1HLPA 2VOEA 3ICCA 3IMFA 4DREA 1VC2A 1E0DA 1PJ3A 5FWNA 2E48A 4XEHA 2C54A 3NDJA 3MWDB 2X0RA 3C1OA 4NBUA 3IUPA 1R37A 3D7LA 5L45A 1B15A 3IKTA 3PIIA 4PLCA 1CDOA 1BHSA 4Y6SA 1PJBA 1UP4A 4ALIA 1Q7BA 3FR7A 1Z74A 4XR4A 1EZ4A 5CPFA 1HSZA 2ZB8A 4KWIA 4BNYA 2RH4A 2WDZA 4CQMB 1GUZA 4M49A 1YL5A 1C0IA 3Q3CA 4P38A 4E2XA 4FGSA 4B3IA 1OBFO 1KVRA 3CEAA 3GEMA 4QECA 4IS3A 2CNBA 2JHGA 3GNTA 1MA0A 1W73A 1T24A 2V6BA 3DO5A 2CY0A 3NKLA 4BS9A 4CQMA 3AI1A 3DAGA 3LC2O 3WJ7A 3CPSA 4K6CA 1HLDA 1Y1PA 4KUHA 1I10A 4R41A 2VHZA 3VDRA 1M2WA 4J1NA 1P0CA 1H2HA 1TA4A 4JQCA 4GX5A 3PJFA 1J6UA 2ZKLA 4IXTA 5IN5A 2C5AA 4Q3EA 2GN8A 3JYPA 2BMAA 1PS9A 4QTZA 3MJTA 1HYEA 3UN1A 1D7OA 2CVZA 2HMWA 4UVGA 1C1XA 3PIDA 1ZSNA 3ZWWA 3WMXA 1Y5MA 1ZK1A 4PVDA 2NVBA 1SPXA 5ER6A 2I5PO 5DBIA 2J5RA 1UXJA 4J0FA 3LYLA 1KC3A 3F9IA 1IOLA 1WMAA 3GQVA 4LRTB 5AXAA 4NBVA 1DFIA 4LVCA 4CM1A 1EVZA 1U3UA 4D45A 1T2AA 4Y6PA 4PGFA 4R69A 4ZHSA 2IODA 1Z7BA 5TS3A 3NDIA 1P3DA 2I99A 3H4VA 4NH4A 4FFRA 2H1SA 2QZ9A 3KYDA 3AY6A 3TF5A 4E5KA 4FB5A 2B5WA 1G0NA 3BHMA 3VOSA 1JKJA 1D4FA 2AXQA 4GQAA 4BMVA 4M54A 3E5MA 1U2GA 3QVXA 1WNTA 2D2IA 3QWHA 1J49A 3ZV3A 4ALMA 1M66A 1XA0A 3WGQA 5IZ4A 4J2HA 4J16A 4X54A 1CIVA 1ZK4A 4Z9YA 5A1TA 4R1SA 4GX1A 1EE2A 1NNUA 4WJZA 3WQSB 2VRBA 3OF2A 2GGSA 1HETA 3GAFA 1LSSA 4JK3A 3ZWOA 4XYLA 4D42A 1N7GA 4YR9A 5A5EA 3P19A 4L73A 4JLWA 3HB5X 8LDHA 2WEKA 5HM8A 3ZV6A 2P91A 4E5MA 3RC9A 3B6ZA 2VWGA 3WWZA 3SC6A 3ZGYA 5KWEA 3TRIA 3NGXA 3QVOA 3PWSA 2RCYA 1H5QA 4I1IA 5JO9A 4L0QA 4OYRA 4K1LA 3RWBA 2VUSA 4GX0A 3U09A 1M6WA 1E1KA 1SEPA 5ENVA 4QO8A 5G0VA 3WWYA 3R3SA 2WSBA 4BL5A 3RFXA 2XXJA 3WDSA 5A9SB 3A14A 3MTGA 3QRWA 3OIGA 1VSUA 3N74A 1WAMA 5KVSA 3E9MA 4GH5A 4TRRA 5AYVA 5DCYA 3LT2A 1QXSA 1PJCA 2EKLA 3P2OA 1N2SA 1TB4A 4U6SA 4EUFA 2ZJ1A 2CSUA 9LDTA 5BSHA 3RUHA 4U5QA 4RO0A 4TWRA 3KLMX 2C07A 2YHIB 1C14A 4CMGA 1F14A 2CF5A 4M87A 3GR6A 2Q1TA 1IL0A 4O63O 4CLOA 1U9JA 3R6DA 1D1SA 5HS4A 4HXYA 4A26A 1O8CA 4YAGA 1F8GA 5BR7A 4IGFA 3PFWO 1N1GA 3RBXA 5JAZA 4O5OA 4R4JA 1G0OA 2GYYA 2CDBA 1Z75A 3G17A 3L0DA 3LT4A 4R3NA 4BMNA 1FJHA 3BMQA 1NQ5A 4QQRA 3LT0A 4FBGA 4BNLA 4D46A 4R68A 4R16A 3NV9A 3ANMA 4N7RA 3GDFA 2RHRA 3FNEA 1AN9A 2FR1A 1R15A 3HSKA 3TZ6A 1PQPA 2BI8A 1H2BA 3DL2A 3DB2A 2FPIA 4NJMB 1P1KA 2O7QA 2UUOA 4MP6A 2B83A 5EQDA 2VZ0A 4LISA 2D0IA 3IAHA 1DIHA 3PJDA 2Y1CA 4HP8A 2PWZA 4D0RA 5KOIA 3D0OA 3QY9A 4EZBA 3O8QA 2PV7A 3RQSA 2Y67A 2Q50A 2HUNA 4UREA 4KOAA 2HRZA 5IDXA 5I9LA 1PZHA 3TZHA 2DU8A 1U28A 5IJZA 3I9MA 3PYLA 2QRJA 4OXYA 3GVCA 4J1TA 4ZQGA 1DAOA 1IHYA 2C0CA 2EP7A 1YRLA 2Y1DA 4W7IA 4DVJA 3E82A 4J2OA 3A1NA 2W4QA 3KEOA 1LLCA 1GV1A 3KM0A 4AJ2A 1BTOA 2X9VA 2HDHA 4CQMD 4DIOA 3C1TA 4MKXA 2X6TA 4RVGA 3WGTA 5EQFA 2FMUA 2C7GA 4BKQA 3K31A 2HJRA 5LDGA 4IDGA 2VQ3A 3ETEA 2EEZA 3U4CA 1YS4A 2A4KA 1YQDA 3PJGA 3DBLB 5AOVA 4YJFB 4OHUA 2G82A 3ZW9A 1GDHA 3W6UA 1IULA 1LRJA 2VUUA 4IDFA 2D4AA 2D5AA 4RF5A 3KYBA 4OAQA 1YKFA 1DJQA 2RHCA 2EXXA 1R4NA 4UEKA 4R1NA 3GH3A 1IZ0A 1DRWA 2A9FA 2O4UX 4BB6A 1MFPA 3DZJA 5BSEA 5EL0A 5J23A 4JCOA 4W9NC 2ZYGA 4FC7A 1Z73A 3ASVA 4OM8A 1WP4A 2I76A 3NT5A 4F6CA 1NVMB 3QWAA 3BHJA 4JBHA 4WEOA 5I7SA 4N18A 5JPIA 3LQFA 3PDJA 3Q9UA 3KHUA 2O3RA 2UUPA 4CM4B 3GRKA 4CMCA 1O9BA 5IDYA 2EKPA 1KBZA 2NWQA 2PZLA 3T7CA 1V3TA 4WLUA 2YQ4A 1G1AA 4E0BA 1JU9A 4Z6KA 4XRRA 4HNGA 1PZEA 2P4HX 2GNAA 4Q3NA 2B37A 4RZIA 1XEAA 2RBEA 5F5LA 1I24A 4BGEA 5L53A 3WGZA 2F1KA 3WSWA 4E6PA 4OIMA 2V65A 2QYSA 4IDAA 1ADBA 1JDJA 3DONA 1ZJZA 1P9LA 4EEZA 1F06A 3GC6A 4R5HA 2J6IA 4E21A 5C5IA 4FJ1A 4AL4A 1PU2A 2Y68A 3JD1A 1E5LA 2W2KB 2XAAA 3PTZA 2OHXA 5DBGA 3WIDA 4KQXA 4BGIA 3FHLA 4WCFA 1SCUA 1IE3A 4CMJA 3HDJA 1LC0A 4CL8A 1EVJA 4XIYA 2V6MA 5JY6A 1YJQA 5JAQA 4WLOA 4FC6A 2VOJA 1BXKA 4S1VA 3X2FA 4FQ8A 3GHYA 3VTZA 3ETGA 3PGXA 4AJKA 4BIIA 5JCJD 1ZJYA 2EWMA 1ENOA 3DMTC 3VPXA 3NYWA 4PG4A 4FD3A 3VPHA 3KBOA 1I3MA 1IY8A 4PLPA 3GPDG 1Y6JA 5IZCC 5JBIA 2VT2A 3OHSX 4BO8A 3UHAA 1NYTA 1ZK2A 3EUWA 1MXHA 2I67A 2JFFA 3U4DA 3GNQA 4GI2A 1G6KA 3IQDB 1T26A 2JFGA 5A04A 4RVFA 5ADHA 2FP4A 3CSDA 4Z0PA 3GDOA 5LC1A 1MC4A 2D5CA 3HFSA 2NVWA 1UDBA 1LDBA 3I52A 4U0KA 4BQRA 1A4IA 4P4NA 3MJSA 4JROA 2DPHA 4HADA 3RC7A 5IF3A 2Y93A 4HFNA 3UVEA 1GZ3A 1M6HA 5KIAA 3KSZO 2PFGA 5DP2A 1MFZA 2J8ZA 1FDTA 3ZHBA 2FPPA 5JC8A 1H9BA 3PQEA 4MOWA 2EV9A 4BO7A 1K3TA 3ZZNA 1B14A 1T2DA 4J4BA 1MLDA 1O95A 4NFYA 4Q3AA 1WDKA 2NU7A 2X1HA 3RFVA 1HEUA 3HN7A 3U49A 2PA3A 2VNSA 1HYGA 3SC4A 3D4NA 1UDAA 5JDCA 4XRGA 3K6JA 4GKBA 5DCWA 3RC2A 4CV2A 2JFHA 4W4TA 3RC1A 3UUWA 3FPLA 1RM0A 4XQCA 4RQUA 3AW9A 4CM5A 1HRDA 3FD8A 3ADOA 2HO5A 4YA6A 4RZHA 3COSA 4DLAA 4II2A 1WDLA 4ID9A 5KTKA 2PH5A 2O23A 2CZCA 3NTQA 1LUAA 2JD2A 3WTBA 1Y9AA 2D1YA 3E18A 5KJEA 3UGKA 1P1FA 1PSDA 2J3IA 2Z95A 4JNKA 1NTOA 1SB9A 3VC7A 3WNVA 4B3HA 1NR1A 2JJYA 3F1LA 4M89A 3VAZA 5ILOA 3FCOA 1VI2A 3VKVA 4BO5A 2YHIA 1CF2O 3DOCA 3DTYA 2AHRA 4XDZA 1KYQA 5CFZA 1E3EA 5C7LO 1XQ6A 2HQ1A 4TKLA 3I5MA 1V9LA 3OJEA 4L8VA 3TN7A 1R4MA 1A5ZA 1LXCA 3R1IA 4CQLA 4IDDA 1UP7A 3GF4A 5L7WA 1T2FA 4N5NA 5EINA 4YDRA 5AXBA 4DYVA 3FNHA 2J5KA 1R4NB 5CEEA 5IFLA 1X15A 2HMUA 2GZ1A 5TLSA 3K2EA 2VWHA 3ABIA 1AXGA 2Q45A 1O94A 2X5OA 1E3WB 2GRAA 3JYQA 4AJEA 2PZJA 3KSUA 1EVIA 3F4LA 4MJLA 3CZMA 3DFZA 1P33A 5DBFA 1IYZA 1E3JA 2GUGA 3F5QA 3FWZA 3CH6A 1LQUA 4IQ8A 2X58A 4L4XA 4YQYA 1P1IA 3MTJA 1HDXA 3JQGA 5CDYA 5CPBA 3H5NA 4ND4A 1DAPA 1PQUA 4Y67A 1CERA 4D3FA 3DZHA 1EMDA 1RWBA 2J3KA 4B8WA 3D64A 4D43A 3GVIA 4PLTA 4CMIA 4NU5A 4QFDA 4WECA 3WFIA 3PHHA 3DWFA 3Q9NA 3PRJA 4EDFA 1GPJA 3K92A 4YB8A 2B0JA 1N92A 4M1QA 1Z45A 1AHHA 3I9KA 3ONDA 4J9VA 1ZIDA 4PLYA 4PLWA 5U1PA 3IUSA 3AU8A 1QSGA 3D3WB 1LX6A 2PKQO 3QQPA 3ZHZA 4BO3A 4RJTA 1ADFA 2IYOA 2V6FA 3RUAA 4BNKA 5JMWA 3UH1A 3ASUA 1GD1O 3H3FA 3SX2A 2JD0A 3M6IA 3BMCA 4YT8A 2Q1UA 2PKQP 3AM5A 4CM9D 3HDQA 3FNFA 4ESOA 1IHXA 1F8FA 1YDWA 2GN9A 2OL4A 3W6ZA 1LRLA 5T64A 3ZWAA 4L74A 3A9WA 4YJFA 1VSVA 4XCVA 2WE8A 1YJ8A 3B20A 2EW8A 4PFJA 4UUMA 2YV1A 3JQ8A 3D3EA 3MCVA 4OOEA 2BLLA 3QWIA 5AVOA 3HWRA 3UCEA 3BTSA 1YDEA 4PZCA 1J4AA 1GCUA 4J90A 3G3EA 3S2EA 5GZ6A 3H2ZA 5IZCA 4IBOA 2ZB4A 3WLFA 3JYLA 4UVIA 2D59A 4PLZA 1M75A 5TNXA 1ZCJA 1A7AA 3ANNA 3BIOA 1HE4A 3JQ8B 4WNCA 4TVBA 1ISIA 2JL1A 3BTOA 5T57A 4BNFA 1UH5A 4ONEA 2AG8A 1XWFA 4KWHA 5CEFA 1FDSA 1U3WA 3JQBA 1S7CA 2VHWA 3DHEA 1GV0A 2C2XA 5H83A 4BKOA 4BOYA 1L7DA 1YBVA 3IKVA 2GERA 3IC5A 3EVNA 2Q4EA 4GMGA 1TT5A 3C8MA 1YL6A 4Q3CA 1BVRA 2CVOA 2JCYA 1GPDG 4EYEA 2DKNA 3HHPA 1PR3A 2WTBA 2WD7A 1UZLA 4E3ZA 2ZK7A 1ZNQO 3PQFA 3KEQA 1UR5A 3GHHA 3RU9A 4QFCA 4MIOA 3VZSA 3PYXA 3ROQA 1E6EA 1GZ6A 1UDCA 1PTJA 1HXHA 2B4QA 5AQ1A 4GAEA 3DZGA 4BNGA 1DPGA 4IPTA 5FFFA 3AU9A 3H7AA 5T8KA 3D4OA 4G65A 2WD7B 3O8QB 3K73O 2NVUB 1J0XO 1F12A 4OH1A 4H7PA 1KVUA 4EITA 1F0YA 2UAGA 1XGKA 1VE9A 1ADCA 5U9CA 4KDFA 2POQX 5ICMA 1NFRA 1SNYA 1E6UA 2G76A 3C24A 4J43A 2B4RO 3WLEA 4D44A 4QSMA 3BA1A 4WEQA 3V1UA 4BNVA 3BMNA 3QV1A 3D5TA 4RL6A 4DGSA 3ZWPA 1YB4A 1YB1A 2NNLD 2YUTA 4IXWA 4DTIA 1SZJG 3ZU2A 3O4RA 1XG5A 1QV6A 4IQ0A 4LW8A 2JKVA 1H9AA 3DAPA 3GLQA 1JKFA 2C59A 3PZRA 4INAA 5CEJA 5HA5A 3KYCA 1DIRA 4RLHA 4BNZA 3O38A 3B70A 1SB8A 4O0LA 1EQ2A 1S6YA 3JCZA 3GUYA 4IIUA 4AFNA 3KLPX 4QEDA 2O3QA 4XJTA 5AXDA 3ENKA 3Q6IA 1MB4A 5T5QA 1Z6ZA 2YHUA 1QKIA 1HKUA 2VCYA 1IPEA 5BNTA 3HFGA 3AWDA 4MP8A 4MIYA 1YGYA 4Z9XA 3Q2IA 4ZQFA 3LLVA 1UUFA 1WZIA 4FSHA 4MVJH 3K8ZA 4Z0TA 3AJRA 1ZXBA 1X13A 4B4WA 4CLRB 1DOHA 4CV1A 2JAHA 4XYEA 4II3A 1KY5A 4FJ2A 4GLOA 3ZV4A 3HADA 4J7CA 3UAGA 4I8XA 4LSMA 2CUKA 3LSYA 1XKQA 4BNHA 1VKNA 4FIZA 1XIVA 4CODB 3PLNA 3AUSA 1HDOA 4F46A 1DEHA 2IXAA 1SBYA 4CM9A 3X2EA 4E5PA 4CMBA 2Q49A 4HX5A 1B26A 2Y99A 4LMPA 5LCXA 3LU1A 1E7QA 3QW2A 4XIJA 3MEQA 2YZ7A 4MVJF 2Y0CA 3JQBC 3AFMA 3P7MA 4RF2A 2VHVA 5H81A 3WOHA 2Y05A 5A03A 1GADO 5JFOA 5L40A 1UJMA 4PIVA 1Y8RA 4NK5A 2YDXA 3WB9A 4C4OA 3P5SA 3E48A 4MO2A 4P4GA 4ZQHA 4E5NA 3QVTA 3SJUA 3TDKA 1T2CA 4FFMA 4YJHB 5A02A 2EJWA 1JQBA 3D5QA 5TGDA 4OKIA 3NEPX 3OA0A 3UW3A 1Q0QA 2OP0A 1A27A 3OSUA 5TRTA 3QWFA 4RVSA 4YAJA 4IMPA 2XPCA 4OXNA 4RF4A 2PGJA 3WGHA 3E1KA 8ADHA 4AJLA 3V8BA 3Q0EA 1PGQA 3ORFA 1RM3A 2QHXA 1SAYA 3QJ5A 1XR3A 2NTJA 4S3MA 2DPGA 1JLLA 2QRLA 3OJLA 3BMCB 2Z1MA 3G79A 4Z3KA 1ZK0A 3QIVA 3ZWVA 2AMFA 4OXKA 4CQLB 1LRKA 3RSHA 1EEHA 1V0JA 3B1KA 4IQGA 2YJZA 1T4DA 2AW5A 1Q7CA 3DZKA 4NQZA 4B7XA 3RJ5A 1VPDA 1BW9B 3G1UA 1ARZA 1KERA 4OSPA 2UVDA 3ZHXA 3GA0A 2J5QA 2VYVA 4CM3A 2JCVA 3EC7A 1R0SA 1UAYA 3B1FA 1NHWA 3ZNOA 2GCGA 1KETA 1D1TA 3CMMA 1RYEA 1LU9A 3GT0A 1QYXA 4A7PA 3AM4A 3BMQB 2OXIA 2NQ8A 2GPTA 2CF6A 4JJGA 4E31A 5JDCC 1RKXA 1UXIA 2EJVA 3TPCA 3WS7A 3JQEA 3L6EA 1DFHA 1XDWA 2FZEA 3PP8A 2HAEA 2OBYA 4NPCA 4NNJA 3DBVO 1Q0LA 3GNSA 4IJKA 3MOGA 1I2CA 2DBQA 1X1EA 1EBFA 1PX0A 3JQDA 2Q3EA 5JLAA 1DFGA 3WGOA 3I23A 5BNFA 4CR6A 5I7FA 4I5EA 4ZU3A 1ML3A 4DQUA 1E7SA 3GAZA 3OA2A 2E82A 1PJ4A 2Z1NA 3UXYA 3VTFA 4URFA 4DBVO 3ANLA 2Y0EA 4LSWA 4WCFB 3G49A 1BMDA 3G1TA 3AUUA 1LSUA 3PHLA 2O50A 2W90A 5DDIP 3VZPA 2IEDA 3PZBA 2QW8A 1ENPA 5CHEA 3ST7A 5G4LA 4J9UE 1C0LA 4ALLA 1C0KA 4RV9A 4KZPA 1UXGA 3PWKA 2NVUA 1YQGA 4WLFA 3F4BA 3DXFA 1N7HA 1O6ZA 1DRVA 1LLDA 1M67A 2P5UA 1P74A 1ISFA 5BQFA 5KVQA 1ORRA 1JAYA 1NQAO 5I9NA 3DQPA 2B35A 4TRMA 1YBAA 3PK0A 2AQHA 4OQZA 1N5DA 2C29D 5IXSA 1Q7GA 3F1KA 2ZB3A 1VJ1A 1H93A 4XGIA 3K30A 3WBFA 1W4ZA 3NAQA 3OETA 1DO8A 3PLRA 2AE2A 2DTDA 1RM4A 1LI4A 3HQ4O 4W99A 3VH2A 1LA2A 1P0FA 4CLDA 1HF3A 5L95A 1BG6A 3GOHA 3OICA 3I9JA 4JP3A 1NBOA 4J4HA 1VM6A 2PY6A 4XYGA 4YT5A 4N5MA 4CLXA 3U62A 1BGVA 1U5AA 1Z7EA 5KCZA 2BFAA 4YEDA 3DBRB 2X0NA 1VLLA 1GEGA 4FPXA 1A4UA 1X14A 1YL7A 2NV6A 2X23A 3OJFA 5KJ6A 5K6AC 2AQKA 5EJ2A 1C1DB 1I3NA 1NFFA 2GF2A 4R51A 3H9JA 4XQEA 1LSJA 3V2UA 4E2WA 1HTBA 1R12A 1LDEA 2E6UX 3ZH2A 4JBIA 1BDBA 3FPCA 1DHRA 4PCVA 4BVAA 4UUNA 1GTMA 4L76A 1SC6A 4AICA 4PZEA 4ITUA 1U3TA 2EIHA 1SOWA 5B1YA 4TROA 3DZBA 3L77A 3O9ZA 4ZN6A 2YV3A 2ZB7A 3NRCA 4W6ZA 4E5YA 3GG2A 3W8EA 2PH3A 4P8RA 4J1SA 4PG7A 2X9GA 4ND3A 2P4QA 4R9RA 4OKNA 4ZRMA 4A03A 1QR6A 2GD1O 1QYVA 5TIIA 4GSLA 4OQYA 3WYBA 1NM5A 1NWHA 1TXGA 4JBGA 3KZVA 3KO8A 1PJTA 2DVMA 4MINA 5TQVA 1BXGB 2X5JO 1KVSA 5A9SA 1UXHA 4CM7A 1K5HA 3WG9A 3ZDFA 4CR7A 3SLGA 1EUZA 2VT3A 4AJJA 5TJHA 3DBHB 4CUJA 4D41A 3H2SA 2VTEA 1ENZA 1KVQA 2NU6A 2P9CA 2QG4A 1PWZA 3PHIA 2G1UA 3AFNA 2BFMA 5H82A 3RIHA 4FR5A 1OI7A 4YTEA 3HG7A 4M86A 4Y9DA 1PR9A 1HDCA 4AJNA 3CXRA 4BQPA 1A9ZA 3M2TA 5ER9A 1NX6A 4DPLA 3JD3A 4MKZA 4NIMA 4B3JA 3VH3A 4ALKA 2NTVA 1LDMA 4E33A 1EQUA 4ILKA 4JJIA 1KEUA 4FJ0A 1V6AA 1B8UA 4WLVA 4RPHA 1PJ2A 3JQGB 5ES3A 3JSAA 1WWKA 5COAA 3GGPA 3KYDB 1YWGO 1V8BA 1HE5A 1UXKA 3BTVA 2VN8A 2ZJ0A 4TVOA 3QLJA 5G0TA 6LDHA 3MJ4A 1GU7A 3PHGA 2HJSA 1YXMA 1HYHA 2R6JA 3EW7A 4AG3A 3U5TA 4GSKA 3TFQA 3UICA 2PD6A 4I5FA 3H9QA 1H6CA 1I5RA 3W4KA 1PGJA 4G81A 1P44A 1RM5A 5BNIA 2AG5A 3DHYA 4E2ZA 2P9GA 4NZ9A 3ZNNA 4DQXA 3A28A 3GZNA 4YYZA 2DC1A 1QYDA 3DHNA 4Q9NA 3MWEB 3TWOA 3TL3A 3KTDA 3AI2A 3MJVA 1Y5RA 3VZQA 3KV3O 1XU7A 3EY4A 5EESA 5F1KA 4EGFA 1N9GB 3U9LA 4UVHA 4ZGWA 1DIBA 1RYDA 5CDGA 3AK4A 4IM7A 2O4CA 2V7PA 4TQGA 5A3JA 5JNLA 4BUCA 4KQWA 1HDRA 4NHEA 3VH1A 3UCFA 3FBTA 4MVJP 3I3OA 1CWUA 1WDMA 5EIOA 5T67A 5C7OO 3WGIA 4ZD6A 1KY4A 1W6UA 5K9ZA 3WR5A 2AA3A 3S2FA 3A4VA 4BNMA 3GVPA 5A5FA 1DB3A 1U2DA 4FOSA 3JQCA 2DTXA 3H3JA 2HLPA 1P77A 3DMTA 3T4EA 3ZW8A 4BNWA 3L07A 3DEYX 4UVDA 3SJ7A 3CKYA 2VUTA 3ULKA 3H6KA 4NK4A 1QORA 3HJAA 3PHJA 4GBJA 1DC6A 5CG1A 4XGNA 4ZQEA 2TMDA 1I2ZA 4DLLA 3RD5A 3E03A 1I3LA 3A06A 3PJEA 4RORA 2ZYDA 2XF8A 1C1XB 5MDHA 1D8AA 2O3UA 3WMWA 3CUKA 1PS0A 4D3SA 3UCXA 4DQVA 3GK3A 3L9WA 4A0SA 2BH9A 3ZWNA 4DMMA 5CAEA 5IXYA 3OEYA 1WPQA 1KOLA 5BT9A 3OQ6A 1R0LA 1NQOA 1YO6A 1QG6A 3DZFA 3OQ1A 4NJOA 3TSCA 1ZEMA 2GDZA 5A3VA 4YJGA 3ZV5A 5L4NA 3NDRA 1B3BA 1N1EA 4UUOA 1B2LA 5TX7A 4MIEA 1X7DA 2FY8A 4CM8B 4CMHA 2W8ZA 2OZPA 2Y1FA 1Y7TA 2WYVA 5F1OA 1O5IA 5EMHA 1ZK3A 1YVEI 3GGOA 4BO4A 2GN4A 1QYCA 3UKOA 3V2GA 2RAFA 4CL3A 3U0BA 3GEDA 1EBUA 1JKIA 3FWNA 5COQA 2OO5A 4XGKA 3S8MA 5L7YA 3EYWA 1XU9A 3JQFA 4YXFA 2AQ8A 5ICSA 1XHLA 3ZU3A 3OH8A 2X9NA 4BNTA 3AI3A 3KVOA 1VL8A 4A5OA 4RGBA 1LDYA 3H5RA 3GN2A 1HWYA 1B3RA 3HUDA 4D0SA 4C7KA 3ZU5A 1HZJA 1F17A 3UOGA 2ZCVA 4XQ9A 4RVHA 1DC3A 1D3AA 3H9UA 1XELA 4YJHA 1DLIA 1MX3A 4DRYA 4W7HA 1N8KA 4HY3A 2Y1EA 1DHTA 1SMKA 2NACA 3Q11A 3M1AA 1PS8A 4KMSA 5DCUA 1CQIA 5KVCA 1E3LA 1GEEA 5FI3A 1U4SA 3ICPA 3DC2A 5L3ZA 4EBFA 3ZHYA 2O3TA 3UF0A 4GLLA 4Y6RA 3PGJA 1HSOA 4UEJA 2FHSA 1ISGA 2IZ0A 5GMOA 2NADA 4BV9A 3RUEA 3GGGA 3JYNA 2E37A 1U8XX 4HKTA 4W9NA 5KKCA 4IINA 1PL6A 4J49A 4HUJA 4TRNA 4B4VA 5G2OA 2FWMX 2Q1WA 3H5AA 4BNUA 5B4UA 3KETA 2PZKA 4J6FA 3GEGA 4YBZA 4KUEA 5L4LA 1SOVA 4F3YA 3ROMA 3AUTA 3B1JA 2H5LA 4F45A 4OGWA 3FF4A 1Z82A 2O48X 2D8AA 4R54A 4XJSA 5JW6A 3CZRA 3MJCA 2EERA 5AXCA 3TZQA 2GZ2A 1HDYA 4R9SA 1CQJA 2OOSA 3RVDA 4P22A 4CM8A 3OM9A 4U6QA 3OBBA 1R4MB 4C7JA 2JCXA 5I9MA 3FTNA 2TMGA 1Q2XA 2E4AA 4LN1A 2ILTA 5C3MA 2BGKA 3ITDA 3DOOA 1ZSYA 1YB5A 1ZW1A 2BGLA 2WM3A 1E3WA 1YQXA 1FDVA 2J3JA 1E77A 2WYUA 1K0UA 2WMDA 3JD0A 3OIDA 4MKRA 1ZVMA 4DC0A 1GYPA 1P45A 1TVEA 1MG5A 2EHDA 4PZDA 2ZTMA 3NTRA 1B7GO 1HL3A 5DOZA 4IGEA 4OO3A 4U7WA 3ZCXA 5I7EA 4J7UA 3PVZA 1KEVA 1MG0A 2VHYA 1WVGA 3OQBA 2X8LA 5IAAA 3EDMA 4JIGA 3KUXA 1DC5A 1LDNA 4HFRA 4AJHA 3GFBA 4FFOA 1NXQA 2OFPA 2BGMA 4U8GA 4Z9FA 3ZNQA 4BNNA 2FRDA 4XYBA 3INTA 1HZZA 3SVTA 4PG5A 4RF3A 2QRKA 4FS3A 2CFCA 2DBVO 3GVXA 5DT9A 3JYOA 4NU6A 4DL9A 5DN9A 3GDGA 3TJRA 1DIAA 3ONFA 3MZ0A 3GMSA 1TT7A 3I9OA 2PR2A 1YOVA 2A94A 5IN4A 1PL7A 4LCJA 3AY7A 2NLOA 1GCOA 1I01A 5K6AA 1LDGA 4RDHA 4IMRA 3UFXA 3IDSA 2XXBA 2VTDA 3D4PA 2Q2WA 4HNHA 5A06A 5JY1A 5A05A 4KTTE 3FBGA 3QA9A 4BB5A 2PGLA 4YQZA 5TJ9A 4MP3A 4WE3A 5EPOA 2ZCUA 4ZA2A 4FN4A 4YACA 4JJFA 5F21A 3S1LA 5F5NA 3IJRA 1CRWG 2FPGA 3CIFA 3ZN2A 2AEJA 3RBZA 1E7RA 1H0KA 4CM6A 2VZ9A 4YT4A 3D1LA 4MVJG 1PZFA 4L75A 1A72A 2I9PA 3KRTA 2DQ4A 5F1PA 4G2NA 1KIFA 4ZQBA 3GY0A 4Q3DA 2X0IA 4YT2A 3WFJA 5G0UA 3T7EA 1QLJA 1R0KA 4KDEA 2XOXA 4DA9A 4GWGA 4OSOA 1UP6A 3QE3A 5JYEA 3JQAD 1H6AA 1JWAB 4GX2A 3M1LA 4IJUA 3C1AA 4BV8A 2OMEA 3C85A 1P1HA 1K6JA 1NASA 4ND5A 2UV8A 4FFNA 4B7CA 1W0CA 4NBTA 1GR0A 2QZZA 4J7XA 1DLJA 3GZ4A 4WKGA 3D3WA 4YRDA 4Z0HO 1K6XA 1VL6A 1E5QA 4IUYA 5K0ZA 1B8VA 4HWKA 3LDHA 2YV2A 4XWYA 1AUPA 3PI7A 2NU8A 1E1MA 4UULA 4IS2A 1ENYA 1GUFA 3BTUA 2B4TO 3E5RA 3PFFA 1CETA 4E4YA 4O59O 4J91A 3I9NA 3EGOA 3L4SO 4WPGA 3VPFA 4R1TA 2PD4A 4N5LA 3V1YA 5KNLA 3FNGA 5JDIC 1T1SA 3IJPA 1OZAA 2PZMA 2VHXA 3ZWXA 3BMNB 2VYND 3CTMA 4NFSA 4CMKA 2PKRA 3NT2A 3VPSA 1E6WA 2VYNA 1DSSG 5I8ZA 2G17A 3U4HA 5GY7A 5L7TA 4AJ4A 1HE3A 4EJ0A 4RPGA 2JAPA 3TNLA 1KC1A 4MVJI 2HU2A 4CJXA 2FR8A 1K2WA 4D3DA 2QQ5A 1GFSA 2ZTLA 4BNIA 4OL9A 5CDUA 2YDYA 2O2SA 3WQQA 1AE1A 5HRUA 4E12A 2B36A 2OP1A 5DOVA 2R00A 4D79A 4ZVVA 3LF2A 4BO0A 2DT5A 2BKAA 2X22A 3E9NA 1ZEJA 4JN6B 4J0EA 1BRMA 1EFLA 1JVBA 1R66A 2IDZA 3JV7A 3WXBA 2VZ8A 4LRSB 2GASA 5JXWA 1E7WA 2CD9A 2VWQA 2WD8A 1I0ZA 5DULA 2FN7A 4PLHA 3ROKA 1NVGA 3L4BA 3QHAA 2Q99A 3OP4A 3TZKA 3WGGA 2X4GA 3WJAA 3ZWMA 2IZ1A 1Y8QB 4BO1A 3I6QA 4NBRA 1ZMOA 2BF7A 3FTPA 5ENDA 5JO0A 2W2LA 4BKPA 2I3AA 3S55A 1JN0A 3QVWA 5HBRA 3SBOA 3Q1LA 4BO9A 4K28A 1TEHA 1GYQA 1ID1A 6ADHA 5JCJA 4A2CA 2AQIA 2BI7A 1V3VA 3RUFA 3PXXA 1T25A 3DBHA 2BELA 3JD4A 3DTTA 3WSVA 1V35A 4MPDA 4B4OA 1K6IA 3RUIA 1DIGA 4DPMA 5JS6A 3I4CA 1IUKA 2VWPA 3JD2A 4NI5A 5JCXA 1I8TA 4NMHA 5C37A 1GL3A 4GL4A 1ZBQA 2HMVA 2AE1A 3V1TC 5A4DA 2D3TA 2DM6A 3TQHA 2AEMA 2C5EA 2NUAA 1NPDA 4IZHA 2ET6A 4PLGA 1RJWA 1WZEA 3ADPA 1KEWA 1BXGA 2GO1A 3SXPA 5COBA 4YCAA 1ULSA 2PLAA 1DJNA 3G0OA 4LGVA 1YONA 2P68A 4J1QA 4CLOB 1ONOA 1VRWA 2CVQA 1EVYA 4PVCA 5ITWA 3L4BC 3I83A 1KVTA 1OC4A 2DAPA 2DBRA 3KSDO 5A9RA 2DUWA 4JGBA 3NX4A 1QMGA 2P5YA 1QLHA 1WLYA 5TT0A 1YBMA 4R1UA 1EDZA 1U5CA 1KEPA 1O89A 1BVUA 1KS9A 3PPIA 3HE3A 2WWRA 1NAHA 4LK3A 2Q46A 1NVTA 2VNAA 4DIBA 3LF1A 2H63A 1C1DA 3E8XA 5MGBA 4TKMA 1Y81A 3RKUA 1O0SA 4HV4A 1VL0A 4EJMA 3JQFC 4A10A 3EHEA 4UAGA 4NG5A 5I7VA 3IS3A 3NT4A 4CMAA 2BFPA 4R01A 5L51A 2ZQZA 3F46A 3QWBA 4XB2A 1ZZEA 1IZ9A 4J4TA 3GMDA 4WGGA 2H9IA 1XYGA 3DMYA 3DR3A 3AM3A 3WYEA 1NHGA 4MDHA 1XCBA 2P2SA 4PRKA 2YFHA 5JAMA 1LBEA 2EP5A 1VKOA 1GQYA 2BRUA 3RROA 5U4QA 4XDYA 5EERA 4GKVA 1Y8RB 2ZQYA 4GGOA 2IXBA 1PGNA 3ZU4A 2WYWA 3DOJA 2Q2QA 4YAIA 2NSDA 3U3XA 3JQ7A 2PTGA 3F6YA 1U7TA 4FOOA 1PJQA 4DLBA 5DNAA 5CG2A 1ZSVA 1EDOA 4YJDA 3PQDA 3IP1A 3LK7A 4AJIA 4XKJA 1WMBA 4GPD1 1VJTA 5TF4A 2C2YA 3JQAA 5CP8A 1E7YA 1OMOA 4QT0A 1AGNA 3BMOA 4ND1A 4WK6A 4XQGA 1PIWA 1XSEA 5C7IO 4WLNA 3N58A 4F6LA 3RUDA 4NFHA 3EK2A 4K26A 3AY3A 4BMSA 1P31A 5T6BA 1A9YA 1H6DA 3LLSA 4XZ3A 1DC4A 1WXDA 1HDZA 1MXFA 3OECA 1ZKMA 1EFKA 1OC2A 1BW9A 4YRBA 4PG6A 3BXXA 1E1LA 1L7EA 4OJNA 5JYDA 2J3HA 1K89A 1ZUD1 1AXEA 4DWVA 3ZWCA 2WJPA 2NQTA 2HMTA 3OIFA 4JXKA 2CDAA 1X0VA 3GVHA 2ZTVA 2YQ5A 5DZSA 2BD0A 4ALNA 3WX0A 4BHTA 1R16A 2ZIZA 4EI2A 1X7GA 4FGWA 4A27A 2RIRA 4CV0A 4I9UA 4BKUA 4QX6A 3WQRA 2RH8A 1W8DA 2LDBA 3AUAA 2EGHA 3QVSA 5G4KA 5TSDA 4CPDA 1A7KA 1YE3A 2IZZA 1Q0HA 3GZNB 1GQ2A 1FDWA 1TLTA 3EVTA 3DAFA 3TOZA 3HN2A 3HB4X 1UAGA 3HDHA 3L6DA 3L9XA 3ON5A 3RASA 4EUEA 3I1JA 2O3JA 4ZICA 5KJ1A 3DZIA 4LVUA 5ILGA 2OGUA 4B8ZA 2G5CA 1ISHA 5BSFA 4YRAA 4FCCA 1T2EA 4R3WA 4IIVA 4IJWA 1NPYA 1I30A 1I3KA 4QXMA 5THKA 3E9QA 3JQ7B 4FFPA 4AJ1A 3INRA 2Y1OA 4ZRNA 1EE9A 4HFJA 4MVJM 1OAAA 3RUCA 2JHFA 5GZ3A 1RPNA 3EMKA 2A35A 5I8WA 1NFQA 5FI5A 9LDBA 7MDHA 1SEVA 5GZ1A 4L4SA 1FK8A 2HK8A 4GWKA 4E32A 1EK6A 2UYYA 1NP3A 3RI3A 3DFUA 2LDXA 2ZATA 1PZGA 1NR7A 1JAXA 3RAJA 1NPTO 5ITVA 4J3FA 3LT1A 1MV8A 3Q2KA 1L1FA 1OFGA 3C3XA 3GFGA 1LQTA 2EF1A 4MVJD 2FZWA 5EN4A 5A9TA 2DFVA 4WCFC 4DYDA 4CLHA 1LLUA 5LDHA 2GN6A 1BWSA 2CMDA 2PD3A 4B7UA 5BSGA 4I08A 3BZUA 4JP2A 5JMPA 4DPKA 3DBLA 1I32A 1ZFNA 3JQ9C 4H15A 2I66A 4UVEA 3OJ0A 4E30A 3DBRA 2JD1A 3S2GA 1I2BA 3BYZA 4XA8A 3KB6A 3BHIA 3W4IA 2P9EA 1U1IA 2A92A 3KYCB 2DFDA 1PJSA 3OFSA
chains in the Genus database with same CATH superfamily
5CLQA 3A4IA 5EHGA 3CVJA 3Q10A 1NLZA 4BCCA 4HN4B 4DNXA 3AVTA 1T34A 3HBNA 1GZ4A 2PUBA 3PYMA 3KR0A 4YMSA 2QU8A 4E15A 4OHVA 2GJKA 3CF0A 4DUPA 3TQOA 4DC1A 1C3VA 4YIKA 1J21A 3V1LA 5HKBA 5JE8A 3IAUA 1TYAE 2IHUA 4B0OA 5TT1A 4LKRA 2O1WA 1DQSA 3F47A 3OPYA 2H9YA 1IBKB 3L0BA 3N0XA 2FPSA 4IZIA 1MP0A 1ONNA 2BN4A 2ZDHA 3H42B 4NYIR 1OBOA 3A2LA 1LW6E 2JH9A 3PWZA 2DJ5A 4TRJA 3RH0A 3EUAA 3IUEA 3BB3A 3VC3A 3GEEA 1WHSB 3K9QO 1JG4A 1QKKA 1YCGA 5EQJB 3UWOA 1K9VF 1RXUA 2FSPA 3N7UA 4HRYA 5KJFA 1QM5A 1WHTA 3QSGA 2K4MA 4UARA 3RAGA 4P83A 1JFVA 2QQGA 3WYCA 5J4KA 3T1OA 1M76A 1GZ7A 3WWPA 2L18A 5C5DA 2ZR0A 3KE9A 1NTRA 1FF9A 4MWDA 3HCFA 2QD1A 4TYPA 1SO8A 2ATIA 1MO6A 1VE7A 1W9HA 4O08A 2JF0A 3MQFA 3QBDA 4PSKA 1SQSA 3HU5A 4GOJA 3BN3A 4GD3Q 3QQ5A 1CZNA 3H84A 2I6TA 2LNDA 4Z3DA 3TE6A 1GITA 2NU6B 3K6SB 1F2DA 1E7MA 4RPLA 5BT8A 3TFOA 1YFLA 3AL3A 3NI2A 4MVJA 2REQB 4WZZA 3RS4A 1Z8DA 3X2SA 2GM5A 1FSSA 2YBDA 4UM8B 3U81A 4C89A 5SV2A 2AMLA 3LVFO 3C8DA 3ECAA 5F3WB 4JOCA 5JSFA 4ESVA 4K9MA 4N5DA 4NDNE 2Z57A 1Y9EA 3DBOB 4QLOA 4CCAA 4AKGA 4HTFA 5H9VA 1WUTA 4ZJUA 2H6EA 3HU3A 4Y2UA 1LW7A 1P1JA 2BHLA 2ORYA 3RNOA 3W8FA 4R6XA 4JVLA 4WKNA 3SFZA 2GSDA 4RLFA 1XRNA 3WICA 4G5HA 3LNCA 1VPTA 5AW1A 1B23P 1Z0AA 1RYNA 2HKIA 4JLOA 3MB8A 4MWEA 2R6GA 4HCJA 3Q8MA 5FWYB 1UZMA 1NQTA 2R66A 4PX5A 1SU6A 5IDQA 1I36A 1U5BB 5HHTA 1ZO8A 2WPDD 1QAOA 1NLFA 3B12A 2AYYA 4XDGA 4QBTA 5TC4A 4AKTA 1YOVB 1NWCA 5F23A 1FRVA 1M2KA 2DJIA 2PNFA 1OAOC 1P2GA 2AJDA 4B3TB 3WAKA 5HKLA 1ZUNA 3SR4A 4B46A 1T2VA 4BLSA 3HJCA 3NVKI 3O1LA 1AKQA 1V11A 2OECA 4MKIA 1J7JA 3W7BA 4UXJA 2QAIA 4V0KA 1QIGA 4BJHB 3Q8KA 5AM5A 1ZOLA 2R8YA 2Y9MB 2VDWB 1ZJ4A 1DADA 2EARA 2XNHA 5IBPA 3OLQA 3KL2A 2GM4A 1MUUA 3GXBA 2JZCA 4N9WA 4YYEA 2ALJA 3OE7A 2PMBA 4Y2XA 3CSUA 4G0WA 4CMIB 3W5UA 5DNYB 1BHJA 4AJPA 2PJUA 2OCIA 4I3FA 1JWBB 2H4HA 3B8EA 1Y1KE 3IR5A 3OU6A 2ONKA 2ZU0C 2XUDA 1GUYA 2DQKA 2XX3A 3ZWYA 5EJEA 1N9GA 2NUTB 4MS3A 1U8EA 2W42A 3ER6A 2R44A 1HE2A 3LX6A 2FOXA 2HYIC 3RSCA 5P21A 1DRUA 4Y2GA 3UT5A 5AW7A 3NMUF 1RSZA 4IHAA 3KV1A 4XIIA 4ZZ1A 3U60B 2JBWA 2LKDA 2NU7B 2V59A 3LC1O 3M3HA 3NTOA 4JUCA 4LF5B 3FUXA 2W43A 3RS7A 4KYUA 2P8SA 4O1MA 3U17A 3C7DB 3CBGA 4JI7B 1Z16A 2Y1GA 3JZMA 2WB4A 3O2JA 4E1BA 1FTYA 2GWHA 4YCDA 1S2LA 2PS3A 3MOIA 1FVOA 2X6RA 5JSQA 2X2EA 4FS8A 5CDTA 1RWMA 2HMSA 1JV2B 5JI2E 4H27A 2Q2VA 1MAWA 3GFTA 2X86A 4UCWA 1UPTA 3MGKA 4JX8A 7ADHA 2XE8A 3ZY2A 2J6CA 2KLBA 2X5XA 1A82A 2FPWA 5LP6C 2GTHA 1BDMA 3CZAA 2VDMB 1II8B 3GYBA 3ND5A 5KQSA 2C2HA 5EOVA 1NIJA 3Q7RA 3AVOA 1KRXA 3MGAA 1AY0A 3WXMA 4FW8A 1C4KA 3CE6A 2DR3A 3PRKE 1CCWA 3ODPA 2WT9A 3AR4A 1ZD9A 1UBJS 1J5PA 3ABQB 4CMEC 1KAHA 2NM0A 3ROTA 5DXFA 2PBLA 1RLJA 4XB1A 3OCXA 1NG9A 4O5AA 4LTMA 4ANFA 1C9YA 1W49A 5LBIA 1E3SA 4B17A 3LUJA 1KZHA 5B12A 1Z6QA 5IF9A 3Q9LA 1KSGA 2B0CA 2HXSA 1J42A 2OTCA 1AQ6A 2W2XA 3GPIA 4ZOCA 4EEXA 5JATA 5KSOA 4DNQA 3HZZA 1FDUA 4TV9B 2GUWA 1A04A 4GPIB 2ZRAA 3VJMA 3JWHA 1CBUA 4H3SA 3O93A 4RYDA 4WXEA 4XX0A 2C9CA 3KU4A 4GMFA 3RVJA 3KKPA 2CHVA 3OFKA 4QJ4A 4U5XA 3PEFA 1KYZA 4U00A 2OUIA 2JIPA 1AHIA 4D8UA 5HW0A 5HUQA 2K7FA 2I7TA 4RMIA 1E5TA 1VL2A 3QIAA 3RKSA 1GCGA 4JYPA 1Y8QA 1WXHA 1Z5VA 3LCUA 4W5WA 2PS1A 3D8HA 4Q9IA 2WZDA 1CY7A 5DXJA 3L2OB 4JUFA 1TJYA 2JI8A 3HP7A 3TI9A 2XWJI 1PEDA 3LY7A 1Z26A 1L5FA 3MSCA 4X90A 3LIPA 1K7EB 4J0DA 3W7VA 1H2WA 3IVAA 5A7FA 3G88A 4B79A 5IH7A 2I8AA 2XF2A 4O2BB 1PGOA 3OLXA 4K6FA 3VPAA 3QP9A 4BN5A 3W5AA 1TYEB 2CDRA 5EWJB 2XE6A 4PYIA 1XRQA 3LY8A 5G0SA 3SXJA 2JPDA 1YFZA 1TUGA 4NCNA 1OWOA 3KAJA 3UMSA 1JMVA 3UC5A 4DY4A 2HDWA 3ZU6A 4WOJA 2CXPA 4H16A 4WD3A 1YQQA 5D85A 3SNHA 1U6KA 3AR6A 2HSDA 5AT1A 1TEZA 1DRKA 3HA7A 3KJGA 1UKAA 3U4AA 2Q1XA 2Q4BA 3M6FA 5M7EA 1Q3TA 4HDMA 4UE2A 1JJBA 1CJUC 2HRBA 2IPNA 4IQFA 4KXYA 3FPKA 4RVDA 3HYSA 1NATA 4MTCA 5FYDA 3RRNA 4ETMA 1JU3A 1S5PA 1C2YA 3GCWA 3KFLA 3K5PA 4R1LA 3U31A 4G5FA 2DYKA 3RF7A 1B16A 1ULUA 5F2OA 1PFYA 3X43A 4B3RB 1ZU5A 3NJ4A 3QYPA 2QGNA 3DO6A 1L5RA 3ZUGA 1E94E 3ETJA 3Q85A 4MW4A 5B4TA 1DTWA 3EXIB 2XMRA 4MVWA 1H4QA 1Z0ZA 5IVPA 4IFTA 3R0IA 2OILA 1GGKA 3KHKA 3WP0A 3ROZA 1M74A 1WY7A 2FNAA 2O2DA 3EZLA 3STHA 4EW6A 3D0QA 5E4JA 1RIIA 4IP0A 5KKAA 4EFDA 1LEHA 2O8EA 4LIPD 1FMFA 3ZPXA 3JQQA 3OQMA 2XXAA 4K9LA 4Q37A 3LZ6A 3UJAA 3E9RA 3RRYA 2RBGA 3UYLA 2P3SA 5TMBA 1JEQB 2VRCD 1C81A 2QRZA 2V6JA 3FMGA 4J7AA 3P2YA 4DLNA 4YAKA 3ICCA 4DM7A 3IMFA 5CA0F 3IMKA 1O4VA 1OX6A 4OHXA 4O4IF 5BV1A 5FWNA 3VR5A 3KQWA 3NDJA 1CQJB 3C5CA 3AI7A 4C4AA 2UZ1B 4NBUA 1I4OA 1VTKA 1CT9A 2YXBA 3K7EA 5L45A 5K8UA 4N3NA 2VA9A 2FPXA 2JFNA 2XUKA 1DJLA 2PBZA 4PLCA 4Y6SA 1PJBA 1UP4A 1IVSA 1JEYA 3AGPA 4PS1A 4OLAA 4DRZA 1PJAA 2W4IA 3IRUA 2GBGA 4EUEA 3C7KA 2XVYA 5IH3A 2RH4A 1I6KA 1VHWA 2D0OB 4OQ4A 4DMUB 3I2YX 1X38A 2KX7A 4DIMA 3UXEA 3PPWA 1Y4SA 4X9XA 2R96A 4B3IA 1V4VA 2QZ4A 1FX0B 4ENTA 4DAOA 1KVRA 2FN9A 3VR5H 2YMMA 2XMBA 3TLZA 3SP1A 2YZNA 2AW3A 5LB4A 3H13A 1MA0A 3NW9A 1IY2A 3CGGA 3UPUA 1W73A 5AK6A 5H3CA 3RWMB 4HBZA 3FRIA 4ZPJA 2RC5A 1T4MA 1AKVA 2Z83A 3NKLA 3OI7A 2P3QA 4U2FA 2I22A 4BS9A 2XUHA 1NW9B 3AI1A 1KP9A 2BHRA 4HMPA 4MXDA 4HRXA 3EZNA 4V2IA 3WJ7A 4B73A 2GX6A 3CPSA 4KUHA 3UNXA 4QGHA 2Z4RA 5ENZA 4AY2A 1H05A 2FN3A 3KS9A 3U44A 1P0CA 1H2HA 4ZI7B 4QM7A 4JQCA 1U2GC 4BWFB 4JUAA 1J6UA 3W34A 4MGKR 3W0LB 3JR3A 5EE5B 4X7RA 3L7NA 2MSNA 1M10A 4Q15A 1XCLA 2FZLA 2CXHA 1GN9A 5FUYA 1M1NA 1UFOA 3L8MA 4U2CA 3JVDA 2H85A 1N4DA 2LBPA 1G4UR 3MJTA 2NU8B 3UN1A 2NOAA 4EIWA 4L2IA 4YH1A 2EKDA 1VGVA 3ECSA 1Y5MA 2O7VA 4UHFA 2DSTA 2YNMD 3M70A 5B57C 2AC2A 3DPUA 2I5PO 3KAQA 4MUXA 5DBIA 4P3PA 1OGJA 2ZE8A 2FPLA 2GCOA 4PPQA 3OIYA 3OD1A 1J2TA 1LVUA 1SD2A 3OZUA 1W4BA 2MTBA 5IEBA 4LRTB 3F9IA 4PYJA 3L1IA 1OV4A 2O0MA 2VP5A 5AXAA 4YROA 4QBGB 2X8BA 1JHOA 2ECQA 2IDMA 4LHXA 4LVCA 2BGTA 1IU9A 2P35A 1T2AA 1B6GA 1KDPA 1V11B 2AZMA 2B3DA 2IODA 2XOKA 3GLHB 4MUMA 2WWFA 1PWYE 1SVKA 2I99A 4JYBA 5FTMA 3UK7A 2NZUG 3M4JA 5FCDA 1TMGE 3ZIUA 3AY6A 1SZDA 1BXRB 2WAXA 2VPXA 4HAUA 3WHPA 4E5KA 1XEXB 4FWIB 4GC9A 4RCYA 2B5WA 1G0NA 3NIFB 4FB5A 2QTRA 4MQ4A 2HADA 1JKJA 1SQ5A 1NJ8A 2PKXA 4FDVA 2AXQA 3CS3A 1MTOA 4M54A 4KLAA 4N8SA 3SJZA 4QOEA 1JJAA 3L8ZA 3DEIA 5H59A 1U2GA 3TMAA 3WQBA 3ZEAA 4EGCB 5JFGA 3EXG1 1COZA 3LC0A 1KARA 5ELLA 3TIIA 1BOOA 1Z6AA 1NRXA 5CB6A 1ZHOA 4FZ3A 3GA7A 5BPHA 4F92B 4Z9YA 4I3GA 4R1SA 2KYRA 1EE2A 4GX1A 1TCCA 4LC9A 4PAOA 4WJZA 4JGIA 4XGRA 4Q9JA 3ZE9A 4LDZA 3DM5A 4G8CA 5HJEA 4O02B 4TL6A 1SJ9A 2A78A 1H2YA 3DPSA 3V80A 3IHKA 3H2IA 3E15A 1LSSA 1IZZA 1S02A 4X8HA 2ECOA 4HXGA 3KB2A 4XYLA 3U3MA 3O8CA 2UZ4A 4HAVA 1UK9A 5EUBA 2WEKA 1NW6A 1YNSA 2G25A 4JJKA 2DBYA 3RC9A 3KT6A 3UKJA 3ZV6A 1KP3A 1E9RA 3RYFB 3ZGYA 1T8SA 4HI0E 3I39X 2Z9DA 1F2UA 3FFAA 4E5UA 4DUYB 3PWSA 5JO9A 4FW9A 3ZVKA 4EY3A 4ER0A 3RWBA 1FXWF 5B2FA 4GX0A 2YN2A 3M4ZA 4Q12A 3RS2A 5EKUA 4BP8A 5EXXA 4TTRA 4HDMB 3PL5A 5J4VA 3R3SA 4B6SA 1QVAA 3CVVA 4FR0A 3U9TA 1JIQA 1ZH6A 2JNWA 1YQWA 2OO3A 2ZVPX 4O8ZA 5E8JA 5A3QA 1DAHA 3A14A 3QRWA 4QTYA 1VSUA 3PRYA 1WAMA 4QYTA 5KVSA 1OA1A 2CZQA 2WAAA 5EJFA 2YS7A 4UBJA 5K0EA 4EG1A 1QQAA 1XMSA 1JDTA 2O05A 3T4UA 4ARIA 1JQKA 4M1ZA 3TXAA 3KQLA 4RULA 1M34E 2EKLA 1K97A 1N2SA 1TB4A 3C3JA 4FEYA 1AH2A 8GPBA 2CSUA 2AJTA 2OV8A 4G0NA 1E89A 3RUHA 4DM3A 4DOMA 1U1FA 5ALLA 4RO0A 3ZE6A 4KQ1A 2E4XA 3R2JA 1KIAA 2XHZA 3UZUA 4MRNA 4ABTA 2XCTB 2NP6A 1YQEA 1F14A 1RQPA 2CF5A 2CYAA 3Q5GA 3A05A 5CX1B 4M87A 4ZQIA 1IUPA 3GR6A 3HO1A 1PYDA 5EZQA 4UHKA 4O63O 2Y2UA 2PR7A 4KX3A 4CLOA 3EQ7A 2A86A 3G9ZA 1ZESA 3MJRA 2FPGB 1ODJA 3E2MA 4GMHA 4X00A 1F38A 3WMRA 5HZHA 1DZ3A 5JWRA 1THTA 1W35A 2Q9UA 3NBQA 3WLNA 4O5OA 2VBCA 1CUYA 2XT0A 1YZTA 2GYYA 3OCCA 4YBRA 1WKBA 4KQKA 5KS2A 1FJ2A 4C7OB 3L0DA 1WSWA 1DWOA 3N05A 4FCVA 4D46A 3H2HA 1NLYA 3U3OA 2B78A 4B33A 4R16A 3OZBA 4ZDIA 4QATA 2QJWA 3G8AA 4JBWA 4N7RA 3S8YA 3TF5A 1AN9A 2BFCB 4QDTA 3SC3A 3WSTA 4EF4A 2PUAA 4I0WB 4GICA 2LCFA 2ZRIA 4I46A 1QYIA 3FPFA 2ES4A 4NCHA 4DWJA 4NJMB 1UMDA 2UUOA 5DSXA 2B83A 2VZ0A 2PVPA 4RKWA 4LISA 1DUIA 1ICIA 2G40A 2I54A 3PJDA 4LWPA 2O2IA 1AA6A 1PTKA 4BRUA 1EG2A 3D6NB 5KOIA 3UGQA 3U16A 3QY9A 2QTFA 4AQ7A 2YWGA 3GCXA 3MS2A 1K7CA 1SN7A 4K86A 4MV7A 4BRZA 3JARB 2NSJA 3SHFA 3HJGA 3OM0A 3O1IC 1R0WA 2WY2D 4BTVA 4EHBA 5B3KA 5M3BA 1MRZA 5ICCA 3VM6A 3GAAA 2PCJA 3TZHA 4TMXA 3I9MA 4DDVA 4OXYA 3GVCA 4AP6A 4Y7CA 1USGA 1CHDA 4ZQGA 3HB1A 1DAOA 3I1FA 2V3VA 2CLIB 2EP7A 2EZ9A 3TSWA 1APBA 1ZC4A 4FI3F 3WB1A 3FAKA 5ES4B 2RG1A 2ZUEA 3AJAA 4LTNA 5BVHB 2FWNA 1Q20A 4QZVA 1YZLA 2AOUA 2C61A 3R3ZA 3CX4A 4C1BA 1UQTA 1LLCA 4OP1A 2WA2A 5TXGA 4I50F 1RJ9A 2GKSA 4BLVA 2L17A 4HDNB 3TUZC 4CQMD 3C1TA 4RIIA 3M5PA 4WBNF 3WGTA 5I9SA 3HZRA 5EQFA 2WHQA 3K31A 3MBKA 4YRJA 1ZIPA 5G3ZA 1Z6TA 1ODKA 3PPYA 4BO4A 5HGXA 4H2DA 4LJ5A 2E89A 4IUDS 4AS2A 2OGWA 3GJXC 2A4KA 3P26A 3HKEA 1E2NA 1WSAA 3DBLB 2GHIA 5IUJC 3OTGA 1CF9A 2PGAA 1B76A 3P9CA 4BUZA 4GW3A 2W83A 2AUTA 3KLNA 3H5OA 4IDFA 4XLZA 3DH0A 2IS1A 3HUUA 3WKBA 4PHHA 3LYHA 4OAQA 1YKFA 3C3MA 3W05A 4ZO9A 3DW3X 5AI9A 2EXXA 1NVXQ 4BB6A 1X1CA 1DRWA 1VMAA 1UKBA 2O4UX 3GH3A 3WLHA 4CHGA 1GRRA 1XFDA 3KJNA 5EL0A 5J23A 4NABA 1R3DA 1MPTA 2ZYGA 1Z73A 1XXHA 4OM8A 1JE0A 1Y9DA 2I76A 1UWLA 1RRVA 3A2NA 3NT5A 5EE3A 1NVMB 5BSTA 3BHJA 2ZUTA 3SZRA 3MT0A 3VTKA 4B48A 1OZHA 1NI5A 2K6GA 1JR2A 3R44A 4E11A 3KHUA 4B4DA 3M6LA 2HWWA 2O3RA 3I2HA 2WNHA 2Q5LA 2GXUA 5DLDA 1KBZA 1R8QA 1Q6ZA 1U1DA 4M60A 1OH7A 3D4LA 1V3TA 3GJ5A 1PLKA 2PRKA 1W5EA 1NV8A 2YH2A 2Z9BA 4XRRA 3TLYA 3ER8A 1J99A 3Q4GA 4HNGA 3JRXA 4WCVA 2V7VA 4I50A 3RRMA 4FBMA 3T1TA 1R2QA 2RE8A 4JFAA 1K2VN 1PN3A 2HIAA 3F67A 3HEBA 1Z7GA 3NH6A 4Q48A 2D5LA 1KO7A 5LMZA 2ZGVA 2R7KA 2O0HA 3NWJA 5L53A 2R86A 1FVFA 3CRNA 5FL3A 3WSWA 2AJCA 1PR5A 1GPWB 3SFVA 1J8MF 1Z3CA 1BJKA 3EMBA 4IR7A 3EZ2A 3HZHA 4B3MB 4F71A 3SN6A 4AECA 4I2NA 3C8HA 5F98A 1K5DA 1E0JA 3EDOA 3UAXA 3RSGA 2GEDA 4RZXA 4R5HA 5C2JB 4HWGA 4E21A 3RG2A 3MFYA 3QVMA 4CF5A 2NTEA 3CX6A 3NOVA 4REOA 2JVJA 2XUIA 3OPNA 2VT6A 1E5LA 1XTKA 4TM7A 2W2KB 4DBLC 3V7FA 5EUMA 3CLSD 2P5SA 1NW4A 3GGSA 2WI8A 5DBGA 4KQXA 1T3ZA 2PL3A 3FHLA 4Y0VA 1XHEA 2QI9F 3H5IA 5J2UF 2H52A 2ZAIA 2DPYA 3FGOA 4MDYA 3KKZA 4AUMA 1YDFA 1BE1A 4GOKA 2V6MA 4I1OA 4NZMA 1JHPA 4OHRA 2QJRA 4XIYA 3U7FB 1BCSA 5JAQA 1J70A 3CRW1 2HHJA 1RBYA 5LXTB 4ZWNA 5BUCA 4JYAB 4S1VA 4NV1A 3SX0A 3X2FA 5AOBA 3NH9A 3GFVA 3H11B 1OIWA 2FZ5A 2VK4A 1C9DB 1I9CA 2P2YA 3ETGA 3QZUA 4JDPA 2P9QA 4AJKA 4BIIA 2P2DA 1G38A 2QK4A 5FLEX 5C1DA 3HKBB 1SCUB 2F7SA 2GSWA 3KZ1E 3WLIA 3G7SA 3ILVA 4MGZR 2QBYA 2HPHA 4WBNB 5A4MS 3GPDG 1XEFA 4J6EA 2WWVD 2XOKD 5EMKA 3L6BA 5HFAA 1VA4A 5J3JA 2C4KA 3B8HA 3O4FA 4DTCA 3PQ2A 2PWAA 1KKMA 1PVDA 2POCA 4BLWA 4BO8A 1Y7IA 1ZICA 2NTYC 3LBHA 2VTBB 2OCDA 2COKA 3EUWA 5DI3B 2I67A 1TKCA 3AR3A 3KLBA 3U4DA 2OV1A 1DG3A 4GI3A 1HT3A 4MR9B 3A3KA 5A04A 5TPZA 5L6MB 1N5OX 4JXZA 4LDPA 3QE0A 1FTGA 1MC4A 3L7BA 2D5CA 1GLVA 4YCLA 5HSGA 3I52A 3RJMA 1LDBA 1NJFA 4BQRA 5L3SB 4KR3A 2H2AA 3PL1A 5DHUA 1A4IA 3LY5A 3EPJA 1IM2A 4D1YA 4OJQA 3GJ7A 2QTWB 4HFNA 5CK5A 3MWJA 1ISSA 1Z06A 2DXIA 3PEWA 2WVHA 2W9XA 4PX2A 3O84A 2II6A 4KQ2A 4WI1A 1MZPA 3OLVA 3E5NA 5GV7A 1MFZA 4AZWA 3ZHBA 2HDOA 3L79A 1A8HA 1B00A 3BH0A 3PGKA 4WDRA 4PXAA 4RXTA 2CBGA 2N42A 4NFYA 4Q3AA 3T3IA 4BFYA 1JH8A 2LD4A 2A9JA 2BE9A 1HEUA 4JYCA 1F2UB 4KWEA 5H3LA 4KDRA 3KT3A 3SC4A 3D4NA 1U7ZA 4AXXA 5JH7B 1AMNA 5HIMA 3K6JA 1MJGM 5DCWA 4CV2A 1PQYA 1H2RS 5U4XA 3GELA 3KZKA 3UUWA 1EXWA 2ZJ2A 1OXBB 1W96A 1XF1A 3FPLA 3N39C 3PDCA 4MV6A 3QEJA 3VNSA 1N1DA 4XQCA 4RQUA 3AQ4A 3OOJA 2WJAA 4YRLA 5GWXA 3QY0A 1HRDA 2DHCA 3NLLA 3H0KA 1IN5A 2QTNA 2WHRA 3BD9A 1KFKB 5BYJA 4G5QA 5CU7A 1WDLA 5LA6F 4UNNA 1QO7A 2CMGA 2F43A 2O23A 3NTLA 2CZCA 3NTQA 2W2QA 1ETHA 1C9NA 3C70A 3FGZA 4XVHA 2XNCA 2ZBVA 4NG4A 4JVMA 4D9IA 1Y9AA 3TLGA 4ECEA 5KJEA 3OTOB 1VRCA 1NTOA 3VC7A 2I3BA 3EBLA 2ECPA 3UJCA 2YX1A 5KX5F 2ERCA 1L3IA 3BRWA 4JQZA 3ROGA 3OZRA 3JALA 1VI2A 1BMTA 4L02A 5TPZD 4DM4A 5IUNC 5CA1B 3SHOA 5EYPB 3W9UA 3UB4A 1UWVA 3ZDXB 1XTBA 2CKMA 5CFRA 5AI4A 2BUAA 1E3EA 1R6AA 3P0EA 2B6HA 2NV0A 2LV8A 2QKYA 4UAUA 2AEEA 4PAMA 4QNNA 3IP8A 4FEGA 3EGXA 4JX9A 4U7GA 1I4LD 5F1YA 5C3UA 4PAGA 1JTEA 3U37A 1PL0A 4C06A 1LXCA 4DJJA 4LYYA 4IDDA 5FPTA 4AW9A 1HURA 4EHFA 1T2FA 4N5NA 5EINA 4EG7A 4YDRA 2CHUA 4K5QA 4BZZA 2QROA 3FNHA 5LLDA 5A7GA 1X15A 4WESA 4LECA 4ZVMA 3Q5EA 3DMGA 1QNLA 3K2EA 4G01B 2VWHA 4DRXA 4BKRA 1E3WB 2GRAA 5CB4F 4MJXA 3KOYA 4MJLA 1EVIA 2QUBA 3WHIA 2GUGA 3F5QA 1EBBA 4Z54A 4YQYA 3R77A 4KMOA 5SZIA 2JASA 2A5FA 5CDYA 2GHQA 3NTXA 3R20A 2GHTA 3LUFA 5FDFA 2J9RA 4IIHA 5IKEA 1DAPA 1PQUA 4D3FA 1CERA 4DG5A 4YI3A 5CVUA 2J3KA 2BEJA 1N6RA 4F06A 2V4UA 2CFIA 4D43A 3QF4A 3GVIA 1C8VB 1TAGA 2DFPA 1UM8A 1G2IA 1PNQA 1VCHA 3LXRA 4CMIA 1P7CA 2XCIA 4QFDA 1B74A 1PG0A 4DSTA 1XXHE 4AD8A 1VPVA 3B3FA 3DYBA 1EVKA 2W6ID 1IEQA 3DWFA 2H06A 2IYQA 4MYHA 4EDFA 1NNLA 4D8VA 4Q7QA 3IBGA 2ZIFA 1H5UA 1G19A 3RJTA 4IV5A 1DARA 1SXJA 1QCCA 2I80A 5JRZA 4GZ6A 1AHHA 1ZIDA 1GQOA 2G09A 3OFNA 2BW0A 1AKUA 3IUSA 3OO0A 4PLWA 3AU8A 5U1PA 2GAIA 4FHEA 4RD1A 1I5OA 4IYRA 1RJ9B 1OX4B 2OFOA 3ASUA 1WCYA 1DKUA 1DU4A 1O58A 1GPAA 2JD0A 3H3FA 3M3PA 3QE2A 3VR3A 3ANXA 3BMCA 5M34A 3RDPA 1DUVG 3QITA 2IBMA 3UK2A 3FNFA 4ZTZB 4ESOA 4QXOA 4ZVKA 3ID6C 1KI6B 5BSWA 4RA6A 4MLCA 1ZD5A 2GN9A 5E7QA 3LOQA 3VFDA 2HB6A 5LU9A 3ZWAA 5HDQA 1GL7A 4D9MA 4DEXA 1NXWA 4QXQA 4WXHA 4OPMA 4C78A 2YS6A 2W11A 2C7QA 3D2LA 3HV0A 4B7ZA 3SS9X 3K9LA 2YIDA 4D3XA 1YJ8A 4PFJA 4KFTA 4ZI3A 3JQ8A 3QWIA 5AVOA 2OGSA 2PWPA 4PZCA 1DJMA 1YJBA 3LY9A 1OGIA 3NIDB 1A96A 4IBOA 5F78A 1HLGA 3K9NA 3AINA 3EA0A 2D59A 4LXUA 4M0CA 3OMXA 4KL8S 4P3YA 4ZVTA 3DCIA 1J0EA 2J7PD 1KDRA 2Q2NA 3BIOA 3ANNA 4DQLA 5CBPB 1HE4A 2OXCA 3DVQX 1ISIA 5A6SB 3CNQS 5JU6A 2FETA 4EG8A 1UH5A 3M8KA 1DBWA 2AG8A 1XWFA 3KQMA 3PDWA 1W5TA 4KWHA 5CEFA 1ZOIA 1TO1E 4CL2A 1GV0A 2C2XA 2Q6TA 4YI5A 1YBVA 3REGA 3IC5A 3EVNA 2VDVE 2X8JB 1CRPA 4EG6A 1U2RA 1FDRA 3AIOA 1CULC 5ALPA 1W1UA 2DKNA 3HHPA 1PR3A 4URXR 2F9MA 4KAAA 4UQPA 1SA0B 2D1FA 2JANA 3PQFA 3KEQA 3BIWA 3G9QA 1GG9A 4QFCA 1DP4A 5ERGB 1FFCA 3VZSA 4UNSA 5F9HA 1E98A 3FX2A 2PIDA 4E1AA 1HXHA 2YXNA 5T41A 4KO2S 3ZLTA 4GAEA 4BNGA 2BT4A 2Z08A 4V24A 3I5UA 4RELA 1Z0KA 3T1HB 4CCYA 2NX2A 1EWTA 4MDEA 1G21E 1ZUWA 3HPQA 4RFVA 3L6UA 5D2CA 4ZJYA 2CLCX 1CQXA 1EU1A 2W0SA 3D4OA 3TTVA 3AERA 2WD7B 2XNSA 2W4MA 4DVGA 3K73O 4YV1A 2NVUB 1J0XO 4OH1A 5CJJA 4ZOBA 3V1MA 4AZSA 4DLWA 3ZI7A 1F0YA 2M6SA 1XGKA 2FZ4A 3T1NA 3FDFA 5LYJB 2YXDA 3PC6A 1ADCA 2QR3A 1JP7A 4JQYA 4AMYA 4UUAA 1NFRA 1SNYA 4BBJA 4OHFA 1JR3D 1U8CB 3C24A 4YLGA 3RVSA 7REQB 4HUQA 5GJBA 4L16A 3BA1A 3E4CA 4WEQA 1V16B 2RKWA 1KEKA 5ALVA 1GUBA 3V1UA 3BMNA 4ZYWA 1I94B 2COUA 5C52B 1IXZA 1D6JA 3BK2A 2PMCA 2V7UA 2IUSA 2ZRQA 2PPVA 3H11A 3IQZA 3LAWA 4MS1A 4RL6A 3ZWPA 1YB1A 3DMPA 4WV3A 4DGSA 4DNPA 4IXWA 3V97A 1SZJG 4NOJA 1UJ4A 2EG5A 3O4RA 3PQ6A 5EHIA 2BDTA 3GLQA 1JKFA 4INAA 5I7WA 2B1RA 4GOMD 1LLFA 2Y77A 3GL9A 1Z2AA 2Q3BA 2CT8A 4FZRA 4E94A 1NVEA 4QEDA 1B0ZA 1JLSA 4QOHA 3HR7A 2A0YA 5T5QA 4QGAA 1Z6ZA 2JARA 4WY5A 4J29A 4FILA 2WU4A 4KFSA 5A71A 2ECFA 2FFAA 4U7JA 3HFGA 3RSQA 3AWDA 3ESXA 1T5DX 2EBFX 4MP8A 2HJ9A 1FXUA 2OPBA 3WJ1A 4MR9A 3Q2IA 4Z9XA 4A1OA 3O8NA 4RH3A 2BYTA 1WZIA 2FFHA 4BVFA 1POXA 5E6SA 4JBXA 4Z0TA 1YQUA 1ZN9A 3EIFA 1QO0A 2BR3A 1F60A 2FMTA 3MUOA 5JR3A 4XYEA 4EENA 2V7QA 1IG3A 3KE8A 4FJ2A 4GLOA 4REMA 3ZV4A 2GBCA 5CFLA 2O19A 2FQYA 3PNMA 1C9JA 1XKQA 1BMQA 2IH2A 4BNHA 4TL7A 1VKNA 3A3PA 3QU9A 4D8TA 2H1WA 3PLNA 2BMDA 2DZDA 3GBPA 1W85B 3AUSA 4OA8A 1I51A 3ZTTA 4BP1A 1QPZA 3QA3E 1JDZA 1SBYA 3VX4A 4MW1A 1O3YA 2ACWA 2Q49A 2QVLA 4HX5A 4W5NA 1UOPA 4LMPA 1A2OA 4RHCA 4EJFA 3L5OA 2XVXA 3DJYA 4JEMA 4RHEA 4MK4A 4XIJA 2A84A 4A0RA 3FZEA 2TECE 2JJ1A 2YZ7A 1ESMA 4GRIA 1ZI6A 3GX1A 5BSRA 4EEKA 1O94D 1ZX1A 5H81A 3E27A 3ENQA 4Q1EA 4Y6QA 2M2IA 3AL0C 4AQYB 3TEMA 3MWEA 4CT4B 2GPJA 5L40A 1UJMA 3ZQ6A 4Q4HA 5T3YA 3MAGA 4C4OA 2BTOA 2RHGB 3P5SA 2QVCA 1W2GA 3F7OA 3E48A 3P9YA 4MEJA 3LGXA 4D3YA 4TLBA 4BAZA 4E5NA 2AR7A 3PXDA 2HA4A 2E1RA 4OGGA 5CNJA 2H7CA 4Q19A 1OXVA 3OQVA 1R4ZA 3DW1X 2FN4A 1MX1A 4HYYA 1ZN7A 4R2IA 4N3BA 4OKIA 3ZCVA 4DSAA 3NEPX 4U9UA 3U44B 1NKTA 3CY6A 2OP0A 1JMYA 5DE3A 4C7VA 3OSUA 1UPFA 1OLSB 2C57A 4NCJA 5AI6A 3V00A 4I99A 5KYYA 1NM5C 4IGAA 1MN6A 4IMPA 4OXNA 3WGHA 5ITSA 1MOQA 4AJLA 1AC5A 4DB2A 4HHEA 3U1BA 3G0BA 1PGQA 3ORFA 1P7ZA 3BGIA 2YZ2A 1DX9A 3OUUA 2FEXA 1KI8A 2CNKA 2QXTA 2H5JA 3RF6A 3ZHVA 4S3MA 5JCOA 2QRLA 1JLLA 3OURA 3VOAA 3G79A 4WJKB 2YIVX 4WN9B 4OFBA 2AZDA 3FOCA 2XUPA 2D7JA 4IVNA 1BVHA 1NUHA 3QBTA 2AW5A 1Q7CA 1CUHA 1U8TA 4DIKA 4E03A 1XVIA 1P2VA 3DG9A 3MJDA 2DHQA 5G53C 1BW9B 2X8AA 3MLEA 1ARZA 3IPRA 2QUKA 2WOJA 4QVGA 1GPH1 1H42A 1PG5A 4CN9A 4EHKA 3B1FA 3ZNOA 1D8TA 1R9JA 1UPAA 3GEIA 3KKOA 4EECA 2BR4A 1TVCA 1RYEA 5C9ZA 1LU9A 1JH9A 4CKWA 3U1TA 1QYXA 3IX7A 3F8SA 3MRXA 5CLIA 3UMBA 1KF0A 2Z56A 4EFKA 4F60A 1O95C 1WXFA 4JJGA 1RYYA 3JS5A 4OLHA 3WLJA 4F38A 5JCXA 1RXVA 2PKEA 3DLHA 2PH7A 2EJVA 4HX9A 5FO0A 5J2UA 4KE7A 3VO8A 4LFCB 3IEKA 3F7TA 4NPCA 3DBVO 1F9EA 1EGHA 1KDTA 2AYXA 2G67A 3B53X 3DOUA 2H4FA 3MOGA 4MUEA 3JQDA 2BM1A 3AIIA 5I7RA 2Q3EA 3NRJA 1DFGA 2BEWB 2J1LA 4JEIA 4J2TA 3SHWA 1THZA 3I23A 5BNFA 1Q0ZA 4IHQA 4R7TA 3WGOA 3P9ZA 1MNAA 2QYHA 2R7MA 4DQUA 1E7SA 1ULZA 4CKCB 1E1QA 2C5FA 3FIJA 2XIQA 3OOSA 3QMVA 1Q0TA 1AUOA 2PZFA 3CYFA 3G7UA 3GLVA 3OZDA 3A4YA 1HMPA 2VP3A 5HFJA 1L5HA 1JSLA 4LSWA 2IBSA 2F9LA 3ADKA 2ZWPA 1Z5UA 3L0PA 5F12A 2AVNA 1LSUA 4P3OA 3A6ZA 2IEDA 2QW8A 5CHEA 3ST7A 5BNZA 3GI1A 1ESZA 4ALLA 4JUIA 1SCIA 2IEAA 1RXCA 2ZJ5A 4WINA 3TNFA 3IDQA 1SBQA 4OCZA 4RV9A 3LQ2A 2G7ZA 5FNVA 4CT0A 4EPXA 5AVWA 4WLFA 3DVRX 3TCKA 1DRVA 1M67A 5BQFA 4X1KB 4S1TA 4JSYA 1S3FA 3M9XA 1JAYA 5I9NA 3VXKA 4LNAA 4XUEA 3FPHA 3DQPA 3RVKA 4MSUA 4W1PA 3WY9A 3U4QB 1IUNA 4GL2A 5IXSA 2DQSA 4OHOA 3INNA 1NXSA 4Z0NA 3STWA 1Q7GA 4HDRB 2IY7A 2ZB3A 3OTWA 3FZYA 2WABA 3CTPA 4O4JB 3KFVA 3SBEA 3X1MA 2J9FA 3D0RA 2QXUA 4KAXA 3IQWA 1ECBA 5IVDA 2D7CA 4EA8A 4HAOA 4NDAA 3IPXA 4QYSA 3VJRA 1ZY2A 4B81A 4GMKA 3NHWA 4ENPA 3HDTA 5ISMA 1JSXA 4V0SA 4BMOB 3HB0A 4B09A 2QG9A 1P0FA 2CVHA 2YOFA 3CNOA 2AFHB 3WL3A 2C1EA 5HKKD 3OICA 5L95A 4TYWA 3BZBA 4JP3A 2V3CC 4HWOA 1NBOA 2IT1A 2BKVA 4XYGA 4V38A 2E87A 4REQA 2C92A 1Y34E 1Z7EA 2P2GA 5LFAA 1WMEA 5K3CA 4YEDA 1SBNE 4M8NE 3HY3A 1PZMA 1Z0JA 1URPA 2I6SA 2X0NA 1VLLA 4FX5A 4I1SA 4FPXA 1NJ5A 1ZOPA 1A4UA 3KTFA 4LC1A 4B6OA 5KJ6A 5K6AC 4MQEA 1MIOA 2VP0A 3M4NA 2VFAA 1J06A 2O1XA 1B8OA 3R5XA 2V58A 4MUJA 1W48A 4NJEA 4LXTA 2GF2A 4JVNA 2PH1A 4CI0B 2ZJFA 1RYHA 1TF5A 1X42A 4XQEA 2OD2A 4IG4A 4YP9A 5BVGA 1DG1G 1FSGA 4IFBA 1QGAA 3RU3A 1DKQA 4F4FA 1NDHA 2ZSJA 2LGJA 2RAUA 3HXOA 4JBIA 4P35A 4HNUA 1BDBA 4PCVA 1Z2DA 4FMDF 1CX9B 1WEHA 3M5DA 4MS3B 1VHJA 4IEFB 1CUGA 1E2HA 1SC6A 5F77A 2G4VA 3KPVA 2C97A 2V7QD 3MTBA 4UEWA 5E6RB 4Z4QA 3PCTA 4ITUA 4ZMBA 2DH5A 2NSYA 3MJFA 4GNKA 5DM4A 1U28C 5I7AA 4BMYA 3ESRA 3PNKA 2VHEA 1WCWA 1XMJA 2WQ7A 3DL0A 5F9MA 3L77A 4TLLB 2W6MA 4X71A 5KX5B 3O9ZA 2ASEA 2ZB7A 3F6SA 5F4BA 1M0WA 1PR0A 3SZGA 1R6VA 4AN1A 1C7QA 3IE1A 1ORTA 1OREA 1A5BB 3RYHA 3GFRA 2JIDA 4R40A 5IMBA 4ND3A 2VK2A 4OKNA 4BU0A 4WH0A 3IOMA 4B74A 2Q5HA 1E3MA 4GSLA 3O8OB 1US8A 3QPVA 4OQYA 5J5CA 3MS7A 3W9SA 5B5SA 1NM5A 5E3IA 3KWLA 3NORA 4JBGA 1QB7A 2FGKA 2OQRA 2YC2C 3L8GA 3Q0TA 2X5JO 1KVSA 5HXAA 3QPWA 3MWLA 3KP1A 2M1ZA 1YR8A 2NT4A 1K5HA 2CHFA 4AO7A 3B3JA 3UAWA 4DA6A 5CVDA 1QE3A 3PPVA 4AJJA 3DBHB 2QWXA 5JBNA 4BC0A 2G1UA 5H82A 3DE4X 1ILEA 4FR5A 4X85A 1OI7A 4B3FX 1OLOA 3LX5A 3P94A 4YTEA 4LGYA 3HG7A 3AZPA 5DM60 1VXRA 5AD1A 1X94A 4RVCA 4PWZA 4QOFA 3ZGLA 2GPAA 3PA8A 4WVFA 4BQPA