4CLOA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 94
structure length 251
sequence length 267
chains with identical sequence D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cloA00
1PU2A 3ROMA 1KVUA 1P0CA 2JL1A 4G2NA 1ADBA 1DLIA 1HDZA 4ZRNA 2I6TA 4BUCA 4E5KA 3K2BA 3TZ6A 1LRJA 4IBOA 2PK3A 2D5CA 5COBA 1NQTA 1I0ZA 3JYPA 5TX7A 2EP5A 3KBOA 1LDYA 4RJTA 4OQYA 3FBTA 3AFMA 3I9LA 2AHRA 4J90A 3RJ5A 5A06A 5BNTA 1A7KA 2VQ3A 3IIEA 4EUHA 1UDAA 4EZBA 3PDJA 3D5TA 3GPIA 4J9VA 4FPXA 1R6DA 1HDYA 1E1NA 2ET6A 3H9JA 3PIDA 2Y1CA 3GQVA 1LUAA 3PYMA 1RYDA 4U8GA 5G0VA 1I2BA 5A9RA 1ADCA 2V6MA 2NU8A 1H6BA 1AN9A 2WSBA 3HDJA 2VWPA 3D1LA 1GR0A 1TT5A 2E37A 2FZEA 3IC5A 3Q2KA 4Y8VA 4GX2A 1JDJA 4XQEA 5EQDA 2OXIA 3OEWA 3WWZA 2FPGA 1ARZA 3ZV5A 2AW5A 3DFUA 4L75A 1LRKA 2B0JA 1O6ZA 4A26A 5CAEA 2PKQO 4RZIA 3AUAA 2JD2A 3PZBA 1ZXLA 3WR5A 4QTZA 4IINA 3ZWWA 2WJPA 3OF2A 3WGZA 3R3SA 4MP3A 4Z9FA 4D46A 5A04A 1QYCA 1KVQA 3IOYA 4LK3A 4D3FA 3M1AA 1BW9B 3ZWOA 3FPLA 2IZZA 4ZN6A 5ADHA 3EZLA 2F00A 1H94A 3JQEA 2EKLA 3A1NA 3SLKA 2Q1SA 3RC7A 1E3WB 1C1DA 3QWIA 2ZTMA 2V7PA 2OBNA 2QRLA 2VZ0A 1T26A 4HY3A 3P2OA 1HDCA 1PGQA 1P77A 1FDVA 3WS7A 3CSDA 2PD3A 2NVUB 1X0VA 2QZZA 1EQ2A 2DTDA 1B16A 1G0NA 4DGSA 3ZU4A 1KVRA 4BB6A 2VN8A 4JIGA 5G0SA 4GGPA 1E92A 3KXDA 3UUWA 4BQRA 3O4RA 3QV1A 3RIHA 4CLXA 4X54A 1OI7A 1YJ8A 3W8DA 4IJKA 1M76A 3WGHA 4QT0A 1NPTO 4RO0A 4H7PA 1M66A 4HFJA 4IM7A 1O94A 5G4KA 1Q7GA 4PG5A 2R2GA 1I33A 4W9NA 3V1YA 1UDBA 4KDEA 4MKRA 1FDTA 1I3NA 4KDFA 4BMSA 5KVVA 1CQJA 4Q3NA 5CEEA 2P2SA 4RF4A 3SVTA 4BQPA 1GEGA 1YVEI 3DBRB 4JJGA 3LLVA 3E5RA 4QUKA 1NHGA 2EWMA 3IS3A 4TSKA 4DPLA 4GQAA 2RIRA 3EY4A 3WLFA 1P1IA 4FC6A 2GDZA 2WD7B 4W7HA 1C1DB 3GEDA 4XYEA 1IHXA 5FF9A 1V3TA 1TVEA 3ADPA 2O2YA 5BR7A 1E3EA 1SO8A 3OJEA 4FFOA 2OHXA 1YWGO 3U4DA 4YT2A 5L40A 3MJCA 5L95A 1JQBA 2NWQA 1L7EA 5G0WA 4FIZA 2VNAA 1CQIA 4QO7A 8LDHA 4GGOA 3PTZA 2Q1WA 5TF4A 2GO1A 4CV2A 2W2KA 3OIDA 1WZEA 4LVCA 4OMUA 4BNFA 4ND4A 2JFFA 4DUPA 3GNQA 3MEQA 3H65A 4E32A 2ZTLA 1XSEA 4WCFA 1KC3A 1H6DA 4CQMA 4IXWA 2YV2A 5L9AA 3NGXA 4RLHA 4XR9A 7MDHA 3R3JA 4UEOA 2BFAA 2VHZA 3INRA 4UUOA 1I5RA 1SZJG 5ILOA 1DDOA 4MOWA 2PR2A 1ZCJA 2O3QA 1IHYA 4FBGA 1UZNA 2YDYA 3UH1A 4CM4B 1CETA 2YQ5A 2JCVA 4IJWA 1R0SA 3DR3A 4PN3A 1EUZA 1HE4A 2O2SA 3HNPA 2ZYAA 4JLWA 3W4KA 4WOKA 5I7SA 3VZSA 4BNLA 2V6FA 1PR3A 3NT2A 1ZJZA 1SAYA 4OXYA 1YB1A 3AOEC 3PI7A 4FJ2A 3GC6A 3O8QA 4U6QA 1A4UA 3NYWA 4W6ZA 3D0OA 2PGJA 4OHUA 1R37A 1T25A 1LDGA 3BAZA 3S8MA 2VYND 3TL2A 2CZCA 5IAAA 3WQRA 4CM8A 3ORFA 4AJ2A 3DBLB 5KVCA 4J4BA 1DIRA 4QSMA 4YPOA 1Q0LA 4RORA 3AOGA 2WE7A 2EEZA 3Q11A 3E18A 1PZFA 4CL3A 3OJLA 2GZ2A 4L4RA 1PGOA 1JWBB 1HXHA 3PHLA 5DN9A 1LSOA 5MGBA 1EMDA 3HFSA 2G17A 5TSDA 1ISHA 1ZO8A 4IZHA 2Y0DA 5L7WA 3ULKA 1GV1A 2B4RO 1B14A 1PTJA 4NPCA 4CLRB 1UP6A 2HMUA 4YRAA 3ZHYA 2ZIZA 1BWSA 4FD3A 3UVEA 5IZCC 4GWGA 3L9XA 1EVYA 1QXSA 4YJGB 3AM5A 1LRLA 3WMXA 4W99A 4H3VA 3PFFA 3HDYA 5K9ZA 6LDHA 3ETDA 1N7GA 1P1JA 2GUGA 2HMTA 3ZU2A 2G76A 2DT5A 4RPGA 1B8PA 4UEJA 4ALKA 1PQPA 3HE3A 1DO8A 5IXSA 4GX1A 3FD8A 3HB4X 1M6WA 1U3WA 1GEEA 1R4NB 2DKNA 3QJ5A 2VTEA 3JQ8B 1HF3A 1VPDA 1V0JA 2BFOA 4DMMA 4NFHA 3RKRA 1DHRA 4PLFA 4BO8A 2GN9A 1Z7BA 5A4DA 2X1HA 1KEPA 4FCCA 2D4AA 4RL6A 1ULUA 3ANMA 1ONNA 2PTGA 5K6AA 1Y8RA 1GTMA 1ZBQA 2W8ZA 4JQCA 4NBVA 2VRCD 3ZZNA 5AYVA 1ENPA 1M2WA 1MC5A 2BLLA 2FHSA 3CH6A 3ETEA 3PK0A 4MPDA 1N1GA 2C59A 3K73O 3PIIA 1YH3A 3KEQA 3WLEA 8ADHA 1I3LA 1C1XB 3S2EA 3WICA 2YQ4A 1ZMOA 1XELA 1Y8QB 1G6KA 5F5NA 4YB8A 3PHIA 1GQQA 5JS6A 3TZKA 4BV9A 1O9BA 2DFVA 1U7TA 1Z73A 3LU1A 5B4VA 4NDNE 2O3UA 2B4QA 2VTDA 1R66A 5L53A 4ALJA 2ZQZA 2DPHA 5IDWA 2B69A 1MXHA 2JHFA 4IIVA 1PJQA 4IXTA 2UV8A 2JCXA 2X0NA 3RQSA 3A28A 1BW9A 1LX6A 4LVUA 1WMBA 4XJTA 1F17A 3I83A 4CM7A 3WWYA 2NTJA 5T6BA 4OL9A 1KEVA 5COQA 2WD8A 4ZU3A 4AJEA 1WAMA 2X9NA 3CKYA 2ZQYA 3HHPA 5MDHA 1NHWA 4AJ1A 1YKFA 4KUEA 4CMCA 1YB5A 2UDPA 3GGPA 4CLEA 4LN1A 3RD5A 2P5YA 4PRKA 3ZWCA 4HWKA 2HO5A 4BO5A 4FC7A 2AQHA 3HB5X 1U2GA 3EYWA 3L4BC 4YQZA 4R1SA 4QFDA 1Q0HA 3WB9A 1BHSA 4II3A 3G49A 3L07A 4M49A 5LDHA 1FJHA 1T4DA 4YWJA 2VHVA 3PPIA 3AW9A 4BNTA 3JQDA 3GZNA 1E5LA 4Z9YA 5A05A 4J49A 3GUCA 3UHAA 1T2AA 2O4CA 2PZJA 2YFQA 1ENOA 3IKVA 4K9DA 5FWNA 4R3WA 1Y6JA 2B35A 1U2DA 4BKRA 4LMRA 3B1JA 5C5IA 9LDTA 3RU9A 4B7CA 4D7AA 2Q4BA 3GH3A 4P38A 2Q1TA 1DIAA 1UDCA 1V6AA 4Z0TA 3AFNA 1MG5A 2C29D 4BIIA 3PWSA 4CLRA 4BMVA 4DLLA 3K9QO 2GZ1A 3TWOA 1VC2A 5HRUA 4WLFA 5AVOA 3K30A 4R1NA 3JYQA 4K28A 2HAEA 4BHTA 1KS9A 3VTFA 4UUMA 5FEUA 1KVSA 4XIJA 4BNKA 2I9PA 1V8BA 3HDQA 3EHEA 1DFGA 1E7QA 4XQGA 5FI3A 3WMWA 4QXMA 1IL0A 3WGYA 4CR7A 1ZK3A 2FSSA 3K96A 5DOZA 1EFKA 4DIOA 5DCUA 4TZTA 1HYHA 3NX4A 2GYYA 2BRUA 4KUHA 4G5HA 4RPLA 4CM6A 4YA6A 4TMFA 1QR6A 5JBIA 2X58A 2Y1OA 1WMAA 4J4TA 4WE3A 1YL5A 2FSVA 3MZ0A 2EF1A 2A92A 2B5VA 3WNQA 3TFOA 3ZW8A 3KB6A 4D0RA 2OORA 2XXJA 2C2XA 1P9LA 4CMEA 4TVBA 3AY7A 3FTPA 2EERA 3P7MA 5KKAA 2BKAA 1QKIA 3HZZA 4J4HA 2AA3A 1ISIA 4YYZA 1LC0A 1QP8A 3ZWVA 5HBRA 3Q3CA 3GVHA 5T67A 1PJ3A 5IDYA 3OA0A 2Z1MA 5I8WA 3NDJA 3KLPX 3MJTA 3F1LA 4YAIA 1YONA 1EUDA 4Z0PA 1VSUA 3IJPA 1J0XO 4CMEC 1HLPA 3QHAA 1U8XX 1UZLA 1E1LA 4IGEA 3RI3A 4CPDA 3U62A 1OZAA 2VZ8A 4QECA 2Y1EA 2NNLD 4Q9NA 5A03A 4A2CA 4D44A 3JD4A 1O0SA 4G65A 3RBZA 4GSKA 2W98A 4MVJI 2NTVA 1IPFA 1IUKA 4OOFA 3W6ZA 2XOXA 4NMHA 4BOYA 4J7CA 1OBFO 1JN0A 2I67A 3FCOA 3LDHA 2HJSA 5CFZA 4R9RA 4F45A 2PY6A 1RM5A 4P4GA 2YZ7A 5CHEA 2C7GA 1PJ2A 5IN5A 5KNLA 1TLTA 3RUAA 1H6CA 4GX0A 3V1UA 4EI2A 5K0ZA 4RPJA 1DHTA 5DCYA 1ZVMA 2VYVD 3IQDB 1R12A 1DC4A 1H93A 1LU9A 2G82A 2J5QA 1GCUA 5I9LA 1P1HA 3ZWBA 1JW9B 3FF4A 3GHYA 3IDSA 4C7KA 4W82A 4TROA 4TRMA 3QY9A 1VL6A 4KOAA 4FGWA 2ZTUA 3RROA 3DZGA 1MP0A 4F46A 2WEKA 1LXCA 1G1AA 2D2IA 2UUOA 1EDOA 4CMJA 4BMNA 4JP3A 1KBZA 3MJ4A 1HYEA 1GZ4A 3D4OA 1C14A 4M87A 4CLOA 3FNFA 3IJRA 1HDGO 3NAQA 5TJHA 4IQ0A 3L6EA 1MLDA 4Y67A 4NH4A 4AJHA 1VRWA 2FN7A 4IDBA 2VT3A 4XR4A 5EL0A 3U4CA 3SBOA 3DZFA 3ZU3A 3O03A 4TRJA 4WCFB 3DHYA 2OFPA 3GLQA 3GUYA 4UVIA 4YVFA 1Y8QA 3FTNA 1HRDA 4BGEA 2IYPA 4BS9A 2GR9A 5KJCA 3WYCA 2AE1A 2OUIA 2YHIA 3I6QA 3JQGB 4R41A 1P31A 3IUPA 1YE3A 2NVUA 5JO0A 3OP4A 4E12A 1OOEA 3DC2A 2C54A 5JSFA 3Q2IA 4K6FA 4HKTA 3TZQA 3WTCA 2WM3A 4ZHSA 4KQXA 3RCBA 3LQFA 4GVLA 4BO7A 1NFQA 4AJKA 3NT4A 3M6IA 4NG5A 4B3IA 5CDTA 1GFSA 3ZW9A 1H2BA 4E13A 4TKLA 2IZ1A 4BNJA 2ZCVA 3VHRA 5HS6A 2R00A 5CG2A 2W90A 3VH2A 3ZWAA 4ZICA 4U0JA 2NV6A 4DC0A 1CRWG 2DTEA 1QG6A 4PG4A 4NZ9A 1TA4A 4I9HA 4RPHA 1B26A 2PWZA 3Q0EA 4Z3KA 4AJPA 5KWEA 1UXGA 4XD2A 2CVOA 3F6YA 2HRBA 4CMIB 2GERA 1DFIA 3GFBA 3U4IA 3EGOA 5H81A 3WYBA 1CYDA 4IDCA 2IRWA 1AXGA 1YGYA 1SOVA 3LSYA 5HM8A 3I3OA 4PLCA 1ZXBA 3ANNA 1HSZA 3LT4A 4YAKA 4BNNA 1WPQA 2QRKA 2J3HA 4E6PA 4ITUA 1M75A 1BXZA 4ZQBA 1P1RA 4BO0A 5KJFA 2Z1NA 5DNAA 3ETGA 4IDFA 5T57A 4N18A 4XQCA 3UXYA 5I7VA 3E9MA 1VKNA 2E82A 3QSGA 1Z45A 1GUZA 2Q2WA 5TRTA 3DTTA 3JQBA 1Q7BA 3NT5A 2PZKA 4HNHA 2TMDA 5T5QA 2NM0A 2X5KO 3U4HA 4QFCA 3ZHZA 2GGSA 2DBZA 3WFIA 2O4UX 3LF2A 1YRLA 1LI4A 4MVJG 1N5DA 1LLCA 2CVZA 4Y9DA 6ADHA 3PQEA 1K3TA 1V3VA 4TRRA 4Q39A 1F8GA 3EVNA 1ADGA 3ZDFA 5C3MA 1EEHA 4XIYA 5C37A 1CEQA 3DZKA 1QV6A 3FNEA 3O26A 3WIEA 2EGGA 4E5MA 1I8TA 4EUFA 3DONA 1LDBA 1JVBA 2NTNA 1TI7A 3TNLA 1R4MA 3U5TA 2WDZA 3DB2A 3BIOA 1MB4A 1TT5B 3PFWO 5JLAA 5KJ6A 1PSDA 4WPGA 1K6IA 1RWBA 3AWDA 3LK7A 2UUPA 4IDEA 4FFMA 4B79A 5KVSA 1EE9A 2GN4A 3A14A 4G81A 2ZB7A 1EBUA 4HX5A 3CMMA 2LDBA 2PH3A 2IDZA 4MIOA 3PWKA 2PKQP 1U7HA 4KZPA 2AG5A 1ORRA 2QQ5A 1EE2A 5JXWA 4RF3A 2OZPA 3GNTA 3PJEA 1Y9EA 3AI1A 4R69A 1GY8A 2HKIA 2OL4A 2NUAA 2CF5A 2NU7A 4KP7A 3GN2A 4QEDA 1B3RA 5JPIA 2JHGA 4L9RA 3JQ7A 3LYLA 3V2UA 5ILGA 1B3BA 1MUUA 4F3YA 4I5FA 5TT1A 2VHYA 3D4NA 2BFPA 3FWNA 4DRYA 2C7VA 2BGLA 2YV1A 1NP3A 3JQGA 3ZV4A 4U0KA 1G0OA 1JTVA 2HUNA 4JXKA 3BMCA 2CDAA 1PR9A 3JQCA 4MIEA 5ICMA 2ZYGA 1Q1NA 2JFGA 4OGWA 2E48A 4BVAA 2FOIA 1HEUA 2O7SA 2PD4A 2Y67A 4RVFA 1WXDA 1K6JA 1SEVA 2CMDA 5JCJA 3KO8A 3I4FA 1U9JA 4C4OA 1LDMA 5JY6A 1BDBA 3AUSA 4GMFA 4PG8A 3AUTA 5TIIA 4PLWA 3ZNNA 2V65A 4AJNA 1GPJA 3SJ7A 4DLBA 1E7YA 3ZWXA 1HDOA 4BGIA 2Y68A 3UF0A 1UR5A 5G4KB 1SCUA 1PL6A 1XEAA 1H5QA 2H9IA 4LSMA 3WGTA 3C3XA 5HWSA 1RM4A 1AHIA 3W6UA 2PA3A 4FFPA 4L74A 3I9KA 1NM5A 3SEFA 1GYRA 4W7IA 4R4JA 2YUTA 3OJOA 2J5RA 3CUKA 1UP4A 1DRUA 1EVJA 4N54A 1CJCA 2PV7A 1BRMA 2Q46A 4OYRA 4WLOA 5EPOA 1IE3A 2O50A 5DULA 3GK3A 1IZ9A 3L77A 4GX5A 2O3JA 4OQZA 3PHJA 2O3TA 4YJGA 5TLSA 2JFHA 4FDAA 3HFGA 4MINA 1HSOA 4PLYA 2Y0EA 1IB6A 1PL7A 2FZWA 3C1TA 1WLYA 1BGVA 1XA0A 2RCYA 2H5LA 2Q4EA 1PZHA 1EBFA 2VRCA 3JYNA 3PYLA 3UKOA 3ZWMA 1NTOA 5A1TA 3RBXA 3VPGA 5I7FA 2Y1GA 1FDUA 1I3KA 4NU6A 3JCZA 5L7TA 1ZSVA 2CVQA 4CUKA 1E7MA 5B4TA 1C0KA 4U6SA 2VZ9A 3D3WA 2AMFA 3KYCB 4II2A 4BNMA 5TQVA 2DBQA 4I5EA 1KY4A 3VH3A 1OMOA 4YAGA 1I2ZA 2IXAA 3WSVA 5JCJD 3D4PA 3U0BA 2CFCA 2J8ZA 1K6XA 5JY1A 4Y6PA 5C7IO 4D0SA 1NAHA 4OIMA 3DZHA 1J49A 1PZEA 4TQGA 4EUEA 1VSVA 2BMAA 3SLGA 5JNLA 5L45A 3A06A 1R0KA 1FMCA 1KEWA 3W1VA 1E3JA 4KWHA 1WDMA 2P9EA 4DMLA 3QA9A 5IZCA 1XU9A 1E3IA 4LRTB 3UICA 4DREA 4EYEA 4HUJA 4WKGA 1JKFA 4NQZA 1Z7EA 4XYGA 2PH5A 4KMSA 5F1OA 1FK8A 1O95A 3U49A 2FR8A 3BTUA 1JU9A 3T7CA 4AVYA 1KVTA 1U4SA 2CUKA 2HK7A 2X86A 5FI5A 5GY7A 5THKA 3AY6A 2Q2QA 2HK8A 2ZCUA 4LRSB 4P22A 3TQHA 3F5QA 3KEOA 4J0FA 1CIVA 2B37A 5U1PA 1ML3A 5F21A 4A03A 1J5PA 5IN4A 5I8ZA 1DJNA 1LBEA 3DAFA 4PLVA 3STHA 1HLDA 4RDHA 3PVZA 3K8ZA 3DBHA 2RAFA 4BO1A 3PLNA 4HXYA 3QIVA 3JQAB 5J23A 2G0TA 3KM0A 4OSPA 4GKVA 3WBFA 1ZKMA 3JQ6A 4PCVA 4IDAA 4YBZA 3WSWA 4J0EA 4DXHA 1YDEA 4E4YA 1YJQA 1A71A 3BHIA 3S2FA 4XZ3A 3F47A 3GN1A 2CDBA 1DAOA 2YJZA 3FR8A 3QP9A 3H3JA 3JD2A 4K26A 1AUPA 5L4SA 2VWHA 4Y6RA 5CG1A 5JCXA 1F0YA 1I01A 3DFZA 1I2CA 1ZSYA 1XIVA 3QVWA 5I9NA 3AM4A 5CPBA 5B37A 2PZMA 1Z6ZA 3PGXA 2UVDA 1X7DA 2J3KA 3AJRA 1BXKA 5TT0A 2QHXA 4OH1A 3OQBA 2D0IA 5A3VA 1N9GB 4Y6SA 3DOCA 4LGVA 3H4VA 3S2GA 3DMTC 4J1QA 2Q1UA 1SOWA 4AICA 4YT4A 4YJFA 5HS4A 2VT2A 2JAHA 3S2IA 4BB5A 2AEJA 5BT9A 4XQ9A 2XPCA 1A9ZA 3TJRA 4MVJD 1DXYA 2BH9A 4BNYA 4MKXA 1HKUA 4GH5A 1GZ3A 1MFPA 1TT7A 3FHLA 5KTKA 4J6FA 3HN7A 3DMTA 3JQAA 4PZEA 1N1EA 1ZH8A 3O38A 4EJ0A 1Y8RB 5I7EA 4XCVA 4D3DA 4AJOA 3OJ0A 1UZMA 4WCFC 3DBVO 4D45A 3RFVA 1X13A 3SJUA 4YACA 1QLJA 3PGJA 1S6YA 4ND2A 1U5AA 2EKPA 3VAZA 1C1XA 4PLGA 2I99A 1E1KA 4OAQA 1IYZA 4XGNA 3RC2A 4GLLA 3N58A 2VYNA 4XDZA 3WGIA 1U3UA 1PJLA 1I3MA 1E6EA 4H16A 3GVIA 5LCXA 3VPXA 3PZRA 4EBFA 1ISFA 4HADA 2RH4A 3QVTA 2DPGA 1LLQA 2X0JA 4EGFA 1PJSA 4J3FA 3UCXA 2AG8A 3GRKA 4B4WA 4ZVVA 1F8FA 2IXBA 3E48A 3WJ7A 1LQUA 1T2FA 3H2SA 3OA2A 4Z6KA 3NTOA 3WBBA 4D79A 2AQKA 3G1TA 4S1VA 4MJLA 3DDNA 1YB4A 5DP2A 3KSUA 1YL7A 1Z74A 4BKPA 4Z0HO 2I3AA 4MVJE 2P5UA 4FFRA 3VZQA 1NPYA 1LSSA 2Y1FA 4ALIA 4I9UA 1B7GO 1NBOA 3FWZA 2DBVO 3GNSA 3MOGA 5FFFA 4CQLA 2O48X 5KJEA 4OKIA 3P19A 5A9TA 2X7HA 2VWGA 3QWHA 1EUCA 2X0RA 3D5QA 4WOJA 5L7YA 1NWHA 4M1QA 3C1OA 1K0UA 4IUYA 3P2YA 2EXXA 1E3SA 4XRRA 2BGMA 3OMLA 3I9NA 1SB8A 4WNIA 4UVEA 2B83A 3C24A 3GGGA 1D4FA 2TMGA 2VYVA 4ZGWA 4YEDA 5AXBA 4DIBA 2AQIA 4CMHA 3U3XA 3V2GA 3CINA 4CMGA 4ZA2A 5IDXA 1A5ZA 3VPSA 5JYEA 2X22A 2O3SA 2ZKLA 4BKQA 1YXMA 1YBVA 4BKUA 1WNTA 1LA2A 4U7WA 5T8KC 3QLJA 1DPGA 4D41A 1N2SA 1PS0A 4ZQGA 2XAAA 1U5CA 3KYBA 5DBIA 4B3JA 4DPMA 1QMGA 4HFNA 4FOOA 4CM8B 4UAGA 1ZW1A 3GY0A 3LF1A 3G1UA 5JE8A 1XQ1A 4R5HA 2DUUA 3JV7A 1FXSA 3RUCA 2QX7A 1X14A 5JAIA 4FS3A 3ONEA 4L0QA 2HCTA 4CMIA 1DC6A 2X0IA 1D1TA 5GMOA 4H15A 5G0TA 3UAGA 3I4CA 5IXYA 3CTMA 1D1SA 4RDIA 5JDCC 1GADO 1DIBA 1E3LA 1DEHA 2AEFA 1E7RA 2NQ8A 2NACA 3JYLA 2P9GA 3A9WA 3EW7A 4LMPA 2FR1A 2D8AA 1LJ8A 3RUFA 4PGFA 1BMDA 4UULA 3TZCA 5KOIA 3QRWA 4FR5A 4HBGA 4NU5A 1QRRA 4BNGA 5JO9A 4WLUA 4DBVO 2O7QA 4DA9A 2QRJA 3ONDA 1Y1PA 1I24A 2BGKA 1U28A 3R0IA 4RZHA 3X2FA 3MTGA 3OJFA 3ON5A 3QVXA 3HSKA 5ER6A 1YOVA 1M67A 1I10A 2NVBA 4XYLA 3GAFA 1SB9A 3M1LA 1N9GA 3B20A 3OH8A 1V9LA 3DL2A 3SC4A 1ADFA 3TN7A 3F9IA 1Y7TA 3U9LA 3L9WA 1U3TA 3BMQB 4N7RA 1DSSG 1DC5A 5A5FA 2BF7A 4M8SA 3FI9A 3E9QA 4OJNA 2W4QA 1WZIA 1XQ6A 4YQYA 3Q6IA 3RSHA 4J2OA 2WYWA 4J91A 3L6OO 4ND5A 3GF4A 1X1EA 2VUSA 1NASA 4NNJA 4D43A 3OM9A 3S1LA 4EITA 1Y5RA 3ITDA 1T4BA 3WOHA 3DZIA 3PDUA 3EC7A 1EQUA 2AEMA 1J4AA 1XDWA 3ZGYA 3KSZO 5BSHA 3RC1A 4E5NA 2BFMA 2GNAA 4IDGA 1J6UA 3JQAD 4J43A 4JGBA 4PLZA 3W4IA 3HDHA 4R1UA 1AHHA 2SCUA 1DIGA 2QG4A 5ITVA 4CMBA 3V2HA 1HYGA 2NU9A 2D59A 4WASA 1GAEO 2FY8A 2ZB4A 4DLAA 4MVJA 3ZWNA 3UOGA 3FPCA 4XWYA 1R0LA 2IZ0A 5GZ6A 3VKUA 1KY5A 3CEAA 2Y1DA 5KKCA 3BMCB 2EGHA 3H9UA 3DBRA 3HG7A 3MJEA 1LSUA 2R00C 2XF8A 5B4UA 3OECA 1GUYA 4AG3A 1OC4A 2DTXA 3C7CB 3CZRA 4XEHA 3COSA 3OQ1A 2WE8A 4XX0A 4A0SA 1A9YA 1GQYA 4YT8A 4NBWA 3PJDA 1VJ0A 3K92A 2EW2A 1JLLA 1BSVA 2DLDA 3CE6A 2P4HX 4CLOB 4I9NA 4XB1A 1D7OA 1UXIA 3DBLA 3EZYA 4M86A 4NJOA 1IY8A 5TJ9A 1UXJA 1Y5MA 4FJ0A 1F14A 3VVCA 2JD0A 2GCGA 2HK9A 4WK6A 3Q9UA 5GZ3A 4A27A 3RJ9A 3M2PA 2X9GA 3GFGA 1CWUA 3RUIA 2GSDA 3FNGA 5JW6A 3BXXA 4OM8A 4IJUA 1UUFA 4R16A 2NQTA 1RPNA 4CMAA 4BNZA 4NJMB 2C0CA 1XLTA 4DQVA 3IUSA 4MP6A 1VM6A 2Q3EA 1BDMA 2Y0CA 3KV3O 3BMOB 1IZ0A 2D5AA 4WGGA 3ITKA 4KQWA 4JBGA 3BMNB 1ZK0A 4YJHA 3LC2O 4IQGA 3F46A 3VDQA 3ZN2A 4PRLA 3TRIA 4HNGA 1BXGB 4XGKA 1KERA 3PRJA 2VOJA 4MVJM 4Z9XA 1SBYA 2ZJ1A 2J5KA 5DBFA 5H83A 3ZH2A 3VKVA 3KYDB 1JKIA 2VHWA 3RUHA 4RV9A 5L3ZA 3TPCA 3CPSA 4PIVA 5FYDA 2QIOA 4A7PA 4XYBA 4IMPA 3H6KA 3I6IA 3ENKA 4DC1A 3ZNOA 2JD1A 5KVQA 2J3JA 2WTBA 3KVOA 4PFJA 4B4VA 3FSRA 4RVGA 4Q3DA 2OP0A 3ICCA 3RAJA 4UEKA 1S7CA 3E8XA 4FB5A 4E30A 5ENVA 3RU7A 5IFLA 1B8VA 5JDIA 5IDQA 4DQUA 3LZ6A 3MWDB 5TS3A 2X5JO 3H3FA 1ID1A 3NDRA 4GKBA 3V5NA 1Q0QA 3AI2A 4E0BA 1YQDA 4EEXA 3LT1A 4IPTA 4CODB 1RJWA 4BGUA 1WW8A 2NVWA 3WG9A 3ASUA 3DXFA 4E33A 3KRTA 1PZGA 4MVJF 1H0KA 4BO2A 3GPDG 4CLDA 5LDGA 1DFHA 1E6WA 4B8ZA 3DEYX 3EAGA 4Z3DA 3NV9A 5JAQA 2O3RA 1ISJA 5JC8A 1H9AA 4P8RA 4CV3A 4FSHA 3TOZA 4BNIA 4N5LA 2CF6A 5TGDA 1UJMA 3K5PA 4R54A 2C2YA 5IZ4A 5ER9A 2BI7A 2PNFA 4B8WA 5L4LA 1ZIDA 3GZ4A 3OFSA 4K1LA 3RFXA 4W4TA 4J7XA 1GV0A 2HRZA 2QW8A 3F5SA 1PQWA 4WEOA 2O23A 1H2HA 3JD3A 2BELA 2BD0A 3MJVA 2WYUA 4TKMA 3F1KA 3CZMA 4W9NC 2P91A 3I9JA 3GGOA 1PS8A 3S55A 4YR9A 1WWKA 4L4XA 1IULA 1PWXA 1XWFA 4D42A 5KIAA 4GBJA 3AK4A 4NIMA 5ES3A 4D3SA 1PQUA 3PJGA 1IOLA 2R6JA 3BTSA 4Q3EA 1P45A 4TWRA 1GDHA 1YL6A 3UGKA 4UVGA 3GMSA 2YHIB 1QYWA 2QYSA 2ZTVA 4XDYA 1MGOA 3DO5A 1LTHR 3C7AA 4N5MA 1HDXA 4J16A 3AY3A 4YAJA 1OC2A 2DAPA 2EJWA 2P4QA 4PLPA 4ALMA 2FP4A 2I3GA 3OETA 1Q2XA 4IJVA 5EERA 1NFFA 5TC4A 2F1KA 1XYGA 2VUTA 3BMQA 2YFHA 1LLUA 1XG5A 4FFLA 2PLAA 3PP8A 2VOEA 3EK2A 3QWAA 4CR8A 5GZ1A 3VZPA 4BNWA 1T24A 4B4OA 1EFLA 5C7OO 1K89A 3M2TA 1NFRA 5IJZA 3JD0A 4YJFB 1Z82A 4OSOA 1ZNQO 3H8VA 1T2EA 2C82A 1GYQA 2DUWA 2EP7A 3RUDA 3QVSA 1JKJA 1MX3A 1ZEJA 1DJQA 3C7DB 3C85A 1OFGA 1YBMA 2UAGA 2B36A 4PG6A 1PWZA 3X2EA 2NU6A 3VH4A 1C0PA 1GZ6A 4YCAA 4RVDA 1HT0A 2EV9A 2GLXA 5DZSA 1MG0A 1W8DA 4Y98A 3AOEA 3C1AA 3OIFA 2W2LD 2DFDA 7ADHA 1IPEA 1NQAO 3VC7A 4MP8A 2VRBA 3HJAA 4DBZA 3BMOA 3PHGA 1HZZA 1DOHA 2PFGA 9LDBA 4O1MA 2ZATA 4GPD1 1P3DA 1W73A 2GN8A 3EDMA 4GMGA 4AFNA 4CM9D 1GU7A 2Z95A 2QYTA 4IMRA 4K6CA 1LEHA 3I9MA 4A5OA 4AJJA 1T1RA 3BHMA 1MXFA 3MWEB 5EQFA 1R4NA 2X6TA 2JJYA 1EVIA 4URFA 2Q2VA 3KETA 3FR7A 4JK3A 3BZUA 3G0OA 4J1SA 5L4NA 3GHHA 3CIFA 4R5MA 4UREA 3CMCO 4B7XA 2Q99A 4A10A 1P33A 2I66A 5TNXA 3GVXA 5G2OA 3E82A 1X0XA 2X23A 5DBGA 1WDLA 4RF2A 4CQMD 3NDIA 3WNVA 2I65A 3VVBA 4OXKA 3BYZA 1EVZA 5JAZA 4EJ6A 3E03A 4J2HA 1A27A 3INTA 4AJLA 4N5NA 1GD1O 1QSGA 1YO6A 2A9FA 3LLSA 3RASA 1AE1A 4ZRMA 1Y81A 1E5QA 3ENNA 3GR6A 4L73A 2IYOA 3BMNA 2NADA 3VPFA 4CM4A 2Y99A 5DOVA 4F6CA 4IGFA 4PLTA 3GVPA 5F5LA 1N8KA 4M55A 3AM3A 4L76A 1I32A 1I36A 4EEZA 3LVFO 1ONOA 4J1NA 5EESA 3K31A 3SX2A 3ZU5A 3U09A 1ZSNA 4FQ8A 2B5WA 4YT5A 1HE3A 4FJ1A 2D1YA 1OAAA 3QW2A 5EMHA 3TL3A 4UUNA 2OMEA 3OIGA 3QWFA 5EJ2A 5CP8A 1B15A 5AXAA 4PZCA 2IODA 5CDGA 5K6AC 3DQPA 1BXGA 3LT0A 3NUGA 3UFXA 4EDFA 2HMSA 4RQTA 3L0DA 4RF5A 2ZYDA 4XJSA 3RVDA 4WNCA 3JQFC 3JYOA 1ZEMA 3D7LA 1VLLA 2OOSA 1BVRA 3GAZA 2FR0A 5CEJA 1NVGA 3ICPA 3ZCXA 1U8FO 3NEPX 4CQMB 4NHEA 4TZKA 3PLRA 3VZRA 3E5MA 3N74A 2P9CA 2W2KB 2P68A 3PQDA 1LDEA 5DT9A 3I9OA 4IS3A 4M89A 1VJ1A 4Q3BA 4FGSA 1MV8A 3G17A 3OSUA 1P1KA 5I9MA 4R01A 3FRJA 1AXEA 3H2ZA 5LC1A 3PHHA 5JAMA 2Q50A 4CUZA 1UAYA 3SC6A 1F12A 4O59O 4J1TA 4RCVA 1MA0A 3HUDA 5T64A 3MCVA 4NFYA 4BNXA 3GVCA 4IIUA 2FWMX 1FDSA 1E0DA 2UYYA 1HE5A 3VH1A 1GQ2A 4MVJH 3WX0A 1VL0A 1GL3A 2CSUA 3ASVA 3GG2A 3H5NA 4PVCA 1ONPA 4WECA 2EHDA 2G5CA 3E6AA 2G1UA 1C0IA 3D64A 3MTJA 4CQLB 4WUVA 3Q1LA 3PJFA 1DAPA 2GF2A 4C7JA 5ITWA 2PGLA 2VHXA 3A4VA 1RKXA 4NFSA 2V6BA 4O6VA 5JYDA 3B1FA 3LC1O 3HADA 1BTOA 3V8BA 1E7WA 1PJTA 3GMDA 4JX8A 3WFJA 3E9NA 3H5RA 3ABIA 3QQPA 4XYMA 2GASA 4ID9A 2Y66A 2OGUA 1NYTA 3ZWYA 1NPDA 4S3MA 1QLHA 3EUWA 3JTMA 3GEGA 1I30A 1XKQA 4JBIA 2RHRA 3E1KA 3JQ9C 3RC9A 4E2XA 2WMDA 3WTBA 1B2LA 2EIHA 3IL2A 3ST7A 2DVMA 1QORA 2BI8A 4LCEA 4GL4A 4WEQA 5JC1A 3DHEA 1VKOA 3W4JA 1SMKA 3UCFA 1NR1A 4NK5A 3B6ZA 1E3WA 1O8CA 4YRDA 4E31A 3KHUA 3ZWPA 5A3JA 3H9QA 4ZQEA 2FRDA 4R9SA 4PLHA 4CM3A 4HFMA 1ZFNA 3ZV3A 2RH8A 1DLJA 4O0LA 3LC7O 2JCYA 3JD1A 4RGBA 1Z75A 3T7EA 4P4NA 5T8KA 4I5GA 2GN6A 2HDHA 3DZJA 2H6EA 3UCEA 3ZNQA 1Y9AA 4XKJA 1B0AA 2EJVA 1R4MB 1VE9A 4MDHA 4A73A 4E21A 2XXBA 1W4ZA 4GSLA 4GWKA 2CNBA 2A94A 5A9SA 5BSEA 1BG6A 1ZK2A 3D3WB 3F4BA 1PS9A 4XRGA 3KSDO 1E6UA 1K2WA 1HZJA 4DWVA 4B3HA 1ZZEA 3W8FA 1RM0A 4MO2A 4BNUA 1LC3A 1C3VA 1P1FA 2C5AA 2J3IA 3GDGA 4YTEA 2ZJ0A 4PG7A 4FW8A 4HFRA 4ILKA 4XA8A 1HL3A 3HN2A 3OEYA 2OBYA 3JQFA 3RWBA 5B1YA 4KTTE 1UAGA 4WJZA 1E1MA 4JNKA 1CF2O 2YHUA 2Q45A 4DIFA 4CM9A 1KOLA 4NR0A 3AU9A 2DC1A 2NLOA 3TSCA 3FBGA 5IG2A 2BHLA 3KTDA 2HJRA 2W2LA 3OBBA 4IDDA 5AXCA 5JDCA 3NTRA 1X15A 1LSJA 3B1KA 3NTQA 2CDCA 3H9EO 2ILTA 3GEMA 4MIYA 3VTZA 3C8MA 3QVOA 4IY1A 1HWYA 4WLVA 4Q3CA 1GPDG 4PVDA 4M54A 1T2CA 2ZB3A 1KYQA 2HU2A 4I5DA 4YXFA 1VI2A 4RVSA 4AJ4A 5DCWA 4HV4A 4OO3A 4JCOA 1H6AA 1T1SA 4PZDA 3DOJA 5H82A 4BNVA 4NBRA 4IQ8A 2PD6A 1ENZA 3V1TC 3LT2A 1P0FA 2DQ4A 4E5YA 4U5QA 1W0CA 3TZHA 4BKOA 3GA0A 1U3VA 4LISA 4WCDA 4UVDA 1YOVB 1TB4A 5C7LO 1ZUD1 2POQX 3NKLA 3IP1A 4DVJA 1PJBA 1UH5A 4ZQHA 2X5OA 3EVTA 2DBRA 2LDXA 4KUGA 3MJSA 2B4TO 3GRPA 2CD9A 3PYXA 5BNFA 4B4UA 3H9GA 1P74A 4DYVA 1K5HA 4BO3A 3IAHA 3KLMX 1NWCA 2OP1A 3GG9A 2OO5A 4BO6A 2J6IA 1PEDA 3F3SA 1NQ5A 3GDFA 2VCYA 4YJDA 2Q49A 5CPFA 4E2ZA 4OKNA 1SNYA 2Y93A 3WGOA 1SC6A 3KUXA 2AQ8A 3L6DA 4NBTA 4ND3A 4WLNA 2RBEA 5HA5A 3BHJA 1T2DA 5JMWA 3OQ6A 2PZLA 3SXPA 4INAA 1V3UA 2C20A 4YJHB 4UVHA 5COAA 3INGA 3JQ9A 4IS2A 3HWRA 1B8UA 1NNUA 4MKZA 3RUEA 5BNIA 5KCZA 2VUUA 3DWFA 2HLPA 2CY0A 1ISMA 1X1TA 3HQ4O 5A02A 1LLDA 3ROPA 3WYEA 4F6LA 4DYDA 4J7UA 4RVUA 2DM6A 1QYXA 3BA1A 2Y05A 3L4BA 1Q7CA 4BL5A 1TEHA 4GVXA 1E77A 5AQ1A 4MVJP 4E2WA 1EK5A 4CUJA 1HDRA 1KC1A 3K2EA 1FF9A 3H7AA 4LW8A 3ROKA 3NRCA 1NX6A 1PJ4A 4JJIA 1ULSA 4B7UA 1XGKA 5KJ1A 3BTVA 1HE2A 3BTOA 5U4QA 2A4KA 3GDOA 4E5PA 5EIOA 4XB2A 2E49A 3ANLA 4JBHA 3ZV6A 2WWRA 3DZBA 5G4LA 4EJMA 2I76A 3I5MA 2GPTA 4ALLA 1SEPA 3WGGA 2PGDA 1GCOA 4R3NA 1VJTA 4O63O 4DPKA 5DDIP 1WVGA 3ROQA 4J9UE 4RVHA 3VPHA 4TRNA 3ZNPA 4P4LA 3IP3A 1KIFA 3CXRA 1QV7A 1ZK4A 2IEBA 1RYEA 1U1IA 1UP7A 1DIHA 1QYDA 1R16A 4CM1A 3W8EA 3AU8A 3WQSB 3G3EA 1CDOA 3KYCA 4GAEA 2Z5LA 3DBHB 2VNSA 1DC3A 4ALNA 1YBAA 5B12A 4CLHA 4L8VA 2YY7A 2YW9A 1ZK1A 1FDWA 1XHLA 2FMUA 3B70A 4TVOA 1F06A 4KTVE 2WD7A 3OICA 2GZ3A 1V35A 4CM5A 4WLEA 3VDRA 5EN4A 4BNHA 1YQGA 3JQ8A 2GD1O 4LSWA 2HMVA 1KETA 3OHSX 3DTYA 1XR3A 2AXQA 5DP1A 1JA9A 2ZB8A 3TOXA 3WGQA 5ICSA 4BO4A 3DAPA 3JQBC 4L4SA 4DQXA 3I1JA 3WXBA 3RKUA 4RQUA 4E2YA 4JP2A 1EDZA 4R68A 1W6UA 3R1IA 2H1SA 4Q3AA 3WQQA 3GOHA 3H5AA 3NJ4A 4NI5A 2ZK7A 4IZIA 4CJXA 3GT0A 3DOOA 1L7DA 1NXQA 4CMKA 4CV0A 5JMPA 5BQFA 3MOIA 4CL8A 3WIDA 3RFTA 2I5PO 3F4LA 1O5IA 3FNHA 5BSGA 1E7SA 1GUFA 1O89A 2X9VA 4LCJA 4YAEA 1D3AA 3ZHBA 1X7GA 3AI3A 4YRBA 1UXKA 2H63A 4FFNA 3PQFA 4CR6A 5CDYA 2X4GA 2WYVA 1HTBA 2EKQA 4JJFA 3ZHXA 4ONEA 3L4SO 2NSDA 2JKVA 5F1PA 3AUUA 3O9ZA 3ZI0A 2HSDA 4ZQFA 5DF1A 1ZMTA 3DAGA 3I52A 1CERA 1RM3A 5A9SB 1N7HA 1P44A 3GZNB 1JWAB 4JN6B 4EW6A 4DTIA 4FN4A 3PXXA 3QWBA 4ESOA 5F1KA 4I1IA 1L1FA 3I23A 1U4OA 1VL8A 3N7UA 4GLOA 1ISGA 1XCBA 3DHNA 1PX0A 1XU7A 1NVMB 4KWIA 3UW3A 3KYDA 1A7AA 5EINA 2YV3A 1NVTA 1MFZA 2X8LA 5HTOA 2C07A 5JDIC 1PL8A 1TXGA 1ZJYA 5THQA 5ENDA 3EMKA 3FN4A 4JROA 1ENYA 4OOEA 4O5OA 1R15A 1KEUA 4I08A 1PGJA 5CEFA 4AJIA 4OXNA 5G0UA 5JFOA 4I8XA 4ROSA 3G79A 4NK4A 3KZVA 3QE3A 4HP8A 2D3TA 5U9CA 1UXHA 1HETA 2E6UX 4RLSA 4XGIA 3JSAA 1AGNA 1SPXA 1PJCA 1YQXA 3NJ8A 4AL4A 1NQOA 5CDSA 1QYVA 5L51A 2GRAA 2YYYA 1NAIA 3O8QB 4ND1A 2FPPA 4RPKA 1PGPA 2QZ9A 5BSFA 2EW8A 5AXDA 1DBVO 1YS4A 2V6GA 1GYPA 1D8AA 2IEDA 3IMFA 1N92A 1LQTA 3RBVA 4ZJUA 4NJMA 3Q9NA 4R51A 3D3EA 3UN1A 1JVSA 2JAPA 5IF3A 1PIWA 1DB3A 2FPIA 3K6JA 1DRWA 3T4EA 2RHCA 1H9BA 4BO9A 4BV8A 1YDWA 4CV1A 1M6HA 3NGLA 4YDRA 2DU8A 4DL9A 5AOVA 3KOUA 2C5EA 2PKRA 1DRVA 1A72A 4UUPA 3PEFA 4GI2A 1LDNA 1JAXA 1WP4A 3ADOA 2E4AA 2VWQA 3DMYA 3WDSA 4R1TA 2AE2A 1WDKA 2A35A 3ONFA 1EK6A 3JQ7B 3P5SA 4NBUA 4ZD6A 2YDXA 1JAYA 1NR7A 4QO8A 5CDUA 4E3ZA 3PWZA 3IKTA 1EZ4A 3T4XA 1BVUA 2HQ1A 1C0LA 3R6DA 3TFQA 3TF5A 1MC4A 2IE0A 1X7HA 5A5EA 1PGNA 3TDKA 1LNQA 5F3RA 4QX6A 1A4IA 2HMWA 4QQRA 3VOSA 2EG9A 3WJAA 4FOSA 4BGVA
chains in the Genus database with same CATH superfamily
2PUCA 4N01A 3HXLA 4R71A 1KGDA 2PX3A 2AD5A 1KVUA 1P0CA 3U3KA 3ZDYB 2JL1A 2B7CA 3L46A 4H27A 1E6KA 3SQOA 1H8EA 3L0YA 1G21A 4AYTA 3TZ6A 1NN1A 4I9GA 1VJDA 5B2EA 2PK3A 3AIKA 1Q17A 4G4IA 3RTBA 1BRTA 1J00A 1I0ZA 2HSWA 3BORA 3JYPA 2EFHB 3OCXA 3OLZA 3J7TA 4CNBA 2C61A 2EP5A 1SBIA 2LWIA 1JDBC 1P9RA 3KBOA 4JWKA 1W1UA 2OHGA 4NOKA 4E14A 1UKVY 2GDJA 1VHQA 4OQYA 3FB4A 4D80A 1D2AA 2H0QA 4JH0A 4C2AA 1A7KA 4LQLA 1JTFA 3IIEA 1RDFA 3L0SA 3TD2A 4EZBA 3PDJA 3D5TA 3GPIA 3EQ9A 2IYZA 1GGJA 4H2DA 3B51X 3MJRA 1Q74A 3U4AA 1ZOPA 5FLEX 5KSPA 3Q85A 2Y1CA 2Y9PB 3GQVA 3PYMA 2O7VA 3TM5A 1I2BA 5A9RA 5C32A 1OXTA 5GOTA 3HGTA 5FUMA 1YBHA 1AUXA 1CR0A 3HDJA 2E7ZA 5ALOA 5IU6A 2H4YA 5EHQA 4ZHQF 2EARA 3P4YA 3R0VA 2E37A 3L7OA 3Q2KA 3OPQA 1QHHB 1WXWA 2VSNA 2OXIA 3OEWA 2IOHA 1OXBB 2XI4A 2P4UA 1WUJS 2YL2A 1YU6A 2AW5A 3BMXA 3PR1A 2X14A 2B0JA 2MSCB 4L75A 4R8KA 2MCFA 1O6ZA 2YQZA 3WLRA 2X7JA 4BQNA 2O2XA 1A69A 1YGPA 1Z36A 2PKQO 1TKBA 2Y2VA 1N6PA 2OGSA 3BSWA 2FEWB 3HLTA 3UQZA 4F97A 1JHXA 4UTVA 2WU1A 4IINA 1IG0A 1EA5A 3FH0A 5HZMA 5KNBH 3OF2A 4AI6A 3R3SA 4JXJA 4Z9FA 1KVQA 1E60A 1R00A 1BW9B 3FDZB 1CR1A 1ICIA 2BFDB 3LXRA 1Y4UA 4GM1A 4JS0A 1U3FA 4MKFA 3V1NA 2IZZA 2RG1A 3ZWOA 5JPDA 3MNFA 1RRMA 2JKZA 4MDEA 1WBDA 3L7YA 1JIVA 1JEQA 5B3KA 4YRRA 3RC7A 1E3WB 2JFZA 2QN9A 2IW1A 1MR3F 7YASA 3ZWQA 3M6MD 4MTLA 4LX8A 2HLDD 1YMVA 4COOA 1IEVA 1PR0A 1EFRA 2QM7A 4R8RA 1MC8A 1T3SA 3TW0A 1P77A 1X9GA 2CEKA 2G8LA 5I01A 1YDMA 3QBDA 1X0VA 4RMNA 2E1RA 1NUUA 3PFIA 3MMZA 4MUJA 5DWDA 4JI3B 4ER6A 2QUJA 2IYSA 2QAIA 3MCTA 4FYVA 4DA6A 4DSZA 5LMNB 4ESHA 1B16A 5HIJA 1ELOA 3GEBA 4WKOA 3ZU4A 2R5NA 4PHHA 1CVIA 2PVPA 3F3KA 3QELA 2Q9UA 4FYKA 2BP7A 4QOSA 3GT3A 4CLXA 4X54A 1YKGA 2FMXA 1UDWA 4V2IA 3HXOA 2G9ZA 5DI3A 1NUQA 4HPXB 3K9BA 2IYRA 3ROFA 4WI1A 4E5UA 5LLSA 4MLZA 3PC8A 2BGRA 1NW8A 1UODA 4KIUA 4ND6A 5BR8B 4PG5A 2O8DA 2WKSA 3ZQKA 5ALVA 2FWIA 2OFWA 3ILXA 4HUTA 4TXMA 3VYUB 3TLXA 1T1EA 5ARDA 1FSZA 1I3NA 4BMSA 1LF0A 1K7EB 1TVKA 3DNFA 3EE6A 3JVDA 4DLKA 4RPCA 1CQJA 4MV5A 5AKHA 3LLUA 1L7MA 4GVPA 2ST1A 4Q3NA 4RA6A 3SVTA 2H08A 4WESB 4BBAA 1NSYA 1U2SA 3IMKA 3MOSA 5DLDA 4BQPA 3EEYA 3A4MA 4JJGA 1RQLA 3LLVA 3MAAC 2CYCA 3KAJA 3E5RA 3NNNA 5CA0F 3SIRA 5KSZA 3BQNB 2VIIA 4LGMA 3F7OA 2ZQ5A 4GQAA 2RIRA 4H6WA 1STOA 3R6LA 3WLFA 1H4TA 4DB4A 1VZ2A 3NWOA 3QKWA 1YS6A 4HPWA 1Y98A 3FKSD 3BJZA 5GIPE 3OLCX 4M0CA 4W7HA 2F8TA 4MYSA 1C1DB 3GEDA 5TQJA 4QGHA 1WNFA 4K9LA 4K81B 1TVEA 4DEVA 3JAWA 1FMFA 2JH9A 2O2YA 2PFKA 4KAFA 4KFTA 4YT2A 3P2MA 3IKMB 2VBFA 4FFOA 1OYYA 4D9KA 1T6XA 3RS0A 4LYFA 1H8ED 1Q11A 1Y9ZA 2IOYA 2YJ3A 1OZ0A 2ZBDA 4HAVA 3SS8A 3T7RA 3UJNA 1CQIA 4GGOA 3UV6A 4Q48A 1NZFA 1ZGCA 5AW1A 3IXQA 3T7KA 3ESRA 4JQYA 3N70A 1P4JA 5EJEA 5GJBA 2W2KA 4LVCA 1NGSA 4DUPA 1OHHA 2NGRA 2ODAA 1JRLA 2F43B 4TSFD 4C0WA 3MEQA 4E32A 1EDBA 4YP0A 3UPUA 4X9XA 4QYSA 4CQMA 2G04A 2YV2A 5L9AA 1V16A 2VHZA 3THWA 1SZJG 4GNRA 2I7DA 1D2GA 2XTNA 4GLBA 1K1EA 1Z28A 3JW8A 5ILOA 1RI5A 1FU7A 1J0AA 3LPAA 4J07A 4QGAA 3ZXYA 2O3QA 1IHYA 1QFJA 4CM4B 5J3JA 2QTNA 1DBPA 1QG4A 1U2RA 2YQ5A 4HQOA 1RTKA 3C6YA 4LWOA 4QVKA 1XT6A 5H80A 1HE4A 3TDNA 1CFZA 3GRYA 3KVYA 5FX2A 1YCFA 5I7SA 1ZVQA 3HJTA 4TV8F 1QHFA 1ZJZA 1SAYA 3EARA 4OXYA 3D6NB 4ZT2A 3WA6A 3AOEC 4EMSA 4GEKA 1W87A 2JGLA 4DCJA 3O8QA 4HYEA 1A4UA 4W6ZA 1C30B 3TIIA 3QYJA 1O57A 2OVFA 3D0OA 1J70A 1Y6GA 1T25A 1ZYUA 1XD8A 2I1WA 4QATA 2JBAB 3KS9A 4TL9A 2AFIE 5F77A 4CKCB 2FSHA 1XXHA 1DMSA 1VDMA 5IAAA 3PV0A 1N7JA 4WKPA 2J59A 1JKMA 4AJ2A 3Q3EA 2W58A 4K6GA 3DBLB 1GQRA 1MAVA 1DIRA 3RIYA 3I2KA 3OMWA 4OHCA 4BMCA 5HW0A 3OTOB 2XMDA 4YPOA 1XLVA 4XAQA 3HYSA 1ZOSA 3AB7A 2WE7A 5B6PA 3E18A 5K3EA 1PZFA 4WACA 4LY6A 3THYB 4JI1B 3HCAA 4F96A 4ZGGA 2O06A 4CTOA 3GJ3A 2PR7A 4EKIA 1HXHA 2N0SA 2X8JA 3PHLA 2MYNA 4JIMA 5DN9A 1EMDA 1UBLS 1XNGA 4C5AA 2GZMA 5TSDA 2FR8C 2XE8A 3TSZA 1TFRA 2C3PA 4R0VA 1UP6A 2WTAA 2HMUA 3QH4A 1RAEA 2ZIZA 2GYUA 4PO1A 5EMNA 3GDWA 1ZJ5A 2H1IA 2QRGA 5FKJA 5HGJA 3S27A 4WY2A 1T5OA 4YJGB 1Z12A 3BXFA 3MVEA 5LU8A 3C6KA 5FWXA 3PFFA 3KZXA 2P3LA 3G5UA 1T9BA 2W2TA 4B46A 1B0UA 1QZXA 1ZIXA 2HMTA 5CK4A 4BV2A 5EEGA 5LP6A 4DR4B 1B8PA 1CUUA 3AG6A 4UEJA 4E03A 1PQPA 2QM0A 1B4DA 4RH0A 5CM2Z 4GX1A 1OUMA 1T4CB 2I2XB 3FD8A 2W8BB 3N2ZB 3S7TA 3KWJA 4Y6QA 4XQ0A 1GEEA 1NX9A 1SQ5A 3OOWA 1E59A 4PGGA 4MCAA 3IAUA 3ESXA 5MGNA 2OCBA 3CX3A 4Q93A 1U0BB 4YI3A 2WR8A 4HNQA 1Z26A 3JQ8B 1K9VF 4UMEA 4WOPA 4BFSA 5LD2B 4Y0VA 1ZM2A 3V8RA 3MRVA 2WQ6A 4CFZA 2A14A 2BFOA 2YV5A 1PUXA 3KWFA 1WG8A 2ZANA 3MW8A 4TMXA 1OW3B 4PLFA 3VMMA 4BO8A 5MN5A 2G7ZA 3V34A 1IVSA 1KEPA 2ZP1A 1IN7A 2H65A 3KXIA 2EOAA 4U8HA 3BXGA 4G1CA 4IDHA 1ONNA 2IPLA 4IL5A 1KAHA 4XM2A 5BOVA 1ZBQA 3OPXA 2I33A 4JQCA 3A7DA 4U7HA 4D26A 4NBVA 4PGHA 1M2EA 1SKUA 2P11A 3O4IA 1NP7A 1WQ1R 3ZZNA 3HU2A 1KI6A 2QU7A 5CDHA 3ABRB 2BLLA 2FHSA 4DTCA 3ASYA 2H85A 1VPEA 3GLSA 1I9GA 1U6KA 4HCJA 1YH3A 4LF4B 1JX6A 4KDRA 2I62A 3SJCA 3KEQA 3F73A 1I3LA 1X8LA 1TF7A 1G5IA 2X1LA 3QUTA 4I6JA 3W3AD 3V97A 1XELA 1NIJA 3IIMA 1Y1LA 5E9WA 5F5NA 3G0IA 4YB8A 1GQQA 1RRVA 4I5IA 4C4RA 1XD9A 3AJ9A 3G5LA 4FZJA 2RGDA 1BDIA 1Q1AA 1VMDA 1GXSA 2XVYA 3AESB 2GM5A 4OMFG 3LU1A 2AF3C 3W3AA 5EP4A 4ZARA 2O8NA 2YICA 1KHHA 5B4VA 1W19A 5KTRA 4FDLA 4XH9B 4F1KA 4ALJA 5DBOA 3VR6A 5L53A 3GLGE 2ODBA 2WU3A 1DT5A 2QRNA 2F4NA 3A6LA 3EUEA 4I1OA 2FPSA 4C2BA 1AKWA 4IIVA 4IXTA 2UV8A 3SXUA 4JBWA 4EGSA 2X0NA 2D62A 3UAOA 1BW9A 1NR5A 2P69A 2A9JA 1AQYA 3ICOA 4ZEVA 4HDNA 2PKWA 1DKLA 1JNYA 1LPPA 1WMBA 4LVUA 5CXQA 2PHZA 5T3YA 4J0CA 4CM7A 1IHPA 2NTJA 4OXRA 5T6BA 1QTNA 2BFCA 2EQAA 1ISRA 1A8UA 2X9NA 3ENVA 2ZQYA 2GD0A 2I7VA 2WT8A 2ZRDA 3P27A 4X20A 4RFSA 4Q9AA 1EG7A 2R8ZA 5A4MS 3HPQA 1GPKA 5DHPA 3UY4A 3OSZA 4MW7A 4LN1A 5LMCA 3A10A 2VAPA 2P5YA 4XPIB 5IBPA 1L0BA 4UQLA 1UC8A 4BO5A 1P8AA 4BATA 1WUTA 1DELA 1XZCA 4GFDA 2FZ4A 2P3OA 2YYZA 1X3SA 3JWPA 4UTNA 1EDDA 1U2GA 3Q7IA 4Q24A 2F1RA 4R1SA 4TTVA 4YQZA 2H4ZA 1ZIOA 4II3A 5DT2A 5KYXB 2EFGA 3G49A 2H59A 3AVQA 5LDHA 2ERYA 1PWHA 3R7WA 3QOWA 2QE7D 2WIAA 3C8UA 3NUZA 4N5IX 1TCCA 2VH2A 4Y1RB 3FWYA 2BMDA 4RV4A 3LP5A 3V80A 3OFND 4QRHA 2R6GA 3A4IA 4NHOA 4Z9YA 5A05A 4J49A 4JUIA 3WAKA 3R2JA 1RAAA 2HSGA 5JS7A 1B0PA 1UKEA 1ENOA 1MJ5A 3IKVA 3AP3A 4UBMA 1Y6JA 1R7RA 3PUJA 2B35A 1IIBA 3B1JA 9LDTA 2ZIFA 1IMJA 3QU7A 5IKMA 1M1YB 1XJ5A 5IEBA 2HCFA 4OTZA 2OWDA 2PMEA 3V3KA 3EXFA 2VJBA 3ELWA 4QOFA 3AHJA 4P4SA 1YNOA 1YRAA 3IIKA 2PGXA 4Z0TA 1LJUA 3DD1A 4JGIA 4KGVA 4YYEA 3SIWA 5IH7A 1YZUA 1N5IA 3K9QO 4OJQA 3TUJC 3TWOA 3B5IA 3DJYA 4U9HS 5HRUA 1GAWA 1HMYA 5A4FS 1HG1A 3TLBA 5H70A 5SZJA 3E9EA 2HAEA 5AK4A 2ZITA 4M1MA 4MITA 4AQ7A 1S8OA 2OY0A 1G4UR 3O9MA 2QYHA 3RRYA 2Q6VA 1GPMA 1OIWA 2FPRA 3OQPA 1KARA 1YA6A 5KNBD 3WL3A 3EHEA 4R2MA 1DFGA 5FI3A 2IIQA 1JEOA 1ZK3A 1NBME 2FSSA 4M21A 1XK6A 4P3NA 4TUYF 4BMOB 4NXNB 2FEXA 1BD4A 1P2FA 4TZTA 3V4RA 1KFCB 2CLDX 4QBHA 3WMFA 2QMOA 4I4TB 5GADl 4U7PB 1PFQA 2BRUA 2AZTA 4G5HA 1ULBA 4KVGA 3V7UA 2PSSA 1RXIA 1U0SY 2WKWA 1QR6A 4YA6A 3UEOA 3NGMA 3HDTA 3SYNA 1XCOA 1Z3CA 1PYDA 1XRPA 2GVDC 1B1AA 2VHJA 1Z08A 3B9QA 1SHKA 3KR0A 2Y1OA 1ZHHA 1VG1A 2VQDA 4J4TA 1SIBE 3M3DA 1YL5A 1JQ3A 1YVDA 4DCPA 1GDTA 1V11B 1B6TA 4D0RA 1ICEA 2Y76A 2XXJA 3BC1A 3U80A 4DLVA 2HLDA 3MG9A 2FQXA 1NULA 1U11A 2IXTA 3WGJA 4ZK6A 4TVBA 3AY7A 2CXRA 2W2OA 4R05A 2C9ZA 3PKIA 2ZUCA 2GM9A 3ZU6A 2PWPA 3GRUA 3QJYA 4L95C 1KRHA 3EISA 3EXAA 4BGDA 1XCJA 5J2TA 4OBEA 1LNZA 1OWMA 2JHCA 5HBRA 3Q3CA 2HA3A 3ED5A 3GVHA 1JHPA 5T67A 121PA 5IDYA 1NVAA 2Z1MA 3NDJA 5CXXA 4P5PA 1A7UA 4HC4A 3R3VA 1S5PA 4W5OA 4UNSA 1EUDA 1P6XA 1S96A 2I6XA 1QZZA 3DB1A 1UFRA 1VSUA 2ZB2A 1J0XO 5F7JA 3KNZA 3QHAA 1U8XX 4CMEC 1EFPB 3AONB 3EIQA 2HA4A 1E2EA 1KI4A 1MT0A 1PVVA 2OSBA 1OZAA 3HR7A 4FMDB 1KQ3A 2I7XA 2VZ8A 3LS2A 4QECA 2ZTHA 1GAXA 4TWZA 1V25A 3DWIA 1XZ8A 1O0SA 1QIGA 3FKSA 5D00A 3WRWA 4GL2A 1WSDA 3P45A 1JDBB 4V3CA 1BMFD 1VGRA 3H1TA 4MCJA 1NF8A 4HWTA 5TS2A 4LTNA 1QPBA 4ZJPA 4FFWA 2ZUSA 5SV2A 2Z04A 3ZZ0A 4BOYA 3ADKA 2I1VB 2KW5A 2BSAA 1G4HA 3TLGB 1C3JA 3L8YA 5HF8A 3FCOA 4Z51A 1NVKA 4MR9B 5DIZA 1Q3TA 5AI6A 2GRUA 3VR2D 4R9RA 1DINA 2NSHA 1RM5A 2AMVA 3S2UA 2C7GA 4OP1A 3CX6A 1PJ2A 3WB2A 4EG7A 4OJKA 1N5OX 3RUAA 2PQ0A 2RGWA 4YRGA 2AFVA 4RPJA 1A97A 1TCBA 2DFKB 2CV1A 1ZQ9A 4HBZA 2O1EA 4CCYA 4IW3B 4PTLA 5FOSA 1H93A 2Q6LA 1S2OA 3W04A 4R2IA 1GCUA 5EWMB 3KWLA 1J2EA 3DZ8A 5CB8A 1GL9B 3IDSA 3K1JA 4OHVA 4KQ6A 3F96A 4C4AA 4DSAA 1O96A 1CUWA 2HADA 2ZSUA 3TR0A 3UK6A 2DKOA 4C6RA 2OQVA 1JBEA 3IULA 2H54A 4C01A 4S24A 1GSIA 1EVLA 1MP0A 5EXTA 4ZAXA 4F46A 2GBFA 4QUJA 3AHGA 3Q7TA 2QZJA 1EDOA 4G67A 1OI4A 4JP3A 3GEPA 4NYMQ 4OGLA 4BMNA 1KBZA 2NVOA 2PZBA 1AV6A 1GGFA 4QBTA 2ZDHA 2KHZA 3D4OA 2OTCA 1UKYA 3IJRA 4PBTA 1NW6A 1YS2X 5K3OA 4H3KB 4IQ0A 4DV4B 4ZXFA 2F8MA 4Y67A 3R09A 4NH4A 1VRWA 2VT3A 4XR4A 3SE0A 1AMUA 3LC0A 1XX6A 1HEIA 3NWEA 3O03A 5B6IA 2BFDA 4FR0A 4RD1A 1FFCA 3B1VA 2BEUB 1HRDA 1F1BA 2VK4A 3EPJA 4K8OA 3K70C 5G1OA 4FFBB 3T5BA 4UTPA 3HUEA 4CIBA 4FLFA 5J2UF 3LPNA 3EPHA 2Q6OA 4RSGA 3UT0A 2C54A 3ZJVA 1Z0IA 2QDXA 2XMGA 3D4BA 1UC9A 5DHSA 1CXZA 5JSFA 2H07A 4KQXA 1Z8DA 5HTKA 3PSAA 4OL0A 1OH7A 5E6SA 4DMKA 4RMIA 4BO7A 3SSAA 1DBWA 4B3IA 2YUIA 3OQIA 3EBLA 3NEAA 4PYKA 1H2BA 1OBHA 1SG0A 3ZW9A 3L6RA 5IAKA 4NV3A 4BNJA 3Q8LA 2VPYA 4XCXA 3TIVA 1AKRA 2W90A 1FZTA 4ABTA 2VJMA 4EG1A 4Q4AA 4REOA 4Z9BA 5B2ZA 1F2DA 2DTEA 1QQ6A 2JC3A 4PG4A 2BC9A 4I9HA 3UW1A 2O9JA 3Q0EA 4DDUA 5AVTA 4AJPA 3RIMA 2BKLA 3OIYA 3LUCA 1UXGA 4NBSA 4XD2A 2CVOA 5I8PA 1XVVA 3EQ6A 3H1FA 1FX0B 2JVJA 1FU4A 3GFBA 1DFIA 3K9LA 2ONCA 1CYDA 4IDCA 3LSYA 4G07A 2D5IA 3AXSA 3CT6A 2CVPA 5C1DA 2WILA 4DJJA 3GUVA 4H3HB 1QTQA 2MWMA 4MB6A 4P53A 1LW6E 3SBDA 3OZUA 1ZXXA 4QTXA 2OKGA 2QRKA 5FLYA 3H1PA 1OFHA 4G6ZA 3SR4A 3HB0A 5T57A 4IYJA 5FUQA 1TGVA 1E2LA 2P0YA 3RIEA 1REQB 4ERNA 4NU0A 2E82A 5CX1B 5AJHA 2MSEB 4FD2A 4LYDA 3MWGA 2Q2WA 1C2YA 4D3XA 4QXPA 1XZLA 4PSCA 1VHTA 3B78A 4UNQA 3O3CA 4I4NA 3SC2B 3U3RA 3L1VA 3CB2A 4ECAA 1F6DA 2BGNA 1Q7BA 1T3GA 5CNMA 4O4LF 1CUVA 3NT5A 3TRHA 1H8HA 1T15A 2VQFB 4QC2A 3U4HA 2IZ5A 4Z8YA 2TMYA 3WFIA 1BD3A 1C1HA 1GZUA 4JEIA 3URKA 2NV2B 2FMTA 2O4UX 2R60A 3BGSA 5BXYA 1RZUA 4JXZA 1Z8NA 3CF4A 3LF2A 2EJCA 2VJCA 1YRLA 2YCBA 3EXIB 3IEIA 4G0YA 4GT1A 3AKEA 5AVYA 3O2SB 1N5DA 2XEDA 3H16A 3PHCA 3WWPA 1RIFA 4MULA 2OD2A 4OB6A 4Y9DA 2Y0PA 4BU0A 2B94A 4Q39A 5LQCA 1F8GA 3ZDFA 421PA 3I0ZA 3DZKA 1QV6A 1U9ZA 3O26A 1V1MA 1BH6A 4QTTB 1PDOA 3OKFA 5PNTA 2GJ9A 3WIEA 5BOSA 2BTEA 3F8TA 5ERYA 1XFAA 1GAQA 4HAUA 1JVBA 3ZE7A 2Z08A 2FWJA 2JLWA 4J6EA 5JXIA 1UOOA 2IHBA 2WDZA 1KE1A 3N87A 1R64A 4EF6A 4AZ3A 1I7QB 5IW8A 4EHAA 1NRWA 1TT5B 3PFWO 5E3IA 5IAJA 3N59A 4ZCLA 4GKJB 1K6IA 1QX4A 1T5DX 3AWDA 3LK7A 3MRXA 2O1WA 4DOMA 3DUWA 1UBJS 1MEOA 2CLIB 2UUPA 4K86A 1MABA 3CB4A 4FFMA 1Z6GA 2BKXA 4IDEA 4CYMA 5D01A 2GN4A 5EJIA 3OEEA 1U8UA 4HX5A 5JJBA 4LWZA 1MO3A 1WMFA 2PH3A 4MAFA 4MIOA 1XXHB 2PKQP 3I6ZA 4AMGA 2VDOB 4EVSA 1ZU5A 3JXEA 1XROA 2JJ1D 2IYQA 4LYHA 4U2DA 3C97A 5DW0A 2OZPA 4NPHA 1CCWA 2IBSA 1Y9EA 4JU9A 5BV2P 2C9OA 2I80A 3HS3A 5HRCA 5EP3A 2NUAA 2AH5A 3LG2A 2CF5A 4PFSA 3S4YA 4BFTA 4GP9A 1NUPA 4QEDA 1KJ9A 2AC7A 1QCYA 3JQ7A 4W9RA 5HDBB 5ILGA 1B3BA 1ODTC 1Z5PA 1DAEA 4F3YA 5IHPA 2CNNA 5JXHA 5TT1A 1RAGA 3THSA 4LGCA 3ODPA 3JQGA 4GZ5A 1NP3A 4WKNA 2ORED 1QHNA 1WXEA 2IH4A 1FDOA 3BMCA 4L22A 1PR9A 4YNBA 5ICMA 1GR1A 2A86A 3AP1A 4KBYA 2NSYA 1HEUA 2Y67A 4I4IA 4RVFA 4U00A 1Q0SA 1OZFA 2ATIA 4WVFA 4CF4A 1IWPB 2GAFA 1LNSA 5AI5A 3JQQA 4ZC1A 4LKOA 1PK9A 1U9JA 2XMBA 1LDMA 1DO2A 5JY6A 1QJCA 3OOHA 2HYIC 1DG9A 5HFNA 4PG8A 2K7FA 3C3DA 3ZNNA 2V65A 3OZDA 4YFVA 1A8PA 3W90A 4E4RA 2SKEA 3OZTA 2QLBA 3OE7A 4L4UA 1M0SA 1TUBA 1R5JA 4TGLA 2VZLA 3EXHB 1IN4A 4PX9A 3UF0A 1TOAA 3KIPA 3UJ3X 1IBRA 3MWDA 4OUDB 4LRYA 3WGTA 1YZVA 2VTKA 2WAXA 3A0RB 1XDBA 3EZXA 1DZ3A 3GV0A 4ZVPA 5JFTA 1AHIA 1MH9A 4FFPA 1JHVA 4B81A 1S4MA 4RHFA 1JZTA 1X1CA 2QAJA 5JVDF 5L8VA 2VP0A 1W46A 2QTRA 4G56A 3L40A 3HI4A 3W05A 3OJOA 3W6OA 3HABA 4C3VA 1DRUA 1EVJA 3VR6D 3AKYA 3W6NA 2NMVA 3PC7A 2PV7A 4OYRA 4KDCA 4WLOA 4UU1A 3X1YA 3GK3A 3ANYB 4HTFB 3PB3A 3ENWA 3PQ6A 2CZQA 3LD9A 2BPOA 4YJ2F 1KRXA 3OCJA 3L77A 4ZVTA 5C4MA 1FSGA 1WSBA 4IIJA 4AS2A 2FW1A 1K68A 2VI5A 2Y6UA 4U2CA 2QSJA 1N5MA 5DMXA 4YJGA 3QOYA 3MRSA 2E4ZA 4DMGA 3HFGA 3DPUA 3URMA 1MRNA 5FNVF 3IMGA 1XA0A 5BYKA 3T0FA 5JH7F 2H5LA 4DCMA 1C8BA 2BAGA 1UT6A 5FL7D 2VRCA 1QFSA 3C3WA 3MWLA 3ZWMA 1NTOA 1DGQA 2Y1GA 1FDUA 2BSQA 1I3KA 4NU6A 3JCZA 1BEEA 4H0CA 2CVQA 2I3ZA 2J0UA 1LVUA 3VU9A 3VKHA 4HS4A 2I7TA 4E5VA 3C16C 3CQ9A 1RKVA 3D3WA 3GEEA 3O31A 4FSDA 4GSYA 3SF8A 1QGUB 1N6NA 1Q0RA 1QH8B 2H0RA 2O8VA 5F7OA 1QB8A 4KN6A 4PYLA 4PWYA 1IQUA 3N0XA 3IXMA 1ZS9A 3F74A 1RJGA 2BISA 3EVBA 3IR7A 1QS0A 3AUYA 2PSJA 3CV3A 3M4YA 3P0IA 4Q1DA 3T7SA 2PGIA 2VP4A 4OI1A 3SG0A 5REQA 4D0SA 1NAHA 3RTGA 2PJRA 4OIMA 1OWNA 1J49A 3CF4G 3MUEA 2XCRB 4TQGA 2BMAA 3I6MA 3L6BA 4F4UA 2D54A 2VF7A 5LBTA 1DADA 2WRZA 3A06A 3FOCA 1KSGA 5FULA 1FMCA 4MROA 2ZI5A 1UL1X 3W1VA 5IDVA 1K7XB 2XDQA 4IMIB 1E3IA 3QGMA 5K0NA 3E2MA 1RWPA 1S3GA 3W7VA 1CJVC 4BDTA 1U94A 1Z68A 4S0XA 3FYCA 4KQFA 2QZ4A 4NPAA 4Q4AB 3K1ZA 3IAXA 2EJUA 1DAFA 4B4DA 1GILA 2V1XA 5FFNA 3U49A 2QMHA 4E11A 1Z5UA 1JU9A 2AG1A 4DLUA 1U4SA 2CUKA 4H4EA 3RNLA 3T7CA 4AVYA 4C7MA 5JNSA 2C2WA 2H9YA 4EUKA 3K0KA 2HK8A 1QTRA 3F5QA 4PO9A 3I6BA 3VOAA 2B37A 4ZJZA 3SF8B 5CH8A 4BVHA 3E5NA 5EYPB 4P7GA 4ZU6X 4NENA 3ZIAA 4OQPA 1T8PA 3JZMA 3I5UA 2ZXEA 1G3UA 3STHA 2EGUA 3CLRD 1HLDA 1T9HA 2YWHA 3FKQA 4I55F 4R6WA 3RKSA 1JFTA 2RAFA 4B6QA 3D6FA 3QIVA 3L43A 3TAXA 3JQAB 1CB7A 5J23A 1OAOC 3KM0A 4GKVA 2AL7A 4IO1A 3WSWA 1KP2A 3CX8A 2IUTA 2ESRA 4KVFA 3L04A 4ZVKA 2A9RA 2CFOA 3GN1A 1GNQA 1K3FA 1YKSA 3OLYA 4HX2A 3VR1A 1DAOA 4KSBA 4EYOA 1NXPA 2WJ3A 1ZR4A 3U81A 1Q19A 4Y6RA 3RVJA 2EC5A 4IWXA 4LZAA 4QJ4A 2IF0A 4EG6A 9ABPA 4L5AA 3LX4A 3THOA 4GPIB 2QU8A 1I2CA 3AHDA 4MSUA 1RXWA 5CPBA 3RU3A 3FVRA 3PGXA 3K72B 2E4UA 2YZGA 2J3KA 1F48A 2BONA 1U0GA 2QHXA 3F90A 3WGUA 2ZIUB 1O6GA 2PLNA 3T1YB 2YHAA 2HRCA 2LNDA 2Q0XA 3KUUA 2J9FB 2D0IA 4HDCA 4Y6SA 2JIRA 4L3OA 4WZBA 3H4VA 3FJOA 3DMTC 5CLHA 3EXFB 1PEKE 1EFVB 1JG6A 2WSSA 3EJWA 1T0UA 2GPJA 2YOFA 3FF1A 2VNKA 3UAWA 4YT4A 2HM7A 2A7XA 3G2JA 5INTA 1TQ6A 3IQHX 1G7CA 1TM4E 2ZIXB 3SY8A 4BLVA 3T1OA 2NUPA 4MJXA 1E1QD 5ALRA 3UXHA 2VDRB 2OKCA 3HGMA 3E27A 4AYWA 3FFWA 1DZIA 2XMRA 2QRQA 3GT4A 3RH0A 1GZ3A 1MFPA 1QRDA 1N5KA 1TT7A 4TQ9A 3VOTA 3J80A 5EXXA 3M9LA 2C8LA 3FWHA 3UC9A 4PZEA 4Q4DA 4QUHA 1D03A 4WDRA 1SVMA 1UINA 1Y8RB 4XCVA 1NVEA 4ARCA 1AB5A 3KDSE 4JBXA 5KSOA 2NPFA 2VAXA 2XJ9A 2RH5A 3DXZA 4D45A 3LUDA 3ZWKA 3G5AA 4Q03A 1JQKA 1X13A 2NXJA 1TEZA 3FAKA 3HO6A 4YACA 2PZ8A 4OI0A 1Y3HA 1PRYA 2WIBA 3DO6A 2C84A 2YJ6A 3F6SA 4ND2A 5AOBA 1C1XA 4P0PB 2QVCA 2Z30A 2JI4A 3E3AA 1NE7A 1NQVA 3L02A 4OAQA 4PLGA 3W77A 5JMOA 1AD2A 2JG3A 3V8NA 4GLLA 4C20A 5JNRA 3WGIA 4E22A 4AS1A 2XRZA 5KQPA 1OJ7A 2A1TS 1E6EA 1TK9A 1P5HA 2A7QA 2R97A 2WJAA 2QLMA 2PZEA 2ZWPA 5LCXA 1NXWA 1V11A 1V1MB 2OFOA 4E15A 1WMDA 1ISFA 2BM0A 2EAUA 2SNIE 3DYVA 4J3FA 4ODIA 3UCXA 1IB0A 3GRKA 2C1XA 4B4WA 4CIXA 1PLJA 3A70A 1F8FA 1OX5A 2QRZA 3C41J 1A8QA 2AZXA 3WBBA 1PWYE 5KTMA 3WGKA 3U37A 5CLJA 1QQBA 1Z6AA 3TVTA 5TR9A 4RMHA 2Y8EA 3UWSA 2IS4A 1M2KA 3GFVA 4Z0HO 1Z56C 3UB3A 4AO6A 2I3AA 3KOOA 3ZGNA 5DV9A 2P5UA 3ROXA 4Q19A 2HTFA 2Y1FA 3KQNA 4L78A 1QNLA 2HPHA 2R1VB 3IBFA 1Y7HA 3GNSA 2OB1A 3CN9A 3RQIA 1J39A 5CGQB 4YMWA 2HJHA 4I19A 4ZTBA 3WO1A 4ZYTA 4MGEA 4MW1A 3QWHA 4HF7A 1L7AA 2FDCA 1EUCA 1C41A 3OI7A 2P40A 2X0RA 4U6NA 2HBYA 3AUXA 5L7YA 3A9TA 3TLEA 3F0TA 3CC8A 2B9EA 1CQZA 4M1QA 1PTJC 2FZVA 2HNAA 2J3EA 2MSLA 3PGKA 1VL1A 4OIFA 2EXXA 4F2PA 2VDQB 2X77A 2RHWA 3VM6A 2ACEA 2I03A 2BGMA 4TL7A 3OMLA 3SBEA 4B3FX 3ZD7A 1SB8A 2OQ2A 2LGJA 3CKMA 4UVEA 2CSXA 1WRBA 4YCCA 3IUJA 1RPAA 1R10A 2TMGA 3A9UA 1HH4A 4LJ6A 4YEDA 4ZGWA 3ZCUA 3TO5A 4UPVA 2XLBA 1H66A 2FP3A 3V8VA 3PGVA 2AQIA 4GZ3A 3V2GA 4XGRA 4JU8A 1PF7E 1JLRA 2ZR8A 4PSVA 3VPSA 4FHZA 3VPAA 5CYOA 1H2YA 4CKXA 1PVOA 1DDGA 4ZOLB 3OEHD 3I72A 1NVFA 4BKUA 4HH4A 3DHWC 4DDMA 1ABEA 1DPGA 4NRDA 1L5NA 3RFCA 3ZVRA 2JJ2A 3KJQA 1K0FA 2XAAA 3TR6A 2EP8A 1CQPA 4FKBA 3WLMA 4DPMA 1OKKD 3A6HA 3G7NA 2PWBA 4FOOA 4UJ3A 4CM8B 4UAGA 1TJPB 1ZW1A 2WZDA 5F2NA 1QWSA 4MQEA 2R1VA 5A3JA 2UZ1A 3VR5H 2UZ3A 2I4MA 2BHTA 3WDLA 2KSQA 4L02A 1D09A 5DHAA 1X14A 5JAIA 3MSXA 4E2FA 2Q0SA 4CMIA 2C4MA 4LJ7A 1CUIA 1DC6A 1PP4A 1ZI9A 4M0LA 5G0TA 1Z22A 2JANA 1D1SA 1FNDA 3VDNB 4BEJA 5JXJA 2ODEA 2D0DA 1DQNA 3NHZA 3RR2A 1GADO 4PR3A 3COPA 3ER6A 2AEFA 3W0LB 3OZAA 5SICE 2NQ8A 1UEXC 3A1EA 3JVIA 3JYLA 2XVMA 3R4VA 1IM8A 1KF0A 2TS1A 2CLOB 4M8IA 3EXG2 3A9WA 3KKEA 1YUBA 2RKOA 2D8AA 2XSZA 3FUVA 3L7NA 4QARA 4UULA 4I3HA 4R0MA 1B23P 2D2XA 2V0NA 4FR5A 1Z6YA 4I55A 1MZVA 1QRRA 4NU5A 3KT0A 1F1JA 2PLFA 1UZUA 1C8VB 2C4UA 3FGOA 1NMEA 1NN3A 1UKZA 3O8NA 1AZSC 2ILVA 1CTQA 1OT3A 3N2YA 5AM4A 5HUQA 5JXGA 3KP1A 4RZHA 1JR2A 1V5FA 4G24A 5CFPA 4ZCMA 3SYTA 4D8WA 5JPCA 1XJQA 1M67A 2HU5A 2QN1A 2WWTA 3F2IA 3UJHA 3M1LA 4Q16A 1N9GA 3OHPA 4UBJA 4RA6B 3USCS 4JJ6A 4URHA 3OH8A 1GLGA 3NRBA 3WGVA 2Z8ZA 2J9XB 3FFTA 1Y6RA 3G85A 1PNRA 2O0MA 1ADFA 3ZK7A 2J41A 3AEYA 1AQ6A 3U9LA 3OY7A 2JNWA 2R6ZA 1SD1A 1Z83A 2C42A 2J09A 1DSSG 4N7RA 2IH2A 2PTHA 4FXPA 4PZ9A 5FBHA 4K9OA 1K7YA 2CL6X 3FI9A 4RULA 3F5MA 3VA7A 1YZHA 1XTRA 2W4QA 2QY6A 1OROA 4YQYA 3RT1A 4UD6A 1BX3A 3RSHA 3D7MA 1CNEA 3NS7A 4J91A 5JG7A 3WY9A 2R8EA 4D43A 3PQ7A 4CKEA 1M3SA 1CUDA 1Q20A 1F2TB 2L82A 4R8SA 1Y5RA 1FA9A 3DZCA 4BEVA 1NMQA 4GLJA 1R6UA 4OXQA 4NE7A 3EC7A 1PV4A 2GETA 2Y1LA 2J33A 2RGUA 4FMDF 4MS1A 1XDWA 1E58A 1R0YA 1VBMA 3UJ9A 4BU1A 2R66A 1MEJA 3Q0IA 4FYJA 4IH9A 3RC1A 1TU3A 4IDGA 5LQAA 3K6SB 1HT1E 4J43A 3JQAD 4JGBA 3TIGA 4BC0A 4ARUA 1OH5A 3HDHA 4R1UA 4RPIA 2SCUA 3CH4B 2OPHA 1LK0A 3V2HA 1JQEA 1D7AA 2JASA 3AR8A 1GAEO 4UHCA 2FY8A 2ZB4A 2QVYX 4MWTA 3KZ1E 5AKKA 1TJ5A 4DLAA 1TJNA 1BS1A 1OLSB 1CQJB 1SVLA 1P2BA 3FPCA 4G5SA 2IZ0A 5CLIA 4BE4A 5ABPA 3SJZA 3VKUA 4B45A 4HAIA 1KY5A 4YUZA 2B3TA 3VMFA 3C3AA 4NAVA 3VNQA 2V3WA 4CWAA 4H31A 2N75A 2YJ5A 5E1MA 1P6QA 3VYTB 1TTPB 1RWKA 1XAIA 1DC8A 1ZN8A 2ALJA 5KYGA 1RTTA 4X8MA 5FPHA 4QJ3A 5B4UA 4RKYA 1Q0TA 1GUYA 3T6KA 3IV9A 3IALA 2ZZNA 1E4EB 4Y2PA 3RLIA 1K3UB 1HLFA 1MOSA 3ZYZA 3S2ZA 4B32A 1A9YA 1GN9A 4MNTA 1E8NA 1VJ0A 4BQEA 5JJKA 2EW2A 3DCJA 1BSVA 1Z6QA 1K27A 4Q9DA 3VPDA 2DSNA 3HZHA 2P4HX 2Q5QA 4CLOB 5HZKA 4EY7A 1U7WA 1EHIA 2ONJA 4Y2GA 4MLDA 1WHTA 2ZRHA 2VVTA 3RRNA 5TJ9A 4F5EA 1F2UB 3LA6A 1MU0A 1UXJA 5A3RA 2O8CA 1W25A 2YS6A 2X4LA 1SUEA 3PXDA 1F14A 5T4FA 3M1IA 2GCGA 4G8JA 4WK6A 3Q9UA 4X63A 4B43A 3Q7RA 5GZ3A 4A27A 2W42A 4RE5A 3LFUA 3M2PA 4BFVA 3VJRA 3AR6A 1IN5A 1CWUA 1VIVA 3TSWA 5C53B 1YCHA 1OFTA 2QJRA 4IEEA 4IJUA 1UUFA 1X77A 1LPNA 2ZJBA 2GKOA 4BNZA 2C0CA 4AIIA 1PO7A 5A6SB 5EKTA 1ATIA 3OKPA 3FYHA 3KQSA 2NYAA 1VM6A 3WKBA 1BDMA 1HORA 4IF4A 3HVHA 3WRVA 3GP5A 4M1TA 2OXTA 3F6EX 1AH2A 5FR2A 3PKJA 4WNAB 1EJBA 1KO5A 3ITKA 3IQFA 3DO8A 3K5WA 3LC2O 4IQGA 5A5DA 3K35A 3A6DA 3F46A 2ZRKA 1L5WA 4LBWA 5HVNA 3TRIA 1L8XA 4P9NA 4F5ZA 4YQFA 1BXGB 4YIHA 4G41A 1W5FA 4IXMA 2JIBA 4Q1FA 2VOJA 2ZYTX 3VQTA 4AXXA 2ZJ1A 4JR0A 1JFSA 2WF6A 3KYDB 1SKYE 2VHWA 3IRVA 1AURA 1YR2A 4GP6A 4G0NA 1CR6A 1Q16A 3G2LA 1IONA 4RV9A 2Z57A 4YP7A 1KR2A 5DK4A 1DJOA 4RD0A 3RV4A 4A7PA 3DKKA 1NUAA 5BORA 2JKYA 1E89A 3H6KA 1LVHA 3CVUA 4YPVA 3I6IA 5HJ2A 3ENKA 1L5OA 4XEUA 2FMFA 4DHEA 1G8PA 2J3JA 2AG6A 5JLJA 1P4HA 3JWIA 3TVDA 1DAGA 3CZAA 3ICCA 1XCPA 4DLPA 2M6SA 2QJFA 2I55A 2A9OA 3WHKA 3QEOA 4TT8A 3RHFA 2R0QC 3OLQA 2IGTA 4KAXA 3PDIB 4OREX 4DQUA 4IV0A 3MWDB 4F3TA 5TS3A 2O20A 4GKBA 3U44A 3ORHA 4R6XA