4CLOB

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQTSSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 97
structure length 251
sequence length 267
chains with identical sequence C
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cloB00
4BKUA 5L9AA 2HMWA 4LVCA 1NNUA 4QECA 1X13A 4FD3A 5CPBA 5ER9A 1Y5MA 4A0SA 1J5PA 3E82A 3B20A 2WD7B 3IP1A 1GR0A 1NVMB 4WCFA 2IODA 3AFMA 5AVOA 1XWFA 4IS2A 3RUIA 4CQMB 4OOFA 5ITWA 2ZJ1A 2D5AA 3CE6A 4XIJA 1V35A 5I8WA 1HT0A 1DFGA 5JE8A 2QYTA 1QYVA 2OORA 4ILKA 1SB9A 3MJSA 1U4SA 1MLDA 1A4UA 4D41A 4E5MA 3K73O 4MIOA 3C3XA 3TFQA 1UJMA 5TQVA 3LYLA 4RPLA 4XRGA 1PIWA 4II2A 4PLZA 1A9YA 7MDHA 4G81A 2H1SA 1YJQA 5JAQA 2ZCUA 3LC7O 4QO8A 5LCXA 1OC4A 5K6AC 3ZU5A 3EZLA 3GVCA 1VL8A 5AOVA 3ZWXA 3SC4A 1UDBA 5K6AA 3B1FA 4ZQGA 1PL7A 4FCCA 4XR9A 4D45A 3M2TA 5C7OO 4OSOA 1HZZA 4XX0A 4UULA 4CUJA 4XQ9A 3M1AA 1GEGA 1E3JA 4NFHA 3SEFA 1T24A 3SXPA 4YTEA 5ICMA 4JGBA 1KVSA 4K6CA 4WGGA 4CL8A 1A72A 3LT2A 4GGOA 4BKRA 3WYCA 4FFOA 1XYGA 1NYTA 4BO5A 3Q9NA 3JQ7A 3B70A 4FPXA 4BO1A 5IN4A 4RPGA 2GERA 4KDEA 1E7MA 1W4ZA 3ZW8A 2Q3EA 3DB2A 1P0CA 4XR4A 3RFTA 2QZ9A 1KY4A 2OO5A 1CJCA 3O03A 4HXYA 4OO3A 1JWBB 4KTVE 3G17A 3T7CA 5BSHA 3KYDB 1PQWA 1BW9A 3QY9A 2AG5A 2Z95A 2D3TA 1RJWA 3ZWMA 4ZD6A 3WBBA 4ESOA 1DC6A 2HU2A 4BMNA 1MFPA 1ZSYA 3OICA 5ICSA 3DMTC 1GD1O 3ZWBA 4F6LA 3WDSA 2FHSA 3U0BA 5JMPA 1X14A 1ONPA 4AJ2A 4E2ZA 3MEQA 4Z9FA 1SMKA 3K96A 1C1XA 4NK4A 4MKXA 1GQQA 3VDRA 1EFKA 2OP1A 3SVTA 1SAYA 5HBRA 3Q1LA 1VL6A 4J91A 3H65A 5CEEA 1AUPA 4CM4A 3MOGA 3KEOA 3GUCA 3GG2A 1SPXA 4D46A 4BMSA 4JCOA 1E1NA 2PGJA 3HDJA 1TVEA 1YE3A 2WD8A 5IDYA 2P68A 4IINA 2O3QA 3MTGA 5HS6A 4B3HA 4BNUA 1I2BA 1CETA 4A10A 5ENDA 1KEVA 5BSGA 3EDMA 3H5AA 1K6JA 1KEUA 2YHIB 5CDTA 1CQIA 4BV9A 3QWHA 3X2EA 2Q4EA 2IXBA 1T2AA 4BMVA 4EJ0A 4A27A 4WPGA 4NBRA 3CTMA 3W6UA 4D7AA 5BSEA 3O4RA 1GL3A 4IGEA 5T67A 4B4WA 4N18A 5KTKA 4YA6A 1WLYA 4B8WA 4E6PA 4MDHA 1U3VA 4R1TA 3L4BC 4NBUA 3IIEA 3JQFA 3QQPA 1ML3A 3GMDA 5KJ1A 3GFBA 4TRNA 3HG7A 1GY8A 4BOYA 3WS7A 3EAGA 1Y9EA 1PZEA 1MXHA 1WP4A 2VWPA 1Q0LA 3G49A 3ORFA 3RQSA 3ZI0A 4BKPA 3KYCB 4Q39A 3QWFA 4Q3EA 3WNVA 3MJ4A 1PJLA 3ZWCA 1RM3A 1T2CA 4L73A 4EDFA 1LRKA 1T4BA 1YXMA 5EQDA 1SC6A 5G4KB 1Y8RB 4D43A 4Q9NA 4CODB 1GEEA 3EC7A 4YYZA 3BMOB 4E5PA 3RFVA 2D5CA 5IXYA 3KYDA 3WGIA 3OJLA 4R01A 2A35A 2HMSA 1NHGA 1D7OA 3OH8A 4PFJA 1J4AA 4JQCA 1DAPA 4QUKA 3I9MA 1YB5A 4BNHA 5B4TA 2EF1A 3BMNA 3WX0A 4ALMA 2ZATA 4WASA 3MJEA 5LDGA 4J1TA 4BB5A 3I3OA 3IS3A 2EKLA 2JKVA 2DBVO 2AE1A 3P19A 2JFGA 3DBHA 1ENOA 3CKYA 2QHXA 4L76A 3DO5A 3GY0A 4M86A 2NWQA 1QLJA 4U0JA 2O7SA 1NFQA 3IJPA 3HFSA 4FGSA 3VPGA 3WFIA 2YV3A 4YJDA 5KVQA 1H9AA 2Y1CA 4GWKA 3K9QO 3ZCXA 2DTXA 4XA8A 5H81A 4DIBA 4O1MA 2C0CA 5TNXA 4R54A 4Q3CA 1BG6A 4BGIA 4II3A 5I8ZA 2NLOA 3LK7A 4WK6A 4IY1A 4CQMA 4O5OA 1NM5A 2CNBA 1XCBA 4PZCA 4U6SA 1DIBA 3QVTA 1EK6A 4INAA 4J49A 1SO8A 3ETEA 1DFHA 3PHHA 3BHMA 1WWKA 4CMBA 4WOJA 1JKJA 1LDMA 3CH6A 3TWOA 2X22A 4FFRA 3AUTA 1ISGA 1I36A 3IDSA 1KIFA 4QEDA 3I4CA 4BO8A 4NNJA 1HTBA 3PTZA 2I6TA 4OKIA 1RM4A 2I9PA 2C5AA 1NVTA 3ETDA 1TT7A 3KSUA 1A5ZA 1I5RA 3WGHA 1C1DA 3JD4A 2J8ZA 1OMOA 3QJ5A 4TZKA 1U2GA 4IBOA 1Q0HA 4JXKA 4L8VA 7ADHA 4DQUA 2X6TA 3WYEA 1TA4A 2WE7A 4Z3KA 2RCYA 4W7HA 5LC1A 1KVRA 3PP8A 5AXDA 1MB4A 3ULKA 1XEAA 2FWMX 4C7JA 4L9RA 1C3VA 4TKMA 1LDYA 1PJCA 2ET6A 3D1LA 2IDZA 3E9MA 3NAQA 2D2IA 4NK5A 1E7RA 1UDCA 4YDRA 2R00A 3PJGA 1FF9A 4LGVA 4XRRA 1HDXA 1MX3A 2AQ8A 3TZHA 1IE3A 2HK7A 2YFQA 3BIOA 3DAPA 4CM8B 2JD2A 2WYVA 1W8DA 2A4KA 4HFJA 1ONNA 3AUAA 1JDJA 1PS9A 3EY4A 4PLFA 3ITKA 2Y0DA 2P9CA 3UKOA 1EE2A 4FC7A 4E2WA 1HDRA 3VAZA 4JBIA 2OHXA 4W4TA 4CMKA 2IEBA 4TVBA 3GHHA 4AJJA 1OFGA 3PQEA 3OBBA 4IMRA 2VZ8A 3WYBA 2W4QA 2AEFA 3E18A 2NVBA 3OIGA 4I5FA 3FI9A 2I3GA 3I6IA 4J7UA 2BGKA 1LSSA 2Y0EA 5IXSA 2BFOA 1EK5A 2IXAA 5L95A 3DHEA 1AGNA 1YJ8A 1ZFNA 3TSCA 1VM6A 2WM3A 1E3LA 4MVJE 4MVJF 3WIDA 2OOSA 4CQLB 3U5TA 2BLLA 4BV8A 2EV9A 4CM9D 1UP4A 4L4XA 4RV9A 2E82A 3JQAD 4BO9A 3PK0A 4R69A 4RDIA 3VKUA 3B6ZA 3M6IA 1ZJZA 4AVYA 2B5VA 4KUGA 1E5QA 1V3UA 3DBRA 1LLCA 1JQBA 2CF5A 2EW2A 2FPPA 1YOVB 3MCVA 1DJQA 3RVDA 4DYVA 4RVHA 1YB1A 3EYWA 4XGNA 4JBHA 4M87A 3D0OA 1CWUA 3OMLA 1R66A 2EGHA 3JQ8B 2YYYA 1P74A 4WCDA 5DULA 4GMFA 4FJ2A 3ROKA 3K5PA 2YHUA 2HRBA 1O89A 1B3BA 3ENKA 3RC2A 4I9UA 1A4IA 2YW9A 2VOEA 1T2FA 5AXCA 2XXBA 3B1KA 4GQAA 1JTVA 2GDZA 3BMOA 4DVJA 4J3FA 1XLTA 4L0QA 4JLWA 1E3SA 5TS3A 2ZB3A 4AJPA 3K30A 1PR9A 4IQGA 3RC9A 3WGTA 3L9WA 1ID1A 5A03A 2DM6A 1FDTA 5TX7A 1JAYA 4GLLA 1IB6A 2CVZA 5H82A 1XSEA 2YY7A 1IHXA 1X1EA 3RROA 3VKVA 2JCYA 3NTQA 1GAEO 2RH4A 3EK2A 5JAIA 4FS3A 5L53A 3ZU2A 3D5TA 3PRJA 4P22A 3LF2A 3SJ7A 4RL6A 3IAHA 3DHYA 3GFGA 3GF4A 2VHWA 2PZKA 3GNTA 1HXHA 3CMCO 2EP7A 3V2UA 2I99A 2DTDA 5A5FA 1IULA 4IJKA 4Y6RA 5EINA 2GPTA 2E49A 3O8QA 4K26A 3PWKA 5DDIP 1QR6A 2B83A 4KWIA 1ZNQO 3GPIA 1TT5B 5CAEA 1PJTA 3JD2A 3NEPX 1XKQA 3R1IA 4D42A 3DDNA 5L3ZA 2WDZA 4B4OA 1R4NB 2GNAA 2Q2WA 4RVUA 2OBYA 1UP7A 1QORA 3OF2A 1E92A 4MP3A 4H16A 1YWGO 3JYLA 4F45A 2WWRA 4ZHSA 4FW8A 3VPFA 4L75A 4XWYA 5EESA 3VTZA 3MOIA 2A94A 3U9LA 4BNIA 4B3IA 3GC6A 3IP3A 3QV1A 2GGSA 1O5IA 4BGVA 3KO8A 5BNFA 4YT4A 5AYVA 4W9NA 2AMFA 2BH9A 1W6UA 3FNGA 3ADOA 2VHVA 4WEOA 4JIGA 4DLAA 5EPOA 5U4QA 4CLRB 4CQMD 3JYPA 1ARZA 1P33A 3HB4X 2ZTVA 3ONEA 4RF2A 4U6QA 3JD3A 2CDAA 1ADFA 1P45A 1VRWA 3SLGA 3T4EA 3WQRA 4YJGA 3DZIA 1XGKA 2NQTA 3NT5A 2NV6A 1Y5RA 1XU7A 1WDMA 5A06A 1IZ0A 2AEMA 2NU7A 3UCFA 2ZJ0A 3VTFA 4M55A 4JP3A 1YDWA 2QX7A 4PLWA 1U8FO 3G1TA 4YAEA 4TMFA 4WLUA 3L6OO 2CZCA 3HSKA 1R0SA 5KWEA 1LA2A 4RO0A 4ZA2A 3HJAA 1S6YA 4DWVA 2A9FA 1X7HA 3GDFA 2QRKA 3FPCA 1PS8A 5CG2A 1RYEA 4EW6A 3D4OA 4Q3DA 2CD9A 2OXIA 3ZN2A 2PV7A 4I9NA 1ISJA 1PJ2A 3IUSA 2PGLA 2Q2QA 4DPMA 1LC0A 1ADCA 1E5LA 4OYRA 3RSHA 1DRVA 2V6GA 1UZNA 1MG5A 2OZPA 4IPTA 2YHIA 4UUNA 4Z9XA 2J3KA 3I5MA 5T8KA 3WGYA 1O6ZA 5A9SA 3S8MA 3A06A 5A5EA 4PLPA 6ADHA 2VT3A 4J6FA 3TL3A 2PD6A 1AHHA 2AEJA 4UREA 5JBIA 4WLFA 4XZ3A 1ADBA 4I5DA 4RLSA 1LBEA 1ZZEA 3EZYA 3PJFA 1ZCJA 2OBNA 3E1KA 3MTJA 1LDBA 3ZV4A 3UCXA 4BNNA 2G1UA 3F3SA 4E12A 2DPHA 2EKPA 3ZNOA 4CMIB 3FR7A 3MJCA 4BNKA 5FYDA 5A04A 1NAHA 3WTBA 4DUPA 4DPKA 3C7AA 3E03A 2W2LA 1SOVA 1DJNA 1KS9A 1QYDA 1ZW1A 5AQ1A 5CPFA 2Q49A 2AQIA 4QTZA 1KC1A 3PPIA 4D0SA 3ZZNA 1R4MB 4LW8A 2IYPA 5JSFA 1UR5A 1E3WA 1FDSA 1X15A 3L6DA 3Q0EA 3G0OA 2GN8A 1MP0A 4BNMA 4R9SA 1PQPA 3PIIA 1A7AA 3FF4A 1ISFA 4NHEA 2X5KO 3UOGA 4J90A 3TDKA 3CSDA 1WZEA 4JNKA 2VCYA 3VH4A 4LMPA 1ENZA 1H6AA 2WJPA 4Z6KA 4EI2A 4ND3A 4NJOA 4Z0PA 3OJEA 5F1PA 2EGGA 4TRRA 4DC1A 1GYRA 1WDLA 3F4LA 3U3XA 2Q1SA 1AXGA 5HA5A 3JD0A 2JL1A 2Y1EA 3GZNA 3GGPA 3H2SA 2DT5A 3ZWVA 4BUCA 3KVOA 1I30A 1LJ8A 2B5WA 4IIUA 5CHEA 4OJNA 2VHYA 3S2EA 1GQ2A 1WXDA 4RPJA 3RKRA 4CLOA 4J1NA 4J1QA 5L45A 1LRJA 4WE3A 4MIEA 4MVJH 2DC1A 5KJCA 4R5HA 3U09A 2GN6A 1U4OA 1HETA 4JX8A 1A9ZA 1G1AA 5I7SA 2RIRA 2DBQA 2VRCD 3I6QA 3JYQA 1BVRA 3UW3A 5JAMA 2FR8A 5F1KA 1NPDA 4E13A 4LN1A 2EKQA 3JQBC 1LLDA 1M6HA 2YZ7A 4CMJA 1TT5A 4CPDA 4CV1A 4MP6A 2NVWA 3PLRA 3GEDA 4OSPA 2YUTA 3WWYA 1HF3A 2AG8A 4AFNA 5ADHA 1RM0A 3H3FA 4A5OA 5DN9A 4NR0A 5L40A 2OL4A 1R4NA 1DOHA 4J2OA 1ISHA 2PLAA 1B14A 1OAAA 4GVLA 3WJ7A 4WNCA 2J6IA 3ZH2A 2C7VA 4N5MA 3E6AA 1F14A 3QRWA 3R0IA 4IDAA 2OMEA 4BNJA 3W8EA 1P31A 3WGZA 1JW9B 1PU2A 2JFFA 4H15A 2C2YA 4XGIA 5JY1A 1B2LA 2UAGA 1GUZA 2TMDA 1V0JA 3F1KA 3NDRA 3OHSX 4XQCA 3CIFA 2PZLA 3H9JA 3OIDA 4BGEA 1P1IA 1V8BA 4GH5A 3A4VA 4OXNA 4RCVA 4BNYA 1XU9A 1EMDA 5A02A 2CDBA 1JKIA 1MC4A 3ASVA 2EEZA 3RCBA 2GLXA 1DB3A 2X4GA 3ASUA 3P7MA 1C1XB 1BDMA 2JJYA 1NPYA 2P4QA 1Q7BA 3C1TA 3QHAA 1FDUA 4CMAA 5IDXA 3RU7A 3GK3A 4YCAA 3ZWOA 5FEUA 3G79A 4EGFA 5U9CA 1W0CA 3DMYA 1V9LA 4MVJA 3TJRA 2HMTA 2ZYGA 3VPHA 3GVXA 4B7CA 1GZ4A 4CLOB 3VZQA 2BMAA 4WUVA 3FWNA 4HADA 4EUEA 4OIMA 3GMSA 2W2KA 3E9NA 3K2BA 2C54A 3C8MA 4AICA 5J23A 5JDIA 1EVJA 3V2GA 3DZHA 4AJLA 3KM0A 3L9XA 4YAJA 4EUHA 1HSOA 1F17A 4H7PA 1TLTA 1AE1A 4LRSB 1HSZA 2PZJA 5FWNA 3H7AA 3IJRA 1N1EA 3BAZA 1TEHA 3AM5A 4GGPA 1A71A 3P5SA 2XPCA 3NGXA 2GASA 3WGGA 4D3FA 1YBVA 2FR0A 4XB1A 2HJRA 3Q3CA 2V6FA 5BNTA 1GADO 3QWBA 5HM8A 1DFIA 4BNVA 1C0LA 3KYCA 3GNSA 3ZV6A 4E2YA 3ZWNA 3NV9A 4R51A 4Z3DA 3ITDA 4IDFA 2RHRA 2DUWA 3W6ZA 4MJLA 4A26A 4S3MA 3MWEB 4YJGB 3L07A 2BGMA 4M49A 4J16A 2Y68A 3CINA 1DXYA 2Y1DA 3RUEA 1P1FA 4RJTA 4LCJA 5L4NA 2DKNA 3C7CB 3K2EA 4QSMA 1FJHA 3PDJA 4FIZA 9LDTA 4OXYA 5L51A 5C7IO 3GLQA 2VUUA 1R4MA 4GX1A 5F5LA 3Q9UA 1GCUA 4FJ1A 1H93A 1GU7A 5CDGA 3AOEA 5DP1A 4CR7A 1I3KA 5GMOA 1HDYA 5TIIA 4D44A 4J4BA 5TGDA 2AHRA 1HYHA 4J0FA 2FPIA 4DQXA 2VQ3A 4XQGA 3WXBA 2WYWA 5DNAA 3I9KA 3BYZA 2BFAA 1LQUA 2X9GA 3GH3A 4HNGA 3FD8A 3E5RA 3COSA 3JQDA 4IDDA 2SCUA 1IHYA 4IM7A 1ZSVA 4M1QA 1TXGA 1MUUA 5DCUA 3GZNB 1K5HA 3BHIA 5B37A 4ALJA 5JAZA 1QLHA 1RM5A 4NJMA 1XA0A 2DBZA 4G5HA 4K9DA 2WYUA 5C3MA 1LLQA 4MINA 3WQSB 3GAFA 1NFFA 4BS9A 3SC6A 3WMXA 2AXQA 4QFDA 3NRCA 2IZ1A 2O2SA 1L7EA 4ZQFA 3SJUA 1DO8A 1ZK2A 1UXGA 3AU8A 3I23A 5I9MA 4IQ8A 3IKVA 3D64A 2G17A 3S55A 4FJ0A 4QT0A 3A28A 3KBOA 4DGSA 1OI7A 5IZ4A 2O50A 5CDSA 4IGFA 5JFOA 1M67A 1WVGA 2HMVA 1UAYA 2O3UA 4NFSA 3I83A 1ZUD1 4O0LA 3N7UA 5G0WA 4BNLA 2I65A 3P2YA 4CMEC 4DBVO 5I7FA 4WLNA 4A2CA 2HSDA 1PJ4A 5DBGA 4NPCA 3LT4A 3JQBA 4NBVA 2HK9A 4WLEA 5I7VA 4A73A 2O48X 1KVUA 4TVOA 3JQ7B 4MO2A 3UAGA 3GDGA 4EJMA 1B15A 1R0KA 2F1KA 1ONOA 1ZMOA 3NKLA 3H9GA 1LU9A 1E3WB 2CDCA 1RPNA 2CVOA 3H8VA 3OJ0A 2YFHA 1BTOA 1QXSA 1EQUA 3ADPA 2DBRA 2A92A 1N92A 2VNSA 1PTJA 1GCOA 4XQEA 2J3JA 1I2ZA 5JLAA 1DHRA 1YBAA 1YO6A 3C1OA 2EG9A 3IC5A 4ZQEA 3V5NA 5C7LO 2P2SA 3I9OA 3LVFO 4WEQA 3F47A 2Y1FA 2ZYAA 2PNFA 3PIDA 4ND2A 4R3NA 3Q2KA 4J0EA 3F6YA 3JQFC 2NTJA 2UUPA 3QLJA 4LCEA 2JD0A 3TOZA 3C24A 1DIAA 1ZK0A 2DTEA 4WOKA 2X86A 5COBA 2I76A 1B16A 1V6AA 3PI7A 1VSUA 2VYNA 5F5NA 4BO3A 3PJEA 5A1TA 4R1SA 1Q7CA 5DOZA 5IF3A 4J1SA 1B0AA 3DZJA 3VVBA 3QWAA 4DQVA 2I5PO 4XKJA 1QMGA 1U1IA 3I1JA 1KC3A 2DFDA 5TRTA 3VZRA 4DPLA 2VYVA 3GPDG 1PZHA 4P4GA 3PGXA 4FQ8A 2H9IA 2PFGA 3WJAA 8ADHA 2O4CA 5A9SB 4DLBA 2CSUA 5JY6A 1SB8A 2NU9A 2BD0A 3ZWWA 1FMCA 1H5QA 1XR3A 4AJEA 2JFHA 1R15A 2WSBA 5BQFA 5T6BA 3GUYA 3WSWA 1HDOA 1P9LA 4W7IA 2C7GA 2P9EA 4XYEA 1EFLA 1FK8A 1PL6A 4B79A 4DREA 2ZTLA 1B3RA 1QP8A 1IPEA 2GN4A 2EWMA 3EUWA 1ZJYA 1N7HA 3TPCA 1M2WA 5F1OA 5KKAA 4Y6PA 2ZKLA 4I9HA 1UDAA 4QX6A 1Y8RA 3DBLB 3OP4A 2ZIZA 3E9QA 5K9ZA 4BGUA 4E4YA 4QQRA 3FBTA 3AUUA 2NACA 3RUDA 1L1FA 5BR7A 3LF1A 2FN7A 3AOGA 1E7QA 3KB6A 1P1KA 1YQGA 2X9VA 3ZU4A 5JC8A 4ZVVA 3DFZA 3PQFA 2VTEA 4RPKA 1T2EA 3WFJA 1Z74A 2GN9A 2D59A 1SBYA 4OGWA 3SX2A 3R3SA 4IUYA 1HDZA 5JXWA 1ZEJA 2YQ4A 2DQ4A 2VRBA 4UVIA 4UVHA 3AW9A 3WICA 1K89A 3RBZA 3HHPA 3PDUA 4FB5A 1OC2A 1D1TA 1E7SA 3H4VA 4AJIA 1I2CA 3TZ6A 1Y8QA 3ZWAA 1PL8A 4ALNA 3W4KA 2NADA 3ZV5A 1DPGA 1LC3A 1UZMA 4TROA 4YXFA 1WZIA 3UVEA 2X9NA 5TC4A 4E31A 1OZAA 3AOEC 5IN5A 1E1MA 4UUPA 4FOOA 5JC1A 4P4LA 4I08A 3DBVO 3CEAA 5ILOA 4LK3A 3GZ4A 3O8QB 5EL0A 5JYEA 3I9LA 3ZHBA 4I8XA 4RVGA 2FR1A 2Q45A 3JSAA 4ZRNA 4WLOA 2X1HA 5COAA 3KOUA 2LDXA 1DLIA 2J5KA 3IOYA 1UXJA 3FTNA 1IOLA 4GX0A 4BQPA 3WWZA 4E5KA 4UEJA 5KVVA 2EP5A 2O3TA 4ITUA 3KZVA 4GKVA 3WOHA 3QW2A 3JQCA 4UVGA 4U0KA 1HYGA 3JQEA 1EVIA 3EW7A 1DBVO 1TI7A 1VKNA 4WJZA 4CMHA 4CUKA 1M6WA 4UEOA 4U5QA 1Y7TA 3PHJA 1UUFA 4AJKA 2BFMA 4FC6A 4JJGA 2RBEA 4RVSA 3VPXA 2DFVA 1T2DA 3AY7A 1A27A 1O0SA 3WNQA 5L7TA 2R00C 5TJ9A 1SZJG 4RZHA 1CIVA 3AWDA 3AY6A 3LZ6A 3IUPA 1HRDA 3TN7A 3DR3A 2Q46A 3PEFA 3JCZA 3GQVA 1E3IA 5CG1A 4CUZA 2BELA 3FWZA 4A03A 3OECA 4TRJA 1C0KA 2VTDA 3DQPA 3PFFA 5T57A 1BGVA 2JHFA 4E33A 2QRJA 3RUHA 1BSVA 1N2SA 3ANMA 1OOEA 3RUFA 3JQ6A 1PJBA 4P38A 3KLMX 5JCXA 4HKTA 1DC3A 1NWCA 1NR1A 2GR9A 2D4AA 1CDOA 4RF3A 1UXIA 3BMCA 4CL3A 3TZCA 1LSJA 2F00A 3IQDB 4IDCA 5BSFA 4FFNA 3HWRA 1HL3A 3ZHXA 3T4XA 4B7XA 2O3RA 2PD3A 1JKFA 3BMQA 3DOJA 4BVAA 1O94A 5L4SA 4AJHA 3PYLA 4J2HA 4JROA 1QYCA 2WD7A 4J4HA 5DCWA 4BO6A 1YL6A 1CRWG 4E0BA 4CM7A 4N54A 4DA9A 1ORRA 3PHLA 1ZXLA 1NX6A 2D8AA 3D3WA 3QA9A 4JK3A 2XXJA 1DIRA 1AHIA 1H6BA 2CVQA 1P1JA 2W90A 3AY3A 4XD2A 1PGNA 1ZK3A 4XGKA 5IAAA 3NJ4A 2DLDA 1XDWA 4EZBA 4KUHA 3RAJA 4AJOA 1LDGA 1S7CA 4NQZA 3L77A 1YVEI 3RUCA 2C29D 3MJVA 2J5QA 4B4VA 4D79A 5GZ3A 5G4LA 1P0FA 2Z1NA 4IJUA 3NX4A 1EQ2A 3UXYA 4OAQA 1FDVA 3CMMA 3GGGA 2DPGA 1G0NA 3OM9A 3O38A 2RHCA 2UDPA 5BT9A 1ISIA 2XOXA 3TQHA 3WLEA 3KUXA 4X54A 5I7EA 3HFGA 2PH5A 4HY3A 4L4SA 4HP8A 3NT4A 4R9RA 4PLTA 2UYYA 3GG9A 3HB5X 4CM1A 4DYDA 3WGQA 1YDEA 3D7LA 1ULSA 1JA9A 3PLNA 5DZSA 4IXTA 4YACA 4Y8VA 1LUAA 4ZU3A 1ZBQA 1NVGA 2YQ5A 1X0VA 2C2XA 4FFMA 4B3JA 2HLPA 4NMHA 1UP6A 2DU8A 1PR3A 2WMDA 1MA0A 4UUOA 1NBOA 5CFZA 5L7WA 4HFMA 5JW6A 3P2OA 4YVFA 4DIFA 3RU9A 4N7RA 1E6EA 3WMWA 1P1HA 1PWZA 1SNYA 5TT0A 2V6BA 1LSOA 3IMFA 4GX2A 1NHWA 2P4HX 1HWYA 4Z9YA 1TB4A 1ZH8A 4GWGA 3D4NA 2IRWA 2HK8A 3AI3A 4G2NA 4RORA 4XYMA 4WECA 4WCFC 3LSYA 4BB6A 4Y6SA 3G1UA 1T26A 3KSDO 1P3DA 4W9NC 1Y8QB 5CP8A 2Q99A 4QXMA 3D3WB 4TQGA 2VWHA 1I0ZA 3OQ1A 4BHTA 2QIOA 3GVHA 3TNLA 4NJMB 3RJ9A 3G3EA 4R4JA 4K28A 3RIHA 1T1SA 4OH1A 1LQTA 3JQAB 5KIAA 1QRRA 2UVDA 4DXHA 2C82A 4ONEA 1ZXBA 1Z82A 3GVIA 3HADA 1VJ1A 3DXFA 4R16A 1LTHR 4BNTA 1ZEMA 1VJ0A 3JD1A 4K6FA 4MP8A 4PRLA 2OUIA 4UVDA 2QYSA 1DC4A 1J49A 2FY8A 1BHSA 2O7QA 2VYVD 3AI2A 3UF0A 4KZPA 4OQYA 5HS4A 1I32A 4PLCA 4AG3A 3ETGA 4Q3BA 2BF7A 5G0VA 3FNFA 1E3EA 2NVUB 3PHGA 5B12A 3H9UA 3VZPA 4PG4A 2VYND 1D3AA 1HEUA 3RKUA 2PKRA 3KETA 1IL0A 1YOVA 1ENPA 3VZSA 1KYQA 4MVJD 4BL5A 5KOIA 3U4HA 2FMUA 3KXDA 3L4SO 4IXWA 4NDNE 4BO2A 2V6MA 3PWSA 1G0OA 2BFPA 4JBGA 3Q6IA 5T8KC 1EZ4A 1BVUA 1PEDA 1HLPA 5DF1A 1HDGO 1GUYA 1P44A 2FZEA 4OOEA 4D0RA 3GRPA 4IDGA 4XJSA 1EUDA 1WPQA 3NDIA 1DIGA 1PZGA 3FNHA 4YJHB 4FN4A 1BXKA 5CEFA 4Y9DA 2FSSA 2YJZA 1QV7A 2X58A 2Y67A 1Q1NA 4FBGA 1XQ6A 4ZICA 5TF4A 5IDWA 4FFLA 4YWJA 2I66A 1LDNA 4ZRMA 3MWDB 3EVTA 4UVEA 5AXAA 1MFZA 1T1RA 2I67A 3DL2A 5KKCA 4PG6A 1U9JA 4YJFB 1NXQA 4WCFB 1K2WA 2Y1OA 3Q11A 2X0JA 3FCOA 3D3EA 1LX6A 2B35A 5T64A 4IIVA 2O3SA 2YV2A 4Z0HO 3KEQA 2VZ9A 5KNLA 3WBFA 4CM3A 3DAGA 3UH1A 4ND5A 1ENYA 2ZB7A 4EJ6A 2LDBA 3V1YA 3W4JA 4UEKA 5BNIA 2YDXA 1WNTA 5EJ2A 1NASA 5TLSA 2CUKA 5JDCA 2QZZA 1PSDA 3AM3A 1SEVA 2GYYA 5GY7A 1LRLA 3A14A 4O63O 2NU6A 2RAFA 1QKIA 3FR8A 3UN1A 4XDYA 1P77A 1YH3A 2P5UA 3ZNNA 3H5NA 2FSVA 5IZCC 4IQ0A 1PGOA 4CMIA 2GO1A 4P8RA 3FPLA 4E5NA 3ICPA 4KTTE 3TZKA 2P9GA 1C0IA 3ROPA 5FF9A 1RWBA 4ID9A 1QSGA 1BXGB 3EMKA 1ZKMA 5LDHA 2C20A 1ZO8A 1U5AA 5KJEA 4HFNA 3DBLA 2HRZA 4MVJP 5I9LA 2VHZA 1YS4A 4CJXA 1WW8A 4W6ZA 3LC2O 2VWQA 1XELA 2BGLA 1HLDA 4CLRA 2YDYA 3D5QA 3QSGA 4YT5A 1BW9B 1K6IA 2X5OA 5A9TA 2O4UX 1VSVA 1X7DA 4ND1A 1J6UA 1EE9A 1I24A 1Q7GA 1V3TA 2BI8A 4KDFA 3OJFA 4NIMA 3W4IA 3QP9A 2Y93A 1U28A 4HX5A 1PJQA 1H6CA 3BMCB 4BO0A 3OQ6A 3JYNA 3U4DA 2B4RO 3FNEA 2E37A 5C37A 3GOHA 2H63A 4GKBA 5HWSA 1DC5A 1UZLA 1I33A 4ALLA 1G6KA 4I1IA 1KVTA 4JJFA 3LU1A 3WB9A 4DLLA 4F6CA 3H2ZA 4GSLA 4Y67A 3CZMA 4EYEA 5MDHA 3KV3O 4LVUA 3ROQA 2GZ2A 3O9ZA 4FGWA 4KP7A 4PG5A 1R16A 1W73A 3JYOA 1GPJA 2FP4A 1YRLA 1EBUA 4QFCA 4DRYA 2OP0A 3AU9A 4PGFA 4KQWA 5A3VA 3DAFA 4RF5A 3HDQA 3GRKA 4R3WA 1N1GA 1WMBA 2IEDA 2NTVA 4S1VA 5EN4A 5F3RA 3JQ9C 3DTTA 3S2IA 1RYDA 1KVQA 2W98A 2C5EA 2EJVA 4BO7A 5JYDA 4PIVA 1B7GO 1XHLA 3NJ8A 3LQFA 3ONDA 5KJFA 3S2FA 2GF2A 3CPSA 3ZNPA 3HZZA 3GA0A 4CQLA 2IZZA 2H6EA 2PKQP 3BZUA 4KUEA 3N58A 4NG5A 4NH4A 1D1SA 3WLFA 1GV1A 1JVSA 1B8PA 3GDOA 4ND4A 4WKGA 3ZHZA 2PY6A 4CR8A 2EJWA 2NSDA 3RBXA 1N9GA 3MJTA 4OKNA 4FFPA 2BRUA 1CQJA 1FDWA 2ILTA 2GRAA 4U8GA 2PK3A 5G4KA 4PZEA 4DMMA 5B4VA 2NUAA 3R6DA 4NU6A 4KOAA 2ZQYA 2ZYDA 1JLLA 4PVDA 2JD1A 1PX0A 3GT0A 4NI5A 2VOJA 4JN6B 4E5YA 2G76A 4DMLA 2P91A 4GSKA 3CXRA 2GSDA 2FZWA 4IDBA 3AI1A 1ZIDA 5ENVA 3R3JA 3GEMA 3PYXA 3BHJA 3OIFA 3CUKA 1F06A 1MGOA 4H3VA 4CV0A 3DOCA 3VDQA 5ITVA 1EBFA 2G82A 3OSUA 3BMNB 3QE3A 1VPDA 4YQYA 4PLHA 4OMUA 1V3VA 2E4AA 2B4TO 3GEGA 4YJHA 1SEPA 3PHIA 5JO9A 2UV8A 3U4IA 4KMSA 2NU8A 3JTMA 5G0UA 3F5QA 3K6JA 4R1NA 2PD4A 3BMQB 4TWRA 3BA1A 2BHLA 4BNXA 1KERA 4MPDA 2AQHA 2CF6A 4AJNA 1GPDG 3ANNA 1H6DA 1JAXA 2EXXA 1ADGA 4UAGA 1DAOA 2XAAA 4CM5A 2PZMA 1AXEA 3DMTA 1CERA 3U62A 1KETA 4A7PA 3TFOA 3JV7A 1KOLA 1Z73A 1PGJA 4XJTA 5JDIC 3H5RA 3ANLA 3OA0A 3HQ4O 2I3AA 4RQUA 5C5IA 3OEYA 2D0IA 2OFPA 4YPOA 3OEWA 2IE0A 1KEWA 1I3MA 2Z5LA 3GNQA 4F46A 2J3IA 4OQZA 4HFRA 5DBIA 3DC2A 2GUGA 1KY5A 4RDHA 2HQ1A 3E48A 4C4OA 3ZGYA 4PCVA 1EUZA 4CV3A 3CZRA 5COQA 2HUNA 4EITA 1LXCA 1XG5A 1WDKA 3ENNA 2HKIA 3GGOA 2Q1WA 4OL9A 2G5CA 1WAMA 1YL7A 2O2YA 2NM0A 3N74A 4LSMA 3BTVA 1X0XA 3KTDA 2P5YA 4CLXA 4HNHA 3KRTA 1NQ5A 4K1LA 3F5SA 1H9BA 2X8LA 3DBRB 3KHUA 1Z7EA 2ZCVA 1HDCA 2Y66A 5JPIA 5TJHA 2R6JA 5A05A 2GD1O 2EIHA 3V2HA 4U7WA 1Z7BA 1O95A 4CM8A 1NAIA 1EEHA 4M54A 3QWIA 4R41A 1H2HA 1LI4A 2POQX 4IS3A 3RD5A 3A1NA 5FI3A 3WTCA 1EUCA 5KJ6A 5K0ZA 3D4PA 2PR2A 3F9IA 3K92A 1YB4A 4MKRA 4TKLA 5IG2A 4YRDA 2HO5A 1YL5A 1HYEA 4WLVA 4ALIA 1NWHA 2CY0A 3QVOA 3RC1A 4CMCA 4DBZA 5CEJA 2Q1UA 2AQKA 5G0TA 3ZV3A 3PXXA 4R5MA 3FBGA 5EMHA 3PZRA 4PLYA 5H83A 5ES3A 5IDQA 2R2GA 1UXKA 2Y99A 3BTOA 3H6KA 3TOXA 1F8FA 3DBHB 4M89A 4HWKA 1N7GA 4J9UE 4JJIA 4NZ9A 1L7DA 2X7HA 1H2BA 4XYLA 1OBFO 2JCVA 4FOSA 4GBJA 1JVBA 3B1JA 4Q3AA 3PFWO 3AUSA 3RI3A 1F8GA 1T4DA 2EHDA 4YEDA 1NQTA 2VUSA 5EERA 2B69A 1DDOA 2J3HA 4FSHA 4YBZA 3STHA 4E3ZA 5JCJD 4JP2A 1AN9A 4UUMA 3S1LA 1CEQA 1PJSA 2GCGA 5MGBA 1BDBA 4LRTB 3NTOA 1U5CA 1NPTO 2VN8A 2PH3A 1O9BA 1YKFA 4ZQHA 1DRWA 3JQ9A 1IYZA 3QIVA 3FRJA 3OFSA 1IUKA 5THKA 3ZWYA 2PWZA 4MVJI 5GZ1A 1NQOA 4XEHA 2X0RA 3LLSA 3AK4A 3LDHA 4B4UA 3M1LA 5KVSA 3INRA 1Y9AA 1YQDA 4XDZA 5ER6A 3RUAA 1E1KA 2IYOA 1U2DA 3JQ8A 2NVUA 1GYPA 2HDHA 4NBWA 1EDZA 1I3LA 2VHXA 4IJWA 4Q3NA 4RQTA 5F21A 1CYDA 4YR9A 1N9GB 1JU9A 3WIEA 2Y1GA 1A7KA 4TSKA 2JAHA 2JAPA 4J9VA 4RZIA 1QV6A 3OQBA 5JDCC 9LDBA 1K3TA 4NU5A 3E8XA 3VH3A 2QG4A 2X5JO 4YT8A 4BNFA 2B4QA 1DIHA 4BIIA 1GZ3A 5TT1A 2ZTUA 1EVZA 2Y05A 3BXXA 3S2GA 4KWHA 1LDEA 3H3JA 4LISA 3BTSA 4CLEA 5TSDA 3VC7A 4BO4A 3QVSA 3X2FA 3DTYA 3DWFA 4P4NA 3L0DA 2RH8A 2CFCA 4R68A 5DBFA 3VVCA 4YRBA 1ULUA 1PGQA 3PWZA 3VH1A 4J43A 1M76A 3UHAA 1Z45A 3C7DB 5IJZA 1O8CA 1ZVMA 5CDUA 1LSUA 4YRAA 4IMPA 4IZIA 4BKOA 2H5LA 5A4DA 5I9NA 3JQGB 2G0TA 4CV2A 3UGKA 2JCXA 5GZ6A 2C07A 1U7TA 3A9WA 2DUUA 2X0IA 3ZHYA 4CLHA 2E48A 3C1AA 2O23A 2ZTMA 5IZCA 5G0SA 5A3JA 3KLPX 2D1YA 3Q2IA 1VI2A 2DAPA 3LLVA 4GMGA 1ZK1A 3HDYA 5L4LA 2VZ0A 4RPHA 2GZ1A 4MOWA 5ILGA 3FSRA 1QYXA 2OGUA 4EBFA 3I52A 3K31A 4IJVA 4AJ1A 4C7KA 3DZKA 1F0YA 4J7CA 3ZW9A 4L74A 2Q50A 5KVCA 4E21A 3RFXA 4CLDA 1DRUA 1H94A 3F1LA 4GLOA 3OETA 4N5NA 1VL0A 3DONA 4R1UA 5DT9A 4B7UA 2ZQZA 4F3YA 4G65A 1I3NA 1LEHA 3K8ZA 3ON5A 3MZ0A 1EDOA 1PJ3A 1Z6ZA 3LT1A 3VHRA 4Y98A 1BRMA 1M66A 5EQFA 4GX5A 1N8KA 4RF4A 3KSZO 4HUJA 1EVYA 1GTMA 2AW5A 4LSWA 4EUFA 3OJOA 2VRCA 3RJ5A 3IL2A 4PLGA 2FPGA 4ZGWA 3UICA 3INTA 2O3JA 1GV0A 1GUFA 2B36A 4OHUA 2Q2VA 2Q1TA 1E7WA 4ROSA 4I5EA 1IPFA 4MIYA 3U4CA 3TRIA 1BMDA 5DCYA 4BNZA 1HE3A 3TL2A 2FRDA 3RC7A 3AFNA 4PN3A 1GQYA 3W8FA 1UXHA 4DTIA 1VE9A 1GDHA 3FTPA 2J5RA 1GZ6A 3V1UA 1WMAA 3FHLA 2ZK7A 2VWGA 3FN4A 3GAZA 3LC1O 2DVMA 4OXKA 1GFSA 1UAGA 2PGDA 1N5DA 3E5MA 4XCVA 1M75A 3GN2A 3V1TC 2PKQO 2VT2A 4URFA 3VH2A 5U1PA 4D3SA 1YONA 4E2XA 3HE3A 3DOOA 3W1VA 5JNLA 1PQUA 1I10A 1Z75A 5DP2A 1LLUA 2QRLA 3SLKA 1NR7A 4YAKA 1KBZA 3ABIA 1BXZA 1R0LA 2Y0CA 3PQDA 4ALKA 3EVNA 3WR5A 3HN7A 1MV8A 4CR6A 1P1RA 3ZDFA 2TMGA 1Y1PA 4MKZA 3W8DA 4CM9A 3VPSA 3DEYX 3WGOA 3LT0A 2QW8A 2W8ZA 4EEZA 4YT2A 6LDHA 3T7EA 3AJRA 4DC0A 1E6WA 3TF5A 1ZSNA 4AL4A 1C0PA 2BKAA 4N5LA 1Y6JA 4PVCA 1XQ1A 4D3DA 2X0NA 2XF8A 5T5QA 3I9NA 3SBOA 1U8XX 1Y81A 1K0UA 5FI5A 2PA3A 1ZMTA 3DHNA 3RBVA 1T25A 3QVXA 4XB2A 1SOWA 5JCJA 5A9RA 4BNGA 3PJDA 3V8BA 3WSVA 2B0JA 2HMUA 1FXSA 4PRKA 2UUOA 1IZ9A 4OM8A 3GR6A 3H9QA 1U7HA 2VUTA 4YAIA 1PS0A 3GVPA 4IDEA 3GN1A 1HE5A 1YBMA 1U3WA 5B1YA 4AJ4A 1HE4A 3O26A 3C85A 1VJTA 2CMDA 1PWXA 1DLJA 4CM6A 2NQ8A 5JS6A 3NT2A 1PZFA 3HNPA 4GVXA 4ZJUA 2X23A 1J0XO 4HV4A 1PGPA 2ZB4A 4XIYA 8LDHA 2V7PA 2ZB8A 1E0DA 2Q4BA 2WEKA 1I01A 2AA3A 2HCTA 3AM4A 4O6VA 1E7YA 1JWAB 1R6DA 1YQXA 4ZQBA 1X1TA 4IZHA 4XYBA 1E6UA 1U3TA 1HZJA 2B37A 4EEXA 4PZDA 4L4RA 1D8AA 3OA2A 1SCUA 4CM4B 5G2OA 1NP3A 3RWBA 3ZNQA 3PGJA 4YJFA 5THQA 3DZGA 5B4UA 4J4TA 3GHYA 3L6EA 4TZTA 4RGBA 3U49A 1HKUA 2YV1A 3NTRA 4BNWA 2GZ3A 4RVFA 1B8VA 4B8ZA 1KEPA 4J7XA 3HUDA 3ONFA 3ZU3A 3WQQA 2BI7A 3HDHA 1LNQA 3I4FA 4FDAA 3NYWA 4FR5A 4MVJG 4NBTA 5FFFA 2E6UX 3KYBA 4CMEA 4HBGA 1E1LA 4DIOA 2JHGA 5CDYA 1U3UA 4BKQA 3IKTA 1YGYA 1GYQA 2W2KB 1HE2A 3PZBA 3ICCA 1JN0A 3EGOA 4BQRA 1UH5A 3QVWA 1B8UA 4PLVA 1DHTA 3JQAA 4TRMA 4MVJM 3F46A 4W82A 4YB8A 2HJSA 3DFUA 4GL4A 3NGLA 1ISMA 5L7YA 3UUWA 3INGA 4YQZA 3WG9A 2PTGA 1E77A 3I9JA 1BWSA 1RKXA 3PVZA 1NTOA 4M8SA 2HAEA 2AE2A 2W2LD 3BTUA 3HN2A 3TZQA 4Z0TA 2VNAA 4GI2A 2QQ5A 4KQXA 4O59O 2V65A 1QG6A 2FOIA 4E32A 3H9EO 4LMRA 1BXGA 5HTOA 4XYGA 4PG8A 1K6XA 1VKOA 4I5GA 2NNLD 1B26A 5DOVA 5EIOA 3ZWPA 4CMGA 5JMWA 5HRUA 3EHEA 3UCEA 1R12A 1C1DB 3ROMA 3DZFA 2EW8A 4GAEA 4DL9A 5KCZA 1MXFA 5AXBA 3ST7A 1MC5A 4NFYA 1Q0QA 1CF2O 5IFLA 4E30A 3NUGA 3M2PA 1MG0A 3VOSA 1H0KA 2IZ0A 4GPD1 1QYWA 1XIVA 2WE8A 1DEHA 3UFXA 1VC2A 3PYMA 1NFRA 1DSSG 3L4BA 4RVDA 1NQAO 4W99A 5JO0A 2Z1MA 3RASA 1F12A 4PG7A 1C14A 1Q2XA 4RLHA 4WNIA 4ZN6A 1VLLA 1X7GA 2EERA 1IY8A 2NTNA 4QO7A 1I8TA 3DZBA 1R37A 1ZK4A 4YAGA 3NDJA 1D4FA 2C59A 3JQGA 2WTBA 3F4BA
chains in the Genus database with same CATH superfamily
2OXTA 4BKUA 4C2BA 4HNTA 5IUNC 4QECA 4NFLA 1X13A 5JXJA 4KE7A 5JH7B 5CPBA 1X9GA 2ZJYA 1Y5MA 3NHAA 4A0SA 1Z07A 1G2IA 1EFHA 3VV3A 5C7YA 2XNDD 5KUTA 3AVVA 2H1HA 4WDRA 3B20A 2EVWX 2WD7B 4PXAA 5GWXA 5HXAA 4WCFA 1Q20A 1N34B 3SP1A 4IS2A 1U2ZA 3CE6A 3S5JA 4XIJA 4EG5A 5JE8A 1DFGA 3W0LB 4DSNA 1QYVA 1W2WB 4YV7A 2QM7A 2GQ0A 3I2HA 5DYGA 3EDRA 4MWCA 1YMUA 5BOVA 1ESNA 3NHBA 3EGDA 2AD5A 3TFQA 2EZ8A 2LTAA 4O3MA 4LA4A 4RTNA 1UJMA 3OI7A 4Q12A 1MJGM 1XQXA 2DMRA 3QU7A 5TQVA 3ZXIA 5IABA 2GA9A 2OLEA 4PLZA 4X8HA 4PWZA 1QBKC 4AU1A 3VZDA 4GOMD 2GLTA 4GVPA 3WLAA 5JAQA 4R9VA 3FDFA 3LC7O 3IR7A 4QO8A 1ZL2A 2CL0X 1OC4A 3EF3A 4BLWA 4H3KB 3EZLA 5K6AC 3GVCA 3ECAA 4HYYA 3WQHA 3SC4A 3CVYA 1WSWA 5B3JA 3BORA 2H2GA 1USGA 4MB2A 2A0KA 2M6KA 5KQLA 5LXTF 1IZ7A 1ZAKA 3M2TA 2J3DA 4GO1A 4CUJA 3WKBA 4MWOA 1NNEA 1E3JA 2QPOA 1JJAA 4NFHA 1TRHA 5FYQA 2UUAB 4DLVA 3TUZC 5ICMA 4JGBA 2X4IA 3ZJYA 4RTSA 1NR5A 1DBRA 2QBYB 1CUHA 2HA7A 2Q3CA 4QAJA 3ZXXA 4FWTA 5K8LA 1E1CA 1XYGA 1XCPA 3BXGA 3QPWA 5F51A 1TK9A 3JQ7A 2UYCA 4IIFA 3IJEB 2IJGX 1DVRA 4PX3A 4DWWA 1EA7A 5DSTA 1E7MA 1PBNA 1W4ZA 2MSWA 1P0CA 4XR4A 5I3ZA 2FH5B 2FKAA 3FDXA 5AK4A 3TKAA 5JARA 1G4AE 1VFNA 5B6IA 3FWPA 4UHEA 3THOA 1E1DA 3KYDB 1TMOA 4OQEA 1C9JA 1JG6A 2Q3FA 1X86B 1CE8B 2D3TA 2PMDA 2RGDA 2REOA 2YWHA 4Q3KA 4QJBA 1FA9A 5EPEA 4ZD6A 2IWRA 3T7RA 4ESOA 2QYHA 2QMUA 3EX7C 1MFPA 3RAEC 5CX1A 3TAHA 1E2FA 4QRDA 3ZWBA 4F6LA 5I7OA 1NJ5A 2RK4A 2WTAA 2ZR9A 3CNHA 5JMPA 1ONPA 2JGNA 1NJ2A 1K06A 1SMKA 3HL0A 2A7XA 3I12A 2IV3A 1A8HA 1C1XA 4NK4A 4JT4A 4V1CA 1VHDA 3V1NA 3VDRA 5LQUA 2NZ2A 4UZEA 5HBRA 4BB0A 1VL6A 2OGWA 1RWQA 1AUPA 2CNWA 5AM4A 4CM4A 2CXNA 5CEEA 4EHBA 1H85A 3GUCA 3N87A 1XZEA 5AW4A 4QODA 1NN5A 4BMSA 1ZJ5A 1E1NA 5IJ0B 1DMRA 1G60A 2Y2UA 5T67A 4PHTA 3KPYA 2YWJA 5AM0A 2J7PA 4YCDA 3ISJA 3LX8A 4TL7A 5BOSB 5BY2A 1OV6A 1QFXA 2ZBUA 2CCKA 1KEVA 2YXNA 5KNCA 1K6JA 3LGXA 2YHIB 3VU9B 2H92A 1LJUA 4AULA 2P9YA 4DM3A 1I13A 5CDTA 4IVQA 4ACAA 1AB5A 3AB3A 1FYXA 4KMOA 7GPBA 3QITA 1FBNA 1M0SA 1UJ4A 3SFZA 2O7NA 3T8YA 1T2AA 2QKYA 1NVKA 4MUHA 4ZANA 5AW7A 3RYCA 4A27A 4JP5A 3W6UA 4FEAA 3Q8XB 1U5BB 4FE3A 2PWBA 2XCIA 5JEDA 1PG2A 4B4WA 4N18A 2V7QD 1G55A 5DLDA 4MDHA 4E6PA 3NH9A 4R8MA 2XDQB 2A3RA 2D2FA 2RAPA 4Q24A 4REQB 5IBRA 1DXQA 1VE5A 4Y2JA 5LB2A 5KJ1A 1QVRA 2H11A 5F23A 1XRMA 1GY8A 3CH4B 3HG7A 3L5OA 2GPAA 4BOYA 1EGHA 1VE3A 3OCZA 2WIAA 1CJBA 1PZEA 1ZC3A 2YNMD 4NP6A 1QNLA 3OJXA 3V55A 1Q0LA 5DISB 2QAGA 3O2SB 5E8JA 4BKPA 1SBIA 4V02A 3VR2D 2WT8A 2EIXA 3QWFA 4MCIA 4Q3EA 3MJ4A 5DLEA 4BLTA 5AVZA 3NTXA 5B1DA 5I4BA 2Q3BA 1RM3A 1Z6GA 1T2CA 3GP5A 3HA5A 4EDFA 1LRKA 1NY5A 1PNTA 1ZVQA 4HX2A 3V9PA 5ABPA 2AIRA 1Y8RB 2FW9A 4WOPA 3SKXA 3DPIA 4Q9NA 3T9EA 2XQFA 2W8BB 4CZ2A 4ESHA 1JSCA 1ZDMA 4RH0A 3C4JA 1U8AA 2GJ8A 2ZRAA 4K6MA 1QHNA 2WMNB 4E5PA 5BSWA 2YJ3A 3KYDA 2OXEA 5GJWC 4CKEA 4QGSA 3WGIA 1VG8A 1JLKA 3ZVLA 2WKSA 2O5CA 1GL9B 5DNCA 4RD6A 2WJ3A 5ERXA 4JJEA 1IHPA 4EENA 3J7AC 3QK7A 3T3DA 2P5TB 3QEAZ 3NYRA 1NHGA 1D7OA 2QVXX 1J4AA 2JIZA 1U2RA 4JQCA 3GXBA 4PC2A 4QUKA 2CJWB 3I9MA 5BYKA 4CKZA 4K9NA 5B4TA 2G4CA 2F1RA 1B41A 1UT8A 3ND9A 3NORA 5DBOA 1E5XA 4QIHA 3LMKA 4BB5A 3IS3A 5C53B 4AI6A 2PIDA 2AE1A 3P19A 3DBHA 1ENOA 3CKYA 2QHXA 2NO4A 4L76A 3ML1A 1SVIA 1NDQA 1P0MA 3UT6A 3GY0A 1TIKA 1M1YA 2WIBA 4FU0A 4LY6A 5KHLB 3PR3A 2CJPA 2PU7A 2EOAA 1NFQA 4LZNA 3HFSA 3F67A 2W2NA 3K4PA 4OY3A 1X7ZA 4RS3A 3KNZA 3EGCA 3M83A 4YJDA 4DMGA 3X44A 4GWKA 1J90A 4ZTUB 2DTXA 4O4LB 1E79D 1EU1A 2Q21A 3SSAA 4AY6A 5CA0F 2IYVA 2B94A 3BQMB 1DC8A 4II3A 1P60A 2NLOA 2BZSA 4K9LA 5I8ZA 5KAMA 4A8JC 2AFIB 3Q3HA 4CQMA 4EP1A 4Z4QA 4CCYB 1TQDA 4U6SA 3ZHQA 4WOBA 3D4LA 3WVNA 3ILXA 2IPXA 2XYQA 1NC3A 3MQ4A 1LPOA 3PHHA 4UHBA 1WWKA 1IWBB 1A04A 1QDEA 2PT9A 4WOJA 2QG9A 3U81A 3P5BA 3G8AA 1DL5A 3AUTA 1ISGA 4LZZA 4YRIA 4XWWA 4IUBS 4PYMA 3D3NA 2V0NA 4BO8A 5DNEA 2CVHA 1RM4A 1NVTA 3KOOA 3KSUA 1I94B 1W35A 4G36A 1ZISA 1JHPA 1GFWA 3JWPA 1J9ZA 4CEJB 2J8ZA 3P8ZA 5BPFA 2IXEA 4IBOA 2VC2B 1PFKA 2BEWB 4M9RA 4Y1RB 3R24A 4CETA 2HIMA 2WE7A 3P2KA 4OLBA 5AD1A 2H0RA 3A6JA 5ITZB 3PP8A 4TTRA 1ZN9A 3RIXA 4MQ5A 1B73A 5KNCD 4H18A 4YP5A 1N6KA 1OYOA 3C5WP 3C6ZA 4IYJA 1TNDA 1C3VA 4L9RA 4TKMA 4F1WA 5HQ3A 1OH7A 1PJCA 3R2JA 3IAFA 3NAQA 1P8JA 3NBFA 4CCSA 4YDRA 3KYJB 1E58A 1FF9A 2KB0A 3JATA 1XYYA 4IG4A 1HDXA 5ERGB 4C4SA 5KYNA 3UPUA 2Q3LA 1IE3A 2HK7A 2P75A 3GJSA 3KKNA 3BIOA 4Z2YA 2DWUA 1XVLA 3AP1A 4PYNA 2A4KA 1ONNA 2R1TB 2LE0A 1Y3IA 3SXJA 4BN0A 4FC7A 4QVIA 2AUNA 2SBTA 4L4YA 4QNRA 3VAZA 4E2WA 4NYIR 3B89A 3BC1A 1AGPA 1C3XA 3CHYA 4LZWA 2VBFA 2ZT6A 4DJ5X 2IEBA 3NFYA 4PCUA 3EEIA 3QVKA 3PRHA 5C0OE 2MCFA 1VJ5A 3PQEA 3OBBA 4XPIA 4AZ0B 5F52A 4TTIA 1EX1A 3HJTA 4NVRA 1RQRA 1HDIA 1YHYA 2W4QA 3O8NA 4F86A 1P2DA 3NM5A 2FK7A 3PX7A 1JG4A 2NVBA 4UDYX 2D0OB 4I5FA 3Q8LA 2QAJA 2ZI7A 2YC2C 1NXVA 3L1KA 1TGYA 2E4YA 1LSSA 1SOUA 2FPKA 3EOZA 5EJIA 1T3LA 4I66A 4OF4A 1GSIA 5L95A 3IAAA 5C32A 2IZOA 2BAGA 1XRPA 3A4MA 2OGTA 2CB0A 3O0TA 1K7CA 4Y18A 1Q77A 4MVJF 4U9HS 4ECEA 3UB3A 1O0BA 4GICA 3WIDA 1RJ9A 2BMEA 1SBHA 1XC7A 2QLBA 5E8RA 5KDDA 3H2YA 2YWXA 5FX2A 1LVUA 1BS2A 2OFXA 2EV9A 3STTA 4ZZ1A 1HH4A 1JHZA 1CSEE 3IXLA 4CM9D 3UHPA 3THYA 3GO4A 2CK3D 121PA 3O8LA 3CVWA 4HT3B 1GIAA 1HTWA 3JAKB 4CHGA 4Q7JB 3T4UA 2AI3A 3JQAD 2RBKA 1B93A 4FOPA 1GT91 4BO9A 3PK0A 1UWLA 3BK7A 4RDIA 1JR3D 4XARA 3ZC3A 3DAYA 5A6VA 3B3QA 2AK2A 4JSTA 3WWEA 3SQXA 3W5UA 1M2KA 1SG0A 2B5VA 2FPSA 4KN8A 4KUGA 1LLCA 3OTWA 3BRQA 4M0MA 1GCAA 1YOVB 2AFHB 1DJQA 2IHJA 3QMVA 4OD0A 3RRZA 5JD5A 5BVHB 2P8JA 4KW7A 3B48A 3D0OA 3G2PA 4IOLA 1KKMA 3E2PA 4R2LA 3RYHA 3DLHA 1TUBA 2EFDB 3JQ8B 2IU3A 4CI0B 1NSYA 1P74A 2RGCA 4WCDA 2BUCA 2O2GA 1R74A 1JSZA 2RHBA 3K5PA 3NXKA 3URKA 5CB4B 4CTMA 3GLFB 1M2FA 2ZVJA 4OGLA 1P5RA 4EZEA 3N8KA 2B8TA 4DWJA 3QE9Y 2YHUA 2C5BA 2HRBA 2OWEA 1V95A 1B76A 3ZVKA 3VHQA 4I9UA 2FJ0A 3ODGA 1T2FA 2D1QA 4X20A 4A8JA 3AKCA 1CS0B 5FXMA 2XXBA 5IBPA 3PIRA 1JTVA 3BMOA 4JWTA 3RABA 3TRKA 3QXXA 4RIHA 4AAYA 3L05A 1E3SA 1CEXA 5TS3A 2I4NA 2ZJZA 3WGTA 2ZXUA 3WLQA 4TXJA 1D6NA 1IIBA 1ID1A 2IXTA 1KJYA 4OGGA 1Y48E 2DM6A 2BGIA 1FDTA 2CLFB 1E9BA 4W6QA 1JAYA 1GARA 1PT6A 2MSKA 2VSNA 3W8RA 1FZQA 1OZ0A 2GEJA 1K68A 5GVSA 3N70A 1IHXA 2ZJ2A 3U13A 3FLEA 5K51A 5JTUA 4X91A 3EK2A 4BLUA 4XOIA 3U3JA 2OBBA 4C0AC 3WE7A 4G5XA 3HABA 3LF2A 3OCJA 5I5GA 3SJ7A 4EY6A 3IAHA 1DCMA 5KX5B 3GF4A 1Z56C 2MTBA 3R5HA 4JKOA 2RFLA 5TDHA 4UPDA 2JLBA 1HXHA 3FFAA 5JAOA 4JR0A 3CMCO 1JIIA 1UJ6A 2EP7A 1OVGA 3LP6A 4G24A 5A5FA 3U16A 4AKIA 1IULA 3ETCA 4KLRA 5EINA 1SKUA 1RWVA 4IIEA 3MQFA 2ZSIA 2D13A 4AYTA 1N33B 1QR6A 1HFEL 5HRCA 1P2VA 1SXJD 1L5YA 2AFVA 1ZNQO 2G0AA 1TT5B 1TF7A 4GU5A 5MN4A 3JD2A 4PQEA 2FSPA 1RQPA 2BC9A 3K1AB 3OZWA 3QFCA 3VZBA 3R1IA 1SZDA 5B1EA 2WU1A 2I6GA 2J07A 3TAUA 2DHQA 2R44A 4ANFA 4D42A 4F0JA 4ZYVA 5IKXA 3LVBA 2WDZA 1V45E 1R4NB 2GNAA 2O2DA 4NZOA 4LXQA 1KFBB 1H05A 2BSAA 4LJ8A 3DPUA 4CW7A 5JJ5A 4F45A 4H16A 3JYLA 3R6GA 4KGDA 1AUQA 2HU5A 3C0KA 4RHEA 3U2QA 2RARA 3WGVA 1EIWA 5T3YA 2FN9A 2JFVA 3MOIA 2YYAA 4CGYA 5E2BA 5LP1A 3IP3A 1SVSA 1WQ3A 3SF8A 2DOKA 2I4TA 3K9NA 3GJ7A 1XNQB 3OOHA 2GGSA 3TRJA 1DJMA 1O5IA 3ECSA 1RAIA 3KO8A 4HNQA 3GMIA 2DG2A 4JB2A 5THXA 4IKPA 1RWNA 4D5GA 4TMWA 4KBYA 4EJSB 1W36B 3I0MA 2ST1A 3MRTA 1FEZA 2VUHB 4UCQA 4V0KA 2QV7A 5AYVA 3ADOA 4WEOA 2O05A 3T9BA 4NCXA 5U4QA 2PQ6A 1M0WA 1Y3AA 1ZUIA 3ILHA 3LQ4A 4CLRB 1GPAA 5EFZA 4EKEA 2ZTVA 1NQXA 4N12A 2QL6A 4RF2A 1XE3A 3A04A 5HPYB 1G20A 1LFDB 3UY4A 4LOIA 1QQ7A 1VRWA 3AEUA 3SLGA 3DZIA 3OQNA 2P6OA 1XGKA 2YNMC 3DZCA 4AUMA 1FDOA 2UXDB 4HNRA 1NV9A 1XU7A 3SLRA 2FFHA 2BI4A 3IT0A 3R8FA 3LHFA 1WV0A 2IQ5A 2Y92A 4M55A 2WT4A 2XIQA 1H3EA 1CY2A 3R4CA 1TC2A 3PUKA 2FX2A 4DNXA 4Z4GA 3T99A 2EFGA 2QTZA 1IN1A 1X94A 3WWCA 3SIWA 3SR4A 4WESA 1XEXA 4R8KA 5KWEA 1D7AA 5J2TB 2EKBA 5FBWB 1XTTA 4BASA 3HJAA 2QRVA 2XWQA 3PBKA 4NONA 1CNMA 4WTOA 4DWVA 1X7HA 2WTEA 2QRKA 5KSYA 1PS8A 1DQZA 1ABEA 1RYEA 1D9ZA 1YACA 4M0FA 1F9AA 3IUEA 3OM8A 3OT1B 3D4OA 1SU4A 1VOTA 2CD9A 4Q3DA 4RFVA 2Y9PB 1SD2A 2XOKA 3MMZA 1WUTA 1N75A 2PV7A 4NMLA 4OGFA 1ISJA 3EFOB 5KX5A 2QVZX 4QBHA 3FRHA 2PL3A 5EA2A 1PTKA 2A5YB 3ACBA 3GGJA 4FYVA 2ANCA 4ZQIA 3HYSA 2E0IA 3WA6A 5GV8A 4PICA 1PX2A 3RSHA 2GS9A 3IPXA 4ZKDA 5JXHA 1O8BA 4HH4A 1MG5A 4LF9B 3I5MA 3RKSA 5BSMA 3UWKA 3S8MA 1VQ1A 5A5EA 3EWNA 1MO3A 2A2ZA 4J6FA 4L5JA 2B5OA 2GAIA 3KEGA 4M8NE 3UW1A 4RYLA 3G82C 3LY5A 3O90A 1FUUA 4QTTB 4YIHA 4H0FA 4RIIA 3EEQA 3NNSA 4WLFA 1G291 1UBTS 1Z7WA 5LD2B 1LI5A 1L5GB 1ZZEA 2G08A 2YXLA 4DCSA 4DG5A 2XD9A 1NRXA 2C96A 4JA0A 4E94A 1ZCJA 5FUVA 1SC4A 2XQKA 2RHJA 2ZPUA 2VDWB 1EK0A 1LDBA 3P32A 1QO9A 5LLSA 3R0VA 2GPJA 1MW9X 4MW2A 5AK3A 1QAMA 1QIEA 1TF5A 3O4FA 1OX4B 1ZH2A 2KWIA 3H5WA 4PYIA 1WUJS 4ASUA 5CT6A 4B82A 3VJRA 1DRJA 2WJAA 3D6HA 5FYDA 2G04A 5JG7A 4GBGA 4DUGD 1YVUA 2P90A 4WMLA 4RM3A 1OH6A 5AKEA 3C7AA 2W2LA 1QAOA 2VTBA 1ONBA 1KS9A 2HA0A 2RGGA 2VSXA 4TLLB 4WIAA 5HQ3B 2KBFA 5TEWA 2Q49A 4NV3A 2AQIA 1V47A 1QHYA 4H2DA 4ZDWA 3W6OA 3ZQ6A 3M81A 3GLHE 4F85A 1P1CA 2IYPA 2JB9A 5E2IA 3V8NA 2RI0A 5CA0B 2GN8A 2WWHA 1JALA 4F3KA 2Q9AA 1ISFA 2R8OA 1AK9A 2EWVA 2F3QA 4XUEA 3NHWA 3H2KA 5ESWA 1FRFS 1YAHA 1WCYA 3BH6A 5FA8A 3L1VA 5LQDA 4LMPA 1JIJA 1QHSA 1JAHA 4EL5A 3IQXA 3KELA 4ND3A 4Z0PA 1V5IA 5F1PA 2K2WA 5JZBA 5CCDA 5HKBA 4GKJB 4AZ3A 3N8HA 5HA5A 5EEHA 2QTMA 1XTRA 2QRVB 5CVDA 2JL1A 3GRUA 1IY2A 1GFZA 3N76A 2Y1EA 3L06A 3GGPA 3HJRA 4D57A 3UJHA 2O8CB 3U61B 3BFKA 4F9EA 1CY6A 2VBCA 3I2KA 2FW7A 2WIJA 4F72A 1I30A 2WQZA 5HKAA 3DQQA 4TWZA 3S2EA 2VHYA 2HUPA 1DQPA 2E18A 3CE9A 1QANA 2ZI9A 3DVAA 3OZTA 5KNCH 4RPJA 5IAGA 5K0JA 1ID8A 3UNXA 1XMJA 2IOFA 4G01B 5L45A 4MIEA 5KJCA 2DC1A 1P4RA 1VBKA 2ATCA 3KZXA 2H59A 3UA3A 3KTOA 2B34A 4U2DA 4I81A 2YW2A 4F6RB 5FWXA 2Q2NA 1I4WA 4MW9A 4PM4A 3UO8B 1LX7A 1ZRMA 1YZUA 2VRCD 3JYQA 5FCDA 1OWPA 1TAGA 1VI6A 4XDGA 2FR8A 5ALIA 3ICEA 4UBNA 3KKLA 3LWDA 4TYYA 4MJXA 3E70C 2C31A 1ELOA 3L4JA 3L8HA 1ZM7A 5AVVA 1M8PA 4ZV7A 1M6HA 1JB1A 2YZ7A 5DGTA 5K0GA 1GGMA 4BCCA 3FOFC 4OSPA 4PSCA 2QN2A 2YYZA 1E9VA 2M2IA 3B9BA 4H17A 4AN4A 1U9IA 5CXXA 1XCLA 2AG8A 3U3DA 1AF4A 4AFNA 4BVBA 4A6PA 3L82B 4X97A 4E4RA 2CHVA 5DN9A 3O8OA 2BH2A 3HJFA 2GKGA 1QIDA 2IC5A 1JQEA 4OAOA 2X2OA 5G1NA 4DLKA 1UT5A 1NU8A 4C4ZA 1J1ZA 5F76A 1OAAA 1JHMA 3EXAA 2J6IA 1NI4B 1NVVR 721PA 2C7VA 4QPDA 3EOAI 1F14A 3GLFA 5IBQA 3DW1X 1MZPA 2G1KA 2OMEA 4LXYA 3HVRA 1IQUA 4H0NA 1IJFA 1GNSA 2QUKA 3T06B 2D54A 4S1TA 1XZQA 2R66A 2RHTA 1QS0B 1YBFA 1JW9B 4IEIA 2C2YA 4UXJA 4Z53A 2IYXA 3T7TA 3B51X 4I4NA 1JAZA 1QVWA 2AT1A 3BVPA 4QUAA 3F1KA 1P91A 3O95A 1OX5A 3CIFA 4HVLA 3TMAA 1QIIA 2XWSA 4MVWA 1PAUA 1NVUQ 3A4VA 4TT3A 4UTPA 5A4IS 3HU1A 4OXNA 4RCVA 4KFUA 4ZO4A 4Q18A 2H85A 2O6HA 3C4VA 3OZRA 3ES9A 2HFJA 4A15A 1Z36A 1MC4A 3D2BA 1ZKDA 1VDMA 4TKUA 1IBCA 2P6UA 1FUEA 3IE2A 2PWAA 3OJCA 1KP9A 1NBMD 1U1EA 2V45A 2X4GA 3HZRA 4IQ4A 1SR8A 4G0XA 3LCRA 4G3XA 2JAUA 3E15A 1C3LA 1LCIA 4JEUA 1NPYA 1SELA 5JYBA 3QHAA 4UTZA 1GLVA 3OLVA 2XMDA 5LQSA 3ZDQA 4J3NA 4GMDA 4EUSA 4BNDB 3DVAB 1WHSA 1N0HA 1XTBA 1QE3A 3N7AA 4L1KA 3G79A 4A92A 1SXGA 4EGFA 5U9CA 3CSSA 3TJRA 4PNPA 1INLA 1GZ4A 4NCAA 4URUR 5BW8A 4P84A 4WUVA 4AKHA 1T4CA 1WPXA 1E2GA 1IQRA 1H2ZA 2DX7A 3EOBI 3N8GA 4OIMA 1Z4OA 4R6XA 5DT2A 2H51A 4XI9A 3ZTYA 2VATA 1JIXA 1WZCA 2C4KA 3U5ZB 4Q15A 2ZG6A 5JDIA 1XMPA 3BULA 2GYWA 4AJLA 3K9LA 4YAJA 5A4MS 1HSOA 3AC0A 5EXPA 5EWJA 3GELA 2D8MA 3KC2A 4MRPA 2BMWA 3K94A 5IAJA 4D8VA 4IRMA 4KVFA 5FWNA 3KT8A 4Y0NA 4CEIB 1CXZA 3TZLA 3IJRA 4N0PA 3RT7A 1TEHA 3OZFA 5AKIA 2VKTA 3AM5A 2GX6A 3WBKA 1KWGA 3DTVD 4NEQA 2FQQA 5LXTB 3Q3CA 2XX3A 4IJMA 3BGSA 5EZSA 1L4EA 1T5BA 1TF2A 2DCMA 3A1FA 3AVOA 3B85A 3FVVA 5BNTA 1GADO 2LKDA 2RJOA 3F6CA 1EI9A 1E2NA 3MWLA 3NAGA 3KZKA 1C0LA 3KYCA 3GNSA 4P7KA 4W5HA 3A27A 1XN4A 3IBCA 5K3BA 2JH8A 3IP9A 4BAGA 3COWA 1YU9A 4DT1B 5JEEA 4OXIA 4Z3DA 1N6IA 4TYNA 4FE7A 2E9SA 3AERB 5EWMA 3DP9A 2IXGA 1VGVA 2BFDA 3HJGA 1V2GA 2C2HA 3EVCA 4BFSA 1H5UA 3DBIA 4NY1A 1VL5A 3A4IA 4P5EA 3L07A 3S7ZA 4ARAA 5HIAA 1BFKA 4A4DA 1Y1SA 2VP3A 1KAOA 5BUQA 2ZIXB 4FFVA 1FPMA 1DXYA 2Y1DA 3VYSB 4LCJA 5IVIA 3WHKA 4Z8YA 2I29A 1MRSA 2RKBA 2WU8A 4QSMA 3UMGA 1TUIA 1PKEA 4MI3A 4S04A 4OXYA 3ZYCA 1Y7LA 2ARKA 2UYQA 3HXOA 3GLQA 3WGLA 2VXCA 2GN1A 4EA8A 1H93A 4NF2A 3HB0A 5DX0A 5I48A 4YUZA 1DNPA 4TT3D 4CR7A 3WYGA 3PL1A 3F71A 1OAKA 3RFUA 5EAIA 3KAJA 3LIIA 5TGDA 1WZUA 1L4FA 2FPIA 1CE8A 2VQ3A 5SY9A 2IDKA 3S0JA 4KR2A 3D8TA 1X1SA 4X63A 2EZTA 5CT5A 2BFAA 3HU5A 5E7IA 2X3UA 1ZCAA 2ZYUX 3AP2A 3TQSA 1ZU4A 5KYXB 1CUYA 2YTZA 5HBGA 4GPZA 2P9FA 4PW0A 4TTAA 4EQZA 2KLHA 4MW7A 3BHIA 3SSOA 3TIIA 3MAGA 1R1DA 5INTA 1RRVA 2AI1A 5JAZA 2D5IA 3KIPA 3O5AA 2YKGA 5KC9A 2A5GA 1NF8A 1Z7YA 3M34A 1FS6A 3KVNA 4X95A 4DLTA 5C3MA 3LGAA 1NFFA 4KLZA 4MQLA 4P1ZA 5EJ6A 1JG3A 3PUXA 4FHGA 1L7EA 4ZQFA 5KHAA 1M2HA 2H4ZA 1XFDA 3FGZA 3K7EA 4BBJA 1C8VB 1ZK2A 4COKA 1PP4A 5MFZA 3I23A 2O8BA 4IQ8A 4XSGA 4OSEA 3C8UA 3D64A 4QUEA 4OYHA 5SYNA 2IV2X 4CKYA 4EUNA 1M5RA 3NR2A 2XNKA 4DADA 1JEDA 4AROA 2JGRA 4DGSA 3WLNA 1GXSA 3OZUA 3QIAA 5CDSA 3RYCB 1WXHA 3TINA 5HYVA 1M67A 1TECE 1WVGA 1Y1TA 5HKKD 4BATA 3Q12A 3HKBA 3I83A 1PSZA 1JR6A 1SPBS 4EW1A 1WTAA 3FAZA 2I65A 2W71A 3P2YA 5FJJA 4DBVO 5BPHA 4R98A 4OB6A 2HSDA 3QXCA 4HDSB 5DBGA 3LT4A 3TPFA 4D9IA 2CZQA 2HK9A 2Q3JA 4WLEA 4DA0A 4DT1A 2JA2A 2O48X 3QXGA 5H3LA 3N0RA 4TVOA 4Y2PA 4ZMBA 3HYTA 3JQ7B 3QKRB 3GDGA 1B15A 4DSTA 4R1MA 4FTWA 3HR4A 1W44A 1R0KA 2ODPA 3LBNA 4WNYA 4J94A 1MABB 1FNNA 3R3YA 1C4OA 4V03A 3TZEA 2DWOA 3DNPA 4QUIA 3K16A 1AY0A 1QB8A 1EQUA 2WJVA 4NZPA 4OA8A 4P4SB 1LPSA 3TNLA 3KS9A 2O1SA 2JLUA 3G88A 4XQEA 4AIRA 3ZBTA 3MJFA 2XBMA 1I2ZA 1DHRA 1YO6A 3C1OA 5IVHA 4IV0A 2P2SA 3IB6A 4HZIA 3E7PA 3I9OA 4UJ5A 4JGGA 2GTPA 2Y1FA 2ZYAA 4OI2A 1GPBA 2CE2X 2G28A 2C2WA 3ZDRA 4J0EA 3R5XA 3WGUA 1YKSA 2FPIB 4LCEA 2UUPA 1EGAA 3MNFA 2O8CA 4OXXA 2V1UA 7REQA 2P7IA 1LF0A 5FIUA 4BXOA 3SQOA 2IPNA 2IOFK 2IYYA 1DIOB 1YQQA 5HX7A 1ZK0A 1QZXA 1Z16A 1FFCA 1SN7A 1B16A 2YIVX 1V6AA 5D2CA 1QCCA 5IC5A 3INNA 4R1SA 5DOZA 3NW9A 3FNBA 1XRRA 4J1SA 1B0AA 2JGLA 3DZJA 3O3OB 4X3PA 3VVBA 2IS4A 1VBMA 3GFOA 3L8GA 1TVMA 4XKJA 3T95A 4PEVA 3TTSA 1RT9A 1TJNA 4GIBA 4QARA 1K88A 5K3CA 3VZRA 1O97C 3P9CA 2NXCA 2GEBA 1PZHA 3HCBA 1CR4A 3EA5A 1JFVA 4EPTA 3M82A 1E5DA 2XI4A 1XBTA 3KQTA 6Q21A 8ADHA 1ZD4A 2QXUA 2CSUA 4DR1B 2R7AA 1KEZA 2NU9A 3EGVA 3TR0A 3ZZMA 4F4DA 1SU6A 2P2CA 2BD0A 1Q1EA 2R3SA 5AW0A 1QH8A 1R18A 3HU2A 3L8DA 2V1XA 1Z12A 1CF9A 2C7GA 3RRMA 1FK8A 3QFSA 4TUYF 1R0CA 1QP8A 4D9KA 4B2YA 3CPEA 3VC3A 2V55B 1N7HA 5DMXA 4EI8A 4UE2A 1NXTA 1K5DA 3DE6X 4DCJA 5KKAA 3AT1A 3M5PA 1XOIA 4EMSA 4WFJA 2IIQA 1TVKA 4F2HA 5K9ZA 1QS0A 4BGUA 3HVIA 4E4YA 4ITRC 3FBTA 5MFPA 3OMWA 4FOTA 5CW2A 1E7QA 5K99A 1P1KA 4ZVVA 5JI3E 1HMPA 1Y8ZA 4M6WA 4RPIA 3DFZA 2DFPA 3ZKAA 4YX9A 3PQFA 3E7XA 4Y2UA 1EFTA 1DX6A 1T2EA 2QTVB 5JAHA 1SBYA 2P6NA 5EP4A 2J09A 4KVGA 4YMWA 3LCUA 4IUYA 3BJIC 4BP9A 3C3EA 3C7KA 3JVIA 5FI0B 1QHHA 1CX9B 1RP7A 4UBJA 3CISA 4PIPA 4AN0A 2DQ4A 1XF1A 3CN7A 3BEDA 2HQRA 2VRBA 2YJ4A 3GL9A 2NV2B 4UVIA 1ZLXA 3CX3A 3T3HA 4P35A 1W75A 3VR4H 3WICA 1K89A 1FSPA 5KTTA 2XUAA 1ZGJA 2PMFA 3SG0A 3HHPA 2Z5FA 1D2HA 1K0FA 1S8NA 3N6VA 1U9YA 1Y8QA 5AJYA 5TEVA 4JS0A 1VBNA 3MYYA 3TZ6A 3ZWAA 2QAGC 2Q6TA 1LC3A 2W2VA 3CW8X 4IP0A 2O14A 2Q6OA 3PFNA 3VR2A 1UZMA 1UKBA 3W5VA 3L7KA 2DFLA 2ILVA 2PE5A 1EE1A 4OLHA 3E3NA 5I9TA 3AOEC 1UM8A 1XHEA 4WDQA 1FX0B 5JC1A 3B78A 2E5FA 4I08A 3DDHA 3SDSA 5HIKA 4NG4A 5FB3A 1SUBA 2BFEB 2HNAA 3AFGA 4Y2QA 4QELA 3WLPA 2ZYWX 5EL0A 5I7UA 3EIFA 4HGQA 5JYEA 4NDZA 1GGJA 2B3TA 1J8QA 2CXUA 1K7XB 4C29A 4I8XA 3PE6A 4DCCA 1BVHA 1WMFA 4HVAA 1Y4DE 4LYAA 4REOA 4ZRNA 5E6UA 1VIDA 4K8OA 1CQZA 1W29A 4BLRA 4ZI7A 3KOUA 5TQ2A 3PS9A 2PKEA 3FTNA 4D4MA 1IOLA 1P72A 1N77A 4C7OA 4BQOA 4E5KA 2DETA 4UEJA 2EP5A 4KRXA 2X0EA 4EMBA 3H8JA 3WOHA 2VHJA 3QW2A 1BO6A 1GPWB 3TRHA 4L6AA 3SQMA 5LJIA 2V3WA 1FSZA 1HYGA 1UOQA 3TYXA 3N5CA 1JLRA 5HILA 2WUVA 1DBVO 1FZTA 5LBUA 4CL2A 4FYXA 4PC1A 4EYSA 2JFYA 4K9PA 1JEQA 2CE7A 1M6WA 3ILVA 4DQKA 1X74A 3O8DA 4L3WA 2K6GA 5EXDA 5BUZA 1LQ2A 2VJLA 4DNFA 2AD1A 4S2EA 4JJGA 2Y4OA 4UDOA 2XSZA 3FPAA 1BE8A 4GYJA 4WXRA 3THSA 4ND7A 1G5IA 1QK4A 1YB7A 3DO8A 3CF6R 4DRXB 2UZ3A 1M1NB 1A77A 4NSNA 2R00C 2BSXA 3HDTA 2I80A 5TJ9A 1NVDA 4F8YA 2UUBB 5FPHA 1ZMBA 1EP2B 3EWIA 4MHSA 3L43A 4LG1A 4YMVA 1EWTA 1KKLA 3GQVA 2AMJA 4QBGB 1UBRS 1UZUA 1V4BA 2OBXA 2O8EA 2HGSA 1RFGE 3HA3A 2ZB2A 2CHGA 3OECA 1LBIA 5EHQA 4C43A 4CIWA 1QTQA 4OMCA 4D9HA 5T57A 2CNNA 2O52A 5C18A 1GZSA 3P71T 2QRJA 4NMWA 1BSVA 1PHPA 3ANMA 1OOEA 1U3CA 4RY8A 4X6YA 5ARDA 3TLYA 4AS3A 2R1TA 3DLBA 1JT9A 1W4CA 4P38A 1A8IA 2YWDA 4HKTA 3LUBA 3QOWA 2WAMA 3HVHA 2WWFA 1DC3A 1NWCA 1NR1A 1R0YA 2D4AA 1T5LA 2GR9A 1ZQ9A 2QY9A 4DC9A 1QTRA 1UXIA 2WLTA 4C7XA 3AUJB 1D07A 2HU7A 1PN3A 2H1CA 4FFNA 2JJQA 3HWRA 4BVFA 3T4XA 4JODA 3WMEA 3LQRA 4Z7JA 4B7XA 2O3RA 2PD3A 3HACA 1E18A 4HDCA 4A0FA 4C1NA 1SHJA 5L4SA 3GJZA 1QGZA 4L7VA 3RIGA 4YASA 1RAFA 1E9AA 4RKYA 3CURA 4JROA 4MYTA 1QYCA 3OLXA 4Q0MA 2CLDX 4WBXC 5DWVA 3HV2A 1W48A 4PGAA 4BO6A 4EG8A 3OU2A 4I5IA 3U37A 4EY8A 5JSZB 1CRWG 1N6OA 3NONA 1ZUWA 1UJBA 1MA3A 3UENA 1ORRA 3PHLA 2BFEA 4YGXB 4Y9UA 5BWCA 3PC6A 1ZOLA 4JK3A 4HSEA 3F2IA 4WX2B 5FUYA 2W90A 2P65A 4X1YA 1OT3A 2NU6B 3SOPA 1M1XB 5TS2A 2WK1A 2IFTA 1GXSB 2AF4C 4QNNA 1LDGA 1S7CA 4US0R 5TQ2B 2I7TA 4B6SA 3VKWA 3HKBB 1C8KA 1FTSA 4GRAA 3HLTA 4NQZA 3PC4A 3L77A 2HA5A 5C4GB 1AUXA 1TRKA 2AMYA 4UQOA 5GZ3A 1ZICA 4QOHA 1P0FA 5KSZA 3QUAA 1O6CA 1FFYA 4JKIA 4OAQA 1FDVA 3CMMA 3EPHA 5ELMA 2AZXA 2DPGA 4QLOA 5BW5A 4M60A 3IMCA 3O38A 5BT9A 4UTXA 3PSAA 1ISIA 1DWOA 1H3NA 1O57A 1RC1A 1Y8AA 3RYHB 3NDBB 4KDCA 1UC5B 5LKAA 4EB8A 5A5GA 1HI9A 3GBPA 2MYTA 3JX9A 4HP8A 2A0UA 3IR5A 4P4SA 3O4VA 3JRNA 4C03A 4PLTA 1VHLA 2AZDA 3NHYA 3OCWA 1TAQA 4FQ7A 1Z08A 2VP5A 3ZCPA 1PNVA 4F8EA 4DYDA 1YKGA 1KDVA 2GSWA 2AC2A 2HRRA 3PE3A 3H75A 2CXXA 4HB2A 5KTRA 4Z51A 1UEXC 1YI8A 4X20B 5BQ5A 3CW9A 5LZ9A 1X1QA 4D4JA 5CVJA 1BU8A 3LH5A 4QULA 1XPRA 4LDPA 1B0UA 2XHEA 5CIYA 4FFMA 4X8MA 1IY0A 2A0XA 2DGDA 2RKOA 4TWJA 2W93A 2PG3A 4NMHA 5H4GA 2ZUSA 4ME6A 1JBQA 1PR3A 2ETVA 3TCKA 1CRZA 3CUUA 4LPSA 5L7WA 2YJNA 3K6SB 3RYTC 1Z4KA 2YR0A 2Z56A 1U2TA 2O0JA 4HFMA 3HWX1 1GL6A 3LUGA 3LHKA 5KTSA 2YINC 1E9RA 2GRUA 13PKA 1SNYA 4RK1A 2GXQA 3KQVA 1NHWA 4GPEA 1A9OA 2WBLC 1XPOA 4GWGA 4X0EA 1R9GA 1VJGA 3AI3A 3BWVA 3I04M 4WECA 3V4LA 4WCFC 1BYIA 1YS2X 2AB0A 3Q0TA 4Y6SA 3KSDO 4X5OA 4Y2HA 2Z4TA 2DQZA 4N39A 3TBKA 3ZHRA 4EHFA 1E2PA 2YL2A 1AZLA 4BGDA 3OQ1A 1I3CA 5CDHA 4FYKA 2QIOA 1UK6A 2BVNA 2KPOA 3GVHA 1FNCA 3ME5A 4NJMB 3R9IA 3QMWA 3UK1A 3HDVA 4AZWA 4R4JA 3LBAA 1EA5A 3C3KA 4FZRA 3C70A 4XTCS 5BR4A 5KIAA 3RC8A 4TS9A 1XZDA 1Z8FA 1ZXBA 4ONEA 1Z82A 3HADA 4P81A 2HV9A 3H42B 1LTHR 1Z4QA 3MMXA 4A0QA 1Y5LA 3TO5A 1GKKA 1ZEMA 4PGGA 2OUIA 4PNZA 2ZWMA 5C5CA 1M7HA 1Q0PA 4YCSA 1VYVA 2CFSA 1I6LA 3LX4A 3OVMA 3EWSA 4LBWA 3TL6A 3UF0A 3VKHA 2R1ZA 1QVZA 4HGNA 5FDFA 1YZHA 4EHDA 3USCS 1I32A 2QRZA 4NRDA 1JG1A 5AQEA 1VCHA 2ZTSA 1K8QA 1MKYA 4ZCLA 5YASA 4TSFA 2VHUA 3WL7A 4BX0A 4DV1B 4CGZA 4MV0A 3BS4A 3BQ9A 4Q3BA 2BF7A 2QNRA 4KACA 4FMPA 3FNFA 2F48A 1KAGA 1ZA2A 3OF5A 4N5DA 4AWBA 5B12A 5KMGB 4FHZA 2O1XA 4GS5A 2VYND 3CRRA 5DH9A 3VNQA 1D3AA 1HEUA 1EVLA 3BD9A 5E4JA 3DSRA 3PF8A 4C4RA 1IL0A 1YOVA 4EG6A 5FV4A 3EXIA 1KYQA 2HZBA 3FIJA 4H9GA 4PC7A 4RZSA 1CRQA 4QDKA 3U7QB 3SBXA 3ZOZA 3ZE6A 2JLZA 4BLOA 4TTJA 3U31A 2FEKA 2V6MA 3PWSA 4K7JA 2DUMA 4RBNA 1P0QA 2FDRA 3Q6IA 4JBGA 4MNTA 3ZIUA 1BVUA 2W6ID 1S3IA 1GUYA 2G72A 1B8OA 3KVRA 3PNLA 4B2PA 4D0RA 7YASA 2FMXA 3SK0A 5F73A 1OXSC