4CLRA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 90
structure length 249
sequence length 267
chains with identical sequence D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4clrA00
3BMCB 1HE3A 4QUKA 3I9LA 3UXYA 5I9LA 4PRKA 5A06A 1DHRA 4E31A 1PQWA 5T8KC 3K96A 1DLIA 4D3SA 3KYDB 1YL5A 9LDBA 1T1SA 4M8SA 4XX0A 4CLXA 2AQ8A 5F1KA 2Y1OA 3WGIA 4NG5A 1YJQA 3UCFA 3WICA 1I30A 1PJTA 3T7CA 1GUFA 2EP7A 1GYRA 4HFNA 4CLRB 4XWYA 1QYXA 4XR4A 4YJHB 1HDGO 4H16A 3ST7A 2B37A 4CM3A 3EAGA 2BELA 1XU9A 3MJ4A 1FDWA 2GZ1A 3S2EA 1U9JA 2ZB8A 4FFLA 3PWSA 1XKQA 3INRA 4E2XA 1Z73A 4KWHA 1GCUA 3OJEA 5K9ZA 2NACA 2P2SA 4YRBA 2IDZA 2D3TA 3PFFA 3OQ1A 4NBRA 3G3EA 1PGJA 1Q0LA 1DEHA 2IZ1A 4LW8A 4P8RA 3C7CB 4M55A 1SMKA 4YXFA 2WYVA 5F21A 3JYOA 2YW9A 3WOHA 4NK4A 1E7MA 5THQA 2VRCA 5I8ZA 2X7HA 3S2IA 1PGNA 2ZTUA 4LSMA 5ES3A 4I9UA 2ET6A 1UZMA 2I65A 3WIDA 1B8VA 3PQFA 1KBZA 4RGBA 5L3ZA 3H9QA 2FHSA 1GDHA 1JQBA 2W2LD 1YRLA 2H9IA 4CM8A 3DBHB 1LRJA 3WWZA 1R6DA 5BSEA 3U9LA 4UEJA 4YJDA 4PVDA 1DIGA 1ONPA 5IN5A 2W98A 4YYZA 4Z9XA 1R37A 2HCTA 3RROA 2PZKA 4MP8A 2CNBA 1HDZA 4NK5A 5ER9A 5KTKA 4KUHA 4R01A 1C14A 3ZV3A 2H1SA 5L40A 2CDBA 2VHWA 2X58A 3O8QB 4PZDA 1KIFA 1QMGA 2HK7A 3RUEA 5KJFA 1ZIDA 2J3KA 2P9CA 3RVDA 1EVIA 1O89A 3G79A 2NTJA 4YAKA 4IDEA 5HRUA 3UAGA 1B8UA 4DIBA 3RUIA 1PWXA 1BW9B 3RJ5A 2EF1A 5KVSA 1G0NA 5EINA 4DA9A 3BAZA 5CDTA 1QP8A 2D59A 3OSUA 1Z7EA 5I7VA 3GA0A 2AQHA 2P9GA 3KV3O 3DMYA 3E5MA 1GZ3A 2VNAA 1RPNA 3H9JA 4BO2A 3ZU5A 2FN7A 3KEQA 3ON5A 2J3IA 2HMVA 2R6JA 3NDIA 4W9NA 2ZYAA 5T57A 1BXZA 1G0OA 1D3AA 3VDRA 3K92A 1N7HA 4B8ZA 1N5DA 3P2OA 4M87A 2FZWA 3WYCA 4M89A 1Y7TA 3DZKA 1UP7A 3I9MA 2HQ1A 4G2NA 4NHEA 2NQ8A 4JIGA 3HN7A 2D2IA 3UVEA 4IUYA 5KOIA 1XDWA 1M6HA 3DL2A 4R3NA 1UP4A 2OORA 3DBVO 1MA0A 4NIMA 5CDYA 2A92A 4ZD6A 1F06A 1HDOA 5T67A 4MKXA 3A1NA 4FFRA 2PZMA 3ZCXA 3QWFA 4B7CA 1X1TA 3VKUA 1BVRA 1EQ2A 3KUXA 3QLJA 1QRRA 5FWNA 1ISFA 4U6QA 3PI7A 2O3QA 1HWYA 3M2PA 4GPD1 4H3VA 4CM9A 3E5RA 3GDFA 3QJ5A 3U5TA 1ENZA 3Q6IA 1FDUA 1YBVA 1QYVA 1SPXA 4Q9NA 4K6CA 4DTIA 3HADA 1XSEA 3DMTA 3GAFA 2HU2A 1RJWA 4TRRA 4AJKA 4L8VA 5JSFA 4XGKA 1U5AA 2HLPA 3PYMA 3QVTA 3DTTA 2Q2QA 3K8ZA 4LSWA 1HYGA 2FWMX 1WZEA 2NSDA 1IL0A 4RLHA 4CLHA 1AXEA 2ZB4A 3OQ6A 4ZRMA 1FK8A 1V6AA 4HNGA 4N54A 3ZDFA 3LDHA 3WQRA 5JBIA 4HWKA 4M49A 2YFHA 4R1NA 3EW7A 1HRDA 4KZPA 3OICA 2Q46A 5BT9A 4W7IA 3BYZA 4NH4A 2EWMA 2GDZA 4GX5A 1XQ6A 1ZJZA 1OC2A 3ORFA 3ZU3A 4PLCA 3QP9A 3DBRB 2V6FA 4GX1A 4GGPA 4YRDA 4I8XA 2OBNA 4RVHA 3V5NA 1U3UA 3SEFA 4QX6A 5K6AA 3DBLA 4FOSA 2AEMA 3WSWA 5HM8A 1B15A 5EMHA 4GWGA 1MFPA 1PSDA 2OUIA 2G76A 1BVUA 4AJHA 4IDAA 4XGNA 2QRLA 3JQ8A 3ROMA 3FHLA 5JMPA 3F4BA 1V35A 3DAFA 3BZUA 3FNFA 1P9LA 3ONFA 4LN1A 4AG3A 1NVMB 5A05A 4QT0A 4Y98A 1ZK1A 4HXYA 2VCYA 3PP8A 1L1FA 5BQFA 2IZ0A 4D44A 5T6BA 4DC1A 4YT8A 4L4XA 4ZQGA 2OP0A 4UVDA 3GK3A 3RC7A 1KEPA 4K6FA 2EV9A 1PR3A 4FFMA 1PQUA 4XDZA 3PHIA 1T2FA 3ZV5A 3CXRA 3FWNA 5DF1A 4CLEA 5JDIC 3Q1LA 5ITWA 2X8LA 2ZTLA 5THKA 3INGA 1KOLA 4BL5A 5JCXA 5MGBA 5JDCC 3KTDA 3L77A 2W8ZA 1NNUA 3Q0EA 3ZWWA 1VKOA 4U0KA 2FPGA 4IDGA 2ZJ1A 4MVJI 3ENNA 4FJ0A 3UOGA 4D79A 2O3TA 4QFDA 4KTTE 3I4CA 3V1YA 4BNFA 2NTVA 3VOSA 3JV7A 1UUFA 4MIYA 3H9GA 4B4VA 4WK6A 2QYTA 4BNYA 1Q2XA 4E2WA 1E5QA 1E7RA 3OJFA 3DZHA 8ADHA 3ULKA 2Q50A 4J9UE 4ZN6A 2YZ7A 1I3NA 4R4JA 4QQRA 4EUHA 5F1OA 4XB1A 2D5AA 2NNLD 5CEJA 2IXBA 2EJWA 1ZK2A 1ENOA 3C7DB 4QECA 1NQAO 3ASUA 2CUKA 2ZB3A 2X0IA 1B3BA 4I08A 5U9CA 4K26A 4ND1A 3WR5A 1LDNA 4Y8VA 1MFZA 4TSKA 1X15A 3ZV6A 1M76A 1HE4A 5KNLA 1E1KA 2VT3A 2BFOA 4E5MA 4E3ZA 2P68A 5G0VA 2CZCA 5G2OA 3EHEA 4EJ0A 4LVUA 4OSOA 3ETGA 4DYVA 3IMFA 2ZB7A 3GDGA 3WFJA 5FYDA 3U4CA 5IXYA 3L6EA 4CMJA 3PDJA 1KC3A 3GNQA 3TQHA 1CERA 4WCFC 5ENVA 5LDHA 3GEGA 4H7PA 3VPHA 1E7WA 1PS0A 1GPDG 3RWBA 1CJCA 3D5QA 1FF9A 4W4TA 1K89A 2C5AA 3IUPA 1RM0A 1IHXA 1JKIA 2DFDA 1UDAA 4KMSA 4CQMA 3ZZNA 3UCXA 1M66A 1NPDA 3GMSA 3ABIA 3NEPX 4FIZA 5IAAA 1NQ5A 1LSOA 1Z6ZA 1KVRA 1WNTA 3LC1O 3KBOA 3NJ8A 1LLDA 4D42A 2C20A 5IF3A 3F9IA 1F17A 1GADO 1G1AA 2GN4A 3PZBA 3KRTA 3A14A 3F5SA 2E49A 1TXGA 1Y8QA 3OEYA 4BNZA 2A35A 4RPGA 2DBZA 4OM8A 4RF5A 5HWSA 3DONA 4CUZA 3ZNQA 4JP2A 4QTZA 3L4BA 2H6EA 4GMGA 5CDUA 4EJMA 4JJIA 5AQ1A 4FFNA 3WLEA 1A71A 2P5YA 1ZH8A 4PRLA 2JAHA 3E03A 3JQAB 4DBVO 2B69A 1C1DA 2GN8A 1T2AA 3OQBA 3JQ7B 4DLLA 4PLTA 2NM0A 5DP1A 4BKOA 4CQLA 5ITVA 4XB2A 1NP3A 5T5QA 1RM4A 2PKQO 4IS2A 4CR6A 1DC3A 3I4FA 3NDRA 2I67A 3NRCA 4PGFA 2GD1O 3H9EO 4BS9A 4E21A 5DN9A 1X13A 4BNKA 1LEHA 4YT2A 1PU2A 2Y05A 5KVVA 4KUGA 1B16A 2A4KA 1NVGA 2FPIA 3SBOA 3D3WB 2IODA 3U3XA 2HK8A 3AWDA 4RPLA 5ICSA 1RYEA 1ZO8A 4DGSA 1ZEMA 4BIIA 2IEDA 3ZWNA 1Y6JA 2YV1A 4Z0TA 3VVCA 1R16A 3PGXA 5A4DA 3CH6A 4Q3DA 4PLZA 2YHIA 3TNLA 5IDXA 1MG0A 3G17A 1B0AA 4Z6KA 2YHUA 4RDIA 3AY6A 3PLRA 1NR7A 2FZEA 1P1JA 3WDSA 4GL4A 4PLFA 5TJ9A 2P91A 3I9OA 3WGTA 4B3IA 1UR5A 4BNIA 1DFGA 5A02A 5KKCA 1MXHA 4HUJA 1QORA 5TRTA 4A7PA 4FQ8A 2BGMA 3ZN2A 1N9GA 2DLDA 1BDMA 4BO8A 3F1LA 1A7AA 1JN0A 3QWIA 3UH1A 1AN9A 1VJTA 3RI3A 1X7GA 3X2FA 3BMQA 4B4UA 4EBFA 3H2SA 1GV1A 3I6QA 3NTOA 1BG6A 2PH3A 1EUZA 1ZBQA 4RZIA 4DLAA 3U09A 4NBTA 2G17A 3AU9A 3M6IA 3GVPA 1QV6A 3ROQA 3U4HA 1W0CA 3ZWBA 3IDSA 3PRJA 4S1VA 2VT2A 2VOJA 4RF3A 1U4SA 2GSDA 5I7EA 3QVXA 3JQBC 1H93A 4LISA 5DOZA 3GVCA 3ZHYA 4CJXA 1M75A 1C0PA 5DBFA 4YRAA 3BMCA 2JD2A 3PQDA 4J16A 3AI2A 3D4PA 2V6MA 2Y93A 3V1UA 3ETEA 4MVJM 1ADGA 5COBA 3Q2KA 1ISIA 1E3JA 2DUUA 3SC4A 3ADOA 5TJHA 4BB5A 2O2SA 1U2DA 2CD9A 4AJLA 3R3SA 4DXHA 5DNAA 2QRJA 4BMSA 4FCCA 1E3WA 3JD4A 2ILTA 3QRWA 4GGOA 4RL6A 4YA6A 4A73A 2AXQA 1HLPA 3GUYA 3ZWMA 1EBFA 4DL9A 2VUTA 1E1MA 5JDCA 4XD2A 3E48A 3I83A 4GMFA 2D8AA 3K30A 1PZEA 1H9BA 3IS3A 2BMAA 4E0BA 4ALLA 3JD2A 4YR9A 2PLAA 5IFLA 3U4IA 3B1KA 4RPKA 2DPHA 3WMXA 2BKAA 4UUNA 1YJ8A 2AE2A 3VHRA 1MG5A 4YJHA 4PG8A 1NPYA 2X9NA 4IZIA 2RCYA 2GN9A 3AUSA 3F6YA 1DAPA 4II2A 3EZYA 2P9EA 2VHVA 2X9GA 3VTFA 4TKMA 5B4VA 1HXHA 2YDYA 5A03A 3C1OA 1YDEA 3I6IA 4OQYA 1EE2A 4O63O 3CINA 1Y9EA 5IG2A 2WE7A 1E6UA 4EJ6A 1SEVA 4LMPA 4CMHA 1I3KA 4HV4A 4Y6PA 1BXGB 4TRJA 2W2LA 1A4IA 3FN4A 1JAYA 4YQYA 3UF0A 1O95A 4QO8A 3TOZA 3F1KA 1DBVO 2VWQA 1WZIA 1GUYA 1I36A 1WMBA 4RF4A 4YJGB 1IHYA 5DOVA 1VE9A 1BGVA 2Y66A 2O2YA 1SZJG 1YH3A 2CMDA 1FDTA 2NU9A 4PLGA 3AUUA 3CZRA 4WPGA 2WE8A 4BMVA 3JCZA 2I3AA 2NVWA 3M2TA 3VDQA 1JAXA 1IPEA 4RO0A 2Z1NA 2FR1A 3IIEA 2AEJA 3PWZA 5JW6A 3WMWA 1NWHA 4UULA 1C3VA 1IPFA 4JNKA 2DPGA 1K6IA 1PX0A 4CMIA 1VM6A 2O3JA 1I2ZA 4LMRA 1PJQA 4CL8A 1VL6A 1IZ0A 4ZHSA 4GLLA 4DVJA 5A9SB 4DUPA 1NYTA 1JVBA 1WPQA 2BRUA 3BMNA 2C54A 3GFBA 5I7FA 2VHZA 1U7TA 3RUCA 1MXFA 4NBVA 1M67A 4OXKA 3L9XA 4UREA 4BQRA 4CMEA 1VC2A 5C7LO 4GKVA 1HDRA 4IIUA 1DAOA 3VTZA 3DZFA 4NI5A 5JLAA 1JWBB 1K2WA 5G0UA 3BXXA 3GVHA 1U3WA 4OKNA 5DT9A 5T8KA 3K2EA 2PFGA 1YS4A 1DPGA 1R12A 3LC7O 2YY7A 4NPCA 3JQDA 3I5MA 4PLWA 1F0YA 2NVUA 4MKZA 4J9VA 3QSGA 2D1YA 2I66A 3KB6A 4BKQA 5CDSA 3AY7A 5L4NA 3K6JA 5CDGA 4KP7A 5BNTA 3SVTA 4UAGA 1QV7A 2PD6A 3L4SO 4ZGWA 1YQXA 3HN2A 3RJ9A 4KQXA 5JFOA 3FR7A 2Q4BA 4KOAA 5H83A 1QLHA 4AVYA 3HFSA 3R6DA 3CSDA 1RM5A 4E13A 1VL8A 1H2HA 3AY3A 4AJNA 5F3RA 4ALNA 2AEFA 1ZNQO 4ALMA 4FFPA 2FMUA 2QZZA 1XA0A 5EQFA 4J1SA 3TDKA 3WGQA 1CIVA 1KYQA 3HB5X 4NNJA 3NJ4A 5HS4A 1E3WB 4ND3A 1G6KA 2JFHA 3NGLA 2ZTMA 4AICA 3O4RA 5BSGA 2YUTA 1H9AA 2B83A 2R2GA 1W4ZA 3GOHA 3T4XA 4MVJG 2E4AA 3NGXA 2FSSA 3M1LA 3FD8A 2BGKA 1NHWA 2XXBA 1J4AA 1UAGA 4BHTA 4BNNA 3E9MA 1NASA 1R66A 3TJRA 1R15A 2YV3A 4BNJA 4LRSB 1DIHA 3DDNA 3K31A 2DBVO 3JQCA 4M1QA 4DC0A 1RWBA 3IP3A 1I5RA 1CWUA 1O94A 5LC1A 1JW9B 2TMDA 4IDBA 3TZ6A 1Z75A 4W9NC 1ENPA 4DPMA 1SOWA 4R54A 4R1UA 1I32A 1VL0A 4EUEA 3KXDA 4CQMB 1ULUA 4BUCA 4OXYA 1NQTA 4I5GA 2QHXA 2BH9A 4XJTA 2Q2VA 3D3WA 1P31A 5CFZA 2WYWA 4BO1A 2D5CA 1E3EA 3KLPX 4ROSA 4J3FA 3O26A 4RJTA 3JYQA 3OJLA 3SC6A 1MP0A 1LSUA 3AM4A 4OAQA 3EYWA 3TWOA 3W6ZA 5MDHA 2E37A 1KEWA 2NU7A 3QVWA 5DCWA 2JL1A 2X86A 4HP8A 2H63A 1FMCA 1EQUA 1NXQA 5H82A 3CEAA 3WYEA 5TQVA 3UGKA 4YDRA 3WBBA 3ZI0A 3PHHA 1PGQA 4W99A 3DAGA 4BQPA 3RCBA 1YQDA 2YDXA 3IL2A 3FNHA 2ZJ0A 5B1YA 3D4NA 2Q49A 3GN2A 5DCYA 2C7GA 4HADA 5JO9A 4DQXA 5G4LA 4CL3A 4J7UA 4D7AA 5TT1A 2DBRA 4FW8A 3ADPA 3KSZO 3MJTA 1GPJA 1EE9A 4Q3EA 3B70A 1NWCA 3ITKA 1R0LA 4AJIA 4DLBA 3LLVA 4RVFA 4N5NA 5KJCA 4C4OA 3KYDA 1LQUA 1W8DA 4J91A 5L51A 4JROA 5COAA 4J4BA 4D0SA 4CPDA 1ONOA 1BW9A 1VPDA 1D1SA 3ROKA 4I5FA 4MIOA 5JMWA 1DO8A 4XA8A 1OBFO 4YACA 3U49A 1J5PA 2WMDA 1BHSA 3DZBA 3OIDA 3VVBA 4FD3A 1KVQA 3H8VA 2B4RO 4K9DA 4NJOA 4DQUA 2QX7A 4FSHA 4XQCA 4BGUA 2BFPA 2O3SA 2WD7A 1V3VA 1HZJA 3DTYA 1J0XO 2PGJA 1BRMA 3O8QA 4ALJA 1LX6A 2VHXA 1NAIA 4U0JA 3RSHA 5IDQA 1DB3A 3ANNA 3FNEA 3AM3A 4CM6A 3GGOA 2C2XA 2G5CA 5EN4A 3FF4A 5I9NA 1F8GA 3EVNA 3IJRA 5F5LA 3CKYA 1Y8QB 2GO1A 3KYBA 5JCJD 1HKUA 3FCOA 4B7UA 1WWKA 4R69A 3RQSA 1H6AA 1U28A 4JQCA 5BSHA 2UUPA 4C7JA 3N58A 5JS6A 4I9HA 3PEFA 4IDDA 2FY8A 3LF1A 4HFRA 4OOFA 4L9RA 2X0JA 3FSRA 4AJEA 5JY1A 1E92A 3VZSA 2JD0A 3GVIA 4PCVA 4L76A 1LTHR 3JQFC 1DFHA 4P4GA 2FR0A 4E2ZA 5A5EA 2E6UX 2HJRA 4K1LA 5K6AC 1DSSG 3MJSA 4N18A 1PL7A 2Q1UA 1ZMTA 3FTPA 1VLLA 4OYRA 1J49A 4A0SA 5CP8A 2EW2A 3HWRA 4J49A 3IQDB 4FFOA 3W8DA 1A9ZA 1PGPA 4HFMA 1HYEA 1PJ4A 1R0SA 5ICMA 4P22A 4CM4B 4X54A 1LDBA 2DC1A 4IDFA 4GLOA 2RBEA 3PJEA 2PV7A 2UYYA 1DRUA 2PY6A 3R1IA 4KUEA 2EKPA 1ZMOA 4GX2A 1PZGA 4LK3A 3QVSA 5CPBA 1BSVA 3DQPA 4IPTA 2X5KO 4BO0A 3QIVA 3W8EA 1WVGA 2NVUB 2EG9A 3G49A 1PR9A 4D3FA 3BMOB 3GH3A 2DTEA 3GRPA 3GR6A 3N74A 5FF9A 4XYGA 4IJKA 4N5LA 2SCUA 1WW8A 1ZCJA 4IMRA 5EJ2A 4EUFA 3I52A 3OP4A 1T4BA 4WEOA 2HK9A 1BXGA 4CUKA 3SJUA 3ZNPA 4TZKA 4NR0A 3EGOA 5BSFA 4WGGA 3WTBA 1YBMA 1SB8A 3AOEA 3LLSA 3GMDA 4RVGA 4RLSA 5C37A 2WM3A 3GDOA 4A2CA 1A7KA 2RHRA 4J7CA 2HO5A 3MWDB 4FN4A 1LLCA 2J5QA 2Q1SA 2Y0EA 3PGJA 3E9NA 1FDSA 4H15A 1XELA 2X0RA 3TZKA 3JQBA 1K6JA 4WLNA 3RBZA 3WJ7A 4LCEA 3JQ6A 2IRWA 2AW5A 4OIMA 1GUZA 2VWPA 4BO7A 7MDHA 1WP4A 5L7WA 5JYEA 4GWKA 1TLTA 3DHEA 4NBWA 4DMMA 4R16A 4Z3DA 2VHYA 4PZEA 4MO2A 1E1LA 1XIVA 1GTMA 1DOHA 4PIVA 3GFGA 4E5PA 4L4RA 2O48X 2VZ0A 4XIYA 1NFFA 4PLPA 1GQ2A 1P45A 3DZJA 3NV9A 1DXYA 1K6XA 3RU9A 3ZHZA 4F46A 2ZQYA 4U5QA 5JCJA 3TL3A 2IEBA 3KLMX 1NHGA 4E12A 1Q7CA 2H5LA 2Q1TA 9LDTA 4CM1A 4CV2A 1X1EA 4BO9A 1ZFNA 1MGOA 1YVEI 3AJRA 2NUAA 3D7LA 4XEHA 4O1MA 1YL6A 4P4LA 1VSVA 2BGLA 5EQDA 4UEOA 1YWGO 4ILKA 4IDCA 3DWFA 4S3MA 3U62A 3FBTA 1YL7A 4J1QA 4TVBA 1U1IA 1F8FA 3TZHA 1P1IA 3ETDA 4Q39A 3RKUA 1P1HA 4PG7A 5TT0A 4IQ0A 4CMGA 5L53A 1XGKA 5AYVA 5TNXA 2Y67A 4GH5A 1H0KA 2P4HX 1OOEA 3WS7A 3H3JA 3TFQA 4DQVA 4PG5A 1PZFA 2GYYA 4J4HA 2HJSA 4CV1A 1HEUA 2Q1WA 2AE1A 1KS9A 5ILGA 2WD7B 5ADHA 1SNYA 1LDEA 3DC2A 3QY9A 2HAEA 1MC5A 5F1PA 4A03A 1PZHA 1QYWA 2B4QA 4AJPA 3DAPA 3E9QA 3GLQA 4R68A 5CEEA 2NADA 1ENYA 2C82A 2PK3A 1Y81A 3C3XA 2VQ3A 3V2HA 2YHIB 3L4BC 1GQYA 3MEQA 3NTRA 5ER6A 4L0QA 2WJPA 4IQGA 3DBHA 4BNTA 3RUFA 1T4DA 3HNPA 4HFJA 4HKTA 3PQEA 1HETA 2XXJA 3WTCA 4OXNA 4CR8A 4BNWA 3LK7A 1TT7A 1EFKA 1QSGA 3WXBA 1QLJA 2AG8A 1P3DA 1P0FA 1MC4A 1SBYA 2BI8A 4RORA 1YB1A 3K5PA 2Y0CA 2GZ3A 5AXDA 5TC4A 1NBOA 3GRKA 1W6UA 5L7TA 1ZUD1 4J7XA 5AXAA 4GSKA 1RM3A 1T26A 3OETA 1CYDA 1E3IA 3NAQA 1JLLA 2NU6A 4C7KA 3GZ4A 2X5OA 3JQGA 3OF2A 1VI2A 2RH4A 2C59A 4J90A 3OECA 5JC1A 2C5EA 1GZ4A 4CQLB 3C1AA 3GPIA 4ZA2A 2Q99A 1YBAA 5JNLA 5JPIA 4BNHA 2I76A 2Y0DA 4MINA 4EGFA 3ZWPA 1LRLA 2QYSA 1B2LA 1LLQA 2UAGA 4UUPA 4I1IA 5TS3A 3UKOA 1UP6A 3G1UA 1QYDA 1WDLA 1IYZA 1EEHA 1PEDA 3WIEA 4IXTA 3Q9UA 5CEFA 3V1TC 1VSUA 4J2OA 4RVDA 1U8FO 1E3LA 4QO7A 4NU6A 4OMUA 4JP3A 4YTEA 1R4MB 2NU8A 3T7EA 4MVJP 2Z5LA 2VTEA 4WASA 4B4WA 1V3UA 1X7HA 3TRIA 1LDMA 4KDFA 4YAJA 3WNQA 1ISGA 1MV8A 3IKVA 3GY0A 5FFFA 4YBZA 4KTVE 1DIRA 4WOJA 1UDBA 1PJLA 3AFNA 3LYLA 3P2YA 3WWYA 3RC1A 1LLUA 2G1UA 3B1JA 5KJ1A 2J5RA 2PA3A 1YB4A 4QEDA 3NKLA 4Q3AA 2OFPA 3S8MA 5A04A 4XR9A 4WCFB 4FC7A 2QW8A 5CG1A 4YJFB 3WJAA 4MP3A 4GAEA 4XYLA 5FI5A 3W4JA 1C0IA 1SEPA 1SO8A 4LRTB 5CG2A 3WFIA 1JKFA 3JQGB 3ZHXA 4IS3A 4BO5A 4ND4A 3PLNA 1EDOA 1DJQA 1TT5B 1ARZA 2CVOA 2ZCVA 1KC1A 2DBQA 3JQ9A 3PHJA 4GBJA 5HTOA 3KEOA 3NX4A 4YPOA 4FJ2A 3OEWA 2OL4A 4BGEA 5JY6A 2QG4A 4CM8B 1HDYA 1O9BA 3GGGA 3KOUA 3AOEC 3PHLA 2GCGA 2O3RA 2RAFA 5C5IA 4UUOA 2A9FA 2O7SA 3ITDA 3LZ6A 2B35A 2WEKA 3B6ZA 2Q3EA 3S55A 5G4KA 4EDFA 3O9ZA 3WGOA 1PIWA 4EZBA 3UUWA 1E7QA 3AK4A 2VNSA 3CUKA 4AJ1A 4PLHA 3ZWOA 1U3TA 1FJHA 3VPFA 3WNVA 4CV3A 2GNAA 1T1RA 2ZQZA 1EBUA 2D0IA 4L74A 1PJ2A 3WGYA 1C1XB 1E77A 1E5LA 4ID9A 1LU9A 1JVSA 2JCXA 2Q2WA 2UVDA 3AW9A 3HDQA 4L75A 5HBRA 3ROPA 3QWAA 2WWRA 3ASVA 1GZ6A 3VAZA 2WSBA 2CY0A 2QZ9A 2BFAA 1GY8A 1PJ3A 1GQQA 3P7MA 4AJOA 4OGWA 3ZW9A 4G5HA 4CLDA 4GKBA 1ID1A 4JN6B 2GZ2A 5IN4A 4ZICA 4CMKA 1RYDA 2I99A 2ZYGA 3RUDA 3ZWXA 4MVJF 2EGGA 1U3VA 3IC5A 3HFGA 1H6DA 3ZWCA 3WX0A 4B79A 4PN3A 3RAJA 1FXSA 1N2SA 4QFCA 4BMNA 4BVAA 3LQFA 4WJZA 1YONA 2C07A 1ZXBA 4Z0PA 4NFHA 1LRKA 2Y1EA 2W2KB 2JHFA 3I9KA 3JD0A 2VYVD 1A9YA 3K9QO 4R41A 1R4NA 1DIBA 1PJSA 2B5VA 3A4VA 1HLDA 3LT4A 4II3A 1NTOA 3BHIA 3GNTA 4JJGA 3DZGA 3AOGA 1HE2A 4EYEA 3BMOA 3CE6A 3BTUA 1GD1O 4JGBA 2OBYA 1NPTO 2B0JA 3AI1A 3EY4A 4ALIA 4DRYA 4D0RA 1EUCA 4MP6A 5T64A 2DAPA 2YFQA 1KEVA 2HRBA 3KSDO 2O4UX 5DP2A 5G0SA 4BGIA 4PZCA 1HDXA 3F46A 4JBHA 2X6TA 3PK0A 4A26A 1ISJA 4ZRNA 3ZWAA 3ZW8A 1HL3A 4JCOA 4RCVA 2QQ5A 2O23A 1U7HA 3DOJA 3FNGA 1C0LA 2DQ4A 3PTZA 4XJSA 4CM4A 4PLVA 1A5ZA 3KETA 1D7OA 2LDBA 4JBIA 5FI3A 3SLKA 1HTBA 1HF3A 4NMHA 1HYHA 1KVSA 3DZIA 2CFCA 5CPFA 2YV2A 4GQAA 2CF6A 2V65A 4U7WA 5A9TA 4N5MA 2O3UA 1BXKA 4IXWA 4Q3CA 2PD3A 3IJPA 1ZJYA 2VTDA 4RZHA 3X2EA 3ZNOA 3L9WA 3S1LA 1AHHA 1JTVA 4Q3BA 4OQZA 3EC7A 1OI7A 1YQGA 1GEEA 3OA0A 4BGVA 1HSOA 1ISMA 3AU8A 3HQ4O 2ZYDA 5L4SA 3FWZA 4XYEA 2HMWA 1E3SA 3MOIA 4QXMA 2XF8A 1UXGA 1YGYA 5ILOA 4WCDA 1XHLA 1DJNA 3F3SA 1SB9A 3PJFA 1MLDA 4WUVA 4HY3A 1Q0HA 1LJ8A 4TKLA 3ZV4A 2IE0A 5JAMA 2CF5A 4XYBA 1WMAA 3E8XA 3JQAD 3HSKA 4IBOA 3KM0A 5B4TA 1I2BA 3D0OA 4ND5A 2OP1A 4LGVA 3ONDA 1HE5A 3EVTA 1P77A 3O03A 1NFQA 3JD1A 5KIAA 2Y1FA 2HMSA 3GNSA 2B5WA 3H5NA 1UXIA 3TN7A 4CM9D 1OC4A 4TWRA 3WQSB 5FEUA 3LT0A 2IZZA 1ZK0A 2R00C 3MZ0A 1VKNA 3H3FA 1AGNA 2OHXA 2ZCUA 2NVBA 2WD8A 2HMUA 2XOXA 3RC9A 1YE3A 1MUUA 3C7AA 4ZU3A 1N9GB 1NQOA 1LSSA 4N7RA 4RV9A 5B12A 1E6EA 2NWQA 2JKVA 4ZQFA 5TIIA 3N7UA 3V2GA 4YAIA 2W2KA 3GUCA 4A27A 4E5NA 3VH1A 2GGSA 3QQPA 2C2YA 1U2GA 3ZH2A 1T25A 1KETA 5B37A 4DYDA 2BFMA 3OIGA 1WLYA 3VZPA 2Z95A 4QSMA 2AQIA 1CDOA 3VH3A 2G0TA 3DO5A 2AHRA 1NAHA 1DDOA 1SAYA 2CDCA 3PWKA 1EVYA 2FR8A 4P38A 3W6UA 2VZ8A 4JBGA 5GY7A 4FPXA 3EMKA 1U4OA 1IUKA 2UV8A 1KEUA 4I5DA 3W4KA 3GPDG 1YDWA 2DKNA 3GG2A 1C1XA 3RBVA 2OGUA 1XYGA 5TF4A 4MPDA 2VUUA 4R5MA 4LCJA 4BNLA 4D3DA 3W4IA 5JDIA 4YB8A 5DBGA 1UZNA 4Y67A 4AJJA 3JQ7A 3I3OA 1CEQA 5B4UA 1JA9A 4J2HA 1I33A 3TOXA 3H4VA 2PGDA 1AXGA 3L6DA 4FB5A 1PJBA 3GG9A 2OXIA 4ZQEA 3C1TA 2RIRA 5CAEA 1IZ9A 1L7DA 5AOVA 4ITUA 1IB6A 4Z0HO 3L07A 1P1FA 4NDNE 4RDHA 5HS6A 1DC6A 2VN8A 1CQJA 1JDJA 3R0IA 4D43A 2C0CA 4EITA 1QR6A 5GZ6A 3RD5A 1X0VA 2HDHA 4WLUA 3OFSA 5KJ6A 1BWSA 2DT5A 1XG5A 4NBUA 1Q0QA 3WQQA 2GR9A 2D4AA 2VYNA 4RPHA 1GFSA 1CRWG 3E82A 3DB2A 4GI2A 4CMBA 5C3MA 1ISHA 4NZ9A 3JD3A 3V2UA 1O6ZA 3F47A 1U8XX 1Y8RA 1EK6A 4BNMA 3CIFA 2FP4A 4RQTA 3AM5A 3GC6A 4D45A 4HBGA 4BV8A 6LDHA 2PTGA 2O50A 2DU8A 2GN6A 3HG7A 2X22A 2PZLA 2E82A 4FJ1A 2Q4EA 3MTJA 5GZ1A 3INTA 1V3TA 1Y5MA 2J8ZA 3ZGYA 3GN1A 3FTNA 3Q3CA 2J3JA 5L4LA 3A06A 2E48A 3I1JA 3F4LA 4DPKA 5TX7A 1PJCA 3OM9A 1WDMA 3QWHA 1R4MA 2EHDA 3UFXA 3H5AA 2XPCA 3PZRA 2ZKLA 2AMFA 1ZSVA 4CLRA 4IJUA 3KO8A 2ZATA 4YWJA 3S2FA 1KERA 1PL8A 1GCOA 1ZVMA 4Q3NA 3HZZA 4R5HA 4I5EA 3BHMA 4U6SA 1ORRA 3GHYA 3ZNNA 3QA9A 4CR7A 4JK3A 3OHSX 3R3JA 3PYLA 4XIJA 1E1NA 3H65A 5IZCA 3IOYA 1DLJA 1A4UA 7ADHA 4R1SA 3W1VA 3GVXA 1JKJA 4IM7A 4TQGA 1XR3A 3PIDA 4UVHA 3VKVA 4J6FA 1H5QA 2EW8A 4NU5A 2DFVA 2DM6A 4OHUA 4MKRA 4B3HA 3FPCA 1NVTA 3ZWVA 2UDPA 3NTQA 4PFJA 4EW6A 4WCFA 4J0FA 3DHNA 2PNFA 3UHAA 2QRKA 1NM5A 1VRWA 2RHCA 2GPTA 4WECA 3I9NA 4TMFA 4G81A 5DULA 1OMOA 3RASA 3H5RA 2EGHA 2X5JO 5IZ4A 2BF7A 2RH8A 1N1GA 3ZU2A 3WG9A 2PKQP 2POQX 4BKRA 1A27A 4NJMA 5A3VA 4BV9A 4IIVA 1E7YA 1I10A 2WTBA 1PGOA 3JYNA 4OKIA 4IGFA 4OJNA 4DWVA 3MTGA 1Z7BA 4MVJD 1KVTA 1RKXA 3VZRA 1LC3A 3FBGA 2W4QA 3WGGA 2PWZA 2JCYA 2BD0A 3MJCA 2GASA 2ZK7A 1Z74A 2Z1MA 4XCVA 1EZ4A 3E1KA 4BB6A 4B3JA 4CMAA 5K0ZA 5KWEA 5JXWA 5BNFA 5GZ3A 5HA5A 1KVUA 1QG6A 3LC2O 2CDAA 4CM5A 5IDYA 3VPXA 2QIOA 3WBFA 2O7QA 4E4YA 2JJYA 3PPIA 4OSPA 1ZW1A 1H6BA 3WGHA 2EP5A 3PJGA 3BTOA 3IAHA 2B4TO 5G0WA 4LVCA 3NT4A 3BIOA 3DR3A 1M2WA 3UW3A 2YQ4A 1V8BA 5A9RA 1H6CA 4IJVA 1J6UA 2GLXA 5EERA 1LBEA 2VRBA 2IYOA 1ONNA 1LUAA 4CMCA 2VRCD 4IMPA 1GL3A 2J6IA 1K3TA 3TPCA 2EIHA 3HE3A 1LNQA 1SOVA 4GX0A 2DUWA 3V8BA 3H7AA 1X7DA 2I5PO 3D5TA 2X9VA 4FS3A 4F45A 2X0NA 5IJZA 5L95A 4DIOA 4MVJA 5DCUA 1MX3A 5U4QA 4F3YA 4Y6SA 1YB5A 1UDCA 4FDAA 4ONEA 1LQTA 2P5UA 4W6ZA 3HDHA 1HZZA 1I3MA 4GSLA 3RUHA 2VOEA 1I24A 4IY1A 4ALKA 2V7PA 3U4DA 4IINA 3RU7A 1UAYA 5JAIA 3DFUA 2UUOA 4KQWA 3TF5A 4GVLA 1EMDA 3CTMA 3PFWO 1B14A 4L73A 4R9RA 5LDGA 2X1HA 1Q7BA 3RBXA 3ZHBA 4Y9DA 3GT0A 3PHGA 1Z82A 4NJMB 2TMGA 4WNIA 4CMIB 1C0KA 4UVEA 2ZIZA 4YEDA 3P19A 5DDIP 1DRVA 4E6PA 3MJVA 3AFMA 3G1TA 2B36A 1B8PA 2VZ9A 5G0TA 1B7GO 4XDYA 3DOCA 3M1AA 1YKFA 5IZCC 1IULA 4B7XA 2X23A 3UCEA 4BNVA 3GGPA 1H2BA 3NT2A 4PG6A 3OMLA 4MVJE 3HUDA 3O38A 1NR1A 1BTOA 4FC6A 1GU7A 4IZHA 3S2GA 3QW2A 4ZQBA 3C85A 1Q7GA 4XRGA 4AJ2A 4TROA 5L7YA 4CMEC 2NQTA 3VZQA 2VYVA 1I01A 3GAZA 2YJZA 2HRZA 8LDHA 4CM7A 3DHYA 2P4QA 2FRDA 1W73A 1HT0A 4HX5A 3WB9A 3GZNA 5G4KB 1XEAA 4M86A 3VH2A 1I0ZA 1DFIA 3ONEA 3ICCA 1P0CA 3KYCA 3LU1A 3NT5A 4K28A 4YQZA 1ZSNA 3DBLB 3CZMA 4NFYA 5AXBA 3FRJA 4KDEA 4MJLA 2PR2A 4Z3KA 1WAMA 5EL0A 3IKTA 1K5HA 4PLYA 5IDWA 3PXXA 3DBRA 2AQKA 1AE1A 1Z45A 2WYUA 4CV0A 2AA3A 4JXKA 5GMOA 4YT4A 2CVQA 5EIOA 1OZAA 2HMTA 2GERA 1N7GA 5TLSA 1GYQA 1ULSA 1ZK4A 2I6TA 3GEDA 2EKLA 3U0BA 5A1TA 3Q9NA 1ADBA 3A28A 2GRAA 2BLLA 4CLOB 4ESOA 3OJ0A 4OL9A 1Y8RB 3OJOA 5KJEA 5CHEA 1ML3A 2PKRA 1BDBA 1R4NB 3FI9A 4BO6A 1Y1PA 5TGDA 4MVJH 2PH5A 3KVOA 5U1PA 3OA2A 3SLGA 1D4FA 2V6GA 3HHPA 1IY8A 1QKIA 2BI7A 2DVMA 4TRNA 5AXCA 2VWGA 1UZLA 1VJ0A 4FBGA 1Q1NA 4MIEA 2WDZA 3MWEB 1O5IA 4RVSA 3D64A 4MDHA 4BO3A 3ZWYA 1ADFA 5JAQA 1QXSA 2OZPA 3FPLA 4W82A 3TSCA 4Z9YA 1AUPA 3JYPA 3RC2A 4IJWA 4O59O 5COQA 1ZZEA 3HB4X 5ENDA 2DTDA 1BMDA 2FPPA 3OIFA 1V0JA 1IOLA 4I9NA 4JJFA 1CETA 3B1FA 3BMQB 2JAPA 4WNCA 1M6WA 3JTMA 3VH4A 1ADCA 2R00A 5EPOA 4P4NA 1YOVB 3AUTA 3ANLA 3WYBA 5DBIA 1XLTA 4BKUA 1LC0A 3OH8A 4J1TA 4AFNA 5A5FA 3L6OO 4Y6RA 3F5QA 3BA1A 1YOVA 4UUMA 1L7EA 3QE3A 1GEGA 4ND2A 1N1EA 3TZQA 3RFVA 4L4SA 2DTXA 3RIHA 1Y9AA 4DMLA 3QV1A 3TZCA 1CF2O 5KKAA 1DC4A 1UH5A 3STHA 1P44A 4WLOA 1DRWA 4CUJA 1TB4A 1YXMA 4URFA 4R1TA 2EEZA 2ZTVA 4A5OA 4UVIA 1PS9A 2XAAA 1JU9A 2GF2A 4FGWA 1P1RA 4D46A 4R51A 4E32A 3C8MA 5I8WA 2VWHA 2X4GA 3Q2IA 4BO4A 1HSZA 1GR0A 1EDZA 3WGZA 1PL6A 4EEXA 2GUGA 3JQFA 1HDCA 4DIFA 3HDJA 1D8AA 2FSVA 3PVZA 1P1KA 4JX8A 4TRMA 1T24A 5J23A 4DBZA 4YAEA 1DIAA 3E6AA 1UXHA 3B20A 2O4CA 3VPSA 3IP1A 1P33A 1PS8A 3EZLA 2Y1DA 1C1DB 1MB4A 3JQAA 4WLEA 3CMMA 1WDKA 2I3GA 1PQPA 3TL2A 4AL4A 3TFOA 3PJDA 4O6VA 3RFXA 5F5NA 3D1LA 5I7SA 1WXDA 3WLFA 4B8WA 4O5OA 4ZVVA 4F6CA 4YT5A 2Y1GA 1DHTA 4WOKA 1XWFA 2JCVA 3RFTA 3G0OA 4BNUA 1OAAA 1VJ1A 4OH1A 1I3LA 1JWAB 1X14A 3LSYA 3HJAA 4INAA 4U8GA 5C7OO 2Y1CA 1Y5RA 2JD1A 4JLWA 1ZSYA 3KYCB 4XZ3A 3D3EA 3NYWA 3W8FA 1K0UA 1UJMA 4M54A 3L0DA 1PWZA 2C7VA 4RPJA 1P74A 2JFFA 4XYMA 2NV6A 1T2CA 3RKRA 2HUNA 1TEHA 2VYND 3GQVA 4XQGA 5JO0A 4CLOA 2NLOA 5H81A 3DFZA 4OO3A 1LDYA 4E33A 3CPSA 1KY5A 3MJEA 1EK5A 1ZK3A 3P5SA 3PDUA 3QWBA 3C24A 4AJ4A 3KHUA 4BOYA 3COSA 5JC8A 4YAGA 1TI7A 1T2DA 1F14A 3BTSA 4BNXA 1QYCA 2OOSA 3BHJA 5L9AA 4IQ8A 1X0XA 1EVZA 3EDMA 2J5KA 4J43A 1E7SA 3OBBA 1S7CA 1UXKA 3QHAA 1E6WA 3JQEA 5KCZA 1V9LA 3SJ7A 4E30A 2EXXA 1EVJA 4WLFA 2OMEA 4WE3A 3K2BA 4WKGA 4CODB 1YO6A 4FR5A 5C7IO 1I2CA 2F00A 4R9SA 1A72A 1LDGA 1XCBA 5A3JA 1R0KA 1N8KA 4DREA 4RVUA 3T4EA 4CQMD 3UN1A 4FOOA 1TA4A 3EUWA 3GEMA 4YJGA 3SXPA 1S6YA 3PIIA 1LSJA 3NDJA 2PZJA 1DC5A 3DMTC 4DPLA 3MOGA 4BKPA 4EI2A 2PGLA 3H2ZA 4F6LA 5JYDA 1NFRA 3BTVA 3EK2A 3RUAA 4YVFA 1U5CA 3BMNB 5BNIA 4GVXA 5BR7A 4WEQA 4E5YA 3DEYX 1XU7A 1LI4A 3ICPA 4RQUA 5LCXA 2F1KA 3LT1A 2G82A 1FDVA 1TVEA 3LT2A 4ZJUA 1OFGA 3I9JA 3MCVA 3CMCO 5EESA 1IE3A 3JQ9C 4E2YA 4PVCA 1H94A 3H6KA 4PG4A 2YYYA 3I23A 3KZVA 4G65A 3VC7A 1UXJA 1T2EA 4NQZA 4OOEA 4ZQHA 2Y68A 1LXCA 4YCAA 1O0SA 4KWIA 1LA2A 4XKJA 4IGEA 1SC6A 4EEZA 2JFGA 4J0EA 4TVOA 3A9WA 2AG5A 2IXAA 1N92A 3WSVA 3D4OA 3H9UA 2CSUA 2EERA 1SCUA 4R3WA 2I9PA 2VUSA 1PTJA 4RF2A 3AI3A 2HSDA 4J1NA 2NTNA 2Q45A 2A94A 4FGSA 4XQEA 4XRRA 3KSUA 3GZNB 4TZTA 1E0DA 6ADHA 1F12A 2YQ5A 3GHHA 3FR8A 2W90A 4A10A 2OO5A 1ZKMA 3JYLA 2LDXA 4J4TA 5DZSA 1GYPA 2FOIA 4XGIA 5JE8A 2C29D 2EJVA 2EKQA 1KY4A 2PD4A 3NUGA 4E5KA 3JSAA 4MOWA 5IXSA 5AVOA 3K73O 4NFSA 5TSDA 3ANMA 3JQ8B 3VPGA 3GF4A 1EFLA 1GAEO 5A9SA 4O0LA 1ZEJA 2IYPA 1TT5A 4Z9FA 2J3HA 4WLVA 1NX6A 1O8CA 3DOOA 1B3RA 3Q11A 4UEKA 4XQ9A 2V6BA 3PYXA 3UICA 3IUSA 4HNHA 1ZXLA 4YJFA 1D1TA 3ENKA 3LVFO 5L45A 5JAZA 4B4OA 3SX2A 2CVZA 4D41A 1CQIA 2JHGA 3E18A 4W7HA 1GV0A 3QVOA 3HDYA 2BHLA 5KVQA 5I9MA 4UVGA 5KVCA 1EUDA 3DXFA 3ZU4A 3LF2A 1B26A 3AUAA 2Y99A 1XQ1A 2HKIA 4BNGA 1AHIA 1I8TA
chains in the Genus database with same CATH superfamily
3X1ZA 3MT8A 3FOZA 1MOZA 3O0DA 4DRZA 1U65A 4OQXA 1ZOPA 1KKUA 2DPMA 3EWIA 1DHRA 4TYPA 4AIRA 2JEZA 1A2BA 1L8QA 2JFBA 5T8KC 3WIVA 1DLIA 1FP1D 1LS6A 4Q5IA 4XX0A 5FKJA 4CLXA 2AQ8A 4R9VA 5F1KA 5BWNA 2Y1OA 5EPEA 1DAFA 2XRMA 1ZGCA 3EDRA 3OAAA 5DHPA 2VPWA 2NU8B 1Z25A 1ZUNB 1CB7A 2H1IA 4DQLA 1W5EA 2YXDA 3UMYA 5IXJA 2H2HA 1G16A 1WSWA 4JQYA 3K0SA 4OUKX 3ST7A 2B37A 3BSWA 4L07A 4CM3A 2WM2A 4C3OB 4HO1X 2BELA 4UE6A 2YXPX 1RAEA 3L79A 1AKYA 1FDWA 3S2EA 3WOVA 4FFLA 2SKCA 1E1CA 3WDMA 2R6HA 1M10A 3KVNA 1TMGE 1Z73A 2PH7A 5K9ZA 3WGNA 3EIHA 2NACA 2ZBFA 4BEVA 2WLTA 5LP1A 5F2NA 2IDZA 3VU0A 3HKDB 2TYSB 1P7PA 3OQ1A 4ZDJA 5LZ9A 2IZ1A 4P8RA 1E5VA 5CHYA 4CNBA 3IBCA 3KAKA 1DRKA 2RHWA 3KXIA 3N0RA 4M55A 4QGBA 4BLUA 3JYOA 4C2TA 3BJEA 2ZRFA 5F4BA 2REQA 3MYYA 1PGNA 4LI0A 4CKWB 5JBQA 2W42A 1ZITA 5ES3A 3WLRA 3TLJA 4I9UA 4RD1A 2PFSA 5EHQA 3W2TA 1DBQA 1G6HA 1KL7A 1N2CA 1P5JA 1GA6A 2B99A 1BKSB 1NE7A 3E9CA 3GRYA 4D6YA 2C4HA 1ZI8A 1R0ZA 3LUCA 1QOQB 3ODGA 1V2GA 3OY7A 1YRLA 2I4NA 2V55B 1S8FA 3H1EA 3DBHB 1LRJA 4QOGA 4YH1A 5HKLA 3WWZA 1RMTA 2KW5A 4FI3F 1LPNA 2RBGA 1F0PA 4X1YA 1DIGA 4X8OA 1K7YA 1TYCA 2XMDA 2BUCA 4PRYA 2HCTA 3RROA 3PKJA 2PZKA 3KEMA 3RVNA 3SQLA 1NU8A 3KLOA 2W6QA 3IX7A 4MP8A 1HDZA 5ER9A 2V7GA 3ZV3A 3OZGA 4HWRA 1WSBA 2WZCA 1RE1A 2X58A 4KWEA 3R7WA 4PZDA 4RFLA 4ZK2A 1ZIDA 4U00A 3B3JA 4BCDA 1C9KA 3HYCA 2QTLA 1SUPA 2ZPUA 3PEUA 1GPYA 3RVDA 2GLUA 1EQAA 1L5FA 5AVRA 3G79A 3PCRB 3MTEA 4U2KA 2EZUA 1P91A 5EI5A 4DIBA 3W9BA 4Q1AA 2W7TA 1U8AA 4MGZR 5BN4B 1HFJA 1IQPA 2Z56A 4TSFA 4DCTA 2MIIA 4K46A 2EF1A 4OHKA 3PBKA 4ZYXA 2FW9A 5KVSA 5ALLA 3RTAA 4MUEA 1YZNA 1KI1A 4G0XA 5MHTA 3GU3A 1MNAA 4FR0A 4DILA 4KVFA 1E2FA 3VO2A 1Y5LA 4FE7A 4YCSA 3OSUA 3OZ7A 1RYHA 2YC4C 4C0LA 2BLNA 1SXGA 9ABPA 3L40A 2DHRA 3PFIA 4Z8XA 1Z7EA 4IIXA 4DM7A 2AQHA 4L9SA 1IM2A 1AQ6A 5AFSA 1UPAA 1ZOLA 3DMYA 1QIGA 5KTMA 1ZLXA 1YF3A 3TZEA 3JALA 3PTAA 3I0NA 4BO2A 5CCXA 1UANA 2O0JA 3DOFA 2R6JA 2HMVA 4MUBA 1GL6A 2XUJA 1UPXA 4ZT2A 4P33A 5U4XA 4KKXB 4Z4CA 4DEVA 1N2CB 5G02A 3VDRA 1V26A 4DZTA 4KW7A 3QYAA 4Z4FA 1R8SA 4D9BA 1CULC 2J3EA 3PXBA 4RC9A 3BGWA 2VBFA 1UP7A 4G2NA 4W5TA 3O82A 1R5BA 1XWWA 1WABA 1ZJJA 4FT2A 4DV6B 4D1YA 2EBWA 3HN7A 2D2IA 2VH1A 4X90A 1KI7A 5A5VA 1J1IA 3DL2A 3IQHX 4X3OA 3RFFA 3A0RB 4HGNA 3K1YA 1H4VB 2A92A 5EWLB 4G4JA 4ZD6A 3QE2A 1UQRA 2AD5A 3DR5A 5E4TA 3NHZA 4H6VA 4MKXA 3A1NA 5C52B 2HRDA 3Q41A 1C2YA 3CSSA 4JUDX 3WMGA 2GZHA 1GO2A 1YQWA 2UZAA 2I7DA 1KI9A 5CM9C 4LZPA 3LPNA 2ZWMA 4C0AC 4E5UA 2WHXA 2O3QA 2XMZA 1HWYA 2Z8ZA 4Q15A 1NI5A 3M2PA 4H3VA 4IFEA 4B4DA 5KYYA 3GDFA 3QJ5A 5SY4A 2VDNB 3IUNA 2O5VA 4LNUA 5JAPA 3Q6IA 3U5TA 4P5EA 4EHLA 5B7QA 1EXWA 1MEJA 2GHTA 1Y8ZA 3TLGB 1QYVA 3VZDA 1R4ZA 3U4AA 4DTIA 1T4CA 2QVLA 3BPSA 2R66A 4NDAA 2Y2VA 1IN7A 2VL7A 2P75A 4XGKA 1U5AA 3P5BA 2HLPA 4YCLA 3DTTA 4II7A 1FC0A 3K8ZA 4X20A 5FTKA 3W5JA 3IAM1 5BV0A 5IJ0A 4QGSA 1WL8A 2P30A 5C8VA 2H2WA 3G8BA 1CP2A 1FNBA 2R4TA 3SKXA 1FK8A 1V6AA 2P69A 3K9HA 2HSJA 3KPUA 4NZMA 3HGTA 5EE1A 3ZDFA 2PUEA 4F2DA 1L5ZA 2GBLA 3G2QA 3PFBA 3L7LA 4LDJA 1BQEA 1H1LB 2VAVA 2XUZA 4FFVA 1PFQA 2GM4A 1XTKA 3LQ4A 4BLOA 3OICA 5BT9A 2O2XA 2J9FA 4NH4A 5DGDA 3W79A 3QPAA 2OD7A 1XQ6A 3ZU3A 1OC2A 1SC4A 2QTGA 2D7DA 3K6SB 1K98A 1BOOA 3MCUA 3R8FA 5HFJA 2GZMA 2F3PA 3IALA 2VNKA 3QE0A 2PL3A 3UYLA 3BH7A 3TW6A 2V6FA 4C89A 2ONZA 2KWIA 5ES4B 4C01A 4CEIA 1KK3A 3QEKA 1L3CA 4I8DA 4QX6A 1BMFD 1OT3A 1KDVA 4R31A 1DZ3A 2RHMA 2CLHB 3WSWA 2XH8A 4GWGA 4B6EA 5KNBD 1PSDA 1O96A 4JHXA 1E9BA 2OUIA 4IO1A 1P9OA 3GUUA 4IWYA 3RS5A 3SXJA 1JQDA 4ZEMA 5AUNB 4BZPA 2YYSA 4G0WA 3PTLA 4D9JA 4DJAA 2C94A 4TXHA 3TGPA 1I94B 3F4BA 1V35A 2R7NA 3R41A 2XMRA 5F12A 3ZCUA 5TY0A 1N5JA 2ASVA 1U0OC 1TADA 4PRZA 4RLQA 4K6OA 4TVKA 1NVMB 4AG3A 2HF7A 5A05A 3S44A 4D80A 4DR5B 1M74A 1ILEA 1ZK1A 4HXYA 5AQEA 1KORA 1WCYA 2VCYA 3ZCQA 3T9DA 1ZPDA 5JASA 5LMNB 2H00A 2QAJA 3GXOA 2QVYX 1L1FA 2N1MA 5CNIA 4IIFA 4DC1A 5JRDS 1UM9B 3NATA 4MR9B 4L4XA 3RYHB 4UVDA 3RC7A 4DXAA 2BUAA 3ITNA 4K6FA 1KY3A 2EV9A 3OOEA 4XFKA 1SHJA 1Z0FA 1Q15A 4FFMA 1PQUA 4NV0A 5IFKA 3O5AA 1Z83A 1W0KD 5J47A 2DWUA 2M6RA 1EFVA 2QJOA 3K09A 4MYUA 5KYUA 3VYTB 1APBA 5IWAB 4NBNA 2L42A 4BYMA 1FP4B 5EHGA 5JJLA 3GCWA 2GETA 4C5CA 4D25A 3HDTA 3I9V1 2BGTA 4GBMA 2ZTLA 4COKA 2NUTA 5JCXA 3QHQA 4IF4A 5JDCC 1UK7A 1QK3A 1OXBB 4MVCA 2GBIA 5DK6A 2WD9A 3OU7A 3T3NA 2AI1A 3EYAA 2YZ2A 4FP9A 3Q0EA 2W48A 1WD5A 3TAUA 3F73A 1U7WA 3NHRA 3L0CA 2PAFA 4TYWA 3GLSA 4ZEVA 4B09A 5BW6B 3WB0A 3AYXB 3WAJA 4RTOA 2JI8A 1B6TA 1X9GA 5TV2A 2WIBA 2GFHA 3UOGA 2H06A 1IWOA 3EPPA 4D79A 2ETXA 2Z8XA 2IP2A 4KTTE 4RY0A 5GONA 5J2TF 3MIIA 4NYIR 3V1YA 4ENQA 1D2GA 4BNFA 1VPWA 1XZDA 1E20A 3QTLA 3VOSA 1UUFA 3ADBA 1SXJC 4GNKA 1ID8A 3VR3D 2QYTA 4E2WA 2RHGB 2CL7X 3DP9A 4RK6A 4EYQA 3DZHA 5SYNA 8ADHA 3QUCA 1JEQA 1F51E 4Y1RA 3I92A 4CI0B 5C46F 4KJXA 3LP8A 3OX4A 1CSEE 2PMWB 1UPCA 2FFBA 2Y0PA 4QQRA 5LYYA 4K40A 4A2PA 1FFYA 2IXBA 4M1YA 1T8UA 2EJWA 4MUKA 3TLEA 5LQRA 4G01B 3CX8A 3O6VA 3OQHA 4K6KA 1QPZA 1T0UA 2D3WA 3TX6A 2EARA 2ZB3A 3TLCA 4CKCA 2AC7A 1YR6A 4UCWA 4LJ6A 1B0PA 3L0OA 4KX5A 3WR5A 4XXHA 2BTQA 1U3FA 1MFZA 1VBNA 4TSKA 5C8DA 1V9CA 3PA8A 1HE4A 2BFBB 3SBXA 1E32A 3GFPA 4GC9A 3RV4A 1ZIXA 4E5MA 4ER6A 4D4JA 3EBOA 1R1DA 5AW1A 3EISA 2CZCA 4GLJA 2ZP1A 3MG9A 4LVUA 5ED0A 1Z8NA 3ESZA 1U99A 2OWDA 3HV0A 4LHEA 3U4CA 4EPRA 1BN7A 4I46A 4LC9A 4URYR 2X9QA 1XRMA 1ZKDA 3HS3A 3L6EA 4GMXA 2P1DA 1THMA 3HH8A 5F4ZA 1O6FA 3T61A 3MVEA 3TQHA 1NJFA 1EX7A 3H84A 5ENVA 2I6UA 4F6RB 2FUNB 3HY3A 3W5CA 3EFHA 1HNXB 3ZDXB 3NHYA 3G0GA 2YL2A 1YRQA 2G71A 2HY7A 2C5AA 1V7CA 1GKLA 1U8YA 3WYGA 3N7TA 1V5EA 4I8IA 2IZOA 2Q7DA 3WLIA 5CB6A 3ZZNA 4FD2A 1YS9A 1RHJA 5BSVA 1WQ4A 4KXVA 1O97D 1NPDA 2A84A 1FS6A 3S40A 3SIWA 3UAVA 4OAOA 3ABIA 4FIZA 1NQ5A 3THWB 1QFYA 1VYTA 4IIEA 1Z6ZA 1KVRA 1WNTA 4P3NA 3ZY4A 5CU7A 4LYJA 4D42A 3DYBA 1JXAA 3MS4A 1W4LA 1WV1A 1ZICA 5I9BA 1A77A 4C08A 1LFAA 1YR1A 4A0GA 3KRTA 3A14A 3F5SA 2E49A 1HOXA 1TXGA 3BE5A 3GUZA 1E79A 4MPJA 2GQ0A 2Q4OA 2YXLA 3HEBA 2B92A 3VHXB 2CUNA 4X65B 3GUVA 1CRQA 1KO4A 2ENUA 3NETA 4G4GA 2BJWA 4PR3A 3REGA 1DU4A 3UMVA 5HWSA 3ANSA 3ZNQA 1K7XB 4QXOA 4QTZA 4WZAB 3G9QA 2C8VA 5CDUA 1CZNA 2V9ZA 4EJMA 5F7XA 1NDUA 3SSAA 1EB9A 4OQPA 1LCIA 1G8HA 2CKDA 1NI4A 1Z16A 4FFNA 4PRLA 3UIEA 2JAHA 4UDNA 2VP9A 5F35A 1K0FA 1FFCA 2R4UA 3HUFA 4C3UA 2GN8A 4DBVO 4EO7A 5ALPA 3JQ7B 1KFEB 1XNGA 1RI4A 4BKOA 1NP3A 7REQB 1GGKA 1RM4A 4KEAA 5FTMA 1GKUB 1AF7A 3PD0A 1JSCA 2PKQO 3OCVA 5CJ2A 3RF6A 3V8RA 4CR6A 3OOJA 3NDRA 3TQQA 4PGFA 1D5CA 2PZFA 3H9EO 4BS9A 4ZI7B 5DN6A 5DN9A 2PNJA 3IP6A 1LEHA 4JJZA 4REOA 5KVVA 3C3WA 3QI7A 2VLIA 1B16A 1EFHA 2A4KA 3WL5A 3KJIA 4OQNA 4BAUA 3TLZA 3A2KA 2FPIA 3SBOA 1WO8A 1Y0BA 4E6EA 5AW0A 3EGCA 2AOUB 1CF9A 2HK8A 3PNBA 3Q7EA 3T95A 2E21A 4LF7B 1UJ4A 3AWDA 5I5EA 3W5BA 4HYEA 1RYEA 2CLLB 2ZIEA 4O2BF 1UM8A 2IEDA 1ZNXA 1YR2A 2SHKA 1D4AA 5A4DA 3CH6A 1UKEA 2WSLA 2VKQA 1WCIA 1MG0A 1JAIA 2OV8A 1EXDA 3AY6A 5E4FA 3TGLA 2GBGA 2YRXA 2ZUFA 2FZEA 1TF2A 1GTJ1 2H51A 4YJKA 5AKEA 1XL1A 2WU4A 5FV7A 1QAOA 4JT4A 2P91A 1Z5GA 5TF0A 4LDQA 1UR5A 2OYRA 2Q6OA 3CE9A 1V43A 1DFGA 4AN4A 3OESA 2PX6A 2W6ID 3K2QA 3M0EA 3HL4A 3ZIUA 1MXHA 3ZHRA 1QORA 5C5CA 2BBWA 4BEWA 4ZOLA 2JGRA 3ZZ0A 3H1PA 4O1HA 1D9ZA 1NMQA 3M34A 2YCLA 1XD9A 2DLDA 2VHTA 2NO0A 4NECA 1TZMA 1YRBA 1V95A 3QWIA 3DAYA 3ND8A 4I50A 5D3QA 4TL8A 4DCOA 3IPAA 1FVXA 1EFPB 3RI3A 5BN3B 1DUIA 1CDZA 1GV1A 2CVFA 7GPBA 4WI1A 4QVIA 4UXJA 3T0GA 5ALTA 4X3PA 3KSAC 2H65A 5DNYB 5AJHA 5DEOA 2HJHA 4ARUA 4R0MA 2GF9A 2OGWA 1QV6A 5FNVA 3SDBA 5LKAA 2NU9B 1STOA 4U3JA 5AHWA 1E9SA 1SOMA 1KWGA 4C3ZA 4TN5A 4D9CA 3G8DA 4DIEA 4F4FA 5JLJA 5DIFA 4KQCA 5FWDA 2VT2A 4ZEWA 2VOJA 3I1IA 4I3FA 4RF3A 2WUDA 3I72A 4ZMBA 3ZXUB 1IQRA 4Y6QA 2WSSA 5TPZD 5I7EA 3JQBC 5DOZA 3JU3A 4JLDA 3GVCA 4TKUA 5LSAA 1NY6A 1C7RA 1RD4A 1C0PA 4NX2A 5DBFA 3WO0A 3BMCA 5AW4A 2E18A 3L6CA 2XUPA 3EVDA 1SCJA 1B1AA 4AXBA 5DNDA 1XDDA 1G8KA 4MVJM 5COBA 1XVIA 3Q2KA 3IHTA 1EUDB 1HPLA 1E2LA 1PQYA 2QUKA 2DUUA 2QXTA 3EWNA 3IH5A 4QU5A 4NYJQ 5EY5B 3VNAA 5AM2A 2IS1A 5TJHA 4BB5A 1CHDA 4UBMA 4X41A 2OLJA 3F7TA 1F8XA 2I7TA 3FMFA 1QJ4A 5DO9A 1IK6A 4AJLA 3RHZA 5G41A 1BROA 3I8SA 2CLFB 2LPMA 3O1IC 2XUQA 4B6PA 4YA6A 1M1XB 1PZXA 3C6BA 3GT7A 4A73A 4KRFA 3PEEA 3AVYA 2AXQA 4FGJA 1C9DB 1C8BA 3OE1A 2DQYA 3D7SA 1E1MA 5DSZA 4YLYA 3I83A 4HZUB 3UA3A 3K30A 2VSNA 1US8A 4XDHA 4U4AA 4DJJA 5AUQA 3JD2A 4YR9A 2PLAA 3H16A 1G8YA 2FWIA 1NM5C 3GLHB 3Q72A 1OI4A 4I6EA 4CNQA 4JQOA 3ABRB 3QPCA 4UUNA 4ZGGA 1TEXA 3VHRA 1Y42X 4EARA 1W1WA 2P2NA 3AT1A 2DUMA 1I4EB 2ANBA 4IZIA 4UHHA 3ZGVA 4NV1A 3P2IA 4X44A 2OAP1 3F6YA 1VYVA 1DAPA 1XMOB 3SMVA 2X9GA 1OD6A 1XQVA 2MYPA 1QTIA 1HXHA 1ZZGA 2IDJA 5F33A 3RRJA 2HLHA 3RYIB 4Y6GB 4F7WA 3GJ8A 1Z38A 3W7AA 5IG2A 3KSBC 3LQ2A 1UAAA 4N3BA 3ZJVA 1NF9A 4LEIA 1SBCA 4A82A 2YJ3A 1I3KA 1RAIA 3BULA 2X4DA 3JWPA 4Y6PA 1E2EA 1AK9A 2W2LA 3FN4A 4Q00A 4YQYA 3UF0A 3X1KA 4G1CA 4LOAA 4TXMA 1GZHB 1JH8A 2W6NA 4LQDA 3V4RA 2Q5FA 2VWQA 1YK0A 3WZMA 1T29A 1GUYA 1WMBA 3CW8X 2F6RA 3GIDA 4PPGA 4YJGB 1CS0B 2FZVA 1BGVA 3ZY3A 3OM8A 4UHBA 1UJ6A 4JXXA 3ICQB 2W2XA 4LFCB 1I1NA 2EHJA 3WAGA 4UM9D 3A1VA 4BMVA 3JCZA 2I3AA 4AAYA 1GGFA 3AINA 3M2TA 3Q0TA 3WKBA 4NG4A 4F60A 1C3JA 2WYHA 1IJFA 1RWNA 2Z1NA 4DAEA 2A78A 1T6NA 4RHUA 1M6EX 3OPYI 2HA4A 3O47A 1PT7A 4R40A 1W94A 1E6LA 2DPGA 1XD8A 4W5WA 4P82A 3RNLA 3PU6A 3ZKAA 2VDJA 1JDBC 2A0WA 2O3JA 1ZRHA 1I2ZA 3WA6A 4CL8A 4EVRA 1C7FA 1IZ0A 3WDKA 4ZHSA 5JMOA 1XQ9A 2Q3CA 3SEQA 3WO1A 4DVJA 2AZTA 3WGJA 5C51B 2IOHA 4DUPA 3VU8A 4UDOA 1JVBA 1WPQA 2J6CA 2WIJA 2WPNA 4KREA 3GFBA 2VHZA 1CR6A 1MXFA 4NBVA 1W48A 5HPYB 4FSDA 4N03A 1OIXA 4OXKA 3L9XA 2WVJA 3LPLA 4MMZB 521PA 3PT9A 1T34A 2JA1A 3VO1A 4AZ3B 1CW2B 3DFFA 3HR8A 4EL5A 4YJ2B 2FKNA 1G5TA 3K2EA 2PFGA 2A7XA 4US2R 3JQDA 3I5MA 4ISBA 1MVNA 3W90A 2ZUWA 4C4RA 4U7GA 5HR5A 4J9VA 4Z9AA 4BKQA 1I4OA 3KB6A 1JDPA 2Q6VA 3AY7A 4AZSA 4EA9A 5B6IA 1NR5A 5HQ3A 5JZSA 4EO4A 5C32A 1UMKA 1ICEA 4IUBS 4LNAA 4ZGWA 5JFOA 2GJKA 1TC1A 3TBHA 5LYJF 4OK6A 3FR7A 4QSHA 2ZJ4A 1C8VB 2HF9A 3D6FA 1AQLA 2ZT8A 2BR5A 3FROA 3M6LA 3A1UA 5DB4A 4RTMA 4HVAA 2R87A 4L8WB 3S2UA 4D57A 2ZR8A 3ELYA 2QTZA 4LXGA 5T4HA 1KDRA 1U0GA 3AY3A 3E0XA 3O8DA 3FM9A 2FJPA 2AEFA 2IPXA 2R1VA 3ESQA 5A7FA 1IH8A 2PS1A 1HH4A 4WXYB 4ZHQA 3N3AC 1VLMA 2W00A 1Y3HA 2ZU0C 4FFPA 4Q9KA 1QIFA 4B47A 3W2EA 3GRZA 4UFPA 3NTXA 4ZVOA 5KOJB 1TEZA 1S96A 4DLNA 1IMJA 1FJ2A 2DHQA 3QPVA 4UNIA 3CISA 3R7BA 5HS4A 4D9EA 2HA3A 1JBKA 1DADA 1L7AA 4I1SA 5DGIA 3NGLA 4I50B 3AVXA 4P80A 4MCJA 3K1AB 1K8XB 3NORA 4IX1A 3T4XA 1W4ZA 3OE7D 3FD8A 1OZHA 2BGKA 4K87A 5FL7A 2ZUUA 5JFGA 3ED1A 2E5FA 2O2DA 3PQ2A 1GG9A 4MARA 1ZNYA 1GNLA 3PVSA 3GZJA 5HF8A 3DLAA 2ZZKA 1R15A 1Z29A 4E03A 1CFJA 4PQRA 2QP4A 1V41E 2WSYB 1Z08A 5KI6A 3K31A 1DV1A 2DBVO 3QPWA 2GF0A 4QNMA 4DC0A 4L3WA 4LV5B 4PCLA 3VA7A 3ORRA 1O03A 2H52A 2W58A 2DR2A 1JW9B 2IYUA 1NUQA 4JY7A 1Z75A 3OKFA 4KMRA 3TZ6A 1EIWA 4DPMA 2HPVA 3U4QB 5KTYA 3HKCB 2WOOA 4X85A 1L9XA 1VL0A 1AM4D 1XCGB 3QPBA 3ZX4A 1PTJC 1IONA 1E9DA 1F7UA 1FA9A 3BS4A 3OO0A 2DEUA 4I5GA 1U0RA 3LBHA 2CL5A 4AXXA 4D5GA 5CFZA 3HBNA 3EOBI 4J3FA 4XGQA 1NBMA 3O26A 1JDUA 4P0TA 3SAJA 1A76A 1MP0A 4G1BA 4LZJA 1IXRC 2BH2A 1NVAA 2OK8A 3HUUA 4OAQA 1LTKA 1T3TA 3GCZA 3IT1A 5E9AA 3TWOA 1UIMA 1SGWA 2OQVA 3O1LA 2H2GA 3QVWA 1D0IA 3P2JA 5LLDA 2XZOA 2CXRA 2H63A 2C2BA 2WT4A 5H82A 4PX3A 3LQQA 4BRUA 1PK7A 2YWRA 5JI3E 3IEMA 2OCDA 3DEJA 2O54A 1PGQA 1A5SB 1V7QA 2AJ8A 4W99A 4D4KA 1UINA 4MJ7A 1QIIA 3RCBA 2J31A 1J8FA 3IL2A 4NLLA 3MBOA 1G5HA 1VMAA 1JZSA 4JUIA 3QG5A 1LNZA 3GN2A 1KTVA 1QE3A 1EJ0A 2C7GA 3R5XA 5DNEA 1R9NA 2RB5A 3KP1A 3CM0A 4IIDA 5K5EA 4X5OA 2A9PA 3T5BA 1X70A 1G59A 4DQDA 1G9XA 2X77A 3VYUB 3GQBB 4D7AA 4F2WA 1V6SA 4IJQA 5AKJA 2XTZA 3IV9A 2NMVA 2N42A 4FW8A 3SGLA 1BXRB 1K63A 4XPIA 3BSFA 5HDQA 3LGAA 4DDTA 4Q3EA 3B70A 3A27A 1ZVJA 5JANA 2YZKA 1L4BA 1P8JA 1Y9ZA 2XB9A 1NWCA 3D1VA 1R0LA 3ITKA 4NZNA 4EUKA 5K2OA 1EWRA 3EN0A 1T43A 2X13A 4C6HA 2FZGA 2QDKA 3IKLA 2I55A 4IH4A 1LQUA 1L5RA 1KP9A 4RA9A 1U04A 2FSGA 2Z8YM 1Y1RA 3VO9A 1IPHA 1W76A 3ROKA 4POAA 1QHEA 3EXG1 2EYUA 3L1JA 1EAMA 4I5FA 4XX1A 3RH0A 1PHRA 3NM6B 1RXEA 1QVVA 1EA5A 1W85A 2BE7A 1FNCA 4RFSB 1XJ5A 1W49A 2HUPA 1GPWB 3A37A 1BHSA 4YACA 1NRIA 1VG8A 1KVQA 4DQUA 4K9DA 2XMSA 3HCBA 2OVBA 2BFPA 2O3SA 4QHSA 5CNKA 3DTVA 1SG0A 4NS4A 4AKEA 3TR0A 2CV1A 3BBPA 1W5SA 1CQIB 1TYAE 2QMUA 2OD9A 1I0IA 3O8QA 4G5OA 1PVDA 4YJ2F 3QUSA 1NAIA 5ERXA 5IVIA 3RS2A 4F71A 4TSFD 3RNOA 3GW8A 2I9KA 4DOMA 3ANNA 3FNEA 3AM3A 1DNPA 1B23P 1PFGA 1C29B 1J7KA 3PA6A 3FF4A 4CCYA 1QH1A 1XEXB 2CUZA 3HEMA 5I9NA 3G5UA 5JVDB 3IJRA 3UGTA 1Y8QB 5JCJD 5EZYB 3CG4A 1WWKA 3D6AA 3HCDA 4R69A 4Z7JA 4DNFA 5ILQA 2FRXA 3SN6A 3NUQA 4MDEA 1H6AA 1XZAA 1W4BA 2QQFA 1NYRA 4XQ0A 4PSDA 3BB3A 2UUPA 1CUJA 1PAUA 4KR6A 1RLIA 2A5DA 4I9HA 5IUKC 5J4HA 3I01A 3VPDA 1NKTA 4RLFA 2R751 3I2HA 1NZFA 3IHWA 1MRSA 4L9RA 4ZC8A 1EBBA 3DLIA 1AQIA 2YBEA 4QHYA 4RU1A 1DFHA 4E1BA 1QM5A 4AO6A 2FR0A 4EBBA 4QULA 3MJSA 2Y9PB 1ZMTA 3T0IA 1C7ZA 1ZCAA 2F4VB 3TMYA 4D6XA 4CQNA 2J9XB 3OLWA 3L18A 3IT2A 4PNZA 5AWFC 4RJIA 3DO8A 1SQ5A 2V5AA 4I50F 4OLJA 2PKWA 3TM5A 5CCEA 3RLFA 1GZ5A 3FYCA 1HYEA 4Z0NA 4PYJA 3CZ4A 4MRPA 2AT1A 5ICMA 3I1YA 4KPUB 4M0LA 4P22A 4CM4B 4P4SB 2AKEA 2G09A 3WNDA 5ECWA 5E3IA 3GEHA 4O3FA 2PV7A 1IN4A 1XVUA 4IJ5A 1R50A 3SKVA 5GP1A 1DRUA 2H07A 4TLMB 5JJCA 2GRJA 1SWWA 4HMQA 2BM1A 5IVHA 4C5BA 2A7QA 3GI1A 3QBJA 4HX2A 3DQPA 4MWDA 1T5IA 1TUBA 2UVQA 3HB1A 3IXLA 4L6IA 4UTRA 2F1JA 1QKKA 4OJQA 4FWIB 3WA7A 1PWYE 3NLLA 2OBXA 1YU6A 4M1WA 4HLNA 1SXHA 1PR9A 3BWCA 3BMOB 1QZ3A 1XRRA 3B51X 3GR6A 4DHEA 4ZVMA 4IJKA 4Q24A 3FLEA 3IT3A 4FLFA 4IMRA 1KGSA 4KN9S 1A04A 4EX6A 5CA1F 2QK4A 3UMCA 5IKEA 1BXGA 1KAQA 2QBYA 4NV3A 1QUEA 3SJUA 4JVNA 3AX6A 1Q17A 4NBSA 1ULHA 4P31A 3KR0A 6ABPA 3LLMA 5BSFA 2OV3A 2IKSA 3LLSA 3MCWA 2NZVG 3PKIA 4TXNA 4DUGA 5KOHA 4BHTA 4EG5A 1QB7A 4CCSA 4JLPA 1M54A 4U7FA 4BMXA 3RG2A 1W9HA 3RIGA 2J5QA 4F38A 1NE2A 1HE8B 4DG5A 3PGJA 3U7QB 1WEHA 3A9SA 4FEEA 2Q6TA 4DV4B 2Z1DA 4G5YA 1U0JA 3D6MA 3UT5A 1Q84A 5ALYA 4C4XA 3TZKA 5FJIA 3NOXA 3AUKA 3WJ7A 4LCEA 3R23A 2XMGA 1GVNB 2FR8C 4LC1A 4RVNA 5B2FA 5KDLA 5E2BA 4XWKA 2XBUA 3R24A 3GJZA 4K9KA 4BO7A 1C2TA 1KZHA 3G13A 4BJ6A 4HNAA 3TSZA 3ZX5A 5JYEA 1CS0A 2IHBA 1RZUA 4BASA 3A2NA 2VZEA 4DIDA 4EMBA 1L5VA 4F72A 4M9XA 5KNCH 2D1FA 3ND9A 3LYAA 1U0LA 4Z3DA 4BO1A 2VHYA 4PZEA 3ZUPA 3H18A 2MCFA 1AKMA 3DPIA 1AGYA 3SLRA 1VKZA 1YUBA 1U8ZA 1T2NA 4M3NA 4V2IA 1EFAA 4F3NA 1KMCA 1GQ2A 1P45A 1FTQA 1SXJA 1DXYA 2Y92A 1V45E 4F46A 4U5QA 3KUDA 3OIUA 2OCKA 5JZVA 2YXEA 4KITB 1RYFA 2Q1TA 4BZXA 4CV2A 3UV7A 3CVWA 4RE5A 1MGOA 4J29A 4PPFA 3SYNA 4OIFA 2GN0A 5FPSA 4NENA 2K5UA 3Q87B 2OPBA 3M4NA 1YL6A 5ALQA 1Q83A 4MS3A 1ZIYA 1NV9A 1VPEA 2BCGY 2WAYA 1TKAA 3OFND 5IKPA 4HAZA 3E70C 4RIEA 4AM8A 4CIXA 2NO1A 2WPDA 4R83A 3D9QX 3OVMA 3ROXA 1YAHA 2O9JA 5FD8A 4RTJA 2TSYB 1IUOA 4J1QA 4AYTA 3JR7A 2Q3MA 4JU8A 2ZM6B 1OH6A 2J45A 1II0A 1U1IA 5FBZA 3TLGA 4EA6A 4DDHA 3RAFC 3H4TA 4NCIA 1FS4A 1Z36A 2YYZA 4IMJB 1G7SA 3ER6A 2FCAA 1QHSA 1IQUA 5AYVA 5TNXA 5JXIA 5K3OA 3B1YA 2Y67A 3FYUB 4GH5A 2P4HX 2Z3ZA 3KXPA 3WS7A 2FWJA 3JASB 1HDEA 1MOPA 1S3GA 4CIYA 4MULA 4QT4A 3FUTA 1HEUA 3IPXA 2Q1WA 4YWHA 2GS9A 2GYWA 5ADHA 2FW1A 3RRFA 3W05A 3VVMA 4EKEA 2I3BA 3DC2A 3L92A 1MZVA 1PEYA 3FVWA 4OJTA 5F51A 3UT6A 3KJQA 1U8CB 4A03A 4EG3A 1OPRA 1OHHD 2WIDA 3WHPA 4DDMA 4ETMA 3COZA 5K7SA 3NMUF 1BS2A 4AJPA 4C6RA 4QLBA 2G1KA 5CEEA 3D0KA 3TKLA 2NADA 3HJUA 5K1ZA 1A7UA 1NBEA 4FHGA 3DLTA 1AUVA 2VCEA 3QU7A 4CEHA 2YHIB 2H7CA 1RWKA 3VR3A 2W6JA 3CLUD 3WGLA 4IQGA 1E0SA 4ZVSA 1XV5A 3HNPA 4HKTA 2H48A 2XXJA 1TYDE 1SXIA 1EFKA 1I6LA 2AG8A 3EGDB 4B6QA 4JJ6A 1JA0A 4HUQB 2JK0A 2A9VA 3JALB 3LGSA 4LTNA 2E89A 1MC4A 3A1WA 4XPZA 2V7VA 1ZY2A 1YB1A 2GZ3A 1EM6A 2FQYA 5TC4A 3GRKA 4C7BA 4N6NA 1A8PA 5E4YA 1JR3A 1T26A 3LHSA 3WNBA 3FOWA 1JLLA 1QFSA 2JI9A 4HTAA 3JQGA 4GP6A 1VI2A 2RH4A 4XAQA 3QJYA 3WLSA 1CUAA 3AEUB 2C5EA 1E2HA 3HA5A 3QU2A 5DLDA 2HMAA 1XMJA 2FFJA 5IJ9A 4GL2A 5ARBA 2FHPA 2CDNA 2Q99A 1YZKA 4G3XA 2GBLC 1LNSA 3B5JA 2VRWA 3PPWA 5JPIA 4BNHA 1QLWA 1TM1E 3PCXA 3BREA 2O8DB 1NLUA 4ZXPA 3T7IA 3AF4A 5BN4A 4FYHA 5J5AA 2QYSA 5BW5A 2CNOA 3EVZA 2BI4A 3KQLA 3FAZA 1WCIB 4GZ3A 4PZ9A 3IBGA 1UBEA 2C78A 4EB3A 4KH1A 4HXFB 5B64A 3FCSB 1Z2NX 1QNLA 2FW7A 3CF6R 4MAMA 4I1IA 1XXLA 2KBEA 1YVUA 4REMA 3UKOA 4HUQA 4F3RA 3G1UA 4U6NA 3KJEA 1IYZA 1PEDA 2W6JD 3BQ9A 3E4CA 1JDNA 5CEFA 2FPOA 2X1LA 1B74A 4YFVA 1U8FO 1USVA 1U0BB 4OMUA 2WJZB 3REFA 2MOKA 1CQPA 1T8WA 4MVJP 1C8LA 3NDBB 1AJEA 1SR8A 2I8CA 5H70A 1V3UA 4XD7A 1RXIA 1X7HA 4UTVA 2PUBA 4GBED 2P9YA 4MV6A 1LDMA 3W3AH 5GM2A 4G4SP 4JBYA 3T5AA 4OY3A 3LVQE 1WB6A 3CRMA 3GCXA 3QX9A 4YAJA 4JUCA 2Y1LA 5JNVA 1BO6A 1FSSA 1G9TA 3DZCA 4NCNA 3FDJA 2IEIA 4WOJA 3Q9SA 2ZRNA 4UMEA 4BVKA 3B53X 3WWYA 3VRHA 4XVQA 3B6EA 1NLZA 1ZD2P 2VDLB 2ZRHA 5EXSA 3G82C 2I4RA 5LXTA 1ECBA 5K0JA 4XWGA 1UT5A 3LIIA 2P11A 3P4YA 3UMJA 4OJKA 3UJ8A 3FA2A 4I2VA 1PJAA 1WSDA 3S8YA 3V4OA 2DHDA 1DQSA 4XR9A 5LQKA 2KHZA 5BWBA 3A4YA 2ATEA 4RJ2A 4MP3A 3QU4A 2V4UA 4ABTA 1ORHA 2ABWA 1C0IA 2KJQA 3L7OA 4LRTB 4HTFB 3WFIA 2V7XA 5KC9A 3MN1A 2G72A 1Q5PA 3EIOA 2FMXA 1J97A 3P1JA 4FBMA 1OROA 1UXOA 4IIJB 1KC1A 2DBQA 3QVGB 1BMTA 2A88A 3ML1A 4YPOA 1CQJB 4FJ2A 3BF8A 2ZVDA 4F92B 2JPDA 3C8HA 2B5OA 3ZHSA 5IARA 2QG4A 4WDRA 4DV5B 5YASA 1M1UA 3GGGA 1QZZA 2F17A 3B7GA 3M9WA 2GCGA 4B6JA 2DUNA 4UUOA 4ENWA 2O7SA 2MR6A 4FGZA 2P4EA 1J9GA 2B35A 1AQNA 1CUVA 3A1FA 4U5XA 2H2DA 4EDFA 1SD1A 4HH3C 3ZZ1A 5LUAA 1P29A 2PQ6A 2ZAIA 3AK4A 4Y1EA 1PR4A 4AJ1A 5J2UB 3K0AB 4PLHA 1C4WA 1U3TA 1FJHA 4G0VA 3CXUA 4CV3A 4Y9UA 2RK3A 1T1RA 2IPLA 2ZQZA 2ZYIA 4GI3A 4HZIA 4LI3X 2D0IA 1PJ2A 1C1XB 2FN9A 4ID9A 3PUHA 4V03A 4YRKA 3HDQA 1VIDA 3B89A 1DCMA 1P80A 2BP7B 5LDGA 1KDZA 1REQA 4XIFA 4MCAA 3QITA 4G9GA 2ZYTX 1U3GA 4OI2A 4D81A 4EB6B 4CIBA 1IY0A 1AUQA 3HYSA 2WSBA 2QZ9A 3FYDA 1GY8A 1MD9A 2JAQA 3F49S 4L2IA 3F90A 3UOWA 4AJOA 4CF5A 3E0QA 4GSYA 1FE8A 4G5HA 3OUZA 4GYYA 5H80A 3ZW9A 3R3ZA 2P41A 4H17A 4ZICA 4L50A 4CMKA 1RYDA 2YMQA 4QOHA 2ZSFA 3OWXA 4B2YA 2ZPTX 1TRHA 3QYJA 3PXAA 4ND8B 2ZVQX 2IV3A 4RENA 3RUDA 4MVJF 3B8HA 2YZGA 4I55A 4RHCA 4PN3A 4ZTUB 3RAJA 1CJBA 1N2SA 4QFCA 4HNTA 2IA5A 4EB8A 4HVCA 5BRNA 4I19A 4M7RA 4GD3Q 3DWIA 2IF0A 4QBIA 3MT0A 2Y1EA 4TS1A 1J70A 1Z5ZA 4L5YA 1KRXA 2QN1A 3NEAA 3M6FA 4BRZA 3RJMA 1PJSA 3ONNA 1NMZA 2HXYA 1X19A 2Q8NA 2ZBVA 1V11B 3F6RA 1R64A 3H75A 3ODPA 3EMBA 3Q5DA 1OLUB 2ZRKA 3BHIA 3H2YA 4POOA 2CK3A 4EI9A 1W36D 2H4HA 1SUWA 3U17A 3E05A 4JIMA 3CE6A 1K5GA 4JITA 4JGBA 3AI1A 3SZLA 2Q3HA 1K3UB 1EUCA 1T36A 4XUDA 4X61A 4JDUA 1KEVA 2RC5A 4WT7A 2H2FA 1MO4A 1DKPA 3WE7A 3FMVA 5G0SA 4FLEA 3IP8A 2WIFA 4IV0A 1HDXA 2PSSA 2X6TA 5ICFA 3R7AA 2X0FA 3ZWAA 1GNQA 3OOWA 4MW5A 5H8WA 1LBHA 1DQNA 2NPFA 3C6XA 3U2QA 3KB1A 1JPUA 2O23A 3DOEA 5LYJB 1E9AA 3PTZA 2BFDA 4XJSA 4CM4A 2FUCA 5AJYA 3KAQA 4RZXA 4F2HA 4BFCA 5FI3A 1Z8FA 3DEZA 4P32A 5G3YA 1HF3A 3T8YA 2IU6A 4LJKA 2JEYA 5PNTA 1JG4A 3DZIA 2FJUA 1ABEA 3MTAA 5CA0A 3SF8B 3BXGA 3WLTA 4ETNA 2CFCA 4JS0A 4KO4S 2BDUA 5CPFA 1N36B 4N5MA 4WAUA 1V6CA 4XIGS 4B3DA 1ZJYA 4DKJA 1EGAA 2AN5A 2VTDA 2YRFA 3E7FA 4RZHA 3GL9A 4MKHA 3S1LA 1Y1TA 3A6GA 1TOAA 2VDQB 1BA2A 2QI9C 3DFKA 4GICA 1O58A 1G63A 1V11A 1GEEA 1N2IA 3QMPA 5T3YA 3AXTA 5G1PA 5CBPA 5FX2A 2QM0A 2ZYDA 4IEFB 2VTBA 3EEOA 3CT4A 1E3SA 1NSYA 2CHEA 3AETB 4RPIA 3TSYA 1XK6A 1XCMA 2XF8A 5ALOA 5JNTA 1QS0A 3V7WA 4WCDA 3FY4A 2ATIA 2Z2XA 3OIWA 4I4CA 4ZOLF 4FDLA 1YRHA 2OFXA 3ZHVA 1C50A 2H29A 3A6HA 4HY3A 4WUVA 3ZK9A 1LJ8A 4DADA 5J