4CLRA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 90
structure length 249
sequence length 267
chains with identical sequence D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4clrA00
4RF2A 3WB9A 2OHXA 1I0ZA 4DQVA 4N5LA 2AQKA 3CZMA 1P44A 1M66A 1VJ0A 1ZK3A 1CIVA 2UV8A 1CJCA 3GVXA 1YBMA 3IS3A 1VPDA 3RROA 1H6CA 2OMEA 1B26A 3EHEA 3BHIA 3OA2A 1QYXA 3QWBA 4BO5A 1UP7A 5C5IA 1SBYA 4IDCA 1D1SA 1L7DA 1HYEA 1T25A 4J0EA 1UJMA 3K30A 3ZWMA 4CM5A 1NQTA 2BI8A 5IN4A 1PJTA 4Q39A 1NXQA 4JNKA 1NVGA 1UXKA 2AA3A 3EVTA 3PJDA 1F12A 4IQ0A 4JP3A 4KDFA 2D3TA 2C20A 1E7SA 3ZHBA 1GD1O 3DDNA 4BUCA 3I83A 4CMHA 1E3JA 1WDLA 4YJHA 2Y67A 4YRAA 4P8RA 3EAGA 2EGHA 3NRCA 1HE5A 1D4FA 2VTDA 4LMRA 4PRLA 4RJTA 4NJMA 1LDYA 3PHIA 1TA4A 2ZB7A 1ZK4A 4B3HA 1R4MA 3DBRB 1F17A 4U7WA 4ZVVA 2XAAA 3PPIA 4TZKA 5FYDA 2D0IA 3LSYA 1C0IA 5BSHA 3F4BA 2VNSA 2Y05A 5DP2A 1SEVA 1GL3A 3UAGA 2C7GA 2CF6A 2HKIA 2NLOA 3U3XA 2VRBA 5TS3A 1KVTA 1B16A 1IULA 1C1XB 1Q0HA 1SAYA 4IY1A 4QT0A 4WNIA 3LLVA 1R15A 4LN1A 3BAZA 2GZ3A 1V9LA 2GUGA 3LU1A 4L4RA 3VDRA 3D1LA 3GY0A 2EW2A 3ENKA 5B37A 3VZQA 1H6DA 1YJ8A 1TLTA 5IJZA 2E37A 2VHVA 1WXDA 2D5AA 4WLOA 1PQWA 4IXWA 4YAGA 3TFQA 1OAAA 1I01A 1YJQA 2Z1MA 2J5QA 3LC1O 2GRAA 3M2TA 1HKUA 3UKOA 2YHIA 4ONEA 3V1YA 1LDGA 2OBYA 4I5EA 2ET6A 1A7AA 3MZ0A 4UEOA 3GLQA 1EK5A 2UDPA 4R4JA 5IXSA 1W6UA 4RVSA 3ZHXA 3DZKA 2NADA 3WNVA 4JJIA 1VL8A 4FGWA 2P9GA 5L4SA 3E9QA 1FJHA 2X22A 4HUJA 2PZKA 1LSUA 2VUTA 4PLFA 1VE9A 2CVQA 3C8MA 4F6CA 1QYDA 4OQYA 1T2EA 3H65A 5HA5A 1Q0LA 2J5RA 3LT1A 2JHGA 4BV8A 3HHPA 4BMNA 3DAFA 2FR1A 4PLHA 4LSWA 3NYWA 3OQ1A 4EITA 2VZ9A 2C82A 3RBZA 1LI4A 1MA0A 2PGJA 3GDFA 3JCZA 1H93A 3T4XA 8LDHA 3KETA 5F5LA 4O6VA 4J90A 3QHAA 2EF1A 1T24A 1XEAA 5HRUA 4PVCA 5H82A 4GX5A 4RQUA 3TZ6A 5A5EA 4X54A 2PKQP 3GRPA 5A9SA 7ADHA 2IEBA 2BD0A 4YVFA 5JMPA 1Z7BA 4WLUA 5K6AA 3G0OA 4IUYA 4Y67A 3WGHA 3ZHZA 3K2EA 1GCUA 4GWKA 4AJ4A 4BB6A 1NR7A 2DLDA 3ADOA 5BT9A 4CUKA 2NU6A 1SCUA 4OL9A 4Z9YA 4RZHA 2LDBA 1DHTA 3E48A 3LYLA 2JD1A 2ZKLA 3OJ0A 5I9MA 1DB3A 4PLVA 4EZBA 1E5QA 5BQFA 3ONEA 1Z73A 2E4AA 3DZBA 1FDWA 4QEDA 3UICA 5DCUA 3GHHA 4G65A 3LLSA 4E32A 1C1DB 4C7JA 3Q9NA 3W4KA 4B4VA 4E5MA 1H6BA 3OIGA 3DMTC 3D4PA 1N8KA 4E21A 1W8DA 2J8ZA 2IXAA 3V2GA 3IDSA 4H15A 4CL3A 4J4HA 4RVDA 4FBGA 2ZYDA 4MP3A 4CLEA 1EVYA 1K6XA 3NEPX 3H9EO 4IBOA 1RPNA 5ER9A 3I9KA 4WGGA 2YZ7A 4PZEA 1HLPA 3OP4A 3U49A 3OETA 3ZNOA 5CFZA 2O48X 3GN2A 4KZPA 5JFOA 4XGKA 2VRCA 4A73A 4LVCA 3V8BA 1Y9AA 4ILKA 4GVXA 2O7QA 4JBIA 5G0TA 4EUFA 1JAYA 2GNAA 4XR9A 3UXYA 2P2SA 2YUTA 1DJQA 3EYWA 1EE9A 4G5HA 4MIEA 2RBEA 2CUKA 4CM9D 4CLRA 4RPGA 4ND2A 1SB8A 2WTBA 1NQAO 5KTKA 4D3SA 1NPDA 2CVZA 4XGNA 1HYGA 4CM4B 4Z6KA 2B36A 3V1TC 1ZBQA 4GWGA 1PGOA 1PQPA 3EW7A 1UZLA 3COSA 1N9GA 2GLXA 1V6AA 1UP4A 2CZCA 3DWFA 2NTVA 1DC6A 4MVJI 3P19A 5TJ9A 4MVJP 1NWCA 2ZIZA 2AMFA 3AFNA 5L51A 1XQ6A 1B8PA 5JDCC 4Q3AA 1I3KA 1M75A 1GV0A 4FQ8A 3DFZA 5L4NA 4FFLA 2VTEA 5F1KA 1JW9B 3EZYA 2X1HA 3PXXA 2JFGA 1WNTA 4CMBA 2VQ3A 5G0SA 2E49A 3H3JA 1V35A 2A92A 1UXHA 4KMSA 5IDYA 4HP8A 3LC2O 4JQCA 3ZWBA 2PA3A 3PFWO 1JKIA 3ZWAA 3HNPA 3IOYA 4XD2A 1NNUA 4MVJG 3SLKA 1HWYA 2I3AA 2AXQA 4E12A 3ROPA 4R3WA 3ZV5A 1O8CA 4BO7A 3PYXA 2HMWA 5CEJA 4B4WA 1I10A 2GERA 4MVJD 3DAPA 4PRKA 4ND3A 5AOVA 3W8FA 4ALJA 3IC5A 4MJLA 1MB4A 5MDHA 4J1SA 3WLEA 2DTDA 3B1JA 1R0KA 2OGUA 4OIMA 1GYPA 5HBRA 4QECA 4N18A 3ZGYA 1I24A 3OQBA 2NU7A 5JSFA 1Z82A 4RZIA 2OXIA 4XYEA 4XB2A 4JP2A 3AK4A 1XWFA 3GNTA 3RBVA 2HUNA 3O38A 4HNHA 3N74A 1IY8A 3BMNB 1HZZA 3TNLA 2RIRA 1XR3A 2VOJA 3D7LA 3X2EA 5JY6A 1QLJA 3NDRA 4UVHA 4AJKA 1Y8RB 2VRCD 1LLCA 3S2FA 1KC1A 4B4UA 2GYYA 4FN4A 1Z7EA 1PJ4A 3M1LA 1Y6JA 4IXTA 4WLNA 3OEWA 4GX0A 3UFXA 3KXDA 1B3BA 3W6ZA 4IQ8A 3M1AA 4RCVA 2IEDA 2CF5A 1HLDA 4PVDA 1BHSA 4NIMA 3ZWOA 1JKJA 2PLAA 1FMCA 1PGQA 1NAIA 1H9AA 1UXJA 1YL5A 4BQPA 3E18A 3I52A 3S1LA 1J49A 1LDNA 1QYWA 3DC2A 3MJCA 4B4OA 4IQGA 3VAZA 1CQJA 3FD8A 4GVLA 3SC4A 3WICA 2DBRA 4NK5A 3GEGA 1JWAB 4K28A 2Y0DA 4S1VA 1AN9A 1ZEJA 4GSLA 4NFYA 5A06A 2RH8A 4F3YA 5FF9A 3ASVA 4BO4A 5IZ4A 3NGLA 1DIGA 1NFFA 4OJNA 4IGFA 2EW8A 2I6TA 4BKPA 1O0SA 4GMGA 2PZMA 3E8XA 5A9TA 3VKUA 1DDOA 3OH8A 2CVOA 2EP7A 2W98A 4XYLA 1B7GO 4RPHA 1YQDA 4J6FA 3DZGA 2VUUA 3MJVA 1YBAA 4XYMA 1MLDA 3VH1A 4DIOA 3IUSA 1TB4A 4Z3DA 5ILOA 2WM3A 2Y1FA 3U4CA 3GUCA 4A03A 4AG3A 1WMBA 2NACA 4JN6B 1U7HA 2VHXA 1QP8A 1GYRA 2C0CA 3NKLA 4RF4A 4BKRA 3WYCA 3GRKA 1I30A 1MFPA 5JAMA 4TRNA 3IAHA 4J7XA 4KQWA 4DC1A 4GMFA 2G82A 3PGJA 4RGBA 1EK6A 1NFQA 2X0JA 3H9JA 5A05A 1QSGA 4A26A 5BNIA 1V0JA 5ICMA 1A4UA 5CDUA 3E9NA 1E1NA 3G79A 4I9HA 2NVUA 1JA9A 3WGGA 3FWNA 3PJFA 1WMAA 5TT1A 1Z45A 4HY3A 3NV9A 3ORFA 2WD8A 4CV3A 5J23A 4R5MA 4CMEA 3NT4A 4J2HA 3S55A 4OSPA 2O2YA 3AUTA 1ISJA 3GVIA 3L07A 4NH4A 3RKUA 2ZTMA 4LCJA 1WLYA 1E6WA 2DUUA 3DEYX 1FDUA 1K89A 4PLGA 1P45A 3ZNQA 3RUIA 1P33A 1ZUD1 3DZHA 3T4EA 2VYND 5KJ1A 1I3MA 2WDZA 3F9IA 1C0LA 2SCUA 4Q3EA 4WOJA 2C5AA 4GKVA 3EDMA 5COBA 3GMDA 2G0TA 2F1KA 4ESOA 3GAZA 4D46A 4RV9A 3FRJA 5KCZA 3KLMX 3PHHA 3RFVA 4OXKA 1GUZA 1X1EA 5DULA 5JCJA 3A06A 4KWHA 4YEDA 4HKTA 1X15A 4L0QA 3PGXA 5KJFA 3H6KA 2O50A 4K6FA 3AWDA 1Y8QB 3BTOA 3W4JA 1UR5A 1N1EA 5THKA 1DLJA 2VWPA 3PLRA 1XG5A 2EKLA 3OICA 5JDIC 1CWUA 2O23A 4Q3CA 3BTVA 2ZTUA 3ZH2A 3IL2A 1HSZA 4RORA 2JJYA 1F0YA 1YBVA 3RBXA 5JXWA 2EHDA 2IXBA 4XWYA 3CKYA 4JK3A 2GZ2A 4DQUA 3P7MA 3K31A 1IPFA 1YWGO 1XKQA 3V2HA 2E6UX 1Y5RA 2PD6A 4Q3NA 3OJFA 4FC6A 3JQGA 1CF2O 4R9SA 4YB8A 5T6BA 3P2YA 2EEZA 4CM8B 4G81A 4I9NA 3Q1LA 4O5OA 4HXYA 1ML3A 3ICCA 1KC3A 3PQEA 2NNLD 4DYVA 3QVWA 5K6AC 2O4CA 2PD3A 3MWEB 1JVSA 2BMAA 2CDBA 5AXBA 4IJWA 3WGQA 1K5HA 1U3WA 4U8GA 2FRDA 4R54A 3PEFA 4UUPA 3ZW9A 1MGOA 2F00A 2R00C 1ONNA 1UDCA 4XQEA 5EPOA 4NJMB 5DT9A 2B4RO 2B4QA 4PG7A 3G49A 2DPHA 4R1TA 2X8LA 3DBLA 3S2EA 1YL6A 1O9BA 3QVSA 3PHLA 4U0KA 1JDJA 1PSDA 5L40A 3D64A 3MJEA 5CEFA 4BNFA 4NHEA 3C7CB 3ST7A 1R12A 3H2ZA 3JQ7B 1I3LA 3O8QA 1PEDA 4YPOA 4XYGA 1OBFO 3NDIA 3KTDA 3PIIA 5C3MA 5ENVA 2NV6A 3L77A 1YO6A 1B2LA 2JFFA 4YAEA 1V3TA 3KSUA 3B1FA 5C7IO 1HXHA 2DU8A 1DLIA 4OOEA 2QRKA 3MJ4A 4J7CA 5EN4A 5TIIA 2AQHA 4KOAA 5AQ1A 3JQ8A 4BMSA 3AJRA 2X9VA 3D4NA 3JYNA 1ISMA 1V3UA 5L7WA 3QIVA 3L0DA 4XCVA 1XYGA 1LRLA 2IODA 1PZEA 2NVUB 3JQAD 3T7CA 2QX7A 3HDQA 3RC1A 2GN8A 2A35A 1EZ4A 4K26A 1XQ1A 3DOOA 3VZRA 4D0SA 5HS6A 2C29D 2GF2A 3W1VA 3CH6A 4GX2A 3JQBC 4R69A 3WIDA 1KVQA 2B4TO 1Y7TA 2A9FA 2YQ4A 1QKIA 2JKVA 1PR3A 3JQBA 5LCXA 3K92A 2EERA 3ZWNA 3AY6A 2WSBA 3KYCB 4FFPA 2GSDA 1PJSA 1PZGA 1W4ZA 3QP9A 2GD1O 1X7DA 4CR6A 1EE2A 1UUFA 4OOFA 1ZMOA 2LDXA 1M67A 1T4BA 1HDRA 4ZQFA 5I7EA 5B1YA 4FDAA 2H9IA 2JCXA 1PX0A 1Y8QA 1BW9B 1T2AA 2FHSA 4KUHA 3EY4A 4URFA 5EESA 1LXCA 5DNAA 4BNMA 3KO8A 4BGVA 2PH3A 1OC4A 4CMGA 1YDEA 3E5MA 4EYEA 6LDHA 4LW8A 3RUEA 3V1UA 5G2OA 2Q50A 1KEVA 1ISHA 2WEKA 3VZSA 1W0CA 4NQZA 5KVQA 5DBFA 3WR5A 5LC1A 1GAEO 4BNNA 3NJ4A 5KKAA 3W8DA 4GBJA 4I08A 4FB5A 3H4VA 1LJ8A 1KETA 2H63A 2HAEA 2IYPA 3OIFA 2FN7A 4GGOA 1ZK2A 1ADFA 2CDCA 1LQTA 3VTFA 2PK3A 3UW3A 1C1DA 1YRLA 2VT2A 3B6ZA 1KOLA 1I3NA 4A27A 1U8FO 3TL3A 1N5DA 2O4UX 1Z74A 4GL4A 1CETA 1E0DA 3JD3A 1ID1A 3FHLA 1PS0A 4MVJM 4EUEA 5ER6A 5DOZA 3WTBA 1ZJZA 1IYZA 1A27A 4BO0A 3G17A 4RVGA 3BTSA 1BSVA 1NM5A 2WWRA 4R5HA 3D3EA 4ZJUA 4WCFA 1IL0A 4HNGA 1VLLA 4AJOA 3H8VA 3ZWXA 3IIEA 4GPD1 4E30A 4UEJA 4YQYA 1VI2A 1MV8A 3D5QA 4EJMA 3JD0A 1GTMA 1UDBA 3ITKA 1LDMA 2O3RA 4B8WA 2GN6A 2VHWA 2AEJA 1LTHR 3DBLB 1MXHA 1ENPA 2JFHA 4PLZA 5JCJD 2WYWA 2BGKA 3JD4A 2Q1TA 1D8AA 5U9CA 4GLLA 3D3WA 4RPLA 4BNWA 3WMWA 1P1JA 4GGPA 3E9MA 3PJEA 4O1MA 3GMSA 2DUWA 1LNQA 5ITVA 1LSOA 4U6QA 3MOIA 1J4AA 5KJEA 2J3HA 5A5FA 1HEUA 3MEQA 3GGOA 3JD1A 1M6HA 5BNTA 1ZK1A 4PG6A 2ZB8A 3PQDA 4Q3DA 3ZI0A 4NDNE 2X86A 1ZCJA 1P1KA 4WEOA 3PRJA 1P1RA 3IKTA 1F14A 1YB5A 4LSMA 3JD2A 1NAHA 2HMVA 4XKJA 1QG6A 2ZTVA 3ONDA 2JCVA 1BMDA 4RPJA 4JX8A 2Q2QA 4RO0A 2AG8A 2GR9A 3E03A 4IDDA 5T67A 1PU2A 5GMOA 2X0NA 4P38A 2B83A 2AHRA 4Z3KA 1I32A 1AGNA 1DSSG 1VJTA 3WSVA 1WAMA 4BV9A 3DAGA 2O3TA 2FSSA 3H9UA 5ENDA 4CV1A 3OMLA 1HTBA 3WG9A 4DBVO 1X0VA 1ISFA 5EJ2A 4IS2A 4R68A 2Z1NA 4TMFA 4M86A 5BR7A 2YFHA 5A4DA 1JQBA 3DTTA 4H16A 2EGGA 3PZRA 5TSDA 3I4FA 1O89A 3HG7A 3KBOA 3QSGA 3GZNB 1ZEMA 1G0OA 4AJPA 1DRVA 2IZ0A 1PZFA 3R6DA 3FTNA 4DMLA 4M89A 1LEHA 1ARZA 1C3VA 2NQTA 2ILTA 4L4XA 4DIBA 5B4VA 1D1TA 3Q0EA 1U4OA 4Y98A 5EINA 1KEPA 3I1JA 4R41A 4INAA 4PLTA 3TOZA 3PWZA 3DR3A 4UUOA 2QRJA 3AOEC 4M8SA 5JYDA 1E1MA 1DEHA 3D4OA 3WMXA 2CMDA 1LSJA 2Z5LA 4RL6A 5DN9A 4BO8A 1LDEA 3ZW8A 5K9ZA 3OA0A 4II2A 3W8EA 1B14A 4DGSA 2NUAA 2HJRA 3JQAB 3R3JA 4QO8A 4Y6RA 3ULKA 4IJUA 1JVBA 4J9VA 4TWRA 3SC6A 4A5OA 4PIVA 2IZZA 2UUOA 4QFDA 2Q1UA 4RVHA 1GQYA 2HMTA 5KVSA 2BKAA 3RJ5A 1EUDA 1GU7A 2YY7A 4FJ2A 2C7VA 3I3OA 4CV0A 2Z95A 1VM6A 5EQFA 2VZ0A 4JGBA 2DAPA 3GGPA 2UYYA 4MVJH 4DREA 4GLOA 4JCOA 4DQXA 2VWGA 4B3IA 4CM1A 3UF0A 9LDTA 1YH3A 2G5CA 3C1AA 2TMGA 3GUYA 4UULA 4FFNA 3PYLA 1Y81A 1IHXA 1LRKA 4YJFB 3PWSA 1J5PA 1N92A 2AEFA 2P9CA 4YXFA 3LT0A 2RH4A 4PLCA 4BNZA 2Y1DA 2R00A 4O0LA 3QE3A 5MGBA 3M2PA 4J1NA 4R1UA 5IDQA 4WECA 3SJ7A 1CDOA 1R66A 4ZA2A 1PJ2A 3QLJA 2QQ5A 4H3VA 3DZJA 4N5NA 3HN2A 3FPLA 4OH1A 1NYTA 2DPGA 3OJOA 1PS8A 3LF1A 1PWXA 4ROSA 1NQ5A 1LQUA 4P4GA 5DOVA 1W73A 1VRWA 4J3FA 4J2OA 4U0JA 2O3SA 4XIYA 2WE8A 3U62A 2Y1EA 4ALNA 1YE3A 4M1QA 2NQ8A 3E6AA 4NU5A 3TN7A 1MG5A 4CMAA 3Q2IA 5TC4A 4W7HA 4EI2A 5CDSA 2PV7A 2OZPA 3LVFO 3VPXA 3UOGA 5ITWA 1KIFA 1FDTA 4I5DA 4JIGA 3G1UA 2OFPA 3EZLA 5AVOA 3AUUA 3D3WB 3WWZA 5TLSA 3PFFA 1EDZA 2QG4A 4CMIB 3DHYA 3GDGA 4E2WA 4XQGA 1X14A 4E13A 2YDYA 2YHIB 3PIDA 2ZB4A 1DRUA 3JTMA 4J1TA 2EWMA 3WGOA 3CTMA 1NBOA 4LRSB 1BXGA 2V6FA 2AEMA 4MVJF 4DRYA 1HE4A 3TZQA 2Y93A 3GAFA 3OEYA 4WLFA 5ICSA 3VPGA 3QQPA 2AE2A 3DZIA 5CDGA 8ADHA 4PZDA 4DXHA 4C7KA 2Y0EA 5EIOA 1E6EA 4B7UA 4BVAA 3UCXA 2WYUA 4IDAA 2Q46A 3C24A 3GG2A 3E5RA 3WS7A 2C07A 3KZVA 3F6YA 5JDCA 3D5TA 4CUZA 4GX1A 2ZYGA 1SOVA 4NU6A 3PK0A 1I2BA 1Q2XA 1AXEA 4BIIA 4D44A 4DLBA 1N1GA 4ZICA 3M6IA 3SJUA 4CV2A 1IB6A 1GFSA 3SX2A 5A04A 1X13A 3HADA 4OXNA 4HBGA 1YQGA 1GZ3A 2DFVA 2YV1A 4B79A 4GKBA 3MJTA 3QW2A 1EBUA 1JKFA 3JV7A 1OC2A 3LZ6A 4CL8A 4O59O 1TT5B 1ZMTA 1SPXA 4R3NA 3INTA 4CMEC 5CDYA 5KJCA 5A9SB 4AJIA 5JBIA 1QYCA 1IZ0A 3VZPA 4FC7A 4E0BA 3Q3CA 5FWNA 3WGYA 3W6UA 3SLGA 1L7EA 3BA1A 4CM3A 3AW9A 4CODB 2EKQA 4YA6A 2QW8A 4YJGA 4W9NC 4OKIA 3UGKA 4AJ1A 1YS4A 1YKFA 3R3SA 5JO9A 3TRIA 1U8XX 4YQZA 1KVRA 3CEAA 4YAJA 5KKCA 4MPDA 1K0UA 2BLLA 3CINA 4I1IA 1YDWA 3JQGB 3QRWA 1HDXA 4QQRA 1DC4A 2CNBA 2HK7A 2NU9A 3NDJA 1ZIDA 3VPFA 1EEHA 1EUCA 1RYEA 3HJAA 4B7CA 2DT5A 3RUHA 4FJ0A 2C54A 1PL6A 4WEQA 3DOJA 4IS3A 4Z9XA 3B20A 5IZCC 5K0ZA 2FOIA 3I9MA 1NHWA 3SVTA 5JC1A 2HQ1A 3E1KA 3F1KA 2WYVA 1P77A 1DHRA 4CJXA 2IE0A 4AICA 2ZTLA 1C1XA 3QWFA 1HETA 1I8TA 4N5MA 4L75A 5G0VA 3RI3A 2FZWA 3S2GA 3OIDA 1E1LA 1TT7A 4YT5A 2HU2A 4TRMA 4PG8A 3MTJA 2ZCVA 4IIVA 4DYDA 3HWRA 4WK6A 3MCVA 3N58A 3HN7A 3WGTA 4ALMA 3EMKA 3QWIA 3G1TA 3C7AA 3C85A 4CM9A 4CLRB 5JC8A 1QV7A 4Q3BA 4AVYA 1C0KA 4QFCA 5C7OO 1F8GA 4OYRA 2VYVA 5JMWA 2NSDA 2P91A 3ZU4A 2O2SA 3WQSB 3VDQA 4W7IA 1XIVA 1T1RA 1OZAA 4TQGA 3F1LA 3L9XA 3I23A 1MX3A 1BGVA 3RUCA 1N9GB 3I6IA 4U6SA 1VSUA 3CUKA 2Y66A 5TRTA 1ZO8A 1JU9A 5CHEA 2WD7A 5DBIA 1EVJA 3IMFA 2W2LD 2ZQZA 3DFUA 1EVIA 3GPDG 3EK2A 2BF7A 3OHSX 3SBOA 1KEUA 1GPJA 3TOXA 3RUFA 1PR9A 1AXGA 4I9UA 1P1FA 4PZCA 1OFGA 1T2FA 3KEOA 4UEKA 3AI1A 4J4TA 3TSCA 3TL2A 1HDYA 3VH2A 1P0CA 3P5SA 2JHFA 4CMKA 5I8WA 2V6BA 4OQZA 3PYMA 5DZSA 1SO8A 3KYDA 2P4QA 4OXYA 3DZFA 3FPCA 4R9RA 1E7MA 3HFGA 3A4VA 4UAGA 5EERA 3TFOA 4UVEA 1VJ1A 1KERA 3X2FA 4W82A 1ZVMA 4D3FA 3DBHA 5JCXA 4ZU3A 1G0NA 2Y0CA 1YGYA 1ADCA 4K9DA 4LVUA 2BH9A 1E7RA 3QWAA 4YT8A 3FTPA 4CQMA 2QYTA 4AJ2A 4DLAA 1GEEA 1XCBA 2C2XA 4QO7A 2JAHA 3WQRA 2EG9A 1PS9A 2AW5A 3EUWA 4IPTA 2P68A 4E3ZA 5B4TA 1X1TA 4IZHA 3BHMA 2GGSA 3DHNA 3U4DA 4WNCA 5JLAA 1N2SA 3G3EA 5CAEA 5KOIA 2ZATA 5CP8A 4C4OA 2YQ5A 5IDWA 4TROA 4PLWA 4CM6A 4EEXA 5T8KC 4DA9A 2R2GA 2X4GA 1IZ9A 4FOSA 5IFLA 3NT5A 3GA0A 4E2ZA 1JAXA 1YOVB 3IP3A 2DQ4A 4KUGA 4FFMA 1GADO 3V5NA 1J0XO 4YJGB 2FPPA 3VC7A 4BOYA 1ZZEA 3INRA 3RVDA 4ITUA 1NP3A 1YL7A 1LUAA 2FMUA 1KVUA 2X7HA 2XOXA 3GOHA 3GVCA 3O9ZA 4BKOA 4CQLB 4ZN6A 2X5OA 1MP0A 1N7HA 1ADBA 1GUYA 3KRTA 3JQCA 1QR6A 5GZ3A 2QZZA 3OJEA 4PCVA 4OAQA 1B3RA 3TWOA 3RKRA 1T26A 3BMOB 1NASA 4NI5A 4IDEA 3VVCA 5F3RA 2A4KA 3FR8A 3TJRA 4GH5A 3ZWVA 5EMHA 5T8KA 2VWQA 4M55A 4J4BA 1DIRA 2V6GA 5TX7A 1X7HA 4NPCA 5COAA 3ZNPA 2HRZA 4CMCA 3L4SO 4A7PA 4BNLA 1WZIA 2XXJA 3WX0A 1FDVA 1UAGA 2PY6A 1UZMA 3A28A 5T5QA 3KLPX 1PJCA 1YB4A 1U2GA 4IDGA 3AI3A 2BHLA 4QXMA 4ZQEA 4CM4A 3PDJA 4AJLA 2O3UA 4XQ9A 5CG2A 1WDKA 3JQ9C 1Q7BA 3QVXA 5H81A 5JAIA 2Y1OA 4ND1A 3FNEA 5BSFA 1X7GA 4Y9DA 5EL0A 2EKPA 3ADPA 4NK4A 3I9NA 3SEFA 2OL4A 4PLPA 5IZCA 3H5RA 4YAKA 4XDYA 4RDIA 4YR9A 3ANMA 4GQAA 4J7UA 4D7AA 2AQIA 2NVBA 3AM4A 3AM5A 1E7WA 5A3VA 3ZU5A 4R16A 2C59A 2J3KA 1RM4A 2I67A 4D42A 1KY4A 5TQVA 1O94A 1BXZA 1AHIA 2AQ8A 4J16A 3VHRA 4MIYA 4N54A 3HFSA 3Q9UA 4ZQHA 4JJGA 4WOKA 4J0FA 1VKOA 1WDMA 1ZNQO 3HE3A 3WYEA 1DAPA 1LX6A 4D0RA 1EFKA 5H83A 4XR4A 2GZ1A 2W2LA 1CYDA 4O63O 1A72A 3BMCA 3DMYA 4MP6A 3H9QA 2YV2A 2WE7A 3CMCO 3A1NA 2EP5A 2G1UA 4LRTB 4ND5A 1IUKA 5CEEA 1ZK0A 2HMUA 3CZRA 5C37A 4CLOB 4PG4A 2E48A 4YAIA 1NQOA 4CLXA 3KVOA 5KIAA 3H2SA 3RFTA 3ANLA 2VYVD 3WDSA 3IKVA 2CFCA 3VTZA 4P22A 3ASUA 2FWMX 2QYSA 1BVRA 3RIHA 3I9JA 4UVIA 5FI5A 2PKQO 3HUDA 4IDBA 1OMOA 3QA9A 1LU9A 3BXXA 1B15A 4FW8A 4E5YA 1E6UA 3JYPA 3JQDA 5KWEA 1NVMB 2GASA 4UVDA 4JROA 3BTUA 1FXSA 1H6AA 3VPSA 1BXKA 2H5LA 2PFGA 1PGNA 5AXAA 2GDZA 1T2DA 1ZH8A 5G0WA 2V6MA 2FR0A 3ABIA 2AG5A 3GEDA 5JAZA 3ETGA 3R1IA 1IE3A 3KB6A 2W2KB 2YV3A 3GNSA 3WSWA 4CM8A 4XZ3A 2CY0A 4ZRNA 4Z9FA 1PGJA 3S8MA 4AL4A 2YYYA 2GCGA 2NM0A 2BFPA 2I66A 2CSUA 4FPXA 5ES3A 1GPDG 3H5NA 1NPTO 1WPQA 3ICPA 5G0UA 1VKNA 4ALLA 1LLUA 1P1IA 4MINA 4II3A 4BMVA 3GK3A 5GZ1A 1UDAA 3GVHA 4ALIA 1LA2A 5I9NA 3LQFA 3PLNA 3HQ4O 3PWKA 3WBBA 2I99A 3KM0A 3QVTA 4BNTA 4YT4A 5IG2A 4BL5A 2Q4BA 3CE6A 4YJDA 4GSKA 1P1HA 4YTEA 4BGIA 4EBFA 3PQFA 2BI7A 4EGFA 4OMUA 3PJGA 3O03A 1PJLA 1PL7A 5KNLA 4FCCA 3RFXA 2DKNA 2B35A 1RKXA 3JYQA 3VKVA 1ENZA 1K3TA 1NFRA 1ENYA 3ZHYA 4BNVA 4E5NA 2HLPA 3T7EA 2ZK7A 5THQA 4IINA 4Y6PA 2YDXA 2NVWA 2Q45A 3L6EA 1ZKMA 3GEMA 1BTOA 1NPYA 5HWSA 1M76A 4CPDA 4MP8A 4YRDA 4E4YA 1XHLA 4BGEA 2FP4A 2Q2VA 4FFRA 4RPKA 4NBVA 2D5CA 1LRJA 4WE3A 3OQ6A 4GI2A 4YWJA 1ISGA 3RAJA 1YQXA 2RHCA 2X9GA 3GFGA 4JLWA 4CMIA 1PJ3A 1UAYA 5DCYA 3JQ8B 4RQTA 1JTVA 4PFJA 2HK9A 3K5PA 1YB1A 5L9AA 5FEUA 1JWBB 3C7DB 2IYOA 3U4IA 1BDMA 1NTOA 3MWDB 3GQVA 1A7KA 3OSUA 1R6DA 4DC0A 2D2IA 4IM7A 1EFLA 4Y6SA 4B3JA 3H7AA 1NX6A 2UVDA 1U28A 2FPGA 3C1TA 4IMRA 4BNGA 1R4NA 5CPBA 1ZSNA 2VOEA 2X5JO 1V8BA 2VNAA 3BHJA 3BMCB 4WUVA 4CQMD 3H9GA 2BFAA 3K8ZA 4K1LA 5JDIA 1QRRA 4BGUA 3AY7A 5AXDA 4F6LA 4H7PA 3PI7A 3IP1A 1TVEA 4KTTE 4KUEA 3DOCA 1BRMA 2PZLA 3ZWYA 4DL9A 1PJQA 3ITDA 5DBGA 5F1OA 1R16A 5IF3A 4E2XA 1QXSA 1TEHA 2P5YA 3A9WA 3PVZA 5T64A 3BZUA 1BW9A 5ADHA 3HDYA 3BMNA 5A3JA 4MKXA 2GN4A 4BNHA 4DUPA 1XDWA 2CD9A 2JD0A 3AOGA 4BO2A 5GZ6A 4HFRA 1FDSA 2ZYAA 2Q2WA 4HFNA 4NBWA 1X0XA 1CRWG 2PTGA 3UCEA 1K6JA 3PZBA 3RASA 4UUMA 4A0SA 1P74A 3JQEA 3L6OO 3ZCXA 4BO6A 4MO2A 2G17A 4Y8VA 1U3VA 3ZU2A 1ZXBA 2Q4EA 4K6CA 4QTZA 4ZHSA 5B4UA 1OI7A 2UAGA 1RM3A 2DBZA 3MTGA 1IHYA 1RJWA 2D1YA 5I8ZA 1E5LA 5IN5A 4CMJA 1LDBA 1QV6A 3KYBA 5TT0A 4XB1A 1I36A 2VWHA 4KQXA 4QSMA 3ZWPA 5L7TA 1GQ2A 1ONOA 3FR7A 1U7TA 4BO3A 1FK8A 4NR0A 3JQ6A 3CIFA 5I7FA 3WYBA 5I7VA 4XYBA 2V65A 1DC5A 4IMPA 2JCYA 5G4KB 5AXCA 4ZD6A 3JYOA 3O26A 3QV1A 4CLDA 3DQPA 1PWZA 1B8UA 3RC7A 1H0KA 3FF4A 3LF2A 4RVUA 2XPCA 3ZWCA 4J91A 7MDHA 1QORA 1H9BA 5L45A 2DFDA 4AJJA 2WMDA 3STHA 1YVEI 4FGSA 3C1OA 1ZSYA 2OP0A 5U4QA 1DXYA 4OO3A 5I9LA 1PGPA 1E7QA 3OJLA 4FR5A 4NFHA 3WIEA 5KVVA 3F46A 1J6UA 3B1KA 2HO5A 5JAQA 4MKRA 1HZJA 1QYVA 3ONFA 3PDUA 3IJRA 4CM7A 3F5SA 1L1FA 3UUWA 2E82A 1DIAA 5T57A 1CERA 1B8VA 3K73O 1E3IA 4R1SA 2I9PA 1HE3A 3R0IA 3F3SA 4Q9NA 1HT0A 4L74A 3UHAA 3DMTA 3VOSA 4DTIA 1LC3A 4HFJA 2NU8A 1LLDA 2QIOA 4L73A 5A03A 1GV1A 1NVTA 1GY8A 4ND4A 5IXYA 4W9NA 5F21A 4LISA 2DTXA 4Z0HO 4DIFA 3OECA 3LK7A 3HB4X 4OHUA 4OM8A 5KJ6A 1DOHA 4R51A 1PL8A 2Q1WA 1V3VA 2X6TA 4XRRA 5L7YA 1GZ6A 4WASA 4E6PA 1UP6A 4YDRA 3U09A 3O4RA 1HYHA 3KOUA 4M54A 5JS6A 1OOEA 3VVBA 1R4NB 4CUJA 1M6WA 3NTRA 3KHUA 4FIZA 4IIUA 1G6KA 5GY7A 3EVNA 2D8AA 1MXFA 3D0OA 3DO5A 2VT3A 3GC6A 2QHXA 3GZNA 5F5NA 5U1PA 1PQUA 4F46A 2OOSA 1EMDA 1B0AA 2I65A 4OKNA 3U0BA 2PZJA 2DBVO 2NWQA 4DBZA 4YRBA 1SC6A 1Y8RA 5B12A 4JXKA 4IDFA 2FY8A 3I4CA 3MOGA 3OBBA 5JO0A 3TZCA 3CMMA 3K2BA 1H5QA 3KV3O 3RWBA 2HCTA 4XRGA 3C3XA 3FWZA 1T2CA 4CR7A 1ISIA 2A94A 1HSOA 3VPHA 1Z75A 3RC2A 4FS3A 2HMSA 4XGIA 4DVJA 3BMQB 3NX4A 2UUPA 4BHTA 3DBVO 1BDBA 1HL3A 1XELA 2DTEA 3ANNA 3JQAA 3ZU3A 1KVSA 4PN3A 4BKUA 1EUZA 4S3MA 4L4SA 3AU8A 5AYVA 4XDZA 2PR2A 4IZIA 1SB9A 4OSOA 4DPKA 3DTYA 3LDHA 3F4LA 4ZQBA 4A10A 1GYQA 1HDOA 1DRWA 5L4LA 3DBRA 3HZZA 2NTJA 5A9RA 4CQLA 1ZXLA 1RM5A 4IJVA 4LGVA 3I9OA 4NFSA 3WNQA 3WGIA 3CSDA 2Q49A 3UCFA 4EJ6A 4ZQGA 3WJAA 1R0SA 3WOHA 3RU7A 2FR8A 3NT2A 4TKMA 1E3SA 3Q2KA 1M2WA 4HX5A 2X0IA 5CPFA 4LK3A 2C2YA 3E82A 1Q0QA 3NAQA 4BQRA 3QY9A 1U2DA 2Y1CA 1ORRA 3KSZO 2VCYA 4PGFA 5IDXA 4EJ0A 3RUDA 1BG6A 2WJPA 1WVGA 2HSDA 5F1PA 3WFIA 5A1TA 3WBFA 4D43A 4RLSA 4KTVE 5JW6A 2QZ9A 5COQA 3H5AA 2Y99A 4MVJE 4P4NA 4NBRA 4XJTA 3DHEA 1EQUA 1NHGA 5G4KA 3NJ8A 4CLHA 4D3DA 4OGWA 3GFBA 4J1QA 3FSRA 2HJSA 3LC7O 4NZ9A 1E3WB 1AE1A 5HTOA 3HSKA 2Y68A 5DP1A 1U5CA 5LDHA 1SNYA 1E1KA 4F45A 3QVOA 3L4BA 1IOLA 4BNYA 4JBHA 2B5WA 1P31A 4WCDA 1PZHA 2W8ZA 4JJFA 2NTNA 4KDEA 4HADA 1DJNA 3FCOA 3FNHA 1Y5MA 5IAAA 4EUHA 2D59A 3KUXA 2EJVA 1DFGA 1YXMA 2VN8A 3GHYA 4BO9A 4BNXA 1C0PA 3AFMA 4TSKA 2R6JA 1K2WA 3ZZNA 5KVCA 2XXBA 1UH5A 1HF3A 4U5QA 1A9ZA 2O3QA 2Q1SA 4B7XA 4G2NA 3GZ4A 3KEQA 4YBZA 1E92A 3GT0A 5HM8A 4GAEA 2P5UA 5LDGA 1DIHA 4BB5A 3FN4A 4IGEA 3DONA 2J5KA 2I3GA 3TPCA 1ZFNA 4UUNA 4R1NA 1NR1A 4DWVA 4RF3A 4FSHA 1XU9A 4I5GA 4J43A 4NMHA 4TVBA 2O3JA 1RM0A 1U9JA 3TF5A 1O95A 2YFQA 3PHJA 2PKRA 4D45A 3BIOA 3HB5X 3QJ5A 2EIHA 3SXPA 2JD2A 2X23A 3TZKA 1MUUA 2GN9A 3I9LA 4YACA 1Q7CA 1TT5A 1DFHA 2RHRA 1I2ZA 3P2OA 4DPMA 4DLLA 3IJPA 1LLQA 4ALKA 5A02A 2G76A 4J9UE 3TDKA 4XA8A 1XGKA 1FF9A 1N7GA 2HRBA 2VYNA 2VUSA 4TRJA 3JSAA 1F8FA 2D4AA 3L9WA 4TKLA 1CEQA 3GF4A 1QMGA 3LT2A 4DMMA 2P4HX 4EEZA 4UVGA 1H2HA 3BMQA 4JBGA 3ZV4A 1DBVO 1SZJG 4DPLA 4YYZA 3JQ9A 4NBTA 4MKZA 5HS4A 1QLHA 3BYZA 3FNGA 2BGLA 4L76A 5DF1A 1DPGA 2JL1A 3WXBA 2W2KA 3EGOA 3W4IA 3A14A 4D79A 1BVUA 1PJBA 1U3UA 1HDCA 1ULSA 4E5PA 1BWSA 2FSVA 1TXGA 1JLLA 3I6QA 2VZ8A 3ZV3A 1U5AA 2GPTA 5TGDA 1LSSA 2IRWA 3GDOA 3H3FA 1Y1PA 2FZEA 2OUIA 2X0RA 2POQX 4NBUA 4RLHA 3ENNA 1E77A 2EXXA 2BFOA 1U1IA 1Q7GA 4FJ1A 1GDHA 4BNUA 3JQ7A 4CR8A 3TZHA 1KYQA 4KWIA 4PLYA 1RWBA 3O8QB 1SEPA 2OBNA 2BELA 1D7OA 2JAPA 4AFNA 4W99A 3IQDB 1R37A 2HDHA 3RQSA 2Y1GA 1PTJA 2TMDA 3AUAA 3ROQA 5CG1A 4NG5A 4I5FA 4MIOA 1ZW1A 1I33A 1VL6A 1GCOA 1KS9A 3FBGA 1E3EA 3RUAA 3HDJA 1T4DA 3HDHA 5C7LO 1O5IA 1ZSVA 2PD4A 1E3LA 4FD3A 4RF5A 2RCYA 4MDHA 3INGA 3S2IA 1E3WA 2HK8A 2PWZA 1R0LA 1SMKA 2OP1A 5TJHA 1GR0A 3WLFA 1GEGA 1P0FA 1GQQA 2O7SA 1T1SA 3GH3A 2B5VA 3TQHA 4P4LA 4NJOA 1ZJYA 3NTOA 2BRUA 2Q3EA 4M87A 5JE8A 2FPIA 2X5KO 1KEWA 2H1SA 1HE2A 4UREA 4BKQA 2OORA 2PGLA 4LMPA 3U5TA 1XA0A 3CXRA 1KY5A 2CDAA 4KP7A 2ZCUA 3U9LA 4A2CA 5G4LA 2EV9A 1MC4A 1GUFA 2B37A 2PGDA 3FBTA 3KYCA 1DO8A 1UXIA 1A71A 5CDTA 2GO1A 2W90A 5I7SA 3K6JA 3EC7A 3NUGA 5ILGA 2VHYA 3KSDO 2ZQYA 4TZTA 3WFJA 3OF2A 4EW6A 1H2BA 2YJZA 4L9RA 3KYDB 4L8VA 3WTCA 3PP8A 2PH5A 2IZ1A 4XX0A 5L53A 1VC2A 4E5KA 4XQCA 1DFIA 3K96A 3RJ9A 3JQFA 4J49A 3ZV6A 3DBHB 3L6DA 3ZWWA 4WLVA 3FI9A 4FOOA 1C14A 3MJSA 1Q1NA 3ETDA 3F47A 4QX6A 1P9LA 4Z0PA 3ROMA 3WWYA 4CQMB 3GNQA 3AU9A 4D41A 1LC0A 4M49A 4XJSA 5JYEA 2ZB3A 3Q6IA 5JNLA 4ZRMA 4MVJA 5JPIA 4HV4A 5JY1A 4I8XA 3GGGA 1A9YA 5TNXA 1RYDA 3RCBA 2ZJ1A 3GVPA 1DAOA 2BGMA 1HRDA 4WKGA 4W4TA 1P3DA 2B0JA 3PHGA 1EVZA 4E31A 3DL2A 4RVFA 4AJEA 2VHZA 1D3AA 3AI2A 1WP4A 3CPSA 4W6ZA 4YJHB 3VH3A 2Q99A 1HDGO 1ENOA 4WJZA 1YOVA 3AUSA 3WGZA 1E7YA 3LT4A 1WZEA 2PNFA 1I5RA 1R4MB 3OM9A 3IUPA 1Z6ZA 5BSEA 2DVMA 6ADHA 4Z0TA 2I76A 3U4HA 2BFMA 2I5PO 4E2YA 4FFOA 4HFMA 4B8ZA 1DIBA 1GZ4A 4WCFB 1A4IA 1SOWA 5FI3A 1MG0A 4AJNA 5BSGA 1AHHA 3BMOA 3ZDFA 4YJFA 3RC9A 3OFSA 3AY3A 4XEHA 4YCAA 1WWKA 1EQ2A 4LCEA 3GN1A 3PTZA 1IPEA 1F06A 1EBFA 1U4SA 3NTQA 3ON5A 4BNIA 2QRLA 1S6YA 2C5EA 1ONPA 3RSHA 1I2CA 2J3JA 3WQQA 4BNJA 3FNFA 1XSEA 3N7UA 4E33A 1VSVA 1YONA 5L95A 2H6EA 4AJHA 1S7CA 5FFFA 2V7PA 1UXGA 1EDOA 5DDIP 3UVEA 2WD7B 2P9EA 3AM3A 4PG5A 4BO1A 2J6IA 1Y9EA 3JYLA 4NNJA 1JN0A 2J3IA 1PIWA 1K6IA 2RAFA 3DB2A 5BNFA 2ZJ0A 3WJ7A 3JQFC 4BNKA 4TRRA 1G1AA 3AOEA 4IJKA 9LDBA 4QUKA 3ETEA 4R01A 1MC5A 5EQDA 5DCWA 1U3TA 1VL0A 3B70A 1XU7A 4WLEA 3Q11A 4MOWA 2OO5A 3F5QA 4WCFC 3ZN2A 3DXFA 1BXGB 3ROKA 5L3ZA 4XIJA 4N7RA 2XF8A 1O6ZA 3VH4A 3GG9A 3I5MA 5TF4A 4BS9A 2B69A 1TI7A 2W4QA 3L4BC 1ADGA 3GR6A 2X58A 1DC3A 4TVOA 2X9NA 4ID9A 2DM6A 2DC1A 3RU9A 3RD5A 2IDZA 1A5ZA 4WPGA 1LBEA 1WW8A 2EJWA 1KBZA 2DBQA 1ULUA 4ZGWA 4CLOA 1HDZA 1NWHA 1CQIA 4HWKA 3K9QO 1H94A 3NGXA 2AE1A 4RDHA 3V2UA 2YHUA 3UH1A 4YT2A 3ZNNA 1XLTA 2YW9A 3GPIA 4EDFA 1MFZA 1UZNA 3QWHA 1AUPA 3UN1A
chains in the Genus database with same CATH superfamily
1QWOA 1C9KA 1QZXA 2OHXA 2VBFA 4KYUA 4C6TA 4CF5A 3I4LA 1HC7A 1NIPA 1VFPA 1ZIPA 1CZHA 1M66A 3BDIA 4JY7A 4LGYA 3AF5A 1CIVA 2XZDA 3GVXA 1VPDA 1P8AA 3M4ZA 3CJTA 3CPEA 1D7AA 4O4HB 4YALA 4ATNA 3EHEA 3E22A 4AM8A 1QYXA 2EFCB 3PNOA 1A04A 4TXNA 4RTKA 2MYUA 4IDCA 5C9ZA 2YNMD 1JZSA 1HYEA 3OX4A 4DB2A 2JGEA 3KWLA 3ZGOA 3AETB 4DSNA 3A1UA 5B55A 1BCSB 2BJVA 2BI8A 2QA5A 4C6HA 1AC5A 4ZCTA 5K05A 5JQWA 1J0DA 2AA3A 2YIDA 3ETNA 1J0CA 3PJDA 1F12A 4IQ0A 4JP3A 4KDFA 2D3TA 3ZHBA 2UXDB 3QX9A 3I83A 4HEQA 1J25A 1W88B 1WDLA 1S8FA 2QN2A 4YRPA 4MQ5A 3UGQA 4E1BA 1KQNA 3L6RA 3TD2A 1JF8A 5FWYA 4URHA 4CIDA 3NRCA 1HE5A 1D4FA 3I1FA 4HAVA 2P9HA 1OXXK 2VTDA 3VC1A 4Z7OB 1X1DA 4RJTA 2UU9B 1M7GA 1HQDA 3LL7A 3PHIA 2O0MA 4HH4A 2QTZA 4MQUA 4ZPJA 5FCDA 1CEEA 3IDFA 1QIKA 3DBRB 5HTKA 4HNAB 1NM5C 1TU4A 4RHXA 5DX0A 4F4UA 1NF2A 1ITZA 1M6EX 2XUOA 2ZE7A 3TKLA 5F78A 2BTEA 2W6MA 4MS1A 4EG0A 1WJGA 5KYUA 2FW1A 4GBGA 1M6NA 1VA5A 2W8BB 2Q6LA 3NOXA 1YNOA 2QPOA 2QM7A 2WM9B 5DSXA 3QEBZ 3O4VA 4JIMA 1FNSA 1C1XB 1Q0HA 1P4RA 1SAYA 2C4KA 2XV1A 3DSRA 5IH7A 4WNIA 5ECYA 4DV4B 2UZ3A 3S28A 3OTOB 3HJGA 2JGRA 3SP1A 2HA0A 3LU1A 2IYUA 3R7LA 2WW8A 1EP3B 3QVVA 1PKEA 2DP4E 3D1LA 3D6VA 4LDQA 5ALDA 5LQKA 1TLTA 1MRSA 1MF7A 1WXDA 2A57A 2D5AA 3HYTA 4PAOA 3SIRA 4IXWA 4LE1A 2E55A 3WIVA 2IVZA 3WKBA 1U0NA 3PFNA 3TFQA 1EPUA 3DW3X 1I01A 2Z1MA 3JQRA 1D6MA 4KVZA 3W2EA 1DBPA 3I53A 2YHIA 3I39X 1RPTA 3HUTA 3U6KA 1QBKC 1GIAA 1QCZA 3CJRA 4P86A 4QOIA 2E4YA 1T2UA 2PS1A 2ZU0C 3D31A 1FRQA 5FR1A 4LZNA 5AW1A 4R4JA 5I51A 2P78A 1DG9A 1W6UA 3DLAA 3ZHXA 4I8DA 2ANCA 2NADA 2Q5LA 3EIQA 3IEKA 2DERA 5HKKD 3ZG6A 4KXNA 1JSXA 3BSSA 3VTKA 1T2NA 4D4IA 1V8DA 4LE2A 4S0ZA 5EP4A 1V26A 1T9CA 2XCTB 1ACLA 1CXZA 1J07A 4ZC1A 4PZLA 3RUPA 4NYIQ 2XQKA 4WSOA 2VUTA 5LZ9A 1OGYA 2YNMA 4YUVA 1Y1LA 2FUCA 4FHGA 4OQYA 2WILA 3M9LA 2GK3A 5HA5A 1Q0LA 2J5RA 2JGKA 3HJCA 3K1YA 2ZRDA 4BMNA 4QM6A 2ZIXA 3QKRA 3NYWA 4K6OA 3NM6B 4R8MA 2QTVA 2FLVA 3HRKA 2VZ9A 1F3LA 2UVPA 4LDNA 1MCZA 2XNDA 4JR1A 3PDHA 3CY6A 2JCBA 3JCZA 3GFSA 3T4XA 1Z4IA 4JT9A 8LDHA 2R751 4BLPA 4DVGA 1EK1A 4KRGA 5EMMA 4BMYA 3KETA 1QRTA 1XF1A 5HRUA 1P17A 2OB1A 2RH9B 5H82A 1P19A 4RFSB 3TZ6A 2PJUA 2ZJBA 3GRPA 3DFKA 2C7QA 1QOPB 5HCNA 4YVFA 5JMPA 1Z7BA 3LUGA 3BDVA 3H11B 4L5IA 4TVKA 1TD9A 2J5XA 4Y67A 3F2IA 4M37A 3VJKA 3K2EA 3JZDA 3W5SA 4UDNA 2XUJA 4KIFA 2VJOA 3ZVRA 1NR7A 1E20A 3ADOA 2NU6A 1MAUA 3VUEA 4F0JA 5J2UF 2NP6A 4KQMA 3G5UA 5SZJA 2QT1A 3LYLA 2ZKLA 3RYIB 1NXTA 4B33A 2PE5A 2IYTA 1GLNA 5K0BA 2WTEA 3ONEA 2GBCA 2PVSA 4TUYF 2BEUA 3DZBA 4OXQA 1F9AA 1H1LB 4OB8A 4IIJB 1DQYA 4QEDA 4U9IS 5DPMA 3VR4H 3WMGA 2BAGA 4IHJB 1IY1A 2BHTA 3LLSA 2IIVA 2ZYRA 4M0CA 5IM4F 1IJFA 1J8VA 3HPRA 3Q9NA 4RHFA 2V03A 4B82A 2XD4A 4HDKB 3OIGA 4Y6GB 2FMXA 4F60A 1NUAA 5I7WA 5KPJA 3RFUA 4EB8A 4IH1A 1R8SA 1VMDA 2VPWA 1FX1A 3A9CA 1DZIA 3ZLUA 2RB5A 4GMKA 2GCEA 4EG4A 3NAZA 3TLEA 5J1SB 1PZMA 5CW1A 1XCJA 2IW1A 4FBGA 4H6XA 3RVPA 1BVHA 3E2PA 1P9RA 4R7ZA 5DXAA 1QK4A 4EHBA 3NEPX 3OJWA 3RS0A 1RYYA 1YMVA 5ULLA 4I50F 2OZEA 2XGOA 2JS7A 4QBTA 1HLPA 1FLAA 3OP4A 5EGNA 1K06A 3G2IA 4F2GA 3U16A 3GP5A 1DI0A 3OQIA 4WV3A 2PUEA 1V4BA 1PG2A 5KTOA 1G4HA 4F06A 1TTHA 1XA4A 2VRCA 2VVTA 1N9ZA 3V8BA 4ILKA 2BV3A 2QAIA 3ISJA 4WKBA 4GVXA 1DS6A 3TLMA 3LO5A 1JPVA 2RC6A 3MRVA 1JAYA 3BK2A 3E5NA 4NNPA 3SU8A 4D81A 2G7ZA 5KBYA 3LE8A 3CF2A 1UBOS 5DH9A 1V8PA 2H0AA 1USVA 4G5HA 3EYWA 1EE9A 4AZVA 4ETNA 2RBEA 1WCXA 2CUKA 4CM9D 4KR3A 3WLPA 5CFOA 4JLAA 2PJZA 3EH1A 2G4VA 1OGJA 4MB0A 1LS1A 5F4BA 3MTDA 3L1IA 4IRUB 4M1SA 4D98A 2RD2A 1AG9A 1UWKA 2J9ZB 1T13A 4HATA 4WERA 5CGZA 4PGGA 1I13A 1FLNA 4CM4B 2GPSA 3OT5A 4AUMA 1Z2CA 1ZBQA 1PGOA 3EEQA 1XZDA 1N5LA 2HJGA 5AESA 1PYOA 3IDOA 4CEIB 3K7EA 1V6AA 4HO1X 4MVJI 2N9UA 2NTVA 4R6XA 3UIEA 2P27A 2HT6A 2Z8ZA 1L6RA 4MVJP 2ZIZA 1FTSA 3R3UA 2RK6A 2AMFA 3MCTA 4R2HA 3WLNA 3CN9A 2H2GA 1AMUA 1ZVJA 2X9QA 2G0AA 4N9WA 3PE4A 1O03A 5JIBA 1DUSA 4KE7A 2Z57A 2JAOA 4FQ8A 2VEDA 3DFZA 4U39A 1TUIA 3M4JA 3EZYA 4XOIA 4YMGA 3LZDA 1Y3FE 3UFBA 1T3SA 3UK6A 3I3SR 1RQNA 1U1GA 2BR4A 3H3JA 5ENZA 4XJVA 1OVMA 1QIJA 1V35A 4O4JB 4BMDA 1JSZA 4G8DA 4OGGA 1J06A 3BCUA 1V4NA 3SSAA 4B76A 4GZ5A 2PA3A 4MTLA 4AMUA 3PFWO 1SY7A 3N0TA 1GZDA 4MCHA 4EY5A 3DV0B 1NNUA 3E7DA 3KKZA 1VQ1A 4E12A 1KQFA 3ROPA 1U2SA 2NU8B 2HMWA 3N5CA 1A9XB 4B4WA 2C9YA 2BH2A 5D3MA 3P2JA 1J1UA 1YVPA 3OPNA 4PRKA 5BW8A 3KZMA 2CBXA 1E1RD 2R8OA 1B1AA 5IRCD 2ZJ3A 4DEVA 1SBIA 3B2NA 1N6NA 2YL2A 4N5HX 5MDHA 2R7LA 1R3DA 2YIJA 4QSHA 5JZ9A 1E5TA 2FDCA 5ALUA 4IIEA 2G9ZA 4IICA 3SF8B 5CB4A 4YCDA 4OIMA 1GXSB 1GYPA 4V0QA 5HBRA 5HRAA 4N18A 4DIFA 3WV5A 4CGYA 2NU7A 1E1YA 2Q3FA 1A3CA 4I1OA 2BWJA 3M82A 3LVBA 4QDTA 4R84A 4DUGA 4PYMA 3K09A 1NW8A 4FLMA 1YC2A 4DE5A 2JKYA 2IXTA 3WY9A 2JFXA 4KK4A 1SC1A 3N74A 3LTEA 3I6MA 3OAAD 1LY1A 3WMFA 4KPGA 2RHBA 3PEEA 2VOJA 5JY6A 1W0KA 3AERB 3KVRA 4UVHA 4OYYA 1V41E 2WC1A 4AJKA 3ZQ4A 5BV2P 2O8BA 1Y8RB 3MXOA 4MWSA 1JQ5A 5ALGA 4EHLA 1Z0JA 4N0EA 1R9JA 1U7UA 3CKLA 3GRYA 1Y5IA 3GLKA 5FDFA 5CA1A 1TVCA 2FKAA 3KXDA 4KXWA 2XQJA 3FFWA 3GJRA 3EZ7A 3GT7A 4GXRA 4OXRA 4GRIA 3IOEA 4IQ8A 5AKIA 1SN7A 3PG5A 4HXGA 1HLDA 2XW6A 2Z8YA 1BHSA 3SXUB 1Y0BA 2XNCA 3X1KA 1S0UA 4Q7KA 4G1VA 2EZ8A 4A6PA 4KPYA 2Q41A 1JJFA 4R1LA 1H9AA 1UXJA 3TAXA 3WOVA 4AG6A 4ZDKA 3E18A 1KNQA 1KFBB 3AFOA 2PT9A 3PE3A 1J49A 1B0PA 3DC2A 1RJGA 1QGZA 3I04A 3MJCA 1BE1A 4IQGA 4GVLA 2YXLA 3RT9A 3WKCA 2IHJA 2DBRA 4KCGA 4DSOA 1CDDA 4KV9A 2Y0DA 3DE0X 2FEWB 3H13A 2GKOA 3RT7A 3ASVA 3LZCA 3UKDA 1SUBA 4M8KA 1UCFA 3NGLA 3GJ3A 2CYAA 4RY2A 4AO6A 3IP5A 1NFFA 1SKAA 1NMZA 4WXEA 1JFVA 2Q6KA 1C1YA 3JATA 4TKVA 1KY3A 4QBGB 4GMGA 3UV3A 1E32A 1TZ2A 2P3OA 3FRHA 1XJ5A 4PQFA 4QBHA 5A9TA 3CUVA 3VKUA 1EA7A 2YWJA 4P58A 1C8LA 2EP7A 3IAS1 3CKKA 1KZHA 3V2IA 2PPLA 4XYLA 4B8YA 2UYQA 4J6FA 3VR3A 3RS4A 4XYMA 1GNVA 5E3IA 3VH1A 5BYKA 5JBNA 4ER0A 3BH0A 2J0UB 3U4CA 8ADHA 1TK9A 3B6JA 2BZ1A 2D0PB 4A23A 2CL5A 4H1UA 1RJFA 3C5HA 1FP7A 3GEPA 4A8JB 3UPUA 3THXA 3MERA 1A8QA 5BY2A 2X8WA 1SUEA 1QP8A 1GYRA 1QFSA 1TM4E 2C0CA 2IIQA 4FHZA 1Y7LA 4N0QA 3I2GA 1SBQA 3LA8A 5MFZA 3TTUA 1POWA 5F52A 2O57A 2FCAA 2ZRNA 5JJ5A 1MABB 2JLQA 5HIMA 1Z5OA 3L6BA 1VRVA 1NFQA 5FBHA 1OIXA 5F9MA 4A26A 4DLSA 1ZMBA 2AOUA 4HJXA 5AW5A 1L5HB 3BD8A 3LBIA 5KYWA 2EOAA 2HH9A 4KQHA 5J9FA 2DWUA 5DGDA 2C8JA 5AI5A 1WQ4A 1A4RA 1Z45A 1VOTA 2WD8A 2Y27A 3ORFA 2WF5A 1DEOA 4AF8A 5J5CA 4JUIA 3O1IC 1M34E 1ESEA 4PWYA 3PVCA 5D51S 2VR1A 3L07A 4FI3C 5JI3E 3D81A 1E6WA 1E96A 3MPUA 1FDUA 5CD9A 4PQRA 1ZI6A 4V2UA 1MJHA 1QWSA 1L1RA 3C6KA 1AHNA 3DZHA 3DXZA 1TEZA 3T4EA 3L18A 3CB2A 1I3MA 2XADA 2SBTA 1OH6A 2QG9A 3F9IA 3RS5A 1G8HA 1SA0B 1R8JA 1SD1A 2FMIA 4LI3X 1C0LA 2V3VA 2GXSA 4KZKA 4TM7A 2Z8YM 4GKVA 1UOQA 1C50A 4F5DA 4MPTA 1E8MA 2EFGA 4RK0A 4EATA 1K97A 3OIWA 2DFKB 4K9QA 4KW7A 1ZGZA 5E3HA 5KCZA 4L5BA 4FKBA 2BFDB 2RAVA 3Q5GA 5DULA 4BLWA 2GQ0A 4A0RA 1U6IA 2ISQA 2JB9A 3LLUA 1X15A 3IE2A 1X7WA 2ZJFA 3LK6A 3NBQA 3OLXA 3PGXA 5A3RA 2ZR9A 2ZJ6A 3AWDA 1VECA 1Y8QB 3F5DA 3IT2A 4AUEA 2XTNA 2HXSA 3BTOA 4IFEA 3W4JA 1N1EA 2AOTA 1DLJA 3A58B 3HKDB 1UPXA 1XG5A 2F1HA 4MDYA 5IJWA 1EWKA 2AUNA 1TZBA 2FPSA 2O23A 2YWCA 4Q3CA 4JI5B 4B75A 2ZTUA 5CVDA 3NOVA 3ZH2A 3UB2A 1SRRA 4BQEA 5FTKA 1UBCA 4RORA 4N3AA 2FMFA 2CV1A 2NAPA 4UZEA 2A9OA 5L6MB 3PQ4A 3RBXA 4B83A 2EHDA 1AKVA 2QJOA 4EUNA 1YDMA 5KMGB 4D25A 2ZBFA 5DEOA 5MN5A 2R1UA 3K9GA 2QJFA 1EWVA 3N2EA 2H3EA 1YIAA 4MEBA 4B45A 2IQ5A 4QXOA 4C6SA 2OK7A 2E6UX 4TTAA 4FC6A 3C5CA 4YLYA 5KNDA 2NYAA 2PUWA 4DLUA 3DCIA 4FGJA 5IJXA 4B81A 4JQZA 2BEVA 3OY7A 4DSUA 4O5OA 1VPLA 3GROA 1FVOA 1G8YA 1NYLA 1YDFA 4M7PA 5F2NA 4YNBA 3PGMA 3GLGE 2WFMA 2O4CA 1Z38A 2G0NA 1ZD2P 4ROTA 5ELLA 3R9IA 4J0CA 5LVAA 1U7OA 3GJ4A 1VMIA 4JXZA 2OBXA 1N8NA 1KA9H 4CW7A 2H7YA 1Z35A 4KO1S 3WGQA 3QOFA 1U3WA 4FUTA 4ZU6X 3WGKA 1VE7A 4MS4B 1TVMA 4QRDA 4YYEA 1MGOA 1ULZA 3TQSA 5E8JA 3ZW9A 4ZXPA 5K09A 3UYKA 4H7HA 2O0KA 5FWYB 3SR3A 4MCIA 2O2EA 3WDMA 5DT9A 2XQGA 3FX2A 3P8ZA 2WSMA 3WWEA 5D84A 4FINA 4PM4A 1PV4A 2E0IA 2JFVA 1RPZA 1W87A 4FHEA 5LOVB 1JDJA 4LWZA 1L4FA 1EG2A 3B9PA 4NHEA 3C7CB 3M6LA 4X41A 3FDFA 5FRDA 2UKDA 3TG8A 5HMMA 3DF7A 3QLVA 1M2OB 1IPHA 1JQEA 4IX9A 4WBNF 4EUSA 5JASA 4JDPA 4DHWA 3B9BA 3BG5A 3E0XA 5BOSB 4M4SA 4WTOA 4YPOA 2ZBQA 4GUDA 1AGXA 1E9VA 4KPUB 4MI1A 3CH5A 1W6RA 5J4VA 3CV3A 4QNRA 4PYRA 5K3SA 1UJCA 2GEFA 5ENVA 4B6RA 2O8FB 3W7VA 1YJAA 3FNRA 1Q11A 3ZLTA 1M8FA 1QGED 5CBKA 2ZI7A 1G41A 1SZDA 1XZBA 4YGYA 3NIFB 2C98A 1NJ5A 2DU8A 4ZDWA 1YZYA 1N25A 4OOEA 2QRKA 2V98A 1KI2A 4M9QA 5TGTA 5H68A 1KXJA 4J7CA 5EN4A 2AQHA 2EJCA 2YBDA 5EIHA 1OIVA 3R4VA 4KOAA 4LHWA 5EUBA 5DHFA 3AKDA 3N28A 1K7XB 3ORSA 2LCIA 3HV2A 1ISMA 2BFFB 4KIWA 3DTNA 5L7WA 3IUBA 3REQB 3P2MA 1R0WA 1R18A 1XYGA 2GETA 1SUPA 4INPA 2E4WA 5CFPA 4IILA 4P0TA 3JQAD 4M76B 2FFHA 4MI9A 1FFGA 3RC1A 3IJ5A 2P2GA 5F33A 1DG1G 4CL0A 1XQ1A 2A9RA 4A82A 1G9SA 3ENWA 1T5BA 5HS6A 4Z4CA 5ABPA 5H3HA 5LP6A 1HH4A 1FXWF 5AWFC 3W1VA 1ZOPA 3CH6A 3MS2A 4GX2A 4MKFA 3UV7A 5EMKA 2L82A 4XARA 2AN3A 1E4YA 3WIDA 1TJNA 3IBYA 5JVDA 3DPIA 2A9FA 3EC2A 3WDKA 1QKIA 4E5UA 1E4EA 3I28A 1PDOA 4RC9A 5JLJA 1BEZA 3O4HA 3ZEAA 3SS8A 2Q5QA 1JIUA 5KOHA 1ZH2A 4DWWA 5A71A 4JODA 3TAHA 5A4KA 4N48A 2J7KA 3ZHUA 4JT8A 1LBIA 2NUTB 1MZVA 4FFPA 4Q7MB 3N8IA 1EHCA 5IDVA 1Z0IA 1W4ZA 1R9NA 3ETHA 5C53B 4CR6A 3S8YA 6AT1A 1A8SA 5AKYA 1Y34E 1M67A 3DE1X 5LQUA 1KP3A 2BBSA 5I7EA 2XYHA 1IZZA 4K40A 3PQ2A 3AM1A 3OC0A 4YMTA 4RAQA 2PGNA 3ZXYA 2BUCA 2XE4A 1W1IA 2YXPX 1CX9B 3C6ZA 3EY4A 1SCDA 1SIUA 3HXMA 3TMAA 4REMA 4E51A 1DC7A 2AR0A 2JH8A 1ZBDA 4FBLA 4EYEA 4GIBA 4LW8A 1DP4A 3B5EA 3EPRA 1W30A 3V1UA 2C5SA 2FPPB 5G2OA 2YJ5A 4I50B 4KN5A 1Q0RA 5LNK6 3EG5A 3OLZA 2BFBB 2QYHA 4MS3A 3RE1A 1GGNA 1KU0A 1V7CA 2YZKA 3NBFA 4PRZA 5DBFA 4BNNA 4CWAA 4YMUA 1L7BA 3E2IA 4GNRA 2QGZA 4I08A 1TM2A 3W8DA 3VPBA 4FB5A 4URXR 1AQJA 4AQYB 2CCGA 2AOVA 5HW0A 4JENA 4JUBA 5LYJA 2SKDA 4F1WA 3CVYA 4C3VA 3FGNA 2FN7A 4GGOA 3M49A 4F4JA 1CB7A 2PUAA 1VGRA 1UK9A 2P9TA 3EBOA 3I8SA 3OPVA 3WMEA 2VT2A 4HVAA 5J4LA 1SH7A 2P9QA 3X1YA 3MT7A 1MA3A 1OA0A 4IHJF 2PQMA 3M3DA 3TL3A 1JLLB 2WK1A 3MCUA 1VYUA 1ID1A 1Q1GA 2A1TR 1PS0A 2HD4A 3FHLA 3JD3A 4LS3A 3BL5A 4MVJM 5K1ZA 3TW8B 5ER6A 3HU5A 4EUEA 4F12A 2Q3MA 3TUZC 1ZJZA 1GPMA 3ZWKA 5E2AA 1M3SA 5IJ0A 1RJ9B 1U81A 4BO0A 5FNVB 2KHZA 2V7TA 3ILVA 3Q8XB 1MX9A 4PZAA 3OZIA 4HQRA 5ALQA 4IUCS 2RHHA 2ADOA 1IL0A 2HCRA 2XVMA 4EL5A 1VLLA 1PW5A 3H8VA 1RCTE 3FWPA 4X20B 1IN5A 1PEYA 3Q3IA 3E7WA 3KLNA 4YQYA 4D9NA 1MV8A 2ZRKA 4RUKA 3RPEA 3JD0A 3VR6H 4F1KA 1GWNA 1UDBA 3ITKA 1LDMA 2O3RA 1L5WA 3GT3A 2BR5A 2XE8A 2GN6A 2J9RA 5FHQA 4HNTA 1LTHR 2PZEA 1VKZA 2ZE6A 3EG9B 1FUYB 1T9AA 2VHQA 2JFHA 1JFFA 3TR5A 5JCJD 3W3AA 4ZJPA 2BGKA 3B60A 3JD4A 4FZ5A 5U9CA 2D7DA 4HVTA 3D3WA 4RPLA 5JFTA 3T61A 3TLGB 3A1VA 2WSLA 3L05A 4Z4QA 4O1MA 2DUWA 1YI0A 3CF4A 2ZR8A 3QF4A 1WHTB 3ANTA 3VNSA 1V9CA 1T29A 4PGAA 5L3SA 3QYJA 4TOIA 1CQWA 4P4UA 4F11A 3GJTA 1F20A 5KJEA 1E2BA 1WXXA 3AHGA 4X97A 3UAYA 3GJYA 4A8PA 2G04A 4M9UA 4K0RA 5A5FA 1QVAA 1HEUA 3DKVA 4IOJA 3JD1A 3PXGA 1GNQA 1YK1A 2W9XA 3WLAA 2QMHA 1ZK1A 1OIWA 3PQDA 4PG6A 4UTNA 2XKKA 4K46A 3EGEA 4MW6A 1RBYA 2W00A 4E70A 5HUHA 5E2IA 1P1KA 2PMBA 3BJZA 1P1RA 3G02A 3S70A 1F14A 4EIWA 1AHPA 1YB5A 1SXGA 3OZRA 3JD2A 2HMVA 3NP9A 1R0CA 3D6MA 1U9IC 4LG1A 4K6GA 2YFYA 4YI5A 3K4HA 4JX8A 4ECEA 4R71A 5E9JA 4RO0A 1CDZA 1THTA 3LRTA 5B2EA 1WZ2A 4IF4A 4OG2A 2AN4A 2O14A 4YP9A 4FNAA 3TECE 1NLFA 1TYBE 1BS1A 4MUNA 1U80A 2IYXA 1I32A 5HOEA 2C4HA 1VJTA 2WY2D 1W581 2ZJ4A 1W8IA 3DAGA 4ZEWA 1KFCB 2ZRJA 2E9SA 1Z5GA 5J1TB 5M3BA 2NO9A 3UJ3X 1HL7A 2Z1DA 2Z1NA 2J4CA 4PQYA 4QDKA 4TMFA 3DV0A 5BR7A 3B12A 5A4DA 1JQBA 3K5IA 4H16A 4B31A 2PKCA 3PZRA 4JC4A 4DLRA 2VG8A 5JDIC 3SF0A 1WOYA 3DMDA 3E70C 4NVRA 3PUJA 3ADCA 1POXA 3KCQA 3KLOA 4QL3A 2WICA 4ND8A 3GZNB 2PN1A 1DRVA 2IZ0A 3NVAA 4BUZA 1OQAA 4CNQA 4HEHA 1WOMA 1FFBA 1A98A 1ARZA 1C3VA 2GAJA 5AVUA 1WDTA 4UHJA 1YSCA 3R20A 2A5DA 4FGUA 1ISRA 2CGEA 4INAA 1FYWA 3LKBA 2IS2A 5HFJA 5BVGB 3ONVA 3Q7IA 1Z4PX 3MN1A 3T3DA 1H1DA 4L22A 4O2LA 2XCUA 1TEXA 4RL6A 4YWHA 2ZPTX 5FNZA 4NPAA 1SM4A 4KN9S 1NU6A 2O20A 2W42A 3LG2A 2V58A 1HFKA 1UODA 4KGVA 2NUAA 2G4CA 3JQAB 4QO8A 4Y6RA 4IJUA 4QJIA 4TWRA 4ESHA 2IEAA 2YS6A 4LHYA 3TNJA 4D9CA 4EHJA 2CNWA 3PNMA 3DGFC 1GGMA 1E60A 2O8BB 2I6XA 2E1RA 3JQQA 5CM2Z 4OM7A 3ZR4B 5KVSA 5DBEX 2QTFA 3ZCTA 3P1JA 4IOKA 2HA6A 1U9ZA 2DPLA 1EUDA 5F3DA 4DW8A 5LP6C 2VS1A 1BYUA 1FP4B 5AK5A 3KXPA 1JE1A 1Q1AA 1FVHA 1YAJA 2FX5A 3IUNA 2GCNA 4JGBA 3H6HA 2P77A 1SQ6A 2CHFA 3HDGA 3NRJA 4JCOA 4QPDA 2O7RA 2V74B 3EBLA 2A5JA 1JDUA 5HE9A 2G5CA 4Q1FA 3F6BX 5HX7A 3UHFA 2CMHA 1HX7A 1S2IA 3R40A 5I5GA 2Q1XA 3RSSA 4Z2YA 3O9VA 2I55A 4ZVQA 1J5PA 1CR1A 2HFJA 3DEHA 1V5EA 3GCGA 4L2IB 3HB0A 3RF7A 3RSGA 3ET4A 3L0IB 3NHMA 2IF2A 4O0LA 4EHNA 4PXSA 3HUUA 4ZWNA 3M2PA 4J1NA 2ZWOA 3ZYCA 3PRHA 5BR4A 4RV4A 1TKBA 2QD3A 3M9WA 3UAVA 3ZE0B 2NZYA 1O6FA 3BXPA 4N5NA 3A3KA 4PGMA 4MLDA 3FPLA 3V7YA 4MWGA 3GP8A 2FMKA 1NDHA 1RWXA 2G83A 2J30A 3LF1A 3O94A 4NC9A 3D6JA 4ROSA 2HHAA 1JJBA 3FXAA 4P4GA 5DOVA 1SVUA 1UDWA 4HDNA 2VYCA 1W73A 4OH7A 3S29A 2GXAA 5LN1A 1VRWA 1LI7A 2HF7A 3TNFA 4RTOA 4J2OA 3AL2A 2YMPA 3K0CA 2ZSHA 4OIFA 4RD1A 2VSYA 4H1VA 4ALNA 2QAGB 2NQ8A 3E6AA 3NBUA 2NSJA 3T5TA 5GONF 4CMAA 1Z7WA 1BROA 1DX6A 4EW2A 3N2NA 3ZIDA 1ADYA 2OZPA 3UOGA 2ONYA 3FOAA 1I4LD 3EC1A 3WAJA 4IIHA 4PIMA 2CNNA 2A9QA 2GHQA 2NT4A 2QPLA 1AK1A 3DFFA 1G3UA 4JIGA 3EZLA 2WMYA 3DE2X 4RE6A 4AECA 2RJOA 3WWZA 4IAOA 3DPUA 3JZFA 4B3BA 2C58A 5EFZA 4BIMA 3D2CA 5HILA 5DM70 3TJZA 1CULC 1E1DA 2B30A 1T0BA 3OZBA 5FXMA 3IERA 3KTFA 3SMVA 4E2WA 4XQGA 1X14A 3RNOA 3SX4A 2YDYA 1VL1A 1VXOA 2A0KA 2H54A 2HO4A 2ZB4A 3HMQA 1SHLA 1WF6A 1XQVA 3JTMA 2EWMA 1RI2A 2GZSA 1NBOA 4FZJA 4J75A 4LY0A 1RKQA 1L5HA 3FWKA 2ZJ7A 5FLEX 4NOLA 1ODLA 2JPDA 1YCGA 2VCHA 1VLVA 3EGDB 3OZVA 3UZUA 4MVJF 2G07A 5HKLA 3TZQA 3OKPA 4O4JF 3V8VA 5ICSA 1MT0A 2EHJA 3CEHA 3DZIA 5CDGA 3COPA 3OQVA 1ECJA 1M8KA 2E1PA 3I0ZA 5F2EA 1GPBA 2QPAA 1YCHA 3DVAB 1Z0ZA 2G88A 2YVLA 3UCXA 2WYUA 1KP2A 3ZZ0A 4BNDA 1CLEA 3C24A 3GG2A 3E5RA 2R8EA 1XEFA 3GFFA 5JDCA 1Y6RA 5EKTA 1J2UA 4ZQCB 3D5TA 1B6RA 1YASA 4M0PA 4WADA 1KDYA 4ZTBA 1RWKA 1Y4ZA 4BIIA 1YVUA 3LBHA 5K20A 3UAWA 4IWXA 5TXGA 1OTYA 1CUWA 1CZRA 1G2IA 1NT4A 4DV0B 1ZD9A 2ZPUA 4XH9B 1NQUA 2ODPA 2WT4A 4YUYA 4EKGA 5BUQA 1A1VA 1M2NA 4OXNA 1WA5A 2DFVA 4KL8S 1KH2A 2PM8A 4N0MA 3MJTA 2WP8J 3CNBA 1SUCA 1XFDA 2GK4A 4FYHA 4O0MA 4PYNA 3UKJA 4BRWA 1RVV1 1KWGA 1XVAA 2LXNA 1JH9A 1TUBB 1YA8A 3NH9A 1HBJA 5BVHB 1Q1EA 4V1CI 1MW8X 4CMEC 5REQB 4FW9A 2QN7A 5A9SB 2E5LB 3Q87B 5JBIA 4HGYA 2AOTB 3HKDA 4DR1B 2GPJA 2J5BA 3OE5A 4DZRA 1HDIA 5FWNA 1LFAA 4GLBA 2G1JA 3NHSA 3FA2A 1J70A 5E6RA 3K1AB 1FFAA 5LQCA 1I4DD 4CM3A 4FTWA 1IAQA 1VLHA 2WV9A 4FDVA 3UGKA 1G20E 2I6UA 1YKFA 4U2BA 3FZNA 2DQKA 2PG3A 1MQSA 3CWCA 5EKXA 3TI7A 3TRIA 3UJCA 1X1SA 1XCPA 2QMYA 3EASA 3STUA 4DCUA 5AHOA 5KKCA 3B1ZA 4DANA 3AQIA 1Z8DA 1GRVA 1K0UA 2POCA 5KTYA 3KOOA 2C9OA 2QQEA 3CINA 3PS9A 4JDUA 5BW6B 1J0AA 4XCXA 2CEKA 5LUBA 2JLAA 1NMQA 5CX4A 2IDMA 5AJYA 1NNI1 4DA0A 3UWMA 4CE6A 4FOLA 5EP2A 3CO5A 1WABA 1F6BA 1EUCA 1NR5A 4X8OA 3HJAA 3S2UA 4OB6A 2PKEA 3RUHA 1PL6A 4L3OA 4YJ3B 4H4CA 3COWA 5G3ZA 5LMCA 1LTKA 4AZSA 5KPDA 1UOPA 4IS3A 3EDQA 4KAAA 4WCVA 5K0CA 4ZYXA 3IKJA 1DEXA 3SS7X 2BFEA 4G5YA 2G1PA 1L4MA 2OY0A 1C1HA 3W2FA 1QLWA 1MAWA 4RYLA 2HQ1A 3E9CA 3JRXA 1CZLA 4LHZA 1TO2E 3F1KA 4M8IA 3OOWA 1GGVA 4AJ9A 5CXUA 1DHRA 2VKQA 4I4IA 1TMGE 3WRYC 4YRFA 1EX9A 3CX7A 3SR4A 5DHAA 1JA1A 4FDUA 4M0LA 1IBCA 2HA7A 3IV6A 4N5MA 4L75A 4MGHA 1JT9A 4NENB 4IG4A 1JS1X 1SCQA 3UJNA 4IX1A 1BKYA 4TRMA 4PG8A 2NO0A 1VBMA 5AJWA 1OLUB 1MO5A 2BZGA 3RTCA 4IIVA 1K8XB 4PY2A 2QRHA 3CT6A 2BP7B 1NXSA 3HN7A 4JHLA 4W5WA 3WGTA 4ZCRA 4NEGA 1W5FA 2RHWA 3FFTA 3OTWA 3QWIA 5DASA 4C4SA 3C85A 4JOBA 2WLTA 4Q9AA 4CLRB 5JC8A 4BX3A 3PFHA 1T6NA 2QN1A 4I3GA 1EK0A 1F8GA 3RYTC 4GOJA 2NSDA 2RC5A 4WZ6A 1A69A 4PXYA 2O52A 3F5MA 3KT3A 4HWOA 1PFUA 3VDQA 2ATEA 3K9NA 3PFIA 1E94E 3GFOA 4CKXA 1MX3A 4QHTA 5A0TA 2WJ6A 4TTSA 5K5EA 1N9GB 4U6SA 1VSUA 2VSOA 4YMLA 1ZLXA 1ZO8A 1QK5A 3G2LA 1EA5A 1W85A 1KI7A 3KBBA 1L4NA 1JMYA 5CHEA 4S04A 1LPOA 1EVJA 4NZYA 1EM8B 5LQRA 3ET5A 1G20B 4EGCB 3FG9A 3HSYA 1GNPA 4YAOA 3R5SA 2RGNA 2AV6A 2XYVA 3QKIA 2DHDA 4UM7A 3ROZA 1AQYA 4JYBA 5AIBA 1SOAA 4P9NA 1KEUA 1KOFA 1TA9A 5JFGA 5J2TB 1D4AA 1PR9A 1Z17A 3RUFA 1AA9A 2BFFA 1OSNA 1VYHA 4I9UA 4JBLA 3DE3X 2QY6A 4TWIA 5D5QA 3W5VA 3G0DA 2WFAA 5CVVA 1E0SA 5DISB 3DTVA 2DH5A 1GILA 3K8QA 4PFKA 3TL2A 3ELWA 1G5RA 3UQYS 3P5SA 3HO8A 3GI1A 3HCBA 3ZBTA 1O96A 1TK3A 4C89A 3TDNA 1WXWA 5I8WA 1BCRA 3KZOA 4WA7A 2CXPA 1UPUA 1RBMA 3BCSA 2YRXA 4OXYA 5FLKA 3T41A 3DZFA 3FPCA 3ZZUA 5JXJA 1QR2A 2WFLA 4QJBA 2G63A 1V1RB 2VHEA 2A5FA 2PXXA 2YJ3A 4PHFA 1ODTC 4EY6A 3THWA 2IF0A 1MQ8B 3BILA 1RTKA 2DWQA 5BN3A 1FNNA 1NV8A 2C78A 4UBJA 2JGMA 5FBVB 1X38A 5H4HA 1PT9A 3OUTA 1SIWA 4LYHA 2BH9A 2Z98A 1VKHA 2JK1A 1HZZC 1E7RA 2RGXA 3HPQA 4OF4A 3TLAA 4CQMA 4YT8A 1OXUA 1U7WA 3GRFA 4CIBA 5EMLA 2R1TA 4GBED 2JAHA 2NXCA 1GTZA 1N2CB 4FU0A 5HCUA 2AW5A 5IJ9B 3EUWA 1PQYA 5A6SA 1SVIA 1X1TA 3PD1A 3HJNA 4IZHA 4DDMA 2GGSA 3DHNA 1SCUB 3C16C 3QUBA 3Q8LA 5IX8A 2P41A 4LDZA 1N2SA 3QYFA 4MRNA 5KOIA 8OHMA 1YULA 1YS9A 1GZUA 2BEJA 2NZ2A 2Q2OA 2R84A 4O25A 4HNRA 4PAQA 5BSMA 2JI7A 3SSMA 4Y3UA 4AY5A 3U17A 1MV5A 3KT8A 4K9LA 1RQLA 3RADC 5KZMB 1I4TD 1QH8A 1P6XA 2B7LA 2R2GA 2X4GA 4LOLA 1IZ9A 2EARA 1CRQA 3E22B 3GA0A 1NP7A 4E2ZA 5JQGA 4X71A 2WSSA 4MQMA 1DTWA 3IP3A 2WJYA 3KX2A 4KUGA 4JI7B 4LZJA 4DYHA 5EXPA 3AYXB 2P5TB 2XUPA 4YJGB 3VC7A 1P5JA 1ZZEA 4QELA 3RKSA 3TR6A 3RVDA 1KORA 1L6IA 3KEFA 3NEAA 1YL7A 1KVUA 3O9ZA 4RD2A 5EIBD 1WUKS 2V7EA 2X5OA 4FFWA 2LV8A 4F8JA 1OU4A 4MLZA 5TARA 4G1UC 3ETCA 2QZZA 2NO4A 1U1FA 4WZBA 5TGZA 1M7HA 3IBTA 3OOEA 4G97A 3RKRA 2DFPA 3D02A 3ND9A 3RG8A 1W88A 3WKDA 3GUVA 1YR7A 4IDEA 2V4ZA 3ENZA 5EE0A 2G09A 3FR8A 1P5FA 4D8VA 1AV6A 1E9SA 4KLNA 1AZLA 5EMHA 5KNDH 2VWQA 1UM8A 1U04A 2BMJA 1KYVA 4M55A 4EQ6A 3QSYA 4J4BA 4BQSA 1NE2A 3KVYA 1NF9A 5COAA 5DW0A 3ZNPA 4QOSA 3IQEA 4JYZA 1PFVA 2HRZA 3NOOA 3BIWA 4EF4A 3BT7A 3L4SO 1RKUA 4BNLA 5DTRA 1TMYA 3D4IA 1FDVA 4Q4JB 3KSMA 1UZMA 1KDTA 4EAQA 1FBNA 1K6MA 1VCMA 3A28A 4LOKA 4BX9A 1O54A 4OI0A 3ESXA 3N8HA 4LSZA 1TCBA 1YB4A 4IDGA 3FRIA 2BHLA 3M70A 4M83A 4ZQEA 4RTMA 5HKOA 4LZAA 1D2RA 3W2TA 1Q7BA 1RDFA 1A9QA 4URYR 5KNCA 2F67A 1K4MA 2H06A 1JAHA 4FZRA 4V3BA 4CTMA 2ZZMA 4ZI7A 5EL0A 2EKPA 1A82A 3HUFA 2EDCA 1T5SA 1R0XA 3ADPA 2PUFA 4X1OA 2WOOA 5IZCA 2P7HA 4XDYA 1YRHA 4P53A 3IA2A 3MHTA 2CCJA 4Y9UA 4YR9A 5K03A 3S99A 2MSLA 4AK9A 4Z2AA 1AN0A 2O8VA 3O6VA 3SY8A 1L9XA 5KDLA 6NULA 3AM4A 1R6BX 1GOTA 2CJWB 2EFYA 4TS9A 1ZU5A 4JGGA 5A3VA 3RG2A 2AYXA 1FB5A 1Q91A 3R24A 3IODA 4F2WA 2XUAA 2HA3A 1KY4A 2CWDA 5A4IS 4HD8A 5HQTA 1BXZA 1AHIA 3CEJA 4MR7A 3SOZA 4MIYA 1N6PA 3VJRA 4G4IA 1UBRS 3Q9UA 3QM1A 1YTUA 2CZGA 3TBFA 1VKOA 3BFVA 4B3DA 4EFNA 2W4IA 3HU3A 1EFKA 4YP0A 3SHWA 5H83A 2LCFA 2DUNA 3BRSA 3G7UA 3L7DA 5TMDA 4CTKA 4ES6A 1A72A 4MP6A 5CCBA 2GHTA 1L8QA 2WE7A 1ZDMA 5EHGA 3PC6A 4UW9A 3AKEA 2G5PA 3TB4A 3H2YA 1QG4A 1ZK0A 4M22A 1T1JA 2HMUA 1QHGA 3CZRA 1BD3A 2NG1A 3GD5A 4Y7CA 1N6OA 4CLOB 2EQ5A 1KMHA 3SFZA 3UFXA 4EI8A 8ABPA 4PZZA 4I5IA 2HL6A 4BB0A 3KVOA 3RVKA 3R7AA 4TVSA 1G7CA 1GPH1 2GBPA 2JLCA 1Y42X 3P2KA 5DNWA 4XVUA 3TLJA 3TGPA 2OCIA 4QODA 4DLPA 3VDMA 2FWMX 2FEXA 3VVLA 2Z2IA 3EEOA 1SKQA 3HVIA 2ZR0A 3DNFA 5CT5A 4DA4A 5AVSA 2AG0A 3WRXA 1UJ5A 4NL4H 4B3TB 4KQ9A 5AVKA 5JG7A 2JJ8A 4P0PB 4LHEA 1B15A 4A5SA 2WKRA 3DJFA 1G8MA 3E5HA 3UWOA 4FFSA 1FFHA 2P7IA 3JYPA 4A