4CLRA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 90
structure length 249
sequence length 267
chains with identical sequence D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4clrA00
3PGJA 3JQAB 4CR8A 3HHPA 4URFA 5I8ZA 3V1UA 1ENYA 2OP1A 2OBYA 3AY3A 4NBWA 1B2LA 3QWAA 4LW8A 4XGNA 4CV0A 5T67A 3B1FA 1FDTA 1EK6A 4ND1A 4RLSA 1QKIA 1PTJA 2DKNA 2VTDA 3DBVO 3HDJA 2GUGA 3AJRA 1NBOA 4ALMA 2B5VA 4N54A 2OHXA 4XR4A 3OP4A 5ADHA 3AUTA 3PQDA 4CLDA 1NQAO 1A27A 4YTEA 4D3SA 2FSVA 4B8WA 1UXGA 4IINA 2NTVA 2AQ8A 4IXWA 1KOLA 3QHAA 3WMWA 5B1YA 2OO5A 5F5NA 4CPDA 2XXBA 5U1PA 3I9LA 1ZEJA 4CMEC 5JO9A 1EEHA 1I32A 4PCVA 2FP4A 1YOVB 4BNUA 1DAOA 1K5HA 3H5RA 1PJLA 1PJQA 3G1UA 1T1SA 1M6WA 1YKFA 3CH6A 3DDNA 1L7DA 4IDEA 1R15A 4BNKA 1GD1O 1MLDA 5L95A 4CLRA 2GLXA 1PJ2A 3RBVA 4YR9A 4E5KA 4YT8A 3KB6A 2O7SA 4CMBA 3DQPA 2G0TA 4PLZA 1QXSA 4K6CA 2AA3A 5GZ3A 4L8VA 1LTHR 1SAYA 3I83A 4DTIA 2H5LA 1W73A 4IDAA 3SJUA 1JKJA 3F47A 4B4OA 5BNFA 4MKRA 4BQRA 1ULUA 2FR8A 4MVJI 3TJRA 3HNPA 2ZTVA 3F4LA 1VKNA 1A72A 2RH8A 4YQYA 1SEPA 1GQYA 2C2XA 4H15A 4LN1A 4GSKA 3FNHA 3HWRA 1DC6A 3BXXA 3FNGA 1P1IA 3VTZA 5BSHA 3MOIA 2I67A 4HFMA 3I6QA 4RORA 1CRWG 1T25A 1AHHA 3E5RA 3RQSA 3VKUA 4DWVA 3QVXA 3F3SA 3E18A 4XDZA 3PJFA 2EEZA 3L6OO 3NT5A 4NJOA 2FR0A 4N5MA 4UVIA 4F3YA 3GZ4A 5TX7A 4BQPA 2WSBA 5A1TA 3W8DA 5FF9A 3D4OA 2Y66A 1JVSA 3FWZA 1WLYA 4JJFA 4D7AA 2PNFA 3ZU5A 3WNQA 3G0OA 3GQVA 3ROPA 1C0LA 3W4JA 8ADHA 3M6IA 2O3RA 3DMTA 4NPCA 5DOZA 1P0CA 3RAJA 4OOEA 3ZDFA 1BGVA 1K6JA 3DZGA 3UH1A 3E6AA 4R54A 1H6CA 3OQBA 4CM6A 4BO8A 4BMSA 1N1EA 1I36A 4CMKA 5K6AC 3U9LA 3H6KA 3WSVA 1H6BA 4QO7A 1QV6A 1ISIA 1R6DA 3HE3A 2CVQA 4YB8A 4H16A 1HSOA 3HDHA 3L0DA 1O89A 4PG7A 4E2WA 3LU1A 4LMRA 1D1SA 5HWSA 3PJEA 5AXAA 1X15A 4BHTA 1OFGA 4J90A 1D1TA 2O50A 4NK4A 3JYNA 4BNMA 1KERA 3RC9A 2JD1A 1XQ6A 3CKYA 3H5AA 1VLLA 4PLYA 2PKRA 4RPGA 4PVDA 4CQMB 3DFUA 3QWFA 3JQ8A 4F6CA 1H5QA 1SB8A 5HA5A 1UDBA 5JC1A 3I9MA 3NTRA 3PTZA 3ETGA 4UVDA 2IZZA 4WLUA 1RKXA 4FDAA 5A3JA 1Z6ZA 3O4RA 2G17A 5HRUA 1GR0A 2AMFA 1ZVMA 2HMTA 4QECA 4PRKA 1TA4A 3RJ9A 4YVFA 3BHJA 4EZBA 4S3MA 2IEDA 4E12A 3R3SA 3L6DA 4FGWA 5TSDA 5L4LA 1MFZA 3GPIA 2EW8A 4BO0A 1JA9A 1HF3A 1ENOA 1YB4A 4XYMA 4KTVE 3L9WA 1J4AA 1LSUA 1PWZA 4E13A 1I10A 4D3FA 3E5MA 1K6IA 3FNFA 2GPTA 1GZ4A 3Q2KA 2C59A 3I4FA 3UN1A 5A04A 4WK6A 1FXSA 2VYND 1BXKA 4HP8A 1KEUA 1HZZA 4MO2A 4W7HA 4EGFA 1LJ8A 3ICCA 2P9EA 3W8FA 4EUFA 1NTOA 3IKVA 2PGJA 3KV3O 4KP7A 3WYBA 2CDAA 1N1GA 3C7CB 4AG3A 2ZIZA 1DEHA 1P31A 1UXJA 1R37A 1DO8A 3EK2A 3D5TA 3ETEA 4OH1A 3L4BC 3ZNOA 3FPCA 2C5AA 3C8MA 2BFAA 3R1IA 5ILOA 5HS6A 1P1RA 2R00C 3OH8A 1EFKA 4JN6B 5IZCA 1J0XO 4RL6A 2Y1DA 1NVMB 1PL6A 3GOHA 3PDJA 1A5ZA 4IXTA 4O1MA 5AQ1A 4UEOA 2PD4A 3ZWVA 4FOSA 3KYDB 3RUHA 4W9NC 4CM8B 4CLOA 3UF0A 5G4LA 3GGPA 3QVSA 2NU9A 2POQX 1LDYA 3GDGA 4ND2A 4PRLA 2J5RA 2WD7B 4OGWA 2O7QA 1EVYA 4OIMA 4A73A 1G1AA 1MC4A 1XU9A 1NASA 1BWSA 2J5QA 1JW9B 2Y93A 3DO5A 2Y99A 2Z1NA 5JMPA 2PGDA 3S2GA 1NPTO 5A9SA 4WE3A 4IPTA 1M76A 1V8BA 5KIAA 2C54A 1SO8A 1QRRA 4XWYA 4KQWA 3I1JA 1DIBA 2VUTA 3BMQA 4JBIA 4ZD6A 3U49A 4WUVA 4IDFA 5I7SA 2QW8A 1UDCA 2HMSA 3GRPA 1E5LA 1IZ0A 4UUPA 3ZWPA 4TRJA 1BG6A 5ENVA 2VYVD 2HUNA 4DBZA 3BMNA 2GN6A 3PYLA 1BDBA 3NT4A 1TT7A 1Y6JA 1DFHA 3GNSA 2P9GA 3KHUA 3TPCA 1P0FA 2C2YA 3D3WA 4RZIA 4UUMA 3ABIA 3GVPA 3SLGA 4AJ4A 2OGUA 4RVUA 4K28A 1E1LA 1P1HA 1E3EA 4IIUA 1UAYA 3HZZA 4BUCA 3OA0A 1GFSA 1HDOA 1Q0HA 2C20A 2ZTUA 4R1UA 1V3UA 1PU2A 2PKQO 4U0JA 4HX5A 2PY6A 3LT1A 5I7EA 2AXQA 3GUCA 4IMRA 4RVGA 3EVNA 1XGKA 1LA2A 5ICSA 2Q4EA 1ISMA 3RC7A 3BTSA 4NG5A 4RV9A 2HMUA 1DHRA 2WE8A 4CLEA 2NUAA 4XJSA 5IJZA 1I3LA 4OHUA 4XZ3A 1VPDA 2FMUA 3EW7A 4R3NA 1FF9A 2V6GA 4YT4A 3GEGA 4CMJA 1QR6A 3B20A 5B4TA 1ID1A 1HT0A 1DIRA 4YAIA 5L51A 3VOSA 1DRVA 3TL3A 2E37A 4RGBA 2YV1A 3VZSA 1H9AA 4D79A 4Z0TA 3SEFA 1TT5B 1VSUA 5I8WA 4UULA 3DBRA 4M55A 3RROA 1U3UA 4UUNA 5DCWA 3WGOA 1B8UA 1YS4A 3OETA 4CM4A 3L9XA 4E4YA 4Y9DA 5TQVA 2CVOA 4A7PA 1LRLA 5A05A 4LCEA 4AICA 4JX8A 2V7PA 1HE3A 3DL2A 1RYDA 3H3JA 3GMDA 5C7IO 4E21A 2X9NA 2OBNA 2GERA 3OJOA 5GY7A 3KO8A 3WWYA 4CR7A 3A4VA 3MJ4A 4CM3A 2D5CA 3PHJA 1U28A 1B8VA 1WXDA 4H3VA 4TRRA 2YW9A 4MKZA 1WDMA 3BTUA 3KUXA 5A06A 2DFDA 4DYDA 4JXKA 4J7CA 4Q3CA 3RKUA 3H5NA 1YL6A 2E4AA 2X86A 4DGSA 4E5NA 5IF3A 2OFPA 2NQTA 4TKLA 1Y8RA 3VPGA 4OMUA 5JCJD 2CUKA 3H9JA 2NQ8A 4MJLA 4RCVA 1F12A 2J6IA 1H6AA 2WYWA 3PRJA 3S1LA 1R0KA 1T2DA 1PZEA 2VRBA 4AJIA 3H9EO 2Y0EA 1E0DA 3RC2A 3RFVA 2OXIA 2VHVA 1BSVA 1J6UA 4R69A 1EVJA 1YQGA 1QYCA 2YZ7A 3DB2A 4TRMA 1HXHA 4BNXA 5ER9A 3F1KA 4UAGA 2WE7A 3FD8A 3JQ7A 3QE3A 4FR5A 2HK8A 4DPLA 2W2KA 4GVXA 3WOHA 4CM5A 3GFGA 4CMHA 1ZZEA 2EKQA 4HXYA 1GL3A 3RJ5A 1IHYA 2Z1MA 2W90A 4BKRA 2GCGA 1ZO8A 1NM5A 1ZMOA 6ADHA 2X5KO 3K6JA 4ZQHA 3KBOA 2G1UA 4OQZA 2BRUA 3KYBA 4ALJA 1ZKMA 5A3VA 4IQ0A 1VJTA 3BTOA 4YXFA 4XYEA 1G6KA 3PXXA 4YCAA 5F1KA 3ZH2A 4P4LA 3X2FA 3GMSA 4XR9A 2UDPA 3KVOA 4WCDA 3DMTC 1RM4A 4IQ8A 1X7DA 3ZHXA 3UFXA 5CP8A 1E1KA 1ZK2A 4MVJA 1E3LA 4OXNA 1HDXA 2DBVO 3GGGA 1XSEA 1DIHA 5FYDA 4XGKA 2I5PO 3TNLA 4HY3A 3NRCA 5JAIA 1ADCA 5L7WA 2EXXA 4MVJH 4MVJF 4CLXA 1LLQA 1XA0A 3FRJA 4YJGB 4MP8A 4IJWA 4BB5A 2ZYGA 4U0KA 2Q99A 1B3BA 1GPJA 4IDDA 4IGFA 4M89A 4I9HA 3AUUA 1I33A 1WDLA 1C0KA 4LVCA 4J16A 2EP5A 1FDVA 3E48A 1LRJA 3FI9A 4GMGA 4NBRA 1C1XB 5G0WA 1H0KA 1C14A 1FDWA 5DP1A 1OBFO 1W8DA 4QEDA 2HCTA 3WX0A 5CDSA 4OO3A 4RVDA 2JD0A 2X22A 4WLVA 1P77A 1XU7A 1HLPA 3BHMA 2ZQZA 4O63O 4WECA 1MP0A 1VKOA 4QT0A 3B70A 5DULA 2J8ZA 2CFCA 4PG8A 2VWPA 4ND4A 4N18A 1GQ2A 3WGIA 2VCYA 1LQTA 3TSCA 3VPSA 5TJHA 5BQFA 5CHEA 4CMIB 1PJCA 1Z7BA 1EK5A 2HMVA 3RVDA 1JWBB 2E82A 3WB9A 4YAJA 3U09A 2PD3A 5A9RA 2EW2A 2VUUA 4OSOA 1E92A 4QFCA 2TMGA 3D5QA 4CMCA 1FJHA 2OORA 4R1NA 3RUAA 2V65A 2AG8A 4L4SA 4IS3A 1X7GA 1QYWA 4R1TA 1I2BA 1W0CA 4NMHA 2Z5LA 3JQGB 3HN7A 4Q3DA 2JFFA 3GEMA 5TNXA 3QWHA 4G65A 3PWSA 1GV1A 1Q7BA 1RYEA 4A2CA 3PIIA 3UW3A 4I1IA 1VL8A 3Q6IA 1FDSA 3AK4A 1T2EA 3Q0EA 3U3XA 4AJLA 2C7GA 5B37A 1SOWA 3JQAA 2OP0A 4JP3A 4E2YA 4QX6A 1NHWA 2PZLA 3GUYA 4IJUA 3V8BA 4E2ZA 1UP6A 2V6FA 1R66A 5JSFA 2G5CA 2PH5A 1ZNQO 4CJXA 3K5PA 1UZMA 5L9AA 4HV4A 2Y1EA 1CYDA 1CERA 1Y5RA 3HDQA 2VWGA 4PFJA 1Z82A 4Z6KA 2C7VA 1E7SA 1I5RA 2H1SA 4IJVA 3RWBA 3GY0A 3T4XA 4HFJA 4CMGA 4IBOA 2NLOA 2X0NA 1TVEA 2FZEA 4XYGA 3C1OA 5JYDA 2ZB4A 5A5FA 1Q2XA 3V2HA 3IJPA 2VHXA 1WMBA 1U4SA 1PGJA 3ONFA 1B0AA 4UVGA 2P68A 4OSPA 4KWIA 1C3VA 3LC7O 1EZ4A 5ILGA 4IMPA 3NUGA 2ZCUA 4BL5A 3LZ6A 4R1SA 4CLRB 4K26A 3ZHYA 1QORA 4LVUA 3WFJA 3A28A 3QV1A 1PS8A 4E30A 1ORRA 3AFMA 4FW8A 1C0PA 1OC2A 5JFOA 5ITVA 2JAHA 5KTKA 2ZYAA 3DTYA 1D8AA 5F5LA 4WNCA 1DC4A 1HETA 1MB4A 3TZHA 4BV8A 5EESA 2E48A 3O03A 1CJCA 4J1QA 4OAQA 2B0JA 1KEWA 4GLOA 2QRJA 2VT3A 3CZMA 1M67A 4GX2A 2DU8A 2EJWA 4A27A 4DA9A 2JJYA 4CM9D 4EUEA 5K6AA 3FHLA 3IQDB 3WYEA 1U7HA 4DL9A 3KXDA 4AJNA 2HU2A 3RSHA 3ZU2A 3WG9A 3QSGA 3WS7A 1MC5A 3NTOA 1SCUA 1E1MA 2OL4A 4FCCA 4G2NA 1YQDA 3ANMA 3IOYA 4CUJA 3DFZA 2JKVA 4E32A 3RKRA 4RQUA 4XQ9A 1L7EA 4BNNA 3DHYA 1GDHA 4UVHA 1DBVO 3JYPA 2WTBA 4NJMA 2WYVA 4NFHA 1I3MA 4UUOA 1NR7A 3RIHA 3K8ZA 3TN7A 4AJKA 1IY8A 1C1DB 1MA0A 1YB5A 2PLAA 2WM3A 2H6EA 3HN2A 3JQAD 1KVRA 3PI7A 3S55A 3ZWMA 1F06A 3U5TA 2ZYDA 3VKVA 2Y1OA 3ON5A 4WJZA 3W4KA 2AEMA 4NK5A 1Z45A 3KSUA 1HYGA 2C82A 1YH3A 4MOWA 4CM4B 3RCBA 3DC2A 3QY9A 4YRDA 4BKOA 4LK3A 2YDXA 1PJBA 1U9JA 2CD9A 3L77A 3RFXA 3LSYA 3OJEA 4HFNA 2QRLA 3GDFA 1LX6A 4PG6A 4AJJA 3GN1A 5G0VA 3GC6A 2B4TO 4BKQA 3KM0A 4EDFA 1YJQA 2IE0A 1LBEA 4EI2A 4WLNA 4WOKA 1I8TA 3F4BA 3S2FA 5C7LO 3WIDA 1V9LA 5JAZA 4QSMA 1HE5A 3NDRA 1X1TA 1KVTA 3MZ0A 4XX0A 1ULSA 4K6FA 3DONA 3PFWO 2X9VA 3QQPA 2UAGA 3OFSA 3ZWOA 1WMAA 3GDOA 4IZIA 2NVWA 2WMDA 1UP4A 2W98A 1MXFA 1RM0A 2Y68A 1I30A 5T8KC 4AJOA 2Y1CA 1LRKA 2FPPA 2DAPA 3F5QA 4J43A 5G4KA 4CQMA 3LVFO 3JQ8B 4MVJM 3PFFA 4B7UA 2IXAA 1HWYA 5EQDA 2BGLA 2HK9A 1PL7A 1NVGA 5K9ZA 5THQA 4U6QA 1HDCA 2VNSA 5CDTA 2QX7A 1NAIA 2OZPA 4RF2A 4AFNA 4C7JA 1WDKA 4XA8A 4YJHA 1JAXA 1Q7GA 2CF6A 2DLDA 3OSUA 1MG0A 1X0VA 3VTFA 3TZ6A 3UVEA 4FGSA 4DIOA 4ALLA 4D0RA 2WYUA 3ZU4A 3GG9A 1LSSA 3EC7A 5C37A 3KRTA 2GASA 4YPOA 3OQ6A 5IFLA 1EUZA 4NHEA 3Q2IA 2CZCA 5I7VA 4DLAA 1CIVA 1DRUA 4U6SA 3AU9A 4LGVA 1TT5A 4L74A 1DB3A 4EITA 1SC6A 3FNEA 4QO8A 3DBRB 1QYDA 3ASVA 1RPNA 1X7HA 5JNLA 2BFPA 4BO6A 2HK7A 1K0UA 2BGMA 3AU8A 1QSGA 2PZMA 3WGGA 3WQQA 4CV3A 2X7HA 4W9NA 4D44A 2IYPA 4EBFA 1X0XA 2EIHA 1U3TA 1Q0LA 4ALIA 4M8SA 3ZW8A 2HO5A 2FPIA 2HAEA 3KEQA 3TOZA 2H9IA 4YJGA 3QLJA 5IDQA 1B8PA 4L73A 2UUOA 2BH9A 4DQVA 2GZ2A 4GL4A 1O94A 2BLLA 1H93A 1HE2A 1NQOA 2C0CA 1UXKA 3PQFA 5BR7A 5JXWA 1A71A 5BSEA 3SX2A 3TZQA 4P8RA 1VM6A 5DDIP 1OC4A 4E5MA 4W99A 4YJDA 4GX1A 2VZ8A 1YL7A 3GR6A 5AXBA 2CDCA 1LSJA 3KSDO 2ILTA 4WCFA 5IDXA 1A7AA 2JCYA 3MJVA 4PZEA 3F9IA 3WGYA 1SOVA 5A9SB 1BHSA 1ISJA 2P5YA 4I9UA 1DC5A 4IY1A 5AYVA 3T7CA 3VH1A 8LDHA 2V6MA 2AEFA 3WIEA 3BAZA 4WKGA 1VL0A 4HADA 1VRWA 4FFNA 3BMQB 2YHIB 2QZZA 1PSDA 1GQQA 4PLGA 2IODA 3JQ7B 3OJ0A 1ZXLA 2Q46A 4J0FA 2XPCA 3KETA 4ZU3A 4CMIA 3ZWCA 1P44A 4ZQFA 3LLSA 4LCJA 1IYZA 3ROMA 1JDJA 3OHSX 1NPYA 3VPXA 3Q11A 5JDIC 1IUKA 4XB1A 1Z74A 1HLDA 5CDYA 3I4CA 3AI1A 3M2PA 1PQUA 1Y8QA 4J9UE 3EAGA 3WGZA 4D0SA 3SBOA 1E6WA 3INTA 1EMDA 3EY4A 3FBTA 3NAQA 3GNQA 5I7FA 4NU6A 3H9UA 3ROKA 1ZCJA 4LRSB 3VDQA 5CPBA 3UHAA 1TXGA 1K89A 3DZHA 4FC7A 1OZAA 1YO6A 2IXBA 1O8CA 1NXQA 4IDBA 2RH4A 3KZVA 1T4BA 4J1SA 3AUSA 1XYGA 5CPFA 4JBGA 1M6HA 9LDTA 1AXEA 3ZWYA 3DZBA 3OBBA 4YACA 4I9NA 1EQ2A 1YXMA 2Y0DA 4FN4A 3WTCA 1PEDA 3KYDA 4RF5A 1LUAA 1AGNA 1R0SA 3ICPA 2J3HA 3AY7A 3QWBA 4GMFA 5IAAA 5CG1A 2PZJA 3FR7A 4YAEA 2DFVA 4EYEA 1RM5A 2WD7A 5FI5A 4XCVA 5HS4A 4GWKA 2PWZA 3VC7A 5T8KA 4P4NA 3GA0A 2HJSA 2ZKLA 5CDGA 1QLHA 3HB4X 2BELA 2PKQP 2FZWA 4INAA 3O26A 3I9NA 1ISHA 5MGBA 4M1QA 5EMHA 5H81A 3ONEA 3QVOA 4FFOA 2WEKA 1A4UA 2W4QA 3QW2A 1ZH8A 4H7PA 1U5AA 3INRA 5T6BA 2J5KA 2A4KA 4FJ0A 4BGUA 5FFFA 3AI3A 1YE3A 2DC1A 1W6UA 1N7GA 4XEHA 5JDCA 4A10A 4QUKA 5LC1A 4Q39A 3IP1A 2NNLD 4HNHA 3NV9A 1MX3A 1E3JA 2BI8A 2X1HA 2D8AA 1R4NB 3DMYA 5KKAA 4EJMA 1DDOA 2I3AA 2X0IA 3BIOA 4PLCA 1K2WA 2I66A 4CLHA 2GZ1A 2HDHA 4NFYA 4BMNA 1DSSG 2FY8A 3PDUA 3RU7A 4BNYA 4KDFA 2I9PA 3C7DB 2RHCA 4DREA 1ZFNA 4B4VA 1Q7CA 3ITKA 1E5QA 1PJ4A 1QG6A 1GZ6A 3GEDA 2VWHA 4RDIA 5LDHA 1Y8RB 3PYXA 3VHRA 1T24A 1OI7A 3DTTA 3E9NA 4MDHA 3U4HA 4EW6A 4JK3A 1S6YA 4YWJA 4YT5A 1E7YA 1AXGA 3ZI0A 3N7UA 2Y1GA 4BKPA 5F1PA 1GYPA 1PJTA 2RHRA 5KJFA 4TRNA 5B4UA 4GPD1 4I5EA 3ADOA 1GADO 4NBTA 4MPDA 3JQFA 2PZKA 3VZRA 3WJAA 4J49A 4NIMA 2VYNA 2CMDA 2ZB3A 4YA6A 3TOXA 4FQ8A 5TIIA 3N58A 4N5NA 4CMEA 4KTTE 3DZIA 4X54A 1U8XX 2EHDA 4KDEA 2I3GA 2PK3A 3CSDA 5TGDA 1ZBQA 3NTQA 4OQYA 2YY7A 3IMFA 2X6TA 1N5DA 4CODB 1JN0A 4DXHA 3WSWA 3VVCA 1U3WA 3UCFA 1VE9A 3ZZNA 3WBFA 2EKPA 5BNTA 1HYEA 1AUPA 4JIGA 4KUEA 3WWZA 2CNBA 3WNVA 3JSAA 3JQ6A 2FPGA 2B69A 1HL3A 4J7XA 4CM1A 3TFOA 3Q9NA 1GUFA 1O9BA 3R0IA 1XELA 3ZNQA 4O6VA 2O4UX 1YBAA 3LF1A 3DBLB 3TQHA 3OF2A 1B15A 1K3TA 3G49A 5U9CA 2PGLA 4NZ9A 5BT9A 5TT1A 1LDMA 2JCXA 1Y81A 2VHZA 2A92A 1ENZA 3HFGA 4IIVA 2NACA 4NH4A 2R00A 3BZUA 1C0IA 3SXPA 2A9FA 1KS9A 4NR0A 3BMOA 4DUPA 1I2CA 2VN8A 1HSZA 4RLHA 3CIFA 3D1LA 4L9RA 2ZQYA 3V1TC 5JY6A 3CTMA 4W7IA 3KOUA 2GN8A 5I9LA 4O59O 4CUZA 3ZNPA 1WNTA 2GGSA 3RUCA 2VT2A 3HFSA 2YFHA 3GHHA 3JTMA 3TZCA 1JAYA 3LT2A 3RBZA 2EG9A 1I3NA 4WGGA 4I08A 3IC5A 1YBVA 4FFPA 2R6JA 1U7TA 3COSA 3E03A 4RPHA 1NAHA 3H9GA 2BD0A 3ITDA 3CINA 4BS9A 4D3DA 3UCEA 1ZJZA 3RUIA 3MJEA 5DOVA 2X9GA 5IDYA 3CMCO 3RD5A 4RPJA 3PK0A 4I8XA 4GAEA 1Z75A 1V3TA 1ONPA 2JHFA 3DHEA 5LDGA 4DC0A 2SCUA 4Q3NA 1DFIA 4PGFA 1F8FA 2O3QA 4KOAA 4IDGA 4TQGA 4JGBA 1TLTA 4C4OA 2Q2QA 5GZ1A 2D4AA 4WLFA 3P2OA 1P1FA 3ROQA 2CY0A 1XIVA 4RVFA 2PV7A 3D0OA 3UCXA 4OYRA 5CEFA 2D3TA 3OIDA 4N5LA 2I6TA 4KQXA 3JV7A 3ENNA 4RF3A 2CF5A 2Q1SA 3H2SA 2IYOA 3NJ4A 3T7EA 1H6DA 4U8GA 1WAMA 3ENKA 3H4VA 2HRBA 4JJIA 4B8ZA 3E9MA 3ZV3A 4NNJA 3WLEA 5ITWA 4M54A 2AW5A 1K6XA 2VHWA 3GAZA 4B3IA 2X5JO 1P33A 4QFDA 2ZTLA 4U7WA 3VZQA 1SMKA 3MCVA 3WQRA 3JQEA 5T5QA 5TS3A 5L3ZA 4BGVA 4QTZA 4BNFA 5L7YA 2DUUA 1B16A 5H82A 4YQZA 3I52A 1GV0A 2PFGA 5JMWA 1KVUA 1YDWA 2QIOA 1MV8A 1A4IA 1NQTA 5EJ2A 7MDHA 1FDUA 3IDSA 3KYCB 1XEAA 5G4KB 1I24A 3NDIA 4B4WA 1WPQA 3P7MA 1F14A 3RUEA 1R16A 3C85A 3E82A 1DLIA 4J1NA 3GFBA 1E3SA 4M87A 3AY6A 3DEYX 3HQ4O 3OEYA 4IS2A 2HJRA 3GH3A 3PQEA 4BNJA 3ASUA 3QA9A 3D7LA 1GY8A 2A94A 4RVSA 4IJKA 4YJHB 4YJFA 1PL8A 4FPXA 3IJRA 3KLPX 1KY5A 3WICA 5TLSA 1HDRA 1XG5A 2O3JA 1D3AA 1DRWA 1XR3A 2UUPA 1QYVA 4BGIA 4Z0PA 1Y9AA 2VUSA 3VZPA 1PR9A 1F0YA 3PHGA 3LC1O 2GO1A 4NQZA 1ZK4A 2ZB8A 2ZTMA 2LDBA 4WCFC 1IB6A 1D7OA 2JD2A 1ZSNA 2Q49A 3V2UA 3ST7A 2FOIA 1LC3A 1GTMA 1PGPA 3BHIA 2BI7A 1LSOA 3ZGYA 1NFQA 5KKCA 4A5OA 1XLTA 4ALNA 2NTJA 4AVYA 1Y8QB 2PA3A 1GYRA 4FD3A 4ZQGA 1DJQA 1CWUA 1A7KA 1KVQA 1XHLA 3INGA 4YRAA 1WWKA 4EJ6A 1ISFA 3HJAA 5IXSA 3DBHB 4L4RA 1A9ZA 5DT9A 4Y67A 5EPOA 1O6ZA 1UJMA 4XGIA 3RC1A 4W82A 2XXJA 3OEWA 1UUFA 4GI2A 1KY4A 2O23A 4L75A 3JQGA 4PLHA 2VWQA 3ZCXA 4JNKA 1ZK1A 3LT0A 3ZHZA 4DVJA 1LDNA 2YQ4A 4WLOA 4YT2A 3ANNA 4XDYA 4MIYA 3U62A 1R12A 5EINA 1Z73A 1HDZA 4XD2A 3GAFA 3DAPA 4G5HA 4HBGA 5IDWA 3K2BA 3R3JA 1N2SA 2GDZA 2P4QA 3F5SA 4RF4A 3RUDA 4DBVO 1GUYA 2RCYA 3B1KA 3OECA 3LLVA 3TRIA 2VOEA 1NR1A 4NJMB 2AG5A 5G0UA 3GNTA 2PH3A 4GWGA 1CQJA 1T2CA 3DOOA 4L4XA 4EJ0A 5G0SA 5K0ZA 1NPDA 1LQUA 5I9MA 1XKQA 3H3FA 1UXHA 2EWMA 3I23A 5TJ9A 5A03A 2LDXA 3OIFA 5C5IA 5KJEA 2WJPA 3WR5A 1LLUA 4R16A 3MTGA 4MIOA 2BMAA 2V6BA 2YHIA 4HKTA 4BOYA 4Y8VA 1AE1A 1L1FA 5DF1A 5JS6A 2EV9A 4GLLA 1GZ3A 5JO0A 4GVLA 2XOXA 1XCBA 3KTDA 2YFQA 4CL8A 4K1LA 4CQLB 3QP9A 1T26A 1HE4A 2HLPA 2ZK7A 4M86A 3QIVA 1EE2A 1R4NA 3WMXA 4D41A 4HFRA 4P4GA 5AXCA 3GT0A 1DIGA 2EF1A 1U8FO 3JD4A 2E6UX 3TF5A 2FHSA 3C3XA 3G3EA 5JCJA 2R2GA 3ZN2A 1V0JA 4DQXA 4DPKA 3LF2A 2Q4BA 3H2ZA 4Q3EA 3GHYA 4AJ2A 4F46A 2F1KA 4KUHA 1BW9A 2GYYA 4MIEA 4E0BA 5JY1A 3ZV6A 2RAFA 3CMMA 3PEFA 3JD3A 1ENPA 3IIEA 4LSMA 4BNHA 4DYVA 1P1JA 4NU5A 3DR3A 1HYHA 1MFPA 5B4VA 3S2IA 1I2ZA 2AEJA 2YJZA 3RASA 5G0TA 4BO9A 2Q1WA 5ES3A 3ZV5A 1SEVA 1PZHA 3ZWWA 4J91A 2W2LA 2NVUA 3FBGA 5CG2A 1UR5A 1AN9A 3WLFA 2OMEA 4GKBA 1LDEA 1PZGA 2B83A 3C1AA 4TZTA 3C1TA 1A9YA 1U3VA 2HMWA 4OKNA 4NBUA 4R9SA 3GVCA 3CXRA 3GF4A 4W4TA 4TKMA 4GX0A 1C1DA 1DXYA 2O3UA 4WEOA 5COBA 3LC2O 4I5FA 3KEOA 1S7CA 4WOJA 1EDOA 1T1RA 3IS3A 4EEZA 5FEUA 3WBBA 5AOVA 5DBGA 1XQ1A 1NQ5A 5L53A 5DP2A 2Y67A 3IAHA 9LDBA 1FMCA 3GG2A 5BSGA 4RDHA 1E6EA 3CE6A 3C24A 4R9RA 3ZWBA 1NWHA 1KBZA 3AM3A 1PQPA 3OIGA 2ZB7A 4DMLA 2VTEA 2A35A 1MGOA 5GMOA 1P1KA 2DPGA 1WP4A 1YRLA 4GKVA 4CV2A 5IXYA 3QVTA 3PZRA 1LNQA 3TFQA 1NHGA 1IE3A 2QQ5A 5JE8A 3UUWA 4R51A 1J49A 3PGXA 3K9QO 3AWDA 4J3FA 4GQAA 1HDYA 1TB4A 2F00A 1N9GA 3IKTA 4MVJD 3VH2A 5B12A 4R3WA 4YEDA 5L7TA 4Z9YA 1JQBA 1U2DA 2NM0A 3MJTA 1ZXBA 3JYQA 4DIBA 2DTXA 1ZEMA 3OMLA 1Y5MA 3ZWAA 4JJGA 3K2EA 3V5NA 1DLJA 1HKUA 2QRKA 5CFZA 1LDBA 4UREA 2AHRA 4JLWA 3WGHA 4QXMA 4XJTA 1JVBA 2EP7A 4BNZA 4E5YA 3Q3CA 3HSKA 2VQ3A 4CV1A 1H2BA 2G76A 4ZICA 2Y0CA 4J1TA 3KSZO 3TZKA 1LLDA 1ZUD1 1N92A 1PGNA 1YVEI 1MXHA 4I5DA 4Q3BA 1O5IA 1N7HA 1T2FA 2CVZA 3D4NA 3NEPX 1KYQA 5KVCA 3BMCA 5CEJA 5TT0A 1E7WA 3S2EA 3HDYA 4II2A 5F21A 4EEXA 1X14A 5C7OO 3G79A 1LC0A 4PLFA 3K30A 3W6UA 1AHIA 4J9VA 4XB2A 1LXCA 3AOEA 5L45A 4ZA2A 1ZIDA 3U4CA 3DAFA 4TZKA 1PQWA 3GVHA 2W2LD 3JD1A 1B7GO 1Y7TA 3JD0A 3OA2A 4M49A 3NGXA 1KETA 4BNIA 3K96A 5JC8A 4UEKA 3TWOA 1OOEA 1EE9A 3FTNA 3WGQA 2UVDA 3ANLA 3MJCA 5JPIA 3CUKA 3JQCA 4MVJE 2DTDA 4EUHA 1H94A 3LK7A 3UOGA 4JP2A 4WPGA 1VI2A 1P9LA 5JCXA 1JWAB 1KC1A 2JFHA 2Q1TA 1UZNA 4OXKA 3EGOA 4BKUA 3A9WA 4MVJG 4R01A 1DPGA 1GAEO 4GGPA 2JHGA 1UXIA 4II3A 4FFMA 4NBVA 4ZRMA 1PR3A 1NX6A 1Q1NA 3W1VA 3C7AA 1OMOA 3NGLA 4ZHSA 2QYSA 1T4DA 1RWBA 3QVWA 3BMOB 4P22A 1PWXA 3AW9A 1BXGB 2C5EA 4FJ2A 3ADPA 4DRYA 5BNIA 3PHHA 3EZLA 1B14A 4NI5A 4BB6A 3LT4A 1PGOA 4GGOA 2B35A 1P3DA 3RFTA 4JBHA 1NYTA 3CEAA 1KIFA 1SPXA 3RU9A 4DLLA 3O38A 4B3HA 1SZJG 4N7RA 1DOHA 1CETA 4ONEA 1E7MA 3AOGA 5KOIA 3M1AA 4GBJA 4WCFB 4YYZA 2X23A 2VNAA 1R4MA 3E9QA 2GZ3A 3EYWA 2O3TA 4XQGA 4E33A 2EGGA 4F45A 2BHLA 2QHXA 4ILKA 4DC1A 1M75A 3I6IA 4OM8A 4A03A 4WLEA 2WD8A 1E1NA 2D2IA 4XQEA 4IGEA 4R4JA 2RBEA 5L4SA 1N8KA 1OAAA 3IUSA 2VOJA 4G81A 3O8QA 3EMKA 3RUFA 2OUIA 4FOOA 3ZWXA 2YV2A 3ONDA 3NYWA 4WNIA 2XF8A 5HTOA 4OXYA 2X4GA 1PS0A 4Z9XA 1X13A 3ETDA 5DBFA 2O3SA 3GVIA 2UYYA 1IOLA 1CEQA 4L0QA 1UP7A 1PJSA 3L07A 2YQ5A 4AJHA 4DLBA 2NTNA 3D3EA 3TDKA 4IUYA 1ZK3A 1DC3A 2D1YA 2RIRA 3DZJA 1MUUA 3GZNA 1KEVA 3NT2A 2AE2A 1ARZA 4OOFA 3GLQA 3EZYA 5GZ6A 1NNUA 3UKOA 4E31A 4MINA 2JAPA 2FR1A 3AM4A 3HB5X 3U0BA 4RVHA 3RBXA 3DOJA 1GCUA 1DAPA 2O2SA 3OJLA 1I0ZA 2NADA 4OL9A 4PG5A 3DHNA 4D46A 4TWRA 1IPFA 2HSDA 4U5QA 2FSSA 2GRAA 2I99A 4FC6A 1XWFA 4J2OA 4B7XA 1R0LA 1PJ3A 1P45A 2DT5A 2TMDA 1E3WA 2GN4A 2IEBA 4ZJUA 1ZW1A 2DTEA 3U4IA 2YV3A 4R41A 5CDUA 3MOGA 1SBYA 3JYLA 4ZVVA 3I9KA 3FF4A 3PZBA 5BSFA 1BXZA 3OICA 3MWEB 3RI3A 4LMPA 4ZN6A 3CPSA 4LISA 2IRWA 4CUKA 1YBMA 3HUDA 3ZV4A 3AOEC 3DAGA 5JAQA 2J3JA 5TRTA 2VRCD 2DUWA 1UH5A 4GX5A 5THKA 3MEQA 2Y05A 4CL3A 4BO3A 1TI7A 3P5SA 5FWNA 3ZU3A 5IN4A 4DPMA 2UV8A 5HBRA 1UAGA 1YOVA 1PIWA 4J2HA 3O9ZA 4MP6A 3JQ9A 1BVUA 4AJ1A 5DNAA 1D4FA 1O0SA 2Q45A 4YRBA 4J4TA 2DPHA 2P4HX 4JROA 1XDWA 4J7UA 3PJGA 4R68A 4FSHA 4ND3A 2NVBA 4IM7A 1VC2A 4DIFA 1U4OA 2XAAA 3WDSA 4B4UA 2B4QA 3SLKA 4FFLA 1ONNA 2PD6A 1KVSA 1LEHA 1X1EA 2NV6A 2GSDA 2JFGA 1NFFA 1PGQA 2EKLA 1BDMA 3L6EA 3G17A 3HADA 4KZPA 2Z95A 5KVSA 3JD2A 1PX0A 3H65A 3ULKA 1ZSVA 4UEJA 2ZATA 3E8XA 2HKIA 2B5WA 1Y1PA 4B3JA 5ENDA 5JLAA 1WW8A 3LYLA 1E7RA 2NSDA 3AUAA 5F1OA 4FIZA 3PYMA 2AQIA 1ISGA 1DFGA 3PP8A 5L4NA 1LI4A 3ZW9A 1IZ9A 3QRWA 1CF2O 4MP3A 4CM8A 1GEGA 2BKAA 1ZK0A 4XYLA 1UZLA 2GF2A 4KWHA 3WXBA 3EDMA 4C7KA 1WZIA 4BNLA 4K9DA 3LQFA 5FI3A 3VVBA 3VAZA 1HZJA 1ZSYA 3K31A 1V6AA 2DBRA 2VYVA 1H9BA 5KJCA 3WYCA 3EHEA 2D59A 2O4CA 2B36A 2Q3EA 5A9TA 1VL6A 4Y6PA 1T2AA 4Y6SA 1I01A 1Y9EA 4PZDA 3S8MA 3SJ7A 2C29D 3WGTA 2BFOA 3JCZA 3M2TA 1NP3A 2IZ0A 3BTVA 4BMVA 4MVJP 2FN7A 1EDZA 4JQCA 4PLPA 5T64A 4AJEA 2GD1O 5H83A 2D0IA 2X0JA 1PZFA 5CAEA 2O2YA 1W4ZA 3Q1LA 2NU7A 5G2OA 4AL4A 2DVMA 2PTGA 5JDCC 3I9OA 3NX4A 3QJ5A 1MG5A 4D45A 3WJ7A 4DQUA 4RPLA 4BGEA 4TSKA 2JCVA 1BTOA 2DBZA 1YB1A 2YHUA 4BNGA 5C3MA 3VDRA 2ZJ0A 4WASA 4E6PA 2Q1UA 3DBLA 4XIJA 2GR9A 3R6DA 2ZJ1A 5KWEA 3D3WB 1N9GB 3E1KA 4BO7A 1ZMTA 3NJ8A 2Y1FA 4AJPA 4BNTA 1RJWA 5EERA 1GUZA 3FPLA 4CM9A 3ZHBA 3FN4A 1VJ1A 3AFNA 5JW6A 3L4BA 4BO2A 4E2XA 4BV9A 2E49A 4KUGA 4PN3A 4R5HA 2P9CA 2CSUA 4PZCA 5HM8A 1GU7A 3ZWNA 4FFRA 3UGKA 1JTVA 3H8VA 3PHIA 3NDJA 4GH5A 1B26A 5EL0A 5JBIA 2YUTA 5DCYA 5KCZA 2WDZA 3K73O 2X58A 4TROA 3W6ZA 3EUWA 1H2HA 3ORFA 4Q9NA 5L40A 4YJFB 2D5AA 2YYYA 4DMMA 5IN5A 1Q0QA 1GEEA 2VHYA 1VSVA 2ET6A 3IUPA 1PS9A 4Z9FA 2W2KB 2FRDA 2BGKA 2JL1A 1HTBA 1P74A 4O5OA 1F8GA 1VJ0A 4XYBA 1M66A 4PLTA 3B1JA 1NWCA 1V3VA 1NVTA 1YJ8A 1YONA 3F1LA 4BO4A 1E6UA 2J3IA 3F6YA 4J0EA 3KLMX 4OJNA 4XIYA 1LLCA 4YBZA 1JKFA 1QMGA 1QYXA 3GN2A 1RM3A 2X5OA 1GYQA 3H9QA 4ESOA 3DZFA 2GN9A 2QZ9A 3VH3A 1BVRA 2WWRA 2EERA 2I76A 4HWKA 4RZHA 4E3ZA 3OM9A 1FK8A 1ADGA 3GPDG 3DBHA 3A06A 4ALKA 2GNAA 3LDHA 1YL5A 4GSLA 1EBFA 3JQ9C 4HUJA 4ND5A 5IG2A 5A4DA 3UICA 3WFIA 3PLRA 2FWMX 4HNGA 4J4HA 5COAA 4PLWA 3B6ZA 1KEPA 3A1NA 3V1YA 2EJVA 3JYOA 4B7CA 5IZCC 5IZ4A 3DXFA 3PLNA 3WTBA 4PG4A 2X0RA 2AQHA 4FJ1A 3ZNNA 2QG4A 4YDRA 4CLOB 3PWZA 2AE1A 2P91A 5JAMA 2PR2A 3BA1A 4RO0A 1EQUA 5CEEA 1U1IA 2HRZA 4MKXA 4XKJA 3L4SO 4ITUA 3IL2A 4A0SA 5EQFA 2NU6A 1C1XA 4LSWA 3KYCA 1Z7EA 1UDAA 3GVXA 4O0LA 5DCUA 1DHTA 3PJDA 5JDIA 3SVTA 5A5EA 4XQCA 4ZGWA 4JCOA 4WEQA 4Z0HO 2Q50A 3D64A 5KJ6A 1EUCA 2P2SA 1QLJA 4E5PA 1G0OA 1GPDG 3W4IA 4Y98A 3WQSB 1HDGO 2NU8A 1JU9A 1LDGA 4ROSA 4Z3DA 5AVOA 1ADFA 1CQIA 4KMSA 1F17A 4B79A 4D43A 2VZ9A 4YAKA 3F46A 3I5MA 1V35A 3AI2A 2VZ0A 3BMCB 1YGYA 4LRTB 3CZRA 4PIVA 3JQDA 2BF7A 1O95A 2QYTA 4D42A 3NKLA 1QP8A 5DBIA 3I9JA 3VPFA 2O48X 4XRGA 1CDOA 1E77A 5KNLA 3VH4A 4ZRNA 1E3IA 2B37A 1JKIA 2IDZA 6LDHA 2NWQA 2DQ4A 5DZSA 1EVIA 3PHLA 5MDHA 3FTPA 1NFRA 4UVEA 1J5PA 4IDCA 5AXDA 4FBGA 1QV7A 4YAGA 3JQBA 5A02A 3FCOA 4W6ZA 1SB9A 2Q2WA 1I3KA 3SC4A 3V2GA 5KVQA 3X2EA 4BO1A 5KJ1A 5F3RA 4QQRA 2B4RO 5TF4A 4FB5A 2H63A 3TL2A 4BNVA 3PWKA 4J6FA 3PVZA 4Q3AA 2DBQA 1YQXA 2P5UA 2VRCA 1IPEA 4ZQEA 4A26A 3PPIA 4BO5A 4NFSA 5J23A 1BRMA 1IHXA 1E3WB 2AQKA 2DM6A 1EVZA 3HG7A 4S1VA 1B3RA 3JQFC 5LCXA 4PVCA 1BXGA 5EN4A 3GRKA 4P38A 2NVUB 5DN9A 2CDBA 3I3OA 4TMFA 2YDYA 1WVGA 2ZCVA 2BFMA 2IZ1A 2J3KA 4Y6RA 1HRDA 1ML3A 4ID9A 4TVOA 1KC3A 1ZJYA 3FWNA 3MWDB 5ICMA 3P19A 2OOSA 1SNYA 4RPKA 4BIIA 5T57A 1HEUA 2Q2VA 4BNWA 1YDEA 3DZKA 3GK3A 4CMAA 4IQGA 3SC6A 4PLVA 5EIOA 3FR8A 4TVBA 1R4MB 3OQ1A 1G0NA 5I9NA 3U4DA 3MJSA 4NDNE 4F6LA 1JLLA 4CQMD 4L76A 5TC4A 1EUDA 7ADHA 1IULA 4J4BA 3UXYA 4Z3KA 5U4QA 2G82A 4CM7A 3AM5A 3GGOA 4XRRA 3VPHA 3OJFA 2C07A 4RJTA 1LU9A 3O8QB 1U5CA 2W8ZA 4RQTA 1YWGO 1EBUA 1EFLA 3JQBC 5ER6A 4CR6A 1DJNA 4CQLA 3EVTA 3T4EA 3BMNB 1BMDA 1IL0A 1TEHA 3DWFA 2X8LA 4R5MA 2HQ1A 1ADBA 2EGHA 2I65A 4IZHA 5JYEA 3P2YA 3STHA 4FS3A 3UAGA 4BVAA 3W8EA 1ONOA 1U2GA 3BYZA 3GZNB 3IP3A 3A14A 3G1TA 3PIDA 3MTJA 1GCOA 3K92A 3DOCA 3H7AA 3N74A 5KVVA 5COQA 3FSRA 3M1LA 1DIAA 3Q9UA 4ZQBA 4I5GA 1E7QA 3D4PA 4OKIA 1BW9B 1M2WA 3QWIA 1WZEA
chains in the Genus database with same CATH superfamily
2LIPA 3PGJA 4KQCA 2BH2A 5CMLA 3QU4A 5JSYA 2X2OA 3QLEA 2GH1A 4UARA 3SSOA 3O95A 1U0SY 2PKYX 1V9SA 4URFA 4B71A 5CM8B 3V1UA 2XAUA 4XGNA 4AXBA 4CV2A 4C5BA 2BDEA 2VSQA 5T67A 1IN4A 4O4HA 3K5WA 3PPYA 2QG9A 3B1FA 2QZ4A 2ZUVA 2YVUA 1YFKA 1W19A 4WBXC 1NF8A 3S28A 2WIBA 2VP9A 1L5GB 4BUZA 2BWJA 3G0HA 1W85B 1PTJA 2ZTSA 1YR1A 2JI8A 3S8EA 2IV3A 2GUGA 2J67A 4ZZ2A 5F4BA 4ALMA 2B5VA 1Y1QA 4RKYA 4XR4A 5ADHA 2ID8A 3AUTA 5AM3A 1G21B 1A27A 2KQUA 2GMWA 3L8HA 2ZRGA 4GLFA 4B76A 2FSVA 1JJIA 4D3SA 2YVAA 3BE6A 3QFHA 1Q92A 1XZKA 4IINA 4UUBA 4TZ0A 2BFEA 2VJQA 2FPSA 3PS9A 5B1YA 3ESZA 3HO6A 3ADDA 4GW3A 2P27A 3IULA 3I9LA 3QG5A 4K3VA 3ZDQA 3OLWA 4TX1A 2QJOA 3FI0A 5DGCA 1GNRA 4DHEA 3PFIA 1FNMA 5A0VA 1KL7A 3BGIA 2ZPTX 4LYDA 2P79A 1K5HA 3L0SA 3H5RA 4REOA 1PJQA 2QDXA 3ZJUA 4GOXA 1KNXA 3UG7A 1YKFA 1Z7YA 2B0CA 3CH6A 4FKBA 1L7DA 3R9IA 3REGA 3GBVA 2OBLA 2HJWA 4V38A 5HW0A 2FUCA 2QPLA 2V58A 5DI3A 3VR6A 2G5TA 5KYUB 1S9DA 2I2CA 2WFZA 5LLTA 3RBVA 2DOKA 3LOUA 3O2NA 2FQYA 4YR9A 1AMUA 1W0JA 1J2JA 2P4EA 2O7SA 3TMYA 1VMEA 2PX0A 4CMBA 4DDKA 2G0TA 5E6SB 3WRXA 1XCPA 2Q3CA 1WW2A 3D0RA 4HZUB 3N7TA 3OE5A 1A0OA 2YMPA 2QAIA 1GKLA 4EGQA 1JEDA 2QTAA 3CCBA 5I4CA 2DSTA 1W73A 3FX2A 1CUIA 1QX4A 2HIGA 2ZOSA 3F47A 4HAZA 4I4NA 4IDAA 3T5GA 1ULUA 2CYCA 2ZBRA 3HNPA 5D3QA 2C78A 2J7KA 4EW3A 2ZSFA 1JYEA 3T3GA 6REQB 1GQYA 3CRW1 1C9YA 2CSXA 3SF0A 4HUQB 4KQEA 3ZCUA 4GSKA 4WRRA 3E1GA 4O4LA 2J9YB 3IERA 3O2JA 2VFAA 4FIDA 3VR2A 3KLBA 3RS9A 3VTZA 5BSHA 1UPCA 2AMLA 5EHNA 4RVOA 3E05A 3T95A 3I6QA 2QSJA 4RORA 3RS4A 3FWHA 2XADA 5LP6F 4MRAA 4KQIA 1CRWG 3FA2A 3VKUA 1BDHA 1XRNA 4HZIA 2BZ1A 1PI3A 2OPBA 3Q3JB 4NV3A 1NM5C 2PH7A 4R0NA 3ZDRA 2J3EA 1P1CA 4NMLA 1U3CA 1T0UA 3B1VA 2EEZA 2FR0A 1OWMA 1JLMA 4TXLA 2DYKA 3I05A 3WL3A 3ZK9A 4UVIA 1Q83A 4DMUB 2X2PA 3L06A 1JQDA 4KR6A 4BNJA 3CT4A 4UNIA 3WRYA 1X1BA 2Y66A 3JAKA 4EO7A 4DLKA 3FWZA 4CDMA 2XKJE 3U3DA 1V2HE 4IF6A 2QUZA 4PPNA 3TEFA 3ZU5A 1L6RA 3KLNA 4DLNA 3GQVA 4HNAB 4MAFA 2ZSDA 4R2XA 1C0LA 1RE1A 5KOJB 2J6BA 3GI1A 521PA 1NW8A 5CYGA 5DOZA 5J43A 2NV2B 5CUQA 3H2KA 1P0CA 3CZ9A 4KGZA 2R84A 3SZ3A 2QMQA 3ZDFA 3PQ6A 1BGVA 2PX3A 4ZKDA 5HPYB 3DZGA 3OQOA 1GT6A 3IKLA 3UH1A 4IJQA 4R54A 3OQBA 4FWTA 2H00A 1CJVC 1M1XB 3VAAA 3VU8A 2IH4A 3R8CA 2JI4A 2QVCA 1EESA 1I36A 2L19A 2G8NA 4Y7DA 3WSVA 4Z4CA 1QV6A 4FTWA 3VU0A 1T35A 3EQ8A 4BCDA 1VTKA 4MK4A 3NTUA 1O89A 1ZOIA 4Y6LA 1SVKA 4JC4A 2QQ0A 4GI1A 3N2IA 3UOWA 1JLKA 1DQNA 2HPHA 4BFSA 3FPBA 1B1CA 1D1SA 3LGXA 3VX4A 2J85A 2OENG 1ISRA 4BHTA 1P62B 5LA6B 1P81A 5BOVA 3O7MA 2H0QA 2MJLA 4QQ8A 4DCUA 3IX7A 1C9JA 3RYIA 4CL0A 4DZRA 4MQ4A 3A4TA 4PZPA 5EWMA 3QXHA 3B5IA 3H5AA 1G8AA 1VLLA 1GRNA 4N5IX 1LVHA 3F3KA 4TSRA 1RZUA 1XLVA 3II6X 3BAFA 3DFUA 2CUZA 5E0OA 2NPFA 2TSYB 2CD7A 2FZGA 1P5ZB 4C7MA 3PXGA 1P0IA 3IUNA 1K27A 2CCGA 3IPCA 1QHSA 5JC1A 3I9MA 2B1JA 3PTZA 4X45A 4QELA 4AY4A 1YCGA 2W2VA 3R3UA 1RKXA 1CR1A 2FVYA 4WLUA 4ZI5A 1JEQB 4F3TA 4FDAA 1EX6A 3O4RA 3QMPA 1K88A 2PVPA 5CNJA 2X4LA 2FMKA 2JLRA 3KXLA 4G0NA 2N3ZA 5IKXA 2QL9A 2ZBVA 3BHJA 4S3MA 4E12A 2BGIA 3L6DA 3HU3A 1SC3A 2BGTA 3WYNA 3OTHA 4GUDA 4PIPA 3NP7A 1KK1A 4ML3A 1JSXA 3SKVA 4FLMA 1SHZA 3DDOA 1BOOA 3L9WA 2FEWB 1ZCFA 2WVJA 4WT7A 4UW9A 4E13A 1PCXA 3E5HA 3E5MA 2J31A 3M4ZA 1IOVA 4FHGA 1JDTA 4Y30A 3E22A 2GESA 2H7YA 3PCTA 2IP1A 4QU9A 2CL7X 2HLHA 2I7CA 2D06A 1FXSA 3N70A 1QF6A 3QYJA 1VIYA 1OQAA 4BFLA 3OWHA 4MO2A 4W7HA 4EWLA 2K7ZA 1LLFA 3EQZA 1LJ8A 3MCUA 2Q6OA 4FCTA 5DGHA 1LGYA 1R1DA 3W8FA 5J2UA 1C9NA 4BRZA 3L4JA 2HRDA 2X3UA 2QAGA 2DUMA 2RGAA 2PGJA 4KP7A 1LJLA 1QV9A 2PLRA 10MHA 3TLYA 1DEHA 4BX3A 5JYBA 2QLJA 5ESDA 2AYXA 2NZVG 3ANYB 1R0BA 4OH1A 1SZCA 3VO8A 4BRWA 3O5AA 2CLLB 1F48A 5ECWA 2CLIB 4CHGA 3C8MA 2YWCA 4E94A 1N36B 5A2QA 5HS6A 1P1RA 1J5XA 2ZT6A 3OH8A 5J2TF 2B98A 3SC3A 5IZCA 4ABYA 1WUTA 1J0XO 1KYWA 3WRXC 4DCCA 4RL6A 4O1MA 1PL6A 1BN7A 4EJSC 5AQ1A 1A5ZA 1FMJA 2JH3A 3TLGA 5AJHA 2PD4A 2Q2NA 5JH7A 2FZCA 2OD9A 1E1QD 3ESXA 3R0XA 4PRZA 4M1SA 4BJ3A 4X6YA 2FJUA 3RUHA 3OWXA 2O9JA 4HLQB 5DHAA 1ZLXA 3UF0A 4IFEA 4JBXA 1JDZA 3WIUA 2QK4A 2HT1A 3QVSA 4L5YA 2B25A 1NONA 3TQRA 1LDYA 1JG1A 3LQYA 3MGCA 2C5BA 3FZEA 3QW4B 4Q3LA 5JNWA 2XX3A 3P0EA 5AW2A 3AF0A 2WD7B 1FLVA 3U3OA 2Q28A 4NECA 2E89A 4NEQA 3OHMA 1M74A 1GUDA 1QZTA 2Y99A 3DO5A 5DWQA 3BDAA 1ZI8A 5D5HA 1GZVA 1ZRMA 3MB8A 4ZPXA 4ZT3A 2E18A 3MTIA 2QF7A 4D4MA 4CCAA 5F77A 4HVAA 3BK1A 4M0LA 2C54A 4XWYA 1QRRA 3FLBA 5CVTA 4PZ0A 1SVUA 5KTOA 2DY1A 1JI0A 1JMVA 3ZXXA 4N9WA 1UOOA 2P9ZA 2FMIA 1R10A 4GI3A 4OXQA 4EVRA 4CIBA 1XZIA 1UDCA 4S1NA 1E1RD 4W8GA 4HLCA 4PS0A 4AG6A 4BBAA 1T5BA 3TG8A 4UUPA 3ZWPA 3R7BA 2YWBA 1V3QE 3RWMB 3VOTA 4BQQA 2IH2A 1PV2A 2HUNA 1VYVA 1H4QA 4DBZA 2FB9A 4YP6A 1Y1KE 4OQEA 2GN6A 4AC9A 4FQ5A 3AIIA 3SY8A 5HYVA 1JZTA 4AECA 4ENQA 4XOIA 2KWIA 2OCPA 3R40A 2P9GA 3KHUA 4MAMA 3SQOA 4XX0B 4XIFA 4HGQA 2QN6A 5JCPA 4H3HB 4N3GA 4RZIA 5AI8A 5K0TA 3SLGA 1GL6A 3LO5A 1T1JA 1I5EA 2XMGA 3I04M 3KC2A 3NWPA 3FFBA 5DLYA 4B6QA 5BPHA 1VXOA 3N8DA 1F7VA 1EUQA 1IAVA 1E1LA 4L07A 2JFQA 4ZODA 1Q5PA 2VBGA 1N7IA 4QRHA 5DX0A 2HW8A 2AJDA 2I8LA 2C5FA 2ZTUA 1CR0A 4R1UA 5FQNA 2PGOA 3P9IA 1PU2A 1K7XB 2CE7A 2H31A 2PKQO 2V6JA 2FPOA 2XNDD 5CA0F 3LUFA 1VRCA 2W43A 4OHBA 3FNQA 3MS4A 4IMRA 1YJCA 1G2OA 1XGKA 2HQRA 4DANA 1R6AA 4EELA 1JEYA 1P0QA 5DWDA 3TL6A 3B52X 3RC7A 1STOA 2AG6A 3GMIA 2ZR8A 3NBYC 3R5FA 4ENWA 5JNRA 3QVLA 2WE8A 3TR6A 3CNNA 3RYCA 3IP9A 4M53A 4EQZA 4C0JA 1GZ7A 4G36A 3R3VA 3R0ZA 3KPWA 2PX2A 1J1IA 1RWMA 4DLUA 3HRIA 1FF9A 1MT0A 3CNHA 1K63A 3M6WA 1V11A 1PK8A 5BVHA 1FVOA 4YAIA 3K9HA 1DRVA 4Q12A 3MQ4A 1YBHA 4FNMA 2JGLA 4A91A 3PEYA 2FPUA 3EGIA 3H05A 4O33A 2ZVQX 3C5CA 3VZSA 4Z0TA 2JI6A 2P9TA 3HWX1 1TT5B 3SEFA 3G9UA 3CVWA 3KD3A 1NT2A 2RG7A 3UAXA 4C06A 2YFKA 4BCBA 1JDNA 2P3QA 3AWIA 1SCAA 3F0TA 3WGOA 3BZWA 3OETA 3COYA 4CM4A 4E4YA 2BONA 3C41J 4G67A 5F35A 5TQVA 2QRQA 1XQXA 2V9CA 1QJ4A 2QMZA 4PANA 3CPJB 5A05A 3KZOA 1MVLA 3OKPA 5CH5A 4ADSG 1NSFA 1WCIA 1X92A 5DI3B 5AW8A 5IULC 3KOOA 4TKVB 5EJ7A 5F23A 1HLFA 1RYDA 1C7QA 5IH7A 1Z39A 2AC2A 5C7IO 2AN3A 1GPKA 1KP3A 2O8CB 4WBNB 2GERA 2VDKB 3VQTA 1BS1A 5K8TA 3LVQE 1FC0A 4P3XA 4P7FA 1V7QA 3AHJA 1JJBA 2ODEA 3AR2A 4BC0A 4PAOA 1L5SA 1YB6A 4GHWA 2JFZA 5FPSA 3KJQA 1XZPA 1Z0UA 1C30A 4TRRA 1RJEA 4MPJA 2YW9A 4D2IA 3ZK8A 3BTUA 3GB9A 4Q0MA 1TVMA 2BFBB 4YR7A 2NPIA 3NOXA 2DFDA 2OYRA 5KTSA 1QGOA 2JGEA 3OZXA 3OKFA 4WBSA 3R7WB 3E9DA 3RVJA 3OLYA 5A0FA 3RS8A 4C2AA 3CB2A 2JI7A 2QX8A 2IY8A 3RKUA 2E4AA 2X86A 2HA5A 1J24A 3KG2A 3I6YA 4M9XA 1SWVA 3UK6A 1CNMA 1IDN1 1QZ3A 2OFPA 4JLOA 4TKLA 1US8A 1KO8A 1OKKD 1Y8RA 3G23A 1UMCA 3AESB 5JCJD 1TVKA 3H9JA 2JIZA 1KYZA 3LW8A 4RCVA 3OT4A 4ICIA 1I7SB 2VRWA 1AGYA 2J6IA 1UK8A 2X2EA 4P80A 2QI9F 4YCNA 1T4GA 3PRJA 5IKPA 1E58A 4L7QA 2WJIA 1PZEA 1MDBA 2ZTHA 1G8YA 3DMHA 1A5TA 2QNRA 4K8RB 2Y2UA 3DH0A 3RC2A 3VR4H 3AJ9A 3L0YA 4B44A 2WTUA 1G8JA 1TO2E 4R69A 1BEZA 3BILA 1Y7HA 1EVJA 4RSRA 1YQGA 1TM1E 1ZOSA 3Q7QA 4O2AA 3BSFA 5JXHA 5HZHA 2EL9A 4G5SA 1KQFA 3P0IA 3OFNA 4EHBA 4UAGA 1JKMA 7GPBA 3O0DA 2G1PA 1ZGCA 1NSTA 2GPWA 4WXPA 4DPLA 5JWOA 2W2KA 3RYFA 1G38A 1YZLA 2ZJYA 1V8OA 5DYNA 3GFGA 1N77A 1NZJA 2ZAOA 5CA0A 4X6LA 2P2LA 2XT0A 5SICE 4FM9A 2EKQA 2OT3B 4HCJA 2NW6A 1DEOA 4IKOA 4MW5A 4OX9B 2W90A 1SHUX 1ZO8A 4J29A 2EFGA 5CJ2A 6ADHA 2JDIA 3KBOA 1U7OA 1HZZC 4LI0A 2GPSA 3KYBA 5A3VA 1SH7A 2VP2A 1DELA 1VJTA 5HFNA 4X64B 1YS2X 4EYOA 1G6KA 3PXXA 3M83A 3ZH2A 3X1YA 1VG1A 2CNLA 3GMSA 1H5UA 1IEVA 2QMOA 2OHIA 3DMTC 4IQ8A 4EW1A 5MN6A 5A4JA 2DHQA 1YNOA 1KHHA 1KYXA 4FI3F 2J0SA 2FWNA 4M9RA 4MVJA 1BKSB 1E3LA 2CBXA 3P9YA 4Y2QA 1P7PA 1I2AA 3GBSA 1XSEA 3PQ4A 4N39A 1DIHA 3N07A 2D13A 3GFPA 4LUCA 4XGKA 3ZDAA 3O8RA 1SVOA 5JAIA 4BP9A 1ADCA 3OTQA 2EXXA 5H5JA 1DWUA 3I2GA 4DA0A 2QP3A 4M1MA 3FRJA 3TRKA 1E0KA 4W63A 2WUVA 2A1TR 2ZYGA 4L4ZA 5TQ2B 3RREA 2SECE 3C2QA 4DSUA 1B3BA 4ETNA 2BGGA 4OKSA 1F2UA 4IDDA 2AKEA 2PRKA 4I9HA 3AUUA 1COZA 2JIPA 3FYUC 3FMPB 4I4TB 3S3TA 4DR6B 4LWPA 1QMPA 2EP5A 2KPOA 3LZDA 4GMGA 3JZFA 1C1XB 5KX5F 4CNQA 4JLVA 4ARCA 4HXGA 5DM0A 1WPXA 1SBCA 3UJ6A 5HZGA 1DOZA 4KPUB 4CDGA 1YI1A 1OBFO 2EX0A 2ZI7A 1LK5A 2XNSA 4OO3A 4RVDA 1BGXT 2JD0A 1NN1A 2X22A 3EGWA 3DFFA 3AETB 5KSZA 4K9KA 1EHCA 4OHPA 1SY7A 4O63O 1QGUA 1P7WA 3V4VB 3FLEA 1TIBA 3B70A 3LPMA 5ECGC 4YRRA 3WK5A 1WDTA 3HEAA 2J8ZA 1D2MA 3PVSA 5ICFA 1LPMA 2PUAA 3RGGA 1EYZA 3CF2A 4ZZIA 1OXVA 5JH7F 3PQ7A 3SP1A 1LNSA 5LNK1 4KR2A 1LQTA 1YR7A 3EBPA 3NYRA 1Q0SA 5A6SB 4CMIB 1Z7BA 1JEEA 3DEAA 1EK5A 1YD7A 3RVDA 3ZR4B 2E1PA 4AJ9A 4ZGBA 5BN1A 3CF4G 3HA7A 4G5OA 3KR9A 1G64A 3TLCA 1RAHA 2H1IA 5CB0A 3F78A 4IMJB 4U2DA 1NI5A 1XZCA 3D5QA 3IJ5A 4POAA 3QBDA 4WZBA 4FE3A 2P4SA 4I14A 4CMCA 4X00A 4F9FA 2OKGA 1FFGA 1H0RA 3W0LB 1T5DX 4L8LA 2V65A 2E6KA 4L4SA 1LF0A 1X7GA 3BFKA 4RZ3A 1I2BA 2OGTA 1VZ2A 2R8OA 4HG2A 4C03A 1KMHB 1Z7GA 1VG9B 2JFFA 3QWHA 1AU9A 1GV1A 1Q7BA 3SHOA 3PIIA 4A2CA 3QXGA 4QGSA 4I1IA 4RBNA 4AMVA 4BE4A 2GCEA 1ZRSA 2EL7A 2B99A 2DGDA 1Z5WA 3IBCA 4HB4A 1UJNA 3GMTA 3VSAA 4KZKA 4E08A 1NHWA 1VSTA 3UWPA 1XNGA 1SXGA 2R87A 3WGNA 1KWKA 1IOWA 1UJCA 4Z8YA 3S0JA 2G5CA 3M9WA 4AIIA 3PD1A 1HPLA 1T36B 4CJXA 1SCKA 3ORQA 5AW4A 4RM3A 2HU8A 5L9AA 2DF8A 4DMCA 2PX5A 1CERA 4YO8A 4YRFA 1FS5A 2DR3A 2NTEA 4Z6KA 1BXRB 4K9SA 2X9LA 2FNAA 1QB8A 1VECA 3I8SA 2VJAA 4HDQB 4U3JA 5JCOA 5LYYA 1GDDA 5DVZA 1B41A 2ZROA 4H1WA 2PQ6A 2L82A 3LP6A 4CMGA 1P5JA 2J0VA 2OAEA 1TVEA 1QHXA 5CGQB 5PGMA 1K5PA 3C1OA 1DXHA 3BD6A 4DSOA 1IY2A 4HAWA 2XR1A 4Q7JB 4M76B 5K0CA 1QK4A 1PQYA 5HUQA 1RRKA 4L72A 1OIVA 3M4NA 3O91A 5BYKA 2KYRA 1AKTA 2IC5A 2I4IA 1N34B 1DUSA 2W4IA 3EZ7A 2E3JA 3ZVLA 1B0AA 3UPUA 3GAAA 1NA5A 5DV9A 2Q62A 1DGQA 3BFVA 1BX0A 2ZSUA 4BL5A 2GD2A 4R1SA 4DDVA 2AOVA 4K26A 1E6LA 4BLTA 5JHHB 1YA4A 3PWTA 1AKRA 1PS8A 2JLCA 2VAMA 5JFOA 1OC2A 3OOSA 4C04A 5KTKA 2B61A 5TS2A 1JQ3A 2VT7A 3TSWA 1WQ1R 1TMOA 3K0FA 1CZLA 2X1MA 1DC4A 1HETA 5JS8A 1KYTA 1WMSA 3PQCA 3MYYA 3LRXA 2EP8A 2VTBA 1OGIA 4RIGA 4RVCA 1E2FA 3SQMA 4F4DA 1CY2A 1ZGZA 2GBCA 3AIMA 1T8SA 2J08A 3Q6NA 4OAQA 1H23A 4KNWA 1WXGA 1RWVA 2F2TA 4GOKA 4DLWA 1YK1A 3HJCA 3H5LA 4GLOA 2WU4A 3F2IA 4MKHA 4TWIA 1HT3A 3BB4A 3JVEA 4ZVNA 2DU8A 3DNFA 4ES6A 1UJ6A 2HF8A 4AO7A 4CM9D 2GPBA 1QK3A 2H4YA 1NBIA 2IZOA 3SYKA 6Q21A 2FETA 1Y34E 1L7VC 3F90A 3IQDB 4DL9A 2PYZA 3P9ZA 4OGKA 2FEMA 5JECA 3U37A 5DSXA 3Q10A 3RSHA 5I7RA 3VJKA 3ZU2A 4K6HA 3WG9A 1FUYB 1MC5A 4X7BA 1L7RA 3U56A 4D25A 3JALA 1YQDA 1RMQA 3IOYA 3KEGA 4O4HB 121PA 4QGHA 1Y6ZA 2ZIXA 4RQUA 4XQ9A 5CM2Z 1L7EA 3ZIAA 4BJHB 4GKKB 1TMGE 2UUAB 3HXTA 2ZE7A 2PYDA 3DHYA 5DBEX 4NFHA 3JYPA 5BVHB 3RIHA 3OM1A 2C8VA 1DQRA 2ZIUB 3K8ZA 1VMAA 1JIXA 4AJKA 1FP4B 1OX4B 2XEDA 1JA0A 3AXTA 2ZYRA 2ZUUA 2IBSA 1YZTA 4BEJA 3WGVA 3HN2A 2ORED 3IOMA 4DHWA 1KVRA 3LI2A 2OBXA 3PI7A 3QF4A 1F06A 3U5TA 3VKVA 4A92A 1EXMA 2Y1OA 3PXDA 3PX2A 5AI9A 2QQGA 5DLPA 2HL6A 2QR2A 2R97A 1Z45A 3BQ9A 3O3MB 3KVNA 4GG1A 4QJ5A 2A9KA 2C82A 1YH3A 2OY0A 3HCPA 4MOWA 5JI2E 5BUCA 3EVBA 1UINA 2WNHA 5B64A 2IHBA 3FOFC 5JASA 3L77A 1E8MA 3RFXA 2ZXFA 3IKJA 2HNBA 1F6DA 2O07A 1K98A 2QRLA 2Q21A 1LX6A 4LYFA 1V37A 3I73A 1DUVG 1KFEB 3MSCA 4PG6A 4AJJA 3DFKA 4HPWA 2IPOA 2JJ8A 3E23A 5G0VA 3CNBA 2GBLA 2Q41A 3BXHA 3OAAA 3A1EA 4MWCA 4AU1A 4ZCRA 1EFAA 1PW5A 4EDFA 1YJQA 4EI2A 1LBEA 2H4HA 3F4BA 1W4LA 1CDZA 3PTLA 5CLLA 3VNSA 1V9LA 1YRBA 2CK3D 1MVNA 4NCJA 5JAZA 3NDRA 4LHEA 1KVTA 1Q50A 4PHGA 4XX0A 5FD8A 5FTMA 4ER6A 1RWNA 5FV7A 4DBLE 1S4QA 3PFWO 1QR2A 5GJBA 1EE1A 2X9VA 2R25B 5LZ4A 2ODTX 1AT1A 3MC1A 3CQ9A 1JFTA 4E88A 1ZIYA 4OAPA 2WMDA 4X7MA 1HR0B 3M5DA 2QM0A 3HCRA 4LECA 3N2ZB 1WEHA 3R24A 4FSXA 5CA1B 2W48A 1GP2A 5ICEA 2G0NA 2B7CA 1K9VF 1LRKA 3IPRA 2DAPA 4DVGA 1XJWA 4HQRA 1YI8A 2GAJA 3D81A 3FRIA 4JT4A 1I3OA 2XUGA 3LVFO 4KVGA 4CQMA 1EP9A 3G82C 3PR1A 3DD1A 3NHPA 1H66A 4R8MA 1JDSA 3J7TA 4DUZB 5EHXA 1H1LA 1SVWA 2IHJA 2IXAA 4Q4LA 5TVKA 4BMXA 3EXG2 2DEUA 2PUDA 1P60A 2HK9A 2IU4A 2FWPA 2JZNA 4D56A 2GPNA 2OESA 3NM5A 4U6QA 5HFJA 4BZQA 4NG4A 3WB2A 1NAIA 2YXPX 3C98A 1SU4A 2VDJA 3B7PA 4YRQA 3V42A 1WDKA 2BR4A 4AFNA 1VE3A 4YJHA 2CF6A 2EKDA 3CLSD 2AW3A 3D0QA 4BZWA 2WYUA 4F06A 2ZM5A 2ZDGA 4WAUA 5ED4A 3A1CA 4QUBA 1C7IA 3FUVA 4DTCA 3BBLA 3HKDB 2ZM6B 3G85A 3CNLA 4NHEA 1KR5A 3OUUA 3ADCA 2CZCA 4FYIA 4ZVPA 2ZE5A 1DRUA 4LAFA 1DAMA 3AU9A 4LGVA 5DN6D 3MWKA 2NO6A 4TYMA 5AKYA 3EMDA 3L7NA 2E55A 2FW6A 4UBNA 3DBRB 1C3OB 1IZZA 1P18A 3GLVA 3M70A 3ASVA 1RPNA 4C87A 4WKCA 1ESMA 5T41A 4OATA 4A0HA 4C0SA 4EAQA 3IUQA 5JNLA 3PEEA 1QF7A 3EJWA 3KE8A 4WK2B 5I5GA 5E9JA 1HKHA 3CWCA 1WCIB 2B20A 2CZGA 2HWUA 3D8RA 2PZEA 3NATA 4I4IA 2ZRIA 5IAJA 5SV2A 5H0IA 4CV3A 4EJFA 5A4FS 1OIWA 1OAKA 3EGDB 3MT9A 3K0CC 4PGGA 1KRXA 1LBSA 1XJ0A 1ZHOA 5A5GA 4Z2YA 3ZW8A 1PVVA 1EK1A 4B9EA 3RIEA 3N39C 2HAEA 4CKBB 2QLNA 5I4IA 1QS0A 4MLZA 3TOZA 4DDHA 2G9UA 4YJGA 3QLJA 3KAQA 3PCRB 4E03A 1I6KA 2BH9A 2OAQ1 1F1BA 3JWGA 3TM5A 2AIRA 2DSNA 1FFAA 3UUGA 4DSTA 1GZHB 3CRMA 3IEXA 1O94A 2IYTA 1WEKA 1HE2A 1ZIOA 3LHIA 1NQOA 3MAAC 5BR7A 5JXWA 2XOKA 3U4QA 4S1TA 3C5HA 3G2LA 4JYMA 3H17A 1NC3A 2HSGA 5LZ7A 2CVFA 1VM6A 3TZQA 1ZOOA 5EWMB 3KT0A 5DDIP 1OC4A 2X9QA 4E5MA 4HLNA 1PNVA 2ACWA 2AFIE 4YJDA 5EGNA 4D98A 4IKEA 1FNBA 1L4KA 2FSGA 3HYCA 1EHYA 5CBPB 2ILTA 5IDXA 3OQJA 3MJVA 5TF0A 1Z26A 1BHSA 2FH5B 4LXGA 2L2QA 3FZYA 4OM7A 2ZS9A 2FE1A 4RC9A 2DPLA 2FA9A 2WU0A 1HFKA 4OLBA 1VRWA 2J1LA 3B38A 4MVXA 3THXB 2A88A 3CU5A 3QXSA 2G88A 2NXEA 5DXFA 3UMFA 2R1VB 1GQQA 4JEHA 4PTZA 4KK4A 1P72A 1LB1B 1RAEA 2D2EA 4PLGA 1K7CA 2QSYA 1N5IA 4R1LA 4KXVA 3RVLA 4OXXA 3V4RA 5CXQA 4RJIA 2O5EA 1BCSA 5E7MA 1LWNA 3WHLA 4B82A 3DQQA 4KR7A 2BFCB 3ZWCA 1YFJA 3HBLA 1IY9A 4ER0A 3WZMA 1FS4A 2GJ9A 4BQIA 4F0JA 4LXQA 1E2LA 3QUQA 1FXWF 4XVQA 3QTTA 3WNBA 1SXJE 4RL4A 2OZLA 5DYIA 3OT1B 3WKDA 2PTHA 3GFSA 1X70A 5CX4A 2DWPA 2G5PA 5CDYA 4YDQA 1R88A 1U0EA 5J2UB 1PQUA 4HWTA 2BAGA 4CF6A 2EHJA 3F4KA 2QTFA 2W00A 4AULA 3Q7EA 4URWR 3CSUA 4DCTA 5HOQA 3N8KA 3H4MA 4IX1A 4LBVA 1DTWB 1FRFS 4QUDA 5CGZA 5DXJA 4K03A 4R31A 4D0NA 1ID8A 1EMDA 2ZRFA 3NORA 3P26A 2GZAA 3NAQA 1XCJA 4W9MC 3TTWA 3GNQA 5EMLA 3ROKA 5AW1A 4G3XA 2NO1A 3EA4A 4QZVA 1K89A 2ATVA 2FWAA 1TX4B 3L0CA 3LS2A 5GP1A 5ALGA 1FRNA 5FWYA 3T0FA 3ZQUA 5BOSA 3IV9A 4RTJA 5FL7D 2YJGA 1F20A 1CEXA 2IEGA 3T3DA 3C4JA 3IOEA 4HWOA 1EQ2A 1LVGA 2B8EA 2ZR9A 4FN4A 4YACA 5T4BA 1ADYA 1LUAA 1AGNA 1R0SA 4GKAA 5CURA 5EFOA 5ESWA 5ELXA 2EVWX 3A10A 2J5XA 4GMFA 3A32A 2M9MA 5EHZA 2YX1A 3ECCA 5CG1A 4QGAA 5KQMA 4C4RA 4YCLA 2Q1XA 2WD7A 3IUYA 4JHXA 5BO5A 5HS4A 4UHKA 2PWZA 2PZFA 2XUQA 3C3DA 2BEUB 3DT6A 4FOLA 3WP0A 5BV7A 3VR0A 5AKHA 5TQ0A 1A3CA 5DHRA 3V8QA 2BELA 3VFDA 3UWDA 3L1IA 1J06A 1QGYA 1TPZA 2OHHA 5B57C 4RD6A 1XOIA 4NCHA 5B1IA 1ISHA 5LQSA 4GQBA 3ZIDA 1O95D 5EMHA 3MPUA 1T8WA 1NBWB 3ONEA 3I53A 3Q1KA 5FFMA 2C9BA 3A04A 5ICGA 3QW2A 2XRZA 4D81A 3IEVA 2HMYB 2VHUA 4XEHA 5CCEA 3D2LA 2PNJA 1G5RA 4ZVUA 4CCWA 1KKLA 3H2BA 1I9GA 4P2GA 1DARA 2O8DA 4X62B 4NVRA 5LC1A 5LOVA 2O8CA 1CEEA 1B0ZA 1E96A 2EAUA 2NNLD 4HNHA 5E6RB 1XRMA 3OPYA 2C95A 3MPOA 1R4NB 2VTBB 4MV4A 1DDOA 3E9RA 3ORYA 2I66A 4ZAGA 1SQ5A 2AR0A 2WKWA 5SY4A 2P6OA 3VYSB 3L49A 4EL0A 2GZ1A 4UM9B 4U7GA 4UC0A 2Y2VA 4O2BF 1VKRA 5ED0A 5L3RA 2WJWA 1DSSG 2FY8A 3PDUA 4KMRA 4HLUC 4KQ9A 3RU7A 2PMCA 3VR1A 3BXEA 4QDUA 1SXQA 1K97A 1JEJA 1I4WA 2R7MA 1QONA 1WS6A 2A57A 3M6XA 1D4AA 2FMFA 1PJ4A 2I1LA 3C7KA 2UVQA 1TJNA 1Y8RB 3EPPA 3OVMA 4ZOQI 1TM5E 1DBRA 3PYXA 4PBTA 3VHRA 2V7EA 3DTTA 1NE2A 3VV3A 4B85A 1HNZB 5KQRA 3KYJB 1C9MA 3AG6A 3C8UA 1Y6RA 1KDYA 4GXRA 4G25A 1RMTA 1SCBA 1NXVA 2Y1GA 1MB2A 3N7UA 1WULS 5F1PA 3Q5EA 2RHRA 1ZM7A 5KJFA 4I5EA 3WQHA 4H7IA 4NBTA 3QNWA 2IYSA 4C22A 1SU6A 1XTUA 3QHPA 4CT5A 1UFVA 2QX6A 4NIMA 1VL1A 3ESBA 4YA6A 1EJ2A 1PT9A 3JAMA 3TOXA 2A3NA 3E53A 4P3PA 3VYWA 3BEDA 3DHWC 4G5RA 3MSXA 4N5NA 5BPFA 2QVGA 4NULA 3CUYA 2AUMA 4Z7OB 2FKAA 2IOQA 5LYJF 2I3GA 4JLMA 5BW8A 1ZBQA 4W5JA 3I1IA 3NTQA 4OQYA 4F9EA 3LTEA 2YYSA 1NVKA 2P0AA 2YY7A 3IMFA 3NBMA 1N5DA 1CX9B 1AS0A 2IJGX 3VNBA 3EVZA 2H07A 1U3WA 1SRQA 2C1EA 3VYVA 5DIFA 3NIFB 2PO7A 5BNTA 3CUTA 3HSSA 4FDLA 3A2NA 2XCRB 1Q1BA 4BPBA 5HEKA 3KCNA 4R0MA 2CNBA 2PPVA 3JQ6A 1HG0A 1JAHA 1Y4ZA 4J7XA 2FDXA 4CM1A 4Y1RB 1O9BA 3MJHA 1XL1A 1IATA 1Q0ZA 3R0IA 1XELA 1W2GA 2R8ZA 3FDZB 3ZNQA 4O6VA 3ZI7A 1JAZA 1WY7A 3MG9A 3ZE9A 1XXHA 3DBLB 3R7LA 3ZKWB 3OF2A 3DEKA 5K0GA 1C8KA 1QWSA 1SC4A 3GDHA 4YALA 5FPHA 5U9CA 2C8LA 3EARA 3OE4A 4G8CA 1SOMA 4NZ9A 5B2ZA 5J2UF 1TADA 1WF6A 1S2MA 5AICA 5TT1A 5I9IA 4ETIA 3FKSD 3TNYA 4JLSA 1T10A 1Y81A 2F43B 1ENZA 3L01A 2PT7A 4IIVA 4NH4A 5DYYA 5LDDC 3VKGA 1QH8B 4HGPA 3HLKA 2C5SA 2W6IA 3HJHA 5BRNA 3USZA 5K45A 5ALNA 1Y82A 2FPLA 5CCDA 2YWXA 4W7IA 1AZSC 1N2EA 3CF6R 4MHOA 4TLLB 4FXPA 2O8EB 4CUZA 4J0DA 2D7CA 1DC7A 2GGSA 2FMTA 2VT2A 1Y5LA 4DB2A 2ENWA 4UXIA 1PUJA 1GSOA 1JAYA 1EWTA 3FGOA 3RBZA 1YK0A 4ZALA 1I3NA 5C1PA 4WGGA 2PG3A 2PSHA 3CRZA 3IC5A 1YDHA 3GCZA 4FFPA 4X44A 3MA0A 1DTEA 3KAPA 3COSA 4IO0A 3E03A 4J16C 5FNZA 3ITDA 2BD0A 2IHVA 4YC7A 4BC1A 3R0QA 4PPGA 2PX4A 4UMFA 3CISA 3ZD6A 4ZAXA 1ZJZA 3AW8A 4AKEA 4J6EA 4LQ4A 5DOVA 1RBZA 3BB3A 2XE8A 1U0LA 5D7BA 5CBKA 1BMFD 3MTAA 1VLQA 2BY4A 4D8TA 4QVGA 3EISA 1ONPA 5LDGA 3UYLA 5KTYA 3WMFA 4EIWA 1RQXA 2SCUA 4MX8A 4HDNA 4PGFA 3O90A 4DJFC 4QLBA 4C4OA 3D02A 3FM9A 4WLFA 4JAVC 5TMDA 2CY0A 4FVTA 4ZO6A 1M2VA 1WOMA 4AAYA 4G0QA 4FFVA 3BHNA 3JY6A 4LNUB 3UCXA 4TKZA 2AMYA 3SZRA 2XBUA 4Z7QB 4KQXA 3IUMA 2H1FA 2XNDA 4OEHA 4RF3A 4RDXA 2Q1SA 4TOIA 2N47A 2IYOA 3SHWA 3SDZA 3I92A 1M6YA 1OGYA 2Q5IA 4LV6A 1XEXB 4NV1A 1IXZA 1HRKA 4F04A 5CFRA 1GPUA 1IXSB 1H2YA 3CWQA 2GVDC 3CB4A 1CFJA 4GFDA 4UTZA 4CIYA 2HRBA 1DJOA 3FRHA 1NNLA 5ITWA 2AW5A 2VP4A 3DOUA 4JY7A 2C77A 2VHWA 3QH4A 5B58T 4X1OA 1OLUA 2ZTLA 4U7WA 4D02A 3GH1A 1I5OA 3MCVA 1Q3HA 3BM5A 2AFHE 4FHFA 4R05A 4TXHA 2P2YA 4UE2A 2DQYA 3U19A 2CEKA 3S29A 4TT3D 1DQYA 1TVCA 2XYGA 2DUUA 1RI1A 2MYNA 1B16A 1IJKA 1JIVA 2CL6X 3I52A 1T8TA 1X7ZB 1I2MA 3LOQA 2PH1A 3HNRA 5JMWA 3WGLA 1MV8A 1NQTA 1PR4A 2AB0A 2IXFA 1FDUA 4YJ3A 3KYCB 5G4KB 3DVAB 3LUKA 3HJGA 4TTPA 5FNVA 3OD5A 4D4JA 1WPQA 1A2KC 2WKPA 3NTLA 4G0ZA 4YMTA 4LXXA 1ULZA 3FPGA 1R16A 1UK9A 2ZE8A 3C85A 3QKTA 4IMIB 5BV8A 3EQ2A 3TLMA 3RTBA 2G72A 3GFBA 3Q3GE 4U63A 2YVKA 1MO2A 1GL9B 1QYRA 3HR4A 4QHYA 1Q14A 4TQUS 1MJHA 2GJKA 3EZXA 2OXRA 4IGAA 4IOKA 5L6MB 3CEJA 1JIUA 3IXMA 3D7LA 2Z3WA 3VXKA 1M2NA 5CLGA 4IJKA 4MCIA 4YJFA 1PL8A 5BN4B 4YX9A 2ZBFA 3KLPX 1CCWA 1ORTA 1WCYA 1M9NA 3BB1A 1FYXA 1HDRA 1XG5A 1D3AA 2O3JA 2UUPA 3CLTC 3G2JA 4FZRA 1W5AA 1NG9A 1GCGA 3LYHA 5B30A 1NUSA 1K6EA 1Q0PA 3LC1O 1YR3A 2ZB8A 4DB4A 2R8YA 1WUIS 2LDBA 1D7OA 1J99A 1W49A 1ZSNA 2O05A 5AM4A 3NHBA 4AY5A 1J09A 1DKOA 2MT9A 4MZXA 2F1OA 4NXNB 3BHIA 2D1QA 1GTMA 1PGPA 1LSOA 1SCNE 5IJAA 3I4LA 5KKCA 1NKSA 1E8DA 1XLTA 4PZAA 1L5WA 1OKKA 3RG8A 2FZ5A 1YF3A 5BW4A 4FD3A 5FA6A 3HJTA 2QI9C 4WXEA 1A7KA 1QTIA 3ROGA 1KVQA 1M34B 4K9QA 4Q9LA 2B9VA 5E1DA 1WU7A 4O2LA 4R1PA 2CLDX 2OMKA 4C4TA 5IXSA 1UWVA 2PUHA 2RGUA 2ON6A 4WZBB 4WINA 2BZGA 4Y2HA 1UT6A 2HGZA 3FLMA 4Y67A 5DT9A 4B6RA 4B7ZA 1OASA 3RC1A 4F2DA 2RDMA 2IUSA 4W82A 3OEWA 5KTTA 1ODIA 3HBAA 4QM6A 3N3BC 1HMYA 3T5TA 1G291 2IE8A 1GHTA 2OK8A 2V74B 3BC1A 4L75A 4KNYA 3JQGA 4GYKA 3TB4A 4JNKA 1GKYA 5BSRA 1XZ8A 3G8BA 4NE2A 1J25A 1YFZA 4P98A 2G67A 1PR0A 1A9SA 3CZQA 3V8MA 1GRRA 2B4KA 2D4HA 3KWFA 2EIXA 4FUQA 4OQLA 4ZOEA 5JPDA 2OFWA 4MIYA 3U62A 1YVUA 3UV3A 2O2GA 2PKXA 1R12A 3A2MA 5K2OA 3SFZA 2G9NA 4QYXA 1HDZA 3AVXA 4X41A 5M3BA 4HBGA 3JALB 4B3XA 5B1EA 1KDZA 5KTMA 4FXOA 3RSCA 5IT4A 2J48A 4ARVA 4QG3A 5KQLA 2RCYA 3LAWA 1LW6E 5HIIA 2V7QD 2ZYIA 1NJ2A 4JT2A 3OECA 3GJXC 1WA5A 1WB4A 1L9XA 1H