4CM4A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
250
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 94
structure length 250
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm4A00
2X6TA 5L7YA 4J1NA 4IGEA 2DPGA 4CM5A 1OI7A 1N8KA 2B5VA 4OHUA 3RKRA 1NVGA 1NFRA 3K2EA 2ZTUA 2C20A 3KO8A 1GYRA 1PS8A 3VH3A 1ONNA 5DCUA 5L7WA 4AJNA 5HBRA 3FNHA 4E31A 4L8VA 4I5DA 4WGGA 3QHAA 1PSDA 1ZNQO 3GAZA 1PR3A 4MIOA 4BOYA 4DBZA 5CEJA 4R9RA 3UUWA 2Y1OA 3QVWA 4R68A 3WG9A 3INGA 3WWYA 1M6HA 1Y7TA 2BF7A 2YDYA 2C29D 2OP1A 3E9NA 1BTOA 1GDHA 3H5AA 1ZK2A 4XYBA 3TPCA 4Y6PA 4CUJA 5KOIA 5T8KC 2O23A 2QG4A 1P3DA 2CDCA 4O6VA 4P4GA 4CQMA 5G0VA 4CLXA 3A14A 1N92A 1V9LA 3NTQA 4XX0A 4ND4A 1DAOA 1GTMA 2PK3A 3GEGA 4CMEA 2GUGA 5F1PA 1V3UA 1I33A 1UP6A 2AEJA 2Q46A 3NGLA 4QT0A 5JO9A 4ND5A 3AY7A 1UDAA 4Z9XA 3E5MA 3U0BA 2BFMA 1LX6A 2PY6A 3LT2A 5EERA 3S55A 4YRDA 1HXHA 2Q50A 3EC7A 4PG5A 4WCFB 5CEEA 5CDTA 2DAPA 2Q99A 3E82A 1L7DA 1XA0A 4CL3A 1CJCA 4KTTE 3CMMA 5ILOA 3K8ZA 4GL4A 3JQFC 1NAHA 3OHSX 3IKTA 4ZN6A 2DU8A 3WGQA 2NU6A 2PZJA 3Q3CA 5A02A 1LDNA 3I23A 3ZU5A 1ZSVA 4P38A 1SEVA 2BI8A 3INTA 2VYND 1JQBA 3G49A 5A04A 3C1OA 2CD9A 2P68A 2PKRA 1P74A 2PA3A 3DBLB 3GMDA 4RVGA 4CLDA 1P0CA 1U8FO 1DIGA 1XQ6A 2J3JA 2GZ1A 4LK3A 3H6KA 3JQGA 3LZ6A 4LVUA 4MVJE 1YJQA 2DFDA 1BHSA 2NU9A 3VPGA 1WP4A 3ZWVA 4E32A 2J5KA 1NR1A 1H6AA 1D1TA 5IDWA 1I0ZA 1V35A 3ICPA 3ZWOA 4B3IA 5L9AA 2Q1UA 4YT8A 3S1LA 1PX0A 3LT4A 4P22A 3ROMA 5L95A 1Y1PA 1IL0A 3I6IA 4LCJA 4FJ0A 2Y66A 1DC5A 4MVJM 1NPDA 1ZEJA 1U3UA 1BXZA 1LLCA 2CDBA 3TSCA 5ITWA 5JY1A 3WS7A 4JJIA 3FRJA 2B0JA 1OZAA 3ZCXA 1MFZA 4A03A 5KJFA 4HKTA 3BHMA 4CMKA 4CV1A 1NAIA 3O8QA 5U1PA 5KVSA 1TEHA 4J49A 1N9GB 5EINA 3HDQA 4GH5A 2VHXA 3ZWMA 1DDOA 2HMVA 3JQ6A 3PWKA 4YT2A 1NVMB 1ZMTA 2FN7A 2DM6A 2V7PA 3GQVA 3WJAA 3DHEA 2VWQA 1VRWA 4HV4A 3DMTA 1Q1NA 3UVEA 3QIVA 3ZHZA 3RUEA 4AJOA 3D64A 4D0RA 4CMAA 2HRZA 3HDJA 1EBUA 3IJPA 3R3SA 2VYNA 3HUDA 3ZHBA 3IAHA 3LC1O 4CM4B 1MG0A 3I9OA 4J2HA 4CMCA 4RDIA 1O0SA 2DBRA 3OH8A 3TZQA 2VWPA 2QQ5A 1Y9EA 4ALIA 1Y5MA 2OP0A 3QY9A 2HDHA 3NT5A 5L3ZA 3WSWA 1NQAO 4CLEA 2IDZA 3KRTA 2NQTA 2B5WA 1KVSA 3OEWA 5L4SA 2EW2A 4XKJA 2IXAA 4E4YA 3RROA 3WGGA 3IQDB 2Y05A 3VAZA 2ZJ0A 4W4TA 1P9LA 5TF4A 2NLOA 1LSJA 1V6AA 4NBVA 1QSGA 4YRBA 3H3FA 1PZGA 2AQIA 4E3ZA 6LDHA 4CM9D 1ZZEA 4DTIA 3KYBA 4LSWA 5ITVA 3RSHA 4QUKA 4AJ1A 3ZWXA 2ZTLA 1HF3A 2P5YA 5JS6A 2YZ7A 1JKIA 3UKOA 1FDUA 4AJIA 3LQFA 4YRAA 3KETA 2Q3EA 3OA2A 1EUCA 4HNHA 2PH3A 4OQZA 3ZV6A 1HE3A 5G4KA 3W8FA 4ZHSA 2J3HA 5THQA 1LDBA 3WGZA 1VM6A 3TQHA 2AG5A 1Z7EA 1NPYA 3UCEA 5JBIA 2YV1A 2P4HX 4YAEA 4CQLB 1ONPA 1Q0LA 3RASA 1X14A 1A7AA 1Q0HA 2PGDA 3JD1A 1K89A 3M6IA 3RI3A 1E3WB 2FSSA 4NIMA 3JD3A 4U8GA 2YDXA 4N18A 3B1FA 1I32A 1D7OA 4NH4A 3K92A 3HDYA 4B8ZA 4OSOA 4E5PA 1O94A 3A9WA 1JTVA 5CG1A 3H3JA 2BGMA 3ZWWA 2P2SA 1XR3A 1ZK4A 1LXCA 5TLSA 1GEGA 3K73O 5A5EA 3PK0A 1B26A 1JKJA 3NT2A 1R0SA 4BVAA 4D7AA 3D3WB 2OHXA 3E03A 4Z3KA 4IXWA 3QV1A 1C14A 1ZBQA 2PZKA 4Z6KA 2D5CA 1U3VA 1F14A 4IMPA 2VNSA 3PGXA 1XLTA 4XYEA 4NHEA 4E21A 2ZYDA 3KSUA 2AA3A 1Y8RA 4CV0A 3VTZA 4CMIB 4YPOA 1I3KA 1YGYA 3WGHA 2BI7A 1UP7A 4ZVVA 2JL1A 3QP9A 4O63O 4CQMB 3CINA 5J23A 2RBEA 3ASVA 5TJ9A 3OP4A 5CPFA 2FP4A 3EZLA 3WWZA 3RC7A 4PLVA 4LRTB 1XU7A 1JAYA 1H9AA 4J16A 4RPJA 3GNSA 2DVMA 3ZH2A 1KEVA 3VH1A 4BO7A 4PZEA 2AEMA 5DP2A 4BKQA 2VYVA 2BKAA 1U5CA 4XD2A 3WYBA 3CXRA 4FR5A 4WLFA 2A35A 2JD0A 3RC1A 1BRMA 2G17A 1LI4A 3GY0A 3IUPA 4FFMA 4ONEA 4WPGA 4DBVO 4GKBA 3GVIA 3ROQA 1YONA 2W2KA 4OXNA 4PLGA 2O3RA 3ETEA 1BW9A 1Y81A 5IZCC 3WGIA 4LISA 4K6CA 4YTEA 4CLRB 4E13A 5KJ1A 3S2FA 4GSLA 3NTOA 4MP3A 4WOJA 3KM0A 5B1YA 1FDWA 1LRLA 3Q2KA 3L4SO 1E7SA 4ILKA 4L4RA 1LSUA 3WNQA 1ZJYA 1FDVA 1PR9A 2VRBA 3DBRB 1GZ3A 4HADA 1ZXLA 2C0CA 4DQVA 1PQUA 4BL5A 1SC6A 4I08A 3M2TA 3RUHA 1HDYA 1E5LA 3KXDA 1ZH8A 3K31A 4J7XA 1XELA 4D41A 3BAZA 1E3EA 3INRA 4R41A 4XYGA 4FS3A 2EF1A 1KY4A 3PGJA 5JLAA 3C7CB 3TF5A 1LUAA 3BXXA 3KYDB 4FGSA 4HFJA 1DIBA 2C54A 5JC8A 1X15A 1SO8A 4D44A 2YFHA 3PPIA 4WECA 4WLNA 4DQUA 9LDTA 1Q7BA 1DHRA 2J6IA 2AHRA 1FDTA 1I2ZA 1QYCA 4GI2A 5LDHA 1CRWG 3N7UA 1QP8A 2VRCD 3QVXA 2O3SA 1SB8A 1MXHA 3LDHA 4MVJG 5G0TA 3B6ZA 1PIWA 4PLYA 5F1OA 2GERA 1DLIA 3FR7A 3RKUA 2VZ8A 4UVHA 2YHIA 1XCBA 4D0SA 4B4VA 1UZMA 4D3SA 1HDXA 4BV8A 1PGJA 3AUSA 1SOWA 3E9QA 4YBZA 4HX5A 2VHYA 3PQFA 3C85A 3WOHA 4YJGA 3NJ4A 3GOHA 1EQUA 2V6BA 3DEYX 3LLVA 3KSZO 4MVJH 4ZRMA 3C3XA 4IMRA 4BS9A 1OAAA 4XRRA 4FCCA 4TRMA 4N54A 5HWSA 3GHHA 1CIVA 3AM5A 4UVGA 5I7SA 3FTPA 3KZVA 5F5NA 4DA9A 1QYDA 2OZPA 1NQ5A 3ZU2A 2PNFA 4LGVA 3U62A 2G5CA 4ND2A 4QTZA 1R37A 2DBQA 4WASA 5C7OO 4DPKA 3FSRA 4O0LA 1DIHA 5ADHA 4YAKA 3OETA 3O26A 3RUDA 4Y67A 1GQ2A 2QRJA 1IE3A 1NXQA 2W98A 4PFJA 5A9TA 3D3EA 5BSGA 4Y6SA 4NBWA 3PZBA 1A72A 1CQJA 3DHNA 1LEHA 4WLOA 5EN4A 2NVWA 2RH4A 3PLRA 1Q0QA 3B1JA 2GNAA 5ILGA 3T7EA 4DYVA 3PFFA 2X0JA 4XB1A 2X9NA 5JCJD 4MKRA 1XEAA 4WCDA 2WYVA 3TJRA 1I3NA 4TKMA 2NTVA 3GN1A 3QLJA 5A05A 5GMOA 1X7HA 2A4KA 4YQYA 1NWHA 1S7CA 4OGWA 4FN4A 5L7TA 4PG7A 3OQBA 3D7LA 3GPIA 1HE4A 5ICMA 4RPKA 1FDSA 1M75A 5JW6A 3KEQA 4E2ZA 2W2LA 1K6IA 3H8VA 3WSVA 3ZWBA 4F6LA 4Z9YA 5BT9A 5DF1A 4MOWA 3SVTA 1LLUA 3PP8A 4MPDA 4B7UA 4XQ9A 3WQSB 1EVIA 5TSDA 1R6DA 1EDZA 2OFPA 3H65A 1XYGA 3PHGA 1W73A 1GUFA 1Y8QB 3PQEA 1ISJA 2JCYA 5JYEA 1PS9A 2CUKA 2VT2A 4F46A 3JQAB 1E5QA 1YDWA 3K30A 1U8XX 4DC0A 3MTJA 2ZKLA 4AL4A 2O4CA 3FPLA 1GCUA 3V2GA 3HADA 1AHHA 1O9BA 3QW2A 3U09A 3DTTA 4PRKA 2I6TA 1U4OA 1XHLA 4FFRA 3LT0A 1EFKA 1H2HA 4EZBA 2Q1WA 4NBRA 1KY5A 4L73A 4R1SA 4KDEA 1WXDA 4II3A 3STHA 3JQ7B 3WJ7A 4GGOA 4YJHB 3WLFA 4E33A 2GZ3A 2Y99A 1GZ6A 2HMTA 4JCOA 4MJLA 3ANNA 3AOEC 3T7CA 3H5NA 1QV6A 3Q9NA 1VSVA 1DC6A 1W6UA 4JROA 1U3WA 3COSA 4QXMA 3GG2A 4NFSA 4M8SA 2EIHA 1L1FA 3ZWNA 4UAGA 4BNKA 1JAXA 3JQ9A 3GVXA 1C1DA 5EMHA 3U4DA 2NM0A 1S6YA 1T2EA 3ZV4A 1M66A 1P1RA 4EI2A 4JNKA 4L75A 3ZHYA 1A4UA 1DSSG 2NQ8A 2NV6A 4YB8A 3H9GA 2DPHA 4WLVA 3BMQB 2VN8A 3UGKA 4DIFA 4Y9DA 3JYQA 2UDPA 1WWKA 4YDRA 4W6ZA 3VZPA 4BHTA 2ZB8A 3VDRA 1R12A 4S1VA 4BO1A 3QVOA 2P9EA 4LMPA 4BGEA 3FI9A 2YV3A 4U6QA 1PZHA 1IHXA 4XR9A 1GQQA 5ES3A 3P2YA 4JQCA 2DBVO 1PWXA 3FWZA 3GUCA 4BQPA 3KEOA 5FI5A 3CPSA 3GUYA 3IS3A 1LJ8A 5CDYA 3WQRA 3P5SA 1UH5A 2FMUA 4PLZA 1B15A 3AFNA 1ENZA 4M89A 7MDHA 5IJZA 5HA5A 2E82A 3HDHA 4J0EA 3WGOA 3VZQA 2BFAA 1BXGA 1EZ4A 4XIYA 2OBNA 4BB6A 4K9DA 2OXIA 3AK4A 3U4CA 3ZHXA 1GUYA 1WZEA 5KWEA 3AY6A 5KKAA 3F3SA 3JQBA 4LW8A 3L6EA 4CLHA 4Q3EA 1K0UA 4XA8A 1HTBA 4DVJA 5A9SB 4MVJA 4IDGA 2X9GA 3UICA 2P9CA 4WEOA 3ONFA 2FR1A 4EUFA 5EIOA 4NDNE 1KS9A 3K5PA 5I8ZA 4EW6A 1LLDA 1V8BA 3MJEA 3E18A 3NRCA 5EQFA 1G0OA 2VT3A 4BV9A 1K6JA 3PXXA 1NPTO 4FFOA 1BSVA 4XCVA 1X13A 3EZYA 5JMWA 1DRUA 1LLQA 3RJ5A 2NVUB 2GR9A 4E30A 4CPDA 1V3TA 3QRWA 1IPEA 1F8GA 3JQ8A 3UW3A 1DBVO 5C3MA 1N7GA 1Q2XA 4YWJA 2X5JO 4PVCA 4IDBA 3MJCA 5F5LA 1HWYA 3TRIA 2Y67A 2IRWA 1YXMA 2O3UA 1JLLA 4Q3DA 5ER6A 2G76A 2CF5A 2D4AA 4TROA 4QEDA 5L4LA 5B37A 3HN7A 2NWQA 1OOEA 4IJUA 3FD8A 3H9EO 4ROSA 3HHPA 3CTMA 4R1UA 3F1KA 1F17A 1EK5A 3NDRA 2B4RO 4TWRA 1QLHA 1RM4A 3LK7A 2QX7A 1KVUA 1MX3A 4C4OA 4DC1A 1ZEMA 3FNGA 4H16A 1N5DA 3NTRA 4EITA 3LLSA 1YB1A 4DGSA 2WMDA 4OXKA 3AM4A 3PVZA 1K3TA 1Z45A 3VVBA 2CDAA 5KJ6A 3NX4A 3PI7A 3SLGA 4YAGA 2YHIB 5TS3A 2BHLA 4M1QA 1VE9A 3OEYA 4R51A 1Y6JA 4LVCA 3Q0EA 4NFYA 1H93A 3PIDA 1HSOA 1NR7A 1EVYA 1E92A 3ZNOA 3S2EA 3RC2A 4IIUA 1KVRA 1FK8A 4TVBA 3GRKA 3SX2A 4A73A 2WWRA 3WBFA 3KSDO 3VPXA 2YV2A 1BDMA 1YL5A 4B4WA 4J4TA 1MA0A 3LC7O 4O1MA 1TT5A 4ALMA 1DB3A 2O4UX 3OQ1A 4E0BA 5COAA 1H6CA 2GN9A 1B8PA 2UYYA 1O5IA 4QECA 4KQXA 4ALKA 2WD7B 4ZU3A 3LSYA 4Q9NA 4BIIA 1PS0A 2O7QA 4WLEA 1EUZA 3L0DA 2ZQZA 2I67A 1H2BA 2PZLA 4HFNA 4BNZA 1IOLA 4L4XA 3F46A 3SBOA 3IOYA 4BGUA 4BNUA 3BMNA 3MZ0A 2EKPA 4MIYA 3ORFA 2XOXA 3FR8A 3GVCA 3OJFA 4R1NA 3VH2A 2V6MA 4GKVA 2AW5A 3WFJA 5T5QA 3QWAA 1ISIA 1JW9B 3GFBA 2NUAA 3TWOA 2DTEA 3FF4A 1VI2A 4DUPA 4CODB 4NBUA 3OIFA 1U7TA 3QVSA 4PGFA 4RQTA 2R2GA 5GZ3A 1EEHA 2IZZA 5CEFA 2OGUA 3MTGA 3R1IA 4N5NA 4RVDA 1Z6ZA 2HMWA 3TOZA 3BZUA 4OMUA 3Q6IA 1DAPA 4XJSA 2VYVD 1PQWA 3UOGA 3WTBA 4F6CA 5C7IO 2E6UX 1TLTA 2OO5A 5JYDA 2AQHA 2G1UA 3JQ9C 4P4NA 4R3NA 1K2WA 2H5LA 5DCYA 3JQGB 5FEUA 4MKXA 1T2CA 5DBGA 1PL7A 1VKNA 3DZIA 1EVZA 2VTDA 1CYDA 3BMCA 4B4OA 2FHSA 4CMBA 1RM3A 1P31A 2LDXA 3FNEA 3OQ6A 4PLPA 5G4LA 4PLTA 3OM9A 2X58A 3RJ9A 2RHCA 1GPDG 3D1LA 3RAJA 1P0FA 1Z82A 1DIAA 3L9XA 4WEQA 4N5LA 2VZ9A 2I3GA 4UULA 5I9MA 2PKQO 1ZCJA 1RWBA 3C1TA 3P2OA 1NHGA 1SCUA 4KMSA 3RU9A 1DRVA 3JQDA 4N7RA 3WMWA 2O48X 3IP1A 4LN1A 3A28A 1GYPA 3AY3A 3W6UA 1CQIA 2O2SA 2XXJA 3PTZA 4BNIA 3BMCB 1GUZA 3W8DA 1E1NA 2FR0A 1G6KA 4RVHA 2C07A 2WE8A 4PCVA 4AJHA 3VHRA 1VL0A 2QYTA 1YB4A 3VDQA 5A06A 1B16A 4TZTA 4J6FA 5DCWA 4BMVA 3LYLA 4RF3A 5A3JA 1RPNA 3F4LA 3GVPA 1HZJA 5F21A 4UVIA 1P44A 1PJCA 5CFZA 1U4SA 3HE3A 3OIGA 2R00C 1A71A 3CIFA 1I24A 4CR8A 4M54A 3AW9A 2VWHA 1GL3A 2BD0A 4BNNA 1XQ1A 3QWIA 2PD4A 1IYZA 4OO3A 4RVSA 3ZV3A 2EKLA 3GGPA 5JE8A 4BNJA 1JWBB 2AQ8A 2B36A 3O9ZA 4GWGA 1FMCA 4NZ9A 4OH1A 3A1NA 4H15A 3VPSA 2E37A 1QXSA 3GLQA 2X5OA 3I9KA 2XPCA 4WLUA 2X8LA 3I9LA 1A9YA 4INAA 4KQWA 3Q1LA 3IMFA 1W0CA 1B14A 3JD4A 3PYLA 4YT4A 3WGTA 3CMCO 1GZ4A 4NU6A 3V8BA 5ICSA 5IXSA 5L45A 1WPQA 4I9NA 4PLWA 1T4BA 2GZ2A 1GPJA 3DR3A 4RF4A 5JAZA 5BQFA 4JX8A 4PN3A 1U3TA 2B37A 2AXQA 5AOVA 3ROPA 1V0JA 4DYDA 3N74A 4N5MA 3WICA 4XQCA 3ENNA 3HFSA 1WMBA 4PLCA 5AXCA 1UZLA 3BHIA 3GR6A 4FDAA 2NU7A 1GY8A 4RPHA 1UP4A 2VCYA 1QYXA 3M1LA 2Y68A 1JVSA 4R5HA 1R16A 4DQXA 4WJZA 5T6BA 2I9PA 4AVYA 4ALLA 1QYWA 2J5RA 3H5RA 3DL2A 1SPXA 1RKXA 2FWMX 2B83A 2OUIA 2DTXA 2Y0EA 4JP2A 1MXFA 1ZVMA 4KWHA 2CY0A 4PG4A 3TNLA 4CLRA 4XIJA 4GMGA 1J4AA 5HS4A 1HYHA 2W2KB 3GRPA 5BNFA 5TC4A 2VWGA 1T1SA 3SEFA 3K2BA 1GYQA 1I3MA 4YXFA 2JKVA 4MVJP 1QRRA 3DC2A 1HEUA 1J6UA 3JQ8B 4KZPA 3HNPA 3DAGA 3Q2IA 4CLOB 1XKQA 3EGOA 4FC7A 1RYEA 2Q4EA 2BGKA 3PIIA 3R3JA 4JLWA 3RUFA 1ZUD1 5IAAA 2V65A 1HDZA 1PJ2A 1WZIA 1P1KA 3UN1A 4RQUA 3WNVA 3AUTA 3U9LA 4IZHA 2VOEA 4NJMB 4XDZA 2FY8A 1B7GO 3OICA 3LVFO 3IJRA 1P45A 1H9BA 1LA2A 4IS3A 4KTVE 2O7SA 4CM8B 2ZB7A 4RDHA 4MVJD 1YOVA 3RBXA 3MOIA 4UVEA 1DFGA 1C0IA 4FW8A 5G2OA 4RVFA 4CMIA 3SLKA 5JSFA 1LSSA 3A06A 1U9JA 2NVBA 2JFHA 3PJDA 1PTJA 3JYOA 2POQX 1YQDA 2RIRA 4IPTA 5BR7A 1H6BA 3X2FA 1GV1A 1HDGO 3O38A 3PHLA 1UAGA 4ZICA 3D5TA 4QO7A 4BKRA 1EE2A 4GX0A 3PJEA 1SAYA 2ZYGA 4BO8A 4MIEA 1YH3A 4ALJA 4EEZA 4M55A 2DC1A 1O8CA 4NJOA 1HT0A 4Z3DA 1Z74A 3GF4A 5A1TA 5KVQA 3GZNB 4GPD1 2V6GA 4FFNA 4L4SA 1LTHR 5I7EA 1A4IA 4BO0A 2EKQA 3RWBA 5JDCC 5JNLA 1T2FA 2FPIA 4J90A 5BSHA 4BO2A 5HRUA 3IP3A 1WDMA 3AU8A 5I7FA 4MINA 2FZWA 2DTDA 3WYCA 4IJVA 4ZQGA 2Q2QA 3RUAA 5COBA 1I2CA 5T67A 2J5QA 3FTNA 1MC5A 3SJUA 4FFPA 5ENDA 4I5GA 3KUXA 4D45A 3PHJA 1YKFA 1JA9A 2NTNA 4JBIA 4BNVA 1PL8A 2UVDA 2O50A 4WNIA 1Z73A 3E5RA 1L7EA 1YO6A 1CF2O 3UCXA 3FPCA 2ZATA 4I5EA 4BKPA 1PZEA 1X7DA 5A9SA 3F6YA 5L4NA 3DHYA 1VL8A 3ZWCA 1HRDA 2QIOA 4TMFA 2D5AA 2JHFA 3F47A 1TXGA 4CM1A 1PGOA 1IUKA 3OBBA 1ENPA 4GLOA 4QSMA 3ST7A 3WMXA 1EBFA 3AI1A 2WEKA 3RU7A 4AJ2A 1U2DA 2Z1NA 5JMPA 1TT5B 4IDCA 5G0UA 5IXYA 3ZU4A 1B3RA 4XGNA 1P1FA 3I9MA 4ZQEA 4ZGWA 1ZJZA 4MP6A 4X54A 1HYEA 2TMDA 1LRKA 1E3JA 1NTOA 2IZ0A 4FD3A 3WIDA 2JD1A 1ADBA 2R6JA 2X22A 3HQ4O 3F9IA 1WMAA 1A27A 1E3SA 3BTOA 1D1SA 1KC3A 3DTYA 4IBOA 4W7HA 3RVDA 4BNYA 4B8WA 2BFPA 3H7AA 4TKLA 4FGWA 3ITKA 4OSPA 5AQ1A 2A9FA 2AE2A 2HQ1A 4J1TA 1A9ZA 3BTVA 2F1KA 3W6ZA 3JCZA 4O59O 4EBFA 2HJRA 3TFOA 4XQEA 3TL3A 5JC1A 2O3TA 4AJEA 1EUDA 1GQYA 1PU2A 3P19A 3OJ0A 4XRGA 1PGNA 1UXJA 1HDOA 5EPOA 1DPGA 2IYPA 3G79A 3S2GA 7ADHA 1H0KA 2FSVA 2JJYA 3VVCA 3O8QB 1B3BA 2DLDA 3MJSA 5C37A 4H7PA 5TIIA 2D1YA 1QV7A 3NDJA 4OXYA 2PWZA 1JKFA 1YWGO 3GA0A 2J3KA 3HZZA 4FIZA 4YJHA 4U0JA 5IFLA 5HTOA 4ZQBA 3GC6A 4H3VA 2Y0DA 1YDEA 3LC2O 3ZWAA 1HETA 3L4BA 1M2WA 1E1LA 1TI7A 4WK6A 4YYZA 5B4VA 5KIAA 5T57A 4M87A 2F00A 2AEFA 4FPXA 5L40A 2PFGA 4P8RA 2HCTA 4Y8VA 3JD0A 5TJHA 3WLEA 2VNAA 4HXYA 3GEDA 3ITDA 1JN0A 4D46A 4KDFA 1LC0A 1MUUA 3KYCB 2OBYA 3JQAA 4LMRA 2OOSA 2YUTA 2PH5A 2XXBA 1E3WA 2X0NA 3ZWPA 4IJKA 1VJ1A 2VOJA 3JQBC 3PYXA 3PFWO 4JJFA 1IZ9A 1DXYA 1NQOA 4KUGA 4M86A 3EUWA 3PWZA 1T25A 4NI5A 1KERA 4J1SA 4AJPA 4YVFA 2X9VA 3I9NA 3W4JA 2VZ0A 3G1TA 1DC3A 3GEMA 1KEUA 3H9QA 1LDGA 3UFXA 1I2BA 5FWNA 4ZRNA 1QORA 3I5MA 3BTUA 2OORA 5A9RA 4BNHA 8LDHA 3I9JA 3RC9A 1C0PA 3TOXA 2ZTVA 2I5PO 2TMGA 3ZWYA 2QRKA 5DOZA 5JAQA 4J9VA 4D43A 2QW8A 2Q1TA 3OF2A 4Y98A 5K0ZA 2DKNA 3ETDA 2WM3A 4JGBA 4CR7A 4HFRA 5DNAA 3WYEA 4BO3A 1HSZA 1BXKA 4BNFA 4BO6A 2W90A 4NK4A 1F06A 2DQ4A 3ANMA 3VH4A 3ZZNA 3VKUA 1GV0A 4QX6A 4DIBA 2Y93A 2UAGA 4MVJF 3OA0A 3PHIA 4FBGA 3BMQA 5LCXA 2JAPA 1JDJA 3GN2A 1PJLA 3SC4A 2X7HA 4DREA 3RBVA 1P1JA 3A4VA 4EGFA 3PDJA 4OKIA 5F1KA 4GGPA 5CG2A 4UUOA 4BNWA 1YS4A 1FF9A 3JQAD 1YBMA 2E4AA 1M76A 1E7YA 4II2A 4NPCA 3GT0A 4UUNA 3V1UA 2BFOA 2XAAA 3GAFA 4IZIA 3DONA 1W8DA 1F12A 2FOIA 3HG7A 1LU9A 1QKIA 5JDCA 1AUPA 2B4TO 1PQPA 2X0IA 2P4QA 2VUTA 4NMHA 3S8MA 4XR4A 2JCXA 1MG5A 2HK9A 1I8TA 1RYDA 1AE1A 3BA1A 2X4GA 4R5MA 1Y9AA 2QZ9A 2FPPA 1U1IA 4BNTA 1VJ0A 3DAPA 5DULA 4KP7A 4I9UA 3GK3A 5I7VA 3VZRA 1IULA 5A4DA 2E48A 4CM3A 3CH6A 3CKYA 3JQFA 2A92A 4OM8A 5AXAA 3RCBA 4A7PA 4R3WA 4YAIA 3PRJA 5T64A 1BVRA 1HYGA 4ZA2A 3KTDA 4JBGA 1N2SA 5JDIA 3FWNA 5JFOA 4NU5A 1Y5RA 2HJSA 4IJWA 4GX2A 3X2EA 2JCVA 1NFFA 3W4IA 5T8KA 4RZHA 1ZIDA 5KKCA 3VZSA 4E5KA 2EERA 4NQZA 2IEDA 4PZDA 5IDYA 4FOOA 2ET6A 3K6JA 3KHUA 3DBVO 3RUIA 1E6WA 2WYWA 1UAYA 1IPFA 2JD2A 2EJWA 4L76A 5MDHA 3OECA 1PJ3A 1NNUA 1YQXA 2CVZA 3F5SA 1I10A 4JK3A 1GFSA 1GR0A 3I4FA 4BO4A 4A0SA 1EDOA 4DMMA 4Q3AA 5BNTA 1WDKA 1WW8A 3HSKA 4TQGA 1U2GA 2NSDA 5HS6A 1P1IA 9LDBA 4EJMA 3C7DB 3QQPA 2HO5A 3ASUA 1ZW1A 1BW9B 1Q7CA 4J7UA 3ZDFA 3G17A 2HK7A 1KEPA 3PJFA 4IQ0A 4U7WA 4E6PA 5I8WA 1WDLA 4FJ1A 2NACA 1C0KA 2IEBA 4U6SA 2PR2A 5AXBA 1GCOA 3HFGA 3BMOA 5G0WA 3NUGA 4UUPA 3W4KA 1X1TA 3LF1A 2DUWA 3G0OA 3ZU3A 1EE9A 4PIVA 3WB9A 1HE2A 2EHDA 4ZJUA 3ZI0A 1X1EA 2BLLA 1NVTA 3AWDA 2WD8A 1TT7A 3QE3A 1A5ZA 2UV8A 4RPGA 1PJBA 5G4KB 3S2IA 3VC7A 1PZFA 2C2XA 4R9SA 3AJRA 3RD5A 3DZJA 4YJDA 5KVCA 2GSDA 4CQLA 4DPLA 4TRNA 3GDOA 4QO8A 5DDIP 3IDSA 1NP3A 4K26A 2ZB3A 3U5TA 3N58A 4IQ8A 1ISFA 4MKZA 4YACA 4MO2A 2AG8A 4XDYA 3E9MA 1QLJA 2RHRA 3F4BA 5U4QA 2D8AA 4BNLA 3D0OA 4HNGA 4JN6B 3GNQA 4NK5A 4Y6RA 4KOAA 3EAGA 1R0KA 4B3JA 1R0LA 5CP8A 4AJKA 4CM9A 4WKGA 2X5KO 1CETA 3CE6A 3PEFA 1KYQA 2FZEA 4XGIA 2I66A 4G5HA 4CM8A 4R54A 5L51A 3AU9A 2VRCA 4IDDA 1HE5A 5CDUA 2WDZA 3PWSA 4RF2A 3D3WA 4CUZA 2EG9A 1XWFA 2HUNA 4RF5A 4IM7A 3UF0A 1HLPA 2R00A 3NKLA 3EVTA 3IUSA 3DBHA 8ADHA 4RJTA 1Z7BA 2Q4BA 2QRLA 5JAIA 4UREA 4J91A 1UJMA 1OBFO 2QHXA 4NJMA 1ZXBA 1E3LA 1Z75A 3DB2A 4RGBA 4J2OA 1LSOA 4RV9A 2CFCA 3KVOA 4ZD6A 3C8MA 1T1RA 4J4BA 3H2ZA 1GD1O 1I3LA 4D79A 3RIHA 4YJFB 3DDNA 1YBAA 1PJ4A 1SZJG 1ZFNA 3AI2A 2CMDA 2DFVA 2JAHA 5CHEA 4HFMA 3DMTC 3W8EA 1LDEA 1UXGA 2EP7A 3KV3O 3KLMX 1DHTA 3ON5A 4ZQFA 3NGXA 4IQGA 3IKVA 1C1XA 1NASA 1U5AA 4Q3NA 5F3RA 5JCXA 2GPTA 3CSDA 3F5QA 3EVNA 3DXFA 1ULSA 4FSHA 3WR5A 1N9GA 1E1MA 2J8ZA 1D4FA 1U7HA 1DJQA 3KLPX 5ER9A 2RAFA 2XF8A 1R66A 4F45A 5IF3A 4BKOA 3ZNPA 1PGQA 3QA9A 4A2CA 5C5IA 1LNQA 1GEEA 3ZNQA 4KWIA 3I6QA 1CWUA 5KJCA 1MP0A 3SC6A 5KTKA 4RCVA 1EFLA 3AUAA 1ORRA 3NDIA 4AG3A 2YFQA 3FNFA 4I9HA 2HK8A 3BTSA 1N7HA 5CDGA 5JCJA 2FRDA 4CL8A 4DL9A 1QR6A 2P91A 5CPBA 4DLBA 5B4UA 3PQDA 4WOKA 1M67A 5COQA 1PJTA 1MFPA 2IODA 2IZ1A 2W8ZA 3V1TC 2AE1A 3L07A 2WSBA 3ZW8A 3UCFA 4M49A 5DP1A 4CM7A 2HKIA 2C5AA 4G65A 1I5RA 2DBZA 4IIVA 4WUVA 5G0SA 4Q3BA 3WFIA 1FXSA 1YB5A 4PVDA 2Q45A 2ZJ1A 5A5FA 1R15A 3H9JA 3TL2A 4J9UE 1MV8A 1Q7GA 2GCGA 1BMDA 4BB5A 4BKUA 4DPMA 5TGDA 1LDYA 2EW8A 3WQQA 4BGVA 2PTGA 3AM3A 2I76A 5I9LA 1X0VA 3MJ4A 4CM4A 2Y1GA 3AFMA 1T4DA 3MOGA 1DEHA 4FOSA 3DBLA 4DLLA 4NG5A 1K5HA 1EK6A 1I30A 5I9NA 2Q2VA 3ANLA 1X0XA 4MVJI 4EJ0A 4I1IA 4OAQA 3E6AA 1IY8A 5DT9A 3Q9UA 2QYSA 2PD3A 1DFHA 1R4MA 3ENKA 5FYDA 2Y1DA 4B7XA 4YT5A 4XZ3A 4YA6A 2CZCA 2Y1EA 4BO5A 2Q49A 4LSMA 3JV7A 3ONEA 3ZGYA 4CR6A 2VQ3A 1BDBA 3UAGA 4ALNA 1NX6A 4JIGA 1IHYA 3MWEB 3QWHA 4AJJA 1YRLA 1PGPA 3B1KA 2ILTA 1P1HA 2GF2A 1X7GA 3TZ6A 4UVDA 1KIFA 4QFCA 4WCFA 3UXYA 5EL0A 3BHJA 2Z5LA 1V3VA 4EJ6A 2JFFA 3W1VA 5H83A 4Z0TA 4IDEA 2EXXA 2HMUA 1PJSA 3DOJA 3DMYA 2NVUA 2X23A 3GZNA 3MJVA 4BQRA 4W99A 4NBTA 4J43A 1D3AA 1HLDA 3DBHB 2VHWA 4L0QA 1D8AA 3VPFA 2HSDA 3FBGA 4JXKA 5TNXA 3CZRA 3HB5X 1SB9A 2CF6A 2C7GA 1R4MB 2G0TA 4PLFA 1J49A 1QG6A 1ADFA 2EJVA 3DFUA 3OSUA 1ENOA 4ZQHA 3DWFA 2FPGA 3IIEA 1YE3A 3TN7A 5FFFA 1N1GA 4E5MA 3M2PA 3U49A 2OL4A 4PRLA 2PLAA 1UUFA 5HM8A 3UHAA 1QYVA 1KOLA 1KC1A 1F8FA 5MGBA 1EQ2A 1KBZA 4J0FA 4CV2A 1XDWA 3NV9A 4XQGA 4EDFA 5KCZA 3H4VA 3MJTA 4RLSA 4E2YA 3BYZA 3WDSA 1AXEA 4AJLA 3PYMA 4ITUA 1GADO 4BUCA 2H9IA 2E49A 2SCUA 5IG2A 2D0IA 5K6AA 3RUCA 2O3JA 3PJGA 2Q1SA 4E5NA 3GHYA 1FJHA 2WYUA 4BMSA 4PLHA 5B4TA 1MGOA 3V2UA 1KETA 5AYVA 1YVEI 2Z95A 1NYTA 4B3HA 2YQ5A 4UUMA 3I3OA 5DOVA 4AICA 3QJ5A 1MLDA 3BMOB 3L9WA 3H9UA 2GGSA 4YQZA 3L4BC 2GYYA 4K1LA 4ND1A 3ZN2A 4E5YA 3WBBA 3UH1A 2BH9A 2PD6A 1ISMA 1PJQA 3B70A 4CQMD 4PG6A 3OJLA 2P9GA 4OOFA 4R01A 4IGFA 4R16A 1ZK3A 2IXBA 1M6WA 3VTFA 1C1DB 5IN5A 3ZNNA 3D4OA 1B0AA 4XGKA 1C1XB 3E8XA 3DQPA 1VJTA 2AMFA 2WD7A 3JD2A 4OOEA 3IL2A 3GPDG 3OIDA 3T4EA 4QFDA 4D42A 1E77A 3MCVA 4EYEA 1H94A 1NM5A 3DFZA 3HN2A 4W82A 4CUKA 2CVQA 1WVGA 5GZ1A 3JYPA 1VSUA 2BELA 2H6EA 5BSFA 4JBHA 3EK2A 1XSEA 3Q11A 4YR9A 5LC1A 3DAFA 1YL6A 2GN4A 1LQTA 4L74A 2Y1FA 2VUUA 1XIVA 1ID1A 2GN8A 2JHGA 2VUSA 5KNLA 3GG9A 3OFSA 3ZW9A 4OYRA 4D3FA 2PGLA 2ZCVA 1T26A 3AI3A 3GH3A 5AVOA 2PGJA 1IB6A 3C24A 2JFGA 2X0RA 1DJNA 3EYWA 5ENVA 2HLPA 3BIOA 1N1EA 2YY7A 1LQUA 1RM0A 4J4HA 1MC4A 5JXWA 3AUUA 5A03A 2CSUA 3L6DA 1ULUA 3GNTA 3LU1A 1T24A 1YL7A 3O4RA 4GWKA 5CAEA 3DOOA 3GGGA 1OFGA 4GMFA 3T4XA 1QMGA 4CV3A 1NFQA 2Q2WA 2QZZA 4HWKA 4BNGA 3V2HA 1ZK1A 3OJEA 5IDXA 1OC2A 2HAEA 4TRJA 4Z0HO 4XYLA 4WCFC 4A27A 3H2SA 4FB5A 1O89A 3U3XA 5DN9A 1AN9A 1I36A 3RQSA 1DO8A 1AHIA 1UXIA 2EWMA 4W9NA 4DLAA 3RBZA 1DOHA 3GMSA 4YJFA 4W9NC 4XWYA 4A10A 1J5PA 3DZFA 4I8XA 4NR0A 5AXDA 2GO1A 3U4HA 4AFNA 1J0XO 2DUUA 1NHWA 3QWFA 4BMNA 3ADPA 1ZKMA 1OMOA 3EHEA 4U5QA 3TFQA 2ZQYA 2H63A 4C7JA 4HUJA 4E2XA 1R4NB 3ADOA 1ISHA 4GBJA 5EESA 5TX7A 4YEDA 4PG8A 3NT4A 1UZNA 1BG6A 1E6EA 1E6UA 5TQVA 1TB4A 4NFHA 5EJ2A 3G1UA 4K6FA 1EVJA 3DOCA 1P77A 4GVLA 3WXBA 1PWZA 4MP8A 3O03A 2B35A 1BXGB 2O3QA 3D4PA 3TZCA 3I52A 5IZCA 4LRSB 6ADHA 4TVOA 4OKNA 1O95A 1ARZA 1TVEA 1B8UA 1T2DA 3AOGA 4XJTA 1TA4A 4BNXA 2C59A 3FBTA 1A7KA 1ONOA 3JYLA 1DIRA 4UEOA 3WTCA 1HDCA 3QVTA 3MWDB 3TZHA 4FQ8A 4I5FA 2C82A 1UXKA 2YYYA 1KEWA 1HL3A 1XG5A 3DZHA 3B20A 3DZGA 4G81A 3I83A 3RFTA 1ADGA 1UDBA 1VPDA 3DO5A 5DBIA 1HZZA 1KVTA 2UUOA 1K6XA 3I1JA 4Z9FA 3JTMA 4BGIA 1JVBA 4ND3A 4CM6A 4MDHA 2BRUA 4B4UA 2D3TA 3KBOA 1T2AA 4GVXA 3VKVA 4GLLA 4S3MA 4L9RA 1ISGA 2PV7A 1DRWA 5LDGA 3OMLA 2ZK7A 4RPLA 4IUYA 1VKOA 3ZV5A 1DLJA 2RH8A 1E1KA 4JJGA 2Y1CA 4DXHA 3EDMA 3R0IA 1KVQA 5H82A 4R1TA 3BMNB 2NU8A 4Z0PA 4ID9A 2RCYA 3HB4X 3PLNA 2LDBA 1EMDA 2YJZA 1UDCA 5FF9A 1NQTA 3K96A 4TSKA 1B2LA 1O6ZA 2GD1O 3DBRA 4C7KA 3G3EA 4CJXA 2GDZA 3NYWA 5K6AC 1ENYA 3FCOA 2BMAA 3KOUA 3E48A 1BVUA 4UEJA 2G82A 3I4CA 2HU2A 3TZKA 1PEDA 5IZ4A 5U9CA 3E1KA 4LCEA 2CVOA 4EUEA 1UXHA 5H81A 5TRTA 3JQ7A 2YW9A 3PDUA 2HRBA 4PZCA 4D3DA 4K28A 4B7CA 2B4QA 4A26A 4OQYA 3IC5A 4RVUA 5IN4A 1CDOA 3ETGA 5C7LO 4OIMA 1E7QA 3JYNA 4CMEC 4FJ2A 1U28A 1GU7A 2FR8A 3L77A 1RJWA 2P5UA 4WE3A 3GGOA 2EV9A 2YHUA 2X86A 4BNMA 3KB6A 1Y8QA 3QWBA 1CERA 2GASA 2I3AA 5GZ6A 5A3VA 1B8VA 2EGHA 2J3IA 1BGVA 2W2LD 3V1YA 3GVHA 1DFIA 1LC3A 1LRJA 2ZB4A 3D5QA 3M1AA 5KVVA 3PZRA 2Y0CA 1E3IA 3QSGA 3LT1A 2AQKA 3CUKA 4DMLA 4IDFA 2C7VA 4GX5A 1CEQA 5DBFA 1ADCA 4EEXA 3GFGA 4TZKA 4W7IA 3JSAA 1Y8RB 4F3YA 4J3FA 2Z1MA 4GQAA 4WNCA 3RFXA 4AJ4A 4CMGA 2DT5A 5GY7A 4IDAA 2PZMA 1YOVB 4GX1A 2UUPA 4FC6A 2NTJA 4IXTA 5FI3A 3JQEA 3DZBA 3ICCA 4E12A 4HP8A 4HY3A 4E2WA 3CEAA 5L53A 5B12A 2WTBA 4Q3CA 2WJPA 5JDIC 3NEPX 1ZSNA 2X1HA 1LBEA 3U4IA 5DZSA 2D2IA 1MB4A 4J1QA 1YJ8A 1YQGA 4CMHA 2ZYAA 4ESOA 2EP5A 4J7CA 2C2YA 2VTEA 4Q39A 2EEZA 3NAQA 5BNIA 4JP3A 4IY1A 3C1AA 3ONDA 2I99A 4KUEA 3JQCA 4UEKA 2W4QA 1VL6A 1NBOA 3D4NA 3NJ8A 3C7AA 3HJAA 2O2YA 3R6DA 3ABIA 2YQ4A 1IZ0A 4RO0A 1HDRA 1HKUA 1UR5A 4G2NA 1AGNA 1JU9A 2WE7A 3GDFA 3L6OO 3ULKA 4EUHA 4P4LA 4FFLA 2GLXA 4NNJA 4YJGB 4A5OA 4TRRA 1DC4A 3F1LA 2ZCUA 3RFVA 5JY6A 4KUHA 3TDKA 4DWVA 1P33A 3AOEA 3EY4A 5JPIA 2GN6A 5IDQA 5K9ZA 3OJOA 5TT0A 1H5QA 1SNYA 3EMKA 4RZIA 4YAJA 3K9QO 1SOVA 2D59A 2B69A 1C0LA 2IE0A 4BO9A 5BSEA 3DZKA 4DIOA 1E7MA 1ZMOA 1E7RA 3PHHA 4IINA 4RLHA 4U0KA 3EW7A 3GDGA 2NNLD 3FHLA 2VHZA 2VHVA 3P7MA 5EQDA 2CNBA 4RORA 3WX0A 4GAEA 3KYCA 2IYOA 1E7WA 1GAEO 1WAMA 2ZTMA 3CZMA 4RL6A 4GSKA 5THKA 1PL6A 1C3VA 3VPHA 1WNTA 1AXGA 1I01A 1LDMA 1R4NA 1BWSA 4IS2A 1ZSYA 5JO0A 1VLLA 1E0DA 4O5OA 4YCAA 2HMSA 1G0NA 3KYDA 3SXPA 5JAMA 4DRYA 2ZIZA 2PKQP 5KJEA 4R4JA 4CLOA 3LF2A 3MEQA 1WLYA 1NWCA 4QQRA 4HBGA 2A94A 1SMKA 2H1SA 1OC4A 3ROKA 1XU9A 1ML3A 4B79A 4URFA 3FN4A 1SEPA 1ZK0A 4OJNA 1ZO8A 1H6DA 1RM5A 2NADA 4CMJA 4XB2A 4XEHA 2BGLA 2GRAA 4OL9A 2I65A 2V6FA 1SBYA 1YBVA 2OMEA 1G1AA 3HWRA 4XYMA 5TT1A 3VOSA 1XGKA 3WGYA 3V5NA 3WIEA 5CDSA 1VC2A 3GZ4A 2EGGA 4R69A 1JWAB 3SJ7A 2C5EA 1W4ZA 1F0YA
chains in the Genus database with same CATH superfamily
1HOTA 4B5LA 4YV0A 5JXGA 2O54A 3I92A 3BN3A 1QNFA 3PLAE 3CPEA 1KDYA 1X38A 3RKRA 3AUJB 3S5JA 2VK1A 5DBEX 1WUKS 3KO8A 3WLMA 4LJKA 3L7MA 5KWVA 2F9MA 2PH1A 1T5IA 1ONNA 1L8LA 4YECA 5DCUA 2QMEA 4HR7A 5HBRA 3FNHA 1CNMA 5LA6F 4L8VA 5C1IA 4B9EA 4D5GA 4E31A 3SJBA 3Q7IA 5DX8A 4F86A 1G5QA 4Z7QB 1PSDA 4J0GA 2NU9B 2FQXA 1Y3DE 2J85A 4BOYA 3KE9A 3IE2A 5DB4A 1GG5A 3OQJA 4G67A 3IAM1 1U02A 1CQZA 3QVWA 3H2KA 3OOHA 4ZEXA 1L4YA 2PWBA 2YDYA 3E9NA 4IEIA 1ZK2A 2UXBB 2RGYA 2CXSA 5T8KC 4RIIA 1P3DA 3RTEA 4DUZB 4P4GA 5G0VA 3A14A 3TVTA 3OX2A 2VH1A 3OC6A 2LKDA 4XX0A 4JENA 5LXTA 5I51A 4RESA 4WGFA 1T9ZA 1KZYC 4CMEA 1X94A 3F6RA 1KI6A 2JI4A 2F1JA 5AM5A 3V3TA 1QTNA 3HCFA 3U7EB 3S28A 1G2IA 1YJ5A 3F5MA 3QKIA 4RA6A 5HM6A 1LPBB 2PMEA 2A57A 1I33A 4HB2A 4URHA 1IY0A 1H2XA 4IIJA 2H5JA 5DHQA 2BUAA 4M1MA 2VJYA 3WC4A 5E4JA 2H7XA 2AEJA 1B4DA 2Q46A 4RNDB 5H8WA 1Y80A 3NGLA 4MB2A 7REQA 5JFTA 1VPLA 2HGSA 5HTKA 2ZYVX 1H69A 1THMA 1CEYA 2RI0A 4YV7A 3U44A 4ND5A 4M6WA 3L6BA 1UDAA 3N7AA 3U0BA 4CDGA 1LX6A 1JSZA 1RBZA 4KACA 3LT2A 3S55A 4TMXA 2SKEA 4YRDA 4WBNF 1J24A 2R6CA 1Y5LA 2Q50A 3EC7A 4ETIA 3Q3VA 1FSZA 5TVGA 2IS6A 3TLAA 1GLGA 4ZOLF 2FJUA 2FN9A 1GG8A 1GA1A 2BEUA 2W4IA 2P5TB 2ZYRA 1WY7A 4KSYA 5EHGA 3ZTYA 3RE1A 1BHQ1 2F6RA 2FEMA 4PGAA 4C7VA 4HH3C 2XD9A 5I9IA 1THTA 1GTVA 5HNKA 1S2IA 4Y1RB 2JI7A 3PC7A 4KE6A 4C6SA 2WFAA 1WMDA 3IKTA 1CR2A 2BTQA 3UAXA 4R2MA 3A70A 3FCEA 1D2EA 4GPTA 5LUBA 3WGQA 5JSHA 1WR8A 4B6GA 1RMQA 4F1KA 3Q3CA 5A02A 5HKBA 1U6JA 2DY0A 1QIHA 2G08A 5LD2C 4DJDC 1TZMA 4EOGA 4P38A 4U3JB 3SXJA 3LBYA 1M10A 1RRMA 2I2BA 3FLBA 4Q1EA 1X39A 1QF9A 2QL5A 2JFWA 3FB4A 3L06A 5ALOA 2O5EA 3NBKA 2CVHA 3RT7A 4YMWA 3C1OA 3NEJA 3I04M 4Q7QA 1KAGA 2CD9A 2VNKA 4C04A 5TQ2A 1DZIA 1P74A 2PA3A 3DBLB 4EIWA 4CLDA 4BX3A 1BQ4A 1OZGA 1U8FO 2GZ1A 2I2AA 1A1SA 3AHGA 3BFKA 4LVUA 3HRIA 4WY5A 2DFDA 1KE2A 5LQNA 2NU9A 1SCKA 1T36A 2A14A 3E05A 3BT7A 1HX7A 2V45A 3A2LA 1WHSA 3M5PA 4M1EA 3KT3A 1TE2A 4QSHA 4R9VA 4NZZA 3ASZA 3ZWOA 1G8FA 1LQ2A 1UMDB 3S1LA 4MVYA 1R00A 3PUWA 5L95A 4P22A 5DHTA 1IL0A 2J9RA 1IG0A 1TYBE 1P4GA 4FJ0A 1DXOA 4MJXA 2IHYA 4MVJM 5IARA 1ZEJA 1BXZA 5EIFA 5CCDA 3WGUA 2ST1A 3UJBA 4JJIA 3FRJA 4ERXA 2I6SA 1CDEA 2ZRDA 1MFZA 3TLMA 4DRZA 4E94A 1KPHA 3RH0A 4NCKA 4F4HA 4CMKA 3N76A 2VF5X 2Z9CA 2B2NA 2GWHA 1ONBA 2IS1A 1G21A 3D81A 3GO4A 3LT5A 5U1PA 1AMOA 2YWHA 1IM8A 1DDOA 1TZJA 2F64A 2HMVA 1A2KC 2O1XA 2XVMA 2ZI6A 3SQMA 3EWIA 3EMVA 4MV7A 1ZMTA 3G89A 1DWUA 3A26A 3H83A 3NWOA 2DM6A 3UMVA 1RI3A 2ZROA 3EXAA 3R20A 3R3ZA 4UJ3A 2V7PA 3OF5A 4WNYA 5G40A 4KOEC 3CR3C 2QTVB 5GJWC 2HNKA 4A0RA 4XWOA 4W5TA 4LC9A 3LUFA 2HA4A 4I50B 3DMTA 4RACA 3TAHA 1SZDA 5KYGA 3EGCA 3FM9A 1RADA 3DE6X 4NEGA 3WK6A 4B87A 2C3OA 4RV5A 3BWBA 4YRMA 3QU4A 1EBUA 1U5BA 2Y1LA 1CP2A 2NSLA 1R9NA 1WSBA 3NHBA 4QOFA 4N5DA 1JHYA 1Y1LA 4PAWA 4R2HA 2CNKA 5GADl 2P2ZA 2AI2A 4JOBA 2ZIUB 3T7AA 2HH9A 1AHPA 3TOVA 1L5HB 1OIWA 3OH8A 5IJ9B 2H7VA 3EUAA 1Y9EA 2R0QC 2A5JA 3BSYA 3WSWA 4ALIA 4CQNA 2NYUA 1G8PA 1TW2A 2J7PA 4W1PA 3AVTA 3KRTA 1L1QA 3TQCA 2B5WA 2GPWA 1KVSA 2OHFA 5TDHA 1GUDA 2EW2A 4LNUA 1MQAA 3KZ1E 3W3AA 2WMYA 4PX3A 3W78A 5AESA 2HF2A 5TF4A 4DMHA 2CUNA 1AK2A 1XEWX 4UC0A 3ZR4B 4NBVA 4QM7A 2POCA 1EFHA 4M3NA 3VZBA 2PMFA 3ZLBA 3OZXA 1VMIA 4GRAA 2IQ5A 1G21E 5DNYB 3PA6A 3PL5A 5IEBA 4I3FA 1H66A 1E5XA 1JHAA 3KYBA 5HHTA 3KX2A 3EISA 1G2OA 4NX2A 5ITVA 3HR4A 1TYZA 1NXOA 1DI0A 2P5YA 2ZTLA 2PUEA 3U37A 3MUFA 2K7ZA 2NXWA 3R0JA 1QH9A 3F6BX 4P7GA 4F3NA 3UKOA 4TMWA 5EXDA 4ESEA 2ZBEA 1JG2A 2H54A 2Q3EA 4Q05A 4UTRA 3UBMA 4MDFA 3A1TA 9GPBA 4J75A 1WF6A 1TCVA 2JHCA 4R0MA 3VZCA 1IJBA 1BS1A 1X1RA 4I9FA 1HE3A 5G4KA 4JT2A 4ZHSA 3WMGA 4F21A 1ZGJA 3WB2A 1LDBA 2R4QA 3H13A 3TQHA 1YQQA 3WGZA 2AG5A 4HUTA 1UOOA 2YV1A 4NENB 5TGTA 4CQLB 1ONPA 2Q5EA 3SYNA 4GQBA 1JQDA 1Q0HA 1Z2AA 2V5UA 3CUYA 4HF7A 1K89A 4QD3A 1X8XA 2XMZA 3HLTA 3EZ2A 3JD3A 1RI4A 3FDFA 4U8GA 1A7JA 1T9GS 1I32A 1LY1A 3CRQA 1NJ5A 2H9AA 5DHUA 5FADA 1D7OA 3TE6A 3WKBA 3FOFC 4Z51A 3K92A 3I28A 4C14A 4YH1A 1CIJA 1D9XA 2CFSA 3GP5A 4F3TA 1FU4A 3LDFA 3V32A 3JVDA 4RY2A 5DMXA 3H3JA 1WVIA 3UENA 1XZMA 2QTAA 1DKOA 2O2GA 1XVTA 3DO6A 3L7YA 3QXSA 4JQSA 5TLSA 1K6MA 3R6LA 4K2HA 2I9KA 1B26A 4G5FA 5TV2A 1JB1A 4D7AA 2QRNA 1MC1A 3B1YA 4MQ5A 4LIPD 1M8FA 1V8ZA 2FRDC 4ZDWA 1AD2A 4ZVUA 5K0LA 2V96A 3DDSA 1O2DA 1G20A 4ZAWA 1RAFA 1NC3A 1DRKA 1ZBQA 2PZKA 4PE5B 4Z6KA 2HIHA 2WKQA 1FYXA 1F14A 4IMPA 2VNSA 3BB4A 1KZ6A 1XLTA 3PGXA 4NHEA 3OEEA 5ERYA 3GBVA 3KSUA 2AA3A 2UZ3A 3RB8A 3V9AA 3B3JA 1OFVA 4TKUB 2CJFA 4CV0A 4YPOA 2V0CA 1I3KA 3W5HA 2IZ5A 4O63O 4ZCPA 2PQMA 3MWYW 4MYUA 3ASVA 1KSHA 1Z6TA 1E4EA 3OP4A 2FP4A 1ODFA 1XRSB 2ZJ7A 5CPFA 1K97A 3ZWKA 1OLOA 2P2LA 2R1UA 4CVNA 3V4LA 3PQ4A 4PQYA 1NG9A 4KGVA 1YBHA 1LV8A 1JAYA 2I2CA 2BUCA 3R3UA 4J16A 2HA7A 3GNSA 3ETNA 4PZUA 3AEZA 4RPJA 1IN7A 1NL3A 1QAMA 3KWLA 3UWOA 2D5IA 5GIPE 4BO7A 4C08A 4FNAA 4L72A 5KOHB 2ZJ3A 3FYUB 3MJDA 3QVVA 4QYIA 2VYVA 1IC6A 1JLHA 1SZCA 2BKAA 2ZQ5A 3B60A 1MMFB 5CH5A 5AJWA 3L04A 1SN7A 1SKAA 2IUSA 2QG6A 1CS4C 3ELBA 4F2HA 2E5FA 2AJCA 1EGHA 1BRMA 3SDBA 3BWMA 3FUCA 3IUPA 4FFMA 4ONEA 4JC0A 4H7KA 2X5XA 2BR5A 2J41A 3N2NA 1LBHA 1BCRB 5DBHX 3ROQA 1M0WA 2O3RA 3WGIA 1WSAA 2WJ4A 3LA6A 2IYUA 1EM8B 3N2YA 3OC0A 4HATA 3UMCA 4CLRB 5KJ1A 2CLOB 2OGWA 1FRZA 4TTVA 2AOUB 3S2FA 4ASUA 1V16B 3NTOA 3O47A 3KM0A 4NYIQ 3WK9A 1ML4A 1IZ7A 2PMCA 4UTXA 1N8TA 5SYAA 3Q2KA 2J0QA 2JIOA 4X91A 3BJRA 3EXHC 1I6KA 2X2EA 2O7RA 1FTGA 1ZJYA 2FKNA 3G5TA 4IIDA 5GJCA 1Q17A 2VRBA 4G5XA 1VJDA 4FX2A 4YMIA 2GZHA 2XZPA 4JA0A 4QQFA 2EDAA 2EDCA 3OTHA 4FEYA 3V48A 3B8EA 3W90A 5IVDA 2RBKA 4BL5A 3T35A 3QBDA 4Q1FA 1LW7A 2OG1A 3LHFA 1DQZA 4GPZA 1QRAA 1TU0A 3SHQA 4D81A 4EKNB 3UQYS 4DIEA 4KR7A 2DR0A 1S1MA 4C05A 3T06B 2UXDB 2J6CA 2OM2A 1A2OA 4TPKA 1MTOA 3A9CA 4PCAA 1ZH2A 4FEAA 4R41A 3B7WA 2FI1A 3PGJA 3QEAZ 3NVKI 1GKKA 1EPUA 1N3LA 5JSZA 1F2TB 3VRHA 5JC8A 3QKRB 1G5TA 2CCKA 5HFNA 5IJ0A 4YCNA 3PPIA 5EWJB 3R3XA 2CB0A 5FX2A 3H2JA 3V97A 3R7FA 1MAAA 5K0NA 4F2GA 3VI3B 5HKOA 1DEAA 2J6IA 3O21A 5CD1A 4MW9A 4Q4HA 1U6KA 3TW8B 4RHYA 4GI2A 3G9UA 5KC8A 3N7UA 1QP8A 2OCKA 3BWXA 1L5LA 2O3SA 4F72A 1MXHA 1KK1A 1FRFS 2B8JA 3DFMA 1GFZA 4JELA 5G0TA 1E0AA 1AM4D 5F1OA 3WHKA 2GERA 2ZXUA 2WJHA 2ZBDA 3PE3A 3ZY5A 4J3JA 3KP1A 3P9YA 2WYHA 2B9VA 4YWHA 2CKDA 5DNCA 4XSVA 2MMCA 2R2AA 5AIAA 2IBMA 4I55B 3DM5A 4RADA 4AWAA 5CBKA 1YCHA 3STWA 1NRJB 1WXQA 3JAKA 4LE0A 3PQFA 5F2EA 5KYVA 2P9BA 5ALFA 3GOHA 5FP0A 2VRNA 1P19A 3DEYX 4BS9A 2PXXA 2UVQA 1DARA 1XRMA 3KNZA 4XRRA 4JT8A 3D9QX 4FCCA 4C7MA 1DC7A 2WWXA 2ZRGA 4LVNA 4Q9DA 1L7RA 3T0FA 3OFNA 3ZLJA 1HM5A 2IYSA 3C87A 4XIFA 5I7SA 2OFOA 1M7GA 3GEHA 1E9AA 3KZVA 4JI1B 1JALA 1E9VA 3VR4D 5DE3A 3R9KA 2PNFA 4G26A 2VDRB 2YY5A 4K87A 4PPYA 4EG4A 5KUTA 2XUIA 1F9EA 3QYFA 4AT1A 1M2GA 3NBMA 4UM7A 3NP7A 1JR2A 1NKVA 3GW8A 4DPKA 2QB5A 1UFRA 1MD9A 5ADHA 1B43A 2QJRA 2XW6A 1ZM3A 3O26A 1U9CA 3IHTA 4R0NA 1I6LA 4KNVA 5FA5A 3ZBQA 2JASA 4PFJA 5BSGA 3D3EA 3KT0A 2ZE6A 4FSDA 1DBWA 4QBGB 2ZDHA 1JI0A 1VXOA 3FIJA 3RVBA 1CQJA 2C4MA 4WLOA 3EZNA 1ZUWA 3AEQB 3B1JA 2D06A 2C9CA 3PFFA 2P4SA 4DADA 4PQRA 2X9NA 3CWZA 1Z5OA 1UWCA 3I39X 4WH0A 4KB5A 4OHVA 4Y1EA 4EUSA 4B3XA 2FW8A 4FQ5A 2ZTSA 4D4HA 1I3NA 1QF7A 5G3YA 2NUPB 3ZBTA 3CXUA 3QLJA 3G2HA 2ZT7A 2QM0A 4RVNA 5A05A 2XAUA 5IC5A 2ZRKA 4MKIA 5HKAA 2I4TA 1S2LA 1X7HA 2JGDB 1AF4A 2HA6A 5ALNA 3JW8A 1W1IA 3HY6A 4AU1A 1UBLS 2PE5A 3QPUA 4RM2A 3TDMA 3OPNA 1QO0D 1PG0A 2CZQA 1IM2A 3OQBA 4JBXA 4G9EA 1QVRA 3GPIA 3IB6A 1DKLA 5AVXA 5K3FB 3D7SA 1OZFA 4G4IA 2O5VA 2XQIA 4LKRA 1OASA 1M75A 4R1MA 5H80A 3U7JA 5HYVA 5TEWA 4E2ZA 3WSVA 5INTA 2UUAB 4Z9YA 2GDJA 4EI8A 2IYZA 1OYYA 3O6VA 5BT9A 2O07A 2Q0SA 1LLUA 1A4XA 3PP8A 4JEHA 1IRXA 3WQSB 2O8FB 5TSDA 1R6DA 1C4XA 5L6MB 5FV7A 1SXJC 1CY1A 2WC1A 3H65A 1Y4ZA 4LYHA 3PHGA 2FZKA 1QIIA 3AZPA 1GUFA 3ZJYA 1QVZA 2WSSD 1QH8A 1Y8QB 3LD9A 3PQEA 4OHWA 4P3KA 2CUKA 5K3SA 5IKXA 1C2TA 2GK3A 2VT2A 4MYRA 4F46A 5DHFA 3S4YA 4Y9UA 3R9IA 1RCFA 2IITA 1E9CA 5DH9A 1B8NA 1U8XX 4C3OB 3R5FA 1W8IA 2O4CA 5CXQA 1Y1KE 4QUIA 4UMDA 2HNAA 3CT6A 2G28A 3V2GA 2UZIR 4LRWA 3PEYA 1NVVR 2GH1A 1O9BA 2W8BA 3QW2A 5IJ0B 3U09A 4KPUA 3IEPA 3FRHA 4MMYB 2YOFA 5ADVA 4KDRA 5AW5A 2BIFA 4PRKA 3PV0A 4X9XA 3I0ZA 3OY2A 2I6TA 1U4OA 1AQIA 3OKCA 2C99A 3LT0A 1EFKA 1EQAA 4PFQA 4FGKA 2VT6A 2A7XA 3AFHA 4L73A 4OJMX 3V7WA 1ZH0A 4KDEA 4II3A 1QGYA 1U94A 2H92A 1TCBA 1Y4AE 3E7PA 4HX2A 1JR3E 4KQ1A 3STHA 3BJEA 2FDRA 2GZ3A 3D6HA 4K8OA 4NS4A 4ZOCA 1KMIY 1OTXA 4F60A 5JI3E 2VYCA 3CF6R 1RYFA 2FZVA 2V7EA 3HJFA 2REOA 2X13A 3IHWA 1GP2A 5JWOA 3JZFA 2SKDA 4JROA 4QOJA 5GINE 3IKJA 1B0ZA 3FHTA 1YR8A 2N46A 3I0NA 2E1RA 4QJ5A 3Q72A 4NFSA 1XD2B 4DXDA 2CLKB 1UBTS 3HBJA 4UAGA 3SNKA 3JQ9A 2QU8A 3GVXA 5B2ZA 2JGIA 2HPZA 3DSRA 1C1DA 1JKJB 4JLPA 3UT5A 3HCNA 3ZCTA 4EI2A 3NHMA 4JNKA 1TF2A 4DOMA 2ZI7A 1DSSG 1KZ9A 1UM8A 5G53C 2CK3A 4IIEA 4LPKA 2DPHA 4NYJQ 4OMDA 1HDIA 2VN8A 3AF6A 3CUTA 3AHFA 1BZYA 3UGKA 3NKVA 2NUTA 4DIFA 3GLGE 3N2LA 4RSRA 3FE2A 2UDPA 1YRAA 2GBPA 2IW3A 3W7VA 4IDHA 4HBZA 2YBDA 2OYSA 1R12A 3ZPXA 4QT4A 1HI9A 5BY2A 1RXUA 4XJXA 3QVLA 4C03A 1KEKA 2P9EA 4BGEA 3REFA 4U6QA 4EL5A 1PZHA 4KNYA 4XR9A 1GQQA 4QXAA 2B21A 3GCZA 1NV8A 3P2YA 5I9TA 5KOHA 2ZSEA 1JR6A 3QKUA 3WXMA 3RRMA 3SIRA 3DE3X 1J5EB 5SYMA 2BV3A 5GIOE 4J0QA 2H59A 1YQUA 1MVOA 2ZSAA 1J07A 2MYPA 4IYJA 4Y2RA 1PLLA 4JVSB 4FDMA 1NZFA 2VHUA 3IH5A 3DB1A 4JC5A 4YRNA 2O8NA 4PLZA 2WU0A 2REXB 3IUEA 1P4RA 1UBHS 2E4ZA 2HQOA 3HEBA 3TB4A 4BASA 1Z6AA 2QZSA 3HDHA 5CYOA 2XV1A 3M4YA 1OJ7A 1K06A 4TYQA 3RIGA 2BFAA 3WGOA 1J2TA 2A9VA 4XIYA 5BRAA 4N3GA 5LNK1 1Y7PA 2QD1A 5FAKA 3QMWA 3H2HA 4PO9A 2MSLA 2WVAA 1G8YA 5FR1A 1LPPA 4DMKA 3AY6A 2W6ID 3V8MA 3ESBA 2ZYUX 2DPXA 4OI0A 3HYCA 2G7ZA 3PPXA 2EEPA 4MITA 1FLDA 4UFOA 3TW0A 1Y6QA 3QFSA 1CRPA 2CEAA 3V8EA 4LOHA 1F2DA 4BRZA 1U2PA 4HGNA 4IHJB 5D3QA 3VSEA 3G9TA 4D96A 4JI3B 2X9GA 2QENA 1CDZA 2Y27A 3Q4GA 3RK1A 1ZD1A 2XB4A 3ONFA 3GMTA 3P9SA 4AIIA 1NUSA 3K5PA 4P9NA 4RHEA 5I8ZA 2JBAA 3FUWA 2J9ZB 4ZK2A 3Q40A 1MBZA 5EQFA 4F8YA 5AKLA 1L6RA 3MUOA 3RODA 4BV9A 4EVSA 4RTPA 1ZHHA 2QTMA 1HTTA 5B2FA 4AQ7A 3KPWA 2OECA 3U1VA 3JPWA 2AOVA 1JEEA 2IHBA 3S27A 3R5JA 2PBFA 2QVYX 5KTSA 3ZVKA 3QEBZ 4QVGA 4BCCA 2GR9A 3EVZA 4OQMA 3MM4A 3CWCA 3QRWA 4F3KA 2ODTX 4Q21A 1C8BA 1E2UA 1Q2XA 4YWJA 3TK1A 1TJ5A 4PVCA 2WB2A 1RWMA 4X61A 4ZXFA 1E1CB 1ZWKA 3MJCA 2C8KA 4A8TA 2IX3A 1SCJA 1YXMA 3GYBA 2R97A 3G5UA 4FUTA 1C30B 2F17A 2G76A 4KSCA 4TROA 4NENA 2GT1A 3FJYA 3SZ3A 1NW8A 3WMRA 4H1WA 1MW8X 1L5ZA 5JQGF 3DAHA 1ZJ6A 2CMFA 3KJQA 1RZVA 1OOEA 1L1EA 2CWDA 3KXPA 3P9KA 4I1SA 4C6HA 4O3FA 4RTNA 3PXEA 4DDWA 4GE0A 4DEXA 1W19A 2FXVA 1ZM7A 4PFSA 1U2DC 4JJ6A 1QF6A 1N5DA 3LLSA 5C32A 3FH0A 1VG9B 3PVZA 3CS3A 1K3TA 3EQ2A 1QX3A 3UTDA 2CDAA 1I6WA 2AWOA 1MX1A 1EFTA 4LZZA 3MS4A 2VHTA 1VPWA 1FNDA 1L8OA 3NOVA 1Y6JA 4DB4A 2ZUSA 2O2HA 1ZICA 3LY5A 2ZT8A 3P4UA 1EVYA 1L8QA 4KBFA 3DG9A 4DDMA 1M5RA 1E3TA 1KZ7B 2ODWA 2E85A 1VE1A 3NB0A 4MQEB 3PHBE 2HY7A 5EXXA 3SSNA 2WWRA 4BWVA 2ZSUA 3L8HA 4RTSA 3VPXA 5K6RA 3UMMA 1UADA 4B4WA 1NJ2A 1YL5A 2F3RA 4M1WA 4Q4JA 5AHWA 4XB6B 1MA0A 3FCYA 3RF7A 1TT5A 1QRSA 1T13A 1DB3A 1UPUA 3UJPA 2O4UX 4D6YA 2DETA 2RK6A 4DDHA 1NF2A 1UKAA 1DQSA 4UD2A 1NBMD 4HD8A 2VJDA 2AK2A 3HXTA 4IVQA 1O5IA 1WXHA 4KQXA 5I7AA 1Z28A 3LSYA 3BK7A 1TZCA 1EESA 1AQJA 4WKOA 2O7QA 1K9SA 1RYYA 4G5OA 1IB0A 2B2XA 4WLEA 1TW3A 1Z8DA 3AEUB 3GD5A 5SICE 3RAGA 5JD4A 1PNRA 2Z8ZA 4F8JA 2PZLA 2N42A 4BNZA 1Y3BE 2XCIA 3WLPA 4BGUA 2EKPA 3DPSA 1YZQA 3M9WA 2NSJA 5UKDA 1GTJ1 3GVCA 3OJFA 4YNBA 2CL6X 1H1LB 4YRPA 1KWGA 1N25A 2FZLA 2PMBA 2WW8A 3EIFA 3HRKA 1A69A 4G5YA 4UCXA 1HLGA 3FJOA 4YI3A 5T5QA 1P5JA 4FR2A 4NMLA 3TWOA 4KXXA 4MWEA 3FF4A 4DUPA 4F6RB 3EWAA 1B0PA 1RQNA 2QS9A 2Z04A 2X15A 3FYUA 1KI4A 4Q48A 3RQIA 3GLIA 5AUQA 4B09A 4FHEA 4RQTA 3ONVA 1ADYA 1EEHA 2OGUA 1SA0B 2G04A 3I64A 5MF6A 4PWYA 3MAJA 1Q14A 2HMWA 4MGIR 3U4MA 4FHFA 1P0IA 3TOZA 3QPCA 4PYNA 16PKA 3BZUA 4OMUA 1XTPA 1MQ9A 2JEOA 4WADA 4I6EA 5FPTA 1FFCA 5THXA 2WLSA 1B00A 4AMZA 4DIUA 2VTBB 1MJFA 1EVEA 3OESA 1N6OA 3UK1A 5F98A 4IV8A 2OO5A 4PPGA 1Z15A 1P61B 2G1UA 1ATIA 1YDMA 2RKOA 4HAXA 5DASA 4UHCA 2YX1A 2H5LA 4L5CA 4B9AA 1T5OA 5DCYA 1PEAA 3K1JA 1UFOA 2B6HA 4IQ4A 4OGKA 3JWJA 5M7EA 1KJWA 1N9ZA 1EVZA 3BMCA 3R7LA 3T9CA 3GI1A 4AKHA 3UHOA 5TQ2B 4EATA 1RM3A 2LDXA 1JJVA 4PLTA 3H0KA 1KI2A 3BFVA 3O9VA 1GPDG 1G9XA 4DMRA 3H97A 3MTIA 4RX1A 5CLLA 2QY6A 5IJXA 4C3UA 1JFSA 3LC0A 1K0FA 1TYCA 2ZRNA 4DA8A 3E53A 4N5LA 4B6QA 1LFDB 2QVGA 5CYFA 4BLQA 1ABFA 2PKQO 4QG3A 1RWBA 4CT5A 2IH5A 1NHGA 3HXMA 3M34A 4HN4B 1JZTA 3A28A 3NDBB 4PX9A 2WUFA 4HK4A 1JIJA 4JBWA 1UK6A 3E58A 3CKKA 3IUMA 4XUEA 3EGVA 1Y63A 4EKDA 5CNJA 1IBCA 1MC8A 3B8HA 2VDWB 3EZXA 3GFPA 3I2KA 5K5EA 1YS6A 2FR0A 2BEUB 3LRTA 4RVHA 3DEJA 3PTLA 1ID8A 2VKQA 3MJHA 1T8TA 2WE8A 2QDKA 1D6SA 1ACJA 2QD2A 2PX0A 2HADA 4ZAFA 4AJHA 4HNTA 2J4FA 1HA3A 1NQUA 3EDQA 4HQKA 2W6PA 4OGFA 4YFYA 1JMVA 1T3SA 3PXBA 4TZTA 4CNQA 2I3BA 5DCWA 3LYLA 4RF3A 2PBRA 1RPNA 1MKYA 3AZQA 3GVPA 4R2LA 1CNEA 3PXGA 3KJEA 2KWIA 4EGQA 1HZJA 3W5JA 1N36B 1V6CA 4UVIA 1JE1A 1VBKA 3D43A 4FZ3A 4WVFA 1JLSA 5CFZA 2PNJA 3K1YA 3V4FA 2IYXA 4JP1A 2B8NA 2BDEA 3EQ9A 1OLUB 4TYMA 3CIFA 4ZOEA 1AS2A 3E8SA 2XUQA 4D6PA 4QICA 5AUNB 1G3UA 4CE6A 1GO2A 2XMRA 1GL3A 1NF3A 1XXHE 3PSHA 3S8EA 3KSAC 2PUWA 2O2EA 3V8NA 4E1BA 1IYZA 5LKAA 1JHMA 3C3MA 4RVSA 4E4TA 3EZGA 2PT5A 4O2AA 1M0SA 4QWWA 4BNJA 1JWBB 1Y1RA 3L1JA 1KJ8A 4R31A 1N2IA 1C9JA 4NSNA 5IK2A 4NZ9A 4D3XA 1SHTX 3A1NA 2PL5A 4L7VA 1MA3A 9MHTA 2Y9PB 3COYA 5E1BA 2X5OA 4RGQA 2A9KA 1ZOSA 1A9YA 4INAA 4QDXA 5C3UA 3T9AA 3Q1LA 5KTYA 1XZ8A 4U2EA 3KR2A 4TV9B 5EHZA 2J48A 3CG0A 3CMCO 5ICSA 5IXSA 3U3RA 1WPQA 1KMNA 2R1TB 3FDXA 4Y2QA 2ZG6A 3N75A 4QIHA 1NUQA 4WESB 4RF4A 3TE7A 3QY0A 1BA2A 1MJHA 3DVAB 4JX8A 1XPRA 1X1AA 3FMOB 1IBKB 3ZS8A 2Y77A 1CK4A 3BBPA 1KEZA 1R3DA 1E9DA 4MV4A 4NAHA 3OIYA 2GPYA 1V0JA 4JSRA 5JSKA 3N74A 4N5MA 3QEKA 3DMRA 1RI1A 2C61A 1W44A 3B6IA 2RGAA 3HFSA 2B94A 4BP1A 7ABPA 5AXCA 1FP7A 2JAOA 4BLTA 2EKBA 3NU1A 4KEAA 4LZJA 4EH1A 3BHIA 1NLZA 1RXVA 3PUZA 5JUWA 3IOCA 4FFBA 5EJEA 4B82A 1T4CB 1MHPA 2Y68A 1JVSA 1RJ9A 3NUQA 2HDWA 3A04A 4WJZA 2I9PA 2ZSIA 4ALLA 4BX0A 1H65A 2J5RA 4GMDA 3DL2A 3IUYA 2OXCA 1SPXA 3M5CA 4MUMA 4X6XA 2OUIA 2DTXA 2I71A 2L69A 2Y0EA 2ZU6A 1ZVMA 2NZWA 4RE6A 5IK2D 2AN3A 1TM5E 3RTGA 2IHVA 2G5PA 3CJRA 1EFRA 1AIPA 3RIXA 3BWEA 4GMGA 3U80A 1HYHA 2QD3A 2W2KB 3GRPA 5TC4A 5G1PA 1DTWB 1VLMA 3IO5A 4MQFB 2B4YA 1YZLA 2WP0A 2PZAA 4YXFA 2JKVA 4M0EA 2EW1A 4KO4S 2QX9A 1RHMA 1AKUA 2XJ9A 2CVFA 4KZPA 3KFXA 5EZSA 1E59A 2FJ0A 3AETA 2WZCA 3DDOA 2G9ZA 3EGOA 3EIHA 4PHHA 2QE7A 2WTEA 3FIUA 1CUWA 4IWNA 5LZ5A 3VR6D 2B30A 1S8OA 5IAAA 1Y34E 1ZUD1 4V1CA 1XZKA 2BHNA 1NVFA 1F2UA 4CU5A 2WV7A 3UWKA 1MAVA 1WZIA 1X74A 3MCZA 3PCTA 1MO4A 4QU9A 3UN1A 3AUTA 1XK6A 5C5CA 3HKEB 4IZHA 4CZ2A 1CUXA 1PUXA 1JWLA 4N7RA 1B23P 3OD1A 5JW6A 1H9BA 4NYMR 4CM8B 4X7PA 1RQ7A 3QNUA 2WF6A 4IOJA 4LXGA 4O8ZA 1Z47A 4BN5A 2YRWA 4CDNA 4MVJD 1ZIYA 3O0TA 4QPDA 2GBFA 2HV8A 3CC8A 1LSSA 4CTNA 1RXYA 4PXAA 2GHTA 1YACA 4V0LA 5KO2A 4JLSA 5KNBH 3M6WA 3MBOA 1PTJA 4TSFD 1ZC3A 3KKNA 3OQVA 2RIRA 3ACCA 3X44A 4Z5XA 5CA0F 5K2OA 3ZQUA 4Y1RA 3X2FA 1HDGO 3WLAA 1DMRA 1TCAA 4DILA 3PHLA 4ZHQA 1MRSA 1N2CA 5TGZA 1UAGA 4A5SA 3ORRA 4O4JF 2NU6B 1MX5A 4ENVA 4ZICA 1AUVA 1C8KA 3DLAA 3NPAA 2IOHA 2J9YB 1PT5A 1WCIB 1SAYA 2ZYGA 4WBNB 2HT1A 2QF7A 2HWKA 3F6SA 2OYCA 3RU2A 2DHQA 2QDXA 3ACBA 5B58C 3TO5A 3KDSE 3HCWA 2PRJA 3GF4A 4FB4A 1YJCA 3WRYC 1C30A 4L4SA 4F9EA 4EG0A 5JAPA 1N32B 5JDCC 1T4MA 2B0CA 2X1MA 1BWPA 1TQHA 4FP9A 4B75A 1OWPA 1BWQA 5BSHA 5JQWA 5LBTA 3DMNA 1P9NA 1YBFA 4LF7B 4LJYA 4MINA 1T0IA 4KV7A 4IJVA 5KI6A 3UA3A 1DBSA 4TMVA 4B4DA 2ZWIA 2X0FA 4D98A 2IBSA 1GAXA 1JHZA 1IPHA 1QHYA 2DWPA 3DO8A 4UEWA 4OSEA 3ESRA 3KUXA 5ES4B 1YKFA 4C0WA 1JA9A 4JBIA 4MS1B 3ESZA 4BNVA 4G0VA 2PIDA 3EODA 4GPBA 4U7GA 2UVDA 2O50A 2VDNB 5IYZF 3SF0A 3U19A 4OMFG 4WN9A 1U0LA 4DNFA 1L7EA 3CRVA 3ETJA 2FDCA 3TVYA 3BL5A 3ECSA 1AMUA 1BX0A 1PZEA 3DHVA 3DFIA 3ZWCA 1Q44A 2H4FA 4ZMSA 4JU9A 1KO4A 4L2IB 2D5AA 3P2EA 3PCRB 1FFSA 1DG1G 1TXGA 1O94D 3NAGA 1P18A 4HDRA 4OHXA 1QC5A 4OXRA 5LQRA 5FUXA 4DWOA 3OBBA 1ENPA 2EFHB 4M83A 4PNPA 5LA6B 2CV2A 1R10A 1EWTA 3ST7A 3WMXA 1EBFA 3RYHB 4B81A 2YINC 1QP0A 1XWIA 2XGMA 4UOQA 5H7XA 1U2DA 2AT1A 3WLOA 3ZK8A 3QTLA 2W37A 1AVTA 1NRWA 4RH3A 4ZI7A 3SHWA 2WKWA 1N5IA 1XLTC 2AZMA 1T5SA 1E9EA 2X8BA 5K8IA 4MP6A 3DJFA 4X54A 4Y9TA 1T91A 3BH0A 4OHOA 1VP9A 5LB4A 1NY6A 3RBAA 3WK7A 1ADBA 4B73A 4AYWA 4PAQA 1DX9A 3QF4B 1WMAA 3ESDA 3BTOA 3OG9A 2ZJBA 5EP4A 3RLIA 5HE9A 1I5OA 3HFRA 3H8SA 2WWWA 4W7HA 2ZUUA 3FFBA 2O59A 3QU7A 5J40A 4UMEA 3H7AA 4LYDA 4M88A 4P35A 3A4YA 2PAAA 2C0PA 3TPZA 3TBFA 5AQ1A 5L51A 2HQ1A 1U2RA 1NN5A 5FULA 3WV5A 2ISSD 3FHOA 4KQGA 2Z98A 2NXJA 4OP2A 1QFYA 4HGZA 4S2UA 4XQEA 3TL3A 4DMFA 1KY3A 2O3TA 1EUDA 1FU7A 3H05A 1GQYA 4OBEA 2ZM5A 4OATA 5EMMA 2YVUA 3CZAA 3DEFA 1IK4A 2OPHA 5CBPB 1UJ2A 5JZBA 3JY6A 1C7JA 1M6VB 1BGXT 1VLZA 2FPWA 2BEVB 3B1VA 3G2IA 3P20A 4KMOA 4MV9A 3LDAA 4DA6A 4F5EA 4PYJA 3V7YA 3O8QB 4WV3A 3X1WA 3GLVA 1R64A 4GW3A 4BQQA 5L9AA 4A16A 4GR5A 1NUHA 1T43A 2VP9A 2J6BA 4FSXA 4MUHA 4PPFA 4XH9B 1G38A 3U7FB 1GRNA 2X0DA 1Y3AA 1CUSA 1JEAA 1U8TA 3NTXA 1KP9A 3NWPA 1QV7A 1XF9A 1CULC 5HMMA 4UOEA 4GWLA 1UBFA 1YWGO 5KTPA 4FIZA 3B51X 2DQYA 3VO9A 1EWRA 2Y0DA 1YDEA 1VYVA 3MRTA 3CZ9A 4RZ3A 5EXPA 4PZ9A 4MTLA 3T1TA 2R4TA 2ENUA 4YYZA 2G25A 2PVSA 4X0EA 5DHSA 4M87A 3TOCA 1KAEA 1GPKA 4E7OA 2GUWA 4RANA 4A36A 2HCTA 4Y8VA 5B64A 2XQGA 3ANTA 1QPGA 1N3YA 2YIJA 4OLJA 1W29A 3SNHA 1OXUA 4IUBS 5JI2E 2LBPA 4MKFA 4ZQIA 4DT1A 4IGIA 2OBYA 4XJVA 3A1VA 1U0JA 5HZHA 2XXBA 1G3QA 1NV9A 2X0NA 4H0FA 3ZWPA 4LYAA 4RWEA 5FPQA 4LJLA 1B76A 4IJKA 3JQBC 1IBSA 1Y4SA 4CKWB 3RSQA 1KO5A 2FDXA 4JJFA 4GXQA 4M86A 5BOSA 5BWNA 1X70A 5JPCA 4PTZA 1VL2A 5DI9A 5EWLB 1S8NA 3CLUD 1MNQA 1DT5A 1T8YA 2I4IA 2JAWA 3GEMA 2XUFA 4TUYF 1LDGA 3FVVA 1RHKA 5E3JA 2NZVG 1W4AA 5FEMA 3QMVA 1HMYA 4H3SA 2J4DA 3O1IC 2JC3A 3Q1KA 1C9NA 2OORA 1NN3A 2XYRA 1KXZA 8LDHA 3I9JA 5C81A 1E0JA 2ZTVA 5LOVF 3K8OE 3IO3A 2QRKA 3N28A 3WOVA 4RLQA 5HGXA 4P7BA 2Q1TA 3KQKA 1W96A 4I55F 4IOKA 4QELA 2QAGA 4Y98A 4Z8XA 2PSSA 3ETDA 4JL8A 3TS1A 5K0ZA 2DJ5A 1NYRA 2JFQA 2WTAA 1N0HA 5DNAA 4BO3A 1GNVA 4HB0A 3FKJA 3ZCQA 5HF9A 2B9EA 3DCIA 4D57A 3BE8A 3EXEB 1I7QB 2DQ4A 1F06A 1UZUA 3PRKE 1KZHA 3SZRA 1CQJB 4NZOA 5P8WA 3P0FA 3FSEA 2BJVA 1RBQA 4MVJF 2XYGA 3OA0A 1U2TA 4TYPA 3JXEA 4FBGA 1KQOA 2X9QA 3EB9A 1TTPB 2PDAA 1XEWY 4H1HA 4BUJA 2JI9A 1R50A 2XODA 3SC4A 1DAMA 5AVVA 3RBVA 5CG2A 3THXA 2AVNA 4GGPA 4JWTA 4UFNA 4BNWA 4CTKA 4ER7A 3WWEA 2IHNA 2PKWA 1E7YA 3N87A 4II2A 2DLNA 4UUNA 5CUQA 1RS0A 5F12A 4IDNA 3ZKWA 1J23A 3TTVA 4JLAA 4Z1MD 2BEJA 4KVAA 1H5UA 8AT1A 2GKGA 2VVTA 3AG6A 4BP3A 4W5NA 1AUPA 3F0TA 1H42A 1DAKA 1PQPA 3HDGA 2PKCA 5C80A 3VKHA 1A5AB 2ZBGA 1Z5GA 3FDZB 3G2MA 4NMHA 3ZE1B 4XR4A 1J70A 3CR8A 3OIUA 1TLFA 4OFXA 3K53A 4N76A 3JAKB 3WHIA 4R5MA 2FN8A 2DE0X 3KQMA 3R24A 3RNOA 4I0WB 5REQA 3IR6A 5I5GA 5BSVA 3CEMA 4NYJR 1E3DA 4NL4H 2E48A 4QEZA 2ZS7A 1SUIA 1FX0A 1G19A 1TAGA 2IHJA 1JHPA 2A92A 3CKYA 3GLHE 4MWTA 5AXAA 4RKWA 3RCBA 5KPJA 1I4TD 1Z39A 3IT0A 4Q4LA 1KZ4A 4V0KA 2XBUA 2QRVA 1SCQA 2JIZA 5BT8A 4NDZA 2GWRA 4EG1A 4IJWA 1J39A 1RZRD 1NMZA 1RKQA 2FEAA 5JNUA 1NFFA 3UJAA 1CYEA 5A7FA 1G7RA 5EWJA 1XNHA 2WTMA 4EA9A 4UHHA 2IIQA 2SNIE 4LJAA 3BM5A 3UB2A 4CKXA 2V7UA 1NVXQ 4FOOA 1G1MA 2XB9A 4JBLA 1P6QA 1NW6A 1S4QA 1T9HA 2AJTA 3ACDA 3DBVO 3RUIA 3BULA 3PX7A 4ACBA 3MF4A 3EZ6A 4LG1A 1QIJA 4H4EA 3QGMA 1P0MA 3U40A 4TOIA 1K1EA 3ZJ5A 2XUDA 2XMGA