4CM4A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
250
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 94
structure length 250
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm4A00
3DBRB 5CDSA 2Q4BA 1GCOA 1UDAA 2UVDA 1XYGA 4AJKA 4EYEA 3JQAA 3AY3A 5GZ6A 4OHUA 3PWSA 2DTEA 3SJ7A 4PRKA 4Z0PA 1K89A 4WJZA 4FFMA 2FN7A 3D5QA 3WB9A 1GD1O 3ETGA 2JCYA 3CMCO 5EQDA 1VRWA 2NQTA 3HN7A 2GD1O 3VDRA 4CV2A 2Z1NA 1X1TA 3NDJA 2DU8A 3VZRA 3AY6A 1Q2XA 1Y8QB 4DQUA 2B5VA 4RCVA 3FTNA 1NXQA 3JQGB 2VUUA 3S2EA 2QG4A 1BSVA 1J5PA 4LCEA 3PJFA 3RI3A 5L53A 1E3WA 1PL7A 2D5AA 4D7AA 1E1MA 1P45A 1U4SA 4E2YA 4M86A 4EUFA 3BMOB 1DDOA 2PZMA 3RUAA 5C7OO 1T2DA 1AXGA 3GAFA 1SCUA 2BGMA 3GMDA 5I7VA 1ZCJA 4XB1A 3CMMA 1SB9A 2J3HA 1I3NA 5IAAA 2WYUA 1R0LA 4M8SA 4RPKA 1EK5A 3TWOA 4FFOA 3WG9A 1O0SA 3L07A 1V3UA 3QA9A 4R1UA 1VSVA 4BO1A 1PGPA 3GRKA 3K73O 3E1KA 3X2FA 3F9IA 3V2HA 1VJTA 4NJMB 1XDWA 1T24A 3W4IA 3H5NA 2YFQA 1HETA 1UZLA 3JQBA 5JW6A 3PHLA 3W6ZA 5AOVA 4BO2A 3KXDA 1TLTA 1PZHA 5F21A 3VDQA 3FNEA 1E7WA 4YT5A 4NH4A 4BV9A 3AUUA 3ZHYA 5TT1A 9LDTA 3OJ0A 2G0TA 3DOJA 4YRBA 4AJJA 3STHA 3K30A 2FY8A 1GPDG 3GPIA 1I33A 1E6WA 4OH1A 3PRJA 3ZV4A 4FW8A 3I4FA 5BNIA 1HE3A 1X14A 1NBOA 3BMQA 4J0EA 1NAHA 5F5LA 5EQFA 2A92A 4U6QA 4JP3A 4PZCA 1S6YA 1BVUA 1YB4A 5CFZA 4CPDA 3QVTA 2AE2A 1CETA 3VVCA 3H2SA 1ZSNA 4LW8A 5F1KA 4Z6KA 4IZIA 2RHRA 2AEFA 4J4BA 2DAPA 4FQ8A 4J9VA 1GUZA 4RPHA 5TF4A 5IDQA 1AE1A 3NJ4A 1VKOA 1ZEJA 2EIHA 1M6WA 4KTVE 1Y81A 3JD2A 2NADA 2YQ4A 4D3DA 1XEAA 3WGOA 4WEOA 2Y1FA 3MTJA 1WMAA 3UCXA 4LK3A 3WGTA 4CLOA 4OSOA 4R9RA 1ZEMA 1V35A 3LT0A 4U6SA 2Z5LA 3L77A 5IDWA 3F5QA 1NNUA 4BQRA 3GGOA 1PWXA 2ZJ1A 5G0SA 1PJ4A 4IDEA 1IL0A 1E5QA 1CERA 4CR7A 4BNNA 1TT5A 3KYCA 4GKVA 4PRLA 4S3MA 5AXCA 5LDHA 5TJ9A 2C2YA 3HE3A 5EMHA 2ZTMA 2VHXA 4CUZA 1U5AA 5JDCA 1D4FA 1JKJA 4BKOA 3V5NA 3F47A 2NVBA 4GBJA 3RCBA 1X7GA 2BELA 1I5RA 3JD4A 4OMUA 3WGHA 4D3SA 4XDYA 4J7CA 4II3A 5B37A 5CG1A 3JD3A 3GY0A 4CV0A 5H83A 2Y93A 1N2SA 3VOSA 5IJZA 2VWPA 4CM4B 4MVJI 3KB6A 1UUFA 3E48A 4HNHA 4LGVA 1ZVMA 4D46A 2BFMA 4IXWA 2PY6A 1H9BA 5BSHA 1ISMA 1DC6A 3FF4A 1SOWA 2E4AA 4DYDA 2HCTA 2WWRA 1KVQA 4YAJA 1RM5A 1ZJYA 2VRCD 3H4VA 3KLMX 3OA0A 2NLOA 1BW9B 4CLRB 2E6UX 1YONA 2JD0A 2ZB8A 1B16A 4JBHA 4YJDA 3C24A 2GLXA 3WJ7A 2AA3A 4BNVA 3OJEA 5AXAA 1ZXLA 4TRMA 4XEHA 3H9JA 5I9NA 3VTFA 1P1RA 5JSFA 1U3VA 4Z9XA 4CM1A 2VHYA 5CHEA 1FDWA 4N54A 2OZPA 4O59O 1XHLA 2A4KA 2P2SA 2GRAA 2HU2A 2YQ5A 3I3OA 3KHUA 3F46A 4UEOA 2FR8A 1MLDA 4DMMA 3RUDA 1LQUA 3D1LA 5TT0A 2XXJA 3UXYA 3ZWCA 3IQDB 5EESA 3D4NA 5KVQA 1A4IA 1U2GA 3IJPA 4HADA 1NWHA 2X6TA 4RVHA 2E82A 2H6EA 2X5OA 4GX2A 3DB2A 1T1SA 5HRUA 2UUOA 4YCAA 3PTZA 4I9HA 1IY8A 1YQDA 2X9NA 4BMSA 4C4OA 1HE4A 3CKYA 4R3NA 2WMDA 3QVXA 4J3FA 5COQA 1O5IA 3S2FA 4YTEA 1ONOA 4Q3NA 3R6DA 1I2CA 3WMWA 3JQCA 3PGXA 4K1LA 2FMUA 2Y05A 5CEEA 5A06A 5EINA 4NBWA 3ON5A 5BT9A 1XLTA 2BGKA 2GZ2A 3IS3A 3GLQA 4UUPA 5ES3A 3ZCXA 1CJCA 4CLHA 1DRVA 4B3HA 4EW6A 3HNPA 4MVJG 4RQUA 3UCEA 5JAIA 3Q9NA 2ZJ0A 1N5DA 1E0DA 1U2DA 2G76A 2HMWA 2IEDA 3FSRA 3B1FA 3K6JA 4M49A 3QRWA 3LT2A 5TGDA 1NQ5A 1J0XO 2QRLA 2Y0EA 2FR0A 5COBA 1OC4A 2FPGA 4FJ1A 1PJLA 2JFFA 1Z82A 1ZBQA 1V3VA 3AM3A 3WICA 2NV6A 4KUEA 1SEPA 4RVSA 3GFGA 3BHMA 4A5OA 4D41A 1YB5A 2AXQA 4XRGA 3W4KA 4PG6A 4NBRA 5AVOA 4MVJP 1G1AA 2BFAA 1BGVA 3UFXA 5K6AA 4WCFC 3GHHA 3GEMA 4H15A 1LRJA 4MVJD 2ZB3A 1UXJA 5KTKA 3I9LA 1ADBA 1P1IA 3ZNQA 3KZVA 2GASA 5KJ6A 1IZ0A 4E5PA 4QEDA 4RZIA 3V1UA 4R01A 4EUHA 3ZV3A 2FR1A 1NQOA 2XXBA 2OXIA 2Y1CA 2C07A 3LC7O 3OJFA 3DTTA 2CZCA 4XZ3A 4ZQEA 3VZSA 1ADFA 3HQ4O 4RF3A 3ZW8A 3DMYA 3FPCA 2VYVD 3E5RA 4ND4A 1B15A 2EJVA 2VYND 5A02A 1VJ1A 4G65A 4YVFA 4IDCA 3C7AA 2JJYA 1GUFA 4UULA 3ZHBA 4NFYA 1DJQA 4KQXA 4D0RA 2I65A 2FOIA 1MGOA 2YFHA 4KP7A 4DYVA 4BO8A 1TB4A 1ID1A 3P5SA 2C59A 1DIHA 5A9SB 5IZCA 2IXBA 3K8ZA 4XIJA 3D0OA 5K0ZA 3ABIA 1T1RA 1NHWA 1RJWA 3OIFA 3JYNA 3PJEA 4CM6A 1TA4A 1B7GO 3I6IA 2C29D 2P91A 2X86A 4FFPA 5L7TA 5TIIA 2OOSA 1Y8QA 2EGGA 2ZIZA 1LSOA 4GL4A 1K2WA 3NTQA 2DBVO 3NTRA 2C0CA 1VPDA 5I7SA 1V3TA 3WXBA 3OM9A 3E6AA 2VNAA 1H93A 2DBRA 3BMOA 1HF3A 3TPCA 3U4HA 4XIYA 4CMGA 3ENNA 3B20A 4YT8A 1GFSA 2W8ZA 3H5AA 4CMIB 1EUZA 3G1UA 4NBVA 1SNYA 3K2EA 3COSA 3LZ6A 4XYLA 1R0KA 1A4UA 2O2YA 3FR7A 1DPGA 1PWZA 3AM4A 2OORA 2JFHA 1I24A 2AQHA 1XA0A 2AHRA 4WASA 3TSCA 3ADPA 3L4BA 1Q7GA 5T8KC 3GDGA 1C0PA 4XYMA 1AHIA 4EEXA 4P4LA 4J6FA 1OFGA 5THQA 2FSVA 2AQIA 3B1JA 4Q9NA 5GY7A 1I2BA 1Y7TA 2P4HX 5G4LA 4URFA 2Q1TA 4L4SA 3JQFC 2AQKA 1PJSA 2Y0DA 3K92A 5H82A 1XU7A 4WOJA 3G49A 4LSWA 3R3JA 2IZ1A 3OQ1A 5A5FA 4BO5A 4ALNA 1WW8A 1AUPA 4NK5A 2W98A 2FWMX 4UVIA 4GPD1 4M55A 3DZKA 4KQWA 1D8AA 4E30A 1LXCA 3LU1A 1WWKA 1GAEO 1OI7A 3BZUA 1Q0LA 3H3JA 4MVJA 1W8DA 1NFFA 1ZH8A 5EL0A 3KBOA 4KUGA 4K9DA 4I1IA 3H5RA 1DFGA 4BNHA 4PG8A 5JY1A 3GT0A 3OBBA 2R2GA 3SC4A 1Y6JA 3HSKA 3KVOA 4J49A 4HKTA 4EBFA 3AOEA 1LBEA 2I3AA 2D0IA 2PKQO 1JU9A 3QE3A 4MP8A 1U28A 4OOEA 4A73A 2X0RA 1WZIA 3BTVA 3ZWXA 3PI7A 5IN4A 2W2LD 3GN2A 1CQJA 1LDEA 1LLDA 3PXXA 4XQ9A 3DOOA 5F3RA 1BVRA 1UXHA 3T4XA 2HK9A 3OJOA 2B4TO 2DC1A 9LDBA 1JVSA 4DPLA 1NTOA 2X9GA 3ROMA 5F1OA 4W9NA 4KDEA 1QORA 3Q6IA 1EVYA 3WOHA 1EFKA 4CL8A 3KSDO 4YJFB 1L1FA 4BNGA 4BGUA 1M76A 1GYPA 1ONPA 2VT3A 4U7WA 3ZU4A 4LISA 1HDCA 3PWZA 2HO5A 1WVGA 3RC2A 2J8ZA 4IGFA 3TQHA 3GNSA 5JO9A 5U1PA 3SC6A 1ZMTA 2CDBA 3DFZA 3I9OA 3JQEA 4WCFB 4CLXA 2I99A 1I3MA 2Q46A 3HWRA 4CODB 3RASA 4CL3A 4F45A 4B4VA 3N74A 1NP3A 4QUKA 4RZHA 1K3TA 2CNBA 2WE7A 1K6JA 3L0DA 2O50A 3N58A 1RPNA 4CQLB 4R5MA 5A4DA 2IYPA 3NUGA 3WNQA 1WDLA 3AFMA 4CM8B 2O23A 2OO5A 4R1SA 4Z3DA 4HV4A 3D4PA 3U4DA 3MWEB 4CM4A 5KKCA 1E3LA 4R1TA 3I9JA 1AGNA 4QSMA 4DLAA 2WD7B 3L4SO 2GNAA 4P38A 4CMBA 1NVGA 1GDHA 1UXIA 1PZFA 4J1NA 3OJLA 3QWHA 3QVSA 3PYLA 1ZK3A 2IDZA 2FP4A 5G4KB 3UVEA 1LU9A 3VPFA 3RSHA 2EP7A 1LI4A 2PV7A 3C85A 1WXDA 1PJ3A 3ENKA 4HX5A 4IDGA 5DP1A 4E5YA 1X0XA 2P9GA 1F0YA 1I01A 2DPGA 3HFSA 5U4QA 3HFGA 4HFJA 3UF0A 3E9QA 4D44A 4YT4A 1GUYA 1P74A 1LLUA 1X15A 1E6UA 4JJGA 1T2FA 3DAGA 1ZKMA 4B8ZA 3OETA 3IKTA 1E77A 4E2XA 2FHSA 4HFMA 3JSAA 2J5KA 2GZ3A 3GH3A 4XYGA 4NBTA 1Z45A 3JQAD 1JWBB 3QWFA 7ADHA 2IRWA 1YBMA 5ITVA 1SO8A 5BSEA 4TZKA 4DQVA 3NGXA 1LJ8A 3PHJA 4CJXA 4ZQFA 3NDIA 3IIEA 1BWSA 2NWQA 1ZW1A 4BNUA 1RYDA 4DIBA 2Y1DA 4JIGA 1ZK4A 4FR5A 1U8FO 4Q3CA 4B4WA 2PTGA 3WSWA 3PIIA 2W2LA 1YBVA 4GAEA 1DRUA 1R4NB 4CR8A 3IP3A 2OUIA 4K6CA 3K5PA 3C7CB 4I8XA 4D79A 1XIVA 2VHWA 1YB1A 2CF6A 3AUSA 1N8KA 4FCCA 5TJHA 2PH5A 1SEVA 1IE3A 2EP5A 5DOZA 2X5JO 1DB3A 3C1OA 4J7XA 3RFTA 2FZEA 4RVUA 3BMNB 3EVTA 1T4DA 3E8XA 1GQQA 3S2GA 5IF3A 1XKQA 3NEPX 1YWGO 4DUPA 5JDIC 2HMTA 2VN8A 1VL8A 3AI1A 4YR9A 1LSSA 2WD8A 4XYBA 2VUTA 4RGBA 2B5WA 5EIOA 1QV7A 2OHXA 5JYEA 4CMKA 4TRJA 1PIWA 1HDYA 4XJSA 4AJEA 4JJFA 1H6DA 2D59A 1P77A 3QP9A 4RO0A 4OSPA 3P19A 3WWZA 3O8QA 5JAZA 4L76A 2HJRA 4CMEA 4RDHA 3ZN2A 2TMGA 3ZWWA 3AU8A 3ST7A 4RDIA 1YJQA 1YOVB 4ND2A 3WYCA 1UP4A 3NGLA 4JX8A 1DFIA 5KVCA 3NT2A 4YAEA 4D3FA 3HDJA 1JDJA 3E18A 1GU7A 3GQVA 3MZ0A 1E7QA 3FN4A 3PDUA 1GYRA 4LVUA 3IAHA 2DFDA 2ZTVA 1Z6ZA 3KETA 2Y99A 1FJHA 6ADHA 4B7UA 1T4BA 3OFSA 1HLDA 2X22A 1MA0A 4NJOA 1RM3A 2QZZA 1A7KA 2X4GA 1OBFO 1C1DA 1P44A 2PK3A 2PGJA 2X0JA 4KWHA 2JD1A 4YQYA 2B4QA 1Z74A 2RH8A 2Y1GA 5CEJA 4W7IA 3PIDA 4Q39A 3RC7A 3JQ9A 3P2YA 3W6UA 2PD3A 1AXEA 1NPYA 1V9LA 5B4TA 4WLEA 5L95A 2YYYA 1DHRA 4FSHA 4AVYA 1EDZA 3GG9A 1PQUA 2P9CA 2PFGA 4E4YA 4Y67A 4E6PA 1NVMB 3E9NA 5T67A 5BQFA 1HRDA 3E5MA 3DZGA 4UUOA 1DOHA 3I4CA 3AUAA 5H81A 4IGEA 4QXMA 1QR6A 2R00C 1Z7BA 4E31A 1ZIDA 1D3AA 4AG3A 4CM9A 5L7WA 2I66A 1P0CA 4WECA 1I0ZA 2EKLA 4XRRA 5IN5A 2IEBA 1KOLA 1F12A 4GLOA 4FBGA 4JXKA 1NYTA 5A9TA 1G6KA 3A9WA 1QXSA 4Y8VA 2AEJA 4CMIA 1KC3A 3DQPA 3H9UA 3M6IA 3G79A 4X54A 2UYYA 1U7TA 3KEQA 4WE3A 3Q9UA 5CPBA 3WBFA 3EK2A 1TT7A 2YW9A 5KNLA 3G17A 2I3GA 2GF2A 2ZATA 3PDJA 2BLLA 3BMCA 2OMEA 2D5CA 1O94A 1ZXBA 5TQVA 1GZ4A 3UICA 3OHSX 1CF2O 1VL6A 4GH5A 1DAPA 1SBYA 4A0SA 3D4OA 4L4RA 3O9ZA 3GZNB 4IJWA 5JC8A 1LDYA 3GVXA 4CV1A 4F46A 1RKXA 4IDAA 5KJEA 1UXKA 1VC2A 3F1KA 1E1LA 1JQBA 1VSUA 1C1XB 3M1AA 4ROSA 1LDMA 3VH3A 1Y1PA 5CG2A 3BAZA 3ICPA 2VTEA 1EEHA 1U9JA 3OQBA 1P1KA 2B35A 3UW3A 1ML3A 3H3FA 1P9LA 4NPCA 3K9QO 3ADOA 4UUNA 5IFLA 3WFJA 3NX4A 2IODA 3BTSA 3PLNA 4FN4A 3VPXA 3K2BA 4F6LA 4Y6RA 2TMDA 3IP1A 2DTDA 2O3RA 4YB8A 3WGYA 1H6BA 3M2TA 1DIAA 3WQSB 3TF5A 2DT5A 3NKLA 2O3TA 3PGJA 4FJ0A 4M87A 1I2ZA 3O38A 2IXAA 3CUKA 1YXMA 1NR7A 1XQ6A 1NQAO 4R5HA 4EUEA 4R16A 4OQYA 3AI3A 4HNGA 4O63O 4CLEA 1VL0A 1ZK0A 1PS9A 4E5KA 4ZVVA 3RUEA 1KEWA 3WLFA 4RLSA 5ICMA 1YBAA 4MPDA 1CYDA 3RFVA 3V8BA 4E3ZA 5FF9A 1T26A 1EZ4A 1M2WA 2EW2A 3EZLA 2Y0CA 3BTUA 4W82A 1EE2A 4O0LA 4Z0TA 3ETEA 5JMWA 3EMKA 3HB5X 3JD1A 2O7QA 1PEDA 4HXYA 5G2OA 4BL5A 4RVDA 3H9QA 4DRYA 4D42A 2POQX 2AE1A 5IG2A 3BXXA 2EJWA 5KOIA 4CR6A 4MJLA 4C7KA 1GL3A 3AJRA 4PZDA 1H9AA 3H6KA 3DMTA 1X1EA 2JHFA 4XQCA 5JYDA 3K31A 1KEVA 1B8PA 1H6CA 3PHGA 4Q3AA 4DWVA 4DPKA 3JCZA 4PG4A 1F8FA 2AG8A 2HRBA 3LYLA 4FOOA 3FPLA 3GK3A 1ADGA 4YJHA 3LLSA 4NI5A 4Q3BA 4UEJA 4DIFA 4CQMD 1HEUA 1ARZA 2CD9A 3NV9A 4LVCA 5JCXA 2BI7A 4XGKA 3CE6A 3JQ8B 3TNLA 1X0VA 3GDOA 4Z9FA 3JV7A 3UH1A 2J5QA 4S1VA 4N7RA 3BYZA 2D8AA 4WCDA 3DEYX 2LDXA 4FC7A 2VOJA 1VLLA 5EN4A 2Q4EA 4B3IA 2J5RA 1N9GA 4HY3A 3SJUA 4B4UA 3DAPA 3EW7A 5JCJA 4YPOA 5BNTA 3IJRA 4PLPA 3BA1A 1M66A 4P4GA 2W2KA 3OA2A 4MOWA 4I9UA 4BB5A 3DOCA 1EDOA 1KEPA 4WLNA 4EZBA 4OL9A 3V1TC 4MDHA 2Q45A 4MVJM 4XR9A 4BVAA 2D4AA 3CZMA 1ZMOA 2J3IA 1QSGA 4L9RA 2B0JA 1BXKA 4K6FA 2NM0A 2GCGA 2SCUA 3VH4A 1GTMA 5A04A 3B1KA 2I67A 2HSDA 3GF4A 3ZHXA 2GN6A 1IB6A 1ZUD1 3MJ4A 4ZQBA 4J43A 2EKPA 1LTHR 2IYOA 5KCZA 1R12A 3FHLA 4YJGA 1WZEA 2ZQYA 5KWEA 4QO7A 3DBVO 4ALMA 1MB4A 3FD8A 3GGGA 3ZWMA 2X1HA 3K96A 1P3DA 2WJPA 1R4MA 1VE9A 3INRA 4NU5A 3ZNOA 3INTA 4OKNA 2WM3A 4FJ2A 4OM8A 3U0BA 3DZIA 2AG5A 5JMPA 1JKFA 1CEQA 3GFBA 3HUDA 1W73A 1JVBA 2CDCA 4BOYA 5A5EA 5JXWA 1JTVA 1DO8A 2GN9A 2JAPA 3L6EA 4JLWA 1W6UA 2A35A 4GI2A 4WLVA 2F00A 1AHHA 1U3WA 3S8MA 4GX5A 1HT0A 5KJCA 2OP0A 4ALJA 2CY0A 3JYPA 1KYQA 3PQEA 4O5OA 2LDBA 3FNGA 1R0SA 5L51A 2O3SA 5HA5A 1MV8A 2OBNA 4MKXA 8ADHA 5KJ1A 3P2OA 1W4ZA 3GOHA 4RORA 4U0JA 1DRWA 2WYWA 1NX6A 3LT4A 3DL2A 4AJ2A 1JWAB 3WYEA 4CV3A 2RCYA 4YXFA 1LEHA 2J3JA 3LQFA 4ZHSA 2J3KA 1M75A 5A3JA 3JQFA 4EDFA 2JKVA 3RIHA 2ZYGA 4E0BA 5G0WA 3AWDA 3BMNA 3JQBC 3LDHA 1GYQA 3LF1A 3D64A 4FC6A 1AN9A 1JA9A 3PLRA 1RYEA 2HDHA 2Q1UA 4R68A 3DBLB 4N5NA 5CAEA 3RUIA 5TSDA 1BXGB 3V1YA 4Z3KA 1O8CA 4BNJA 3KYDB 1ENPA 2QYTA 2ZTUA 3NDRA 2Q2WA 3KUXA 1C3VA 3DONA 1E7RA 4CQMA 4Y6PA 3AK4A 3KLPX 5K9ZA 2AEMA 4ZRMA 4BO3A 1NPTO 1MXHA 4GWKA 1LDBA 4K28A 3HJAA 1HDGO 2B83A 1R66A 3SXPA 2VUSA 4YBZA 4AFNA 2PWZA 3W8EA 4RPGA 3RAJA 3FWZA 3GNTA 3HG7A 1CDOA 3NAQA 3A06A 5B4UA 3KOUA 5L4SA 4IY1A 3OICA 1OC2A 1J49A 3ROQA 3SEFA 3WNVA 1A72A 1YOVA 1LC0A 3KEOA 4PIVA 1PR3A 4GGPA 4PG7A 1ORRA 2NU9A 1YL5A 3TZQA 1B8VA 3WQQA 5ENDA 3DTYA 3PZBA 4G5HA 4GMGA 1B14A 4KOAA 4J1TA 1ZSYA 2XAAA 1ULSA 3GGPA 4DREA 1LRLA 2BFOA 4OKIA 4OAQA 3ROKA 4U0KA 4FGWA 3WTBA 2EW8A 3UUWA 1WNTA 3GUCA 4IJVA 4CM5A 2YHUA 2PH3A 4AJIA 1BHSA 3DO5A 3ETDA 1MC4A 3EHEA 2YHIB 4N5LA 4AJNA 4AJLA 4Q3EA 1U4OA 3NTOA 1MX3A 4JJIA 5ADHA 5I8ZA 4E5NA 1QYXA 4W4TA 5JO0A 3DBRA 4AJOA 3FBTA 4P4NA 1I32A 2Q3EA 4NQZA 3I5MA 3JQ7B 4M1QA 4FFNA 2GZ1A 2G82A 4F6CA 5AXBA 2DLDA 4CMAA 1QYVA 2X0NA 1SMKA 3ONFA 4YA6A 5ER9A 5JDCC 4H3VA 4MP3A 2P4QA 1LSJA 1HZZA 2XF8A 5FFFA 2CVQA 3F4BA 1WLYA 1B26A 1LX6A 1A27A 4IDFA 1HYEA 1HYHA 2GDZA 2NSDA 3HDHA 3JQGA 3PFFA 4OYRA 5ER6A 1FDUA 4HBGA 3QJ5A 4XX0A 3G3EA 2Z95A 3ZV6A 4ZQGA 5I9MA 4OXNA 2PZLA 1SPXA 2X58A 4J0FA 4XQEA 3RUCA 1HLPA 3I6QA 4XKJA 3ITDA 1OOEA 4WUVA 4DTIA 3JQAB 3Q0EA 3QLJA 2X5KO 1A5ZA 3H2ZA 4BO4A 1PGOA 2PGDA 2BD0A 2D3TA 3GNQA 4PLWA 2I6TA 4IQGA 3I9NA 4L0QA 1E92A 1PU2A 4U5QA 3GZNA 1GV1A 4YQZA 4RV9A 3RBZA 4BKPA 4ZJUA 2O2SA 1KVTA 3QV1A 5BSFA 4MKRA 4NJMA 1YDWA 3GVIA 4ZGWA 3RWBA 2C5EA 3RU7A 3GA0A 3AU9A 5DBFA 1B8UA 4UVEA 1GQ2A 2H63A 3WWYA 4YAGA 1JN0A 4LRTB 1E3WB 1KEUA 3WGIA 2EKQA 1LDNA 3L9XA 4IQ0A 4N18A 3CINA 2PNFA 1HYGA 1BTOA 2VQ3A 3ZV5A 2O7SA 1P1HA 2FSSA 4RPJA 1VJ0A 3H7AA 4FB5A 2OBYA 1EQUA 4IUYA 1PJ2A 1ADCA 3R3SA 5DDIP 3D7LA 2PGLA 1TI7A 3ZDFA 1NAIA 3RROA 4DLLA 4Y98A 2HMSA 2QX7A 1B3BA 1LDGA 2V6FA 4QTZA 3IOYA 4UUMA 3T7EA 3I1JA 3INGA 1CRWG 2WE8A 1ENZA 3H9GA 3DZBA 5JAMA 3U4IA 3AOGA 3GN1A 3FNFA 3R0IA 3NRCA 3WFIA 1T2CA 2WSBA 3I52A 1EUDA 4NG5A 2VWHA 1H5QA 3GR6A 5TS3A 2BMAA 1O6ZA 4XGNA 2X7HA 1U5CA 5JNLA 4J16A 3CIFA 1GEEA 2DVMA 3DZJA 5DNAA 1UDCA 1GY8A 3BMQB 3AM5A 1J4AA 1XWFA 4CMCA 4BGVA 5DOVA 2X8LA 3PYXA 5KJFA 1X7DA 3WJAA 5K6AC 3QVOA 1F06A 3TZCA 1LC3A 4NK4A 5DT9A 1NR1A 2Q2QA 3NT4A 4ZQHA 4CUKA 4MP6A 2EWMA 4I5GA 1H0KA 3UKOA 2QHXA 3I9KA 1OMOA 3PK0A 1ISFA 1E6EA 2PR2A 5L7YA 5TLSA 4JP2A 1TEHA 1ISHA 2QW8A 4ND3A 2BH9A 2NQ8A 4PCVA 1ONNA 2GO1A 4NNJA 2EEZA 4WOKA 4J4TA 5G0TA 2J6IA 3GDFA 4DA9A 3DFUA 4CLOB 1DLIA 3D5TA 2Q50A 3WGGA 4TSKA 3OIGA 2PKQP 4P8RA 1RM4A 3RKUA 5DBIA 2IZZA 4RVGA 4BQPA 2RHCA 2Z1MA 4R51A 4RF2A 1BW9A 4CLRA 1TT5B 3KYCB 3VC7A 2V6GA 2NU6A 3QIVA 4LMRA 3VZQA 2C5AA 5IDYA 5A3VA 2B69A 3DC2A 1YJ8A 4DVJA 1I36A 2ZKLA 3KV3O 3UHAA 3KRTA 3VAZA 5CDGA 2V6BA 1HWYA 1GPJA 4B7XA 1DHTA 1G0OA 2ZYDA 1GEGA 3U4CA 4Z0HO 1S7CA 1H2HA 4PLFA 1DC5A 1YRLA 3ZWPA 3EUWA 3WTCA 1U3TA 2D2IA 4CM3A 4W7HA 1C0IA 1QYWA 3SLKA 4AL4A 4BO0A 5L9AA 4R1NA 2QRJA 2HJSA 1DIBA 4XYEA 2HRZA 3ZWNA 1FK8A 3CZRA 4Y9DA 1QG6A 1N92A 3QSGA 5HBRA 3C3XA 1VI2A 5L45A 2Q49A 1YO6A 4CM9D 1GR0A 3O4RA 4RLHA 3HDYA 3S1LA 5BNFA 1SZJG 4RF5A 4PLTA 3VVBA 5ENVA 4E21A 2YJZA 2BGLA 5A9RA 2EG9A 1IOLA 3C8MA 5THKA 3RJ9A 3SX2A 4TWRA 2DPHA 3BHIA 3PHHA 4PLCA 1DIRA 1D7OA 4ZRNA 4BHTA 1WAMA 3OQ6A 4TROA 5I7EA 1I8TA 1E1KA 1HDRA 4BNFA 4A26A 3MEQA 1KY5A 3CH6A 1IPEA 3DR3A 3DZHA 4CMJA 1IUKA 5DULA 3IKVA 3DBLA 1A71A 4XB2A 2VT2A 1BXGA 1EVJA 4EJ6A 3H65A 3KYDA 3KM0A 4IBOA 4YEDA 1LQTA 4KDFA 4I5EA 1KBZA 4FFRA 4D45A 3GPDG 1R15A 4BMNA 4BNLA 4IINA 4WKGA 1KVRA 3ONEA 4AJHA 2JCVA 3EDMA 3L9WA 1MP0A 3FWNA 3KO8A 1QV6A 4ONEA 2ILTA 4XR4A 1FF9A 2EXXA 2Y66A 4J2OA 2BHLA 2ZCVA 1HSZA 1HTBA 1P31A 5A05A 5MDHA 1R6DA 2XOXA 1E5LA 4J91A 2YV1A 3AOEC 1RWBA 5HS6A 1LNQA 1PQWA 5ITWA 1Y8RB 4JBGA 1K0UA 4QFDA 5JBIA 3DHYA 1LA2A 5COAA 4Y6SA 3JYQA 5B4VA 3MJSA 1QP8A 4KZPA 3VPHA 1BDBA 4W9NC 2UDPA 1V6AA 2YDYA 4GGOA 3DAFA 1U8XX 1PJTA 1Y5RA 2V65A 4WGGA 5FWNA 4BIIA 4A2CA 2I5PO 3QWBA 1HDXA 4OQZA 2V7PA 1F14A 4A7PA 3GUYA 1C0LA 2X9VA 4PLVA 3JQ7A 5JY6A 1X7HA 3VZPA 2Q99A 4BNKA 3F6YA 4JCOA 2VZ0A 4HFRA 1PGNA 5F5NA 3ZWVA 3ZU5A 5A9SA 1EVIA 1ZFNA 1HL3A 1OAAA 4BKRA 3JYOA 4HFNA 4L73A 3SVTA 4OXYA 8LDHA 3U09A 2Q1SA 1ZZEA 2IE0A 3CTMA 3ICCA 4B79A 4CM7A 2PLAA 2ZQZA 2HK7A 2O3QA 4BUCA 4MKZA 3N7UA 2A94A 3WR5A 2YV2A 3PP8A 2DFVA 1HDOA 2GUGA 1LLQA 4MO2A 4XCVA 5KKAA 1Y9EA 3DZFA 3UCFA 2O3UA 3Q1LA 3KSUA 3I83A 5C7LO 4E2WA 3B6ZA 5CDUA 5MGBA 2QZ9A 1DIGA 4JGBA 5DN9A 4GKBA 4E33A 3GRPA 5JCJD 1I3LA 4OOFA 3RU9A 4RVFA 3FTPA 2DKNA 1WDKA 3IMFA 3ASVA 3VKUA 1C14A 1N1EA 1Z75A 1EE9A 4IIUA 4GMFA 1NPDA 5A1TA 1D1SA 1UZMA 4GX0A 4XQGA 3A14A 4MVJF 1OZAA 2C82A 5JS6A 4R3WA 3ITKA 1GZ3A 4ZICA 5C3MA 1Q1NA 2ET6A 2DBZA 4TKMA 2VTDA 3DBHB 1PJQA 3R1IA 3DXFA 2GSDA 4MIOA 5HTOA 3PEFA 4ESOA 4LSMA 4NU6A 4XDZA 3FBGA 4PVDA 3OMLA 3PWKA 4K26A 1KS9A 3DWFA 3JQ6A 5L4NA 3ZZNA 2DBQA 2WYVA 4DBZA 1HXHA 3JD0A 1MXFA 2GYYA 4INAA 5KVVA 3KTDA 3LC2O 4DXHA 1SC6A 4GWGA 1B0AA 3QQPA 3NYWA 4II2A 5DCYA 1T25A 5C7IO 5TX7A 1GQYA 3FNHA 3RKRA 5ICSA 4TQGA 1L7EA 5CDYA 2GERA 4IPTA 1RM0A 4JNKA 5TC4A 3T4EA 5BSGA 2D1YA 4ALKA 4IDDA 2GPTA 4BO7A 1ZNQO 4XWYA 4DL9A 4J1QA 4J7UA 1BRMA 2NTNA 1CQIA 5EJ2A 1UZNA 2PD6A 3RVDA 4DPMA 2Y1EA 2O4CA 3T7CA 4L4XA 3E82A 3W8DA 3PHIA 1O9BA 3GVHA 2H5LA 4F3YA 1KVSA 4YJFA 1DAOA 4FPXA 3L6OO 4BKUA 4R54A 4BNYA 4J9UE 4IS2A 2PA3A 1P33A 4CMEC 7MDHA 3IC5A 5LDGA 5T57A 4ALLA 5DCUA 3CSDA 1YL7A 1ZSVA 4WCFA 2W4QA 3IUPA 4GX1A 4YWJA 2EF1A 1ZO8A 3MJEA 3ZWAA 3TL3A 4YDRA 1Q7CA 1U7HA 3DHEA 2VZ9A 4HP8A 4H16A 1A9ZA 3FCOA 4CQLA 1NVTA 3E9MA 4B7CA 3TJRA 1I10A 4KMSA 4CM8A 2RIRA 2NU7A 4GSLA 1ZK2A 2Y68A 4J2HA 2QRKA 4ID9A 4FOSA 2C54A 2YY7A 5DZSA 1H6AA 4JQCA 2WD7A 1Y5MA 3VPGA 3X2EA 1F8GA 3JQ9C 2HLPA 2DQ4A 4NFHA 1R16A 4QQRA 3ZH2A 4AJPA 4TVBA 4TVOA 5FEUA 5G4KA 5TNXA 2VOEA 1ENOA 1TVEA 4WNCA 4PLYA 3GEGA 2UV8A 5EERA 3IL2A 4IJUA 3TN7A 4BNMA 4BO9A 1FMCA 2EV9A 1Q0QA 3GHYA 4RQTA 3F5SA 5HS4A 2NUAA 1WPQA 1MG0A 4J4HA 2HK8A 5F1PA 1W0CA 1PZEA 2FPPA 3RQSA 2ZCUA 1FXSA 4M89A 1XG5A 3ZWYA 1NHGA 2H9IA 3L6DA 4E12A 3M1LA 5DP2A 1ULUA 4LMPA 3F3SA 4TMFA 2IZ0A 3IDSA 4MIYA 5U9CA 4BNZA 1MFZA 1O95A 4OIMA 4L74A 4J1SA 3LSYA 2NVUB 5AXDA 5DF1A 1YQXA 4BGEA 1DXYA 1PTJA 2BRUA 1ISGA 5G0UA 1Q0HA 1DLJA 2AQ8A 2NVWA 1TXGA 3PJDA 5T8KA 5IZ4A 4YACA 3MJVA 1QRRA 4UEKA 4GLLA 4ALIA 1BG6A 3S2IA 2E37A 1R4NA 2VWGA 3PPIA 2C2XA 2UUPA 3U62A 3HB4X 1LLCA 3U5TA 2RH4A 3Q2KA 4CUJA 1PL8A 4JK3A 1EUCA 2HKIA 2VHZA 3ANNA 3KSZO 3WSVA 3Q11A 3DDNA 5CPFA 3A28A 2C7GA 2VZ8A 3WGZA 5G0VA 1QLHA 2HMVA 2CVOA 2B37A 3C1TA 1EBFA 4EITA 1JW9B 1Y9AA 4GVXA 4E5MA 1QMGA 4KWIA 5L4LA 2Y67A 1P1FA 3D3WB 2BFPA 3TFOA 1SB8A 3ZGYA 4YAKA 1M67A 3E03A 3PZRA 1XCBA 5DBGA 1MFPA 3HADA 3AI2A 3ZHZA 3GMSA 4OO3A 3PJGA 4YRDA 4TKLA 5A03A 1E7MA 1UAGA 2C20A 1F17A 2CMDA 3SLGA 3WLEA 5I7FA 1DC3A 4UVHA 1LRKA 1N7GA 1UP7A 1Y8RA 4AJ4A 1DSSG 3ZNNA 3NJ8A 3I23A 1PZGA 3AFNA 4QT0A 3BIOA 4QECA 2NU8A 4DIOA 3TRIA 1EMDA 2C7VA 5JAQA 4BGIA 2A9FA 3MJTA 2H1SA 4FS3A 4B3JA 3FI9A 5ILGA 4DGSA 3DMTC 2EERA 2YDXA 4R69A 3M2PA 4RL6A 4XA8A 1A7AA 3OF2A 5B1YA 3QY9A 2OFPA 3GC6A 4BNIA 4QFCA 2O4UX 3G0OA 1WDMA 5LCXA 1PGJA 2HQ1A 2VWQA 3RC1A 1NFQA 1B3RA 2I76A 5GZ1A 2YZ7A 1JKIA 3WGQA 1C0KA 3O8QB 4GQAA 2G17A 2O3JA 4JN6B 4U8GA 1XSEA 2E49A 4WPGA 2P9EA 4BNWA 2JHGA 3TZHA 5L3ZA 4I5DA 4NBUA 4DC1A 3PVZA 1PS0A 4WK6A 1Z7EA 4E2ZA 5CDTA 3AUTA 4IMRA 1NFRA 3JQDA 5GZ3A 5BR7A 2DUWA 4R9SA 4BS9A 2VRCA 3MCVA 2FPIA 4GSKA 1R37A 1K5HA 2V6MA 2CSUA 3MOGA 4W6ZA 1T2EA 4DBVO 2VRBA 1YDEA 1C1DB 4YRAA 1VM6A 2QIOA 2XPCA 3MOIA 1UAYA 4B4OA 2JAHA 1JAXA 4YAIA 4KTTE 4PN3A 1E7YA 2HUNA 3ZWBA 1WMBA 1YVEI 5CP8A 5T64A 4FD3A 1JLLA 4RF4A 4CLDA 1KVUA 3V2UA 4KUHA 4EGFA 1ENYA 2X23A 3RC9A 3IUSA 1MUUA 4M54A 2I9PA 4ILKA 5LC1A 4D43A 3RFXA 4MVJH 1EK6A 2FRDA 1FDVA 4D0SA 3GEDA 5FI5A 1UDBA 1P1JA 4E13A 1HSOA 3G1TA 2GGSA 4LN1A 4EI2A 1V0JA 1UR5A 3WYBA 2VHVA 4XGIA 3LLVA 3HHPA 3ULKA 5JPIA 4E32A 5I9LA 2ZYAA 3QHAA 1KIFA 1UJMA 1C1XA 1FDTA 3DBHA 1D1TA 5CEFA 1ISJA 3LK7A 3VKVA 1XR3A 4LCJA 4XD2A 2BKAA 3GVPA 4BKQA 4FIZA 1EVZA 3HN2A 1MC5A 1V8BA 2NTVA 3H9EO 4IIVA 1PGQA 3A1NA 1MG5A 4OGWA 2G5CA 1CWUA 2DTXA 3BMCB 4RPLA 3C1AA 3EGOA 2OP1A 3PQFA 1HZJA 4J90A 4IS3A 3TZKA 3WX0A 1CIVA 3W1VA 4BMVA 5AYVA 2JFGA 4CMHA 1IPFA 3RUFA 2CF5A 4EJ0A 3F1LA 1XU9A 1KERA 4ITUA 4WNIA 5ILOA 1PS8A 4YT2A 2EHDA 2GN4A 3U9LA 1GCUA 5IXSA 1H94A 5C5IA 3FRJA 4FGSA 2NACA 1BXZA 5TRTA 3VTZA 4A10A 5JDIA 3WS7A 3KYBA 5KVSA 4RJTA 3QWIA 4UVGA 3FR8A 2P5UA 2ZTLA 1Q7BA 3AW9A 4R41A 1EBUA 4O6VA 4WEQA 1JAYA 4Z9YA 1YS4A 3W4JA 3C7DB 1LUAA 2JL1A 3QVWA 2BI8A 3ASUA 3ZW9A 6LDHA 1E3SA 3VPSA 3OECA 4DC0A 4TRNA 1I30A 4NHEA 4FDAA 4WLFA 4EJMA 3LVFO 1YH3A 1J6UA 2VYVA 1U1IA 4IXTA 1A9YA 3JQ8A 1QLJA 5HWSA 2VYNA 3GG2A 1PL6A 2ZK7A 3U49A 3MWDB 3AY7A 2CFCA 4WLOA 4W99A 2VNSA 4FFLA 1XGKA 3OIDA 4OXKA 3ANLA 3DHNA 3ZU3A 3OEYA 5FYDA 5B12A 3CPSA 3NT5A 5AQ1A 4LRSB 4O1MA 1IHYA 1QKIA 2JD2A 1I3KA 2Q2VA 5DCWA 2QQ5A 3TOXA 2E48A 1UP6A 4JROA 4YJHB 3JTMA 3TFQA 3EVNA 1XELA 1IZ9A 2B4RO 3JYLA 4BNXA 2Q1WA 4NMHA 5EPOA 2BF7A 1FDSA 3LC1O 3WIDA 3BHJA 4IQ8A 3TOZA 3CXRA 1DBVO 1YE3A 3GAZA 2NTJA 3H8VA 4DQXA 5IZCC 4NDNE 2ZB7A 3MJCA 3QW2A 3EYWA 3I9MA 4G81A 1E3JA 3ROPA 5C37A 3VH1A 1N9GB 3B70A 2R00A 4B8WA 4BV8A 4Q3DA 4BNTA 1IYZA 1NQTA 4UREA 1KC1A 1NWCA 5JLAA 2F1KA 2W2KB 3ZWOA 4MIEA 4I9NA 1E3EA 3EZYA 1G0NA 1XQ1A 4WLUA 1U3UA 4ZU3A 4IM7A 2W90A 4PG5A 1HKUA 4UAGA 4PVCA 2P5YA 2PKRA 4JBIA 4I5FA 1X13A 2NVUA 2QYSA 1T2AA 1YL6A 4L75A 2PZKA 1BMDA 2UAGA 3VHRA 2RBEA 2AMFA 1ZK1A 1PX0A 4TZTA 4AJ1A 5JFOA 4MVJE 1UH5A 4XJTA 1PSDA 3HZZA 2VCYA 4IJKA 4YJGB 1Z73A 1P0FA 5IXYA 1B2LA 1GADO 3V2GA 3L4BC 3WQRA 4DLBA 2R6JA 3HDQA 2HAEA 4GVLA 4C7JA 1SAYA 4NIMA 4BO6A 1R4MB 4HWKA 1YGYA 2AW5A 2CUKA 3PYMA 4MINA 4HUJA 4PFJA 3ANMA 3LT1A 2FZWA 4PZEA 4P22A 3RBVA 2WEKA 4BB6A 2ZB4A 4R4JA 2Y1OA 1E3IA 3BTOA 1HE5A 1ISIA 1K6XA 1M6HA 3D3WA 4ZD6A 3TDKA 2JCXA 5T5QA 1BDMA 3PFWO 5HM8A 4NZ9A 3O03A 1L7DA 3UAGA 3WMXA 3D3EA 3S55A 3QWAA 1IULA 2RAFA 2YV3A 3OH8A 2CDAA 2O48X 1GZ6A 1NASA 1N1GA 1PQPA 4OJNA 3W8FA 4H7PA 2P68A 3MTGA 3TL2A 5JC1A 4QO8A 1EQ2A 4PLZA 4UVDA 1E7SA 1NM5A 1QYCA 2PZJA 3EY4A 2X0IA 3OEWA 1KY4A 2HMUA 3WBBA 3ZI0A 4PGFA 5IDXA 1PJCA 1DEHA 4TRRA 2NNLD 5GMOA 2WTBA 3UN1A 2G1UA 4CQMB 3UGKA 3F4LA 2EGHA 3EAGA 4IZHA 1WP4A 3GZ4A 1N7HA 3Q3CA 1PR9A 3WDSA 1E1NA 1UXGA 4ND5A 2CVZA 2YHIA 1HDZA 3RJ5A 1YQGA 5KIAA 3LF2A 4NR0A 1KETA 4IDBA 1DJNA 2YUTA 1O89A 1ZJZA 3OSUA 5I8WA 3ZU2A 3EC7A 3RUHA 3U3XA 4A27A 3SBOA 2GR9A 3GVCA 1DC4A 1DFHA 3CEAA 3ORFA 4I08A 4NFSA 1H2BA 3ZNPA 3VH2A 4PLHA 5T6BA 1QYDA 4QX6A 3ONDA 3RD5A 3UOGA 3O26A 4A03A 2PD4A 4PLGA 4IMPA 4ZA2A 3A4VA 3P7MA 2DM6A 4L8VA 1EFLA 1PJBA 5J23A 3OP4A 4DMLA 2OL4A 1K6IA 4G2NA 5JE8A 4YYZA 4ND1A 3Q2IA 4EEZA 3RBXA 5FI3A 3TZ6A 4AICA 3PQDA 3WIEA 4ZN6A 1HE2A 2OGUA 1IHXA 1VKNA 4N5MA 2WDZA 1GV0A 5L40A 1LSUA 1YKFA 2B36A 2DUUA 1SOVA 2GN8A
chains in the Genus database with same CATH superfamily
4G86A 1F0KA 1WF3A 4X90A 3SS8A 5CDSA 2I7TA 5CFRA 5JSUA 3KLNA 6ADHA 2QTMA 4HB4A 5IDVA 3KDAA 5GZ6A 5MN6A 3LUJA 3PWSA 4GG1A 2Z09A 3SJ7A 2WB2A 4Z0PA 1PFYA 4ZOLA 5B1YA 4Q9HA 1K89A 2XOKD 4XVRA 4C4AA 1DKRA 3T0IA 5LN1A 2WVHA 5TQ0A 3GLVA 2MSWA 3E61A 3CN7A 3W1EA 3G9TA 2BTEA 1VRWA 2GD1O 5EJ7A 1Y8AA 2ZVPX 4UU7A 1RS0A 1D5WA 2JFQA 3AVQA 2ZAIA 3GP5A 2ZGVA 3NDJA 4M7PA 2ECKA 3G2HA 2JK0A 4IHAA 2YJTD 1XMSA 3AY6A 4Y1RA 3VZRA 1Y8QB 2PUAA 1L5QA 2B5VA 5AI6A 3T35A 3JQGB 2HJWA 3D4BA 1Z2DA 3TCKA 3WIBA 3V8NA 2BYTA 1IBKB 3RI3A 2ZVJA 1IN8A 1A2OA 1NQVA 2PRJA 2ENWA 2D5AA 3PFKA 4KWEA 2B4AA 5LOVB 4MV9A 5IANA 3R8FA 2XRZA 1KA9H 2GN2A 1ZR4A 3RUAA 5C7OO 2VYQA 3NNSA 1AXGA 3GMDA 2BGMA 2WWVD 3AL3A 1R0XA 5I7VA 5ESXA 4BVEA 1KO8A 5HZMA 1P2UA 1U0HC 1RIFA 1SB9A 1EH5A 3D3KA 3TXAA 1UBJS 2J3HA 1KIMA 3GLUA 5DM60 1JILA 1R0LA 4UEWA 5IAAA 4DR7B 4FFOA 5EJIA 3L07A 3QA9A 4R1UA 2X3YA 2HU5A 4FT4A 4C5AA 3LA6A 2PH7A 2XODA 5ALUA 1A8HA 1PN3A 2JGJA 4QGSA 3F9IA 4NJMB 2A9QA 2QK4A 3UWKA 1XL0A 4ENWA 4FM9A 3SZ3A 1U99A 2YFQA 5FO1A 4FSDA 3W6ZA 2PEZA 3KXDA 3SOPA 2FB9A 3I2GA 3G88A 3STVA 4H1TA 4D9NA 1GOTA 3VDQA 5BR4A 3TTUA 3X44A 3G0DA 4TS4A 4M1TA 2YKGA 1QGAA 3OX1A 3KEMA 1CJBA 2RH5A 1TUEA 4LJ7A 8ABPA 3GPIA 1I33A 2X9LA 2NXEA 3X1YA 3UMYA 1BOFA 4RW0A 4RJLA 4FW8A 4GNKA 1FFXA 1GTJ1 3P20A 5E38A 3SJCA 1UPCA 1P39A 5LNK1 2HQOA 2DUNA 2V8OA 1DBQA 3MCWA 4KQ2A 4ZMBA 1NAHA 3SQMA 2R8ZA 5F5LA 2A92A 1X2BA 1WXHA 1SK9A 1VE5A 1C30B 1WUIS 3BT7A 5DWQA 3TIFA 4LUCA 1CETA 3S2YA 4LXIA 5ALGA 5F1KA 3VVCA 1TC2A 3OTWA 1E6CA 1FP2A 3BRCA 2FWNA 3AI7A 4IZIA 4JFAA 1F8XA 4KSCA 4HWRA 4Q37A 3RV4A 3JRWA 1GUZA 2SBTA 4OQNA 4C7MA 1OBHA 2FMTA 3AVVA 1IZZA 3LUBA 1G42A 2PQ0A 2H16A 3NJ4A 4HEA6 3FTEA 1V7PC 4FTWA 4HAXA 3RVOA 2Z57A 2J9GA 2BZ0A 3JD2A 1JJIA 4PYIA 4Z8XA 5EKXA 2NX2A 3H0CA 1SCAA 3NBAA 1EDDA 1GSAA 4FI3C 2XUGA 1ZJWA 2E5LB 3OU6A 1SKUA 3G85A 2J1LA 3SHQA 1LF0A 1XQXA 4C2UA 4KGVA 3AR2A 3WGTA 2WRZA 3VSAA 2W6NA 1RJ9B 3W5IA 5G3ZA 3I6MA 2DZDA 3NVAA 4B6FA 3K32A 2XITA 4U6SA 3MOSA 4YO7A 2GPSA 1JXQA 4O4HB 1RQPA 1Y9DA 2ID9A 5TQ2A 3RSFA 1V25A 2C2HA 4L57A 1AC5A 1PWXA 3QITA 1HV8A 1T1EA 5EMLA 3QBEA 5DW3A 3QU2A 3T61A 1TCBA 2XCUA 2VS1A 1TO2E 3M6AA 5FJIA 1ULAA 1QO0A 3KAQA 4HQLA 5TJ9A 4NCBA 1R1DA 5GJBA 5F9FA 3BXPA 1U5AA 1XNGA 4MXDA 5KWSA 4DAOA 4EUSA 1UKCA 2ADMA 3H04A 3OUTA 1KI3A 4LE2A 1LPAB 1WDWB 2DFNA 2PKWA 5A3QA 4GBJA 4EZEA 3EA4A 1I5RA 4D3SA 4QYWA 4XDYA 3OQNA 1RADA 1U6KA 4J7CA 5CG1A 1W581 3JVVA 2CCKA 3U7IA 4ZHQB 5AICA 1S89A 2VJNA 5AKHA 3WKCA 4EA8A 4X85A 1MKYA 4GPAA 4MVJI 4ME6A 3COVA 5IKOA 2ZXUA 1XDSA 3COYA 3TXXA 2OYRA 4JUAA 2B1JA 2CUZA 4FCWA 4PYJA 4LY6A 4ARVA 4L78A 5AK6A 4WTOA 5REQB 2V3VA 5DM2A 1RM5A 4Z1MA 2VRCD 3OM8A 1MIOB 4CTNA 1F0NA 2WFMA 3TW8A 5JT1A 2RHHA 2NU6B 2P35A 4JBHA 5EIBD 2BKUA 2LXNA 2WSYB 3CVJA 1E5TA 2GLXA 4DSAA 3X2SA 3OJEA 3ET5A 4S1NA 3ZDDA 3H6GA 4TRMA 4Y7CA 4XEHA 5I9NA 2PIDA 4BC0A 3UWDA 3CLHA 4BFVA 2VQFB 3TCXB 5AM2A 1MIHA 3CZ9A 4N54A 2GRUA 3NDPA 5FB3A 5C0OE 3B5IA 4I3HA 3T9EA 4RTJA 2BT4A 1P3Y1 2UYHA 2ZYUX 3GUVA 1SXGA 4KLCA 2AUMA 3IAS1 1N77A 4O4LA 2FR8A 4P80A 4KR0A 2XX3A 2QI9F 5TT0A 4ZWNA 5EJ9A 3IVMA 4EFNA 4ED9A 3IQDB 2XLBA 3D4NA 3RW9A 4LOAA 3SKYA 1I4LD 4GOMD 4H6WA 1GTRA 5LLDA 1M34B 4D6PA 5KOJA 2E82A 4AZSA 1P8AA 5KB3A 4QVKA 3DB2A 2MWMA 3A58B 3MGKA 5J2UF 1KORA 1VMDA 2JLWA 1S3SA 2UUOA 4L8LA 1IY8A 3T41A 5DNUA 3ASZA 4BMSA 1HE4A 1NMEA 1AKYA 2HRCA 4UHKA 5ETJA 3EQ6A 3ZCSA 4YMTA 5FTLA 4W1PA 3C4QA 3V32A 4EB0A 2QR3A 1HNNA 3IO3A 3GGJA 1ZRHA 3O2JA 4YTEA 2XIJA 1TU3A 3O8OB 1F2UA 1E2JA 3JRNA 3PEUA 4V0LA 3WMWA 5BWCA 3PGXA 1W30A 2DPLA 3AKEA 3AVUA 4UNIA 2PX5A 4D0LB 1F2DA 1T0PA 2ZPTX 5BT9A 1CUUA 4UUPA 3HN6A 3NAGA 5GONB 4ZO9A 3UIEA 1HYQA 1L1QA 4B3HA 4PYMA 4EW6A 3HNPA 3N0XA 3UCEA 3UXHA 2BKXA 3EPLA 1S8AA 3OM1A 3E70C 2EFJA 2ZJ0A 3Q9NA 4P84A 2R8YA 1E0DA 3KAPA 5C4MA 3RSGA 3HLKA 3RFCA 1D2CA 1YQQA 2VRWA 3EEYA 1NQ5A 1LJUA 2F9MA 1H2ZA 2V97A 1Q1AA 2JI7A 2QRLA 5KYNA 3ER8A 4XX1A 6NULA 4BWFB 3PC4A 3AQ4A 4FJ1A 1V3QE 4L50A 3HTXA 1SURA 4U7TB 4I1OA 4WZBA 3DZDA 3WICA 5J47A 3IIKA 4GD3Q 4Z7QB 3A04A 3GFGA 4S1OA 3AKZA 4MWEA 5B36A 5J4LA 2BFDB 4R9UC 3EW9A 3L0OA 1YB5A 4XRGA 5JJBA 2FWBA 4NBRA 5F98A 1J07A 2ATXA 2C3YA 1XZCA 1UXOA 4DNQA 1NMXA 1NF3A 3TNJA 3VISA 4YDHB 3RVMA 4Z6KA 2AOWA 1E9FA 3GEMA 3H17A 1XA4A 3UMCA 3KPJA 3QEOA 3N8DA 1FTWA 4G0XA 4H27A 4BEVA 1E2UA 1H85A 5ELMA 1NJGA 2LKDA 3DDWA 1U0JA 5K3DA 2I8LA 2P3SA 3FIUA 4QEDA 4UBMA 4R01A 2J5XA 2MSLA 1AQIA 2QVYX 3Q0IA 1A5TA 2XXBA 1W4RA 1DVRA 4MAFA 2Y1CA 5CM2Z 3UB2A 1YUNA 2NO6A 1DQYA 1R9GA 4XZ3A 1XTIA 4ZQEA 3HU1A 3VZSA 2WI8A 4RF3A 3IBSA 2BFBB 2JHAA 1CVLA 3FZNA 3P9CA 3E5RA 1G18A 2HNKA 3U7QB 1ONBA 2HBZA 2H00A 1XVUA 2JATA 4YRLA 5ELXA 5A02A 4IGIA 4NXNB 1EP1B 4ACBA 4DB4A 4UQOA 3FOAA 5IYZF 3AONB 3X1MA 3ZHBA 5EJ5A 4KQXA 2MDTA 1QHHA 1G4UR 4DYVA 3N0RA 5BP7A 3KHKA 1TB4A 5LBTA 3RU2A 3QU5A 1PR1A 3CR3C 1Q57A 2LGJA 3P5SA 2C59A 1DIHA 5FBHA 3LL7A 3QI7A 4EECA 4W5OA 1S02A 3ZUGA 5A9SB 4LZWA 2IXBA 3K8ZA 3ZK7A 3URKA 1UDWA 4R6WA 4RIFA 2Z9DA 5IEBA 2PL9A 2ZDGA 1KIAA 1U8EA 1VIVA 3L8FA 1KDVA 1DG1G 1GGJA 1GU0A 1G1MA 1HLFA 1XL1A 2C29D 2P91A 2ZRLA 3I6IA 3L7CA 2ZSHA 3TVYA 1TJ5A 4CIVA 4HC4A 2ZZMA 1N0WA 2KJQA 3PD1A 1OFHA 3PDWA 1K2WA 3NTQA 4B3IA 1GRRA 1XF9A 5IMBA 4BCCA 3SC2B 3NTRA 4LF4B 3VAAA 2OK7A 2IVZA 2F3TA 2GJ4A 5I7SA 2YX1A 4BU1A 1WPRA 5HQJA 3WXBA 2P7HA 3IBCA 4WSOA 4DCOA 4YUXA 1L7QA 2GKSA 3OM9A 3ZDZB 2IUFA 4DW8A 3BMOA 1GPBA 2W70A 1L4NA 1FMLA 2V7BA 1JHVA 3ENNA 3H13A 3OQIA 1DOAA 2PUTA 1O95C 1GZVA 1FL9A 1SWVA 2ZE5A 3B20A 1MQAA 3ED5A 1G6Q1 1EUZA 2OCPA 5E2AA 3WAJA 3JS5A 1CCWA 2QLMA 1QDLB 1SNYA 2ZJBA 1EFUA 3FGPA 4NBVA 5NULA 3S6JA 3EEIA 3UJ7A 2UVPB 4DCJA 4F8JA 1Q2UA 4I6EA 3QVJA 3TBFA 5I47A 5FLXA 4LFBB 5C4IA 2WBLC 1RCUA 2PKYX 3TSCA 4C1BA 4F60A 1Z0AA 2P62A 4FSXA 1SUPA 1T3LA 3PICA 4I55B 5EPEA 3LYAA 4AMGA 4UAVA 4PZPA 4Q0MA 3DOHA 2GDJA 1GP2A 1E2FA 1PR0A 4J6FA 2WPDA 2ZRPA 3IOBA 1FS4A 5LU9A 2HCRA 2HA2A 1I2BA 3ZD8A 2ZAOA 1D9ZA 3Q0TA 4FOPA 4JXJA 5LSAA 2BI4A 3LHFA 4B0PA 4URFA 2H11A 4KE8A 5CURA 5CLIA 4FFSA 5K3BA 1FX1A 2FN3A 2PSDA 3K92A 5ALNA 2AKAB 1L7VC 4KPGA 3HR4A 3W2HA 1TAUA 3OT4A 4TOIA 3A3PA 3T95A 2OZLA 3U16A 4C2BA 1Z6YA 2A6PA 4PC2A 1MENA 1U0BB 4BP1A 5C34B 2JCBA 3RS7A 3UA4A 4TMXA 1NUHA 2FXVA 2XDWA 4G0QA 1K98A 1QFZA 5CB0A 3KQMA 2IPOA 2Q4DA 4MPTA 3H3JA 2XTNA 1F1JA 4UHCA 1W8DA 2VCEA 5F2OA 2KBFA 1NP6A 3RE1A 1BN6A 2CN1A 3LQRA 1FYXA 4E14A 2C9MA 4F3KA 2ZSEA 2Q9UA 3A25A 4PG8A 3H87A 3QIAA 3E9ZA 3ZXYA 2JVJA 2R2GA 4BLVA 1Y6JA 2ORYA 4J49A 1FRZA 1XJQA 1E2GA 4EBFA 4EYQA 3AOEA 1LBEA 1LVGA 2D0IA 1UJ5A 4MGHA 2G9VA 1JU9A 3CBGA 3UANA 4OOEA 5KTYA 2HU7A 3IQFA 3KIPA 4ZTBA 4ARSA 2X0RA 1K8YB 2IYTA 3BTVA 4LS3A 4ER6A 2XNDA 4RH0A 1CQJA 3ENQA 1T9DA 4KW7A 1CDZA 1LLDA 4N48A 3I09A 1E2NA 1JIVA 3DOOA 4N12A 2WT4A 1UXHA 3OJOA 4F9TA 1H3EA 5K5EA 1JVSA 4ARZA 1NTOA 4MV1A 3NAZA 4XLTA 4MYDA 5TMBA 3O3OB 1Z7GA 1V47A 2E6KA 3D02A 1EJ6A 1O9HA 1V39A 3AKCA 3OWXA 3ZTYA 4JCCA 4YC7A 3WOHA 5IYZB 1EFKA 1NNI1 3CEJA 3H5VA 1IM2A 3EVCA 3H1PA 4PTZA 1GAXA 1L1FA 5FPYA 4FMCB 3F3MA 1ITZA 1IEVA 1JU4A 1Y1LA 2PA0A 2VT3A 3FMFA 4LZAA 4U7WA 3WYNA 1HDCA 1GKUB 2BVNA 3RT9A 3ZU4A 2CJFA 4ETMA 1WBBA 2O2DA 3TQHA 4UQLA 1L7MA 2VJAA 3GWGA 2IYXA 3MD0A 1YIAA 2ETXA 3PA6A 5T6MA 5B3JA 4GZLA 4ZREA 2GCEA 1MF7A 4CLXA 3NOQA 5EUBA 4YROA 1J97A 3HM9A 2G06A 3B1WA 1LPPA 4XCQA 1VLHA 4MUNA 4PR3A 3HCFA 3EF3A 5HZHA 3P32A 4QUKA 2FA9A 2DRIA 4K9MA 4NOLA 1K3TA 4U9HS 2RGNC 3WC4A 3AETB 3RTAA 1KZGB 4HQKA 2ZVQX 4PEVA 5KSYA 1NUQA 4R5MA 4EY5A 2MR6A 5DWVA 4IVPA 4XTCS 5BPHA 3AFMA 1RQNA 4FQ7A 4XSVA 4GBGA 1GSIA 4L1KA 3OFND 4UTPA 5I01A 5KTSA 3D2BA 2ISCA 3WISA 2IHJA 3MWEB 3NGMA 1E3LA 2ADOA 2V5UA 4P35A 4R1TA 4CM4A 4DSTA 4DLAA 4Z54A 1UINA 4NOJA 4DV5B 1DAFA 4JX9A 2CV1A 5KQRA 4XQ0A 1CRLA 4HCJA 4N40A 4P38A 4P53A 4PZLA 4CMBA 5KTMA 3TUZC 2IEIA 3LCJA 3QVSA 3L41A 2E4XA 4JFRA 2FP4A 1SA0B 1LU9A 5E6UA 2A1TR 1T43A 2X7JA 2EP7A 1S8FA 1UBOS 3G7NA 1O96A 4PCLA 5CXXA 2DHEA 1PFGA 1PJ3A 5AK0A 4G89A 4E4TA 3PXDA 2P9GA 1MGPA 4ZVTA 4YT4A 2FGKA 1T5DX 3HFGA 3AIOA 4HFJA 3RPEA 3DUFA 1GKYA 1GUYA 1P74A 4OV6B 1X15A 2P2LA 3ND7A 5CH8A 5JROA 4B3GA 4JJGA 5B64A 3DJYA 1BQEA 1W36C 1HFEL 1YC5A 1G41A 2FWAA 1ZKMA 2OB1A 2QM3A 2Z8XA 3DAGA 4WKOA 4B8ZA 5JNUA 5KPJA 1KRWA 2EZ4A 1QE0A 1T2NA 3DP7A 4B3TB 1P60A 1UKYA 2OBMA 1OVMA 2J5KA 4EHNA 2OGWA 4XYGA 3MUEA 1Z45A 4PANA 1IDOA 5FOTA 4JWKA 3W05A 4B46A 4C06A 4F4FA 1JT2A 2D62A 2QGZA 3KB1A 3MFYA 4X71A 7ADHA 5JANA 2GTHA 1OVGA 4WZ6A 3N6VA 4R8MA 2PYZA 5BSEA 3EPKA 3BF7A 5DLDA 3OMWA 2HA4A 4F91B 1CZNA 2W9XA 3AJAA 2ZUEA 4XIFA 4RD2A 1ANKA 4TLEA 2BM8A 4BNUA 4F9FA 5KTRA 4WY5A 1Z37A 1QO9A 4WVFA 3ZE0B 1E8MA 1FFSA 5JWOA 5J43A 2HCJB 2VLBA 3TJMA 1R4ZA 1ULBA 4CHTA 1RKBA 4EPVA 4TLDA 2JG3A 2ZSKA 1UF9A 3CX4A 4C4YA 5C8YF 3KQHA 3LPMA 1OXTA 1OF1A 5DT2A 4CHGA 4DLZA 3HRKA 3QKSB 1VCNA 2W2LA 4URUR 3ZR4B 5AJYA 1NMZA 1ZN2A 4HLNA 3QJYA 4OFWA 2WJ3A 3SU8A 4GAEA 3U3DA 1UZAA 1FNSA 2WVJA 2J9XB 3IOEA 2DF8A 1ABEA 4D79A 2P9QA 3QHQA 1DMRA 4BJHB 4PPYA 3CX6A 4FCCA 1EUCB 2XUOA 3K9WA 4N82A 4X8OA 1IE3A 1QE5A 4QAJA 2X5JO 1DB3A 2OGZA 2F3UA 4KSBA 2PPVA 2C95A 3QKTA 1U0NA 3C1OA 4CQNA 3E8XA 5D2CA 3SOZA 3YASA 5GP1A 3NEPX 3L4EA 2NTEA 5JDIC 4EA6A 1VL8A 2CJWA 3AI1A 4O4JF 5EGNA 4KBGA 4EGAA 1JFFA 4HEJA 5KSPA 5A2QA 2HPAA 5BWMA 2B5WA 1UBLS 4GZ5A 5EIOA 5EZYB 3ISVA 3D6MA 2OHXA 1JQJC 3JRXA 3M6MD 4IQ4A 4CMKA 1J33A 3P2MA 4KLNA 3E23A 4XE5A 1GFWA 2GPNA 3QOYA 3UK0A 3WWZA 1NRIA 4OSPA 4CL2A 3QYAA 1HC7A 5FNVB 5JAZA 2AC4A 1BH2A 2ZUWA 3KB2A 2TMGA 2B1RA 4M2LA 2IF2A 2H4ZA 1ESMA 4DMUB 4N8EA 1KAOA 3HVKA 2A84A 3NGLA 4JX8A 1DFIA 1GAQA 1YAJA 4OEHA 4MYUA 5EE1A 2RIPA 4EYSA 3NT2A 5KVCA 3JQPA 3HDJA 1T3TA 5CLJA 5MF6A 1IXRC 1JDJA 1NF8A 2CMKA 1T6NA 2CNNA 3SX4A 3MZ0A 1CS4C 3RJMA 1ZS9A 1HPLA 1I1OA 5AUQA 2J31A 5FLYA 1SXJD 2DFDA 1OB2A 4NCNA 1P72A 4CN9A 1CIJA 1FJHA 1GL7A 1KSFX 3EZ7A 1ORVA 2BHTA 2QX4A 4HPJB 3UT0A 3C70A 4D9CA 5LD2B 1OBFO 1Q50A 3A6GA 1GFZA 1C1DA 2Z2YA 3PCXA 4BRZA 1P44A 2PK3A 5KINB 1W7AA 2O19A 2IH4A 2C4UA 1JDPA 3GEBA 4QWMA 4XOUA 4W7IA 5L3RA 3NVDA 3RC7A 2E7ZA 1Z5NA 1IM5A 4FB4A 1EFDN 1MOPA 5DHSA 4AI6A 4Q1EA 4ZEMA 3Q9LA 3K0SA 1MX9A 4ZVUA 1NPYA 4M83A 3JU3A 1M2OA 2VP5A 1M34E 3GQBB 2BSXA 4HNRA 3G5UA 5INTA 2X8JB 2JNWA 1EGAA 5DNWA 5KEIA 5CJ2A 1B74A 4BEBA 2NUPA 1Z4JA 2R1TA 3OQVA 2R8RA 4LRUA 4Y67A 5T67A 3DQQA 3OLYA 1T8UA 1OT5A 1DOHA 3C6KA 4ROTA 3KR9A 3R5FA 3UAYA 4BMCA 1YFJA 2VJMB 1WXXA 5B58T 2IYNA 3L8HA 3CUTA 3UMBA 4E31A 2W2XA 4CM9A 2GF0A 2XECA 3OOWA 2FW0A 2L17A 3BREA 3JWHA 5DE3A 3PL1A 3LX5A 5IN5A 2IEBA 3OOSA 3L8YA 4BMXA 5JBNA 1LPMA 4JXKA 4JUCA 4LGYA 5CA1B 4PZYA 4UXIA 1JTEA 3L0CA 2OYSA 1QONA 1U6JA 4Y18A 2AEJA 4I1UA 1JPVA 5CRIA 1KC3A 4QOEA 1KP3A 3ZI7A 2DE0X 2GHTA 4BVKA 4L2IA 4BQNA 1UOEA 4L8WB 4EGSA 16PKA 1JRLA 2UYYA 1OJLA 3KEQA 4XDHA 4ISBA 3EK2A 5D7BA 3I05A 2QL9A 3G17A 2A9PA 4LQLA 4N0QA 2N9UA 2ZG6A 3RJZA 3P1JA 2OA0A 1O94A 4B7AA 3A6FA 1KJ8A 4W6QA 1GZ4A 5TQVA 2QE7A 3FRHA 4WW0A 1ABFA 4C01A 2JAUA 2XVZA 1E3QA 4A0SA 3HBJA 3O2SB 3O9ZA 3GZNB 4KX5A 3CS3A 4DXDA 1LDYA 5JC8A 3A3KA 2C3UA 4HDKA 1H3FA 1G98A 3QVKA 5BWNA 1BVHA 4C0XA 3TNDA 1MOQA 4JEUA 1BA2A 2E1RA 5H9VA 1JQBA 3SYMA 1S5PA 1C1XB 4EKDA 1SCIA 1SBTA 3CY6A 1Y1PA 5DXFA 1G20B 3UW3A 3GJQA 2RSLA 4O4HF 2WAMA 3DMRA 3H3FA 3CNHA 4UUNA 3BFJA 2ZYTX 4FN4A 1U6IA 5FWXA 4DJTA 2IPXA 4LC1A 4Y6RA 2TMDA 3COJA 3IP7A 4J07A 1RXCA 2JLAA 2RHWA 1BS1A 2O3TA 2NZWA 3C3MA 2B82A 3G2KA 3NKLA 2IPNA 2W2PA 2BMVA 2BGTA 4HTFB 4M87A 3BULA 2LUOA 1BXRA 4G0UA 3KL2A 1T6XA 1Z6XA 4OHBA 4R5HA 4R16A 3N2NA 1AT1A 2AYYA 4O63O 4S1VA 3EVEA 1PS9A 1KBOA 3LP8A 3M6XA 3WLFA 1BU8A 2V55B 4MPDA 3QFHA 2C58A 2G71A 4OL0A 4E3ZA 3PSHA 1NQWA 1T26A 1EZ4A 3DMFA 4XM1A 3L04A 4C1NA 3BDAA 3PITA 3MLBA 3VVMA 3BRQA 4Z0TA 3I04A 1RD4A 4X24A 3JD1A 3HB5X 2SKEA 4B48A 1SUCA 3WOVA 2F64A 4RVDA 1X1SA 3K9HA 2WJYA 2POQX 2Y8EA 3SFZA 1C1HA 1QTIA 3NEJA 4M3NA 4D98A 2UU9B 2X0DA 1CHDA 1ESNA 1QFYA 1SQGA 1X1EA 4IRXA 4NV1A 4U7JA 4XQCA 5JYDA 1A77A 2AX4A 5KYUB 1DG3A 1X7ZB 3FGNA 1QIMA 3EJ6A 1B8PA 1H6CA 4PC7A 5CNIA 5JFTA 1F0PA 3DDZX 4Q3AA 4DWVA 3KSAC 3PFCA 2G5TA 3OC0A 3BB3A 1F8FA 2MYTA 3LUGA 4FOOA 3GRFA 4HYYA 3V4RA 2AB0A 3UNXA 5EVJA 1ADGA 4H3SA 3LKDA 3X0DA 1XEXB 3IR5A 4B47A 4H31A 4P9NA 5H1YA 3V1KA 2CT8A 1IJFA 4QU9A 4MR7A 2ETVA 1XZBA 1NI5A 2D2XA 1NBEA 3ILXA 4PZ9A 1J20A 4TWBA 5LR6A 3KB8A 1H2WA 2JKYA 4XGKA 1WCIB 1GAWA 4TPKA 4X3PA 3I42A 3JV7A 4L51A 1JQDA 4MI6A 3R8CA 4Q1AA 2Q6LA 4M1WA 3FFBA 4NKRA 4I0WB 4JT9A 1Y34E 2VPXA 4NCHA 1N9GA 1ORDA 1Y89A 2B1IA 4G3XA 4U2KA 3EE6A 5B1DA 1PT7A 4PAQA 3S7TA 4EQ6B 4WIAA 4PLPA 3A6PC 1X1AA 1M66A 4BB5A 2W2KA 4I9UA 1Z7YA 2ZJ5A 4M1ZA 1KEPA 3PUHA 1J0DA 4WLNA 4FHFA 4MVJM 2FE4A 2KS6A 2YWRA 2D4AA 3CZMA 3ZDXB 5BR1A 1A69A 1WJGA 1PSWA 1I5EA 5IM5A 3HKEA 2QQFA 1ZD1A 2GCGA 2SCUA 2C84A 1ZNXA 2ACKA 2P4EA 3QFRA 4G07A 4KHPB 1E69A 1ZIXA 4ISCA 1ZCAA 3SBEA 1AD2A 4YRQA 4DLXA 1FYWA 4MYHA 1HG1A 4NAVA 1RW4A 1ZUD1 4GM4A 2AUTA 4J43A 2EKPA 2OXRA 5E6RB 3O3NB 3O4IA 4M0LA 1WZEA 2GILA 5F52A 2NPFA 3G0HA 2ZQYA 4XJVA 4IEFB 1STOA 2RGBA 4M9RA 4MUFA 4QO7A 1I1NA 5E4TA 3TLBA 4EEKA 1IH8A 3UXEA 1XVIA 3QF7A 4KI0A 1G3QA 3GGGA 4IRUB 3LBNA 4RYLA 3AERB 1G8MA 4A4DA 2AEEA 1DI0A 2MIIA 4A8HA 1X8XA 1C4WA 1VE9A 1XTJA 3INRA 3ZNOA 3INTA 4OKNA 3U0BA 3W6OA 2UYGA 3WGNA 5K45A 1TCAA 6REQA 2D2FA 3NNDA 4U2CA 3HO8A 1QGUB 1W73A 2CDCA 4HGNA 3V55A 1K5DA 2GN9A 2YBDA 4R8SA 3RSOA 3MWJA 4JLWA 1WB5A 2A9JA 3KXPA 2F00A 2PBZA 1AHHA 3H16A 1UAAA 1Z13A 3DWGA 1LK0A 5TGZA 3F71A 2Q5JA 3EGEA 5AR1A 1E99A 3HMKA 2V54A 5EZ5A 3RTEA 3P9ZA 3JYPA 4B4KA 1BDJA 1OZFA 3FNGA 3FOBA 2WM2A 3LUDA 3D0RA 4MZDA 3IVAA 1QZZA 1MV8A 3CF0A 4MKXA 5HA5A 4W9RA 1IBRA 4B3RB 3GOHA 2WYWA 2C42A 4JOSA 2AOUB 10MHA 3LT4A 1I0IA 1KK1A 2YY5A 2UYQA 3FMPB 3G8YA 4TV8B 3LQ2A 5FL7A 4CV3A 1LEHA 4YXFA 3EBPA 3LQFA 1WS6A 2GEJA 4RKRA 2ZRDA 1DKLA 3WLQA 2XUFA 4YIKA 3CG4A 5CFNA 5E6SB 3KQOA 3TOSA 1DDIA 1GYQA 1B1CA 1RI2A 2MINA 3WMRA 4AZVA 5IVDA 1R0BA 1JA9A 2BW0A 4BX2A 3HY4A 2XDQB 2PZGA 2HDHA 1DKPA 4PY2A 3EXEB 3EIXA 4OHXA 1H3NA 4Z3KA 1A1VA 4BNJA 2V9PA 2QYTA 1ZNZA 1W2WB 3BXFA 3KUXA 1II9A 5LZ7A 4B85A 4Y6PA 5AVQA 1BO6A 2ZDHA 4FR0A 3RIYA 1Z28A 1LVHA 5K9ZA 3THXA 1MXHA 3FVVA 1LDBA 3BOSA 1UM9B 3HJAA 1WULS 3JVEA 2B7CA 3LL4A 1QQTA 2B83A 5DTEA 5EE5B 2RGRA 3EARA 3TTWA 3RIEA 4LZPA 4TLAA 4AFNA 3KL4A 3A10A 4RPGA 4DM4A 3FWZA 5C8ZA 2E3JA 3NAQA 3A06A 3IMCA 5ALEA 1JIXA 3AHJA 1J49A 3SEFA 3MHTA 2IYLD 1LC0A 3JSXA 3KEOA 1TECE 4PIVA 1PR3A 4IEEA 2OOKA 3I0ZA 3SXJA 3K6SA 4QT4A 2ZIVB 2YW2A 1QHFA 1NI4B 1KMHA 1N57A 3EA5A 1THGA 4LJAA 3BWCA 2BGJA 3VKWA 4LNAA 4EWLA 3WNZA 4J1TA 1CJKC 5KSWB 2H31A 2ZJYA 1AKRA 4BU0A 2F17A 4ZAWA 4EO9A 1Y42X 3PQCA 1LRLA 3HR8A 4UUBA 4D2IA 3THWA 3AC0A 4ZOLF 2WUVA 1C81A 4QYIA 3WTBA 3PEYA 4IJVA 3I5YA 1F4LA 4N0DA 5AI9A 3LBFA 2VQDA 3ETDA 3EUAA 4IIGA 2PHZA 5HIAA 1MAWA 2ZU6A 3T0GA 2O2GA 4FHDA 5JXJA 2QRQA 2PSSA 5CB4B 4Q3EA 1Z63A 4KI7A 4NESA 2PZ8A 3O8DA 5JG7A 3AHCA 4E5NA 4CIYA 3DBRA 1S1CA 3QKWA 5JO0A 1GSOA 4P4NA 4RXMA 4C6TB 4KIJA 2C4HA 1QRTA 5J5CA 3JQ7B 2G5PA 2I7VA 1M5UA 5KSZA 4IHJB 1AB6A 3BD6A 1IXKA 4G9GA 2LE0A 4TTAA 2DSTA 2IHNA 4CG0A 4YA6A 1YFZA 4H3VA 1CR2A 1KAMA 3C5WP 4WY2A 4MHSA 2P4QA 4FLFA 1HZZA 1LSJA 2XF8A 3A3NA 4YRSA 1B41A 1CEEA 4QBFA 3F4BA 3DOUA 1LS6A 3ONWA 5B7PA 1Z2NX 1ZI9A 821PA 1B26A 3BRWA 1LX6A 5F2EA 4S2EA 1HYHA 1VBNA 2NSDA 3VJLA 1KAGA 2DQSA 3F7TA 4HBGA 6PFKA 4CTMA 4RJKA 3NRBA 1J0BA 1E1CB 1K92A 1TQHA 1DZ3A 2Z95A 4HS9A 4XLLA 2WHEA 3OHPA 2OLJA 1F2VA 1PWEA 4UUAA 4XQEA 3X1ZA 4TMVA 5BURA 1ODJA 5AUOB 4Q7QA 3GDHA 4D96A 4YRGA 1AKMA 1UEIA 2VR1A 5HYVA 5LMNB 1B93A 4JT2A 4XKJA 3ITDA 3G6KA 2OFFA 2H1HA 1EWQA 1A5ZA 2QRNA 4Z51A 1FFHA 1Q5PA 1Q6YA 2BD0A 2ODAA 4HPXB 3KAJA 1QX3A 2PSHA 4TYYA 3WIUA 2X2FA 3K1JA 2I6TA 2O5EA 3F7OA 3I9NA 4L0QA 4LBVA 1J9ZA 1HFKA 1K9VF 4U5QA 1GV1A 1K7YA 1YQUA 1Y6GA 3RBZA 3BPSA 3D54D 3FG9A 2LVBA 4BKPA 3M81A 1KVTA 2ZRFA 4UM9B 5FAKA 2ZIFA 5AK3A 4D9KA 1OB5A 2W43A 5ED4A 1NLYA 2G80A 4MKRA 5EP2A 3ZK9A 4EAQA 5K0FA 1KI6B 5B30A 3BH0A 2AD5A 2H0RA 4TL6A 1D2EA 1DJOA 2J46A 3B3JA 1LFAA 1B8UA 1GQ2A 4XUGB 3K0BA 4Q66C 1BKSB 4IJMA 4FLEA 4OIFA 1E3WB 1KEUA 1PLJA 2JJ8A 1F9EA 2EKQA 2Z1DA 1N0IA 3L9XA 4JS0A 4V0NA 7REQB 2QTAA 3TE6A 1BGWA 1FLVA 1H1LB 1TJ3A 2MSEB 4MPRA 4D3XA 2AH5A 3S7ZA 1GTVA 2GBCA 2HIGA 3ZV5A 4CG3A 1U2GC 2O7SA 4O2AF 3BFPA 1CD5A 1VJ0A 3H7AA 1ZDMA 4JA0A 3DCYA 4X20B 3KSRA 4XSGA 5C1IA 2UYOA 2F9LA 1I6WA 3HSYA 3FTFA 5C8VA 1HR0B 3ZTWA 2PGLA 3M3PA 1TI7A 2JZNA 4RSRA 3ZD7A 3TGLA 5TY0A 4YHHB 4JVOA 1NAIA 3G5AA 1C0EA 3E27A 3JAKB 4I3GA 4ZV4A 4U63A 2IY9A 1GM5A 3L2OB 1M2HA 1XFDA 2WABA 2AOXA 1B3BA 1LDGA 4TSFA 3IOYA 5HFJA 2GXQA 4LJ4A 1QQ5A 4G09A 4NBKA 4DMCA 3IDOA 3DBOB 1NDUA 1ENZA 1Q1BA 1TD9A 2RBGA 1ZGAA 3H9GA 4GOKA 4RCYA 4WXYB 2P9HA 1XPOA 1B6GA 3KKQA 3OURA 4QULA 3QOFA 4V39A 1Z07A 3EH1A 3NPAA 1G66A 3G2MA 1Y7LA 4PX2A 2CXSA 3RVBA 1EP3B 4R0VA 3IPYA 2WSBA 1O0BA 2GK3A 2ZR0A 4OUDB 4F7DA 1H5QA 3PDIA 5TS3A 1UWVA 2WHQA 3LDFA 4LGCA 5I9BA 4HDNB 4ENTA 2VTKA 5A4AA 4WNAB 2PIAA 3EMDA 5GVRA 3D0QA 2X8BA 1K6EA 3K4QA 1IEXA 2WHXA 3FMGA 4A8JB 6Q21A 4QREA 3V8MA 1A98A 3AEKB 1XWFA 1CY7A 1G3UA 2ZWVA 1A96A 3V7YA 2DGDA 3PYXA 2XUPA 5KJFA 3NBMA 4B09A 1RRVA 1T4CA 5TR9A 3C6MA 4MB0A 3P2KA 2ZQ5A 5JFOA 3TMKA 4MX8A 3ILHA 3TZCA 3JTEA 3D31A 1SBQA 3M7IA 4MR9B 4WWHA 1U9ZA 2Q2QA 2XCLA 2ZBDA 3NT4A 4R1OA 5DHRA 4MP6A 3UWSA 1RAGA 2EWMA 2XA9A 3O6VA 4LYDA 5AJUA 4ZVKA 1DEOA 4LRQA 4MDEA 3A4LA 3GJRA 1GT91 2YYAA 1E6EA 1V7CA 1ZNYA 2RJOA 1W88A 3KPUA 1VA4A 5AW5A 1YF3A 2XB2A 5CK5A 5SZHB 2QNBA 4Q4JA 4X8HA 1ISHA 3CRMA 3OZEA 2EEZA 3NWJA 4PSVA 3UUEA 2GX6A 4OB6A 5CXUA 2C2GA 3Q10A 4K87A 1W0KA 2QLNA 4DA9A 3NAMA 4PRZA 3Q6MA 4JJ6A 3GU3A 5CJPA 4Z4CA 1P6XA 3NASA 3GT7A 1O57A 2WYOA 1NXTA 4YP7A 3ZY4A 3KZMA 1OXKB 4AZ3A 2R48A 4BV3A 2UXDB 3RKUA 1L5OA 4RTMA 3CN9A 2GBFA 3DB1A 2IZZA 4G0MA 1L5HA 4O4LF 2RHCA 4HAWA 3S40A 2PM8A 1J2EA 4ZO8A 4C2AA 1KMIY 2AI1A 3DDCA 4LPKA 5KZMB 3I2IA 1TT5B 2V6GA 2Q0XA 4ZEVA 3QIVA 5AM4A 3KOOA 3VZQA 1MNQA 3LVQE 1T9CA 4RMNA 4U2EA 5JSZA 2B69A 1X7YB 4L4YA 5AJTA 4GIBA 1A7UA 2QD3A 2CWWA 2CCJA 3DVRX 3K7EA 3W9UA 1N1DA 1NJ6A 1SUBA 2CXQA 4RSHA 4RHEA 5EZYF 3N53A 1GPJA 4X1IB 1GEGA 4WXHA 2BMFA 2R86A 3REGA 1S7CA 1MC1A 2UZ0A 3F5FA 3ZCTA 5HTKA 2CLMB 2F3SA 1DC5A 3ZWPA 1V1JA 4Z4QA 1DUSA 4KXVA 3WTCA 4B2IA 1J5EB 3RYIB 2O1EA 4E7PA 1QYWA 4P3KA 4R1NA 2V0NA 1DIBA 4GZ6A 2HRZA 4XYEA 3TNFA 1FK8A 3CZRA 1OHHA 3OFJA 5LPNA 1N92A 3QSGA 3NWPA 5AVJA 1RVDA 4LHZA 3MD9A 3C3XA 3CC8A 3FXAA 5IUKC 5FYQA 5JZVA 4LY0A 2Q27A 1YO6A 1GR0A 2OORC 2BHSA 2GM3A 1D6NA 1CY1A 2VP4A 3MM4A 4K6MA 4BE4A 4RMGA 3T38A 3VVBA 4ADSG 5ENVA 1ACMA 3UK2A 1IY9A 3H1TA 1E2IA 3VR1A 2EG9A 3FDXA 4MTCA 1WF6A 5FHQA 5EHZA 3RJ9A 2P3LA 4GM1A 1JEJA 3BHIA 3RR2A 5I6DA 1TUBA 3C39A 1DIRA 2VPWA 2YC4C 4TROA 3T4UA 4HNTA 2Y4NA 3O0DA 5B1SA 5I7EA 1HDRA 4DMFA 3T7DA 1FYDA 1FQKA 3DZHA 4EVIA 5DULA 3E1GA 1BJKA 1N32B 1CUXA 4OK6A 1Z7WA 5KUTA 3DC7A 3EUFA 2N46A 4IBOA 3VHQA 1IN4A 2F2TA 2FFAA 1BS2A 4F2DA 2CWDA 3KVRA 1KBZA 4X66B 4O29A 4UHBA 5J5AA 4JT8A 2QDKA 1QVZA 2ST1A 3BXHA 3G9QA 4TV9A 3RJTA 4DCSA 1T3HA 4DQDA 5JAUA 1V71A 4NYIR 3ANYB 3L9WA 4ZCSA 4Q48A 3EFBA 3N2GB 2ZZNA 3NATA 4B45A 1SXIA 3OE7A 4QQ8A 1CP2A 1SVOA 2XNJA 3ABQB 4RY2A 4TT3D 2DERA 4WMLA 2H5IA 2BHLA 2A58A 1IOZA 2Q0SA 2ORIA 3PBKA 2OXTA 2ZCVA 3PRHA 3NH6A 4DRXB 2AOTB 4TXNA 3RT7A 3F7MA 3FPAA 1UPBA 1NIJA 5A05A 1NATA 3U4GA 5MDHA 3L8CA 3UGQA 1A8IA 5BR8B 3QBVA 1LNQA 2P40A 4D81A 2D3WA 2JI9A 3QQ5A 4M1MA 1G8AA 2FETA 3EPRA 1RQLA 1VLJA 3BZBA 3DHYA 5A4MS 1NGSA 3JYQA 2C5HA 5L3VA 4YCMA 5JSQA 3B7WA 1GCGA 2RBKA 4MW9A 1CB7A 3TO5A 1M8FA 3C74A