4CM4A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
250
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 94
structure length 250
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm4A00
3K31A 4EJMA 4YDRA 1AHHA 4ALMA 3CIFA 3IP1A 4D3DA 2Z1NA 5JC1A 5BQFA 3RC7A 1P1IA 1WMBA 5CDGA 4CV3A 4J1SA 1BDBA 1JU9A 2R2GA 5IDYA 5TF4A 4YB8A 4B4WA 1CQIA 2Q46A 3KTDA 3SJUA 3L4BA 5LCXA 5A1TA 1BG6A 1HF3A 1I36A 2FSSA 1GUYA 3I9OA 3ON5A 4G81A 4TVOA 5DOVA 4B3JA 3ANNA 5CHEA 1BWSA 3X2FA 3NDIA 4QO7A 2UUPA 1P0CA 4BV9A 1KEPA 2E37A 3RUAA 2VT2A 1PZEA 1FJHA 4JROA 4CLHA 3TDKA 3FNGA 1ARZA 2NUAA 3QE3A 1JKIA 4CM6A 3WMXA 3IQDB 1P0FA 4NU5A 2H5LA 1O9BA 2JCXA 1M2WA 4BNIA 2JD1A 2O48X 3WJAA 5KJCA 5GY7A 3E03A 3KOUA 1X1EA 4IJKA 4U8GA 1Y1PA 3F47A 3WGHA 5JS6A 4U6SA 4DWVA 3BMNB 3PGJA 5CDSA 3NV9A 1NAIA 5TNXA 1WVGA 2GD1O 2YDXA 4DC1A 4DYVA 4KMSA 4XIYA 1E7QA 1F8GA 4RF2A 1HLDA 5EJ2A 1Q7CA 4GAEA 4KP7A 2EHDA 4E6PA 4RVGA 1DJNA 1CEQA 1KETA 2D2IA 2YHIB 1J0XO 3DQPA 1UXIA 1IY8A 3UN1A 2GZ2A 3JQDA 3GHHA 1VE9A 3DZFA 3PLNA 4PVDA 3B1FA 1HYEA 4R51A 3TPCA 4DBVO 4XQEA 3I9NA 3V2GA 1U5CA 4GI2A 4ITUA 3RFTA 5F5NA 3LC7O 3KYCB 4RPLA 4BV8A 4NMHA 1BHSA 5AXCA 2HLPA 1XG5A 2AEJA 1N1EA 4CQMD 4FGSA 1JVBA 1ONNA 1GUFA 4XZ3A 3M1LA 2X4GA 4CQMB 4XGKA 3DAFA 1EUDA 2QYSA 3KETA 3JQ8B 3WYCA 1PZHA 3INGA 1NQAO 3HN7A 4ND3A 4XR4A 4CM4B 3JQAA 4AVYA 3DMTA 4DBZA 3DO5A 4BQPA 3D5QA 1Z6ZA 3PDJA 5DBFA 4D7AA 1ML3A 2YUTA 2AEMA 2C59A 3LZ6A 4GMGA 3AUSA 4G65A 1PTJA 3O9ZA 2BD0A 5T8KC 1Y5RA 3L07A 2HRBA 3TZCA 1ZEJA 3N7UA 2HSDA 3H65A 1C1XA 1CQJA 3C7CB 4UVDA 4LW8A 4E31A 2Q99A 3C3XA 4FGWA 3RU7A 5C37A 1IPFA 1QP8A 3LT0A 1E3WB 4WECA 1HETA 1Y6JA 2AMFA 4YRAA 1GYRA 3AUUA 5KVQA 2HDHA 3BHIA 4YT4A 1U5AA 3G17A 1HXHA 1ID1A 4OQYA 4EW6A 3PWSA 4PZDA 1R6DA 1JAYA 3F6YA 4YJGA 1P1HA 1H9BA 2FWMX 4RVDA 2AA3A 5H81A 1XHLA 3ENKA 2EKQA 3GLQA 3QIVA 4HFNA 4UVIA 5EN4A 4IPTA 1QG6A 1T2DA 5L40A 3GMDA 1BSVA 2Y1DA 1T4DA 2BF7A 3FNHA 3GK3A 4MVJF 1YL5A 3P7MA 1P1JA 4IQ0A 1NXQA 3H9QA 5JMWA 1LX6A 1A4IA 1PJSA 4CV0A 2NVBA 1M6WA 5K6AA 1XU9A 4R4JA 4J1TA 2X6TA 3WJ7A 2B0JA 1UDBA 5DBIA 2W2KB 1V6AA 4DVJA 3PIIA 2GN9A 3IC5A 3ZNOA 4ZQGA 3GG9A 1NP3A 1EDOA 1VJ1A 3EUWA 3E82A 3D7LA 1H6DA 3TOZA 3RIHA 3ADPA 4ALKA 1BTOA 4GSLA 1B2LA 2C54A 1LDMA 4OSOA 1H0KA 1I2CA 1V9LA 3JYOA 4A0SA 1CETA 3M2TA 2HKIA 1O6ZA 3INTA 1NPDA 3WIEA 4XYMA 4BNUA 4CQLB 1LRJA 4UUOA 5EQFA 3LT1A 1EVZA 2H63A 3T4EA 3PQEA 5JAMA 4WPGA 1VL0A 3ORFA 1ZMOA 4JK3A 4RPKA 2GF2A 3QRWA 2VYNA 2X5JO 5FWNA 4L76A 2O4UX 1MV8A 1E1LA 1MC4A 2EJWA 3DAPA 1YBAA 4AJIA 3F5SA 3HB5X 3BYZA 3ASVA 1B0AA 4OMUA 1J6UA 2VHWA 4LMPA 2JAHA 1YH3A 2BKAA 3NKLA 4R54A 1ZBQA 2J3IA 2EV9A 5CDYA 4XEHA 1YL7A 1P74A 2ZQZA 1AE1A 3FN4A 4GSKA 4L4RA 4BQRA 5KVSA 5A05A 1ZIDA 5MDHA 1UP6A 2VRCD 2AQHA 4IDEA 3ZW8A 1K5HA 3PHGA 1SB8A 3FSRA 4IQ8A 1ZO8A 4AJNA 4BMNA 1XA0A 4B7CA 3LK7A 5IZCA 4E2ZA 5JNLA 2E6UX 5L3ZA 3PJDA 1BXGA 2E48A 4W9NC 5L4SA 2JCYA 1I3KA 3R3SA 5T67A 1A27A 2FPGA 2IODA 3CINA 5THQA 3F9IA 4IS2A 1KY4A 3W6UA 1EFLA 3MJ4A 4GX5A 4NBRA 1E7WA 3S8MA 2JKVA 3RFVA 5EPOA 2CVZA 1IB6A 1VJ0A 2J5KA 3ZV5A 5HS4A 3TFOA 3C85A 4A03A 1K3TA 4CLOA 4AJOA 3OJLA 5IDWA 5T64A 3AU9A 4CR6A 3ZV4A 1RJWA 4YRBA 2HK8A 4P4GA 3LLVA 3QVOA 1Q7GA 2OZPA 1ZK1A 2B5VA 3AY7A 1FXSA 1P44A 2NU7A 3BMQA 4MO2A 4TQGA 5DP2A 1VM6A 1X7GA 4BNJA 5CG2A 4GLLA 2J6IA 1AGNA 3BHJA 3W4KA 1Z74A 1ZFNA 4UEKA 1EBUA 1R4NA 4D46A 2HK7A 4NH4A 4E5NA 4CM1A 3EVNA 5I7EA 4D41A 2SCUA 3MOIA 2PKRA 2G0TA 3MTJA 3RKRA 2I67A 2GSDA 1Y81A 1MG5A 4UVHA 5TX7A 4I9UA 5A3VA 4R01A 3PPIA 1YS4A 1NHWA 2DPHA 3F1KA 5B4UA 2X22A 4IDFA 4RLSA 1W8DA 4BNVA 1S7CA 2H1SA 2I6TA 3WS7A 4OM8A 4XRGA 2PKQO 3D3WB 4J2HA 5COQA 4IINA 2FOIA 4ID9A 4ZU3A 2EW8A 5DCWA 4HFRA 5IXYA 1PS0A 3WGTA 3ZWPA 1Y9AA 2V6BA 1C14A 2W90A 5G4KA 1VRWA 1VL8A 4GL4A 1KBZA 4J0FA 3KXDA 5KKAA 1O95A 3O38A 4IDCA 3NJ8A 5K9ZA 1ZK4A 3TWOA 4EJ6A 1QV6A 3ZH2A 4RVUA 3F5QA 3ZNNA 3C1OA 1O8CA 1GTMA 1ISFA 3EHEA 3A14A 4MVJA 4H7PA 1EE9A 3PGXA 3QWBA 4QQRA 3X2EA 2ZJ1A 1K6JA 3LDHA 4E2XA 4E13A 1I33A 2Y0CA 5I8ZA 2E4AA 3GEMA 4QXMA 2PD3A 3GFBA 3CTMA 1SOVA 4FS3A 3QP9A 4P4LA 2IE0A 4FJ1A 2NWQA 2DBRA 1E7YA 2P9EA 3K92A 3BTOA 1A5ZA 2GDZA 5A4DA 2P4HX 3L0DA 3QVTA 4IDBA 3WBBA 2YQ4A 4B79A 4J91A 1PS8A 4OOEA 4I9HA 1VKOA 3BHMA 1R0SA 3DR3A 5IFLA 3KUXA 1XKQA 5CDTA 1XQ6A 1KEWA 2O3QA 4NBVA 5G0UA 1BW9A 2D5AA 4Y67A 5CEFA 3V2UA 3CZMA 1XELA 3OJOA 4U0KA 3WQSB 4YQYA 1PJCA 3HDQA 3R1IA 2Y1EA 3GQVA 3JYQA 5A04A 2PTGA 3UCEA 1LDBA 2F1KA 4PG6A 4NR0A 4HBGA 4JJIA 1NWHA 1D1TA 1GR0A 4QX6A 5KCZA 1DSSG 3B1KA 3G1TA 3AY3A 4MOWA 4Z3KA 2NLOA 2HU2A 1ISIA 4XYGA 1YQGA 1HE5A 3CH6A 4PG8A 4WASA 1IPEA 3K8ZA 1KY5A 2EW2A 3UAGA 1GEEA 3RBVA 3VVBA 4EYEA 1DDOA 4IQGA 1E92A 3DBLB 3RQSA 4EBFA 1VI2A 4CR8A 2HMTA 5JDIA 4CLEA 2OBNA 4HUJA 3U5TA 1X7DA 3ASUA 3VAZA 5A9SA 4WLOA 4HX5A 2HMSA 4BKRA 1GUZA 1M6HA 1UXGA 4CM4A 1PGJA 3EYWA 3FI9A 3O8QA 3GC6A 3ZHYA 4L0QA 5IDQA 1DXYA 4MJLA 4PLCA 3DEYX 5LDGA 1PGPA 4L74A 2VYND 2D0IA 1LNQA 3QVXA 2O3UA 2X5OA 5U1PA 3VC7A 4GVXA 3GDOA 3WB9A 2YJZA 4RPJA 4YA6A 1CRWG 4CODB 4Y8VA 3ETGA 1VKNA 3OICA 4HXYA 3IKVA 1T2EA 1CIVA 5AXBA 1ISMA 4C7JA 1MFPA 2BFMA 2P5UA 3QSGA 3JD3A 4J7XA 5AYVA 1TT5A 4I5FA 1HTBA 3HUDA 1Q0LA 1LSOA 3H9GA 3P5SA 1F06A 3U09A 1XYGA 3JQEA 4OKNA 1U2GA 4OYRA 2X58A 4PLVA 4CUZA 3UVEA 1RM5A 4RZIA 4A5OA 3ZWMA 2W4QA 3I9LA 4RZHA 1TVEA 3DXFA 4WJZA 1HDRA 3V1YA 4NJMA 2EGGA 3ZWOA 3B20A 4IGEA 3VTFA 1J5PA 1VJTA 1QORA 2V6FA 4GBJA 3EY4A 3QJ5A 1UAYA 2UVDA 4R5HA 3GZ4A 4BKUA 2PK3A 1UP4A 5U9CA 1U4OA 3DB2A 3KZVA 2PFGA 3DOOA 4DTIA 2VN8A 3KEOA 4L4XA 2HMVA 1N5DA 2X0JA 2YY7A 4N7RA 4BNLA 4Q3CA 4GGOA 4DL9A 3RUCA 4YTEA 3WLFA 1OC2A 1PX0A 2DUUA 4RL6A 5KWEA 2Y93A 5L7YA 3VOSA 3D4PA 4NFYA 4QT0A 3ENNA 1G0NA 1U7HA 2E82A 3C1AA 2O7QA 3CMMA 4RLHA 1B14A 3DBHB 4EGFA 4IY1A 1HDOA 1LC3A 1XEAA 1MXFA 1JQBA 3MJTA 1JN0A 1V8BA 3GN1A 5C7LO 2Q4EA 5DCUA 3TL3A 3MJSA 4TRRA 1EUZA 3H3JA 5G0TA 4NK4A 5HS6A 2FHSA 1Y8QA 4PCVA 1JDJA 4K1LA 3CMCO 3WTCA 1V35A 2VNSA 3WGZA 4GPD1 2I66A 3ZHBA 2EG9A 3OEWA 3EZLA 1WZEA 3WG9A 4OGWA 2ZTMA 3ANMA 1NHGA 4JCOA 1ZXLA 3TZHA 1ISGA 3GFGA 2RCYA 3I1JA 3RC2A 1PS9A 3QW2A 3V1TC 3KEQA 3OEYA 2HCTA 2PZLA 5HRUA 1ZNQO 5ENDA 1QMGA 1MG0A 4J2OA 4RCVA 4U7WA 3VHRA 2BGLA 1ADFA 5BSFA 5ENVA 3DBRB 1T4BA 4H16A 4NFSA 3I6IA 4NZ9A 3ZDFA 3AWDA 2Y0DA 1DPGA 5ICMA 1ZMTA 1GCUA 3FR7A 1G6KA 3Q9UA 3SXPA 2LDBA 5L7WA 4NBTA 3UHAA 4CQLA 1FMCA 1NFQA 1I2BA 1NVTA 3JQAD 2HMWA 1Z75A 1GL3A 2B37A 2CSUA 2DAPA 4ALNA 4EEZA 2UYYA 3JQAB 3KBOA 4MP3A 4YJDA 1D3AA 1DRVA 3VPFA 5L4LA 2FP4A 3TZQA 3FBTA 3QVWA 4D0SA 3TZ6A 1UAGA 2DBZA 4PFJA 4RF5A 3F46A 1QSGA 5HBRA 1QYVA 3TQHA 5IZCC 4E30A 3HFGA 2FPPA 1DIHA 4JX8A 5IXSA 2V65A 4K6CA 2R00A 4FFLA 3KB6A 2HJSA 1ULSA 4M55A 3STHA 1KEVA 4CR7A 5GZ6A 3JV7A 1V0JA 4RF3A 3EAGA 3H2ZA 4M49A 1NR1A 4BMSA 3JTMA 4UEOA 2Q49A 3PRJA 4YJFB 3K73O 4R41A 1I3NA 2O2YA 3GNSA 2POQX 4FSHA 4Y6RA 1PU2A 4BB5A 3VZPA 4F46A 3PP8A 5BSEA 3JQBA 4WK6A 3FBGA 5JY1A 1F8FA 3TFQA 1UZNA 4XA8A 2EP7A 3WGGA 2EF1A 4J49A 2XXJA 4CL8A 3EGOA 5AXDA 5A5FA 2EIHA 3ROKA 1E77A 2NNLD 3OH8A 4RJTA 4CM8A 1L1FA 4ND2A 1LJ8A 5EMHA 3OM9A 2X5KO 3H2SA 4I1IA 3GZNA 1SMKA 1Z73A 2QW8A 2NU6A 5T57A 5IDXA 5IN4A 4AJJA 3M6IA 1P3DA 4BO0A 4B3IA 4MVJH 3DAGA 2QZZA 4H3VA 3JD4A 2YQ5A 1O5IA 1Q0HA 2RHRA 2W2LD 4S3MA 3D5TA 4XIJA 5KJEA 1PJTA 2CF5A 2LDXA 2IEBA 3CSDA 5DF1A 5TJ9A 4IMRA 2A92A 5KTKA 1I8TA 4O5OA 4YJHA 4ZD6A 3RKUA 3ZCXA 3VPGA 2YV3A 2YHUA 5EINA 1YXMA 3RUFA 5JCJA 3G3EA 2BGMA 4JBIA 2P9GA 2OFPA 3QV1A 4MDHA 4XRRA 2VNAA 4TKLA 3ZNPA 5A3JA 1I2ZA 1JVSA 2D1YA 4BO3A 4E0BA 4ND5A 1QYDA 1PJBA 4BO4A 4QFCA 3H9EO 2AQ8A 5JDCC 2YFHA 3IDSA 2X0NA 4XR9A 4Z3DA 4D79A 3RUIA 5CPFA 5DCYA 4BNMA 4CLRB 5AVOA 2JJYA 4DQXA 3PJFA 4K28A 4CM9A 5IJZA 5I7VA 3E1KA 1OOEA 2YW9A 3ZN2A 4YEDA 2CUKA 3QWHA 4ZICA 3ZU5A 3RFXA 3Q6IA 4PLHA 4WLEA 1DC5A 3PYXA 4FD3A 4UUPA 3U0BA 5AOVA 2X9GA 3JYLA 1P31A 4XJTA 5IZ4A 1RM0A 3ZV6A 3BTVA 4TKMA 5MGBA 4R1UA 2Y99A 4JP2A 3DONA 4YQZA 3JD0A 3ZHXA 1JTVA 4M1QA 1U8XX 5F3RA 8ADHA 5H82A 2NM0A 1QYCA 4UVEA 3A9WA 2AEFA 3WGQA 1HT0A 4YAKA 4YXFA 1MC5A 4IGFA 1DHRA 3TZKA 1F17A 3R6DA 1F12A 4N5NA 5CG1A 1G0OA 3SC6A 1N9GA 4OHUA 5H83A 4BKPA 1ZEMA 1GZ6A 1E1MA 5KVCA 5L9AA 3GUCA 5A03A 2W2KA 2IEDA 5G0SA 3HDJA 3E5RA 4CMBA 2DBVO 1WPQA 3JSAA 2BFOA 4IJWA 4DGSA 2J3KA 3IMFA 2NTNA 1E3WA 2PZJA 3K6JA 2ZYGA 4LVCA 4CUKA 5B12A 2DFVA 2CVQA 3CUKA 3MWDB 4MINA 5IF3A 5G4LA 2VCYA 4ZRNA 2P91A 3DBHA 4ZQHA 5CAEA 2VT3A 2H6EA 6ADHA 3HWRA 3SLGA 3DHYA 1F14A 4IMPA 4LCJA 4HFMA 4FN4A 1E7RA 1P9LA 4DQVA 4A73A 4Z0PA 5DN9A 3HJAA 1L7DA 3UCFA 4RVFA 4FDAA 2AE2A 2ZCVA 1O0SA 2GASA 5CEJA 4AJLA 3D3WA 2DM6A 3ITDA 3H5NA 4TRMA 4HFJA 1OI7A 2R00C 3HE3A 2ET6A 3MWEB 1U28A 2I65A 5ER6A 1GQQA 3DOJA 4E32A 5DDIP 1C1DB 1DOHA 4KDFA 3V8BA 3H8VA 3WQRA 3LC2O 1B7GO 2CVOA 3EMKA 3JQ6A 4QECA 2DKNA 1LDYA 4DIOA 3ICCA 3UICA 3ROQA 1ZCJA 3UGKA 2HUNA 4DLLA 1NNUA 2OP1A 4NNJA 1N92A 2ZATA 1LXCA 4HV4A 1NX6A 4OSPA 3UF0A 4IUYA 4CM9D 1GAEO 3PLRA 4B8WA 4CQMA 2DU8A 1ZJYA 4WLVA 3FTNA 4OXYA 2BFPA 1R4NB 1YBMA 2VUUA 1E6UA 7ADHA 4IM7A 2QRJA 1E0DA 4GX1A 1EUCA 2GN6A 1OC4A 2IZ0A 4E4YA 3CXRA 4KQWA 2VWHA 5DP1A 1PJ4A 3GNTA 3M2PA 4WNIA 4BO6A 1HLPA 4ZJUA 3QWIA 2VOEA 2O23A 4FCCA 2VUTA 2NTJA 1FF9A 4FQ8A 4KZPA 3I5MA 2GLXA 3GVIA 2YZ7A 3Q2KA 4DRYA 3F4BA 5G2OA 2Q3EA 2A94A 3JQ7B 3NUGA 3PZBA 4BNFA 2C7GA 3ZNQA 1C0PA 5KOIA 5G0WA 2CD9A 1E3EA 2BLLA 3E5MA 2ZQYA 4IIUA 3VH1A 1OBFO 1EVYA 2DT5A 3GPDG 4N5LA 3VH2A 2XOXA 1DRUA 3JD1A 3TN7A 3PHLA 3IUSA 1H2HA 1P1KA 4O1MA 1WDMA 1MGOA 3I83A 2O3RA 3PYLA 1KOLA 1ISHA 3ZWWA 3WWZA 1HSZA 3AW9A 4J4HA 1ULUA 1P33A 3KM0A 3QVSA 1BMDA 1LRKA 5EL0A 2FMUA 1E7MA 4BNYA 3WR5A 3ZWAA 1QV7A 3VPHA 3K9QO 3K96A 1YQXA 2G76A 3H9UA 3OJFA 1UDAA 2W98A 1YKFA 3H9JA 1N9GB 3ZV3A 3WOHA 1LDGA 1HRDA 2GUGA 3JYNA 3TSCA 3WQQA 4EDFA 4WKGA 5TGDA 1ZSNA 4W4TA 1UXJA 4RQTA 2G17A 4YT5A 4F45A 2VYVA 1ZK3A 3DOCA 3GRPA 5HTOA 4DC0A 4RORA 4RGBA 3DBRA 4IZIA 3TRIA 2O50A 1MA0A 1PJQA 3RROA 2C5AA 1Y5MA 2WE8A 1K2WA 3JYPA 4NU6A 3RBXA 4DYDA 1EE2A 4OH1A 1FDSA 3VTZA 3WX0A 3ONDA 3P2YA 4CMHA 1H94A 3JD2A 1DIBA 4L4SA 5I7SA 4YAEA 4XD2A 5AXAA 5JY6A 3FPCA 2I76A 5C7IO 5BSGA 5EESA 4ZQFA 3I6QA 3DWFA 4AFNA 1MB4A 3B1JA 3OQBA 3FR8A 4AJKA 1EFKA 1JLLA 2B36A 1I5RA 2Y1GA 4WCFB 3GHYA 3PHIA 1YBVA 4CV1A 1NPYA 4FFNA 1BXZA 2HMUA 1VPDA 3H7AA 5THKA 1YRLA 3BMCA 4FB5A 3U49A 1KYQA 3KYBA 2YFQA 1RKXA 4E5KA 1E7SA 1RM4A 4EZBA 3FD8A 1SNYA 2O2SA 3EC7A 4ZVVA 4D3SA 4WNCA 3FNFA 4KQXA 4HNGA 2JL1A 3O03A 4GGPA 5JO9A 4Z6KA 5FF9A 1SOWA 2NADA 4LRSB 1K6XA 4BMVA 5DZSA 3S2FA 3U3XA 4FC6A 4NIMA 4FOSA 4I8XA 3K30A 4ZA2A 2WE7A 1UUFA 1HZZA 4XGNA 4AICA 1DC3A 3WXBA 3L4SO 4KUGA 1XDWA 3PJGA 2OO5A 3TJRA 2J8ZA 3PEFA 2DC1A 2WSBA 3H6KA 1GPJA 4TROA 4R1TA 1C0KA 4XB2A 4P4NA 3MOGA 5CDUA 1PQUA 1GQ2A 4FJ2A 4J1QA 1HDCA 4MVJP 4WLNA 4TVBA 1HKUA 4Q3EA 1U7TA 1IHYA 3DZBA 1TA4A 2PA3A 3LVFO 1P1RA 4A2CA 1LA2A 2AXQA 4IDAA 5TSDA 1XGKA 1PR3A 1CDOA 1NM5A 3GVHA 2VZ0A 4A7PA 5GZ1A 3WWYA 1PJ2A 4GX2A 5JC8A 1UDCA 3FNEA 4UEJA 4BL5A 2VHVA 3GVCA 3JQ8A 4FFRA 3CZRA 4RPGA 1PZGA 4DMMA 4YT8A 1DO8A 1DC6A 1FDUA 3EVTA 3T7CA 2Q1TA 2B5WA 1G1AA 2IXAA 3BA1A 3IJPA 2J5RA 4B3HA 2VOJA 3GN2A 3VVCA 3MJVA 1YO6A 2O3JA 3AOGA 1KIFA 1T1SA 3RUEA 4X54A 1B8UA 1T2AA 2GNAA 3Q11A 1LU9A 2VHZA 4Y9DA 3I9JA 1GV0A 5I9NA 1OFGA 4JBHA 1LEHA 4MVJM 3RUDA 2QX7A 1EK5A 2Q1UA 1ADGA 3VH3A 4CM8B 3MJCA 1DFIA 3S55A 4ONEA 1XU7A 4R1NA 4XX0A 3VZSA 3GAFA 1VC2A 3COSA 4AJ4A 2AG8A 1H2BA 2HJRA 1UR5A 2OOSA 4ZGWA 2X1HA 5ADHA 3F1LA 1SPXA 1R0KA 1NASA 4L73A 3KYCA 2I3AA 1UH5A 4E3ZA 1WZIA 3DDNA 4WEQA 4GKBA 5COBA 3LT2A 4EUEA 4J9VA 4XWYA 1T25A 3OA0A 3MZ0A 3SJ7A 3U4IA 3K2BA 3MCVA 2HO5A 3NEPX 4QO8A 4DREA 1TB4A 1JKFA 4W6ZA 3DZHA 4MP8A 2PY6A 4N54A 1DAPA 3SLKA 3HDHA 2J3HA 1U3VA 1HSOA 4DMLA 3B6ZA 5IAAA 1HE3A 4XQGA 1E1KA 5B4TA 1ZH8A 4UVGA 4J7UA 3WGOA 2PH3A 5KVVA 4NI5A 5ICSA 4E2WA 5L4NA 3VH4A 4PVCA 3JCZA 1DLJA 1LBEA 3RAJA 4ALJA 4J9UE 5A9RA 5KIAA 4CM3A 1PEDA 3L9XA 4Y6PA 2JHFA 3G79A 5A9TA 1YJQA 3ZWCA 3OQ1A 1HDXA 1KVQA 1EDZA 3GA0A 3ABIA 1RYDA 2C2YA 3O26A 2UUOA 2I9PA 1YB5A 3DZKA 2X23A 3Q1LA 4WCFC 4YJGB 1NQTA 2A9FA 1I10A 3QWFA 3UXYA 4W82A 2X86A 1ZZEA 4YVFA 1E5LA 1YONA 2B4TO 1H6BA 3E9QA 4C4OA 2C2XA 3AU8A 1BXGB 3ZU2A 4F6CA 4XCVA 4D44A 1BVRA 1LQUA 4QTZA 1PIWA 1O89A 3LC1O 3DTYA 4E12A 4RO0A 2G1UA 4M8SA 2VHYA 3BMCB 3UFXA 1QLJA 1CJCA 1PR9A 4BIIA 2QQ5A 3ONFA 3H4VA 4J0EA 1I01A 3DBVO 3KV3O 4WUVA 3W1VA 4LSMA 4E33A 1DAOA 1DJQA 1ORRA 3HNPA 1X0XA 2FZWA 3GOHA 4BKOA 2IDZA 3JQ9C 4GVLA 4MIYA 5BNIA 3JQFA 1DIRA 3GAZA 4PIVA 2P9CA 3KYDB 4JIGA 4DPKA 1ZXBA 3OETA 3QWAA 5LDHA 4EUHA 4R9RA 3U4DA 3LSYA 1B8PA 3M1AA 4JNKA 3KSZO 1BVUA 1C0IA 3G0OA 4YAJA 4J7CA 3NTQA 3UH1A 1ENOA 4M89A 4DA9A 3BAZA 1HDGO 1WAMA 4XB1A 1A4UA 1B26A 3OIFA 3SBOA 1KVUA 5JAIA 2VZ8A 1EZ4A 3DFUA 4A27A 1N2SA 3ST7A 5ILGA 3PYMA 1IOLA 2Q2VA 3L9WA 1N8KA 1Z82A 3OQ6A 4CPDA 2I5PO 4XYBA 3QA9A 4PG5A 1NQ5A 4I5EA 1Q7BA 4AJPA 1GDHA 2C20A 4MKZA 4BGIA 9LDTA 1YQDA 1HE4A 4YAGA 1KVSA 4CLRA 4ZQBA 3GT0A 3IAHA 1AHIA 5HWSA 2X9NA 4KWIA 3U4CA 2X8LA 4BVAA 4JQCA 3N58A 1U3TA 1GCOA 4RDHA 4TZKA 5F21A 2C5EA 4EITA 3NDJA 1LLUA 2RIRA 5DT9A 3NYWA 4OXKA 1X7HA 1F0YA 3L6EA 1SAYA 4CMIB 1JKJA 1I3MA 2X0RA 4BO8A 3PJEA 4F3YA 4RVSA 1U8FO 3I4FA 1I3LA 4YT2A 1O94A 1ZJZA 3NTOA 4CMCA 4YJHB 4II2A 5L95A 1SC6A 3VPXA 4E21A 1Z45A 3VDRA 2F00A 2QZ9A 4PGFA 3AUTA 4P38A 2GZ1A 2O3SA 5TC4A 4MVJG 2CDCA 4CL3A 2BHLA 3AUAA 1D4FA 3BZUA 4FFMA 1H9AA 2JFHA 3N74A 3NRCA 1R37A 4Q3NA 4JGBA 1DFGA 1UJMA 4OKIA 4MKRA 1IE3A 2EEZA 2EJVA 2GN8A 4RV9A 1I24A 4U6QA 4CV2A 2IZZA 3Q9NA 1YOVB 4INAA 1E3IA 1LRLA 2DTDA 2VRBA 5ITWA 2O7SA 3ZWYA 1NWCA 4DLBA 3OF2A 4U0JA 3D1LA 3MEQA 4B7XA 3TNLA 4BB6A 3OECA 1GQYA 3IJRA 5B4VA 2HK9A 1UZLA 1W73A 2A35A 1FDVA 3AFNA 2VZ9A 3OBBA 4K26A 5J23A 5L51A 1P45A 2PLAA 2HQ1A 4PLZA 4BNHA 1GEGA 5A02A 2QRLA 2NU9A 5JSFA 4FFOA 3DZJA 1SBYA 2PZKA 3L4BC 2VWPA 1R12A 3WFJA 2QYTA 4FIZA 4GX0A 4YJFA 4ALLA 2CDAA 2GO1A 1Q2XA 5A06A 4MP6A 1IZ9A 1PL8A 1XR3A 4KTVE 2E49A 4FBGA 4O0LA 4IBOA 5JE8A 4MVJE 1NVGA 5BR7A 2EP5A 3I4CA 1K0UA 5AQ1A 4LRTB 4BGEA 3NAQA 3DMYA 4CMJA 3Q0EA 2W2LA 3ETDA 4TWRA 5ILOA 4C7KA 2RBEA 1PJ3A 1Z7EA 2CMDA 1ZUD1 2BGKA 2ZYAA 2A4KA 3GEGA 1GPDG 4NBUA 3WGIA 4TSKA 1H6AA 3OFSA 4LN1A 3AOEA 1EQ2A 1YL6A 2GN4A 2O4CA 5TJHA 4J6FA 3PHJA 4K9DA 4NK5A 4AJ2A 3W4JA 3ZZNA 4OOFA 4ND1A 5TRTA 2UDPA 3RC9A 4JJGA 4Z9XA 4PZEA 1K6IA 3GG2A 4HKTA 4DPLA 3WMWA 1ENPA 1RM3A 2DTXA 5TT0A 3I3OA 1ZK0A 3D64A 5L53A 5DBGA 3OHSX 1QR6A 4EI2A 2DPGA 3JQFC 5CPBA 1A9ZA 1D7OA 1IULA 2J5QA 1A9YA 2D5CA 2BH9A 4GQAA 2CY0A 3UCXA 1NR7A 2PGJA 3LF2A 1QYWA 3IL2A 3ANLA 4O6VA 2ZTUA 4WE3A 2ZTVA 2FN7A 1XCBA 2IYOA 3C8MA 1NPTO 3GMSA 3PFWO 4FOOA 5KKCA 2VRCA 2WEKA 1W4ZA 2O3TA 4LCEA 2NQ8A 1Q1NA 3JQ7A 1U2DA 3NT5A 2FR0A 1PL6A 4PLYA 4BO2A 2PZMA 1NFFA 1WWKA 4GKVA 1LDEA 2OGUA 3QLJA 4KWHA 4B7UA 1B15A 3L77A 2J3JA 1T24A 2WD7A 5ES3A 2OXIA 3JQCA 2NACA 2AHRA 3HFSA 1NVMB 1XLTA 3OA2A 1OZAA 1W6UA 3ZWBA 3CKYA 4Z0HO 4TRJA 3PI7A 2Y1FA 4IIVA 4BNZA 1M66A 4DIFA 3K2EA 5G0VA 2EXXA 2OL4A 1JW9B 1CERA 1X15A 2RH8A 4HY3A 1LC0A 3DC2A 2NU8A 4OJNA 1LDNA 2ILTA 2R6JA 1ZW1A 4ILKA 4IDDA 5JLAA 1DBVO 4PLFA 1U3UA 3PQDA 1WP4A 1A7AA 2VUSA 1EK6A 2BRUA 1IYZA 3C24A 3LLSA 2VWQA 1U9JA 4WOKA 1Z7BA 1CWUA 2NSDA 2WMDA 3AJRA 3HQ4O 2Z1MA 4XYEA 3KSDO 3RSHA 3BTSA 1KVRA 2WYUA 2Y05A 4FC7A 3DBLA 3OMLA 1ADCA 1AN9A 2RH4A 2Y0EA 1GU7A 4L8VA 1HDYA 2C7VA 4BO1A 4XKJA 3LU1A 1QLHA 1GADO 1N1GA 3NGLA 2Y1OA 4BO9A 4GMFA 4ZN6A 2VHXA 2ZB4A 3GRKA 1YDWA 2RAFA 1LUAA 3GGGA 4LGVA 1SB9A 4AJHA 3AI3A 2ZTLA 3PK0A 2QHXA 3ZU4A 4MKXA 1EEHA 2AW5A 3FHLA 1DB3A 1K89A 1A7KA 2GR9A 2VWGA 3EK2A 3KO8A 4N18A 2JD0A 1DIGA 2XPCA 3WGYA 4Q39A 1PWZA 4J4TA 1RPNA 4WEOA 1YE3A 2UAGA 4F6LA 1X0VA 2VQ3A 4QSMA 4BO7A 3R3JA 1H93A 1LTHR 1YDEA 5B37A 4YBZA 1KERA 1SEVA 3EDMA 3ZGYA 5C3MA 1SZJG 3V2HA 1UP7A 1WDLA 3E8XA 1HE2A 1PWXA 3DMTC 4N5MA 1X1TA 1J49A 4KUHA 5TLSA 3E48A 4O63O 3ROPA 1C3VA 4NG5A 1TT5B 4RQUA 2C07A 3RWBA 3T4XA 1LSUA 1X13A 3FRJA 4Q3DA 4I5DA 1AXEA 2X7HA 1HZJA 2NV6A 3LT4A 2AG5A 2CDBA 5FI5A 2WD8A 1TEHA 1VL6A 3BMNA 4YACA 4P22A 5FYDA 1Y9EA 3UKOA 4ESOA 4FR5A 4E5YA 5CFZA 1JWAB 1NBOA 4TMFA 3OSUA 2Y68A 4R16A 3Q3CA 3JQGB 2IZ1A 1UXHA 2ZIZA 4FW8A 3VPSA 2ZK7A 5KJFA 3A28A 3U62A 3WFIA 1D1SA 1VSVA 2OORA 1PJLA 3UUWA 1XQ1A 3WNQA 5HA5A 1HWYA 3O8QB 3QHAA 1V3TA 1Q0QA 5KJ1A 2PR2A 4BO5A 1N7HA 1ZKMA 5GMOA 4UULA 4CM5A 1MFZA 4J90A 4NHEA 4U5QA 1V3UA 4J1NA 5C5IA 1E3SA 2PKQP 1DEHA 4W99A 1HYGA 4MVJI 4CJXA 1LLQA 3S2GA 3DTTA 4W7IA 2DUWA 1P1FA 4W9NA 4YPOA 2PNFA 4BNGA 3C1TA 3LQFA 2WM3A 3ICPA 4EJ0A 3PHHA 4KOAA 3P2OA 1MLDA 5JO0A 2Q2WA 3W4IA 3WTBA 1MUUA 4RVHA 4CMGA 1E3JA 1R15A 1T26A 1LSSA 2QG4A 4CLDA 2TMDA 3ZHZA 4H15A 1SEPA 1UXKA 4RF4A 3Q2IA 3RCBA 2DBQA 2AE1A 2JCVA 2ZCUA 4WCFA 4MIOA 4NDNE 4BOYA 2Z95A 3O4RA 1EVJA 1XWFA 1DFHA 3ZWXA 3PWKA 3RD5A 1PGQA 1AXGA 4XQCA 2BFAA 3DZGA 1EQUA 4ZRMA 1RYEA 3HB4X 4NFHA 2B69A 2ZYDA 5IG2A 2PWZA 4XJSA 3RASA 4FJ0A 4Q9NA 2P5YA 4PZCA 3IS3A 3GUYA 1DIAA 4BNXA 2JD2A 3DHEA 5JDCA 2GRAA 1XSEA 1X14A 3RU9A 2JFFA 3PIDA 3ZWNA 3PFFA 7MDHA 1PGOA 2YYYA 3OJEA 2XXBA 5COAA 3PWZA 3WNVA 1SO8A 3MTGA 4PLPA 5TT1A 4EEXA 5DOZA 3PQFA 2VTEA 2DVMA 2C29D 1GV1A 4UAGA 4DXHA 1KC1A 3B70A 3WYBA 2Q50A 4MVJD 1QKIA 4NJMB 4A10A 2D8AA 3GH3A 5GZ3A 1P77A 2BMAA 2DTEA 1WXDA 4YR9A 1PQWA 4XQ9A 3S1LA 2P2SA 4WOJA 5T5QA 2NVUA 3HHPA 3VZRA 4ZHSA 3KLPX 4OQZA 2GZ3A 3RUHA 1ONOA 1FK8A 4GWKA 1OMOA 5LC1A 2PGDA 5C7OO 1T2FA 4LMRA 4Q3AA 3ULKA 1BXKA 3NTRA 2EWMA 4JBGA 1IL0A 5JXWA 3L6DA 2IXBA 3PZRA 3VKVA 5K0ZA 1FDWA 3WBFA 4XYLA 2Y1CA 1B16A 3I9KA 1DC4A 1CF2O 3BMQB 1GD1O 2JFGA 3NGXA 1FDTA 1YGYA 2D3TA 4GWGA 5BT9A 1E3LA 1R66A 3JQ9A 1ONPA 1YWGO 5JAZA 5BNFA 1IZ0A 4XDYA 4YCAA 5G4KB 4ROSA 4R69A 4R68A 5F1OA 4CLXA 1BRMA 1GYQA 4PLWA 1M67A 3ONEA 2ZB8A 2XF8A 4UREA 1JAXA 4W7HA 1ISJA 3F4LA 1B8VA 4Y98A 3TOXA 1HDZA 1AUPA 2RHCA 3E6AA 3KHUA 4NPCA 4L75A 4MPDA 4BNKA 4KDEA 2D4AA 4OO3A 4Z0TA 2IRWA 3RJ5A 3AI1A 3AY6A 4R3WA 3A06A 2FPIA 3GNQA 3PDUA 3E9MA 3IP3A 2YDYA 5KJ6A 2OHXA 1GZ4A 4Y6SA 2Z5LA 1A71A 2HRZA 2V6GA 3GGPA 1OAAA 4PG7A 1N7GA 1Y7TA 1GFSA 4HADA 3ZWVA 1NYTA 2YV2A 3IUPA 4J16A 1R4MA 2WWRA 3F3SA 3KYDA 5L7TA 2VYVD 2ZB3A 3RJ9A 1KC3A 2FR8A 3EZYA 2G82A 2V6MA 4IXTA 4JXKA 4LVUA 3U4HA 4YAIA 1T2CA 3VDQA 1ADBA 2WTBA 1TLTA 5A9SB 1BDMA 4CMKA 3ZU3A 4AG3A 3FF4A 3AM3A 5JMPA 4E5PA 4D3FA 1BW9B 4JP3A 5CP8A 1U4SA 1H6CA 1TXGA 1RWBA 3A1NA 3FPLA 3FCOA 1EBFA 4KTTE 2FRDA 9LDBA 3NX4A 1Y8RB 2XAAA 4LK3A 3W8FA 5L45A 3E9NA 2D59A 3SEFA 1E5QA 1HEUA 4TRNA 2OP0A 3GVPA 5EERA 3SC4A 4R1SA 4J43A 4LISA 1PGNA 3ZW9A 1WLYA 2QRKA 1YJ8A 3C7AA 3MJEA 1IUKA 2PGLA 1DLIA 3VZQA 1U3WA 4IXWA 3GZNB 1B3BA 1S6YA 1UZMA 4M54A 4WLUA 3ZI0A 2CF6A 4CUJA 3HZZA 4AJ1A 4D42A 5B1YA 1I32A 1VLLA 4NQZA 4CMEA 3U9LA 4BUCA 3AFMA 3ROMA 3C7DB 3V1UA 4OXNA 3KSUA 4O59O 1GYPA 3WYEA 3OIGA 3D4OA 1LQTA 4DLAA 4IJVA 3RC1A 3GVXA 4DPMA 4WCDA 4J4BA 4EUFA 3OIDA 3ADOA 2BELA 3A4VA 4RPHA 4AL4A 3GY0A 3DFZA 3BMOA 3FWZA 3W6ZA 3CPSA 2H9IA 2PD4A 2TMGA 3CEAA 2CNBA 3GF4A 3EW7A 4ND4A 1E6WA 5TQVA 3IIEA 4XGIA 2B83A 5DNAA 2FZEA 4R5MA 3WSVA 1EVIA 1IHXA 4R3NA 2GYYA 3GEDA 1KVTA 2AQIA 4MIEA 2WYVA 2BI7A 3AK4A 2Y66A 2V7PA 5F1PA 4ALIA 4ZQEA 3P19A 1LLDA 2DLDA 2Q1WA 3GPIA 2NTVA 3DHNA 3D3EA 1B3RA 4OIMA 4BNTA 3NDRA 4B4OA 3AI2A 1PL7A 4JLWA 1D8AA 2PV7A 5JDIC 2NVUB 1QYXA 1SCUA 3BTUA 5DULA 4BGUA 2OMEA 5I9MA 1JWBB 1Y8RA 3I52A 2B35A 3ITKA 3R0IA 5ER9A 4PN3A 4Q3BA 2CZCA 4I9NA 4D45A 3NT2A 2QIOA 2VTDA 2NVWA 1KEUA 3S2IA 4Z9FA 1NTOA 1CYDA 1DRWA 4M87A 1NFRA 1TT7A 1L7EA 2Q1SA 4QEDA 4DQUA 4L9RA 1PZFA 3RVDA 5JYDA 1WW8A 4IS3A 2G5CA 2GPTA 3HSKA 4YRDA 1QRRA 3G1UA 3NJ4A 2P4QA 4B4VA 3ETEA 1YOVA 6LDHA 1YB4A 3OP4A 1MXHA 4I5GA 5T6BA 1YB1A 4B4UA 1HL3A 1PQPA 2HAEA 2I3GA 5BSHA 4QUKA 4HNHA 2Q2QA 1R4MB 1WMAA 4DIBA 1JA9A 3T7EA 1M75A 3VKUA 2EKLA 3FTPA 3JQBC 4AJEA 1I0ZA 4YWJA 4PLGA 1QXSA 1YVEI 3KRTA 3LF1A 1EMDA 4GH5A 4HP8A 5IN5A 3RI3A 3WICA 4YYZA 1W0CA 2JAPA 2WJPA 3I9MA 5ITVA 2AQKA 4Z9YA 3BXXA 1ZSVA 4UUMA 4GLOA 3RBZA 1J4AA 2YV1A 4RDIA 4E5MA 4KUEA 4DUPA 1LSJA 1XIVA 4BHTA 5F5LA 2Q4BA 3HADA 4TZTA 4BNNA 4CLOB 1ZVMA 3LYLA 3KVOA 4CMEC 3INRA 3GGOA 3SVTA 3AOEC 4BS9A 1WNTA 2OBYA 1C0LA 3GDGA 4JJFA 3KLMX 1C1DA 4CMAA 4OAQA 1R16A 4B8ZA 3AM5A 3CE6A 4IZHA 1TI7A 5F1KA 4HWKA 1ENYA 5FFFA 1HYHA 3HDYA 3H5AA 5K6AC 1E6EA 3HN2A 3QY9A 4JN6B 4G5HA 2FY8A 3D0OA 3TL2A 4URFA 2W8ZA 5EQDA 1WDKA 3JQGA 3GR6A 3FWNA 4R9SA 3WSWA 2OUIA 2P68A 4K6FA 4NJOA 1BGVA 3QQPA 2YHIA 2GGSA 4E2YA 2EERA 1NAHA 2FSVA 3WLEA 2ZB7A 3V5NA 3W8DA 2FR1A 2Q45A 5JPIA 4PRLA 1VSUA 4J3FA 4UUNA 3UW3A 4FPXA 4P8RA 4LSWA 1LI4A 1R0LA 2ZJ0A 1A72A 3AM4A 3H3FA 3TF5A 2PD6A 3L6OO 1I30A 4D0RA 2PH5A 2CFCA 4CMIA 5TIIA 5HM8A 5FEUA 1T1RA 2C0CA 4PRKA 3E18A 4S1VA 2C82A 2WDZA 4BKQA 3S2EA 2ZKLA 2JHGA 2B4RO 1ENZA 3D4NA 3PTZA 4PLTA 3DL2A 1V3VA 5JCJD 1ZK2A 3PXXA 5JW6A 3WIDA 2DQ4A 5CEEA 2BI8A 2X9VA 1U1IA 3IOYA 4A26A 4IDGA 2NQTA 4CM7A 5JBIA 5KNLA 1ZSYA 3I23A 4QFDA 8LDHA 5JCXA 3OJ0A 3BMOB 2GCGA 1Y8QB 2I99A 1GZ3A 2IYPA 4M86A 3UOGA 4WLFA 5I7FA 1E1NA 3K5PA 3WDSA 3NT4A 3IKTA 1LLCA 5A5EA 3BIOA 5U4QA 1MP0A 1C1XB 2EGHA 4BGVA 3GDFA 5JFOA 4D43A 5TS3A 5I9LA 2DFDA 2Y67A 1DHTA 5FI3A 2X0IA 4G2NA 4FFPA 3HG7A 2EKPA 3DZIA 5JYEA 4BNWA 1KS9A 2GERA 1PSDA 2WD7B 3G49A 3H5RA 5T8KA 4PG4A 4II3A 3SX2A 4WGGA 5JAQA 1H5QA 5I8WA 1M76A 3PVZA 1GY8A 4IJUA 2UV8A 3W8EA 4I08A 5EIOA 5BNTA 4OL9A 2B4QA 1NQOA 1MX3A 4XDZA 2WYWA 4NBWA
chains in the Genus database with same CATH superfamily
3K31A 3E3LA 4PAWA 4BDSA 1WEKA 5A4IS 1AHHA 3EXG2 2QQGA 3IP1A 2P6MA 5BYAA 3H1FA 3GZJA 3AF3A 4RX1A 3RC7A 3CZAA 5BOSB 4ZI3A 2OCAA 4ZK2A 3AL0C 1JFVA 2PRSA 3QKWA 5E1BA 2R2GA 4C08A 5M3BA 4QELA 2CNNA 4GRIA 5KQMA 3OCCA 1CQIA 1KI6A 2Q46A 3SJUA 4A0FA 3PDCA 2IX3A 4MR9A 4HQ6A 4B5KA 3WL8A 4E03A 1HF3A 3NNNA 3PHCA 3BJRA 1BU8A 4GF5A 4YWHA 5I5GA 5KTNA 4TVOA 2CXUA 3DOFA 5LNK1 4B3JA 5CHEA 3GDHA 3X2FA 2EVWX 4QO7A 2WU0A 1P4JA 4WD3A 1A4RA 2M6LA 4EY7A 1AKRA 1E9RA 3KNZA 1P0CA 1TGVA 5K20A 2EYQA 4BV9A 3RUAA 5DTMA 4NEQA 1KFCB 1L1EA 2IWHA 1FMJA 5LP6C 4U2BA 1XN4A 3G2KA 2CXXA 1ARZA 1BQ3A 1KP9A 1M8GA 2F3RA 2JBAB 2ZR8A 3EG5A 3O73A 4L3OA 4URWR 1EKXA 4NU5A 1II8A 3G8BA 1KIMA 3ENVA 4K9PA 4N7BA 3SYMA 1M2WA 1TKAA 1RAGA 1ZAYA 5KJCA 1Z9BA 5EZ6B 2Z57A 3HCBA 1OBOA 3ANYB 3AUJB 1VL1A 4YJ2F 3F47A 3WGHA 3QE9Y 2PVCA 4OJMX 1KOGA 2K6GA 3EWIA 4ZAYA 4HL6A 5CDSA 5LUAA 5TNXA 4KE8A 3WLOA 2AF3C 3FUTA 4P5DA 3ETHA 3TX2A 1JDBB 2YDXA 2BEWB 3DJYA 4GQBA 4DC1A 3IUNA 4DYVA 3A6FA 2MYTA 5CB4B 1RBYA 3H2YA 3MRXA 4RF2A 2FR8C 4TQAA 5EJ2A 4F5WA 1Z0UA 2P6UA 3L0PA 4I4NA 5B3LA 2CWDA 4RVGA 1V1MB 3GJZA 5K3AA 1KETA 2YHIB 3LLMA 1J0XO 3SU8A 1PWHA 3UUFA 5C1BA 4C9BA 3PLNA 4UXHA 4XVUA 5EJAA 5JAHA 3W7BA 1TAUA 4F9EA 5GOZA 3CX3A 1TEVA 3B53X 3I9NA 3IUQA 3AKZA 4R83A 3ZE7A 1U5CA 1BCRA 5DW3A 1E5TA 2XRZA 2FAXA 2GEFA 2JGRA 3LC7O 2X9LA 2ALJA 3EIWA 1L5MA 4NMHA 4D3ZA 5DLYA 3WYDA 3AUFA 2PWBA 5AXCA 2O0JA 3WMEA 2CYAA 2AFVA 4HF7A 4H7JA 3A9RA 3Q12A 1CR6A 2QLNA 5B1SA 4CQMB 2C2HA 4HVCA 1EJ0A 5HKKA 1C7JA 1GPLA 3ILHA 3UAXA 2AH5A 3G82C 3UUGA 2CXPA 1TJYA 2FFHA 2XGGA 1QCCA 2XUQA 3AF4A 2AVDA 3HN7A 4HJRA 4WESA 5KAMA 2F1JA 3M3HA 4LKOA 3BWDD 5EZSA 4BQPA 1Z6ZA 3LHDA 3PDJA 4HAYA 5DBFA 3ZHCA 4D7AA 2YUTA 4H0NA 3D6FA 2CVPA 3FM9A 5AW5A 1NMZA 3VTKA 1E79A 3L07A 2HWWA 3TZCA 1ZYUA 5HOQA 1OXVA 2GA9A 4Z4IA 5A3QA 1CDDA 2BBSA 2J09A 1Y1TA 2L18A 4JQOA 3QHPA 2Q6KA 4G36A 3IODA 2ODQA 1BE6A 3BXHA 5AHOA 5EIWA 4R1TA 2Q99A 4FGWA 3IXLA 2FPPB 1U3GA 4MRMB 2ZITA 1MJNA 1ST2A 1UPCA 5AKXA 2JA1A 4WECA 4QXOA 4B9EA 1AXRA 1L1QA 4YRAA 4PONA 4IHJB 3SDSA 1Y3HA 3AIIA 3DLHA 2C9OA 3BHIA 4J0GA 4RTPA 2R1VA 1HXHA 4NMWA 1JR4A 2QJFA 4OQYA 2PUFA 3PWSA 2CNWD 2DOKA 2PS9A 5EZYB 3KPYA 4P82A 2Q0SA 5ULLA 5BSVA 1A69A 5CFPA 2QSUA 1H1DA 5LXTF 2FWMX 4L22A 3ZEIA 4ND3A 4HZIA 1XHLA 3V4ZA 3Q2OA 3OI7A 2FF7A 1C7IA 3FCCA 4PRZA 3IR6A 5FH9A 2X2EA 1HEYA 2IY9A 3GMDA 4YBRA 4G09A 2K2QB 1N3LA 1CRLA 1QTNA 1T4DA 2BF7A 3GK3A 3MWJA 4MVJF 1YL5A 2NTEA 5CGZA 4AMGA 5I5EA 3HJHA 1GZ7A 1H0SA 4IH1A 4IQ0A 2BMJA 3FFWA 1O97D 1TUIA 3S2SA 1NXQA 3TXXA 4XWOA 1F7VA 3PCXA 1A4IA 1YZKA 5BV7A 1M6WA 1KI6B 3FCAA 1XU9A 1GPMA 1G21B 2G88A 4R4JA 1JHDA 3O8BA 2GTHA 3WJ7A 2OE2A 3EIFA 2IEZA 4B87A 4YV7A 3JYHA 1ZRHA 2W2KB 4IVQA 2VDNB 4NDAA 4ZQGA 3KR9A 3BHNA 2I6UA 4DSUA 5LU9A 3EUWA 3ZQKA 4DRXB 1H6DA 1M33A 4FR2A 1XD9A 3MWKA 3EARA 4MCJA 3ADPA 5FOTA 1QQ5A 3HY4A 3SC2B 1PD1A 4GSLA 1RU3A 3GMTA 3OPMA 3GBPA 3TH5A 1LDMA 3L41A 1ZMBA 4OATA 2D2FA 1JB9A 2Q2NA 3M2TA 4MV0A 2O8BB 1YS2X 4Z4CA 3INTA 1ZJWA 4R71A 1IQ0A 2XE4A 1N0HA 3WIEA 1MO6A 2E5LB 4QARA 1RCFA 4UUOA 2AYZA 5JI3E 3LS2A 2DWCA 1EZZA 3A9TA 3LPNA 4WESB 5EG5A 5IT9A 3UPDA 1NBME 3BRWA 1YFZA 4KYUA 5CDFE 5D5HA 3S0JA 3RO7A 2VHCA 3Q40A 1XFDA 4RPKA 2NZXA 3GLRA 1DU4A 3D2LA 2GF2A 2YW2A 3ORFA 3QRWA 3R3YA 3IAS1 4JK3A 4LOKA 3A8TA 4D4JA 2A1TS 2JRCA 4V0LA 4HDRA 4QRHA 5EHGA 1PE0A 1B1AA 4ZAXA 2ZRDA 5LP6B 3H83A 1AZWA 1QIFA 4M7RA 3P71T 2PQ0A 3ZY2A 2DQKA 3PF9A 3D8BA 1RXEA 3CO0S 3LA6A 3EAQA 1B0AA 3LCJA 3LVQE 3QJYA 4MAAA 4OMUA 1MRSA 2GXSA 4LMPA 2JAHA 3T52A 4EW2A 1XMIA 3H6GA 2ZRAA 3N2KA 4KQ9A 2PQ6A 5ALVA 1PW7A 3BE8A 1PZXA 2QX4A 4RPIA 2I7TA 2VA9A 3F6SA 1ZBQA 5MFPA 2RHLA 4MMZB 1EPUA 2YBDA 3RTEA 2O6LA 1Z0FA 5CDYA 4PTLA 4DWOA 2FSHA 3G2HA 4XEHA 3QEKA 2PE5A 3LY9A 1AE1A 3FN4A 4GSKA 1TA0A 4DG5A 4KO4S 1JIJA 4UJ3A 3MGCA 2Q5HA 5TS2A 2HFJA 1GCAA 4JYAB 1G64A 3GW8A 4KFUA 4N48A 2REQB 1K5HA 2C92A 5JR3A 1SB8A 4IQ8A 3L01A 1ZHFA 5LLDA 2C78A 1AGRA 4JXZA 1W4LA 1J8VA 3EA4A 4LJYA 1JAZA 3OMXA 2O8EB 3NZEA 3PJDA 5L4SA 3NPAA 3OPYI 4KWEA 4QUJA 5LMCA 1TPYA 4HSGA 1A27A 5DH9A 3TX6A 5THQA 4COOA 4KIWA 1OHHA 2Q3MA 4Z9BA 4P7KA 4BIMA 1EFLA 2ZJFA 4YFVA 1Y6GA 2DJ5A 4B75A 4AIRA 1ZP6A 5KYYA 1ZH4A 4AQDA 1IN8A 3C4QA 4LQDA 1VJ0A 1XNHA 3ZV5A 4WN9A 5JAPA 5F33A 1V6SA 2P62A 3H0EA 3MGAA 1IJEA 3EGWA 1GUAA 2IOFA 5EJMA 5FOUA 3A1UA 3WMFA 3BB3A 1WCIA 2JH8A 4IXDA 1L5ZA 1OI4A 5M29A 4KXMA 2IS2A 1ZJ6A 2OXEA 3WWEA 3AU9A 5JIBA 3RF7A 1CYEA 4YRBA 2HK8A 3R3VA 2ZE6A 3E4CA 1JT2A 3IE0A 4W9MC 1OB2A 1ZK1A 5FUXA 2B5VA 1UMCA 1FXSA 1WHSA 1JXOA 2NU7A 2IXDA 2O06A 3BMQA 3D2BA 2ZT7A 4PZZA 4Q18A 2UYCA 2O8BA 4GLLA 2PX2A 1NKSA 2J6IA 5FA6A 3BHJA 4ZIRB 2FMTA 3A6DA 2PKCA 1Z74A 1ZFNA 4X6UA 1R4NA 4D3XA 1IBRA 3K1ZA 3EVNA 4Y1GA 4NMLA 5HE8A 4E4RA 2O2IA 3EFBA 3T5AA 4DM7A 3LRPA 2HT1A 2I67A 1EP2B 4NVRA 4UVHA 1CZOA 1Y81A 5F7JA 4CWAA 4I9UA 1MV5A 1IXKA 3PWTA 2NIPA 4EYGA 3GNLA 5A3VA 1TJ5A 4ARZA 3ND8A 4FSDA 2BGRA 3BWEA 4MYRA 1JDVA 3NWJA 2IU0A 2FWNA 2WJGA 1VLJA 2QI9F 4OJKA 1UJ6A 1CDZA 2OGZA 4FKMA 4OM8A 5COQA 1OU4A 3GJ6A 4IINA 5AKLA 2FOIA 2V8BA 3BJZA 1U2GC 4ZU3A 2J0UB 4JLNA 3I3SR 5DCWA 4BQOA 5CVDA 2DGDA 4Q1FA 5FPHA 1EVLA 1K27A 2RHHA 3I9V6 1Y3CE 4FFDA 2NTYC 3CH4B 1CR1A 1KMQA 1VRWA 3BWCA 4KE7A 1EQAA 2OENG 4J0FA 4GR9A 2WHPB 2WSSD 2BHNA 1VLMA 2QNBA 2XUHA 4L0CA 4YCLA 2AN5A 2A14A 3S1AA 2EBWA 4QHSA 5K9ZA 1F20A 3NRJA 1EP1B 1K7CA 1P73A 2RHWA 4RVUA 4COKA 1NJ5A 2DERA 1E2GA 2PS0A 3PD7A 1QHIA 3JASA 4MA4A 3U17A 3ZNNA 2ETVA 5D85A 6LDHA 2E2WA 1ISFA 3EHEA 3JR7A 5FWYA 3ZU6A 1GG2A 3I8SA 4B82A 4TTSA 4K87A 3GX1A 1KGDA 2YOFA 4H7PA 3PGXA 1X92A 3B9BA 4QRIA 2PANA 1BVHA 1E2IA 1E2HA 2ZT6A 3LDHA 1I33A 4Y9SA 3GEMA 3RSCA 2CMGA 2PD3A 5KQSA 3TI7A 2GESA 3MBKA 4DLSA 5LP1A 3ZHVA 2PX4A 1FU7A 4JT2A 3V3KA 2IE0A 3VGJA 3WQBA 4RTJA 2RHMA 4X95A 2NWQA 4B85A 1T0BA 1A5ZA 2GDZA 1RP7A 5BWLA 4PWZA 4JODA 4ARAA 5AVSA 3OLVA 1Z34A 4KEAA 3DUFB 4B79A 4J91A 3ZCQA 4BTLA 1PS8A 4GPBA 3VNSA 3W7AA 5F1YA 1PD0A 1DV1A 4ZMSA 3DR3A 4MNTA 3BQ9A 1ZUWA 2XMZA 4GPAA 4Y0NA 2A2ZA 4Q4AA 1KEWA 4MO9A 1JG7A 4D9KA 1JL3A 3WE7A 1E6KA 4Y67A 4CIAA 1OXKB 5AKIA 4NAUA 4AS1A 3I5AA 3V2UA 4C0LA 1XXHB 1E4EA 2Q41A 3A6EA 4B43A 2GM5A 3C4JA 3EZNA 3R1IA 5C31A 3THYA 4GBED 5LWHA 2BMFA 2VPPA 3C3KA 4DARA 3ROGA 3R9XB 1YE8A 1BYIA 3FUVA 4NR0A 4EFLA 2ES4A 1GTSA 1UJBA 2PPVA 3M6XA 3KJXA 1DAMA 4MOWA 2JFBA 1I4OA 3R23A 4URUR 1QQTA 2HU2A 2NLOA 2OY0A 3HWSA 4LNUB 1JR3E 1V37A 2FW0A 2NT4A 3HYRA 4OHRA 5CX4A 1MPXA 1YQGA 3C3BA 4GI3A 4I0WB 4ER3A 4RMIA 4DR2B 4OBWA 4MV8A 1X42A 3G2NA 2BH2A 1XHFA 3K8ZA 3EVFA 3AIOA 1KY5A 3IALA 1AKVA 3O4GA 3OMWA 5EKTA 4D9GA 1QP7A 1DDOA 2YWFA 1V5FA 2PV0A 1E92A 4LTMA 3AVOA 1O87A 2FSPA 3JARA 3QEOA 1SHUX 2OESA 4LYFA 1Q6ZA 4CR8A 4POOA 1QFZA 5EPUA 2Q4RA 1HT2E 2QX9A 2GX6A 4M1ZA 4MLPA 4D9JA 1FLAA 3FY4A 3M6VA 1KZ6A 1YACA 2G70A 2D74A 3U5TA 1X7DA 1CEXA 4EO7A 3UKJA 1TTPB 3G2MA 1LB1B 1QHHA 4QUEA 3V42A 5CD9A 3U60B 3K9NA 1FRFS 1GUZA 2HDWA 3EEBA 4B3CA 4X20B 2V6IA 1KFKB 4MGHA 5K1ZA 1XC7A 4LSZA 4JVOA 3EEIA 1JFTA 2QJOA 3VSDA 3MN1A 3FI9A 3W2EA 3SYKA 1ABFA 2VAVA 3FPKA 3IP6A 4WQMA 5K6TA 4BMDA 3THXA 1SXJC 2ZLBA 3NUQA 4MGYR 4P80A 5LDGA 5AW2A 1YFLA 1PGPA 4L74A 2QAIA 4M98A 4QLOA 1JP7A 3IB6A 2D0IA 3QVXA 4DYHA 1X1QA 2O3UA 2X5OA 3LCUA 3HJUA 1VBKA 5U1PA 1JDSA 3W6PA 3WB9A 4YA6A 3HBFA 3ILYA 4P31A 1ZR4A 1ZQ9A 3BFXA 2QU7A 5IM5A 4CODB 4QU8A 1FP4B 3HKEA 1HX7A 1USIA 5ALIA 1T2EA 1CIVA 4OF4A 3EEFA 2R65A 4UU0A 2BFMA 4EAAA 1HORA 2JEOA 2W5UA 4PS1A 3GRZA 3QXSA 2VP0A 3MK31 1KI7A 3I32A 4QPPA 4YP0A 5CXQA 4YDQA 3K70D 2ZSAA 3QFTA 1U0SY 1YASA 2C1EA 3JVIA 5AYVA 3WGKA 3AHFA 4ZEWA 4LXTA 1HTBA 5KNCA 1Q0LA 2C1XA 1Y3IA 2OYRA 4F9GA 4BMOB 3PEVA 3QUBA 5TV2A 4BASA 3PE6A 4PLVA 5AO9A 4TVKA 3WAGA 1E79D 1RM5A 1TJPB 4RZIA 1FLVA 3K0BA 4A5OA 2ZVDA 3CJQA 5HGXA 2Q9CA 3I9LA 3UJAA 2GLTA 4HN9A 3V1YA 2W2XA 3MBIA 3QOWA 5ELMA 5KSPA 3ZWOA 3PUXA 3EVBA 3QNWA 4HS9A 1YNSA 1EHIA 2HSJA 2YZGA 4KX5A 1LF5A 3MAJA 4KPFC 4KKVA 2ZIWB 5LM3A 4D6XA 2G71A 4DA7A 5I4KA 2F55A 5C2JB 1N36B 3C5HA 1QORA 4QDJA 3OZAA 3ROZA 4GBJA 2ASVA 1OTYA 2WUDA 3KT6A 2UVDA 3K0KA 1NP7A 5EE1A 3ORQA 2ZYSA 1D2MA 4AXXA 2V0CA 4XW2A 3QXJA 4V0MA 4QTXA 1UP4A 3N0VA 3KZVA 2Y6UA 2HNKA 2JFPA 2X8AA 5ES4B 4UUBA 5DHPA 2ZXEA 3IMCA 1JDPA 3DE3X 5CTAA 3TDNA 4UTNA 2VN8A 3N6RA 1ZM7A 3BGDA 3DVSX 3B12A 3T1HB 3LWZA 1OZHA 2LKDA 3KV1A 4GLFA 2EJTA 3WLFA 4M9CA 2F9FA 1PX0A 5KWEA 1K8ZB 1WOMA 1T4MA 2G7MC 4IX1A 5L7YA 4MMXB 2IP2A 4B3GA 4LNAA 3FZQA 1L3CA 4R8KA 1CXZA 3KS9A 2A6PA 3H4TA 4QT0A 3UOWA 3N2ZB 3AEYA 2A5LA 3CMMA 4L15A 4RLHA 1B14A 1WKVA 3DBHB 3OOEA 4LG1A 5CFNA 1LC3A 3EXEB 1XEAA 3GWGA 3R5HA 4OHVA 2P6NA 2GBCA 1IVYA 4LJ9A 1KHHA 5CVCA 3X1XA 4QAQA 1UK8A 3GN1A 4ZMRA 1V5IA 5DCUA 1BXRB 3K0CA 2HQOA 3MJSA 3TL3A 3H3JA 4B6JA 4NK4A 4TT3D 1CT9A 5HS6A 4CETA 3O4FA 4X7MA 1JEQA 2WHEA 4K1LA 2UZAA 1V35A 2OV8A 3A04A 5LD2C 3QEAZ 2OO5C 3D8RA 2ZPAA 2EG9A 1UKVY 1EGHA 1MAVA 2MIIA 1X7WA 3OEWA 3TEJA 4V0QA 3G6KA 4G0XA 1THTA 4UM8B 3UJ9A 3KPUA 4LJ6A 1TZJA 1SU8A 1I4DD 3W5DA 1T1JA 1Q12A 3KQSA 1JLHA 2QMZA 1PS9A 4B3XA 3B3FA 3KEQA 2ACWA 2Q4DA 2PZLA 2PKYX 2L69A 4HDOB 2QN8A 1ZNQO 4MGIR 4RCVA 3TYXA 4U7WA 4FMCB 4DWWA 4L3WA 2IPXA 2I2DA 1ADFA 5BSFA 1QYRA 1V1RB 2FEOA 5ENVA 4LFBB 3F6RA 4NFSA 4ZC1A 2UU9B 5BRAA 1K6EA 2PLNA 4NZ9A 3ZDFA 2P6RA 2Y0DA 1V11A 1TO1E 2X41A 3P9CA 5JDCA 1G6KA 2OZLA 1IU9A 1OYYA 1CJKC 2VI5A 3Q9UA 3SXPA 4AJEA 2VH5R 4NBTA 4CQLA 1NVTA 4AKEA 1Z75A 4EEZA 3JQAB 4JI4B 1DWOA 2JFYA 4L8WB 2K2WA 2FP4A 3TZQA 3FBTA 2LWIA 3QVWA 4XLLA 1NYQA 1XZKA 3RIYA 4E70A 1UAGA 5DYYA 1ZUIA 1SUAA 2VJYA 2FZVA 4RF5A 3VNQA 5B1IA 5JVDB 4PC6A 3L04A 1CQXA 1IAVA 2JGJA 4P4UA 6AT1A 4KXNA 3VKGA 1EFVB 1QYVA 1UPBA 4CVNA 1PFVA 3B89A 4LXIA 1XXLA 3OAAD 5FDFA 2HSGA 3HFGA 2ZI5A 1UBMS 2AMLA 2FPPA 2BM0A 5DXFA 1A82A 5C8VA 5EJEA 3FDXA 1P2BA 2FQXA 4LE0A 2QRMA 5B53A 3O3OB 4FFLA 3KB6A 2HJSA 1ULSA 1TDJA 4LJAA 3TZBA 4MZDA 4BZZA 4CR7A 3T38A 3JV7A 3MGKA 1IUOA 2WF8A 3ZJ4A 4BMSA 3JTMA 1PEYA 3GLGE 1E9SA 2Q6VA 4BZXA 3ZV7A 5ALRA 4NNOA 3PRJA 2BJVA 3NP9A 1Y7LA 4M38A 4MHOA 4DDTA 3L8ZA 2EHJA 4YY3B 1I3NA 5HIIA 2POQX 4FSHA 4EHJA 4EWLA 1PQYA 4B2LA 4TWJA 2I2WA 1VP9A 2CMKA 3WWDA 3PP8A 3TRFA 5IPFA 3FBGA 1RKVA 3QUQA 4P58A 4BMXA 2W11A 3L0YA 4W5RA 3KWFA 4MW5A 2DE0X 1KPHA 2I6QA 3RSSA 2F3SA 3WGLA 2QTHA 5C52B 1XAIA 4LZZA 4XDHA 3FLEA 1LX7A 3T5DA 2XXJA 3OZBA 3I2HA 3GJ8A 2EIHA 3MWEA 1E77A 2O2JA 4JYCA 5AKHA 3ZJTA 3IR5A 5FTLA 3SNKA 2I29A 4NE7A 1EXVA 5T57A 1E5XA 2I4LA 4H59A 2EX4A 4H0CA 1AKNA 3QV2A 5LA6A 4Z2AA 4FZJA 3M6IA 5DLPA 4H35A 4B3IA 3I76A 4MVJH 2XUIA 5LBTA 3SC2A 3DTVD 4X9XA 4X7RA 2QAGC 3JD4A 3JVVA 5G1OA 1O5IA 4S3MA 4GKJB 3DM9B 3M5PA 4J94A 2ZIXA 4W9RA 4DOMA 5CBKA 5DF1A 5M2QA 2AFIB 5HPYB 1ZXXA 2RHOA 5FXMA 1D8TA 1FFXA 2QNIA 2WT8A 3RKUA 3PC6A 3ZCXA 1EXWA 4QPCA 4N01A 3VDNB 4F86A 2R5WA 1C8VB 5EINA 1YXMA 2R62A 5AOBA 3KTOA 1CSEE 5BN4A 3RUFA 4N7JA 2QRQA 2BUBA 5JCJA 5C32A 5EHZA 3W9UA 3PD0A 2BGMA 3RTCA 2KQUA 2OFPA 2J4DA 2B4KA 4OMCA 1UBCA 4MDHA 2VNAA 4TKLA 3SZOA 4C0JA 2FEAA 5FWDA 3QLTA 1JVSA 1EIZA 3DBIA 3I2GA 3NHMA 1ZJ5A 1UC9A 1UFOA 3HRIA 4BO3A 1SVWA 4N5IX 4ND5A 1QYDA 3PC2A 3THXB 4KQJA 3IP8A 1D07A 1R8XA 1UKAA 2APJA 3HNOA 4HLNA 4QUIA 1GAQA 2GYUA 4IO1A 1RWQA 3Q7SA 4FGKA 5JDCC 3S70A 5TB5A 2YFHA 5JSQA 5F4ZA 2PMBA 4LI0A 1Z22A 3Q5DA 3K6RA 4IJQA 3GEHA 1O0BA 5LZ4A 4Y2YA 2GO7A 1N2JA 2JJYA 3B2EA 4CG0A 1QE5A 3PJFA 1OOEA 1K8QA 1NJFA 4TZ0A 1NBHA 3ZN2A 3W3AD 4AROA 1KXZA 1J0AA 2NXEA 3C16C 5IKXA 2QUJA 4WBNB 3VMMA 1ZLYA 3ZU5A 5EIEA 3FMOB 2P30A 2MSNA 4RHTA 3QFHA 3OUUA 3A2NA 4Z49A 3JATA 4WLEA 1RI5A 4JQSA 2HDOA 2HF8A 2IVZA 2OLKA 3AR3A 3KT3A 1YB2A 5AOVA 3U0BA 5I4CA 1OF1A 5BT8A 3ZV6A 3BTVA 5IYZA 5CT5A 1KSGA 1PWYE 3O2QB 4JP2A 5ALWA 2IS4A 3IJEB 4OK6A 3ZHXA 4M1QA 3FW1A 1DZ3A 2PL3A 1RXIA 2VXBA 5F3RA 4CCYA 8ADHA 1QYCA 1JH8A 2D2EA 4UVEA 1KJZA 1TEXA 5AHKA 5DSXA 3A9WA 1VL5A 4ETNA 4YAKA 4YXFA 2DYKA 1MC5A 3M5DA 2XGOA 4KE6A 2VQ6A 3AX6A 5CG1A 5FX2A 3SC6A 3P4UA 1N9GA 4LRYA 4I1RA 4RIFA 5GGYA 1N32B 1Z6YA 1IN5A 5FNVA 1F8UA 4WGFA 4RK1A 1OBVA 5AVXA 2ZW9A 1LBIA 2G5PA 3DDWA 4MPJA 5FFMA 4YX9A 4LHWA 4TMYA 5TMEA 4AZ0B 4KB5A 4V0OA 3SLRA 3VU8A 3K32A 3FHTA 3MLAA 2QRUA 2NQ2C 3GCZA 1W29A 2DBVO 3BULA 4OA8A 4AIIA 1HFEL 4YP5A 3MS2A 3FLMA 4ISCA 1VSBA 1GVNB 1P29A 4UASA 1Y5NA 4DGSA 3DNMA 1TJ4A 2Z8YM 1XQXA 2YCBA 2ZYGA 4MS3A 1VSTA 3RVMA 3WC4A 1JDBC 5B12A 2OZEA 4UKDA 2AT1A 2J59A 4YCCA 5IF3A 3BK7A 4RMHA 3QYPA 2VCYA 2YFYA 3AR2A 2P91A 5DM4A 5CAEA 2OHFA 4LYJA 5AI5A 2H6EA 4KQEA 4P6VF 3R0VA 3C6ZA 4NICA 3KOOA 3ZQ4A 2H65A 3O0DA 4FI3C 4IMPA 4LCJA 4NARA 1E7RA 5AK4A 5KDLA 2X8JA 4LJRA 1E6LA 3L0OA 1GARA 4DIMA 3S28A 4BC0A 4KODA 1L7DA 4KW7A 4NF2A 3UCFA 4FDAA 4HRVA 3ZVLA 1QQ6A 1NUHA 1XYVA 1Z13A 2C5GA 2ODEA 3OFVA 2GFQA 2RIPA 4EVIA 1FSZA 4G97A 4FYWA 3D3WA 1IM5A 3RV4A 3HP1A 2DM6A 1D9ZA 3SZUA 1C7ZA 4HFJA 1TZMA 2R2AA 3P45A 2NPFA 2C94A 1FTNA 2P5SA 1JEYA 1GQQA 3DOJA 4EUNA 1QZTA 2ZIUB 2PKEA 1DOHA 1RHUA 1TRKA 1N6PA 1XB2A 5DDIP 1FCJA 3LC2O 4WBNA 2BM9A 4RESA 4HS4A 4P54A 5CITA 1U81A 1REQB 2CVOA 1E20A 2V4ZA 3LXXA 4NNPA 2HPVA 4QECA 4DV0B 3KJHA 4KR7A 2D1FA 6PFKA 2GWHA 2XWBF 1IEWA 1YS1X 4MQUA 2ZIVB 4PAQA 3UGTA 5B30A 1ZGJA 2FMHA 1DQRA 2J45A 3PQ7A 3ROQA 3UGKA 1OLXA 1PNVA 1N92A 3FTDA 1LXCA 3L6BA 4OX9B 1NX6A 1RLUA 3UF0A 2F4NA 1GAEO 4B8WA 1T6NA 3FJ1A 3SGLA 3PNPA 2HO4A 4CN8A 1QAMA 1ZLXA 3FTNA 3WYGA 3SM3A 1CUSA 2BFPA 5LQNA 5JWOA 2XH8A 1KFBB 1XFAA 4GXTA 4BJ6A 4KXXA 4IM7A 3IDAA 7ADHA 2X1LA 4G84A 1CUFA 1JGTA 1OJ7A 3FWKA 2J7PA 3HJBA 2XBUA 4KQWA 4DCGA 1Z4KA 5DBOA 1KR5A 2FA9A 4RLQA 5IBCA 2D8MA 1R6UA 3DPUA 1GQOA 3ME5A 1KEKA 3T5PA 1BDIA 4P5EA 3M0EA 1DCMA 4FWBA 3GQBA 1GTJ1 4AUKA 1JJBA 1EWTA 5AM1A 1FF9A 3WRYC 3MINA 4I50F 1F4LA 2GLXA 5H02A 3TLZA 4O4HF 4IYRA 2XA1A 4DRYA 4JKOA 4MTLA 1DKMA 4EKIA 1FS6A 5G2OA 2Q3EA 3JQ7B 3NUGA 1YGPA 1YOBA 2B20A 3ZKWB 3K9FC 5KDDA 3SXUA 4TTJA 3FNBA 3RS9A 3VH1A 2HPZA 1USGA 1K1EA 4NLLA 4YP6A 5JZMA 5EHIA 1VCHA 1D4ZA 3KD3A 1HQDA 1PNOA 1P80A 3LC0A 4TYNA 3HTXA 1T0UA 4DDKA 3PHLA 3IUSA 1P1KA 1WDMA 2PUVA 1IQRA 3AQIA 5F98A 3I83A 4HNUA 3CEPB 1ISHA 2FUKA 2Z83A 2D62A 3D2AA 3C0KA 3GBSA 1SIUA 2WFZA 2A4MA 4EG4A 4U5XA 1ULUA 3ZCRA 2IYRA 2H59A 4PM4A 4C88A 2BKXA 1WU7A 3H05A 1QV7A 3ZWAA 4DJAA 3R0ZA 2DJIA 3DBOB 3TI9A 1GOTA 3GROA 5C1DA 1AC5A 4MQFA 5JVDF 4KC0A 4W6QA 4WBSA 2C5FA 2R5FA 3NHWA 3C74A 4GYKA 3K94A 2DHEA 4IL5A 2GUGA 5HIMA 3T5TA 1L8XA 3JYNA 3TSCA 3FOZA 1GU1A 1PDWA 3CPEA 3HZOA 3BIJA 3CB2A 3EGXB 2BFFB 5K0LA 4AN1A 3RYFB 2G17A 3OTQA 2GPYA 4K03A 5B6IA 4FDTA 3SM9A 2WOOA 4PQYA 2VYVA 1ZR2A 1XZAA 1UC8A 2I3DA 2TMYA 4PFSA 4CDNA 2J4CA 1E1RA 5JTUA 3DBRA 1QX3A 2R6AA 3TRIA 1AV7A 3RANA 1FP1D 1MA0A 1NXPA 1U1EA 4UNIA 3U1BA 2LE0A 1MOZA 1RWKA 4L02A 4AZTA 5BN5A 1SA0B 4RS3A 3W5BA 5J59A 3RBXA 1F60A 1TUEA 1EE2A 4U2CA 3AONB 4UTOA 5EMMA 3KQVA 4DMRA 3P2YA 1R3UA 2FKNA 3NIDB 1IXSB 1H94A 2P9FA 3DE1X 3EXFA 3JD2A 4H6PA 4Y6OA 5FOXA 2HOQA 4YAEA 2IDMA 2Q6TA 1QCZA 4UCWA 3R24A 5EKSA 4BQFA 2I76A 1BQ4A 4ZK6A 5EESA 5TXGA 3I6QA 5JMTA 1OJLA 3EF1A 1J1IA 3B1JA 2FFAA 4LPKA 4C0KA 1EFKA 1GKUB 4YGYA 1EGAA 2RH9B 2B36A 4B76A 1T3HA 1AK9A 2BN4A 4YRFA 1CE8B 1RKQA 2QNRA 3X1YA 1XV5A 1US8B 1YUBA 1NPYA 1EG2A 2JHPA 2ZBUA 3LQ4A 3U80A 2R7NA 1WBBA 5K0EA 5IVHA 1BZYA 1VPDA 1QR2A 4OMDA 2QTNA 2X5NA 4MYTA 3R7LA 1CHNA 3U49A 4R1MA 2VAPA 4O1IA 4FYHA 3VAYA 4M83A 4HYEA 5J5AA 2QENA 1UKCA 5JADA 2PIAA 3DEFA 3VVLA 2PQMA 3H8SA 1JXAA 2O0KA 1W581 3FD8A 3IPLA 2MSDB 3KYIB 1UIRA 2Q4TA 3QMVA 3T9DA 5JQGB 3VV3A 5KYWA 3KB2A 2AK3A 2FPUA 3RNOA 4D3SA 5I9IA 4ZOQI 2GK7A 2BSAA 3IPRA 3O8NA 4HNGA 2X0EA 2XY4A 5FUBA 4JU8A 3DTVB 1SUCA 4JB8A 1RBQA 4R1OA 4HMOA 2XITA 1RR6A 3QTTA 1DQNA 4Z5XA 5JPCA 3C6MA 3U3XA 2QLJA 4IICA 3DOUA 4CCYB 1QIIA 3NEAA 3PUWA 1AU9A 1NN3A 2D7DA 1RQ7A 1ACJA 3KUUA 4Y1EA 4CQNA 1RLTA 1C9EA 3CZQA 5A0TA 1DQPA 2RHTA 3FTCA 1AN0A 3G6WA 2I2AA 4KUGA 1CU1A 1N5LA 2OO5A 3PEFA 4CKBA 3H6KA 3HXMA 3FZGA 2E89A 1C0KA 2FU5C 1DQSA 1XK6A 3MOGA 1ZD1A 2DY0A 1WSWA 1IMOA 1PQUA 2AF4C 1HDCA 4ED9A 3FFXA 3GLFB 1HKUA 1U65A 1MJHA 1Q20A 4NY1A 4Q3EA 5F35A 1U7TA 3SHWA 1VI6A 1E6CA 5ICGA 5INTA 5AIBA 1L5OA 3H1GA 4EPVA 3PC8C 5B6JA 3RJMA 1PR3A 2VZ0A 5GZ1A 1XVVA 1JHQA 2CZGA 4GX2A 3RH0A 4BNWA 3PR1A 1U0RA 4QAJA 2JVJA 3G8YA 4QGSA 2JKYA 3ZXYA 3EF3A 3CF0A 4UEJA 4BL5A 3R3HA 1EFRA 1MAAA 3OE1A 1TUGA 1IXZA 1EUCB 3GFTA 1H1TA 1GLNA 4REQA 5ALYA 4YONB 1EX7A 1S3IA 1DC6A 1FDUA 2ZT8A 3VR3D 4DMMA 2RGXA 2EWWA 2ERCA 3T7CA 2YIDA 4DDUA 2D06A 2B5WA 2FW1A 1IY2A 2OCYC 2J5RA 2TMKA 2P2NA 3VVCA 3AOGA 1QRUA 2PH7A 2X40A 4ICIA 5EWLA 1B8UA 2HYDA 3Q11A 4BBAA 1ZG3A 1LU9A 4UXIA 4EY3A 4Q0MA 2YC4C 2WVAA 3B1YA 4Q24A 4XAQA 4QYSA 5ADWA 4IHKA 2EFYA 3DVQX 2QX7A 1EK5A 1G20B 1GPAA 2BONA 3U1TA 3U7QB 3ROXA 3DD1A 1O95C 2INGX 2P7IA 3MA0A 4MWOA 5TQ0B 3RHZA 1XU7A 2HXYA 4R1NA 2N3ZA 3LX4A 3S55A 3VZSA 2AOUB 4WZAB 3TR5A 2WILA 4DMFA 4F06A 2GXAA 1NA5A 3QH4A 3OCWA 4C4PA 2AG8A 2OXFA 4I4CA 1ETUA 3GP8A 4YNBA 2DR0A 3DQQA 4NE9A 1I3OA 2JAUA 4OHBA 4QGAA 1II9A 4W1RA 5C4MA 1NASA 4E3WA 1CB0A 4QD3A 2AK2A 2VKTA 3CPJB 1DBSA 3WK8A 1E1YA 3FHOA 5COBA 4JC8A 1IRIA 4Q1DA 1TRHA 3KVVA 5C3UA 5AUOB 1SXJE 2MSWA 3DT6A 2A33A 4J9VA 4XWYA 1T25A 3OA0A 4F0JA 1UBFA 3W5AA 3SJ7A 3U4IA 5DASA 1NW8A 1TB4A 1AHNA 3FUXA 4W6ZA 3DZHA 2PY6A 2ZUDA 3DPSA 4EA6A 5T7BA 4NULA 2YWCA 2FCAA 2J3HA 1K97A 1TAHA 1DADA 1WE2A 3AV3A 3B6ZA 2Y9MB 3PT5A 1CCWA 3PHBE 1XCLA 1HE3A 2H3EA 2PBLA 1E1KA 4M1WA 2P6OA 3LBFA 4G07A 4XQGA 4EGCB 2ZB2A 4UVGA 4NI5A 1Q3KA 1XRQA 3PI6A 4KQGA 2WVGA 4N82A 3IOEA 5TMPA 3VH4A 4HRYA 4KN8A 3EISA 1Z2DA 3FXAA 2FQYA 4HWGA 2W6CX 4KXFB 4XX1A 3SF8A 4ALJA 4C0SA 3PSAA 3V7WA 2IHVA 2OK8A 4ADSG 2AKAB 4CM3A 2VQFB 1Q11A 4NBLA 2XAUA 3N6XA 5J2UA 1GSHA 4Y6PA 2JHFA 5A9TA 2NUAB 3VOAA 4CGZA 4KGXA 2IYAA 3F3MA 3CB4A 3ZWCA 1K7YA 1EDZA 3ABIA 3QF7A 5AHRA 2BKLA 1P2SA 2FYTA 2UUOA 3T6KA 2G28A 2Z98A 4EVRA 1HDEA 2OAEA 2X23A 10MHA 4HNRA 2Q6LA 1TU4A 3VR5H 3UXYA 4XVCA 2X86A 4A92A 3NMUF 2FWJA 1UPTA 5DWQA 1H6BA 2EL9A 1ULTA 1MTOA 2B92A 3W0LB 2DWPA 1SY7A 3ENZA 5FYQA 4CDRA 3KR2A 4D44A 1V96A 3A4YA 4ZV9A 1O89A 3OO1A 3DTYA 5AW8A 3EGDB 3UFXA 4BIIA 1Y48E 4IR7A 2C95A 1I01A 3DBVO 5FBKA 1T34A 3KDPA 1C7EA 2BR4A 2RD2A 2GARA 3ZIUA 4LSMA 4MPTA 3WGMA 3OFKA 1DAOA 4X3OA 4ZPXA 4QG7A 4MUHA 1HQYE 2G77B 2J3LA 4UXJA 3T5GA 2IDZA 3NHLA 3N3AC 2HXSA 1JNYA 1KHTA 2IYNA 4B44A 3FVWA 3CZCA 4P08A 3SQWA 3OETA 4GEKA 3NYIA 3PFBA 5LDHA 5FR2A 1MORA 1KQFA 1QFMA 3KIPA 3LBIA 3LSYA 2C58A 3GO4A 3KSZO 5BMVA 3G0OA 3I8XA 3Q3GE 4YAJA 4WY5A 5IT5A 2ZXUA 4J7CA 1ENOA 4GUAA 4BNDB 2SNIE 1CS0A 1HDGO 3UAZA 4AMZA 4ERNA 3PNYA 1RAFA 1QH9A 1TGYA 4BX3A 5ED0A 4WDQA 4ZEMA 4DB4A 2VZ8A 1EZ4A 1O6FA 1BXRA 5ILQA 5IBPA 3LX6A 4QYTA 3NC0C 3ZD9A 1VG9B 2I4RA 1N8KA 1TKRA 3A1VA 4FWTA 2PS1A 1SHJA 2JGLA 4GDMA 9LDTA 3PD1A 1MQ8B 1YQDA 1WV1A 1NBAA 3L0BA 1G20A 3GRCA 4YAGA 3GT0A 3TIVA 5CJJA 5HWSA 3KJFA 3RS0A 2X9NA 4KWIA 4C04A 1PJ8A 2X8LA 4NCIA 5ALPA 2A3RA 5AJHA 4DUZB 3WZMA 3S1SA 5LZ8A 2A5YB 1QU3A 4GI5A 4TN1A 2RIRA 5DT9A 2HC9A 2PRIA 2V97A 4PHCA 3A32A 4HWRA 3HEAA 3UC5A 3H1EA 2G7ZA 4XD7A 3SZ3A 2O8EA 4DJ5X 4F1WA 3FNQA 2XMSA 3N8KA 1JTEA 2Q9AA 4HWPA 1W5TA 4RVSA 1U8FO 4HDMA 2XQFA 3K5HA 4CMCA 1T6XA 4CEIB 2AMJA 2HU5A 5I4IA 2BFEB 1LD3A 4CHGA 2GVDC 3VPXA 4Z7JA 1T5OA 4S05A 3VDRA 4IUDS 1XPRA 2GZ1A 2HBQA 5CFOA 5K3DA 4X8MA 5ALTA 4B6SA 1H22A 2H2FA 4FKZA 1EK2A 4G1FA 3TK1A 1I9GA 4US2R 4KIJA 2BHLA 2QPOA 3WIVA 3BZUA 1KAHA 1YS9A 3ZZ1A 2QSYA 4BX8A 1R37A 4UNPA 1DRJA 4JGBA 3MIZA 1DFGA 2BZ0A 4QRDA 2J9GA 1EUYA 1LWOA 2GN8A 3ND6A 4RV9A 3JVUA 5FR1A 1YQEA 2IZZA 1YOVB 2VRBA 3L93A 4JCCA 5ITWA 1H2EA 3C5VA 3HA5A 2O14A 1H42A 1KMHB 3LBAA 2IF0A 3NORA 3BE4A 4I1YA 4C4TA