4CM5A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
250
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 94
structure length 250
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm5A00
3CH6A 3ZW9A 3GA0A 3Q9NA 4MVJI 1Y8QB 1GEGA 2OP0A 3FNEA 4E32A 5DP2A 1HDOA 1TT5A 3KOUA 4DLLA 3GZNB 4NBWA 4J1QA 3H9EO 3ZHXA 1HL3A 3GRKA 4R1TA 1GTMA 4IS3A 5BT9A 4FJ0A 2Y1OA 3ZWYA 4E2YA 2CSUA 5BNIA 5A1TA 3NGXA 3LU1A 4DBZA 1LSOA 3WGZA 1XU7A 4WJZA 1LRLA 5EQFA 4PG4A 5CDTA 3U09A 2EJWA 5JAQA 1ULUA 3P5SA 1QLHA 3R6DA 3A06A 4J43A 4BKUA 3GN1A 3ZGYA 1JA9A 2B35A 4EUHA 4NU6A 3GOHA 3TZ6A 3OP4A 5IDXA 4OO3A 4MVJG 1B3RA 1AE1A 3W4JA 3INRA 4UUPA 1N8KA 2A94A 3SVTA 1N1EA 3WSWA 1HXHA 2DU8A 4AVYA 2UDPA 1I32A 4PN3A 5DCYA 1H0KA 4IGEA 1LLCA 3TRIA 3VZSA 3QIVA 3U5TA 3ST7A 2EW2A 2XXJA 3EY4A 1YWGO 5EMHA 1ADFA 4NK4A 4LCJA 1QSGA 3ROQA 1IE3A 4DA9A 3FTNA 2A92A 4ZICA 2E37A 3DOCA 3PP8A 2WTBA 3E18A 3ETGA 3TDKA 1X7DA 4I8XA 1W0CA 2O4UX 1CF2O 4CM4B 3ZWWA 1AUPA 3DBLB 5A03A 1KETA 3INGA 3GG9A 4BO7A 3RCBA 5KVVA 5JAIA 3L4BC 1C1DA 3WDSA 3LLVA 2PKRA 4XRRA 1BG6A 2J3IA 3ZHYA 3IQDB 4YCAA 4FJ1A 3WMWA 2WSBA 4EJ0A 4Z0PA 2O2SA 4E31A 2G76A 5JS6A 1T24A 4GQAA 3I9OA 1O6ZA 3PVZA 1YQDA 3I5MA 3ANLA 5GZ6A 1ZFNA 4RVDA 5F3RA 1GYRA 1J0XO 4CR6A 1OC2A 3RC7A 4BNNA 3GPIA 4LN1A 4NR0A 5GZ1A 5JY6A 4OYRA 2FN7A 4XYBA 1Z7EA 5G4KA 3DAFA 4K6CA 4FC6A 3WGHA 3QRWA 4GL4A 4DC1A 1FK8A 2POQX 5DF1A 3V2GA 3WX0A 4B4OA 4TZTA 2VHVA 2ZTMA 2OUIA 1LRKA 3JYQA 5GZ3A 5K6AA 1H6BA 2J3KA 4J49A 3RC1A 2UV8A 4OMUA 5I9MA 2D0IA 1UXIA 3WNQA 3ULKA 5CEEA 3DBLA 1H6CA 3M2TA 3AW9A 3G1TA 4YWJA 4BL5A 4IIUA 3QWIA 4A10A 1ENYA 4Y98A 1DLJA 4A5OA 4DBVO 3NTRA 4W99A 2NVUB 4IDCA 1MX3A 1YO6A 3JQGB 4GWKA 4QECA 4XYLA 1NPYA 4EUFA 3C1TA 2P91A 4FFNA 3EYWA 1HE4A 3W1VA 4IQ0A 2JAPA 2Y0DA 1DDOA 3EAGA 3ZV4A 3UXYA 1QORA 4MPDA 3DC2A 4UEOA 2B36A 4ZJUA 1A9YA 3I9LA 2BKAA 3DFUA 3S8MA 4RORA 4GLOA 3AY7A 4BNWA 3E82A 1QYWA 2NTJA 3WFIA 3DL2A 2CFCA 2X1HA 4W6ZA 3VTZA 2EERA 3HADA 3FTPA 4JIGA 4FGSA 1U3WA 1U8XX 3ZHZA 4BIIA 3Q2KA 5CAEA 3HSKA 3K92A 3FR8A 4AJKA 2ZIZA 4PG8A 4JCOA 2EG9A 2CVQA 3BTOA 2RBEA 2VUTA 3KO8A 2X0NA 2NSDA 3PGXA 3PYXA 2HDHA 4CMBA 1MA0A 2GN6A 3DONA 1L1FA 1K0UA 1ZK0A 2H63A 5A9RA 3KSZO 3SEFA 3RKRA 1I5RA 3VPXA 1R0KA 4BS9A 4UUNA 3PTZA 3ZWOA 3H5RA 4TROA 2JFHA 4OSOA 2CDAA 5JAMA 2NTNA 1HZJA 3D5QA 4MVJE 2E6UX 4PLFA 2YJZA 1PX0A 1UZMA 4J91A 5AXCA 3E9NA 4DUPA 2HKIA 5CEFA 3F1LA 3VPHA 3HDJA 3PWZA 1HDYA 1YQGA 4CLOA 5AYVA 3Q0EA 3VDQA 2VZ9A 3TPCA 1NASA 4RL6A 4K6FA 4FN4A 4RCVA 1MXHA 1GV0A 3RC2A 4YJGA 2YDYA 4DVJA 1HT0A 2GGSA 2FR8A 3JV7A 4XQEA 4A73A 4PG5A 4PLHA 3PGJA 5FFFA 1IPEA 3OJEA 3GFBA 3GPDG 3PWKA 1B0AA 3OIDA 1A7KA 3D7LA 3WQSB 3ZCXA 1U7TA 2GDZA 8LDHA 4DLBA 5T8KC 4F3YA 2E4AA 3RUAA 1JW9B 4FB5A 4BKPA 1W6UA 1XGKA 4KZPA 3U4HA 2JFGA 3ZWAA 3CZRA 1GUZA 3M6IA 2JCVA 4IJVA 1SMKA 1CQJA 2EJVA 1GUFA 1IYZA 1YKFA 5C5IA 2O3TA 4DYVA 3GGOA 3B70A 4H7PA 3BTSA 3ZI0A 3QSGA 1GZ4A 1SB9A 4FQ8A 5A5FA 1LDBA 1W8DA 3P7MA 1R6DA 1UH5A 4L73A 1HYHA 3GNTA 3N74A 1I36A 3C85A 1NPTO 4WCFC 4P4LA 4CMEA 3U49A 4IQ8A 4GBJA 4FGWA 3M1AA 3KYDB 1EVJA 3GGGA 1ZSYA 2VRCA 3OJLA 1DAPA 3RROA 4LSWA 1IZ0A 4MVJF 1PIWA 2SCUA 3KV3O 1ZSNA 1W4ZA 4U0KA 3JYOA 2X5KO 2TMDA 4JBHA 1HRDA 1V3VA 1ZK1A 1E1LA 1KVQA 2Q50A 3WBBA 1K5HA 4IDEA 4Q39A 3WSVA 3DZJA 2I66A 3QJ5A 3TN7A 3PQFA 4O59O 1YL7A 3O9ZA 1RM5A 1WWKA 3OA2A 4JJFA 2VYNA 1ADCA 2HJRA 4JN6B 5IZCA 5FI3A 1PS8A 1NP3A 2X6TA 2X4GA 5G4LA 3RU7A 5I9NA 1K89A 3L4BA 1YB5A 4Y9DA 4E5PA 3PEFA 3JD1A 2I5PO 3CINA 3U4CA 1OOEA 3PZBA 3WICA 3PZRA 1U3VA 4ND4A 1DJQA 1Y81A 3L9XA 1ZBQA 2JFFA 3K96A 3M2PA 4DLAA 4DPMA 2JJYA 4B8ZA 1Q0HA 4WLOA 4GAEA 2VWPA 1A4UA 2QX7A 3RWBA 3ETDA 3F46A 5FYDA 1EK5A 4CLEA 1H9BA 2Z1MA 2AQKA 3D0OA 1PGQA 3D4PA 3DBHB 3MCVA 4ZVVA 1G6KA 2NTVA 3WYCA 3PK0A 2GF2A 2QHXA 2Q4BA 1RKXA 3JQFA 2BGMA 3DAGA 1PWXA 2Y66A 4FFLA 1DPGA 4A0SA 3RVDA 5A9SB 3V1YA 3DB2A 5IFLA 3VH3A 3ADOA 4NBUA 2BI8A 3DMTC 3W8EA 4CUZA 2Q49A 4ZQHA 1I2CA 5AQ1A 3AUUA 3CE6A 3RBXA 2ZYDA 5T67A 1GYPA 4B7XA 2P9GA 4XIYA 4GX5A 2VHXA 1NBOA 3FSRA 2UYYA 2DTDA 2JCXA 3NV9A 3ONDA 4GKBA 1NR7A 4WPGA 1UDAA 4YRDA 3OSUA 1RM4A 3QE3A 4PZCA 1RM0A 5FWNA 2CD9A 2VWHA 1YQXA 3JQAD 3RC9A 4MJLA 4Z3DA 4TRRA 5TSDA 3PFFA 3RUDA 1BXZA 1VJ0A 3JQ9C 1YDEA 2OO5A 1DHRA 4PG7A 1UAGA 3WS7A 4WEOA 4URFA 3PDUA 1CEQA 2BFAA 1XA0A 1P1KA 1MXFA 4Y8VA 2WD7B 5BNTA 2DPGA 7MDHA 1BXGB 3QVWA 3IJRA 5CDYA 3I9JA 1E3JA 3PYLA 4W4TA 3GN2A 3MTGA 4ZQBA 4I9NA 3WLEA 2LDXA 1YOVB 1G0NA 2Y68A 1Y8QA 3WWYA 5A06A 3I1JA 3KYBA 4L4RA 3F4LA 1KS9A 4B7UA 5JDIA 3E5RA 4PLPA 3S2GA 2RHCA 4MINA 4ALIA 1PGOA 3BAZA 4CV3A 3QP9A 3VPSA 1XG5A 1F0YA 2WM3A 4NJMB 3WFJA 3WYBA 1F12A 3BMNA 3UKOA 4CQMB 1IULA 4WNIA 4E33A 3FWZA 1C1DB 9LDBA 1LQTA 3HHPA 2GN4A 4ZGWA 3I4FA 4K9DA 4XJSA 1LX6A 1M67A 1Y5MA 1Z73A 1P1JA 1OZAA 4R3NA 1E3WB 4CLOB 4O0LA 5IDYA 3L07A 3SX2A 2VNSA 4WLUA 4BHTA 2J6IA 2W98A 1WDLA 2AE2A 4LGVA 1VL6A 4MKZA 3QA9A 4YQYA 1TT5B 3F47A 1R12A 1E5LA 3IKTA 3AK4A 2FOIA 3JYLA 5HA5A 3GC6A 5IN5A 5B4TA 3HN7A 2C82A 5EJ2A 4G2NA 2YDXA 5JY1A 2W2KB 2I6TA 1IHXA 4D0RA 1MFZA 4RLSA 3GVIA 3KHUA 1JQBA 3ZU2A 2ET6A 5A9TA 3RJ5A 1A5ZA 3GZ4A 4XGNA 2H9IA 4HV4A 3ZH2A 4DXHA 1QRRA 1FJHA 1LU9A 4W9NC 2JKVA 2WJPA 4L74A 2Y0EA 3H8VA 4KP7A 2DUUA 3O26A 3E48A 1U3TA 4QFCA 4WECA 3JQCA 5EESA 3UFXA 5KKAA 4L76A 1DJNA 1JAYA 1SEPA 3PJEA 5IG2A 5I7EA 2ILTA 3Q3CA 1YH3A 1ADBA 1HE2A 2QIOA 5L53A 1EVYA 1HETA 3F3SA 1YE3A 3ROKA 4J1SA 4XYGA 4DQVA 5HS6A 2Y05A 1B8VA 2QZ9A 4BB5A 5L40A 1HSOA 4JBIA 3QW2A 4LRSB 4BUCA 4CQLA 1DIBA 4IQGA 5AXDA 4UEJA 2TMGA 1PR3A 3CEAA 3ENKA 2CZCA 1YL5A 4D42A 3ZU5A 2HU2A 3W4KA 5A4DA 5HWSA 2X8LA 4B4WA 4CR7A 3PXXA 2PK3A 4PCVA 1OFGA 3DZIA 3VTFA 4BNFA 3K8ZA 4TQGA 3LC2O 2VWQA 4YR9A 3LF1A 1KVSA 1UP6A 3ZNPA 1V3UA 3JQ7B 1NWCA 1YB1A 4PLCA 3HDQA 1HE3A 4IJWA 2CVZA 3W6ZA 3WGOA 1IOLA 3I3OA 5TRTA 4BKRA 5CG2A 3TWOA 1LSJA 5IZ4A 1QV6A 4YEDA 2VRCD 1TA4A 3UUWA 1GAEO 1DIRA 1NHWA 1PJ2A 1PJLA 2JD1A 1DRVA 3QWBA 3MJ4A 3TL2A 1W73A 3GVHA 4R41A 2AEMA 1Z6ZA 3FCOA 1LSSA 2DTXA 1PTJA 1U28A 2GO1A 4QX6A 1NXQA 3D1LA 1I33A 1PQUA 3K5PA 1KEUA 5IF3A 2PZMA 3TFOA 1X0XA 1PWZA 4TKLA 1P9LA 1V9LA 3MZ0A 1SB8A 4UUOA 4BQRA 3WQQA 1B3BA 3NT2A 1VM6A 2P9EA 4YJDA 5AVOA 1A9ZA 1PR9A 5CEJA 3PLRA 4FDAA 1XQ6A 2PNFA 5JLAA 1DSSG 2NLOA 2O3UA 5ITWA 4HUJA 3STHA 4DL9A 2OP1A 4MIYA 4JK3A 1LA2A 1EBUA 1C14A 2DM6A 4FSHA 2I9PA 5ADHA 3BHMA 3L6EA 4OQZA 3LT2A 3DEYX 4RVGA 2AA3A 4ZQFA 1Y5RA 3C8MA 4C7JA 1JKJA 3GDFA 3HDHA 3ZV5A 4DPKA 3EVTA 3WQRA 5C3MA 2X9GA 1Q1NA 3E03A 5C7IO 5JSFA 1U4OA 2OOSA 4AJLA 3QLJA 3TQHA 4BO6A 4WLVA 2V7PA 4YAKA 4JXKA 5DOZA 1PZGA 1ZNQO 2A9FA 2HMTA 1QP8A 3WBFA 4PIVA 3EDMA 3VHRA 1X15A 4FD3A 2DBQA 1EE9A 1BDBA 5IXYA 1ISMA 2C07A 3M1LA 3A14A 4YPOA 1XR3A 5T8KA 4BGVA 1XSEA 3QV1A 2P5UA 4NZ9A 4CMKA 3EC7A 1N1GA 4ZRMA 4A03A 5DBGA 4IZHA 1TT7A 2PH3A 1B8UA 4NNJA 5GY7A 5HBRA 4GWGA 3AI2A 4R51A 3VKVA 3PIDA 4ONEA 5KJ6A 1UXHA 5BQFA 3ITKA 1LDMA 5CHEA 4J16A 1PS9A 1I01A 1OMOA 1VE9A 3H2SA 4IDGA 4HKTA 3MWDB 4OXNA 4XB1A 4XR4A 3C1OA 4DREA 3IDSA 2BLLA 5AXAA 3AOEC 2G1UA 2RIRA 3AI1A 4HFJA 3WJ7A 4B8WA 3AU9A 2I3AA 4LVUA 3RFXA 2Z95A 3WJAA 2UVDA 3JQ8B 3WOHA 3R0IA 4EJMA 1DB3A 1GY8A 3ZWXA 4UEKA 4PZDA 1H6AA 2Y99A 4PRLA 4R9SA 1OI7A 1OBFO 3H65A 4QFDA 2I67A 4ALJA 1ADGA 3KZVA 4N7RA 5G0TA 4D0SA 3ZWMA 1JVSA 3PHJA 4WKGA 3JQEA 4EW6A 4L8VA 4I9HA 3MJVA 4EI2A 1CJCA 4OJNA 1P33A 1T2DA 2E48A 2YYYA 4FCCA 1RYEA 3MJSA 3UICA 3VKUA 3AUSA 4H3VA 3FNHA 3QWAA 4I5DA 2GD1O 1HKUA 3U0BA 3RI3A 6ADHA 4CLDA 2YHIB 7ADHA 1RM3A 4NIMA 4UVHA 3VAZA 2Z1NA 1NVTA 1Z82A 5FEUA 1CERA 1F8FA 3DO5A 4PFJA 3DFZA 2F00A 3WIDA 1DC5A 5KJCA 3KYCB 2QRLA 4NG5A 4Q9NA 4XQCA 5JCJD 1DEHA 1ZEJA 4P38A 1FDUA 3DHYA 4ROSA 5T57A 5TT0A 3WGQA 1F14A 3T7CA 4GSLA 1ZK4A 2BGKA 4I5GA 4CMIB 4E6PA 2GUGA 1YJQA 1E3SA 4HFMA 3VZRA 4BOYA 3TZQA 1ISHA 4Q3CA 5L7TA 4XDYA 2VHZA 2X23A 1E92A 2GCGA 2PZKA 2DBZA 1QMGA 5EINA 1FDVA 3NTQA 4OXKA 4XRGA 2W4QA 3OBBA 4CM1A 3DTTA 3H7AA 2QW8A 4HP8A 2FRDA 4HY3A 1MGOA 2D3TA 4OOEA 2C5AA 1ISJA 4BNGA 3EK2A 1UXJA 1E7SA 2GNAA 2DTEA 3DQPA 4XR9A 1MC5A 3I4CA 1HDGO 4E13A 2HCTA 5CPBA 1LUAA 1R66A 1HLPA 2B69A 3OF2A 4NI5A 2AQHA 4U5QA 4KWIA 4PLZA 5L7WA 1T26A 4J90A 3LYLA 1BW9A 4JLWA 5IAAA 4L0QA 3ETEA 1PGNA 3HN2A 3VH2A 5JO0A 4M49A 1LEHA 3EHEA 1G1AA 4ZRNA 2NU8A 4BQPA 1K3TA 1SAYA 5F5LA 3UW3A 4YDRA 3AOGA 1NWHA 5CPFA 4CQLB 5L45A 5HRUA 2R6JA 3GR6A 1VKOA 5ILOA 1PQWA 2XF8A 3OETA 1LDEA 1F17A 1P0CA 4II2A 1GADO 2D1YA 2RH8A 1E7WA 3WIEA 4E5KA 1F06A 1T25A 5EN4A 2PKQO 1VL8A 1Z45A 3G49A 3RASA 3LC7O 3ZV3A 1EQUA 3ZHBA 2DT5A 4CR8A 4ITUA 4M8SA 3DAPA 4XX0A 4BGIA 2EW8A 1FMCA 4HX5A 1DOHA 1ZCJA 4YA6A 1R0LA 2VT3A 3AOEA 1H2HA 4CLRA 2C7GA 2X5JO 3GEDA 1YJ8A 2W90A 2NU9A 3ZU3A 5U9CA 3SC6A 2R00A 3T4XA 2PLAA 1YBAA 2J5RA 2QYSA 3BMQA 3NAQA 2AXQA 4CUKA 1M75A 3AI3A 2CDCA 3ONEA 4AJOA 3HB4X 4R68A 1J5PA 4FFMA 5KKCA 4R16A 4YYZA 3CMCO 5I7VA 4XYEA 2V6FA 4YT4A 1SBYA 1NR1A 3AWDA 3C1AA 4RO0A 5IDWA 1LDGA 4C7KA 1XHLA 3NUGA 1TB4A 1BDMA 2I76A 3K73O 3CUKA 2IZZA 2RCYA 4ND2A 4W82A 1HDZA 2Y1DA 1B7GO 4KQWA 1CQIA 4CJXA 1HSZA 1QYCA 1R16A 4XQGA 4ZQEA 5J23A 4WOJA 1I2BA 3I9KA 5JYEA 2PFGA 2Z5LA 3DZKA 4CUJA 3H3FA 3EZLA 3T7EA 3DXFA 3SXPA 2EWMA 3WR5A 2X0RA 3OIGA 4YT2A 2IXBA 1Y9EA 3TNLA 4XJTA 4XKJA 3ANNA 5BNFA 2BMAA 2ZTVA 2B4RO 1BGVA 3DHEA 1DC3A 2VQ3A 1P1FA 1ZW1A 1PGPA 2FR0A 3NEPX 1LJ8A 2NV6A 4I5EA 4LMRA 1WMBA 1ZJYA 3D3EA 3PWSA 1EE2A 3KSDO 3H9GA 4K28A 4KUHA 3WNVA 1CDOA 2B4TO 2QRJA 5DT9A 4FPXA 1X0VA 4P4NA 1T4DA 5IXSA 3IC5A 1A4IA 3JQ8A 4ZHSA 4IXTA 3P2OA 2WYWA 2GASA 2CVOA 3ZU4A 3JD0A 1K2WA 2XAAA 3GGPA 4RPKA 4ID9A 4YJGB 4BO2A 4Z9YA 3FPLA 4WLEA 2DVMA 2DKNA 1P1HA 3LF2A 4RLHA 5IZCC 1GV1A 3BHJA 4KTTE 5EQDA 4I08A 1U1IA 5FF9A 4A27A 3KM0A 3PYMA 4M1QA 4M86A 1F8GA 2C59A 3JQ7A 1PZFA 3L77A 3WGYA 4JP3A 2CF5A 3D64A 3VC7A 1IB6A 4L9RA 2FP4A 2GN9A 3KXDA 4FOOA 2PD6A 4BNZA 1R15A 2Q3EA 5JC1A 3G17A 4CMGA 1ONNA 2HLPA 4OKIA 4KUGA 4IPTA 4O63O 4UUMA 3ON5A 4B4UA 1AXGA 1DRUA 2J8ZA 2HK9A 2VOJA 5DULA 3V8BA 1QYDA 1NQ5A 1ZO8A 4DPLA 3UAGA 4DYDA 3RBVA 4F46A 3UGKA 1MG5A 1ENPA 2RAFA 1GZ3A 3N58A 3D5TA 4E30A 1BVRA 4PLYA 4Z9XA 3H3JA 3CXRA 4JX8A 4D44A 5ENDA 1GL3A 4H15A 1EUZA 1T2EA 4BO4A 3BMOA 4P22A 3G1UA 2P2SA 1DRWA 4CMIA 2PWZA 5KOIA 3QVXA 2Y93A 2Q4EA 4CV1A 4E5MA 2D2IA 4R9RA 4MDHA 4B7CA 4LSMA 3O03A 1NQTA 5COAA 1D3AA 1U2DA 3JQGA 1QYVA 3FN4A 2IDZA 4CM3A 1I3MA 3ZV6A 4OSPA 3L9WA 1IY8A 3VVBA 2NVWA 5JBIA 1ZKMA 4CQMA 1U4SA 1B8PA 3ZWBA 3LVFO 4M55A 5FI5A 1ONOA 4QUKA 3DBRB 4RVFA 1V3TA 5C7LO 3PPIA 3NDIA 3TJRA 2NNLD 4INAA 3EMKA 1DFGA 4JNKA 5IJZA 1P1RA 4IBOA 5KNLA 4XB2A 4UVEA 1KY4A 3FF4A 2GR9A 4XCVA 2P4QA 2PR2A 3EZYA 3A9WA 4G81A 3L4SO 4TRMA 4IMRA 4XGIA 5JDIC 4GGPA 1VPDA 4XDZA 2QQ5A 4YAEA 3I23A 2C2XA 2VCYA 4IGFA 4FOSA 1PZEA 1VSUA 4DWVA 2WD8A 1ONPA 2OMEA 4D79A 4RF5A 2YV2A 2XXBA 2NVBA 1MFPA 4RPLA 4N54A 2HO5A 3HFSA 1E3LA 1PJBA 2HMVA 1PQPA 4RZIA 1RWBA 1TI7A 3P19A 1WLYA 4B4VA 1JN0A 2PGLA 5THKA 3V5NA 4U6QA 3PQDA 3PFWO 2V6MA 1ZUD1 5K6AC 4BV9A 1X1EA 4DC0A 2ZK7A 5JFOA 5L4LA 3D4NA 2B5VA 1FDWA 3JYNA 2FY8A 3TL3A 3PRJA 5TNXA 1LSUA 2IODA 1E6EA 1EK6A 3KRTA 2CF6A 2GZ1A 2VUUA 4Z0TA 1CIVA 4IUYA 1UUFA 3U4DA 2W2KA 3HB5X 4CV2A 1JAXA 4CMJA 3NT5A 1Y7TA 2UAGA 2JD0A 4E5YA 1BRMA 5JW6A 4Q3DA 3NGLA 4Z3KA 2J5QA 3MOGA 4QO7A 3X2EA 4M87A 3JQ6A 4NDNE 2VYVD 2BELA 4UVGA 5DOVA 4D3FA 1TEHA 1UAYA 2ZQYA 1ZEMA 2OFPA 4BKOA 2HSDA 3JTMA 1X1TA 1YDWA 2I99A 1U5AA 2JHGA 1T2FA 4YAIA 5TS3A 4Z9FA 3F5QA 3AUAA 1M6WA 4UULA 3ZW8A 1PL8A 1RJWA 2NU6A 5BR7A 1UP4A 3I6QA 2JL1A 4R54A 1DAOA 1P45A 3IMFA 3GLQA 1E1MA 4IZIA 4MO2A 2OL4A 3PLNA 4RPHA 1GD1O 2R00C 4QTZA 3BTUA 3L6DA 2O4CA 1JVBA 1NVGA 3AY3A 1QKIA 3C24A 4IJKA 1A72A 4YBZA 3A4VA 3SBOA 2E49A 3GZNA 2DBRA 1H9AA 3BMCA 3W8FA 4E2ZA 5TJ9A 1LI4A 2AQIA 1ULSA 3PHHA 2O3RA 3O8QA 1C0PA 2NACA 4IXWA 4I5FA 4J6FA 4NJOA 2WMDA 2DPHA 4R3WA 5I8WA 3RSHA 1T4BA 4J0EA 3DOJA 4R4JA 1N7HA 4GX1A 4PLTA 1BTOA 1BXKA 3OEYA 2EGHA 2X5OA 5A3JA 1Q0LA 2VYND 1PJ3A 4XWYA 4NPCA 1HYGA 3UHAA 5TGDA 3ENNA 1UP7A 2EKQA 2HRZA 3NJ8A 2JHFA 1IHYA 2UUOA 2PGDA 4MP6A 2Q1UA 3FNFA 4ALLA 3JSAA 1DFIA 1CYDA 1JWBB 5JC8A 4CLXA 3V2UA 3DMYA 2VUSA 4PVCA 3MJEA 2G0TA 3PJFA 2J5KA 5DP1A 3WTBA 1GQ2A 1YB4A 2C20A 1N92A 2ZTLA 3KUXA 1PSDA 2QG4A 1KOLA 3ZN2A 2DLDA 4BGUA 2B0JA 3G0OA 4S3MA 2AMFA 4ND3A 1R4MA 4KOAA 2VHYA 1NAHA 1YBMA 3V1UA 4BO9A 1UZNA 3F5SA 3H2ZA 4RF4A 2ZKLA 2F1KA 1NM5A 1JDJA 1SEVA 4ZD6A 2GRAA 3TF5A 2ZATA 3ZDFA 1KVTA 2IYPA 3PJGA 3UCXA 2JAHA 5I9LA 3KSUA 1Z7BA 2DC1A 5L3ZA 5G4KB 3H5NA 5A04A 3DZHA 4IDFA 2V6GA 1J49A 4BMSA 5B37A 2EKPA 1GCUA 1VC2A 3Q6IA 1EMDA 2IZ0A 3IUPA 4WE3A 1NPDA 1NHGA 2X9NA 3ICPA 3K2BA 4ILKA 1K6JA 4B79A 4ND1A 1M66A 1GZ6A 1X14A 1AXEA 1E1KA 5LCXA 1GDHA 1U9JA 2Q1WA 3KBOA 1C1XB 1B26A 1PL6A 4JBGA 3LC1O 4MVJD 1Y9AA 2HMSA 4D43A 4TKMA 3DMTA 1Z74A 2WE7A 3AM3A 1WMAA 3MEQA 4YJFA 3DBHA 1E7RA 1M6HA 4EZBA 3OEWA 2Q99A 1D1TA 3X2FA 2C5EA 2NU7A 3OECA 4PZEA 3GDOA 1HE5A 4MVJM 1E0DA 4LMPA 4XA8A 2A35A 3S1LA 2HMUA 2EGGA 1PL7A 1X13A 3KYCA 1FXSA 1UXKA 1R0SA 3CPSA 4YXFA 1ZXBA 3A28A 2B83A 2X58A 2B5WA 2WE8A 2IEDA 4BGEA 4J3FA 4MIEA 3IP3A 2Q2QA 2ZCUA 4Q3EA 1C1XA 1V6AA 4E0BA 5ILGA 1PJQA 2O3QA 3GMDA 1Q7CA 1ZIDA 1KEWA 3RFVA 5ICMA 2AW5A 2Q45A 3JD3A 1HF3A 2YFQA 4RF3A 3PHLA 2NADA 2VN8A 4K26A 2UUPA 9LDTA 1A27A 4A26A 3DZFA 2AG5A 3FI9A 1OAAA 4BB6A 1M76A 1YONA 1R4MB 4K1LA 3ROPA 3EGOA 3ZNOA 4J4TA 4Q3AA 1YRLA 1LC0A 1QLJA 1UXGA 3GDGA 4OXYA 3K31A 3KEOA 3OIFA 1DIAA 4DIBA 4RF2A 1DLIA 1EUCA 5ENVA 4YJFB 2HK8A 4AFNA 3D3WA 4DGSA 4MP8A 4RVSA 4JJGA 4ZU3A 1I0ZA 4R5HA 4IDBA 3E6AA 1DIHA 2FWMX 1CWUA 4BO1A 1UR5A 3WGGA 1K6XA 2BI7A 3H9UA 2YY7A 2VT2A 3EVNA 4AJIA 3OMLA 3HFGA 4G5HA 3DZBA 1PGJA 2Y1CA 3FD8A 5A3VA 1VSVA 4NU5A 1KERA 4Q3NA 5I8ZA 4RQUA 4RJTA 4J7XA 1MG0A 4BNUA 3NT4A 4YT8A 5JAZA 5JO9A 1S7CA 5F21A 2IE0A 1JLLA 4LISA 4C4OA 3R1IA 3O8QB 4DIFA 4OGWA 2CUKA 5ES3A 4J4BA 3IUSA 3NDRA 3ROMA 2Y1FA 2W2LD 4IIVA 4WUVA 3DWFA 2IYOA 4NBRA 2NUAA 3OH8A 4GX2A 4R1SA 2X0JA 4L4SA 4HFNA 4NBTA 1M2WA 2BFPA 5H82A 2NWQA 4AJHA 4DMLA 2BFOA 5K9ZA 2PD4A 3HQ4O 4NFYA 3GHHA 3U4IA 3SLKA 2R2GA 2W8ZA 3Q1LA 5KWEA 2OBNA 1D1SA 4JJIA 3B20A 2ZB3A 4EJ6A 1P74A 4J0FA 1DO8A 2BF7A 4NQZA 1EEHA 1HTBA 4XD2A 4CMCA 1RYDA 5ER6A 2ZTUA 1P3DA 5HTOA 4TVOA 3PHGA 2O48X 3WG9A 5L95A 2O7SA 5CG1A 3RUFA 2I65A 4BNYA 3COSA 1MV8A 4J9VA 4N5NA 3TZKA 4BMVA 2Q2VA 3SJ7A 1CETA 5CDSA 4GGOA 4U0JA 4F45A 3GEMA 1T2CA 3I9NA 3IIEA 4E2XA 2O3SA 2YFHA 2WD7A 5CFZA 1ZMOA 3IOYA 4PLGA 1X7GA 1OC4A 4UAGA 4FFPA 1GQYA 4Y6PA 4KWHA 3FPCA 4OKNA 1LTHR 5DDIP 2ZCVA 5JMWA 3DZGA 1E3EA 3K2EA 4ZA2A 2O3JA 3GRPA 3OQBA 4WASA 3ZZNA 3W4IA 3HNPA 4EDFA 3MOIA 3RUHA 2C0CA 3E9QA 2FMUA 4GMFA 4WEQA 4OOFA 1U7HA 3IP1A 3SC4A 1LBEA 4R01A 3ZWNA 2FZWA 1IUKA 4IDAA 4D3DA 2CY0A 4BV8A 5DNAA 4N5LA 1ENOA 4WNCA 3ASUA 3H9QA 1B14A 2FR1A 5AXBA 4ESOA 4BVAA 5JDCA 1Y8RB 4WCFB 4GMGA 4O6VA 1QXSA 2PZJA 1WP4A 3WMXA 3PDJA 4Y6RA 1WZEA 3QVSA 3NYWA 3GAFA 3B1KA 3LT0A 5JYDA 5IN4A 3JQAA 3TZHA 3NDJA 1WPQA 3BIOA 1ZH8A 2HUNA 1D4FA 4NHEA 5B4UA 1GR0A 4A7PA 4S1VA 1ISIA 4BNIA 1P44A 4Z0HO 2GSDA 1Y8RA 1J4AA 2PY6A 4ALMA 3F1KA 1E3WA 4ZQGA 1BMDA 1U2GA 2DFVA 5U1PA 3VZPA 1IL0A 1MLDA 1Q7BA 3GNSA 2EV9A 4PLWA 3OHSX 1ZMTA 2AQ8A 3TZCA 1BSVA 3LT4A 4HNHA 3RU9A 3V2HA 4FJ2A 3BMNB 4KQXA 4R5MA 1VI2A 2P68A 3DR3A 3WLFA 2EHDA 2DFDA 2LDBA 4MKXA 3DDNA 3KVOA 2J3HA 4KUEA 1C0KA 2NM0A 4PGFA 5TF4A 1ENZA 1VRWA 2OBYA 1GUYA 3GUYA 1V0JA 1D8AA 2VNAA 2X22A 1P77A 1LLDA 3FHLA 1ISFA 3CIFA 3JD2A 3PJDA 3BMCB 3VPFA 2AHRA 4U8GA 3I6IA 4MKRA 2FPIA 2XOXA 4YT5A 3VOSA 3JQBA 3MTJA 4DQXA 4QXMA 1LNQA 2HK7A 3CTMA 1YS4A 4WCFA 1TVEA 4E2WA 4NFHA 1XDWA 4M89A 5EPOA 3B1JA 4QT0A 3PI7A 3UH1A 1PJTA 4PRKA 3KETA 1KC3A 2XPCA 3HZZA 4IMPA 4O5OA 1HZZA 5ER9A 3UOGA 4XYMA 2VOEA 1EDOA 3RKUA 4D41A 2AEJA 1PU2A 2CMDA 1GPDG 3ZNQA 1PJSA 1C3VA 2BH9A 3UCEA 5I7SA 3JQDA 2JD2A 2EP7A 5MGBA 4BKQA 1WZIA 3VVCA 1QR6A 3HDYA 2WWRA 1WNTA 3IJPA 4UREA 1O9BA 4LVCA 1E7MA 5TT1A 4RPGA 3JYPA 3QWHA 3PQEA 4IDDA 3D3WB 3GVPA 3TSCA 2PD3A 1NFRA 1LLUA 4RVUA 2ZJ1A 4KDFA 4TMFA 5DZSA 2RH4A 4MVJP 5T5QA 4YAJA 3GF4A 1V8BA 4TWRA 1GCOA 1WVGA 4CM8B 2VYVA 3UVEA 4BNMA 4ALKA 2PV7A 3GUCA 3E5MA 1J6UA 3K30A 5T6BA 1VL0A 3LQFA 2VTEA 2O50A 3BMQB 4U7WA 4YVFA 4XEHA 3NTOA 3RUCA 3C3XA 1O5IA 3I52A 1KVUA 3GNQA 3GMSA 4EEZA 1E77A 4YB8A 4B3IA 3U3XA 4BO8A 5F1KA 1XLTA 1HDXA 2WYUA 3OM9A 1I3NA 3OICA 4RQTA 1SC6A 5G0SA 3WGTA 1EUDA 2V65A 1WW8A 1KBZA 4J2HA 5A02A 2A4KA 3S2IA 3BA1A 3E9MA 3AUTA 2GPTA 2YHIA 4N5MA 5TIIA 5DN9A 3ANMA 3E8XA 3G79A 4ALNA 5G2OA 5JDCC 4IINA 3BHIA 1ISGA 4MP3A 5K0ZA 1ARZA 1KEVA 4CM5A 1EFKA 3AFMA 3LZ6A 1LLQA 1JU9A 5B12A 3KTDA 1TXGA 4GLLA 1D7OA 2P4HX 3OFSA 2NQ8A 4YTEA 4B3JA 1ORRA 2ZB7A 2OZPA 2GYYA 4G65A 1A7AA 6LDHA 1NVMB 2EIHA 3FR7A 4KDEA 5EERA 4RV9A 1HDCA 1LDNA 1AGNA 3MJTA 1V35A 2P9CA 4HWKA 4NK5A 4F6CA 3R3SA 2C54A 1XWFA 1NAIA 3BXXA 1ZVMA 4FC7A 4BNHA 2H6EA 4FFRA 4Y6SA 1I2ZA 4PVDA 4DTIA 3NKLA 1AHHA 1U3UA 2ZYAA 1I8TA 1Q2XA 4D45A 4LRTB 3JQFC 3HJAA 2I3GA 4YRBA 5COQA 4HBGA 1E7QA 4J9UE 5TJHA 3ASVA 2VZ8A 3KB6A 5JPIA 5KJFA 2EF1A 4WOKA 4D46A 2O23A 1XELA 3B6ZA 5L4SA 1ZSVA 4O1MA 4HNGA 4TZKA 4BO0A 1VJ1A 5B4VA 4Z6KA 5L4NA 2OXIA 4NH4A 4OQYA 5G0UA 1HYEA 4BMNA 1O8CA 4BNTA 2ZJ0A 3FBTA 4RVHA 2OHXA 3UN1A 3OJOA 4ZN6A 3AU8A 5EL0A 2W2LA 3JQ9A 5GMOA 1DXYA 4DMMA 3HUDA 1DIGA 4L4XA 4CM9A 5H81A 4D3SA 3HG7A 2X9VA 1NQAO 1WXDA 1P31A 3DHNA 3GFGA 4RGBA 1H6DA 1PJCA 3VZQA 5BSFA 1T2AA 2WEKA 3G3EA 5HM8A 1Q7GA 2G5CA 4JQCA 1JKIA 2H5LA 1HEUA 4JROA 2Y67A 4TRJA 2RHRA 4IS2A 4KTVE 3U9LA 4BNJA 3LSYA 3A1NA 2E82A 1QG6A 1KVRA 3VPGA 2EXXA 5A05A 1B16A 3EW7A 4AJ2A 3VH4A 5THQA 5JMPA 4JGBA 3CSDA 2YQ4A 3F6YA 5DCWA 3U62A 4EYEA 4CODB 1B15A 3MJCA 4J7UA 2YHUA 3FBGA 5JXWA 5ITVA 4CMAA 5JE8A 4AJEA 1N7GA 1EFLA 4EBFA 4AG3A 3JD4A 2QYTA 2PZLA 3TFQA 1N2SA 4QO8A 4W7IA 1Y1PA 3B1FA 3C7DB 3AM4A 1NYTA 1AN9A 1DHTA 1VLLA 3LK7A 4E5NA 2GLXA 3KLMX 4B3HA 1DC4A 3DOOA 5JNLA 2C2YA 2X0IA 4LW8A 5G0WA 4KMSA 1E3IA 4I9UA 4TRNA 4XZ3A 2D8AA 1P0FA 2HJSA 5KVSA 3CKYA 1UJMA 3DBRA 4FBGA 3WYEA 3GHYA 4LCEA 2AEFA 2CNBA 4IM7A 4CM6A 4OL9A 3GAZA 5KTKA 5TQVA 1VKNA 2DBVO 2PA3A 2FPPA 5DBIA 1YOVA 4YAGA 1L7DA 3ABIA 3AM5A 4IY1A 3RIHA 4H16A 1P1IA 2GZ3A 3C7CB 3GQVA 5AOVA 3AJRA 3LT1A 5LDGA 4CQMD 4CMEC 4TSKA 3T4EA 3FRJA 4W9NA 4WCDA 1PJ4A 1Y6JA 3TOXA 3QVOA 2EEZA 2GERA 5EIOA 4CM4A 1G0OA 1ML3A 2QRKA 2VTDA 2YV3A 1O0SA 3IS3A 3QVTA 1JTVA 4GH5A 4AJ1A 2PTGA 4BNVA 4OAQA 3R3JA 4BO3A 2AE1A 4EUEA 1JKFA 4GX0A 4W7HA 3IAHA 4YJHB 4AJ4A 1ID1A 3C7AA 5CDUA 3O4RA 3Q2IA 4BNKA 3GVCA 4X54A 3W6UA 5C7OO 1SCUA 3ZWPA 4OIMA 3WTCA 3JQBC 1XIVA 1HWYA 2FSSA 2AG8A 1NX6A 1I10A 4RPJA 4I1IA 2G17A 5COBA 3RUIA 4AJPA 3UCFA 1XQ1A 1ZZEA 3K9QO 2YW9A 2X86A 2D5AA 8ADHA 3EUWA 4QEDA 3WWZA 2NVUA 1RPNA 4MVJH 4YJHA 3PHIA 4AJNA 2B4QA 2ZQZA 5BSGA 4HXYA 5DCUA 2X7HA 4N18A 3ZWCA 3DBVO 1HDRA 1MC4A 3RD5A 3RUEA 1DFHA 5HS4A 2C7VA 1MUUA 3GVXA 1K6IA 4PLVA 4R1UA 3RAJA 4RDIA 1YBVA 1BW9B 1SZJG 3INTA 1B2LA 4CV0A 4R1NA 5U4QA 4EITA 4WGGA 4GSKA 4BNXA 5F1PA 3ICCA 5KVCA 4OM8A 3SLGA 5I7FA 1ZK3A 4AL4A 1E7YA 3LDHA 1LXCA 4WLFA 2FPGA 4QQRA 4CPDA 4FIZA 1JWAB 3FWNA 3VDRA 4J1NA 4BO5A 4II3A 1SNYA 3S2FA 3QHAA 1EVIA 3V1TC 3D4OA 1GEEA 3RFTA 1T1SA 5L7YA 2IXAA 5DBFA 1SOVA 2GN8A 4L75A 2Q46A 1BVUA 1YXMA 3NJ4A 1Q0QA 5L51A 1H93A 3BZUA 4E4YA 3I9MA 1FDTA 2Y1GA 3GY0A 3OJ0A 3BMOB 4DQUA 1YGYA 3L6OO 4Q3BA 1KEPA 2GZ2A 2EP5A 3MWEB 3P2YA 4J4HA 4GVLA 5TC4A 3RQSA 5TLSA 5LDHA 1C0IA 3F9IA 3PIIA 1KY5A 2VRBA 1N5DA 2D59A 3ORFA 1ZJZA 3GT0A 2P5YA 4YQZA 5LC1A 4YACA 1FDSA 2BRUA 1QV7A 1UZLA 3ITDA 4QSMA 1UDCA 3QQPA 5KVQA 1E6WA 3L0DA 2PH5A 1O95A 1VJTA 2BHLA 3OQ1A 3BTVA 4U6SA 3GH3A 1BWSA 4JP2A 1EZ4A 3DTYA 4GI2A 2J3JA 2YV1A 3TOZA 1HLDA 4RDHA 3O38A 3NRCA 2O7QA 3S2EA 3H5AA 4CM7A 3OA0A 4GKVA 4DIOA 1PEDA 4NJMA 1H2BA 5C37A 2B37A 1LQUA 4FFOA 1C0LA 3HE3A 2Q1TA 4NFSA 4PG6A 2QZZA 1I3LA 4EGFA 1I3KA 1LC3A 2ZB4A 4D7AA 3OJFA 4XQ9A 2O2YA 1L7EA 4AJJA 1UDBA 2EKLA 1QYXA 3GG2A 1GYQA 4R69A 1EQ2A 4CL8A 2BGLA 1CRWG 4CM8A 1O94A 2PKQP 5F1OA 3H6KA 2JCYA 1SPXA 3CZMA 1H94A 4BNLA 2DAPA 2C29D 1N9GA 1WAMA 1NTOA 1WDKA 2DUWA 2FHSA 1E6UA 2IRWA 2PGJA 5JCJA 2D4AA 2WDZA 4DRYA 3ADPA 3CMMA 1DBVO 5KJEA 2YQ5A 4IJUA 4ND5A 5BSHA 4NBVA 3KEQA 3Q11A 2IEBA 1MB4A 1GFSA 1YVEI 4P4GA 1FF9A 4YRAA 4LK3A 5CDGA 4M54A 2HRBA 3JCZA 1R37A 2G82A 1IZ9A 1BHSA 3QWFA 4CM9D 4AICA 4NMHA 4EEXA 3VH1A 1XKQA 3UF0A 1X7HA 1O89A 2VWGA 4FS3A 4RZHA 4J1TA 2CDBA 5A9SA 2OORA 4E21A 1XEAA 3WGIA 4MVJA 4Y67A 1R4NA 5MDHA 2VZ0A 2Q2WA 3OQ6A 3SJUA 4TVBA 1XU9A 1S6YA 1ZK2A 3S55A 4CL3A 2YUTA 1XCBA 3K6JA 3WB9A 4FR5A 4XIJA 4MOWA 3IL2A 1NNUA 5ICSA 4F6LA 3KYDA 5TX7A 5A5EA 4CLRB 4E12A 1KYQA 3AFNA 2HAEA 2OGUA 4MIOA 1LDYA 2YZ7A 1A71A 1YL6A 3GEGA 1MP0A 4XGKA 1ZXLA 5KCZA 2IZ1A 1I24A 1E1NA 4CLHA 4FW8A 1I30A 1EBFA 4OH1A 3H4VA 1NFFA 5L9AA 1EDZA 1LRJA 3BYZA 1NQOA 4E3ZA 1PS0A 5KJ1A 5G0VA 2BFMA 2ZYGA 1R4NB 3JQAB 3H9JA 1AHIA 5F5NA 5H83A 4HFRA 4GPD1 3LLSA 3W8DA 2HMWA 3HWRA 4OHUA 1U5CA 1BXGA 2V6BA 5BSEA 2ZB8A 2H1SA 3RJ9A 2NQTA 2DQ4A 1XYGA 1T1RA 4CMHA 5B1YA 3IKVA 3WXBA 1DC6A 3Q9UA 3QY9A 4GVXA 3N7UA 4HADA 1SOWA 4WK6A 1GU7A 5KIAA 1E5QA 2Y1EA 1KIFA 1EVZA 2BD0A 2WYVA 1TLTA 1PZHA 1H5QA 1KC1A 1NFQA 5IDQA 4A2CA 4J2OA 3NX4A 3I83A 2Q1SA 3FNGA 2Y0CA 5JCXA 4UVDA 3AY6A 1U8FO 2FZEA 3KLPX 2D5CA 5CP8A 1GQQA 2VHWA 3ONFA 3ZNNA 4P8RA 1SO8A 1N9GB 4J7CA 4WLNA 2HQ1A 3ZWVA 4UVIA 5T64A 1IPFA 1Z75A 3RBZA 2FSVA 3F4BA 3GK3A 1GPJA 3E1KA 1WDMA
chains in the Genus database with same CATH superfamily
2XZOA 1G8GA 2BHSA 4MVJI 1AGRA 3TG8A 3MWGA 3M5PA 1JG1A 2VF7A 3JS5A 4A3SA 1XRQA 2H1RA 3W9BA 3I2GA 4NBWA 2Q6OA 1GGKA 3ZHXA 1M9NA 1ZL0A 1M10A 3SG0A 3GRKA 3K0KA 3GGCA 1M2OA 1XUOA 4IS3A 3WLHA 3IYLW 5AKIA 3AFOA 3SYKA 2CSUA 4Y1EA 2A0FA 4ER5A 4EMBA 1MIOA 2GXUA 2E3JA 2BKEA 1FDOA 3VV2A 4MZXA 3ZBQA 3PFBA 1XZIA 1BS9A 3WGZA 5B3KA 9MHTA 5B2FA 3MBKA 3MGKA 4WJZA 5BW8A 3CNQS 5EQFA 4G67A 4XTRA 3JSXA 4TZ0A 1VL1A 4P54A 2VT7A 4ENVA 3CO5A 1P5FA 3DFKA 3R6DA 4KQMA 3A06A 3C5HA 1XQXA 1RWQA 2H16A 2WHPB 4B75A 5DEIA 4ENSA 3GN1A 1C7ZA 2B35A 3PUWA 3PXBA 1A2OA 1S8AA 4I4CA 4QGSA 2YWJA 3D8SA 3GOHA 1F2TA 3OP4A 4ZVLA 2FPKA 3QJYA 3VR0A 4B81A 4MVJG 2CHQA 3EA5A 4RTMA 2GN2A 2GCOB 3W4JA 3INRA 1NQVA 4J94A 1CZOA 3SQLA 1I2MA 1JHAA 1SC1A 1T1GA 2WNSA 1SXJD 2Y1LA 5CT6A 3X1JA 4AVYA 2BH2A 2UZIR 1I32A 1K8ZB 2Z2JA 5DCYA 2EX1A 2F1HA 4IGEA 4BN5A 4ZYTA 1YRBA 2BZGA 1QO0D 3N28A 1ADFA 1B6SA 3SIPA 2YXEA 2WQ7A 5FBQB 1IE3A 1IN5A 1VSTA 1Q0PA 2GMWA 4ZICA 3ZZMA 5DNWA 5K8TA 3PP8A 1SIBE 2WTBA 3QBEA 4RHFA 2M6RA 1QIKA 3A1FA 5JBNA 3IOCA 4DMGA 2O4UX 4YV0A 5JAPA 4QPCA 2ZYWX 1U0HC 4PGMA 3ZWWA 3B7PA 1AUPA 3DBLB 4LZOA 4WK0B 3INGA 5EXPA 1CEEA 3GG9A 4BO7A 5KVVA 3EQ7A 4KO1S 2A6PA 4BE4A 5JS8A 3L4BC 1FSZA 4ZANA 2OQIA 3F3KA 4JDPA 3VR6A 4YGYA 3CEJA 2JATA 4CU2A 3WIVA 5K09A 1T0PA 4FJ1A 2IGBA 1MAHA 1EVLA 3WMWA 4MYRA 2YR0A 2O2SA 1CUEA 3DFIA 4JB2A 4EF5A 2R0QC 2IOFK 5DBEX 4LRQA 3QYPA 1YCHA 4GQAA 3PVZA 3KWJA 2RE8A 4HPWA 1CR2A 4KMRA 3W34A 4LJ5A 3DUWA 2CLOB 1TZMA 1M6VB 2VSNA 2BR5A 2W5UA 5F3RA 1GYRA 1Q44A 1VCHA 4PZAA 1USIA 4DLWA 1OC2A 3RC7A 1KJJA 4PHGA 4NR0A 3OLVA 1RAFA 3VAYA 3GLRA 1Z5GA 4ACAA 4DT1A 4EGCB 5G4KA 1RQ2A 4LC9A 4K6CA 2RHJA 1NNSA 4OB7A 2HR1A 2XHZA 1YUNA 1P72A 1X9HA 2HMAA 2AUNA 3H5VA 1N2ZA 1P2DA 2AC7A 4TZTA 2R6FA 2W2NA 3FVRA 5ALJA 4JBYA 5L3RA 7REQB 1LRKA 3GLKA 3IMGA 3O8OA 1T9DA 3GA5A 2CXUA 5GZ3A 2J3KA 5IWCA 3FCUB 3LECA 2D0IA 3GAMA 4ZALA 3ULKA 5CEEA 5E4JA 3AJAA 3DBLA 4NV1A 3M2TA 1SCDA 1OA1A 4PAOA 3IR7A 1H3EA 1JFFB 2ZE7A 1ECGA 1QIEA 2GYVA 3ZCVA 3UHOA 4DZRA 4GT1A 5K8IA 1NRIA 3BDVA 3QWIA 3EXFA 4FEYA 1DINA 3HFRA 4IIUA 4JLDA 1ENYA 2ATCA 2BDUA 2X13A 4WIAA 2ZP1A 4U7HA 5FHQA 3T5DA 4DBVO 4TM7A 2NVUB 4PPYA 4IDCA 4GWKA 3ISJA 3JZDA 4ZOLF 3ZCQA 4QNRA 1C30A 2YKGA 3UV6A 4AG5A 4BDSA 2F67A 2P91A 4FFNA 3EYWA 3PNVA 4IQ0A 3LNTA 5DKFA 3X43A 4ARSA 4FUQA 5KWVA 4F97A 4MPDA 2LV8A 3NPAA 2XE8A 5EE9A 4Q02A 5CXUA 1Z16A 2IEGA 1GRNA 5D87A 2Z2XA 5F7XA 1KEZA 1KQ3A 2AFIE 3EVDA 1T34A 3NHBA 3MQFA 4G0YA 4RIEA 4YRZA 1FNSA 1QYWA 2NPOA 2Q9UA 4XEUA 2IP1A 4DILA 1KO1A 3RSOA 3HADA 1O97D 5AUNB 5CB8A 4S12A 4JIGA 2JHPA 2CMFA 3HYLA 1U8XX 4Q3KA 4A4DA 1KDYA 2QRPA 4CTNA 4MPTA 5CAEA 1ATIA 2CNNA 3K92A 4RD6A 3T7JA 3DNFA 4PG8A 1R6UA 2O06A 2UVPA 4PCLA 1WDWB 2JGFA 2QLTA 4UHCA 1WXQA 3WHKA 2WJ4A 3TF5A 1Z5VA 4EJSC 1RD4A 3PYXA 5BO5A 3WK5A 4CMBA 1SKAA 1YR8A 5AK3A 3I64A 3IAM1 5A9RA 3KSZO 2JEZA 5H0IA 3TM5A 3SZLA 3A4IA 3RKRA 2IYUA 2X8BA 4MUFA 1R0KA 3LCUA 4PFQA 4UUNA 3OFVA 3V2IA 1V8FA 1DRKA 2ODAA 3NKFA 3ZWOA 4B2PA 2JFHA 4HB0A 1L8QA 1C9YA 2PL3A 2WAXA 4EJFA 1DT3A 4DUPA 1LWOA 5LP6A 1VTKA 5E2IA 2F4NA 3DVAA 5CEFA 4B6FA 4RHCA 4ZV7A 4YRNA 2IU0A 4DSAA 1Y89A 5LQNA 4I19A 1YQGA 1VLJA 5AYVA 5ICFA 4CBVA 4X65B 1C9JA 3VDQA 1O77A 2VZ9A 3WNZA 2IYTA 1M7HA 5HCNA 4DCSA 4LZPA 1MXHA 1TZKA 2H7YA 2A5GA 3B3FA 1HT0A 3AETB 2FR8A 1E6KA 4LC1A 4Q03A 1ZA2A 3VV3A 3KSMA 1X92A 4G97A 3AR8A 2P9QA 2PO5A 3GPDG 3N53A 3PNOA 4R7ZA 5FJIA 1USGA 1XF9A 3PWKA 1KARA 1U0LA 2YASA 1QIMA 3HJNA 2IYVA 3OIDA 4LZAA 2GAIA 3D7LA 4JJKA 1U7TA 4U7DA 3ROFA 2GDZA 8LDHA 1OTXA 3M33A 4J1TC 4LXGA 2G9ZA 3U80A 2HZ7A 4IX1A 4LFBB 4FB5A 1SVWA 3WLQA 1WXHA 1D0VA 2JFGA 2BZ0A 3A0UA 3EHDA 5I7RA 3QGMA 1JKJB 2FUEA 3GBPA 4LE0A 2MCFA 4E5SA 3KUDA 1SMKA 3VC3A 2IH4A 2EJVA 3KKPA 1O94C 2JZCA 1IYZA 2WIDA 3BJEA 2WVHA 3KU4A 4UM8B 5DHRA 3MB8A 2EZTA 4L6AA 2ZZKA 2ALJA 3IALA 3TGPA 3I32A 3ZI0A 4IOLA 4TN5A 3S2YA 5EWJB 2AD1A 2FN8A 2NXNA 5DHAA 5F5XA 3PXGA 1CVIA 1SXJA 1UH5A 3FNBA 1RS0A 3GEEA 1FRQA 3QBDA 2XYVA 1E0AA 4D02A 3GNTA 1I36A 3PR2B 4LHXA 4P86A 5IU6A 4WCFC 3IDFA 5AK6A 1QWOA 4OBEA 3W2HA 4FGWA 4H9GA 4TT3A 3KYDB 5ICEA 2R3SA 2HBZA 2FUG1 3PD1A 2HMYB 3D6JA 4LSWA 3RROA 1IDOA 4MVJF 1F2UA 1GXSB 3GJ6A 4M9UA 4WESA 4XCQA 3SR0A 1N2CE 1OIXA 3V7YA 4B34A 1E79D 1ZSNA 2OPBA 2JLSA 2V55B 2X5KO 3HXOA 3FVWA 3KSRA 3P2EA 4JBHA 4I6GA 3Q3JB 5IAOA 4FR2A 3QX7A 4M9XA 1I4EB 4YIHA 4KKVA 3DPSA 1KVQA 4R9NA 3NEJA 4ZOEA 4RJJA 2WHXA 5H59A 2WKQA 3F71A 3TN7A 1XT6A 5CCXA 1U6JA 1JFSA 2NOAA 4LBVA 5GONA 1WWKA 1OTYA 3OA2A 4JJFA 3AVUA 2H1HA 5IZCA 2HTFA 2F3RA 1MDFA 1G3RA 1PS8A 1NP3A 2H7CA 4HR7A 3FZGA 2ZJ5A 2J87A 1FFEA 2XCUA 1YB5A 2H9AA 4KI0A 3PC8C 4WD3A 5TPZA 5FTMA 4G5XA 4BLVA 4E5PA 5JNTA 1F3LA 2WF7A 3GJ3A 3MAGA 4PYMA 4X1OA 1OOEA 3RYIB 1J23A 2VYQA 3U4CA 2AFIB 1U3VA 4N47A 4HB4A 4IRMA 4ND4A 4RAOA 4EQ6B 2EGUA 1Y81A 3L9XA 5ALMA 1N32B 1O6FA 4GZMA 5EKXA 1A5BB 4MTLA 2JJYA 3PEWA 1Q0HA 2FLKA 1XO1A 2VWPA 3IPAA 3K7EA 1ZD4A 3LBHA 5IKXA 1V5EA 2CD7A 2QX7A 3ETDA 4M0EA 3FPBA 4C1NA 2D7JA 1M8PA 1Z8HA 1DUSA 1KI3A 3CR7A 2O9JA 2WFLA 2Z1MA 4DR3B 3H2BA 3QBVA 4ZVVA 4H4DA 1TU0A 3F3MA 2YHAA 1Z38A 2GF2A 2QHXA 2Q4BA 5CDHA 1O87A 2QL9A 5L6MB 1VIMA 2XUQA 2Y66A 4U2FA 4FFLA 1DPGA 1GITA 2CFIA 3HPRA 3KDAA 3RVDA 4OUDB 3GJ7A 4IF6A 3U40A 4NWIA 1Y5LA 2BUCA 2P69A 5F12A 1JIUA 4GXNA 4G0UA 1TYZA 3DMTC 4A0RA 2JRCA 1RACA 1TKBA 1W9MA 1N1MA 4TQ9A 5EHXA 2IPMA 1I2CA 1OHHA 4ESHA 2GVZC 3AUUA 4FYMA 2PZBA 3M0EA 4B7XA 1WEKA 2IK8A 3WLTA 5J2TB 3AVTA 2GXAA 2ZUFA 2ADMA 1LV8A 2JCXA 1IJKA 3AGPA 4AUEA 4Q1AA 4YRDA 4IH1A 1FX1A 2BMDA 4PZCA 3QE3A 4KSCA 3KQQA 1UM8A 2CD9A 3JQAD 1OVGA 2H5EA 2H17A 5CLLA 1XCMA 1GFZA 1T9ZA 2QTGA 3HKEA 5TSDA 1AUXA 1BXZA 1XZHA 2PH1A 2X7JA 3D6VA 4PZYA 2YBDA 3T1TA 4PM4A 2FZ4A 4UU8A 5ALEA 1AHNA 1GAQA 3UK0A 2CKDA 1RJ9A 4BNDA 4CG0A 4RK0A 2MU1A 1CPYA 4LXXA 2ATXA 4NY1A 2O8CA 1CJUC 3HKBA 1F60A 5D84A 4I14A 1SULA 4PIPA 4GGMX 1E3JA 4N3CA 4JVOA 3KVYA 4I9NA 3SEQA 2LDXA 3F78A 3OVMA 5DNCA 5KI6A 4GYKA 1D4ZA 2Y68A 1WUHS 4RW0A 2VIIA 5KPDA 1WS6A 3BL8A 3I1JA 3ONWA 1EHCA 3E9ZA 1GNQA 1KS9A 2IYQA 4N0MA 4RMGA 5DV9A 2J5BA 3E5RA 3H8WA 1FLDA 1SM4A 2LVBA 4P3XA 3ND5A 4G4IA 1X2BA 5M3BA 3HJFA 1PGOA 1F2TB 3HS3A 4WKOA 4C7OB 1YZUA 4CCAA 3COWA 4TUYB 2WT9A 1XG5A 3VYUB 1CG6A 1KP2A 3WYBA 3P4XA 4DQKA 4GE3A 4RKWA 1C8VB 1BROA 1PI3A 2HH9A 3I09A 3HKEB 3PUYA 4IDHA 2CEKA 4XIIA 1YVDA 5DTIA 4CI9A 4E33A 9LDBA 2J33A 1ZCAA 3CWCA 3I4FA 4K9DA 3T4UA 1Z73A 3QEMB 1P1JA 2ARKA 2H08A 4F5DA 1A9QA 4CLOB 3FB4A 3RSCA 1FZTA 3Q8MA 3IT1A 4HH1A 4GPEA 1SRRA 4QHSA 4BHTA 3VNUA 2ANBA 2WP0A 3SDBA 3RVPA 1SCAA 4IDOA 3FSEA 1GPUA 1Q15A 1L3IA 4LGVA 2YH2A 2FFRA 4F91B 3QA9A 1EIZA 1JLHA 4YQYA 1TT5B 3WADA 1R12A 1NVVQ 1PYGA 1RXIA 2FOIA 2RI0A 3JYLA 4NZOA 4WK4B 3IKTA 2FX5A 4BVLA 3V1MA 1L9XA 3QNWA 2QU7A 4NHOA 3SXUA 4YRCA 2ZE6A 2ZB2A 2PMCA 3D7SA 4KQKA 1BIFA 4D0RA 1CU1A 4ZHQA 4LQ4A 5HPYB 5JY1A 5KWSA 5FA6A 1N9ZA 1C9EA 3R0QA 3MINA 5FO0A 1G63A 2AC2A 3NH6A 1JQBA 1XLTC 2CXTA 3C45A 5HKBA 2WP8J 1G20E 4ENRA 3RJ5A 3DULA 1WY7A 2JA1A 4JYZA 2WJYA 2BTQB 3L0PA 2OBMA 4HV4A 4YR7A 3O83A 1H2WA 3QVKA 1JHMA 4MUAA 3ZGXA 1N77A 2VLIA 1FJHA 5DX1A 4W9NC 1JPUA 2JKVA 2WJPA 4I3GA 1F0PA 3TSZA 4DR6B 4Y1FA 3H8VA 1DELA 3MWFA 2FZGA 4H0NA 2ZRMA 4JI4B 3BXOA 4QFCA 5ELXA 3JQCA 2FW8A 1U0EA 2PRKA 2XB6A 1ECFA 3JAKA 3O8BA 4QOIA 4WVFA 3ZVRA 3IAEA 3Q8KA 1SHZA 3L1IA 2V5VA 1F4PA 1E8DA 2V58A 3ZCSA 2ONZA 3O2QB 2Q5IA 2XT6A 3FMVA 3PJEA 3W78A 4K03A 5I7EA 3T5MA 2ILTA 1ADBA 1H66A 4XIGS 4D9EA 2RDMA 3ROKA 4W9RA 3W2TA 2H5IA 5JJLA 5HS6A 2Y05A 3ZIAD 4DADA 4MV3A 3VSBA 4O2BA 2ZBVA 3T7SA 2O0LA 4JR0A 1NBWB 5L40A 1SC9A 1SCIA 3I0MA 4G5OA 4L51A 3EG9A 4X3PA 3OOWA 4RCZA 3T06B 1JSLA 5JZOA 2YNMA 5JNWA 4LXHA 1PVVA 5FFMA 4A5SA 5C4GB 1GXSA 2ACKA 2BGJA 4OK3A 5C8DA 1FMTA 4ZFNA 3W4KA 4OB6A 2PBFA 2VDWB 3HYSA 2E0IA 3INNA 2FSVC 5D6NA 3W2EA 3WL7A 4FEEA 2OK7A 1W0KD 1V16A 4JSYA 1PT8A 2OBFA 4WW0A 4YQFA 3UMFA 1R9GA 4PCVA 3TZBA 4P32A 3T0FA 3VTFA 4BNFA 1M7GA 4OKSA 4EG0A 2E2WA 5AESA 3TIVA 4P35A 5I7UA 2RAPA 3QLVC 4MJ7A 3JQ7B 3X3HA 4Y1RB 4C01A 1NJ8A 5IT4A 1Y8CA 4P7BA 2BFNA 3RRNA 5LXTB 3GXOA 3WK8A 5BSKA 1YBFA 1IOLA 4YAUA 2B5OA 1DC7A 2WU8A 5KTRA 1EX9A 4PV7A 4BKRA 1NKVA 1E2UA 2GBLC 1NN0A 3EA0A 3ESBA 2C4VA 4QDZA 1LSJA 4ZTBA 3ZZ1A 4C6TA 4IFEA 2N46A 3ESCA 1MENA 4JEMA 1XVTA 3RVOA 3ZGVA 3UUWA 1DIRA 2NYUA 1NHWA 2WM8A 4HNAA 1PJLA 3KKKA 2CLSA 3TL2A 1HMYA 1GLGA 2RMKA 2W83A 3O1LA 4WFJA 2IQIA 3K5PA 4JR2A 3R40A 5DRYA 1KEUA 2KMLA 1JAIA 5IF3A 2PZMA 4JXZA 1H4QA 1P9LA 1V9LA 1XVAA 4YJ2B 5JRJA 4B1FA 1GSOA 3OUUA 1FSGA 3BL5A 4QQFA 4YJDA 3DE0X 4UCFA 1W46A 5CVCA 1YS6A 3FIJA 5JLAA 1MZVA 2HWYA 2J0UB 3FOBA 3GMTA 3SBXA 2J5XA 3U1TA 1DSSG 4JU9A 4B40A 4KV9A 3OEHA 1FPQA 4YDHB 3AM1A 4DL9A 1MMFB 3ZKWA 3A6FA 1E9VA 3W5HA 5DTRA 1LA2A 1EBUA 2DM6A 3R5XA 4FSHA 4GBED 2R1TB 4V24A 5ADHA 4OQZA 4S1NA 3Q7QA 2JW5A 4C4AA 5K3OA 4CW7A 3TUJC 4IYRA 4RVGA 5IYZB 2AF3C 3KPVA 4NZMA 1Z2PX 1W47A 4RMIA 5IYZF 4C7JA 1HA3A 5LMCA 3SF0A 1MAVA 3A6ZA 3RFUA 5MF6A 3GDFA 3HDHA 4MYSA 3ZV5A 5BN4A 5KKNB 4M9RA 1QZZA 4PC3A 3I8XA 3V7NA 2X9GA 3VPCA 2JIDA 3OLQA 1Q1NA 3CX8A 4IIBA 5IC5A 1SJ9A 4AJLA 5BURA 3FBWA 1S9HA 4RM2A 1MJHA 4YCMA 3VO1A 4PTZA 4YAKA 1G8FA 1U8EA 4JXKA 4JY7A 5DOZA 4F9GA 1DKOA 1PZGA 2R8OA 2JIPA 4R8RA 1QP8A 5DTQA 5JD4A 4PIVA 1TCAA 1X87A 3EDMA 4UU7A 2J6CA 3RT9A 3PDHA 1KAGA 2BGIA 2P0YA 1QHXA 1U81A 1JEAA 1M7BA 2WFAA 2VQDA 5FV7A 3GFQA 1KSGA 2XAUA 1XR3A 3FKQA 5T8KA 2WSYB 1FNDA 2D62A 4NCNA 5KSZA 1ZMBA 3G8CA 4ZRMA 2W4MA 3MGBA 4PO1A 2L82A 4QU0A 3T7TA 3OTHA 4OYLA 4CNQA 2FYTA 3UMCA 3KS9A 1C9DB 1ESMA 3LO5A 4JI6B 4MRMA 1UMCA 2F9FA 2HHAA 1V9CA 1YVRA 4R51A 4D2IA 3VKVA 1PRYA 4DJTA 3V4PB 5BQFA 1XI2A 1LDMA 3NH9A 3ORQA 1TM7E 4JA2A 5CHEA 4Q9JA 3FUVA 1VE9A 1F0NA 3H2SA 2WWTA 1N2OA 4HKTA 4IDGA 4KGXA 2O8FA 3TQFA 2PX0A 2V0CA 1MPTA 3S5JA 3LXMA 5CH5A 3OZSA 3SXJA 5L6LB 3GLFB 3WJ7A 3AU9A 5AVWA 3HK2A 2XNCA 1GPH1 2VJYA 3CF6R 4HAIA 3JQ8B 4JL5A 3NUQA 4QOFA 1OAKA 1GY8A 3ZWXA 1EWRA 1P80A 4PRLA 4R9SA 2PUFA 4OMDA 5SZIA 1NUPA 1OBFO 3A37A 2BM8A 1IZ7A 5FWXA 2DY1A 2I67A 4S0ZA 1I94B 2ASVA 3ZW7A 4HYTA 2C9YA 4N7RA 4A6XA 1BDHA 3DAHA 4OP3A 3N2NA 3BORA 3SS7X 3ZHVA 1JVSA 3PHJA 3H05A 3FJYA 1U90A 1TEZA 1UT6A 4EI2A 3G2MA 4GYYA 2NO7A 2JZOA 4BLSA 1BGWA 3N9IA 4OJNA 1W1WA 3H2JA 4YK7A 3VR5H 4EF6A 2XCSB 2PRSA 3GFVA 3Q9LA 2Z58A 5F7OA 2XODA 2CL7X 3UICA 5G41A 1CXZA 4D8XA 1E6MA 1JJFA 4DLKA 3BXFA 1U1EA 3FNHA 4I5DA 5BQPA 2GPJA 4LJYA 3U0BA 4ZDKA 2C3UA 1O96A 5DGIA 3RI3A 2PX2A 1NTRA 1NVKA 5LWQA 1TYEB 4P36A 2P11A 4DY6A 1TW2A 3EZ2A 4NIMA 4UVHA 3VAZA 1NVTA 5AVVA 5AWFC 1UBFA 1ZI8A 1W87A 3WL5A 4G5FA 3BIFA 3U4QB 3R0JA 2O2CA 3JASB 4BUZA 4KQCA 5KCMA 3DMRA 1C9KA 2F00A 3QG5A 1DC5A 2R66A 2ZYSA 4XQCA 4KODA 4REQB 2VDRB 5C1BA 1BFUA 1JMYA 4P38A 4ROSA 1RABA 4FWIB 4GHWA 5T57A 1FA9A 1AB6A 2ZJBA 3NTVA 3Q7TA 3T7CA 3EQ9A 3WXMA 4F72A 2R44A 2Y4OA 4I5GA 3PFIA 1AO3A 4E6PA 1HY3A 1E59A 1L7XA 1WL8A 4DLRA 2D6FA 4EAAA 3M5WA 1YJQA 3K71B 1DG9A 3F7MA 4Q3CA 5CX4A 1JI0A 4YP6A 4TWZA 2LCQA 1KI6B 1E92A 1KJNA 3IAXA 3JQRA 4FYIA 3RSQA 3TIIA 1V7CA 3OU7A 2GCGA 2C95A 3GP5A 3VPDA 2O8FB 2W9XA 1Q5PA 4DAOA 1ZGZA 3ZK9A 3PPVA 1MR3F 1QMGA 3UMMA 2D1SA 2K6GA 2DHQA 1FYXA 2WTAA 2XNDD 1THGA 3DVSX 2JGAA 3NTQA 3QXCA 2X8JA 3DEAA 2W4QA 3NJRA 3OBBA 4G5YA 3DTTA 1II8A 2G9UA 2PJZA 2FRDA 1XCPA 3W5CA 2D3TA 4BFSA 1Y4SA 2WU1A 1DQSA 3A4YA 4TV9F 5CX1B 1C1HA 1Q22A 1QGAA 1SC3A 2GNAA 2E5LB 1J21A 1FP4B 1HDGO 3KZOA 1T2UA 2HCTA 3E9YA 1LUAA 3OOHA 4N40A 4AMVA 2NO5A 4BQQA 5L7WA 3VR6H 2ZSHA 3B7WA 1RRPA 1T26A 2FZCA 3IT0A 3AVXA 1JG7A 2I4TA 3EXAA 4LYFA 3IEKA 5HJ5A 1JHQA 5IAAA 4L0QA 2GWRA 2ZJ2A 4DCOA 4FHGA 1C8LA 4RIGA 1PNRA 3VH2A 5JO0A 5EC8A 5JSHA 1G1AA 1V25A 5DMHA 1PYOA 2EARA 3H1GA 3IUBA 1ZX1A 1M74A 5IF9A 3DS8A 3UW3A 4TL9A 3VNRA 4ER0A 5L45A 4O4IB 2R6JA 3TZLA 5CA1B 1IBRA 2XF8A 2C4MA 3N76A 5B1DA 4BN0A 1YZ3A 1P0CA 1QCDA 3STTA 3V6MA 3CH7A 4DXDA 2QNIA 1GNPA 5ECDA 3K16A 4BTEA 1MU0A 3ECAA 3LC7O 3ZV3A 3FW1A 1EQUA 1GGEA 4QHTA 3ZHBA 1Y1RA 1ZC4A 2DT5A 3IQIX 4TSFA 4EYOA 1S4MA 1YQTA 3DAPA 3I0ZA 3JVDA 4QBKA 2XB4A 5I9SA 4JJ8A 5HOEA 2QRNA 1GG2A 4QG7A 4AI6A 3ESQA 3TBHA 1H2HA 1ZZGA 3CC8A 5HXAA 4Q48A 5HJ2A 3RQIA 2YCBA 1US8B 5FO1A 2OECA 5U9CA 1YUBA 2FWAA 2PLAA 3BIWA 1IXYA 1BCSB 2J5RA 4XVQA 5DMXA 4LHZA 5HJEA 1QGOA 3CA8A 2OCAA 1VPWA 3QX9A 1V1RB 2FWBA 1GZVA 1T6BY 5AM1A 3T3IA 3ONEA 4FYWA 2VK1A 4Z1OA 1NBMD 5KOJB 2E7ZA 4D25A 4DS3A 5KNCA 4UAVA 3HB4X 3L1UA 4R68A 3H8JA 1EFHA 2B92A 4RHEA 4YRFA 2R62A 3HEBA 5HF5A 2GZAA 1KO5A 2VVTA 3AWDA 3C1AA 2ZIXB 3W8RA 4ES6A 3CN7A 4HD8A 4DB2A 1N8SA 2IYWA 5C1IA 2W37A 3WKDA 3ZZTA 4DKXA 2I76A 5HNKA 3CUKA 4MWZA 4NNOA 4DOMA 2C5SA 1OFVA 1SXHA 1XTPA 5HFAA 4ND2A 4D8UA 1HDZA 5EJ9A 3PFHA 4Q12A 2Y1XA 1JJ7A 2OHOA 3KT0A 3FPHA 4KQWA 5ADWA 1HSZA 1R16A 1QX4A 2ZIUB 4ZQEA 4GXTA 5FL3A 3DZKA 3EZLA 3QYJA 3OHMA 3EPLA 1K3FA 3I5XA 3ICQB 2VP6A 1X7ZB 4A23A 4LY6A 3IQWA 2IXBA 1Y9EA 2RHWA 2QTFA 3G9UA 1LW7A 3H18A 3ZVMA 1NSTA 4YI3A 3DHEA 2O6HA 1KRXA 1GDTA 1DC3A 2VQ3A 1P1FA 2FR0A 1E3DA 1AKVA 2I0FA 3NEPX 1LJ8A 4LOLA 4I5EA 5FIUA 4DF3A 5AW3A 1WMBA 1OU0A 5FPHA 3SQWA 3BH7A 2QZ4A 1RXVA 3ZS8A 4EI9A 2AEEA 3H9GA 4K28A 2CNKA 2OHGA 1XTQA 2R1VA 2QRJA 3EDCA 3IDAA 3KFLA 3GLHE 1E2EA 4IVNA 5DT9A 3RRFA 2GNPA 3L04A 3ZQKA 4YLEA 5IXSA 1KFBB 4E1BA 1DJPA 2H11A 1XK6A 4KLCA 3UT6A 3WVNA 3EC2A 2GPNA 2CVOA 1OWLA 1JG2A 4JHLA 1K2WA 2XAAA 3GGPA 4RPKA 1W4AA 3WSTA 5BVGA 5C3UA 1MAWA 4YDQA 4YJGB 2OHIA 2X42A 4WLEA 1PHPA 2DVMA 1USVA 3RHSA 1UBHS 1VYHA 3D8TA 5HFJA 3ID6C 2GBIA 2H0RA 1F8YA 3T1NA 5ESWA 2YJGA 1OAOC 1HT3A 1U1IA 1L8LA 2A5DA 2ZVPX 3KXKA 3KX2A 4HRYA 4X93A 3KM0A 4M1QA 2ID8A 4LY3A 1EXWA 1VDZA 3GJ0A 3K5WA 4K0RA 5A0FA 3C4QA 4G6ZA 3UUFA 3WNBA 1E1YA 4FGUA 2BFBA 1GN9A 5ALGA 3KT6A 2QWXA 5BYJA 1OPRA 3D64A 4XM2A 3PTLA 2B1GA 5TDHA 3FVTA 2WZQA 1RHMA 4LDAA 1NNEA 4LJAA 3THOA 4YCCA 2FDRA 2PKEA 2WWWA 5WRFA 4A6EA 1M8KA 5JANA 3G17A 1ONNA 3H4IA 3CXUA 4WBNF 3BIJA 1S8OA 4KPUB 2VSXA 1D4OA 2AKAB 1ULBA 3EMDA 3ON5A 5E4YA 4B4UA 5LL6P 5E7QA 3WMRA 4BQSA 2J8ZA 2VDPB 1PUXA 2VOJA 3QHPA 5JTTA 1H5NA 2A33A 1AO0A 1NQ5A 4CDNA 2HA6A 3GV0A 1GZ3A 1ZINA 3TX6A 4K2AA 4E30A 3E2PA 2OXFA 3IBTA 3U3RA 5HP4A 2J32A 2B34A 5E3HA 3CXRA 3FMOB 3U7EB 5CCBA 3DV0A 1DBRA 3CG4A 3NAZA 1SVSA 4D56A 4Z54A 2VJOA 2OKGA 3L6CA 1D6MA 1JLSA 3QG1A 1OT5A 4CIWA 4P22A 2OFFA 3SJZA 4I2VA 1O0CA 5KOIA 3FOWA 2Y93A 1JQJC 4I36A 2VDKB 3T3HA 3HMQA 2D2IA 3KOWA 1NNLA 3PD0A 4MDHA 4B7CA 4LSMA 4TWIA 5COAA 1ZR4A 3NHPA 3LOUA 4CEHA 2GI4A 3JQGA 4JASB 3EZGA 1KDRA 2IDZA 4CKZA 4OATA 4RS3A 4OSPA 4UE3S 3FPFA 4HJRA 3W06A 2GCPA 5LQJA 1JDUA 2IF0A 4CQMA 3G5LA 2FAXA 5J4YA 5F2EA 4M55A 2GEDA 1GTSA 2W8BB 4I1OA 3DBRB 3AKYA 1V3TA 4ARVA 1H69A 1DFGA 3IUQA 2XT9A 1Z9BA 2H1FA 3OZXA 4D0NA 2CWWA 4DR4B 2OMKA 5J59A 2EQAA 4KKXB 5FOXA 2C3PA 1KY4A 4QD3A 2P6OA 1QNLA 1QOPB 3EZYA 3K0AB 3OSZA 4UOEA 3A9WA 4GL2A 1P5RA 5JDIC 5BWOA 4XGIA 3I2JA 1AG9A 4L7VA 4OJKA 4R2IA 3FKJA 3KTAA 2B98A 2CNWA 3I23A 5ABPA 2J3EA 2AG6A 3OX4A 4K9OA 1MPXA 3EFHA 3P9RA 1A8UA 3QX3A 1FP7A 1TVKA 2YV2A 2NVBA 3M82A 3EZ6A 3TB4A 4NENB 3UM9A 5JVDA 4F6RB 3MWEA 1UL1X 4LNUA 1RWPA 3I72A 4LC0A 1M2KA 1SA0A 2HMVA 4WKPA 1A76A 2I54A 3OQJA 2ORED 3P19A 4QICA 4KFUA 4MUYA 4WY8A 4Z5XA 1KR2A 4OH7A 2AYXA 3KJIA 5THKA 4B4VA 1TX4B 2HWUA 5JH7A 2G5TA 2ETVA 4HDCA 3PFWO 5AFSA 4F4DA 4GDMA 3U81A 5LP6F 1DBPA 1LVUA 1X1EA 4B5KA 2DHDA 1XLWA 4PWZA 1E0JA 1NONA 3D4NA 2B5VA 5LA6A 2RH5A 3NO4A 1QIJA 2AIRA 1UFRA 3AJ9A 3ECCA 1KI1A 2NSLA 4UDYX 1E6EA 4YH1A 2GBLA 2GZ1A 1LVGA 3F2VA 3BILA 3U4DA 3WB1A 1IMOA 1XN4A 5AI4A 4UTNA 1JAXA 1UQUA 4TS1A 3TQCA 4D9MA 4EGSA 4C88A 3NT5A 4QOJA 1Y7TA 3JR3A 4E5YA 1BRMA 3C5WP 1XZQA 4MVXA 1UANA 2IF2A 4JFAA 2AI3A 1U0FA 4Z3KA 5JW6A 5K4GA 2JAUA 3MOGA 3X2EA 4MA0A 4M87A 1OBHA 3DCYA 2M6LA 4DQDA 1XZ8A 2AWNA 2FEWB 3JQ6A 1TE2A 1WE2A 4XM0A 1H2YA 4D9HA 1IQ0A 3ITEA 1T6XA 3RVRA 2A59A 2C8LA 3ICWA 3HYRA 3N39C 4UZSA 1RT9A 1V5IA 4NEQA 3PFKA 3R0ZA 4BKOA 1MH9A 1X1TA 3L7YA 3ZLJA 4PGHA 2I99A 1O3YA 1SG6A 2AFHB 3IVGA 1I7DA 2C2ZA 3BOSA 1U1DA 5J5AA 1Q14A 3AUAA 4UULA 1HI9A 3FRIA 4MQFA 4RH0A 1P9NA 1RFGE 4RIIA 4R54A 3IMFA 4US0R 1JNXX 2A0XA 2XUKA 1GG8A 1Y7LA 2RKOA 4MO2A 4DV6B 4C3UA 2ZUVA 4TMVA 1YZVA 3GDWA 4KOEC 3KG2A 3SQMA 5LVAA 3OZBA 4KRGA 3N2IA 3PU6A 3C24A 1QKIA 3BM5A 1JWLA 4IJKA 1X86B 4ZEWA 3I37X 3UMRA 5BUZA 3TW4A 3I53A 2DBRA 5BMVF 1H9AA 3M4XA 3BMCA 4YJ3A 2IKQA 2G1AA 3UJPA 3ZE6A 4E2ZA 5LN1A 3CLUC 4P31A 3NHLA 1AJEA 4MQ4A 5FUVA 4MUXA 3AUJB 3D8RA 4IQ4A 5EMMA 5CJJA 1KMQA 1TAHA 5FBZA 2O8BB 3SZOA 3DF9A 4JBWA 4KSBA 3E7FA 1LD3A 4IXWA 5C9ZA 5I8WA 2WMDA 2ODBA 2VI5A 3UFBA 2W2TA 5LJLA 5BN3A 4PHHA 2GKGA 1XVIA 2QL5A 721PA 4AO6A 4LKOA 5I6DA 1N7HA 5BPHA 2EWVA 4GM1A 1A4XA 2R4QA 4S0XA 5CNIA 3TLXA 1KMIY 4E14A 2WAOA 2QF7A 4OPMA 4PLTA 1BTOA 4X61A 5EJAA 3HC7A 2ZUDA 3AR4A 4IEFB 2H0QA 4G3XA 2A1TS 4ZO7A 1PJ3A 2EFDB 3EGIA 4XWYA 1N57A 3CX3A 3A1DA 3WYFA 5AVTA 1N5RA 3CF0A 3ENNA 1NVBA 2EKQA 3ZCTA 4MAAA 1VLVA 2JHFA 1EWYA 3CZQA 3N7TA 2UUOA 2Q5EA 3NHZA 3FG9A 4EYKA 1QVAA 1T5BA 2FN9A 3JSAA 4M2LA 1DX6A 3BJMA 4ALLA 1DFIA 4YRQA 3B2NA 3DE5X 1XDGA 2C9MA 3VO9A 4QA9A 5REQA 3EXEB 1JWBB 3HH8A 1RIIA 1FJ2A 1PLKA 1JLKA 2IU3A 2VC2B 2BW0A 3Q88A 4E51A 4Y0VA 2PX6A 3OP1A 1RMQA 3V2UA 2COKA 4C2AA 1FS5A 1NP7A 3A3KA 2VUSA 5FPTA 4C06A 2TRSB 1P29A 1XJWA 3FH0A 2J5KA 3L43A 2K5UA 4IZ6A 2AMJA 3OEHD 3TW6A 2IPAB 1N92A 3LIPA 2B25A 3KUXA 2QG4A 1KOLA 2DLDA 1IZZA 2B0JA 2J0SA 4ND3A 2QUIA 2D1TA 2XF2A 4MS1A 2VHYA 3GO4A 1G21B 1L9KA 1CZNA 2VDLB 4Q9DA 2A86A 2JIMA 4U7GA 1Z33A 4AROA 3R3XA 2WZDA 3ORSA 2YRFA 2F1KA 1NM5A 1L5ZA 4I4TF 3V55A 3HLYA 4X71A 2GRAA 2IYXA 4LMAA 3D81A 4X41A 5FBVB 2J9ZB 3IAM6 1T9GS 3ZDFA 5KU7A 2JAHA 1GKLA 1O95C 2W2QA 3FJ1A 4TVSA 5LMNB 3KSUA 1JQ5A 1Z7BA 3LUGA 3DD1A 4G5SA 3H5NA 4CF7A 4JEUA 3WLIA 3WDKA 1G5TA 4QNMA 1N0WA 2Z98A 1QU3A 2ATVA 4K8OA 5GGXA 3UK2A 1OYVA 2EKPA 2WDPA 4Q7EA 5B37A 1VC2A 4L5YA 1KEKA 1MKYA 3Q6IA 1EMDA 1H4VB 1OSNA 3GIWA 4D5GA 1Y9JA 2AFVA 2X9NA 2GFQA 3FF1A 2O7VA 1SVOA 4V0KA 1LF0A 2Q1WA 1V8OA 1N3BA 3Q4GA 1PL6A 1VMIA 2I4OA 2CLMB 3KALA 4U2BA 5DM60 4NABA 3U39A 2QXTA 3K1TA 5JI3E 4FYKA 4TKMA 5H9WA 1Z74A 2WE7A 4FYXA 1J2YA 1WMAA 1ZM2A 1R5OA 3PRHA 4EZBA 4IWYA 1C2YA 3PPXA 5BSWA 1DQPA 2W6ID 1ODKA 1TUBB 1PEKE 3X2FA 4ER6A 1JAZA 1CDEA 4KQ6A 1GGJA 2NU7A 3UGJA 3OECA 4A2PA 3W7BA 3BXZA 2Y27A 2Q5QA 2WFZA 2NO9A 4LMPA 1F9EA 4XA8A 4MMZB 1ZGHA 1X13A 2V4UA 3KYCA 4TT8A 1T6ZA 1WPRA 2I1VB 4D26A 2NAPA 1UXKA 1R0SA 3MCTA 3MWYW 3CPSA 1NI5A 4IFTA 1ZXBA 3NP9A 2B83A 1EXNA 3CF4G 1KMHB 1K7FB 1KORA 2OAQ1 2JEOA 3IKLA 4BMDA 1JNYA 3PF9A 1JR4A 2GDJA 3LBIA 3MLEA 4Q3EA 2ZAYA 4N76A 4DV3B 3GMDA 1IAVA 2WU4A 1R6TA 1QHHB 3DCNA 1R3DA 4IKPA 4YGXB 4NPHA 621PA 2O2ZA 1SCUB 4E7OA 2G4LA 3P94A 5H7XA 1Y3DE 1E2HA 3DT8A 4FTWA 1L1RA 4FLMA 5K0FA 1HQKA 1FTWA 4WSOA 2YINC 1E1QD 2ZBPA 9LDTA 1ZGAA 1A27A 3LQQA 4P2BA 3DZFA 4HS4A 4YUZA 1UFKA 3RHZA 3LTEA 4BB6A 2DHEA 2VJMB 4N8EA 3HJUA 2WJ6A 3U7IA 3ZNOA 5TY0A 4J4TA 2XB9A 3V1LA 4QJIA 3K9BA 3CZ9A 4ZARA 5F9MA 3U4MA 1Z47A 4ROTA 4BJ3A 2RIPA 1UXGA 5JSYA 4EDHA 4IV8A 4OXYA 1USUA 3DVQX 4KXMA 3LFHA 4HSGA 4RPIA 3FKSD 5FOUA 3WA6A 3EZ9A 5CVDA 3R5TA 5K3BA 2IEIA 5HIAA 3UKJA 2JIZD 4I4NA 5MFPA 1XCOA 1IEWA 2I7TA 5ENVA 2O1SA 5DK6A 1V8PA 4KYUA 4L95C 4NZNA 4GD3Q 2PQ6A 2AGVA 3G8BA 4GR9A 1BZYA 4MP8A 4RVSA 3K8YA 3URKA 5LIPA 3NATA 5KYXB 3EDYA 2VHEA 4XTCS 3A7EA 4LV6A 3KZ1E 3T5GA 3TQQA 3H9UA 1CQIB 4IQFA 4EATA 3L1HA 4EMSA 1KZ4A 2GZMA 1N0IA 3CN9A 3EVNA 4DLPA 2WJVA 3HFGA 4JP5A 3DZBA 1PGJA 1XZDA 1OV4A 3OBIA 3FD8A 5F76A 4YJ2F 2A9KA 3DT9A 3EMBA 3O8NA 5F4ZA 3CEMA 5I8ZA 3CLRC 2AFHA 4PQEA 5GP1A 4MRSA 1MVOA 5IK2A <