4CM7A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
252
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQNGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
total genus 94
structure length 252
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm7A00
3PWSA 2EGHA 3GRKA 4R16A 2AXQA 5F1PA 4GLOA 4WLUA 3GLQA 4FGSA 3KSZO 3IS3A 1K89A 3DMTC 3JQBC 2I99A 4MVJF 1XG5A 5I9LA 1IE3A 2X4GA 1LU9A 1YQXA 1IULA 4KP7A 4CODB 5GZ3A 3RQSA 4NK5A 1M6HA 2VOJA 4IZHA 3PLNA 4ZQHA 3WYBA 3C7DB 5DCUA 1BW9B 1M2WA 2VUTA 4J1SA 3OP4A 1DAPA 1LDEA 4NQZA 1QP8A 1ZMTA 3GVCA 1V35A 1YVEI 3AK4A 3FN4A 3NTQA 3ZWOA 4CV3A 5LC1A 4KDEA 3E9MA 2BHLA 3NT4A 4U6SA 4AJNA 5IN4A 1T1RA 4BKPA 4K28A 1ADCA 1K6JA 4WLFA 4OKNA 4J0FA 1U2DA 2HMUA 3C7AA 1WDLA 2VWGA 4FIZA 3ZU3A 3INTA 1C0KA 1TLTA 1PU2A 1YQGA 2AEMA 3JQ7A 4L0QA 4LMPA 4LSMA 4CMHA 4K9DA 5C7IO 4R1NA 3JQCA 4YJGB 2O4UX 3AOEA 1X13A 3F3SA 2UUOA 3JQAD 1RYEA 1HF3A 4R1TA 3VZQA 4OAQA 5KVVA 2RAFA 4XEHA 1UXKA 4GKBA 3JQGB 4NJMB 4CMBA 2RH8A 4J7CA 3LC1O 4AJ2A 1NYTA 3QY9A 3IP1A 2DTDA 5AXDA 1LX6A 4E2ZA 4LW8A 3ASVA 4U7WA 3R6DA 4XRGA 1MXHA 1WDMA 4Q39A 4JLWA 2ZQYA 2BGMA 4GLLA 4GX0A 3VPFA 1ONNA 4D3DA 1ORRA 1B15A 1GCUA 1UZNA 2WYVA 3WTCA 1EZ4A 2WEKA 2NU8A 1JLLA 2EW8A 2HSDA 2P5YA 5L53A 2AG8A 2LDBA 4B7XA 1O94A 1XYGA 2DTEA 3S2GA 3DO5A 4F6LA 2GZ3A 4CQMB 1GUFA 5EJ2A 1A4IA 1QYCA 3I9OA 1GPDG 1VLLA 4CLXA 1GZ4A 3AOEC 2IXBA 3D5QA 1LLUA 2XXBA 3F5QA 3HWRA 1BXKA 1YL6A 1FMCA 3IQDB 4ND3A 5K6AC 4E5NA 4CL8A 4IQ8A 3DR3A 2I67A 2O3RA 1SEPA 3PYXA 2CF5A 1DFIA 3VH2A 4YAIA 4EJ0A 1P44A 3HB4X 3ZWBA 1QRRA 3PTZA 3WGGA 4AJLA 3WLEA 4BHTA 3NJ8A 4CR8A 1Y81A 2NADA 2ZATA 3H9GA 2J5KA 3A9WA 3OA0A 3VTFA 3TWOA 4WOJA 3Q1LA 2HMVA 3WGZA 4H3VA 1GZ3A 2D8AA 1AE1A 4RVFA 4MVJM 1BVRA 2NU9A 4XQGA 4CM8B 4YXFA 3EVTA 3W4KA 5JBIA 3EMKA 1T26A 2PKRA 3GOHA 3JD2A 3DZGA 1EQ2A 3JTMA 4IQ0A 3OH8A 4EJMA 5JDIC 4AJ4A 3ETGA 2A9FA 4B8WA 3VZPA 1ZBQA 4BMNA 3IJPA 1R4MA 3BYZA 4IDCA 1ISFA 1PQPA 1P1RA 5BSHA 1PGJA 4YCAA 3TF5A 4ONEA 2O50A 2IEDA 3JSAA 4PLTA 5AVOA 3KUXA 4UUNA 2VHWA 2XF8A 1Y5RA 3IOYA 5C7OO 3BZUA 1AUPA 4ZJUA 3SBOA 2DT5A 4Q3AA 2DC1A 3F5SA 2Y66A 4LSWA 2Y0CA 5FEUA 3IUPA 3MJCA 1PIWA 4BO0A 4CM7A 3W8FA 5L4LA 3SEFA 4CMKA 3WJ7A 2I9PA 4EUEA 1QLHA 3RCBA 1P74A 4ROSA 1HE3A 1SB9A 1KBZA 4FOOA 3BXXA 2RH4A 4CL3A 3EGOA 3I4CA 2WE7A 3AU8A 2O3JA 3WQSB 4NIMA 4AL4A 5JCXA 3OJEA 3N74A 4JQCA 4OIMA 3E18A 2ZB8A 3QSGA 1ZEMA 2D59A 3AM4A 3FNHA 1PEDA 2IZZA 4XX0A 4BNUA 2GN8A 3QQPA 1A9YA 1UZLA 2ZTMA 4IJUA 1Y7TA 9LDTA 3I3OA 1FDSA 4KTTE 1UAYA 5KVCA 3TJRA 4GSKA 4HV4A 3CE6A 4E4YA 1LNQA 5BR7A 3UCXA 1LDYA 1B16A 4KUHA 1PGQA 1EUCA 1FDVA 4NMHA 1YB4A 3BTSA 2J3IA 1YE3A 5F1OA 1W73A 4DC1A 4DQXA 4S1VA 1FJHA 4UVEA 1YJQA 2E49A 3RUIA 4Y67A 3RUAA 4R4JA 1LJ8A 1PS9A 2TMGA 3NGLA 4BNZA 5KJCA 2Z5LA 4BUCA 2PV7A 4XGIA 3E48A 3ZWNA 2A35A 3PHJA 2DTXA 3L9WA 1HE5A 1ENPA 3ONDA 4U5QA 1D4FA 4YQYA 4F3YA 3QW2A 1NVGA 2HCTA 3GVPA 1R12A 2Y99A 3K9QO 3F1LA 3WX0A 4R51A 4Y98A 3STHA 3V5NA 4FCCA 3EDMA 1SO8A 1PZHA 4BS9A 2FMUA 3RC2A 1PQUA 5TSDA 1EDOA 4PLCA 2H63A 2G76A 2X0JA 2CVZA 2P9EA 4TKMA 3S55A 4PLFA 4EZBA 1NTOA 1DIRA 5IJZA 1U28A 2GLXA 4WPGA 5JY1A 5EMHA 3G79A 3OM9A 3VDQA 1KIFA 3OFSA 4YEDA 3ZWMA 2QX7A 3OJLA 3JD0A 4OHUA 1R15A 5TJHA 2GPTA 3RU9A 2YZ7A 1JU9A 1I32A 1MLDA 2ZJ1A 4HKTA 5T64A 2C20A 4E2YA 3ROPA 5IZCA 5CPFA 4CQMD 4LVCA 4CLDA 2NTJA 2PY6A 4BGVA 5DBFA 3V8BA 3PWZA 4MVJH 2ILTA 5AOVA 2HLPA 1JVBA 2H5LA 2PFGA 3WBBA 1Y1PA 3CUKA 4QT0A 3CKYA 4IXWA 1LTHR 2DU8A 2GCGA 1PWZA 3C3XA 1ENZA 1QYDA 5FWNA 2WM3A 5I7FA 1LUAA 3GNQA 3E5MA 3B20A 1QG6A 1OZAA 3F4LA 2XOXA 5H83A 1YL7A 1ADGA 1PJLA 1NAHA 4JP3A 1JKIA 4OXKA 1VJ0A 1HLDA 3KO8A 4YB8A 1HE2A 4F45A 4RDIA 3QIVA 4ALNA 1Y8QA 4YR9A 2X1HA 3KSUA 4ZICA 1ADBA 5T8KA 3HHPA 2AMFA 5IN5A 1PTJA 5JO0A 4BO1A 3ETDA 5U1PA 2D4AA 3BMNB 4P4LA 1JQBA 2QRKA 3U9LA 4RDHA 3HFSA 4BKOA 3P2OA 5IG2A 2B36A 5TRTA 4P8RA 4RJTA 5IZCC 2VWQA 1OBFO 4B3HA 3OJFA 3KM0A 3KTDA 1NQTA 1YRLA 4E33A 4WK6A 4WASA 1B8UA 1V3VA 3DHYA 1MC4A 3MTJA 2EW2A 3ZWWA 5DN9A 3D0OA 2DQ4A 4BNMA 5DZSA 5IDYA 2POQX 4FFPA 4JNKA 3GNSA 4BNVA 2GN6A 3EVNA 3QVTA 2Q4EA 3DAFA 3PHIA 4W9NC 1Z82A 4R01A 1HT0A 2XXJA 3RKRA 4Q3CA 4UAGA 1YBVA 3FNEA 1I36A 5J23A 4N54A 3DZBA 3VKVA 4EGFA 1WZIA 5U9CA 2EWMA 2WYWA 4YJFB 2X5OA 1A7AA 5T8KC 1P1IA 4XYBA 3UF0A 1HDOA 1KC1A 3CTMA 3WSWA 2UDPA 3OMLA 2C54A 1KOLA 2HQ1A 4J4HA 2BFMA 1ISJA 2IEBA 4HFJA 4YACA 1YH3A 2BELA 3JD4A 1VKNA 3GK3A 2FPGA 2O3TA 2C7VA 3ZI0A 3IAHA 1RM5A 1I8TA 3LLSA 3I9JA 2VWPA 4FSHA 1U3WA 1IUKA 3H3FA 2GF2A 1X7DA 2PD4A 2DBZA 5DCWA 1X1EA 3ZN2A 2VNSA 4FJ1A 1SOVA 1KY4A 1KEWA 3GG9A 3KV3O 1EDZA 3RWBA 1C1XB 1LEHA 1X1TA 1Q1NA 3E6AA 3H65A 1V9LA 3U0BA 3P7MA 3WG9A 1RM0A 2NQ8A 5TC4A 3QV1A 3MJTA 4MKRA 4CJXA 3AUTA 1ZZEA 3PHLA 3DZFA 1UDBA 3RJ9A 5U4QA 3VC7A 5HM8A 2R2GA 1PS8A 4A26A 2CDCA 3KOUA 1XEAA 4II3A 4DLBA 5CDUA 3C24A 2GO1A 1YXMA 4B8ZA 4Y6PA 5L40A 1ZO8A 2BFOA 4C7KA 5ENVA 3UAGA 5JDCC 2NWQA 3AU9A 4WLNA 1GQQA 2O23A 1KEVA 1VJTA 4H16A 2Q99A 4YVFA 1V6AA 3A06A 1TB4A 1Z6ZA 4CM6A 5CDGA 1F8GA 3RAJA 1T2FA 1E1NA 4IINA 4OH1A 1I30A 5F5NA 3SLKA 3BMOB 1SEVA 1X7GA 3K6JA 4OXNA 4CLOA 4BNJA 3DBLA 3H7AA 3U4CA 4WECA 5TF4A 3DFUA 1PQWA 3CZRA 3GFGA 3D64A 4FB5A 4I9NA 8LDHA 5BNTA 3AJRA 5JFOA 1VPDA 2G17A 4BO2A 2CVOA 3L4BC 4BKQA 3ZWYA 1PGNA 5AQ1A 4XGKA 3BHJA 1SOWA 5F21A 4C7JA 4IMPA 2W2KA 3V2UA 2ZTLA 3RJ5A 1XA0A 4KDFA 1IY8A 5JNLA 1E7RA 4PZEA 2CDBA 3M6IA 4IJWA 4CPDA 1IHYA 4IQGA 2GGSA 3ZWAA 3TRIA 2GYYA 4QFCA 1E7YA 5FF9A 4DUPA 4J6FA 4HWKA 2BRUA 3HSKA 3V1YA 2V6BA 1K2WA 1Z74A 4QO7A 1E1MA 1C1DB 1CIVA 4G2NA 1HTBA 4GQAA 3DOJA 4PVCA 2EP5A 2V6GA 3AUUA 5B4UA 1V8BA 1UXGA 2YJZA 3VKUA 2AQ8A 1H6DA 4R9RA 4BNGA 3E5RA 3UOGA 3QVWA 3TZHA 1DRVA 3DFZA 4EUHA 5I8WA 1DHTA 1LLQA 2VZ9A 3DHNA 3VPGA 3GGPA 3LC7O 2CD9A 3GEGA 5I9NA 1RYDA 3PQFA 5ADHA 1SPXA 1NFRA 1LRLA 1FF9A 2C2XA 3L6OO 2CMDA 2Y05A 3SX2A 2HUNA 1OI7A 4U0KA 1TT5A 2Y1DA 4NFHA 4DXHA 1LSOA 1P3DA 1XDWA 3BHIA 1X14A 1DB3A 3W4IA 4DYDA 3PHGA 2DBVO 4EBFA 3GRPA 5ITWA 3IUSA 3K2EA 4YJHA 1GYPA 2YQ5A 4L4SA 3P19A 1HE4A 4L74A 3OEYA 1T4DA 5B4TA 3TNLA 3ZHBA 3H5AA 4AJJA 4PG8A 3DBHA 3JYOA 3RBXA 2VYNA 3OHSX 1HLPA 3L07A 4B7CA 3NAQA 1KYQA 2P9GA 1LDGA 3H9EO 2IXAA 1UDCA 2FR0A 5COBA 3F9IA 3VOSA 1EVJA 1KETA 1M67A 1DLIA 3MOGA 4DYVA 5A05A 4XIYA 4Z3DA 2HMTA 2A92A 2DLDA 4OM8A 4OSPA 1TA4A 3KLMX 4TWRA 4CR6A 4HFMA 2VTDA 4N18A 3WS7A 5A3JA 4E0BA 3RBZA 1JA9A 4Z9FA 2V7PA 5A9RA 1YBMA 1NVTA 3DMYA 3FWNA 1SZJG 2DFDA 2G5CA 1XELA 2YHUA 5GZ1A 1Z7BA 2C29D 3QWHA 3WGQA 4A7PA 3A1NA 2Q45A 5LDGA 5L9AA 4CMIB 2F00A 4MVJD 1DC5A 3LQFA 1VL6A 2CZCA 1W8DA 1NWCA 2FY8A 1WNTA 2W8ZA 5T5QA 4P4GA 3OICA 3HG7A 2X22A 3DOOA 3OA2A 2NQTA 3DHEA 3PYMA 2OXIA 4M55A 2FZWA 2I66A 4GX2A 2IE0A 5ITVA 2H9IA 3QRWA 2EXXA 4Q3DA 2FN7A 4FPXA 3TFOA 3LVFO 3I4FA 1P45A 4CV0A 2PZLA 3IKTA 4L75A 3JQBA 1JN0A 5CPBA 4O1MA 1I5RA 4ITUA 3RVDA 4B4VA 4N5LA 4CLRB 3K96A 3MEQA 2HRBA 2JL1A 1ID1A 3ST7A 1SB8A 1ISGA 4RVHA 2UAGA 2JFFA 4CR7A 1IL0A 3B1KA 3C1OA 3TOZA 1KEUA 3AI3A 1V3TA 5CG1A 4M49A 5A9SA 4FW8A 4XQEA 4OJNA 1EQUA 3L6EA 1T2AA 3ZV3A 1BTOA 3JQAA 2X58A 4PG4A 2PZMA 2PK3A 1R66A 1QV6A 1UJMA 2FOIA 2G1UA 2VZ8A 4XB2A 5A02A 4B7UA 3CIFA 3TFQA 3DEYX 4FC7A 2AE2A 5L7YA 4J49A 2E37A 1EBUA 1AXEA 4ZVVA 1HSOA 1ISHA 2SCUA 3F46A 2NLOA 3V1TC 4N5NA 3F47A 3RUHA 3Q2IA 1LRJA 1Q0QA 2DKNA 2AQKA 4NZ9A 1LQTA 2VRCD 3KYCB 1YBAA 3KHUA 2OFPA 2O48X 1PX0A 3RUEA 4O59O 2QRLA 4MVJI 2DBRA 4PG7A 3ROQA 5EERA 4IDFA 3X2EA 2GDZA 4NFSA 4BO9A 4BL5A 4OL9A 4MP6A 3DZIA 1SC6A 3OQBA 1T24A 3PJDA 3FBTA 2VNAA 3D5TA 2VCYA 4L9RA 1Y8RB 3GVIA 4WNIA 3V2HA 5CEEA 1BHSA 1VKOA 2Q3EA 4D44A 4YYZA 2FR8A 2VYVD 4QX6A 1GUZA 2G82A 4PLVA 1MGOA 4RPHA 1SBYA 1BWSA 2VN8A 3O38A 4UEKA 3HDQA 1NXQA 4QECA 2VT2A 2E4AA 3AI1A 1N5DA 2ZYAA 3WLFA 2UV8A 1HDYA 1Q7CA 4RF3A 4G5HA 2Q1UA 4PLGA 3ZV6A 2C0CA 4Q3BA 3TZQA 3BMQA 4W99A 1K6XA 5K6AA 1C0LA 1UDAA 3WGTA 4C4OA 2HK8A 3FTPA 1GPJA 1U1IA 1GZ6A 1F17A 3F1KA 3VZSA 1PJ4A 2ZTUA 4UUMA 2RIRA 4DMMA 5DOZA 3RC1A 4D45A 5IF3A 4MKXA 1P0FA 3OQ6A 4ZQEA 1VSUA 1LLDA 2O3QA 4GPD1 3OETA 3TL2A 5JS6A 3JQ8A 3RC7A 2FSVA 4MIOA 3UH1A 3HDYA 2UUPA 4NBVA 4EW6A 1YL5A 2PLAA 2J5RA 3HE3A 1D8AA 4GWGA 2QHXA 1N7HA 1R4NA 1MA0A 1B8VA 3KYDA 4TMFA 3UW3A 3SC4A 5JDIA 3W8DA 4YT4A 3HADA 1E7SA 5JW6A 2NTVA 3IKVA 1MC5A 2IYOA 2BGKA 2X0RA 3NDRA 4I9UA 2A94A 1DIBA 2J3JA 3Q0EA 4CMCA 1NNUA 3S2IA 3TSCA 4CUJA 3NTOA 4ZRMA 3CINA 1ULSA 2HO5A 3PFFA 2JFHA 2WTBA 3PJFA 4II2A 1Y6JA 1L1FA 4TSKA 1QYXA 2Y1FA 2RHRA 1A7KA 1RJWA 4YT2A 4F46A 1QKIA 4JN6B 1BW9A 2VUUA 1ENOA 1F0YA 2PGJA 3A28A 4ID9A 1K5HA 3E1KA 3WOHA 1ZVMA 1P0CA 1NWHA 3WMWA 1JWAB 4IGFA 1EBFA 1DFHA 2A4KA 2G0TA 5JAZA 3GVHA 2JFGA 3H3JA 3HN2A 2D2IA 1E3EA 5BNFA 4IIVA 4XD2A 2Y0DA 4JBIA 2FZEA 5JE8A 5JC1A 4O63O 2DUWA 2NV6A 3JQDA 3BTOA 4L4XA 2GERA 3T4EA 1DJQA 3UVEA 4FJ2A 1UP4A 1IPFA 3RFVA 1WMBA 3MWEB 1HEUA 3BIOA 1DRWA 3DZJA 2D5AA 4Z6KA 2I6TA 2WWRA 5IXYA 3GZ4A 4BB5A 2DVMA 2X86A 1ULUA 3I6IA 2NUAA 3JQGA 1Q7GA 4NJMA 2CY0A 5DNAA 5A06A 3WTBA 4BO7A 1XHLA 2C07A 1GD1O 1QXSA 1VC2A 3FTNA 4PCVA 4HY3A 1NBOA 1O6ZA 3PRJA 5L95A 5FI5A 4PLWA 1YDEA 4AJEA 3JYQA 4NBWA 6LDHA 3T7EA 4A27A 1XGKA 3B1FA 4A73A 4CM4A 5HS4A 2Q1SA 1CERA 5BSGA 3L4SO 1HDGO 4QXMA 4CLEA 1IYZA 1HDCA 4AJPA 4DPLA 1YGYA 1DC4A 5G0UA 3T4XA 3K31A 4PLYA 1I3MA 3KXDA 3GA0A 4HNHA 4I1IA 4MOWA 5ENDA 1CYDA 3ITKA 5FYDA 4CQMA 2IRWA 3H6KA 5BSFA 4J2OA 2AQHA 4E5MA 3CH6A 2E6UX 2QQ5A 4IJVA 4FC6A 1ZJZA 3PQDA 2W90A 4EEZA 1H9BA 1P1JA 5ER9A 3EUWA 3GAFA 3AI2A 4CQLB 1I2ZA 4CM5A 1VSVA 4KUGA 1E7MA 2AE1A 3V1UA 1P1KA 3W6UA 1S6YA 1XR3A 1Y8QB 3W1VA 2JD2A 5TJ9A 4L76A 3O8QB 4ND4A 4ND5A 2O7SA 1I2BA 5DT9A 3V2GA 5JMWA 3WWZA 1P1FA 1WW8A 3BAZA 1UXHA 1AGNA 3ON5A 5JO9A 4D41A 1DEHA 1V3UA 1LDNA 1C3VA 1NP3A 5A04A 1I33A 3ORFA 2NM0A 4QTZA 2X5JO 4OYRA 4PRLA 1KEPA 1LBEA 2EKPA 2PWZA 1XSEA 4YJDA 3I83A 1BGVA 1MB4A 3LDHA 3CZMA 2I3GA 1HWYA 3PEFA 1HETA 4TRJA 3H5RA 1P31A 1IPEA 5T6BA 1P9LA 2GR9A 4JXKA 4WCFB 5JSFA 4BNIA 1DJNA 2O7QA 3U4IA 4ZD6A 3DBVO 5EESA 2CFCA 3L6DA 1X0XA 3QA9A 4ALMA 1YDWA 5ICMA 2J3KA 3JYPA 4J16A 2EJVA 3CSDA 3M2PA 4MIYA 4GGOA 1LDMA 1E6EA 2BKAA 3GR6A 2P4QA 2WYUA 4PZCA 3PHHA 3NEPX 3QE3A 1KVQA 4EEXA 5IFLA 1E3SA 5L7WA 4UEOA 1K0UA 5G2OA 1LSSA 2HMWA 2PR2A 4KWHA 4PLPA 4Z0PA 2AW5A 3G17A 4UEJA 3ABIA 2OP1A 4IS2A 4W9NA 5TQVA 1AHHA 4TKLA 4RCVA 2OUIA 4IBOA 4S3MA 3I52A 4R1UA 5KVQA 3SC6A 3D3WB 4NBRA 7MDHA 3A14A 4B4UA 5HWSA 4IXTA 2VUSA 4DMLA 1GCOA 1GL3A 4FFLA 4KMSA 1T2EA 4L8VA 3SJUA 3QVOA 4BV8A 1KY5A 7ADHA 1KC3A 1RPNA 2BF7A 3DWFA 1PS0A 3WDSA 1J0XO 3DDNA 3D1LA 4QSMA 3AY7A 1NAIA 4GMGA 1TI7A 1Z7EA 4O5OA 3LU1A 4GH5A 4GL4A 3R3SA 4J1NA 4R5MA 1C0IA 1D1TA 1X0VA 3VVCA 3C7CB 2Q2WA 4XB1A 2ZB4A 4XDYA 4DLAA 4E30A 1MFPA 3SVTA 4IGEA 4AJHA 1ZFNA 3VPXA 4UVHA 2YDXA 4PLZA 5EL0A 4KQWA 2Y67A 3WR5A 4CUKA 2B4RO 5TNXA 4J4TA 3ROKA 1N9GB 1NX6A 1PL7A 5ILGA 3WYEA 4Z9XA 2B4QA 1NQAO 2ZB7A 3VTZA 4MVJE 1HZZA 1XQ1A 4EJ6A 1BSVA 2ZYDA 4MPDA 4DBZA 1M75A 5EIOA 2GASA 4KOAA 4CV1A 1PJTA 3DQPA 4J91A 4P22A 1EEHA 3BMCA 4D42A 4XYLA 1C0PA 1WXDA 3C1TA 1E77A 1Q0HA 4UVIA 3RI3A 4DIBA 2OL4A 3X2FA 1EVYA 2I76A 2V6MA 4BNWA 2FHSA 3DBLB 3O4RA 4Z9YA 4PLHA 4R69A 4J7XA 4ILKA 4UVDA 5G4LA 2Z95A 1CQJA 3OSUA 4WJZA 5ER6A 1JVSA 2QW8A 4JJFA 5TLSA 1R16A 2R6JA 4D79A 4AG3A 3WICA 2B4TO 5JDCA 9LDBA 2EKLA 4YWJA 4TRRA 2PH3A 3H9QA 4ALIA 1IB6A 1O89A 2BI8A 2EF1A 4NBUA 4GMFA 1KVSA 3ZDFA 2CF6A 4R5HA 2PA3A 1UXIA 2W2KB 3KVOA 1DPGA 1B3RA 3KZVA 2C5AA 4IMRA 4AJIA 4D3SA 2YFQA 5BT9A 1HSZA 2D5CA 2E82A 4TRMA 5TT1A 2NTNA 2JCXA 3MJEA 1NPDA 4BKRA 1B3BA 1ZK4A 3HNPA 4JIGA 3N7UA 3TZCA 4Y6RA 3WNQA 3WSVA 3MOIA 4PIVA 5CHEA 3ULKA 3VPSA 1W0CA 1E5QA 3DB2A 3HJAA 3L4BA 4U0JA 4DTIA 4DGSA 5H82A 2TMDA 3FSRA 4WLOA 5F1KA 1AHIA 5I7VA 5HRUA 4BNFA 1KVUA 4A5OA 3FHLA 1ENYA 4DIOA 3NX4A 2Q46A 5JLAA 4E21A 1LDBA 1T1SA 2EERA 3LT1A 1JKFA 1XCBA 2NU6A 1WPQA 3UHAA 2BMAA 3NT5A 1YO6A 2DM6A 4E2WA 2B5WA 1E1LA 2QYTA 4CV2A 5G0TA 3DL2A 1Z45A 2B69A 4CLHA 1I3KA 4XJSA 5IAAA 1LSJA 3PIIA 3ZZNA 4AVYA 4DQUA 4RO0A 2OBNA 4J7UA 1RKXA 1E3IA 5DBGA 3DTYA 1W6UA 3G49A 1H93A 2Y0EA 3PGXA 5KIAA 4QO8A 1NASA 3ZHYA 1TVEA 2O2SA 3G3EA 4NU6A 4RPGA 3GC6A 4I5GA 5I8ZA 4M1QA 1EUZA 3L9XA 4JBHA 5JYEA 3KRTA 4XZ3A 5KCZA 4YJHB 1I24A 1T25A 1WWKA 3K30A 5L7TA 3IP3A 4M86A 5KOIA 1DC3A 1Z73A 3PDUA 3PK0A 4CM9D 2PD6A 3RASA 1U7HA 3DBHB 3HQ4O 2Y68A 4FFNA 1JTVA 2HDHA 3FR7A 3DTTA 4OKIA 1SNYA 4YJFA 1R0SA 1S7CA 3PYLA 3RC9A 1A71A 5G0VA 2J6IA 4K6FA 5B4VA 2X7HA 1ZJYA 2IYPA 5DP1A 2X9GA 4IDGA 1XU9A 2HMSA 4XGNA 4XQ9A 1XWFA 2YV2A 2JD1A 4ZU3A 1MUUA 4HP8A 4IUYA 2B0JA 4G65A 5CEJA 4TROA 5ILOA 3D4OA 4JJGA 1LA2A 2CUKA 4N5MA 4JK3A 3IDSA 4EI2A 1N92A 4BNTA 1PJSA 3GZNB 4FD3A 5DDIP 4ALLA 1YS4A 1C1XA 3FNGA 3CEAA 1YOVB 2AEFA 3OJ0A 5BQFA 4NDNE 2EV9A 3FD8A 4K26A 1RWBA 1G0OA 4CMAA 3PIDA 5CFZA 3QJ5A 3GGGA 2P4HX 5BSEA 1XKQA 1WMAA 3MTGA 4M89A 3DZHA 2CNBA 5A3VA 3ONFA 3EK2A 4FFRA 1SCUA 2NVUA 3BHMA 2OZPA 4GGPA 3UGKA 2WE8A 3TN7A 2YY7A 3VH1A 1H2HA 4MVJA 5COQA 2Q1WA 4NI5A 4D7AA 5JCJD 4HUJA 5DULA 1BXGB 4RLHA 4W6ZA 1DIGA 2ZIZA 1GYRA 4BMVA 1NQ5A 4RZIA 4W82A 1XIVA 3PPIA 1HYGA 4PG6A 1U8XX 5IDQA 4NFYA 4TVBA 4TVOA 3ICPA 4Y9DA 3ZU5A 3DBRB 4IDEA 3U4HA 1H9AA 3NRCA 4E32A 3QP9A 1FXSA 3AY3A 1FDUA 1YKFA 1UUFA 1E3WB 1U3VA 1UZMA 2XAAA 1DAOA 3C8MA 4ZA2A 4KTVE 3JQ9A 1J49A 1E3JA 4ND1A 1GEEA 1ZKMA 1R0LA 4PVDA 4JGBA 3ROMA 4IZIA 2FP4A 4DREA 2P2SA 4E2XA 2F1KA 1JW9B 2P9CA 4R68A 3JD1A 3H2ZA 4XR4A 1HL3A 4RVSA 1F12A 2CVQA 3FF4A 2AHRA 3ZW9A 3NKLA 5EN4A 3ZH2A 5AXAA 2W2LD 3SLGA 1EFLA 4BNLA 1GQYA 2ZJ0A 3KYBA 5ICSA 5G4KB 2B37A 5IZ4A 1QSGA 2BFPA 3DXFA 1VJ1A 1YJ8A 2HKIA 3IC5A 3WGOA 5L45A 1ZK1A 1VL0A 1OMOA 1CEQA 1I2CA 1PJQA 2OBYA 5DOVA 2Z1MA 4E5YA 3PXXA 4JBGA 3VZRA 2EP7A 1Y9EA 4FFMA 3GPIA 1GADO 3B70A 1H94A 1TEHA 2X9VA 5HBRA 1C1DA 3JQ9C 3NTRA 2YHIA 1M76A 4OXYA 3Q3CA 3VPHA 5A4DA 1YONA 1BMDA 3JQFC 3D4NA 3OIGA 1BG6A 3QWFA 2VRCA 4B79A 4JP2A 4LRTB 4HBGA 4OGWA 4X54A 5L4NA 1MP0A 1U7TA 4ALJA 4DA9A 1R0KA 4OMUA 1C14A 5JPIA 1KS9A 1BVUA 1L7DA 3ZGYA 1ZCJA 3CMCO 5A9TA 4J90A 1FDWA 1ZXBA 1NHWA 1G0NA 4AJKA 2YV3A 1D7OA 4CM4B 4EUFA 2NVBA 1T4BA 3JQ7B 3EYWA 2VYVA 3AM5A 5L3ZA 2B35A 4HX5A 1B8PA 2LDXA 3ZU4A 2BFAA 4W4TA 3IJRA 3I6QA 4BOYA 2QZZA 3JYNA 2VYND 3M1LA 1LQUA 3BMQB 4FJ0A 2OORA 1MX3A 1UP7A 3ZW8A 2H1SA 3KB6A 5KNLA 2YW9A 1QMGA 3KBOA 4NJOA 1A5ZA 1N1EA 3GEMA 4OQYA 4RPLA 2BD0A 2O3SA 1E92A 3ICCA 3ZU2A 4FGWA 3JYLA 1ONOA 5LDHA 2RBEA 5KVSA 2PNFA 3LC2O 2JHFA 4XQCA 4PGFA 1KVRA 3B6ZA 2GSDA 2UYYA 1CF2O 3ADOA 3S8MA 4Q9NA 4RLSA 3RFXA 3GT0A 3JQ8B 2WD7A 3M1AA 3O03A 3PLRA 1RM4A 5AYVA 1OFGA 5THKA 3ZHXA 4D46A 3U62A 1ML3A 2HU2A 2JKVA 1O95A 3ASUA 4DIFA 1Q0LA 3PVZA 2D0IA 3RFTA 2IDZA 1R4NB 3AW9A 3RIHA 3A4VA 3OF2A 3O26A 3UCEA 4B3JA 1PL8A 3GUYA 3LF2A 3OBBA 1U4OA 2WJPA 4RF5A 1NR7A 4D0SA 3E82A 1H6AA 2X0NA 5EQDA 1OOEA 2QYSA 4R9SA 3JQEA 2EIHA 2C2YA 3S2FA 1PR9A 5DCYA 4OSOA 4Y6SA 1UH5A 4CMIA 2QZ9A 2ZK7A 1A72A 3NDIA 3LF1A 3ADPA 4UREA 3WQRA 4H15A 1I10A 1LSUA 4RPJA 5I9MA 3ANLA 3H5NA 1YB5A 3RSHA 1Z75A 2NNLD 4DRYA 1MXFA 3E9QA 3LLVA 1N2SA 5HA5A 1MV8A 4DL9A 3PZBA 4MP3A 4YQZA 1WP4A 1E7QA 5T67A 4MKZA 1ZXLA 2NSDA 3TZ6A 1FDTA 4EYEA 4XRRA 1R6DA 4HADA 3WJAA 4KZPA 1CQIA 2VZ0A 5AXCA 3DC2A 4ALKA 1GTMA 4HXYA 3E03A 1R4MB 4IDAA 1F06A 1DDOA 1Q2XA 1BRMA 4CLRA 4LGVA 3HDHA 2Q49A 2R00A 1HZJA 4RQUA 3ZWCA 2CSUA 5GY7A 4GVLA 4NG5A 4YRDA 4I9HA 2ZQZA 3VH4A 1JWBB 4RF2A 3LT4A 1M6WA 3GY0A 2C82A 4IJKA 3WB9A 3R3JA 1D1SA 2E48A 5K9ZA 3U4DA 2X5KO 4DQVA 5BNIA 1O9BA 1AXGA 3ZWXA 3GMSA 1IZ9A 3AFMA 2IZ0A 4ZQBA 1U8FO 4WNCA 2WD8A 2X6TA 3GEDA 1WDKA 1KVTA 4NU5A 4ESOA 4BMSA 3F4BA 3HN7A 1W4ZA 2I3AA 5TX7A 4ZQGA 4GBJA 2VRBA 5JC8A 3D3EA 3H9UA 3MWDB 4JX8A 5CDSA 3H4VA 4GX5A 2QIOA 4WUVA 2ZCVA 4FR5A 8ADHA 2JAPA 3KYCA 1PSDA 4QQRA 2R00C 4IM7A 3VVBA 3IL2A 3QLJA 4BIIA 2C7GA 4AJ1A 4RVDA 3GF4A 5TIIA 1UP6A 1XQ6A 3RU7A 5DF1A 2EHDA 3TPCA 4Q3NA 5HS6A 4GKVA 4I5FA 1Y8RA 4R41A 4YA6A 3KSDO 2P91A 1A9ZA 4ZGWA 3NGXA 3E9NA 4XKJA 3OJOA 4I5EA 3OQ1A 4BO6A 1NPTO 1NVMB 2FPIA 4LK3A 3GHYA 1L7EA 2PD3A 4CMGA 5A1TA 3K8ZA 4JROA 4YAEA 3E8XA 2J5QA 4I5DA 2OMEA 3GFBA 4IIUA 1EVIA 4AFNA 3H8VA 4EITA 3NDJA 5B12A 2AG5A 2VHYA 3I9KA 4K1LA 4YJGA 1G1AA 5JAQA 3GDOA 2NVWA 1WZEA 4GI2A 4FBGA 4WEOA 1IOLA 5JMPA 1PWXA 1NQOA 4CMEA 4AJOA 1OC4A 3FRJA 4W7IA 4Q3EA 4BNHA 4NNJA 4UULA 3SJ7A 3KETA 3K2BA 4QEDA 4GAEA 3ZNNA 2VTEA 1ZK0A 1ZEJA 1LC3A 3ZWVA 5KKAA 4D43A 4DBVO 4RPKA 4BO5A 1ZSNA 5KJEA 1QLJA 1EUDA 3AOGA 4R1SA 1PZEA 1MG5A 3GGOA 4LRSB 2DAPA 3MJ4A 4BB6A 1UAGA 1QYWA 1CWUA 4YT5A 2GN4A 1XLTA 3MZ0A 2ET6A 3EZLA 2XPCA 4Z0TA 1EK6A 1QR6A 4Z0HO 3ZNPA 1H2BA 1JAYA 4CM1A 2YUTA 5KJ1A 5MGBA 1K6IA 1VRWA 3VHRA 1VI2A 2EKQA 4A2CA 4TZKA 5JAMA 1H6BA 4IS3A 4HFNA 4J43A 4INAA 3QWIA 3TZKA 5JXWA 2VHZA 5CP8A 3W8EA 4CMEC 3WYCA 3ZCXA 1N1GA 1X7HA 2C59A 2Z1NA 4KQXA 1P1HA 1JAXA 3N58A 1PJBA 5KTKA 3F6YA 2FPPA 5A5EA 1ISMA 4A10A 2PGDA 4B4WA 3QVXA 3RUDA 3ETEA 2PH5A 1U5AA 3ZWPA 1XU7A 2PGLA 3ONEA 4R54A 2YDYA 4DWVA 1ZUD1 4MDHA 3W4JA 4CM8A 3RKUA 3TL3A 2Y1GA 2P5UA 3FR8A 2OO5A 1DOHA 3DAGA 1E3LA 5LCXA 1F8FA 4ZRNA 4J9UE 2Q50A 2BLLA 1DBVO 3AM3A 4P38A 1WLYA 1NFFA 5CG2A 1ISIA 4M54A 4YPOA 1I0ZA 1QV7A 2AEJA 4E5PA 3I5MA 2EG9A 1QYVA 2ZTVA 2DBQA 1U2GA 4AICA 1A27A 4BNXA 1F14A 1U9JA 4RGBA 2C5EA 1N7GA 3KEQA 5TT0A 2X9NA 4DPMA 1B7GO 1HYHA 3BMCB 3Q9UA 3WQQA 3COSA 3GDGA 4BGEA 3NYWA 1LLCA 1DIAA 3GN1A 3AUSA 3ANNA 4PG5A 5L51A 2VQ3A 3SXPA 3LYLA 3OIFA 2BI7A 1PJCA 3NV9A 3QWAA 1HDRA 4XA8A 5EQFA 1QORA 2OOSA 4XJTA 3WIEA 5F3RA 4IPTA 4NK4A 4URFA 5CAEA 1O8CA 1DC6A 4M87A 2GD1O 2HJRA 4MIEA 1E5LA 1NM5A 3I9LA 2V65A 4XWYA 4PRKA 4J9VA 4R3WA 2O2YA 3DAPA 2HRZA 4LCEA 4R3NA 2WSBA 4YAJA 1PGPA 3C85A 4RZHA 4ZHSA 3H2SA 1NPYA 3PWKA 1GV0A 1DIHA 1Q7BA 4J0EA 3D7LA 1ZSYA 1GR0A 3Q11A 4NBTA 3WGYA 3UN1A 1E6UA 1HKUA 5DP2A 1T2CA 4J4BA 2BGLA 4CQLA 3Q9NA 3LT2A 1M66A 3EHEA 4WKGA 3ZV4A 2AA3A 3JD3A 2FR1A 3O8QA 3GN2A 5JY6A 4MINA 4KUEA 2Q2QA 1DHRA 3K5PA 3Q6IA 4WLVA 1CETA 4HFRA 3Q2KA 1HDXA 4XR9A 4MVJP 1RM3A 3IIEA 1CJCA 4FOSA 4OOEA 3FBGA 3WMXA 4ZN6A 2I65A 5KWEA 3G0OA 2EJWA 4MO2A 4CLOB 2ZCUA 4ZQFA 3WWYA 3ZNOA 3EC7A 5H81A 2X23A 1JKJA 1ZW1A 3LZ6A 4YT8A 3L77A 3D4PA 4WCFA 3ENKA 2QRJA 3K92A 2X8LA 2JCYA 1GFSA 4A0SA 4U6QA 1B0AA 3TDKA 2J3HA 3WIDA 2VHVA 1UR5A 2Y1OA 4WEQA 5COAA 4D3FA 4E6PA 1YQDA 3MCVA 1H5QA 4LISA 2FSSA 3VDRA 4CM9A 1VE9A 1BXZA 3HFGA 1WVGA 2W98A 4LMRA 1BDBA 3R1IA 3RBVA 3NT2A 5L4SA 3PJGA 2W4QA 3ZNQA 5DBIA 2HK7A 1ZK3A 4WOKA 4I8XA 2RCYA 1YB1A 3U49A 1ZIDA 3CMMA 1IZ0A 1VL8A 3TOXA 2RHCA 4E31A 4YDRA 2D3TA 1U3UA 3D3WA 1OAAA 2PZKA 5JYDA 3INGA 4NPCA 4U8GA 3U3XA 4BO8A 5A5FA 2DPGA 5TGDA 3S1LA 6ADHA 2Y93A 4LN1A 3PZRA 4WCFC 1FK8A 2IODA 3PGJA 4NR0A 3BMNA 2GZ2A 3PFWO 1HRDA 4OQZA 2IZ1A 5KJ6A 3GH3A 5I7SA 1Y9AA 4J1QA 2VOEA 3VH3A 3I9MA 1LXCA 2JCVA 2NVUB 3VAZA 1P77A 2JD0A 1HDZA 4H7PA 1NHGA 3WXBA 4GWKA 2JHGA 1EFKA 1MFZA 4RVGA 3AFNA 4BO3A 1EVZA 1TT5B 3WGIA 2ZB3A 2VT3A 5AXBA 4MP8A 4F6CA 3OEWA 4Z3KA 3HZZA 2V6FA 3S2EA 3C1AA 4BKUA 5IXSA 1U3TA 1HYEA 5B37A 2ZYGA 1N9GA 2OP0A 3HB5X 4BQRA 4CUZA 5A03A 5ES3A 1PJ2A 3BTVA 1I3NA 2ZKLA 1DSSG 3OIDA 4IDDA 4RF4A 4TZTA 4XYEA 5JCJA 1EK5A 2NU7A 4J2HA 4BNKA 1B2LA 3RUFA 4BVAA 4TQGA 3LT0A 2CDAA 3H9JA 1WAMA 4YRBA 1J6UA 3GUCA 4IDBA 1GV1A 3B1JA 4RORA 3P5SA 3UKOA 3WBFA 4YAKA 3T7CA 3JQ6A 4IY1A 4YBZA 4W7HA 4ND2A 1LI4A 1PZFA 4BV9A 3GG2A 2B5VA 3FCOA 3U09A 3PP8A 1N8KA 5C3MA 4MJLA 2YYYA 1PZGA 1LC0A 2AQIA 3LSYA 5CEFA 1NFQA 1U5CA 3FPCA 2DPHA 5TS3A 2DFVA 3CPSA 3WNVA 2P68A 4PN3A 3GPDG 1J5PA 2JAHA 2J8ZA 4OO3A 2WDZA 1GAEO 4WCDA 4O6VA 4XIJA 5FFFA 4PZDA 1UXJA 5IDXA 4GX1A 4FDAA 1A4UA 2W2LA 3PQEA 4DLLA 3LK7A 1GY8A 4UUPA 1H0KA 3FI9A 5G0WA 1TXGA 3WFIA 2OGUA 2YQ4A 3RUCA 3I1JA 4YRAA 3EAGA 3PJEA 3UICA 3NJ4A 4LCJA 2H6EA 4N7RA 3AUAA 3FNFA 2FWMX 3GNTA 3EZYA 3KLPX 2YFHA 4CMJA 1E7WA 1SMKA 1T2DA 1ZK2A 3UUWA 1HXHA 2Y1CA 3BA1A 2YHIB 3I23A 5B1YA 4DVJA 2X0IA 5MDHA 3ITDA 2GNAA 2QG4A 4M8SA 1BDMA 3EY4A 3GMDA 4UUOA 4GSLA 5THQA 4L73A 2YV1A 1PR3A 4TRNA 1O0SA 3PDJA 1PJ3A 4RV9A 4BO4A 2WMDA 1E1KA 2GUGA 5EINA 1OC2A 3DZKA 3QVSA 1B26A 3RROA 4BQPA 4E13A 4QUKA 3U5TA 4NH4A 4WLEA 2EEZA 3K73O 1EMDA 5C7LO 3RD5A 3GVXA 1KERA 3PI7A 1CRWG 1SAYA 3P2YA 2PZJA 3DOCA 3KEOA 5F5LA 4J1TA 5GMOA 2HAEA 1U4SA 1K3TA 3BMOA 3JQFA 3HDJA 1NR1A 3ANMA 3FPLA 3QWBA 2Q4BA 2Y1EA 3O9ZA 1AN9A 3FWZA 1GUYA 1TT7A 5G0SA 4P4NA 4WE3A 5A9SB 5I7EA 4KWIA 5EPOA 1X15A 3GAZA 2O3UA 4XDZA 4PFJA 2GRAA 4WGGA 1DO8A 2Q2VA 3UCFA 3W6ZA 3JQAB 1B14A 1O5IA 3G1UA 4FQ8A 5T57A 1G6KA 1GYQA 1V0JA 1ZH8A 3NUGA 2UVDA 4D0RA 4EDFA 3EW7A 4O0LA 1PGOA 1ZSVA 3ENNA 4Y8VA 2DUUA 2VHXA 1E0DA 1MG0A 4BGUA 4I08A 5JAIA 2WD7B 4YAGA 1PL6A 4RQTA 5GZ6A 4E12A 3UXYA 3I9NA 4G81A 2O4CA 3G1TA 5IDWA 3ZHZA 2HK9A 3MJSA 3TQHA 3GHHA 2VWHA 2GN9A 3M2TA 1ARZA 2HJSA 4BNYA 4RVUA 5KJFA 3R0IA 1I01A 5HTOA 3GZNA 5C5IA 3BTUA 4FS3A 4XYGA 1DLJA 1LRKA 3GDFA 1YOVA 4J3FA 4JCOA 4E5KA 3WFJA 1DRUA 4HNGA 1GU7A 2EGGA 2D1YA 4QFDA 1JDJA 3WGHA 1R37A 5KKCA 4B4OA 1YWGO 4MVJG 3GQVA 5CDTA 2JJYA 3QHAA 5K0ZA 3UFXA 3AWDA 4YTEA 1I3LA 1ADFA 5C37A 1DXYA 1ONPA 1BXGA 1GEGA 3INRA 2FRDA 2PKQP 1CDOA 4NHEA 4A03A 4XCVA 1GQ2A 5FI3A 1ZMOA 3OECA 1GDHA 1EE9A 1DFGA 1EE2A 3CXRA 1E6WA 3DBRA 4K6CA 4E3ZA 4L4RA 5CDYA 1P33A 3DMTA 1IHXA 1E3WA 4UVGA 3L0DA 4LVUA 4CM3A 2GZ1A 1ZNQO 4BNNA 3AY6A 1VM6A 3JCZA 2PTGA 3JV7A 2I5PO 1H6CA 2B83A 2Q1TA 4GVXA 4OOFA 4JJIA 2NACA 4DPKA 3ZV5A 1D3AA 3HUDA 2BH9A 3KYDB 4DC0A 3DONA 1J4AA 5G4KA 4RL6A 4B3IA 4FN4A 4XYMA 3IMFA 4FFOA 1Y5MA 3MJVA 2OHXA 4BGIA 2PKQO
chains in the Genus database with same CATH superfamily
3O2JA 3BXEA 2JG3A 3BJZA 1U0OC 3KSZO 4YFVA 3IS3A 4IGIA 5J59A 1VPVA 4MUKA 4JJZA 5BMVF 2I99A 3KQMA 4MVJF 1Q77A 2WHXA 5I9LA 2V59A 2WAMA 2YVLA 3STXA 4C05A 1J1IA 4Q4HB 4TYWA 1TEXA 5FCDA 1BGWA 3PC8A 4C2BA 1WPGA 1MO6A 2ZPTX 1EE1A 1ZM7A 3EODA 2JLAA 4FFBA 4KP7A 3RQSA 3OPYI 4NK5A 421PA 3T5TA 2D5BA 2KI5A 2VOJA 1VI6A 5AP9A 3PLNA 1Z2PX 3C7DB 1P80A 2NYUA 1OB2A 1D2EA 2QU8A 2ETXA 3C0KA 3KB2A 1HORA 4J1SA 4A9AA 3GVCA 4YO8A 1V35A 5FXMA 1OGYA 1QZUA 3NTQA 3W5VA 3IRVA 2NSHA 3MW8A 2HZBA 3E9MA 2BHLA 4P3YA 3TTUA 4O4IF 2V8OA 1T1RA 4BKPA 1K6JA 2A0XA 1NN5A 2P3OA 3PXDA 4EKIA 4UTPA 5LD2B 3T3HA 3ZDZB 2FEKA 3R0XA 2VWGA 1BJKA 3AIKA 4FIZA 3ZU3A 3INTA 1VGQA 3DL7A 1PU2A 4LWQA 4MVXA 5K1ZA 4L0QA 3I53A 1IFXA 4LMPA 3U44B 5C7IO 5GVSA 1QPGA 4FMBB 4YJGB 1PJRA 1RAIA 2O4UX 3AOEA 1X13A 2YRWA 1K6MA 1FLDA 1SUFA 2XQGA 1DAIA 4EWLA 4L3OA 4Z53A 1SH7A 1FYXA 1SKQA 1TZBA 3NRJA 4I14A 4AO6A 4XIGS 3C7TA 4H7HA 4XEHA 5KVVA 3VH1A 4GKBA 1IG0A 2H51A 3JQGB 3PC8C 4R6WA 1A9XB 4MUBA 3RYTC 4CMBA 3Q85A 4ZJZA 1TO6A 2VA8A 1NYTA 4RPCA 2X5XA 1VSTA 5CIWA 3IP1A 3UOAB 1H65A 4ZOAA 3CUVA 1XZGA 4YP6A 2OHJA 3I5YA 4CYMA 5DISB 3NKFA 1L5OA 3C8ZA 4M0FA 3MILA 3RLFA 3E3NA 1KO5A 3OTHA 2C4MA 1WDMA 2RGAA 4WZBE 4YP1A 3UAWA 4DARA 3AVWA 1XF9A 1LNSA 1CC1S 1D6SA 1CZOA 2FQQA 2QL5A 1NC3A 2R4UA 3LGAA 3UC5A 1R5BA 3IEPA 2NU8A 5ELXA 2HSDA 1ZRNA 5AWFC 5IUKC 5C32A 5JNVA 4B7XA 1A9SA 1GCAA 4C06A 1XYGA 4P54A 2Q5HA 2C98A 3HXLA 1A4IA 3I9OA 3G9TA 3VKHA 2JDID 3HV0A 3AOEC 3SFVA 1BXKA 2BEWA 2JASA 3AP1A 2CVHA 3VSDA 4ND3A 2PAAA 3E3OA 4F3CA 3Q4GA 3RVKA 1NRWA 1O1YA 4P2BA 4RANA 5CBPB 5CNKA 5IXJA 3DR3A 3D1VA 2A0WA 2FJPA 2I67A 4R83A 4ADSG 4EQZA 1SEPA 3EXFA 1SCQA 1NDUA 1J70A 4PFSA 2X0DA 1DFIA 4F7WA 2CEAA 3D8BA 2EDCA 4FD2A 1FTQA 1P44A 3HB4X 1ADJA 5IAOA 3O8CA 4LNUA 1QRRA 4G8DA 4AD8A 1AG9A 3OZWA 3PTZA 2WJGA 1GLGA 3PQ5A 3NJ8A 4KBYA 3RRJA 4BHTA 3SZOA 5F4ZA 4CR8A 2IS6A 3IAM6 2HF2A 1P0PA 3RSGA 1WUYA 4KYVA 4WOJA 4Q01A 3Q1LA 4N3NA 3QITA 5J58A 3PFIA 1WCYA 4R1OA 5CFQA 3BD8A 1AE1A 4W8GA 1QBGA 2PBLA 4XQGA 3NBAA 4O08A 4YXFA 1K8QA 1KJ9A 2YS7A 4MMXB 1UC9A 1IBSA 3EMKA 3FX2A 1T26A 3HA5A 3NHWA 4OAOA 5FIUA 4EAQA 4X20A 4MPPA 1EQ2A 1IM8A 3BFXA 3N05A 2VQSA 1M2FA 4AJ4A 3ETGA 2MSWA 1ZBQA 1FSSA 3C98A 5EHIA 2C9DA 2G1KA 1WOYA 1DX6A 1V41E 1X9IA 2CHUA 4IDCA 4JLJA 1NU8A 4YY3B 1PTKA 2W6QA 1JMVA 2ALJA 3EISA 4PLTA 2VH5R 3AKDA 1XDZA 2EBWA 1I5OA 3KUXA 3FHTA 2VHWA 4F4UA 1Y5RA 5F64A 1YZVA 2FQXA 1O77A 4EG6A 5TXGA 3EDQA 3JASA 3IMGA 5JARA 2JH8A 4BKMA 4B3SB 4TMKA 2UZ0A 5H16A 4Q3AA 5ALDA 4EFMA 4Q4CA 4RMNA 3Q6MA 1ZY2A 1E2NA 2Y66A 1EVKA 3I6MA 4LSWA 2QK4A 3MJCA 5DKFA 4YR7A 1PIWA 4G09A 1E59A 4CM7A 2Y1KA 2SNIE 2DWUA 3LDUA 4ZAXA 3RQIA 1R74A 1U7WA 1GQOA 2WP8J 3NHRA 1A88A 3GJQA 1NNLA 1VHLA 4FU0A 3TX6A 2JAOA 3HP4A 4Q4JA 2PUDA 4EUEA 5F9FA 4KFRA 1GSIA 1QLHA 1P4JA 2PUJA 2VJMB 3UATA 4EG8A 4ROSA 1HE3A 2EZ8A 4GLFA 4ARCA 5LQDA 4X1IA 4FOOA 1AKWA 3AUXA 1BJTA 2RH4A 5JNRA 3GQBA 1VA4A 2WIGA 1A9TA 4ZOLA 4I1VA 2E5LB 3GBPA 1P7CA 3FSJX 5JBQA 1OAOC 3AU8A 4NIMA 4QGGA 5LD2C 3KVNA 2YV4A 5IKEA 2BFCB 2BW0A 3GJ6A 5EEGA 1MAAA 1S8OA 1Z5PA 1ZEMA 2D59A 3FNHA 1T29A 3LPDA 4Q21A 4QDZA 1QAQA 1ZVJA 4V3CA 4XX0A 4BNUA 3LI2A 3KQPA 2V98A 1FE8A 4RZ3A 2GTPA 2QTGA 2BM9A 4F8EA 4AULA 3IJEB 3I3OA 1FDSA 1UOEA 3AR4A 2QN1A 2AOUB 3HCWA 1M1XB 3TJRA 2P6NA 3NR2A 2BMDA 2FWAA 3CE6A 4WGFA 4EKNB 4HV4A 3FOZA 4G63A 1LDYA 2R6GA 3ZVMA 3L7JA 2W6PA 4PTZA 2V3WA 1ZC3A 4KQ2A 2BYTA 4DC1A 1XZKA 4ILEA 1CIJA 3OLQA 4DIDA 4X62B 3AF6A 4UVEA 4F60A 2FMXA 1PR0A 3HK2A 2XUAA 3HWSA 3O9MA 4HUQA 4C0WA 1LPNA 2VJBA 3KAPA 4R4JA 5JG7A 3RUAA 4RD2A 4F97A 4YMTA 1WCIB 2FUEA 2Z5LA 2EF0A 2VVTA 2HJHA 3Q7SA 2ZT5A 5I9TA 4D97A 1Y4SA 1HE5A 1ENPA 2IPOA 2QMHA 2WUFA 3ONDA 4U5QA 1RMQA 3CN7A 4E94A 3PNOA 3WX0A 4R51A 2CDRA 4WKPA 3V5NA 4TTSA 1JL3A 5HZHA 1P2UA 2RJNA 1JPVA 2XNJA 2OG1A 2NXJA 5FO0A 2B6HA 2H63A 2G76A 1SPBS 1TZJA 2NXEA 1A9OA 2X0JA 3SAJA 5EKSA 2VP6A 2W70A 1NTOA 1FX0A 4M0UA 1UC5B 5EMHA 4DM4A 3OM9A 1W47A 4CGZA 3OFSA 4UMVA 4QBGB 4YEDA 2R6AA 1LCIA 3CONA 4XUEA 3H99A 4Q3OA 3OJLA 1TW2A 4OHUA 3UO8B 1Q7TA 1R15A 3AQIA 3KJEA 4A8JC 4D4JA 3CNOA 3LDAA 5IF9A 2YZ7A 3QTTA 4LJYA 4B40A 4UAVA 2AFRA 2Q3BA 1GKYA 2W6ZA 2ZJ1A 3ZK7A 5IT5A 2IZ5A 2OSVA 4A5SA 1FTGA 4LJ9A 5IZCA 1N0HA 2NXCA 4LVCA 1WB5A 2NTJA 1KIMA 3CNNA 5HW0A 1ELOA 5K05A 3I6BA 5H8WA 3PWZA 1QUFA 2Q2OA 1D07A 2HLPA 1JVBA 2IYYA 5H59A 1E3DA 1RRFA 2ECKA 3ZD6A 3PUZA 4RX1A 5CA0F 4RTOA 3I8OA 3C3XA 2O2HA 2ZI5A 3SYLA 2WM3A 5I7FA 4BAUA 4TQAA 3GNQA 4HQRA 3B20A 4ZCQA 5D86A 3NDBB 1TQ4A 4A36A 3ZGVA 3GGSA 1YL7A 1RSZA 4WXEA 1NAHA 4E3WA 1Q6ZA 1VJ0A 4IHJA 5I01A 4KVFA 5K20A 4I66A 2OFFA 1CUVA 2FMKA 3LC0A 2ESRA 3EGXA 3QIVA 4ICIA 4P36A 4RDIA 4R81A 2AOTA 5LP1A 3DV2A 1XTTA 4ZICA 1GFIA 3ZYZA 3NIFB 4N7MA 1WTCA 2CHVA 2X1VA 3FUCA 3N2LA 4J29A 1PTJA 3EFBA 5JO0A 4ZYUA 4FVTA 4A1FA 1KARA 4L5AA 2N3ZA 4TLAA 1T9HA 2FW7A 1T6ZA 3HM9A 2FJUA 4ZYLA 1JQBA 1XZHA 2QRKA 3HJTA 4RDHA 2Y3IA 1QO0D 1XD8A 3NPAA 5IG2A 2COUA 2B36A 1TLFA 1NJ1A 2V3CC 4H3KB 3EXAA 1NOKA 1V39A 3G8YA 1DO2A 1E32A 4J16C 5IZCC 4EHAA 1IXSB 4X92A 3AY0A 4M1KA 4PC2A 3BEOA 1AA6A 3SDZA 4YUAA 2JLQA 4WK6A 1B8UA 2ZUDA 4MJ3A 1U8AA 4AWAA 1V3VA 3DHYA 3MCZA 1MC4A 3MTJA 4MI9A 4GBED 5L3RA 3VAYA 3ZWWA 2YC4C 4OLJA 4YUXA 1Z2AA 3K0KA 2NGRA 4MUJA 1IJKA 1KO7A 1N2ZA 3SK0A 1Z22A 3H1FA 1G8AA 4C2UA 4FFPA 1YMQA 5GVRA 4BNVA 2GN6A 3QVTA 1I7QB 1WXGA 2QTZA 4XFDA 3PHIA 4G0NA 4UNIA 3GCGA 4R01A 2C3MA 2PU7A 2P67A 4UAGA 3FNEA 5FPQA 4WNAA 4M1ZA 4N54A 5J23A 2C8LA 1FS5A 1PK9A 2WYWA 2X13A 3EZXA 3H5WA 2YHAA 1DCFA 2WI8A 2D06A 1KDRA 1OIXA 4TTAA 4Z7JA 1TOAA 3ND5A 1BDJA 1KC1A 3KZOA 3EXG1 2AWNA 4UEQA 3ACBA 4LDQA 3COZA 4D6XA 2YVKA 2HQ1A 5FWDA 4J4HA 5U4XA 3ROZA 3NHAA 3B6IA 1WUTA 2IEBA 3TUJC 1MTOA 1QB8A 3JD4A 4WRRA 1SU4A 4IG4A 3HO8A 4WV3A 4S2EA 3AT1A 2ZYUX 3HCRA 3HZRA 3ZI0A 4JP8A 4YRMA 1RM5A 2QVGA 2IGTA 5C31A 1Y4UA 4CW7A 4E5VA 3IGFA 3QFRA 4F91B 1VBKA 3MUNA 4FSHA 5HQ3A 1I6WA 2BR5A 2GD6A 2ES4A 2PD4A 1TYDE 2OUKA 3ZN2A 2PTHA 2CJWA 4KQFA 1KO1A 5K3DA 1C1XB 5GWXA 1PLJA 1Q1NA 1X1TA 3ZS8A 1N32B 1V9LA 1Q1BA 1XYYA 1PV1A 3EOAI 3HGTA 3N2GA 3ACDA 4PO8A 3U0BA 4N4AA 4UTVA 4ARUA 2XMRA 1NLUA 2ZRGA 2NQ8A 2J9ZB 3QV1A 4WNYA 2JIOA 1DPFA 4B2IA 3OD1A 4CJXA 1IK6A 3HKEA 5HK8A 4DAEA 1KI1A 2OKGA 4REOA 3ORRA 5IK2A 1W49A 4NJEA 5AI9A 1K92A 2BBOA 1M1YE 1NG1A 3VC7A 4LF4B 1JDZA 3QHPA 1WULS 3TMYA 4NEGA 2QW0X 2MT9A 2Z8YM 4UEJA 1EINA 2GYWA 3SS7X 1PS8A 4JC5A 3TZEA 2C2OA 4PHTA 1VLVA 2XYVA 3IHKA 2B0CA 3C24A 4G56A 4JUCA 1TMKA 1VYTA 1DAFA 1YXMA 3GU3A 4Y6PA 5CB4F 5KMGA 3N2ZB 3VKFA 3GLFA 1XE3A 2UZ4A 1ZO8A 2PANA 3AEKB 4F3NA 5AKHA 5IM5A 4DDUA 2QMEA 2NV2B 3GLHB 4MV3A 4QEKA 3SKVA 3AU9A 1R2QA 1XCMA 1QM5A 3HB7A 4XLTA 5IAGA 4WLNA 3K1AB 1EHCA 3O91A 2WAXA 3O2NA 1RPJA 2AUNA 2HRDA 1MB2A 5F98A 1OT5A 4CKWB 5EIWA 1TB4A 5GM2A 5CDGA 2C2HA 3JQQA 1T34A 1F8GA 5G02A 1JRLA 1KK1A 3F78A 4OH1A 5F5NA 2HHHB 4OY3A 2BVNA 2VP2A 2NZJA 3LFTA 2JGIA 3FLAA 1SG9A 1RQPA 4OXNA 4CLOA 1H2FA 2B6NA 3LYAA 5TF4A 1W94A 1KHHA 3KQVA 1MH1A 4YRGA 1C9MA 4JYAB 4I9NA 8LDHA 4L5CA 2AD1A 3MT8A 4K6KA 2G17A 1YJXA 5J40A 1GPAA 1YSCA 3VR4D 4BKQA 2FPXA 1DTWA 3C6BA 2XQIA 4XGRA 3H8WA 1PHPA 3BHJA 3SEZA 4C7JA 4IMPA 1RI3A 3LBFA 5AI8A 2CK3A 1LTQA 2FZKA 1D5CA 3D8UA 4I4CA 1XA0A 4KDFA 5J4LA 4W5TA 1G1MA 1DP4A 2WOJA 4IMJB 1O9HA 1N57A 2E0IA 2QAIA 3AHGA 4CPDA 1IHYA 2O8BA 5LYJF 4N39A 1RVV1 3DE7X 4D99A 1BHQ1 3TRIA 1OBVA 2GYYA 1XN4A 3GJ4A 5FF9A 1J2YA 1KORA 2FWJA 1M6YA 3BORA 4J6FA 3UHPA 3W9YA 4YMUA 3FVTA 2YFYA 3OMXA 1RHQA 3V1YA 1FTNA 1K2WA 1O8BA 1E1MA 2C3PA 2VDNB 3VSBA 1IBKB 2IWHA 3P2EA 1V96A 1U7PA 3DE6X 3IA2A 1IVYA 4PVCA 3AZPA 4F38A 1I7DA 2ZUEA 1UXGA 2A7XA 1X1CA 3QEMB 3WGLA 5BR4A 2YXPX 1H6DA 5D85A 1RC0A 4KIJA 1LW7A 4BNGA 1E6KA 3E5RA 2I1VB 4P86A 3UOGA 4Y1FA 3HTXA 3B52X 1YR9A 3E7XA 4DV2B 2FW8A 4RWEA 4S0XA 5FO1A 4Y1RB 4LFBB 1LLQA 3QI2A 3LKBA 3DHNA 4PIPA 3FUTA 1DNPA 3VPGA 4CDNA 4DLYA 1TQHA 3LC7O 4BBPA 2PRKA 3GEGA 1IU9A 2YOHA 4MS3B 5I9NA 1G19A 4F5WA 1BEEA 1C81A 2DHRA 3H97A 3PQFA 4LGYA 4ZZ3A 1QQAA 1SPXA 2XB8A 4KRFA 2AFVA 2D00A 1FF9A 4YBRA 2XXAA 1RQRA 3OQVA 2BEUB 2HUNA 1OI7A 2CKDA 4U0KA 5IW8A 1G9SA 2H2IA 4EJFA 3P9KA 3V80A 1B4DA 3TTTA 1X14A 1CZKA 4DIKA 2DBVO 4FFWA 3K9GA 3GRPA 2WJJA 4URYR 3CSUA 1ABFA 3IIKA 3IUSA 2G28A 1GYPA 4L4SA 3P19A 4QUJA 1VA5A 4O4JF 4Y0VA 1ZGGA 4L74A 3OEYA 1T4DA 2Q1XA 5ALFA 1NP6A 4JASB 1KO8A 2IIPA 1QF9A 5B4TA 4AJJA 4EHJA 3PEUA 3DBHA 3RBXA 2VYNA 4ER6A 1RHJA 1VECA 4Y2JA 3RSOA 4DV6B 2H0AA 4MW4A 1JQEA 2OXRA 3SG0A 3B12A 4PAMA 2FP3A 4G6ZA 4I50A 3RG8A 3KFVA 1R5OA 1HR0B 4ZT4A 4MHOA 5COBA 2IXAA 1UDCA 1E2EA 5LLSA 3VOSA 3AKZA 3TMAA 1KETA 1N2CE 1GWNA 2I7XA 1GHTA 1SXPA 2V5VA 4LOKA 1R18A 1OA0A 3L0SA 5LP6B 4V39A 3BMXA 2WIDA 3L8FA 4OSPA 5DX8A 1OR8A 3TSWA 3LHDA 2VDPB 4DAOA 4N18A 1VGVA 2H4FA 4RD0A 3V33A 1N8NA 3DLBA 1ZWKA 3ESDA 5A9RA 4F0JA 3I04A 1NVTA 2ZVPX 4YRPA 4HDQB 1V1MA 1DIOB 1SZJG 2YY6A 4MB0A 3SZ3A 2EL9A 3IESA 4IH9A 3FNQA 3PPYA 1IK4A 1OWNA 2QTAA 3QXHA 4EABA 3ROEA 2W11A 5KNCA 2D2EA 4U7GA 3WGQA 4A7PA 3GZJA 5L9AA 5KINB 3DKVA 3LBNA 3IAS6 4MVJD 4PS0A 3ANTA 2ZR0A 1DC5A 1EAMA 2PVCA 1UWLA 3F6SA 5B1SA 2A8YA 1NWCA 1DJMA 4PX9A 5AJHA 2W8ZA 1AUQA 1AV7A 4GI7A 5T5QA 1OAKA 3HG7A 5AW1A 2DPLA 2X22A 1KXJA 3QXJA 4KWCA 4IIJB 4TGLA 1II8A 2NQTA 5IJXA 3R5FA 4IIHA 5TEVA 2P2DA 4HWOA 4HWSA 4M0EA 2R47A 5ALKA 2EARA 3MUOA 2OXIA 3X0DA 4DCVA 2VJQA 4Y9UA 2I9KA 1Q19A 2EFJA 5ITVA 2H9IA 2ZITA 5EJFA 2HT1A 2PR7A 3GELA 3K16A 3B36A 1WHTA 4G4GA 4DA7A 5KYXB 4LYJA 3W34A 2QLTA 2YMLA 3I4FA 2Z83A 2CUZA 2Q21A 4PONA 1H4TA 4TXNA 4HZUA 2IQIA 3VISA 3DMPA 4MNTA 3SWWA 1W5SA 1PUIA 2FQYA 5IMBA 1HC7A 1XTPA 2ZBEA 1OUMA 1JN0A 4UPDA 1SXHA 4JI2B 4O1MA 4MICA 4M8LA 5CA1F 5EE5B 4ITUA 4LC1A 3ROGA 4CLRB 2PSJA 1S4MA 3EZ2A 3IAM1 5JROA 3VYSB 3G2KA 1RMYA 4WN3A 1YJ5A 2C4NA 4DANA 2JFFA 1I0IA 3CSSA 2WVAA 1IB0A 4P7KA 2OD2A 3C1OA 5BN5B 4ENSA 1ZH0A 1JHPA 1SR8A 3VPBA 3P1JA 2QWXA 2QVXX 4P0TA 3AI3A 1C4XA 2NO6A 1LVUA 4MI6A 3EBOA 2VRWA 1QZ3A 5EZYF 5DHFA 4EKDA 3GJYA 4FW8A 3OC6A 4IF4A 5HUJA 3DE1X 3CW8X 3L6EA 1DVRA 2QX9A 2R25B 2I80A 5LIPA 1C8VB 4P5DA 1VIAA 1J9GA 4FE4A 3LKZA 3C70A 2PZMA 1SC1A 3LV8A 2PK3A 3FOCA 1UJMA 3I1FA 3QNWA 3HUEA 3IPCA 4O2AB 4Z86A 1HURA 2XWSA 1UT5A 1SBIA 2FWNA 4B32A 5L7YA 3WK8A 5BWCA 2NUTB 3L5OA 2FEOA 3MWJA 3ABQB 4ZVVA 1RLTA 3NTUA 2NLOA 4EF4A 2EBFX 4PZ9A 3Q2IA 1LRJA 1NVBA 5KYVA 3SOPA 2WM2A 2R3SA 1Q0QA 1ZL0A 2Y0BA 2YJNA 2I2CA 3E9YA 2JFQA 1EFTA 5A1JA 5AVUA 4IAOA 1ZVKA 1FU7A 1U6IA 1WO8A 2PKCA 2OGZA 4N5HX 3MMSA 2O8VA 3ILXA 2IDKA 4PIMA 4R2XA 2V5UA 3CZAA 2O48X 1PX0A 4GOXA 1UBKS 4DHEA 1QHFA 2WFMA 3BEDA 3D8NA 1TA0A 4KQMA 3VJMA 1G16A 1K66A 2A59A 4B83A 4BL5A 5K4GA 3CS3A 3V1KA 3R0JA 2JBAA 4RE5A 4KLZA 1G8SA 1Y7IA 2CWDA 1WU8A 2GX6A 2HDNB 3T3NA 2QI9F 3TUZC 2IITA 1CUDA 2OORC 2VCYA 2VNAA 3LQ4A 4WNIA 3V2HA 2REOA 3GI1A 2JVJA 2B9VA 3COJA 5GIPE 2HYDA 1VHWA 3AG5A 3QLVA 4HNUA 1KAQA 3W7AA 3TDNA 2FR8A 2QXTA 1TZCA 2ZBVA 4LJAA 4QX6A 1H1DA 3VPAA 3U40A 1DEXA 2VN8A 4AG5A 5FV7A 1TU4A 3OY2A 3HDQA 1L5WA 2AC7A 1GITA 1NXQA 2WU8A 3PEWA 3AI1A 1QRSA 3RC8A 1M2VA 1FRZA 4F56A 3WLFA 3MWYW 2GBLA 3FCSB 2Q1YA 4H60A 4RF3A 3RSQA 1SELA 2YMQA 4DZRA 1XB2A 4IF6A 1V6CA 4YPVA 1CS4C 4CCYA 3RS0A 5JQGA 3JWIA 3THYA 2X19A 1BH2A 4W99A 5E1MA 3TZQA 1K6XA 5K6AA 2A9PA 4ED9A 2H85A 3X44A 4N03A 1CYEA 1SC4A 5ELMA 5C4IA 3RUPA 3UQYS 3BF7A 1PJ4A 2ZTUA 2JFPA 2RIRA 4BV3A 3A4LA 3ETJA 1THMA 4JLVA 5DOZA 1QC5B 4G9EA 2Q6LA 1P0FA 2AZDA 4BECA 4ZQEA 3ENWA 5HDQA 2XWQA 4R7TA 4NYJR 5DYWA 3BWDD 3WQQA 2Q41A 2F8SA 1XQVA 1J21A 1UJ5A 4DNFA 3PDCA 4EPWA 3ZE2B 4K9PA 5B6PA 3RC7A 2FSVA 3UAYA 5KTSA 2B8EA 3QLVC 1XZNA 121PA 4NBVA 1BQ3A 3LPCA 4NICA 1O03A 2G72A 1WQ3A 1ZOOA 2CB9A 2O0JA 5DNVA 3VO1A 5KPJA 3T38A 3O0TA 5HJEA 1WY5A 2XYQA 1L4UA 2CBXA 4GWGA 5AJUA 1N7HA 1LF0A 2O52A 4MJ7A 3W77A 2DB3A 3H5VA 3VMFA 5HJ5A 1OLOA 4LZPA 4TYMA 1NBAA 3T7KA 2P3QA 4BN4A 4BFVA 5JDIA 2O8EA 3B1ZA 3T5CA 4BFSA 4EPRA 4WJLA 1XJQA 2J0QA 1PT8A 3HADA 2DFPA 4MR9B 1Q84A 3EAQA 3TLBA 2NTVA 3IKVA 1MC5A 2IYOA 2BGKA 1XZJA 4M0LA 1Z6AA 1P2BA 1MJGM 1RCFA 3KR1A 4I9UA 5HMMA 1P4RA 3ZVNA 2A94A 5KNBH 1MABB 4WK0B 1DIBA 1KPIA 3TRJA 1Y4AE 3V3TA 1QFJA 2Y71A 1RKBA 3EBLA 4CUJA 2BFWA 1TNDA 3DAHA 3M8KA 3NTOA 4BFYA 1IQ0A 3EG9A 4ZRMA 1ULSA 5B57C 3RGGA 3HRIA 3RRYA 4BJ1A 1H8HA 1JSCA 5L3SA 1EXWA 2X41A 3AEXA 3C3MA 3PQ6A 5GM1A 5HUHA 1QYXA 3BGSA 2C5SA 4ZAZA 1PV4A 2FSVC 4EECA 1P61B 2VAXA 4JN6B 4LF8B 1BW9A 3OZCA 5HZMA 1WW3A 1X74A 3QUQA 2BZ0A 1VKZA 4KBFA 4F4CA 1ZLYA 5JSZB 2VDLB 4H27A 3VJRA 1JWAB 2ZUWA 3GBSA 4IGFA 4F21A 1DFHA 1SKUA 2XADA 1NXWA 4I3GA 3CH5A 2HJGA 1QTIA 1ZC4A 5AI4A 3L7NA 3LUHA 4BIMA 4RMGA 3D2LA 2C42A 1W4CA 4MW0A 4D4LA 1BOFA 1KYIA 5JE8A 1XAHA 5ALLA 5DTQA 4WESA 2DUWA 4LRXA 4BVKA 1N2IA 2GERA 3UVEA 1JAHA 3AF5A 5DB4A 2DERA 4QOJA 2ZUBA 5F1YA 5GJCA 3M6MD 2QR2A 4FEYA 1F38A 3J81k 2DJ5A 4MQ4A 2FTKE 4Z6KA 2I3DA 1QJ4A 2I6TA 1R9GA 4JL5A 1EXVA 3N0TA 5IS2A 3DLCA 4OQXA 5CW1A 4H0NA 2VKQA 1ULUA 4JJ4A 4NJMA 4LYGA 1Q7GA 4QOHA 2CY0A 1Y9DA 3HDVA 4V0SA 4GOLD 2NO5A 4KPGA 3LCMA 5FADA 5SY4A 2E18A 2VP3A 1Z0ZA 2C07A 1ZIOA 4FI3C 4M0DA 4PCVA 2AR9A 1O6ZA 5FOXA 2YS6A 4UTOA 2D1FA 2Y77A 3FFAA 4F2PA 4KITB 2WYOA 2YVAA 2GXQA 1O97D 1VFPA 2LKDA 2Y27A 2YQZA 3R3XA 5CAEB 3MIIA 3T7EA 3W3AD 4N49A 5FTLA 1WP9A 4EYSA 9ABPA 1DKQA 1R9MA 3N8KA 4LYEA 3GLIE 3SVZA 1HDGO 3VI4B 5FOQA 2ACKA 2Q28A 1IYZA 2VR1A 5E9AA 1GAWA 1G4AE 2VZLA 2XKJE 3HRKA 3Q15C 2E5WA 4KZKA 1BXRB 4BGDA 1DC4A 4Z5XA 5G0UA 2MYPA 3ELYA 2G77B 3P9QA 3STYA 3DTVB 2ZJBA 4LBYA 3CKLA 4HNHA 1CDEA 3B6MA 2IXGA 5ENDA 4C0JA 2JLZA 3SDBA 1KGSA 3U7EB 4NZMA 4ANFA 4AP9A 4CQMA 3H6KA 1NI4A 4CRWB 4UDYX 4FTWA 2FEAA 1KKUA 1JFTA 3M9LA 1E98A 1TUBB 1L2TA 2W90A 4EEZA 1H9BA 3DUFB 1G21E 3A6JA 1AF7A 3O8OB 3GDWA 3GAFA 5H5JA 2I03A 3N2EA 4CKZA 1VSVA 4KUGA 1E7MA 3EXIA 4P5EA 2GPBA 4Q4AA 1XR3A 1IATA 1U2EA 2JD2A 3FYUA 2COKA 2DPXA 3N7AA 1VJDA 2G67A 2PSDA 4X84A 4E08A 3IXMA 4JJ6A 3O4HA 3DPUA 1I2BA 2GJSA 2W43A 1Q15A 2PV0A 2ZRKA 5ALQA 1WW8A 3PFKA 4Q93A 5I9SA 2P2GA 3BAZA 5EXPA 1AQNA 5JO9A 2FEXA 2TS1A 4D41A 1PW7A 1K4KA 3D2CA 2DFLA 2AYYA 2WF7A 2ZIXB 1NW8A 4UNNA 4BWFB 4RTNA 1Z06A 2V96A 3I05A 3GJ3A 3V4OA 1I33A 3H75A 5BNZA 7GPBA 1D0SA 5BO5A 3H5LA 2H2AA 1NMSA 2UUCB 2XA2A 1KEPA 3FH0A 2RGXA 1XLTC 4PRLA 3T0GA 4M7PA 4IDHA 4Y9TA 2PWZA 1XSEA 4Y2UA 4MEJA 2IHZA 3U60B 2WK1A 3LDHA 4PCLA 3CZMA 4YRSA 3MD0A 2XUQA 2R85A 5DGDA 3R9WA 1HWYA 4UCQA 3PEFA 2BHRA 3D4BA 4F3KA 3WHPA 1NQWA 3QPCA 3ZV7A 1K7SN 1UOQA 2Q5JA 5T6BA 1TCUA 2NYAA 5FD8A 4O25A 4HNTA 4QAJA 4CN9A 4ZD6A 3NWOA 4UATA 2BHSA 2R7AA 1J2JA 1JFLA 2CFCA 2IX9A 1X0XA 5ALGA 4ZYZA 2NXNA 2G9UA 2J3KA 1A7JA 3H0CA 3D3KA 1ZQ9A 5TMEA 1YJBA 3GT7A 1YVUA 3CSDA 4ESEA 1G7CA 3M2PA 3SSMA 1N0IA 3IQEA 1BKDR 1LDMA 4GGOA 4JSTA 1E6EA 4L7VA 1FC0A 3V34A 4AF7A 2C9MA 2P4QA 5DCLA 2OV3A 5KX5B 4MQMA 3FF1A 3IP8A 4L15A 3ZQ6A 1AZSC 1EEXB 1VB3A 2GCIA 2H8KA 2XYGA 5T4FA 1QGYA 3WP1B 1K0UA 4XVUA 4C0QC 4B09A 2WJZB 3QPWA 1WM1A 4C6TB 5CX4A 1ODSA 2BONA 3RVLA 4Z0PA 2AW5A 1XRRA 1W25A 2QZSA 3G17A 3V6LA 4IS2A 1EESA 4Y6QA 2FWPA 2IH5A 1V9SA 4TKLA 1TM7E 5JANA 3GRRA 4IBOA 4S3MA 1A5BB 1RLIA 2PBFA 3CH4B 3D3WB 4NBRA 4KGVA 2WWWA 4B4UA 3BM5A 3GFFA 1Z33A 4KAAA 2VT6A 4KMSA 4M9SA 1T6YA 4PZYA 3RVRA 1ILWA 2BY4A 2FFHA 3QVOA 3SJUA 1KC3A 3UHJA 2NSLA 4MULA 1VDZA 7ADHA 1ZRMA 3DWFA 3LSTA 1N5RA 3M6XA 1J0XO 2DPMA 2X7XA 3DDNA 4L8LA 4MQFA 2VG8A 2JHPA 3P2JA 4GMGA 5CLGA 4GH5A 2OZLB 3BXFA 4KGZA 1T5LA 5HCIA 4E30A 3F4KA 2CDNA 1CS0A 1XVUA 3OZTA 4XB1A 2C77A 4XDYA 5EEHA 3JATA 521PA 1OXSC 1SG0A 3NONA 4JU8A 1E1QA 3S28A 4US2R 4KW7A 1Y8CA 2QW1A 4X7BA 5EL0A 4D57A 3EQZA 4LHXA 3KJQA 3D3NA 1NV9A 1P39A 4CZ2A 2X7JA 1W1WA 3T7IA 1NX6A 4QBIA 1FNCA 2XGMA 5CR9A 4HF7A 4MVJE 1XQ1A 3KXPA 2MSDB 1BSVA 4CIBA 1A95A 2DQSA 1UEIA 3DWEX 2GASA 2YJ5A 1EFRD 3I5XA 1PJTA 3THXB 3JZDA 4OXQA 1D2MA 4AG6A 3ZZ1A 1BROA 4JR0A 4M1YA 5JEDA 3MGGA 4XYLA 1C0PA 3VNSA 1CZRA 1W88A 1E77A 1Q0HA 1WXDA 3MGBA 3JTEA 1BMFA 3QUSA 3RI3A 4DIBA 2JLVA 2OL4A 2ZWPA 4MAMA 1P0QA 2V6MA 2I76A 1C2TA 4MWZA 4JR1A 5I5GA 2H17A 3QFSA 4OG2A 1P4GA 4R69A 5G4LA 5C2JB 4KQ1A 1GG8A 1SJ9A 3AWIA 1JVSA 4X6LA 1GKKA 3L06A 1R16A 4MWBA 1GXSA 1FSZA 2R44A 2HHAA 2QLNA 3AX6A 4AG3A 4HJRA 3EH2A 2A5DA 2B4TO 3CUUA 4PEVA 4ZOLF 2GAFA 1RJFA 3G2IA 5ENZA 3W6NA 4YWJA 1PR4A 4ZMRA 4UARA 1UK7A 9LDBA 2XNKA 5FT9A 4B3DA 1XF1A 3TI9A 4UM5A 3DNFA 3MMPA 4PSUA 2P3LA 1JX6A 4GMFA 1M2NA 1KVSA 4MDYA 5FPPA 3KT3A 2BC9A 2CF6A 4L22A 1M0SA 3SBXA 2GJ9A 1DPGA 4IMRA 3KZVA 5AW3A 4BN5A 5LLTA 4RS4A 4D96A 5BUSA 2FZVA 4TRMA 1JEOA 4HDMA 3GUUA 4KLAA 5TT1A 3A1VA 2JCXA 4E1AA 1YFZA 3BWYA 1OZFA 2HQSA 1CY0A 1B3BA 1ZK4A 2PEZA 3MJDA 4WBSA 3PSHA 2IYUA 3B1VA 3SQXA 3DEJA 4JY7A 1NVAA 4ZALA 1KQFA 1UOOA 4UXJA 3U16A 1TVCA 2P79A 3C97A 3KELA 4JXJA 2G7MC 4EATA 3ULKA 5FR1A 1W0CA 2BFEA 3KJZA 2R68A 1XNGA 2QUZA 3HJAA 4BLRA 1T4GA 4O8CA 4DGSA 1C3JA 3C4VA 5F1KA 3E4CA 4J03A 3EZ9A 1KVUA 1OZGA 3I62A 1ENYA 2Q0XA 4NZOA 5JLAA 3VR3D 2FF7A 4EHLA 1T1SA 4B80A 3OZBA 1NW5A 1HKHA 1PBNA 3IBGA 3T7JA 3UHAA 1V11A 4HL6A 2DM6A 1NC1A 3HM2A 3OAAA 1SCBA 4WZAE 4ND8A 4RTPA 3GPCA 3IAS1 1YK0A 4J0KA 1FUIA 4DVGA 4FWBA 4DLPA 3THWA 4O02B 2CLKB 8AT1A 2FETA 4XJSA 2XIJA 1W2HA 2XZLA 1JQLB 2QRQA 4AYWA 3W5JA 1KI9A 3O21A 2WYHA 6NULA 1TC2A 2OBNA 2IEZA 3ZBPA 4C4AA 1ULZA 1W6UA 3PGXA 1H93A 1QJCA 2Y0EA 4WD3A 1LPOA 3IV6A 4XSGA 1NASA 2GFQA 4ND7A 5FL3A 3G3EA 3T34A 3ZHYA 1GZVA 3KOMA 3NC4A 3GC6A 2CFOA 4I5GA 4ZO8A 3L9XA 3KRTA 1QG4A 1NX9A 3FZEA 4YJHB 3TECE 2P4UA 4QZVA 2AFIE 1L1RA 2J0UA 3OIUA 3R3ZA 2G9VA 2HNKA 3QGMA 4JQYA 3B3JA 1DC3A 5K03A 5KOIA 3EF3A 2XB2A 4PAGA 3WKDA 1Z73A 5KTOA 5C80A 1P4AA 2YZNA 5IHPA 3O8LA 4EJSB 2HWYA 1C5KA 1U7HA 4OK5A 2EFEB 2C83A 3RASA 4FFNA 3TQIA 4E70A 4D0GA 1I7NA 1T6BY 3OLCX 2P9FA 3W06A 3Q41A 1GTSA 1YS6A 2K2QB 5CCBA 3AH8A 3PYLA 2Q6OA 4ZZ2A 2J6IA 4K6FA 1H4QA 4OLBA 2ZCJA 5DP1A 4TL8A 1Z8HA 1SIWA 4FYMA 1YRBA 1MGPA 4CFSA 4C76A 3ZGZA 1FSPA 1CZHA 2X8AA 5AUNB 3CVWA 1MJNA 2IHJA 4GMKA 1L7BA 4U2FA 4IUYA 3GNLA 2P5SA 3L43A 3LPAA 5A0TA 4TROA 4IHJF 4FYKA 3D4OA 4IEIA 4L27A 5JTUA 1SUAA 4Y3UA 1N3LA 2GARA 1NJ6A 2BM0A 3DBIA 5FFMA 4DRXA 1SU6A 4JK3A 2HF8A 1IUOA 3M6LA 5HOEA 1R9JA 4KYTA 4CU2A 1QIJA 4FS8A 3RH0A 1DBSA 1YS4A 1GPWB 2PT6A 3FNGA 5C9ZA 1WMDA 3E3MA 4YMWA 2PKWA 5BQFA 3QYAA 2EV9A 1A76A 1ODLA 4OM7A 4AUEA 2J7KA 3OQNA 1R00A 4MQEB 3WWDA 4DQLA 2I33A 3PIDA 1FYFA 5CFZA 3HGQA 4LOHA 5C5EA 3DKKA 1AH2A 3MOSA 2QJOA 1YZUA 3DZHA 1J8VA 2CNBA 2P9TA 1VI5A 3AHFA 2E2WA 1SCUA 4N12A 3W9SA 4RLFA 3FKSD 2L18A 4ENTA 3GP8A 2GRJA 3ITNA 4QGHA 2JAQA 5DULA 3QTLA 3H7IA 2WIBA 4WX2B 3KKQA 1CP2A 4RIEA 2DZDA 1ZGAA 4KXFB 4RLHA 1M1NB 1NQ5A 5C7YA 2PRZA 2HY7A 4PG6A 5HQJA 5LZ2A 4UFOA 1WF3A 3ME5A 3K0CA 5IDQA 5A4AA 1RTTA 4FX2A 3FKQA 3ZU5A 2ZUUA 3TNFA 3ORSA 3O6VA 3A1UA 4IDEA 4E32A 3LQKA 1QS0B 4KLCA 1E99A 2IXEA 3AY3A 4MO9A 3DEIA 1E3WB 2XAAA 2C7QA 3O1LA 4OFZA 3L0BA 4FCWA 4Y30A 5FLEX 5JJ5A 3O4GA 1E3JA 1GEEA 1W6RA 4LSZA 3TW6A 1PJ8A 3U0VA 1D0IA 4ABYA 1RWMA 1B00A 3QBVA 4DREA 1SQSA 3I64A 2G63A 1JW9B 3JWEA 4JLDA 2WFLB 4V02A 4URVR 2FK8A 4WXHA 1HL3A 1YQQA 4LYHA 4AX4A 1JZTA 5EVJA 4KU4A 2V7XA 1EFLA 1M3SA 1Z6QA 2ZJ0A 4JZYA 2OC9A 4OEHA 3VFDA 1I94B 1G7TA 2D62A 2GBFA 2YJGA 3KD3A 4R31A 1OTXA 3UB3A 1QSGA 1YJ8A 2HKIA 3WGOA 2PT7A 3H19A 1UPTA 1TAUA 1F1JA 4WOCA 2VSFA 2I6XA 1OMOA 3K0CC 2OBYA 1VLZA 2JKYA 2PWAA 4TYPA 1W1UA 3FIUA 1K1EA 2BKUA 4IIEA 1K86A 3FETA 2YJTD 4F85A 2B82A 4RA9A 5AW8A 2ZT7A 1FQOA 1Z4MA 4EFLA 3NV7A 1HFJA 1NKVA 1H94A 1TEHA 3AXSA 3BICA 3C45A 5HBRA 5KQGA 3A9CA 3ETCA 2NIPA 1C1DA 3WKAA 2IYVA 1UKVY 1E79A 3RFFA 3QF7A 2HBQA 4PM4A 3I73A 3SSOA 2QR5A 3JR7A 4YDQA 3HJFA