4CM7A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
252
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQNGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
molecule keywords PTERIDINE REDUCTASE 1
total genus 94
structure length 252
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm7A00
1DHRA 1H93A 3RIHA 4Q3EA 4CLOA 4CMEC 2PKRA 3BMOB 1YGYA 3HFSA 4JIGA 3RUIA 4NFHA 1YQXA 4GMGA 3SLKA 4E3ZA 2UVDA 1ZBQA 1DJNA 1P74A 1DXYA 4E5KA 1QORA 3ZU4A 1PJLA 2W2LA 1QYXA 2VT3A 3PK0A 4YJGA 3I9LA 3JD4A 1XYGA 3HADA 4JBGA 4BNVA 3TOXA 5FFFA 4UVEA 1DAOA 4A26A 3BMOA 3IOYA 4NR0A 1C1XB 4JBHA 4W99A 1A9ZA 2B0JA 3DZBA 2GASA 1X0VA 3Q11A 3G1UA 4ILKA 1ISMA 1P0CA 5B1YA 3RI3A 4NBUA 3D3EA 1NQOA 4DIOA 9LDTA 3D4PA 3OSUA 2Q99A 3PDJA 3GEDA 2GRAA 1P1IA 4ND2A 4R01A 3WGZA 1LRLA 1A27A 3MOIA 1W4ZA 4XD2A 4AL4A 4XB2A 3FI9A 1UJMA 1MFPA 3GHHA 3W4JA 4EEZA 1V8BA 4CUZA 4AJJA 4BGUA 4EUEA 5FYDA 5DBGA 3Q2KA 1CIVA 1EVJA 1PS9A 4YWJA 2PZKA 2XPCA 2Z95A 4BNZA 3L9WA 4CL8A 5TT1A 2I65A 2Y99A 3S55A 4F45A 5B4TA 3PQFA 1R37A 4BGEA 2AG5A 2QRLA 3ZW9A 1I0ZA 1YOVB 3TZCA 1V3UA 5TJ9A 1IPEA 3NRCA 5B12A 1NWHA 4CL3A 1HEUA 3NT4A 1BXZA 4LRTB 4FOOA 1BHSA 3CXRA 5JAMA 3DZHA 3QE3A 4Y8VA 3SJUA 3WOHA 3EW7A 3O4RA 3MEQA 1ONOA 1OBFO 2GZ2A 5ADHA 1FK8A 1UXJA 1P1RA 1KVSA 1I01A 1RYEA 4QECA 2CDAA 3ZWWA 5IN4A 2DBRA 1I2ZA 4HFRA 4IS3A 1VM6A 2NU7A 3M1AA 1CERA 4M89A 5EERA 4FFNA 4G5HA 1DC4A 2W8ZA 3AOEC 4TRMA 1WVGA 3HB4X 3H65A 1PQUA 4BVAA 3ZV3A 3NDJA 4MVJG 5U1PA 1LDYA 2BFOA 4BO3A 1VJ0A 4NDNE 2ET6A 3IKVA 3K2BA 4TKLA 3NKLA 2BKAA 1V9LA 3FCOA 1B3RA 1WWKA 2YJZA 5G2OA 4DYVA 4EUHA 1EBUA 1E3LA 1C1DA 4CMEA 5BNIA 1OAAA 5CDUA 1SAYA 5DCWA 1KETA 3VKVA 3A06A 1ZKMA 1WDMA 1ADCA 2VRCA 2VZ8A 1LSSA 2CSUA 2IODA 2YFQA 3FPLA 1QG6A 5H83A 2G82A 3ZCXA 3HFGA 2PGJA 1KC1A 3A4VA 3ABIA 3ITKA 2Q46A 2D1YA 4R9SA 2NVUB 1N7GA 3QP9A 4OGWA 1B3BA 3WR5A 1WMBA 1CQJA 3EZYA 5JCXA 4FC6A 3W6ZA 3IS3A 4IINA 2BRUA 4CMIA 3FTNA 4HX5A 2DKNA 5L7YA 1BRMA 2LDBA 2YHIA 1BXGB 1LTHR 2OFPA 4DLBA 1Y7TA 2WYWA 1ISJA 1GY8A 5A9SB 3QWAA 1LRKA 1MUUA 2AEJA 4RPGA 3WGGA 4IZHA 2NTNA 2B35A 1DFIA 1T24A 4BV8A 5F1OA 4E2WA 4CLRB 1E6EA 2WMDA 4KQXA 5T67A 2Q1UA 5L9AA 3RU9A 2HRZA 1N7HA 1CWUA 3R3JA 4GQAA 4RORA 5DP1A 4YAKA 4PIVA 4FFLA 2R2GA 2VHYA 3D0OA 3S2IA 1VSVA 4Y67A 1JU9A 3KXDA 1ZZEA 7ADHA 3L4SO 3GHYA 3GF4A 4MVJI 9LDBA 1JTVA 4OJNA 4GKBA 5CDSA 4U7WA 2DC1A 5KWEA 1AUPA 1TT5B 4HP8A 4UULA 2OP1A 2X7HA 2PZLA 4MVJD 5BSHA 1DRUA 1IB6A 1AHIA 3S2FA 4PVCA 4UVDA 2Y1GA 4R68A 4CQMD 1HL3A 2PK3A 4BIIA 1WXDA 2NTJA 4R4JA 1EK5A 4WLVA 3GGOA 3NT2A 5AOVA 1UP4A 3ZV6A 1I30A 2V6BA 3BMNA 1M66A 4XZ3A 5T6BA 1RM5A 3F5SA 3U4CA 3GEMA 4NIMA 1A72A 1HT0A 1ZJYA 1NR7A 1VL8A 4Q3DA 1YDEA 2D0IA 3WG9A 3D4OA 4PG6A 3ETDA 2IEDA 2O3TA 4FDAA 1T1SA 5G4KB 3UCXA 2V6MA 4R3WA 3R1IA 5MGBA 2Q1WA 4XKJA 3DWFA 5B37A 3RBXA 3V8BA 4DA9A 2OHXA 2VUSA 3OP4A 4NHEA 3W8EA 4DTIA 1HDZA 3D3WB 3GG2A 3TWOA 3NEPX 4FC7A 1PZFA 3A9WA 3ZN2A 4CV0A 4OM8A 5JPIA 3D1LA 1B0AA 1P1JA 4RQUA 4XYBA 5IDQA 4CR8A 1HWYA 4ZHSA 1H6BA 4BKPA 4DL9A 4M8SA 1HDGO 1KEWA 4LK3A 5FI3A 5A3VA 1F8GA 1NVTA 4C7KA 4FBGA 2XXBA 4QFCA 3RJ9A 1HE2A 4ESOA 4GSKA 4WLFA 2NQTA 1I8TA 3VH1A 3OH8A 2NSDA 2VHXA 4IJWA 4DC1A 3RROA 3JQBA 2VHZA 1EUCA 1Z73A 4I5EA 4W7IA 4W6ZA 4GBJA 2RH8A 3FD8A 4U0KA 1PR9A 4JX8A 3DBLB 2AHRA 2O4UX 2JAPA 1GQQA 2W2KB 4IIVA 3ZWBA 5L95A 2FHSA 1BW9B 2BGKA 1NAHA 2BGLA 2RAFA 3DZKA 3A28A 1C1XA 2WM3A 3JD2A 3K92A 4D3FA 4GH5A 3PQDA 1Q2XA 1PJTA 1XU7A 1YO6A 4PLCA 2O4CA 5AXCA 1ULUA 4TZTA 1H2BA 5COAA 2DLDA 4A5OA 1ISFA 2DUUA 2PD6A 4HWKA 3RUAA 2C20A 1B8VA 4D41A 5A9RA 3UOGA 1ZSVA 4UUMA 4W7HA 3AUTA 3WJ7A 4Z9XA 1ZK2A 3C1OA 2QQ5A 5IAAA 4KUGA 4DIFA 4MVJM 2RCYA 5KJ1A 3LK7A 2R6JA 3FTPA 1I2BA 1NVGA 2HRBA 4P22A 3TDKA 4CMAA 4R51A 3UHAA 1CQIA 4DLLA 1EVZA 1HRDA 2CF6A 3VPSA 4DXHA 4YVFA 1BVUA 1JVSA 2V6FA 1K0UA 4OYRA 4CJXA 1PGPA 1GYQA 3GT0A 4WK6A 4A73A 4BNKA 4R1SA 2P9GA 4WLOA 3VAZA 4ALLA 3PTZA 3INRA 5G4LA 3WQSB 5CDGA 1C1DB 2NADA 3U09A 1F8FA 3E9QA 4YXFA 4YJHA 5C37A 4TWRA 2DQ4A 2C29D 1DSSG 3WBBA 4UUNA 3H9EO 1DIHA 1YB4A 3ZNOA 3AWDA 2AEFA 2W90A 3VH3A 1JDJA 1NFRA 4YJFB 1UAYA 3PFFA 4AJ4A 5HM8A 3KYBA 1U3TA 1TB4A 4ID9A 3UXYA 1E6WA 3K6JA 4XRRA 4AJIA 3INGA 4O5OA 3T7CA 3GNSA 3K73O 3IAHA 3KLMX 3L07A 1XDWA 1DO8A 2IE0A 3M2TA 4M1QA 2IYOA 1KOLA 2I3GA 3KYDA 1E3WB 2YV2A 3PYMA 4RO0A 3VPXA 1MC4A 3GEGA 5F5LA 4GX0A 5I7FA 1Q1NA 3LZ6A 2Y1EA 5EPOA 4AJOA 4WJZA 1U3WA 2I5PO 3ZHYA 3IIEA 5ENVA 2X5KO 3FR8A 1I24A 3GRPA 5ENDA 1BDMA 3I1JA 4B4UA 2I6TA 1K6JA 4KTVE 3RUFA 1DOHA 4YT2A 1DLIA 1JQBA 3JQEA 3K30A 2PGLA 1F0YA 2A92A 1UP6A 3KOUA 5IZCC 1UDBA 5FI5A 4BNUA 4EYEA 1E1LA 4YQZA 3H3JA 3RC2A 5ITWA 1E6UA 3JD0A 4IQ0A 3H5RA 3UN1A 2FOIA 1HYHA 1LXCA 2P9CA 4D7AA 3VOSA 2CZCA 3OIDA 3F46A 4CM3A 4ZRNA 4BB6A 2BF7A 2DBZA 3NAQA 2NWQA 1PZGA 1U8XX 1P45A 4FGWA 1YJQA 1A4IA 4DIBA 3CSDA 3V2UA 3O38A 4JBIA 4BMVA 1M67A 1K6XA 1LC0A 3JYOA 5JCJD 1K2WA 1DRVA 2NU8A 1IUKA 3PIIA 5L7WA 2O7SA 3AI1A 2EF1A 1CYDA 2VNSA 2BMAA 3DONA 4RF4A 4WCFC 2O48X 5FWNA 3Q6IA 2HDHA 1RKXA 4XEHA 4DMLA 5F1PA 1HDOA 4NFYA 3HDQA 4BO5A 3GC6A 2YV1A 3U62A 1ZMTA 1R4MA 4CR7A 1M76A 4UVIA 4QX6A 4FIZA 3N58A 5G0TA 3SEFA 3V1UA 2VWPA 4HBGA 4LW8A 4J3FA 4Q3NA 4CM9A 1P1KA 1YVEI 3I6QA 1XEAA 3PHLA 4KTTE 5KJ6A 4XCVA 4IPTA 5MDHA 3AFMA 1VKOA 4LVCA 1BG6A 2C5EA 3CH6A 3NT5A 4KWIA 3S1LA 2QW8A 2AXQA 1ZK0A 3B6ZA 3WJAA 4BQRA 4G2NA 3UF0A 4ALKA 1E3WA 2G17A 3DBRB 3I5MA 3ZWCA 2J3KA 3GNQA 2Z1MA 4R1UA 3DHYA 2JJYA 1IHYA 4LRSB 1ZO8A 2AQ8A 5BNTA 3ONDA 4BS9A 2CVQA 3VKUA 3OIFA 1E7RA 4WOKA 4W82A 3RASA 2OL4A 5ER6A 5J23A 4RL6A 3OJ0A 5G4KA 5BR7A 3WGQA 5BSGA 1PZHA 4J6FA 3RKUA 4A03A 3KSDO 3DHNA 4ND3A 3GDGA 2P5YA 2AW5A 3DMTA 5HBRA 1E1NA 1SMKA 2GN8A 2WSBA 4A2CA 2ZK7A 3TRIA 3ENKA 3PRJA 2YFHA 3CMMA 3FSRA 3ASVA 2O3RA 3R6DA 2W2KA 1NYTA 2WYVA 3DOJA 4RPKA 4XQ9A 2RIRA 4TRRA 2DVMA 2AG8A 4I5GA 4M87A 2Y0EA 5JY6A 3QVOA 2P4HX 3RUHA 1UUFA 5TS3A 4IM7A 2DUWA 4YAEA 1Y9AA 1FF9A 3UGKA 4RJTA 2CY0A 3HN2A 3OEWA 2X8LA 4G65A 2J5QA 2PH3A 3MJTA 3QHAA 4U8GA 1F12A 3SC6A 5KIAA 1SOWA 3ZWVA 1XELA 4R54A 4YYZA 2O7QA 2HK9A 1DIGA 3SX2A 1KEPA 3L4BC 4NBTA 3ASUA 3B70A 1HE4A 1T2DA 2BHLA 3L6DA 2YHUA 4TZKA 3DAGA 1N9GA 3HN7A 3DQPA 4J1SA 3GFGA 4J91A 3I9KA 4L4XA 1QR6A 1DAPA 4IJUA 3JYQA 1Y5MA 3PYXA 4BNTA 2AE1A 2GERA 1JAYA 2O23A 1Z7EA 1Y81A 1M6WA 4HFNA 4RLHA 1DEHA 2JD1A 3DO5A 1UXGA 4OH1A 3JQ8A 3CIFA 3IL2A 3CKYA 4M55A 4O63O 3T4XA 2Y1DA 4IDGA 4K1LA 4XQCA 2BFPA 4AFNA 5C7OO 3TSCA 1P3DA 5A4DA 5C7LO 4YAIA 3E03A 1T2CA 4J2HA 1EEHA 2IXBA 5L7TA 3VPGA 3F3SA 1XIVA 5JS6A 2PH5A 4L75A 3AK4A 4BO2A 4GPD1 4HADA 4MVJA 1R4MB 3HZZA 5BT9A 4ROSA 2BD0A 3LT4A 2VUUA 4Q9NA 5HWSA 2EERA 5JE8A 3SXPA 4RVDA 1DLJA 1T25A 1A7KA 1E3SA 1BXKA 1U4OA 4AJ2A 3PQEA 3AW9A 3DOCA 1OC4A 1PR3A 1T2FA 5JDCA 4FFMA 1GAEO 3MJVA 1DIRA 2WEKA 3TN7A 4WE3A 4FR5A 4RF2A 4U6SA 1BSVA 4FJ1A 6LDHA 2WWRA 3QQPA 1PJ3A 2OOSA 3NDIA 2A4KA 5I7EA 1Y8QA 4CM4A 3NDRA 4FCCA 5IF3A 4ZN6A 5KVQA 1RM4A 3HUDA 2DPGA 2OUIA 3VDRA 3WNQA 3WIDA 1J6UA 1U7HA 3OM9A 3LT2A 3OA2A 2EGGA 4DLAA 3STHA 4IS2A 5A3JA 2AQKA 1GQYA 4FFRA 2D59A 4F6CA 5IG2A 1KVRA 1PQWA 4WNIA 1NXQA 5A9SA 1LSJA 1JWBB 2Q2VA 3UUWA 1L7DA 4YB8A 1U5CA 3KEQA 5U4QA 4CR6A 3ANNA 3RUEA 4NPCA 4YQYA 1U4SA 3OF2A 3S2EA 1C0LA 5L3ZA 1HDYA 2PV7A 2WD7B 1FDUA 3U5TA 5C7IO 3GAZA 4U6QA 2NM0A 3PWSA 2CF5A 3ORFA 4ITUA 3ZNNA 2HMTA 3H4VA 3H8VA 1N1GA 3WFIA 2P91A 1I5RA 1VJ1A 3O8QB 1NPYA 2Q1SA 5G0UA 4PLVA 3MWDB 2FPPA 4AJKA 4U5QA 2ZJ0A 3BTUA 1LLUA 5TRTA 1M6HA 1A4UA 2QHXA 4JJIA 2X9NA 3ZNQA 3DTTA 1YWGO 4CMIB 1PGJA 3IMFA 2J5KA 2DU8A 3LC1O 3EAGA 2HK8A 2JD0A 1YDWA 4IDBA 3TZQA 1VSUA 1IL0A 5AYVA 1LLDA 1PU2A 2E6UX 3BA1A 1MB4A 1WZEA 4HFJA 4L74A 4YT4A 1Z75A 2FZEA 2XOXA 3ZWAA 3H5NA 5EJ2A 4R5MA 4ZU3A 1J0XO 1KIFA 1ENPA 2P9EA 3BTSA 5K6AC 2AE2A 1MGOA 4BNYA 3ZHBA 3CMCO 4ND4A 1ONPA 4GGOA 1E7QA 3LC7O 5ER9A 4XX0A 4GMFA 4EUFA 4ZICA 4YA6A 1NWCA 3OJEA 2VYVA 3AU8A 3R3SA 4NJMA 4B7UA 3JQAA 4CMJA 4E30A 2Y0CA 1HKUA 3RUCA 1X13A 4ZRMA 3AFNA 4BNNA 2X1HA 4UAGA 1NTOA 1PZEA 1Q7GA 2EP5A 4B8WA 4E4YA 3GPDG 3I9MA 4G81A 3GA0A 5A03A 4H15A 3TOZA 1Q7BA 1UXIA 1ZK4A 1GPDG 3NX4A 3ZWXA 2HQ1A 4MIOA 4B4OA 4KDFA 3IUSA 3MJSA 4O6VA 1HETA 4KOAA 3ZH2A 5CAEA 3E9NA 2VWGA 2FPIA 3W1VA 3VZRA 5TGDA 1DDOA 1OC2A 3WMXA 4EITA 3KEOA 4I9UA 4N5LA 2O2SA 3VVBA 1XR3A 3O03A 3I83A 1AXGA 4MKRA 4EZBA 5HTOA 1NAIA 1R16A 3CUKA 4DBVO 4FN4A 3GG9A 3OQ1A 4MVJH 2EJVA 3DFUA 3FNFA 1UXKA 3CINA 4MVJF 5CHEA 4D43A 2GDZA 3F6YA 2DFVA 1ISHA 2TMDA 1GL3A 4HFMA 3BTVA 4J7XA 2JFGA 4MPDA 1ZH8A 5F3RA 4Z6KA 3DBHB 3E5RA 4E5YA 3ADPA 4CUKA 4ZGWA 1HDRA 3BAZA 4C7JA 5KOIA 2EGHA 1E7WA 2GN4A 3CEAA 5FEUA 1LRJA 4YJGB 3GR6A 3ZU3A 3JQ8B 2IZ0A 3DC2A 5L4NA 2NNLD 4CLHA 3RCBA 7MDHA 4NK5A 4KMSA 1WNTA 5L4LA 1WP4A 4IDEA 3U3XA 3GVCA 3IC5A 2E49A 3F47A 4K28A 1S6YA 4IGEA 3RD5A 3DBHA 4BUCA 1ZCJA 5JO9A 2EKPA 2V6GA 1GZ6A 4Y6RA 2PGDA 1KY5A 3VPFA 1JAXA 1EE9A 1G6KA 4AJLA 1DJQA 3DBVO 1KVTA 4D3SA 5GZ6A 5IDYA 2ZTVA 2OBNA 3FPCA 1NFQA 3DAPA 3NTOA 4NI5A 3C1AA 3IQDB 4II3A 4DQXA 3GGPA 1NP3A 3BYZA 3ETGA 1H0KA 3AU9A 1E5LA 2JCVA 4DQVA 4A7PA 5H81A 2QIOA 1PJQA 3QLJA 3GZNA 2PKQP 4D45A 3H2SA 4CPDA 1H5QA 5A5EA 3U4HA 3QVSA 3MZ0A 4P8RA 1XWFA 4XGKA 1R6DA 5B4VA 3TFQA 3VVCA 3L4BA 5JCJA 1Y9EA 4R1TA 3FWNA 4HXYA 3ZNPA 1R4NA 3L9XA 2EKLA 5FF9A 4QSMA 4DVJA 3KB6A 4NU6A 1EDZA 5EQDA 3U9LA 3KZVA 5A1TA 4B4WA 1GUFA 3WGOA 4F3YA 5AQ1A 1KVUA 2QZZA 1T2AA 1DC3A 3GZ4A 3P2YA 3ICPA 3DHEA 4PLYA 3R0IA 1JKIA 2XAAA 4X54A 3G49A 5DOVA 2BFMA 5GMOA 1KC3A 1YOVA 1EQUA 1YONA 3OQBA 2O3UA 4ZVVA 3EVTA 4IGFA 1UZMA 3JQFA 5EIOA 4N54A 3AOGA 4CMCA 3RFTA 4D3DA 1YE3A 5TF4A 1HDXA 2C59A 2Q3EA 1EUDA 1CJCA 1GCOA 5KTKA 3ZV5A 2WD7A 3SJ7A 3ZU5A 2A94A 5HS4A 1PJ2A 5JMWA 3SC4A 2C7GA 4IDFA 5COBA 3DZGA 3V1YA 1DIAA 4GX2A 2WTBA 4WLUA 3I3OA 2CUKA 2WJPA 2A35A 1CDOA 3QIVA 1PEDA 3ROMA 1PL6A 3JCZA 4YEDA 2EEZA 1LNQA 1NPTO 4CM8A 4J4HA 3NJ8A 3UVEA 1GCUA 3X2EA 2HAEA 2HSDA 2ZB8A 1PSDA 5JY1A 4J7UA 4BMSA 3GK3A 4GX1A 3GPIA 4CLDA 2CNBA 2G0TA 2G1UA 4D79A 4OAQA 4WNCA 4YT8A 3TZ6A 3EUWA 2Q2QA 1ID1A 3ZI0A 4K6FA 1HSOA 2QRKA 1ZEMA 2EHDA 3Q9NA 4I5DA 3G3EA 1F06A 5IXSA 4WGGA 4CV2A 1XQ6A 4YRDA 1YRLA 3PXXA 5TC4A 3PJDA 1A7AA 3QY9A 2P5UA 2W2LD 3WX0A 3C8MA 3GVPA 4J7CA 4N7RA 1X14A 2B5WA 1MFZA 4JROA 4S1VA 1NASA 1LUAA 5AXBA 1W0CA 3NTRA 3OEYA 3P19A 4NJMB 2ZYGA 2HMWA 2HUNA 5CDTA 1LQTA 2H6EA 1P1FA 1X15A 1YQGA 1A71A 2ZB4A 4FSHA 5TX7A 4QT0A 4EJ0A 1Z45A 1K3TA 1JA9A 4JCOA 5EESA 3I4CA 3F9IA 3OBBA 3WYBA 4E12A 4BO6A 3KHUA 1ZIDA 4IMRA 2E37A 3ROKA 3PLRA 4WEOA 4B8ZA 5GY7A 5JYDA 5K9ZA 1TEHA 1OZAA 4K6CA 4L73A 1TLTA 1YBMA 3IUPA 4BOYA 3ADOA 4FGSA 4BL5A 1ULSA 5KKAA 4RVHA 3WNVA 1LBEA 3VTZA 4OQZA 1HE3A 3FBTA 4WCFB 2OO5A 2NTVA 5EINA 1KS9A 4BQPA 2E48A 3JQ7B 4QQRA 2G76A 3LT0A 4B7XA 3EZLA 5I7SA 2R00A 3KETA 4C4OA 1ISIA 1W6UA 2JD2A 4MKZA 1FDSA 1PQPA 1IULA 3UW3A 1IOLA 4ZQBA 4ND1A 1O89A 3DEYX 4HNGA 1QYDA 3U4IA 4J0EA 3ANMA 3QVXA 1YL7A 4GSLA 3TPCA 4IDDA 3GVHA 4E32A 3H6KA 5TT0A 3EHEA 2ILTA 1PTJA 3D5QA 5DCYA 4FQ8A 3JD1A 4RDIA 2EXXA 2BI7A 2OXIA 4XYEA 4AJNA 4YRBA 1HXHA 2VRBA 2JHFA 3B1FA 4YJHB 4PLFA 4PLGA 4BNFA 3PHGA 2IDZA 1QV6A 1TXGA 3D5TA 1ZXBA 4CMGA 2IRWA 5T5QA 2Y68A 2CVZA 3LU1A 2BGMA 4BHTA 2YQ5A 3PLNA 4AVYA 3FBGA 3U4DA 2E4AA 3G79A 3JYLA 4O59O 1Y5RA 3HDHA 3INTA 1LLCA 1ENOA 3BMQB 3GNTA 4D0RA 4Y98A 2FSSA 4RVUA 2DTXA 4Z9YA 1E3IA 2EWMA 1EMDA 3RFVA 4CMBA 5JYEA 2PD4A 1GQ2A 1YQDA 1T26A 2FN7A 3KYDB 3QVTA 2X0RA 3WBFA 3BMNB 4R5HA 5T57A 1XCBA 1BMDA 2Q4EA 1K6IA 4DPKA 1OFGA 2I99A 3BHMA 3E8XA 3N7UA 2IZZA 1NFFA 3ZWMA 4BMNA 4M54A 4DWVA 1GDHA 1BVRA 3KRTA 4XQEA 4OHUA 1FDVA 1UP7A 2POQX 4XDYA 4K26A 5T8KC 5KVSA 4WLNA 3A14A 4XJSA 4Z0PA 4KUHA 3CZRA 2Y93A 3P5SA 2Q4BA 1ZEJA 4E6PA 3DXFA 4PRKA 1U7TA 5B4UA 1GPJA 2BI8A 3QWIA 3H5AA 4JLWA 4ALJA 2NUAA 3HHPA 4B4VA 2YDXA 4BNWA 1DHTA 4A10A 2VHVA 1WAMA 5DCUA 2D4AA 5JAIA 4MVJE 2VCYA 4JN6B 2UUOA 4WLEA 5DBIA 5LDHA 1HE5A 2VUTA 3BMCB 3DDNA 2GPTA 3FN4A 4QFDA 5DN9A 3ROPA 4HKTA 4TVOA 4XYLA 5JC8A 5DT9A 4W4TA 4L76A 3LC2O 5IZCA 4M86A 3PJFA 3ZU2A 1DC5A 1KERA 1GUYA 1VC2A 2B4QA 3Q1LA 5TQVA 3S8MA 2B37A 1ORRA 1MP0A 1PJCA 3A1NA 4Q39A 5IXYA 3KSZO 5THQA 3ZWPA 4DBZA 4EBFA 4WCDA 4FJ0A 4PLZA 3H7AA 4BNJA 4E33A 1GV1A 1I3NA 4WASA 3RKRA 1GZ3A 1J4AA 2VYVD 2GD1O 3CPSA 3OJFA 4Z3KA 4MIYA 3VHRA 4W9NA 1E0DA 1EK6A 2UAGA 3AUAA 4WKGA 5ICMA 2E82A 4P4LA 1E77A 2F00A 4DYDA 5GZ1A 3PJGA 3K8ZA 1D1SA 1EE2A 3D4NA 2C0CA 1SB8A 4AJPA 1ARZA 4I8XA 1Q7CA 1EQ2A 2QRJA 3VPHA 2ZB7A 1MXFA 1LQUA 1N2SA 4XR4A 4XIJA 4OKNA 2EP7A 3LF1A 2X9GA 3OECA 1B14A 2HLPA 1KBZA 1DIBA 2HU2A 2VN8A 4PFJA 2WYUA 4JQCA 4EGFA 3LT1A 4RQTA 3F4LA 2NV6A 2Y1FA 1LA2A 1O5IA 1DFHA 3QSGA 5I8ZA 3JQGB 3HSKA 2XXJA 1RM3A 1TT5A 3CTMA 4BV9A 1PGNA 2DAPA 4DMMA 2Q50A 1H94A 4MJLA 3ZWNA 3AY6A 4CM1A 4J4BA 8ADHA 1Y8RA 2X0IA 1LDEA 4ZA2A 4QO7A 3HG7A 4FOSA 3GMDA 3FWZA 3O9ZA 4L9RA 1AGNA 1I36A 2YZ7A 1WDKA 2Y0DA 4FW8A 1JW9B 4RF3A 4Z0TA 1GR0A 1WZIA 4RZHA 1CRWG 8LDHA 1I32A 2WD8A 3E18A 4DC0A 3ST7A 1WMAA 1RM0A 2VHWA 1TVEA 2R00C 2SCUA 1C3VA 3WS7A 1QSGA 2Q2WA 4OL9A 1VL0A 3V1TC 4DRYA 4URFA 1FDTA 3SVTA 3WFJA 2VYNA 2HCTA 3WQQA 4OO3A 1WW8A 4CM6A 4J1QA 1AHHA 4BKOA 1N1EA 1NBOA 4IJKA 3C7AA 3QV1A 3DR3A 1FJHA 2BH9A 4GI2A 2OGUA 5G0VA 1VE9A 1C0PA 3SLGA 1QKIA 4A27A 3ZV4A 2X0JA 5BSFA 5DOZA 1FDWA 1H6CA 4RLSA 4TRJA 4XB1A 2FRDA 1QYCA 3W8DA 2GN6A 1CETA 4L4RA 4E21A 4CUJA 1E5QA 1PS8A 3NGLA 1ZSNA 2J3IA 4RPLA 1VI2A 4ZQEA 5CEFA 1QRRA 2C54A 3LSYA 4RGBA 1LSOA 4MINA 5DF1A 1R0KA 2GR9A 3E6AA 4YDRA 3JQ9C 2PD3A 1G0OA 5JXWA 1YL5A 5CDYA 1Y8QB 3VH4A 2JAHA 4PG7A 1VJTA 4PZCA 4EW6A 4YR9A 2WE7A 2JL1A 1B26A 3NTQA 1MV8A 2AQIA 1N5DA 3T4EA 1YL6A 1E1MA 2Z5LA 2GCGA 2P68A 4IQ8A 2PTGA 2OZPA 4H3VA 2D3TA 4N18A 3HDYA 1JKJA 2O3SA 5K0ZA 3HWRA 3I9OA 3IDSA 3JQDA 3ROQA 4INAA 4PLHA 4CQMB 2NU6A 1GD1O 2ZB3A 2Q49A 1Y8RB 1ZMOA 2ZQZA 2D5CA 4PG5A 4BNLA 1Q0LA 4OOEA 4B3HA 1PGQA 4LMPA 3E82A 4CM4B 1PWXA 3KTDA 1V3VA 1OI7A 3VDQA 2QYSA 3GUCA 2YV3A 1XHLA 4B3JA 5EL0A 2PZMA 4E2YA 2Y1CA 3RC1A 3O8QA 3I9JA 1QMGA 3TZHA 2J8ZA 2VZ0A 3KV3O 4GAEA 1MLDA 3WQRA 2IEBA 4DGSA 1LDGA 1YBVA 4E2XA 4PRLA 2I67A 1IYZA 4PCVA 4BNGA 2V65A 1ZUD1 5KKCA 1O8CA 1EBFA 1U3VA 2FR1A 3C1TA 3F1LA 5EN4A 1Z82A 3VH2A 3KYCB 4E0BA 2CDBA 5GZ3A 3IP3A 1UDCA 1JWAB 2I76A 2QZ9A 3TFOA 2ZKLA 4TSKA 2BELA 4ND5A 1B2LA 5T8KA 1UDAA 2F1KA 3JTMA 3M1LA 3RQSA 3ZHZA 2VTDA 3KUXA 3OQ6A 5IDXA 1QLJA 2J6IA 3PZRA 4QXMA 3GH3A 3K9QO 2ZATA 2GZ1A 5CG1A 1L7EA 1DB3A 5BQFA 1U1IA 3F5QA 3RAJA 3BZUA 2VWHA 3L77A 3GN1A 5I9MA 1U2DA 1ENZA 5LCXA 5JAZA 3EY4A 2EIHA 3WLFA 4E5NA 3WIEA 3DTYA 1P33A 1IZ0A 4B79A 4OXKA 3VC7A 3AM5A 5TNXA 4EI2A 5JSFA 1V0JA 2J3JA 2JKVA 1QYVA 4R1NA 1TI7A 3GOHA 3LYLA 3OHSX 1O94A 4XWYA 4Y6PA 4J9VA 1N9GB 4R3NA 2H5LA 4JJGA 1U5AA 4L0QA 2DTDA 4BO1A 5K6AA 1V6AA 1L1FA 1Z7BA 2I9PA 4M49A 4IDCA 4BNHA 1PJSA 2X86A 5ICSA 4D44A 1PL7A 5G0SA 1F17A 3WGYA 3JQFC 4NBRA 5KVCA 1PJ4A 3M2PA 1LI4A 2Y67A 3AI2A 2DBVO 1U8FO 1Q0HA 2XF8A 1BDBA 2Y05A 4Z3DA 4J1NA 2A9FA 1LC3A 4YAJA 1LSUA 1XLTA 4L8VA 2OORA 4NBVA 3GQVA 1OMOA 4JK3A 2IYPA 3COSA 3RSHA 5I7VA 3KLPX 3U49A 3BHJA 3NYWA 2FY8A 1MA0A 1D3AA 1FXSA 1HTBA 4IUYA 4MOWA 4GVXA 3VTFA 4RCVA 4WOJA 1Y1PA 3DAFA 1MG5A 1WDLA 2ZTMA 1E3JA 3WSVA 5JLAA 1HF3A 4U0JA 3PFWO 1UR5A 4L4SA 1ZSYA 4J0FA 5A06A 5JBIA 5CFZA 2B69A 3ETEA 4IXTA 5JC1A 5AXAA 3JD3A 3WMWA 3GMSA 4PLTA 3RU7A 1MG0A 4J9UE 2Q1TA 3JQAB 1VKNA 4R69A 1UXHA 3IJRA 3CZMA 2NQ8A 2FSVA 4WECA 1Z74A 1QXSA 2X23A 1E7MA 4OXNA 3AY7A 1E3EA 5I8WA 4FFPA 3Q0EA 1G0NA 3I4FA 3GFBA 1IZ9A 1SC6A 3B1KA 4LGVA 5DDIP 5HRUA 2IXAA 3TL2A 2FWMX 4WEQA 5F1KA 1LDNA 5TJHA 5C3MA 5IFLA 3TNLA 1WPQA 1RWBA 4LCJA 2G5CA 4XRGA 4AJEA 3GZNB 1RPNA 3SBOA 2NLOA 1O6ZA 2ZYDA 4IZIA 5AXDA 4RVFA 3WB9A 5JDIA 2GO1A 4JJFA 1UH5A 2DPHA 3TZKA 3TQHA 4I1IA 5KCZA 4ALIA 4OOFA 5JFOA 1IPFA 2B36A 3B1JA 2JCYA 4XR9A 2HO5A 4J16A 1ENYA 4KDEA 1ZK3A 4XGIA 1DC6A 3PI7A 4GKVA 3V2HA 5L45A 2AQHA 4YT5A 4N5NA 3CE6A 1B8UA 4FB5A 4PVDA 1KEVA 4OIMA 2ZQYA 3RBVA 2EW2A 3MJCA 4CQLB 3ONFA 1JLLA 2C2XA 2PLAA 3E9MA 3MJEA 2FMUA 1D1TA 1GEGA 1B15A 1ZNQO 4EDFA 2H63A 2CFCA 4PG8A 5JNLA 3PZBA 4TVBA 1UAGA 2B4RO 2GUGA 2ZYAA 2CDCA 3AI3A 3DL2A 2X9VA 4EEXA 1J49A 2C82A 1P77A 4FPXA 4CQLA 2X58A 4J49A 1U2GA 1IY8A 4JGBA 3P7MA 4HV4A 4QUKA 3K31A 1EZ4A 2H9IA 3GVIA 1R15A 3Q9UA 3AUSA 4BO0A 2RHRA 4A0SA 4EJ6A 4QEDA 1X7GA 3GUYA 5H82A 4F6LA 3LDHA 1KVQA 1ML3A 1CF2O 3C85A 4P4NA 4IIUA 3U0BA 3NUGA 3V2GA 2NACA 3GGGA 4ZQGA 2BLLA 4IXWA 4J90A 2RBEA 1R0LA 2PWZA 1Y6JA 1R4NB 3BIOA 3OETA 3PHIA 4PZEA 3ZW8A 5IDWA 1YB5A 2FP4A 2UV8A 4CLEA 1GFSA 3EDMA 3WLEA 1PX0A 1X0XA 3GY0A 1HSZA 3ITDA 1XU9A 4KQWA 2EW8A 5CG2A 3OJOA 4YCAA 4J2OA 4P4GA 3EC7A 4J1TA 3B20A 3EVNA 1B8PA 3DBRA 4DQUA 4PZDA 3C7DB 2VRCD 3WTBA 4RPJA 3E1KA 3AY3A 3KM0A 3X2FA 3LVFO 1LU9A 2DM6A 2I66A 4IDAA 3PP8A 4Y9DA 3I23A 1DFGA 4MP6A 1P31A 2VQ3A 4CM9D 1P0FA 3AM4A 3LLVA 1E92A 3ON5A 2YY7A 3KSUA 1NM5A 4YPOA 3PWZA 3TJRA 5ILOA 3W4KA 5A05A 1X1EA 1LJ8A 5A04A 4R9RA 5ITVA 1BWSA 1EFKA 3L6OO 2O2YA 1KEUA 2YYYA 4I9NA 3K2EA 5JAQA 3EK2A 1E7SA 4NMHA 1QYWA 1BW9A 5EQFA 2EV9A 2TMGA 3D7LA 1XG5A 1Z6ZA 3DBLA 4ZQHA 1MC5A 1FMCA 3MWEB 1YKFA 4BNMA 4EJMA 2O50A 2NVWA 2VOJA 1EVYA 2D8AA 3Q3CA 4GX5A 3RBZA 3KYCA 3ZGYA 4DREA 2EKQA 2X4GA 3WXBA 3JSAA 1K5HA 3MTJA 4OSOA 1ZFNA 4ONEA 3JQBC 4B3IA 1GEEA 5DNAA 2X0NA 3ULKA 4XYMA 4YJFA 1AXEA 1GTMA 2EJWA 4PGFA 3ANLA 5F5NA 2JHGA 1DPGA 3G0OA 1H9AA 1A5ZA 3EGOA 4UEKA 2H1SA 3UAGA 1HYEA 4K9DA 2YW9A 1X7DA 3UFXA 1BGVA 1SZJG 2VYND 4I08A 4MP3A 2VZ9A 1E7YA 4GVLA 1W8DA 3L6EA 4ZQFA 4BKQA 2WE8A 1SEPA 1NX6A 4LSMA 1TA4A 2YUTA 5JMPA 4CV1A 2JFFA 3QRWA 3FR7A 4LISA 1JVBA 3FF4A 2VNAA 3WGHA 1VL6A 1T1RA 4ZD6A 1KY4A 3GN2A 2ZTLA 2P4QA 2X22A 2Z1NA 3JYNA 3MCVA 3RFXA 2PR2A 2IZ1A 4KWHA 4UUOA 3NGXA 1RYDA 4P38A 4E2ZA 1YJ8A 1GADO 1W73A 1ZJZA 2JCXA 1X1TA 3M6IA 4XGNA 4II2A 4H16A 3KVOA 4YTEA 3D3WA 4QO8A 1LLQA 3AUUA 1BXGA 5G0WA 4Q3AA 4XIYA 3JQ7A 5CP8A 3GLQA 4CV3A 2AA3A 4LMRA 4WPGA 3LLSA 1NHGA 2VWQA 3DMTC 2VOEA 4BO4A 4TQGA 3OFSA 4DUPA 1K89A 4RZIA 1CEQA 3QVWA 4CMKA 5I9NA 2FPGA 5HA5A 5I9LA 3WWYA 4B7CA 1SB9A 4R41A 4BO9A 6ADHA 4FFOA 3VZPA 4NG5A 2UDPA 4MKXA 5DBFA 2FR8A 3I9NA 1N8KA 3UICA 1I10A 4HY3A 3WYCA 1MX3A 1GZ4A 2OMEA 3MJ4A 3PHHA 4PG4A 2J3HA 1NPDA 2JFHA 3QWHA 2QYTA 1UZLA 2YQ4A 4AJ1A 1SOVA 2CMDA 4BGVA 3GDOA 1D8AA 2D2IA 4BGIA 2PNFA 4GLOA 1TT7A 1P1HA 4IY1A 2GF2A 3DFZA 1HLDA 5DZSA 4TMFA 4XYGA 2NVUA 1R12A 3C7CB 5CEEA 1D4FA 5COQA 2Y1OA 5AVOA 2HMVA 3QWBA 1N92A 3IJPA 4MDHA 3V5NA 1R66A 4ALNA 3QJ5A 2GLXA 3OJLA 1UZNA 5TLSA 1A9YA 4E31A 4RF5A 4RVSA 3K5PA 4GGPA 5ILGA 4YBZA 5C5IA 5IZ4A 3ZHXA 5EMHA 1I33A 2YHIB 1T4DA 4GLLA 1MXHA 4JP3A 4LVUA 5KJFA 3I52A 4JNKA 3DZFA 2C07A 1H2HA 3JQCA 5DP2A 2LDXA 4N5MA 1VPDA 1GU7A 2DBQA 4UEJA 3JQ6A 4LSWA 5A9TA 3BTOA 4UEOA 1R0SA 4OQYA 4F46A 1D7OA 3PYLA 3WWZA 5L40A 3TF5A 4CLXA 2RH4A 4DPMA 1SPXA 5JDIC 4BKUA 1HLPA 1EFLA 1GYPA 1F14A 3BMQA 1T2EA 5CPBA 3RJ5A 1LX6A 3H9JA 3HB5X 1WLYA 3T7EA 2GYYA 3DB2A 3PEFA 1OOEA 1YB1A 2B5VA 2ZCVA 1X7HA 4RDHA 5KJCA 4XDZA 2ZCUA 2HJRA 5CEJA 4CLRA 3IKTA 1DRWA 5ES3A 2EG9A 2PY6A 1O0SA 2Q45A 1P44A 3W6UA 1C0IA 3HNPA 5T64A 3P2OA 4CLOB 4IQGA 2PKQO 3H9UA 3QWFA 5IJZA 3MOGA 5CPFA 3FNHA 3ICCA 4Z0HO 1ZVMA 3FHLA 3RWBA 2RHCA 3ENNA 2X5OA 1ADGA 1LDMA 4OSPA 5KNLA 1PIWA 4YACA 5KJEA 1JN0A 1I2CA 3MTGA 1J5PA 2GN9A 2VT2A 2GZ3A 3PIDA 3ONEA 4Z9FA 3UCFA 1RJWA 3WTCA 1U28A 3BMCA 3ZWOA 1SEVA 4YAGA 2VTEA 1O9BA 3C24A 1V3TA 4JXKA 4E5PA 4CM5A 4UVHA 1NQAO 1HZJA 4Q3CA 3JQAD 3WYEA 4RPHA 1NHWA 4MVJP 2QG4A 2C5AA 3GRKA 2PZJA 3WGTA 1EUZA 3BXXA 2AMFA 2ZJ1A 5LC1A 1BTOA 3K96A 3OA0A 4OXYA 1H9BA 4W9NC 1QP8A 4PLPA 4BO7A 1B16A 1B7GO 4FD3A 4AICA 3WGIA 2C2YA 3H9QA 1LEHA 1QLHA 3BHIA 1NQTA 1XKQA 3AM3A 3PVZA 2HMSA 5TSDA 2ZTUA 2NVBA 1LDBA 3LQFA 4CM7A 1HZZA 4S3MA 3VZSA 3NV9A 4J4TA 3LF2A 3PHJA 4LN1A 4TKMA 3KO8A 1Q0QA 3OIGA 3JQ9A 4E5MA 1ZW1A 3C3XA 1P9LA 1SO8A 4HNHA 4DPLA 2X6TA 4UUPA 4NK4A 3VZQA 1NR1A 1PJBA 5JO0A 1E1KA 1U3UA 2V7PA 1NNUA 4H7PA 5A02A 3H9GA 1ADBA 4RVGA 3GVXA 3QA9A 4BKRA 1V35A 2DT5A 4XQGA 4CQMA 4HUJA 5KVVA 4D46A 1G1AA 4BNXA 2OP0A 2P2SA 4GWKA 4NU5A 1SNYA 4UREA 3E5MA 5DULA 2HKIA 1PS0A 1PGOA 4LCEA 2B4TO 3JQGA 1M75A 3PGXA 2UUPA 3G1TA 3HJAA 1IHXA 2ZIZA 3PGJA 4KUEA 2HMUA 4NQZA 5JW6A 1ADFA 4PLWA 1U9JA 2HJSA 1GV0A 5BNFA 5L4SA 3UKOA 5U9CA 3W8FA 1M2WA 4O0LA 4CM8B 1IE3A 1QV7A 4BNIA 1ZK1A 3PDUA 2PA3A 3G17A 3HQ4O 3PJEA 3S2GA 4IJVA 2Y66A 3ZZNA 2FR0A 4TROA 4AG3A 1HDCA 1YBAA 2D5AA 3GAFA 4KZPA 1YS4A 3F1KA 4UVGA 2GNAA 3JV7A 3H3FA 1O95A 2NU9A 4D42A 3PPIA 3DMYA 3RVDA 3WICA 2I3AA 5LDGA 2J5RA 2OBYA 4NFSA 1EDOA 3FRJA 5TIIA 4OMUA 1YH3A 1VRWA 4YJDA 3GDFA 4QTZA 1S7CA 1ISGA 4RV9A 1T4BA 3EYWA 2DFDA 3I6IA 4AJHA 2FZWA 2GGSA 4NZ9A 4E13A 5BSEA 2HK7A 4YRAA 1PWZA 3OMLA 4I5FA 3WDSA 1H6AA 5L53A 4Y6SA 3PWKA 2C7VA 2WDZA 4IMPA 4WCFA 4WUVA 3L0DA 1VLLA 5HS6A 3ZDFA 1I3KA 1SBYA 1ZXLA 2QX7A 3HE3A 4JP2A 3UH1A 1XQ1A 2CD9A 5JDCC 3NJ4A 3FNGA 3O26A 4XJTA 4TRNA 1EVIA 3EMKA 1XGKA 3D64A 1PL8A 4MP8A 4XA8A 1I3MA 1I3LA 3E48A 2UYYA 2CVOA 3RC7A 1YXMA 3AOEA 4OKIA 3H2ZA 1JKFA 2GSDA 5A5FA 1GUZA 1NVMB 3DOOA 3QW2A 1ONNA 1NQ5A 3DZIA 3W4IA 3F4BA 3FNEA 5L51A 4PN3A 3RC9A 1HYGA 2O3QA 4O1MA 3TL3A 1H6DA 1SCUA 4CMHA 1GYRA 2W98A 3JYPA 4R16A 2PFGA 3WSWA 3ZWYA 4D0SA 2YDYA 4GL4A 4ZJUA 1AE1A 1KYQA 4Q3BA 4FJ2A 5THKA 3Q2IA 2X5JO 4FS3A 1C14A 2BFAA 3IP1A 3KBOA 5F21A 3UCEA 3AJRA 3DZJA 1AN9A 2DTEA 4NBWA 5IN5A 3OICA 4BB5A 4CODB 2O3JA 2AEMA 3N74A 1DBVO 2W4QA 4BO8A 2B83A 4IBOA 4KP7A 4NJOA 1C0KA 4MIEA 3HDJA 4NH4A 4GWGA 1XA0A 4I9HA 4MO2A 4J43A 3RUDA 4ALMA 4NNJA 1XSEA
chains in the Genus database with same CATH superfamily
1H2YA 3UK6A 3RIYA 4AKHA 4YO8A 4UNRA 2OHHA 4JIGA 2IS1A 1WUIS 5A7GA 5BWBA 3H0KA 4XOIA 1ZQ9A 2PR7A 1LV7A 1SBZA 4V0SA 4FDLA 2UVDA 3SKVA 1DL5A 2R6FA 3PUZA 2AX4A 4KN6A 3VU0A 4ZAWA 4LOLA 1OWMA 2ZWIA 1PJLA 3ZU4A 3QBEA 1BZYA 2CVFA 2VT3A 4FSDA 1G60A 1RAHA 3FRIA 4F2HA 1Y3AA 3HADA 4BNVA 5AKGA 1DMRA 4CT0A 3AVUA 5FFFA 4PC3A 3C8UA 1MC1A 4Z1MA 4MQEA 4ZP1A 3JWIA 5TV2A 3TI9A 1M6EX 1Z5NA 2OLKA 2QB5A 3G2QA 2B2XA 4HWPA 5J3JA 1HQYE 4AUNA 5SYAA 2QD5A 3TXYA 4EFDA 4KREA 2R6R1 2XF2A 3UOAB 1FTNA 5GINE 1KDRA 2VSXA 1J0AA 4GKKB 2C2KA 1G66A 5SYMA 1XZAA 1ISMA 3T1OA 3CCCA 1IATA 3C3JA 5JG7A 1E99A 3D3EA 2DSTA 1LQ2A 2VSYA 5BSMA 1FMJA 4KLZA 4DIOA 5LFAA 5H68A 4B45A 7REQB 1T9HA 3C74A 4AQ7A 1SXJA 3R5TA 4WBNF 1P1IA 4ND2A 4BGDA 4L9SA 3THYB 1L7OA 1ZW6A 3BAFA 1Y6FA 1A27A 2Y71A 2YJGA 1LX7A 1VIMA 4XD2A 1YDHA 1N33B 3FI9A 3UMSA 1V1RA 3VMMA 2R97A 2A67A 1Z28A 4JGGA 3V8RA 2H52A 2O8VA 5JYBA 2X7JA 3CF4A 2YS7A 4OHPA 3GRZA 1EVJA 4G1UC 2N47A 2PZKA 4ZYVA 1DRJA 3R8CA 1KGSA 4D3YA 3NTXA 1NUPA 4FNOA 3P9SA 4WK2B 5E2BA 2G1KA 2Y99A 1SU8A 1Y8CA 2OECA 3TRHA 1E0AA 1Q2UA 4PQEA 4GEGA 4Z86A 5CJ2A 4BGEA 4EARA 2KS6A 5DNDA 2PXAA 1KP3A 3DVLA 3O75A 1JHVA 4HLNA 2AXEA 4BX3A 1UXOA 2IH4A 3VNVA 3T9EA 5TJ9A 1IPEA 3NRCA 1KK0A 3FDJA 4L5CA 4BDTA 1NWHA 3WHIA 4BV3A 1O6GA 2HK6A 4ARZB 3O8NA 5A3QA 2E4VA 1BHSA 5LU9A 1X1RA 2HWUA 5AHWA 4NFLA 4IYRA 1II8B 1OAOA 5LA6B 3MEQA 4JR0A 4JODA 4B73A 1FK8A 3OZAA 4G0UA 1P1RA 4M76B 3KPVA 1I01A 1RYEA 2WWWA 3MQ4A 5K0NA 1ZWLA 5IN4A 5KYXB 2I1LA 1HOXA 2DBRA 1I2ZA 4IS3A 1XEWX 1PUIA 1E1CB 2NU7A 2GPNA 4M89A 2B4AA 3I0ZA 3HCDA 2N46A 4NX2A 4RK7A 4TRMA 3IT3A 2WIJA 3A70A 4EK9A 4MPPA 4QLBA 2QN2A 4AP9A 1Q1BA 4AK9A 2BKEA 4MVJG 1B0UA 1ZQ1A 2EZ4A 4X64B 1EVKA 2PSDA 3PDCA 3L49A 4TKLA 4KV7A 4P93A 5IVPA 4E11A 5LQAA 1NVUQ 1RHJA 2CHVA 1Y1KE 4PW0A 4QXAA 1V9LA 2WU0A 4XB6B 3PUXA 1LNSA 2YXBA 5G2OA 4EUHA 2I1QA 1TOAA 3WB2A 4BUZA 5CDUA 3CR7A 1SAYA 1F9AA 1KETA 3I09A 4IMIB 4LJ6A 4YMIA 5HPYB 2QUZA 2YMQA 5CM8B 1B23P 2YWXA 4EQ6A 1ADCA 1FX0A 1H8ED 4RPIA 5GOTA 4S2EA 3QE0A 1MO5A 2WQ7A 2CSUA 2ZSEA 1MOSA 5CAEB 1IWPB 1IZ7A 1ST2A 1BHJA 3OO1A 3QKIA 5JJBA 2JBAB 3GLFA 1ZM3A 3R0VA 1KC1A 4YXWD 1BFKA 1L5SA 3ITKA 2D1YA 1II9A 3ND7A 4EPRA 1TTQB 1XFDA 3E9RA 3WR5A 3HJRA 1K88A 5EJ9A 1O2DA 2ZI6A 5JSZA 4JYZA 2H2GA 2EBFX 3BXFA 1G5FA 3HI6A 5IANA 3GDHA 4GKJB 3IS3A 3HCCA 4IINA 3CC8A 5DVZA 3STXA 2VDMB 1R2QA 2DKNA 4A4DA 1LW6E 3FTCA 1BRMA 5FA6A 1LTHR 2OFPA 2E87A 2WTAA 5A9SB 1ISJA 1GY8A 1OGJA 4INZA 1GGEA 3ZY5A 5CVCA 3GJSA 3GLHB 1J0CA 1ZJ6A 4I19A 4BV8A 2GCOA 1GKUB 3CCBA 4CKBB 1F38A 4HAOA 3RVOA 4CLRB 4KQXA 1NJ8A 3T0FA 3W05A 2HRZA 1N7HA 3PD0A 3T0GA 4JXZA 3PA8A 3R3JA 4M0PA 3RBAA 2I6FA 1MQSA 1NSFA 2KBFA 1VPEA 1VHQA 1TM2A 3G7NA 1OWNA 2G70A 4GRIA 3W7VA 1VSVA 4ZYXA 2H65A 3VTKA 1R8YA 3RR2A 1G9TA 2WVGA 4DUGD 3KXDA 4C0KA 3EZ2A 3HABA 4IJ6A 4B87A 7ADHA 2I62A 3GHYA 3GF4A 3HJGA 2ECKA 4MVJI 4NV0A 4OJNA 9LDBA 2DLCX 1VJDA 4MRNA 4U2KA 2GFIA 3OT4A 5EHNA 4BC0A 1HMPA 4L50A 5REQA 1T2VA 1AUPA 4QGFA 3ANYB 2PZLA 2CNWD 2VTKA 5BSHA 2PA0A 4DOMA 5K20A 4Y7DA 1IB6A 2GEDA 4H7IA 3S2FA 3HU2A 2I0FA 2LGJA 1A7UA 4IAOA 5ALXA 4X1KA 3VR0A 1NXVA 4NBNA 2Y1GA 1YI1A 4L8FA 4HEHA 4CQMD 2JIDA 4FT4A 1WXDA 2NTJA 4QBFA 3NT2A 2H2HA 4O3MA 4EPVA 2PVCA 4MR8B 2K2QB 5JQGB 2ARKA 1AKYA 1M66A 2AV6A 2F2TA 2GH1A 3KQYA 3DTVB 3F5SA 1P18A 3O1IC 5T6BA 4WZAE 5KNDH 1HT0A 2CLCX 2HJGA 3OE5A 1MENA 3KU4A 1CQIB 1VL8A 1UZAA 2FPIB 2ESRA 2CXUA 1ZD8A 4DLWA 4UTVA 2O59A 2QRVA 4LI3X 2JW5A 2MYUA 4PG6A 3E3MA 3L8GA 3T5TA 2VBFA 2NUPA 4C7BA 4HNUA 4C1BA 1T1SA 3HXQA 5G4KB 4JI0B 2QV7A 4QWWA 2CNOA 2FI1A 1XZ8A 3UA3A 1DX6A 1RWPA 2K4MA 1K9VF 1JYFA 5FUBA 4PSVA 3RVRA 2QAJA 2ZXEA 2VUSA 4AY2A 4RYDA 4GBGA 4GMDA 3WA6A 3ZGLA 4RDXA 1Q20A 3LS2A 3GFQA 3LKDA 5B1SA 3TWOA 2IEIA 3PUWA 1W581 3WLEA 2HCJB 4DV2B 2YZGA 1D2CA 3B2QA 1N4AA 3ZN2A 4WQMA 4OM8A 4CV0A 3CVXA 1B93A 1M5UA 2PSSA 4D4KA 2OSVA 3FUCA 4NBKA 4RQUA 4QHTA 4UOEA 4AZWA 5IDQA 1RWWA 3D4BA 1SQSA 2YVQA 4QG3A 4LHWA 4YJ2A 4M8SA 1HDGO 3H5IA 3V46A 4N1AA 3VSDA 4C7KA 2XXBA 3ESZA 4PWYA 4ESOA 1T5DX 2IE8A 2IKSA 3CJTA 2C4KA 3I1YA 2IZ6A 1C9JA 3HN6A 3NANA 5LMCA 4MQFB 1YMQA 1I8TA 4KIFA 2OHFA 4IJWA 1IEVA 5A3RA 3RROA 4P1ZA 1E2JA 1VMAA 1YSCA 1Z73A 2CB0A 2G67A 4W7IA 4DUGA 3FJ1A 4K6HA 1USGA 5FL3A 2I7XA 5GIOE 2RH8A 1UBFA 5D3KA 1JDSA 3G5LA 3OUTA 4I1VA 1LF5A 4JX8A 4L6IA 1H8EA 4FP9A 5L6MB 3OOYA 2Y9MB 3EQ7A 2AHRA 2IW3A 4HR7A 3BCRA 3RRNA 4FS8A 2KJQA 5HILA 2RAUA 5IAJA 4IIVA 3PIRA 1Z33A 1G19A 4CIVA 4NXNB 1C9MA 1MIOB 1BW9B 1TD1A 5IC5A 9MHTA 3B1YA 3K92A 2C99A 3PCXA 5JI2E 4F2WA 3ORSA 3VO2A 2A1IA 3OE1A 4HQRA 4J3NA 2FE4A 3PI6A 1HEYA 3MJFA 3R7SA 2O1XA 4UXHA 4ZREA 5DHUA 2PX2A 2ZSUA 1H2BA 4JSTA 4QUDA 3TSYA 4A5OA 2PD6A 3F5MA 2BOVA 1I5OA 3DF9A 4ZHQB 2QTNA 4DSNA 3ODPA 1Z26A 1C7JA 2LBPA 2Q6LA 3CM0A 1F2DA 4YMHA 5C4GB 1VTKA 3GRRA 1FP1D 4CL0A 1ZSVA 3AUTA 4P7JA 4KNVA 1S4MA 3RS3A 2QD1A 2ZVQX 2NZ8A 5KJ1A 4EHBA 5E6RA 2Q4DA 4ENWA 1NVGA 2RI1A 1KMHA 3LYUA 1CQIA 2HTFA 4P82A 4DLLA 2EJUA 3VXKA 1RHQA 2VCHA 5ELLA 4AECA 1YIAA 3O3CA 3TJZA 2BHTA 3ZKAA 2EZ9A 2YV5A 4YRRA 1E61A 1IEXA 3NC0C 1GRVA 3D02A 1PGPA 1GYQA 2LD4A 2D54A 4IRUB 5FULA 1A5TA 3KNZA 4HYTA 1PR6A 3MS2A 4A73A 3W5CA 1N2HA 5FTMA 4D97A 4D8YA 3E9CA 4QPCA 3INRA 4RGVA 2HW8A 2EW1A 3MB5A 2ZUTA 3UT0A 2A6PA 1A9PA 3NWJA 5FTKA 1YQ9A 4IIFA 1UBGA 1F8FA 2PBZA 3GLRA 4I55F 4YJHA 2ZJBA 2DQ4A 2O20A 3AY0A 4F93B 1E2EA 1X39A 3KWLA 1DIHA 4X6XA 5ENZA 4WW0A 2ZEJA 4E08A 3BGVA 3SSOA 1U0GA 2WZBA 1NFRA 1JFVA 4LV5B 3V4OA 2PXXA 1GKIA 3DKKA 4PHTA 1OXTA 4AJ4A 5GJBA 2M1XA 4N0MA 3BF8A 4HQKA 4ID9A 4EG6A 4YGXB 4CQMB 2FFRA 3K0AB 3FCUB 1M34E 3K6JA 1MZVA 2BFDA 4PSAA 4JLSA 4O33A 5FUXA 3T7CA 4AJIA 4GOKA 2RH5A 2ZIVB 3S8YA 4JC5A 2G04A 1KJJA 3FVTA 2AOWA 2XCOA 2SICE 3A11A 1TTTA 3IAHA 4YDQA 2CDNA 3KLMX 3L07A 1XDWA 3K70C 1JILA 1M7HA 3O91A 3HKEA 1L5FA 1KOLA 2I3GA 3TR6A 3GPLA 2D2EA 3GLGE 1XL0A 3D0QA 4BO8A 5JQGF 3Q3VA 1Z0UA 5F5LA 1G3RA 2C5BA 3RVLA 4AJOA 1ADYA 1GZ7A 5G02A 1K8YB 2YFKA 1U3WA 4X84A 3ZG6A 2NNWB 1VLHA 5GQSA 3ZKWA 2ZPTX 4ZU1X 1W96A 4BQOA 3GRPA 5JZVA 1FYEA 1I14A 2DFLA 3IT2A 3OY7A 3A4TA 3PFHA 2OE2A 3N7AA 5DO9A 2R3SA 4B4UA 5B7NA 5K01A 1MKYA 1K6JA 1JHYA 2I6TA 2Z2ZA 2FFJA 3GJ0A 3OEHA 4W5TA 2IU4A 3I62A 4YT2A 1ZG3A 3PHBE 4R8RA 1XCLA 2WJVA 4DE5A 2PGLA 5EZYF 2FOLA 2WA2A 4TOIA 3KT3A 1UDBA 1TM4E 5FI5A 1DAEA 1JHXA 4EY8A 1SM4A 3FX2A 2I4LA 1E1LA 5ECWA 2PDAA 3S4YA 4BJ1A 5ITWA 1E6UA 1PDOA 1AZWA 2WTEA 2BTEA 3P9CA 4D7AA 1FSPA 4KSYA 5LYJA 2JG3A 4G67A 4NENB 2BIFA 3E5HA 1XB2A 2VP2A 3F9RA 3GNLA 3LWZA 4ZRNA 4ZVUA 4BB6A 1G18A 1WW3A 2R44A 2O1EA 1PZGA 4DIBA 3U1BA 1A4IA 1KKLA 3PUVA 3AKDA 3IMCA 4OP2A 4RH1A 5AW5A 1K6XA 1QK4A 3L46A 1L8LA 1N5OX 1RHMA 2P3QA 4HDNA 2L18A 3EXFB 4XSGA 5L7WA 3AUFA 1L4GA 2EF1A 2BMAA 3DONA 4RF4A 3JVIA 1MIOA 3BORA 3Q6IA 3UFBA 2VH1A 3LOQA 1L7NA 4P6VF 5F1PA 1HDOA 4NFYA 1Z6GA 3IIKA 1I4DD 3HDQA 4LSZA 4JZKA 5I7RA 4BO5A 2ZE5A 1IOZA 1LPPA 2YV1A 1PF7E 1RWOA 3FZQA 3N28A 1K75A 1RI4A 4NDAA 3U3DA 2Q1XA 3RS2A 1ZOLA 2V0NA 1VPWA 3ILHA 1R4MA 4NP6A 3ZXUB 2IQ5A 5LU8A 3N58A 3C3WA 10MHA 1Z88A 2VWPA 1JMKC 1RNLA 3N6RA 1E2LA 4LDQA 1W2HA 3O95A 5HZGA 3HJUA 1O9GA 3BRWA 4D56A 3PHLA 1BKDR 1G55A 1V5WA 4KTTE 4HBZA 5D7NA 5KJ6A 2PT7A 5K0SA 1QB8A 1G64A 3KD2A 4K9PA 3A6FA 4LHEA 3ZHOA 3NLLA 5E2IA 1CJVC 1QHXA 5EJ5A 3TO5A 2F1IA 4B5LA 2PL3A 2RI0A 1ZK0A 1MT0A 2Z57A 3B6ZA 4JELA 4QPZA 3IP9A 3WJAA 4AKIA 1VG8A 5ED4A 4H1HA 1KYTA 1LGYA 2GYUA 2O2DA 3DBRB 1V37A 4Z7OB 3L7AA 5FI0B 2AFHE 1IIBA 5ALFA 1RRCA 1IHYA 3DYIA 1Z2PX 2WWFA 3WK4A 5BNTA 4FFBA 3ONDA 2NTEA 4QDZA 3ESAA 3VKUA 3VU8A 1E7RA 1TF7A 2XMSA 1AV7A 1EPUA 1NX9A 2XIJA 3D1JA 5F12A 3RASA 4A6DA 4ZI7F 1BH2A 5AESA 4L57A 1P4HA 1JQJC 4UBIA 5CFRA 4RGQA 4I4TA 1NURA 1N0VC 4YRMA 3CPEA 1GDDA 1KMMA 3RNOA 1XTRA 4ND3A 1R10A 3GFOA 2P5YA 3CKLA 3AZPA 3P4XA 4CQJA 1UBEA 1LBIA 1B74A 3DLIA 2ZXUA 1MV5A 3TRIA 5FPQA 2QM7A 2Y77A 2YFHA 1X80A 3HU5A 2MJLA 5ALHA 1TUGA 5FAXA 1CJSA 2QIPA 2QVLA 2IELA 3O8BA 4RPKA 4R0MA 5EXDA 5LJLA 1Q92A 4FYIA 4TRRA 1X7WA 3A26A 3SEQA 1T13A 5CVEA 5K4HA 1ORVA 4MQ4A 3QVOA 4INPA 4KI0A 3V7NA 2P4HX 2BZGA 3B82A 3DLPX 1QHIA 3EXG2 4L22A 4Q3OA 3RUHA 4HJXA 4AG5A 3IILA 2Q5IA 2GJSA 3MJHA 5KOHA 2IBTA 5KAMA 5KQSA 2BFDB 4E2FA 4P32A 2XY4A 3HN2A 3DPSA 3SX0A 4HAUA 2C4NA 3R5SA 2HLDA 1C50A 1FTWA 2J5QA 2F90A 2PH3A 4G65A 3SC6A 4BQFA 5KIAA 4GVPA 2KLBA 3AUXA 2GZMA 4ZYWA 4ZZ1A 1GTG1 1N0UA 1UPFA 4EHNA 4YYZA 5B6PA 5K8VA 2JFYA 1Z07A 1DIGA 4K0RA 1IM2A 1KEPA 5J5VA 3SX2A 5ICMA 1W76A 5IT4A 1Q1GA 3A6DA 2PVSA 2HD4A 4EFLA 2XOEA 1SKMA 1HE4A 1T2DA 2YJTD 3B1XA 3EFBA 3G23A 2HU7A 4O4JF 2YHUA 4M1SA 1TD9A 1PRYA 1ZA2A 3HN7A 3CXUA 1Z62A 2J9FB 2XBLA 3KT8A 1J9EA 3DEAA 4QJ5A 1E0JA 5BSUA 3ZE7A 1DAPA 2VF8A 3JYQA 4FCWA 4EB6A 1DC7A 4ZYTA 1RRMA 2C7BA 2QUIA 3UPTA 2AE1A 3UMBA 4DVGA 3R8FA 5CYPA 3AV0B 1XTUA 2WDPA 1MAVA 1GNVA 5EUMA 3WYAA 4E46A 1RP7A 4NOKA 1FA9A 3WLIA 2RHDA 1UXGA 4DLVA 1SR8A 3JQ8A 3CIFA 4LXXA 2Y1DA 4OVKA 1XNQB 3LK6A 4Z4IA 2P9BA 2XMGA 3H11B 3DM5A 2GO7A 3K94A 4XWKA 2CYAA 1ZVQA 4MR9A 2KSQA 3E35A 3TSCA 5C7OO 5A4DA 1IVSA 5AHKA 5DWVA 5JS7A 4GNKA 2YZKA 1J1ZA 3IDAA 3LHKA 1GNRA 2IYLD 3LPLA 2AR9A 1IN7A 3GCDA 2BKUA 4C3VA 4CIYA 3CRQA 2ZFUA 1ODKA 4M8NE 1Q50A 5KTSA 1I1HA 1XIVA 3LXMA 3O4FA 4JR1A 3W5IA 4L75A 4V0QA 4BFXA 3RAFC 2ZJZA 4HDSA 4GPD1 2C77A 3H1FA 3NOQA 2F59A 4NS4A 1F2UA 1IN5A 3HZZA 1P5FA 1U9ZA 3JAKA 2IYTA 2VUUA 5HWSA 1THGA 4XUEA 4FWIB 3QUBA 4AP5A 3RVKA 1A7KA 3A4NA 5HIAA 1E3SA 1BXKA 4TLEA 1Z6TA 4UDYX 4E51A 1E4EA 5KYWA 1YR2A 1C7FA 3EA5A 2QYOA 1FP7A 3AW9A 3LA6A 3LMKA 4I3GA 3ERCA 3PR2B 2DHDA 1DIRA 2FDXA 1OT5A 3ZZTA 4FVTA 2BEKA 2Z8YA 4WE3A 4RF2A 2H9AA 2YIJA 1R0ZA 3V4LA 4HDKB 2JKYA 4AO7A 1BSVA 3B6JA 3OQIA 2WWRA 1NI4B 2ZI5A 5DI3B 6LDHA 3QQPA 2OOSA 3EXHC 5ECGC 4DIMA 5BWCA 2H16A 2HPAA 4FCCA 3AERB 2WY2D 2ZRLA 3UXMA 4ZN6A 2X2PA 2XCUA 2X0KA 4PYQA 3IQHX 5BQXA 4P83A 1NQXA 3TW8A 2IK8A 3OM9A 3EEFA 1OFUX 4FKZA 2VPZA 4G09A 5T3UA 4DLAA 3STHA 4IS2A 2FEWB 5HQ3A 4FFRA 1GQYA 4IUCS 4RIFA 3HCOA 5CX1B 2C9OA 2IUFA 5CT4A 2P0YA 3JZAA 1KQPA 5G1PA 4WAUA 1NXQA 2G36A 4OQDA 2H57A 2IXTA 1EP2B 1JWBB 3RDPA 2Q2VA 4OI4A 4TYQA 4EB8A 5A9SA 4YB8A 3JWGA 4HUTA 1O54A 2PFKA 1UC9A 1PT7A 2I54A 3F7TA 3FFAA 4ZVNA 4B2YA 1W87A 4JOSA 4KPEC 4B09A 3DMPA 2HNAA 4NYIQ 1V8FA 1H5NA 2WU4A 4P53A 1HDEA 2IDJA 3U7JA 4LC9A 3QENA 5JQGA 2RG7A 1Y63A 2IP4A 1C7IA 2NM0A 1KPHA 3IRVA 2GHIA 2WSSA 4XM0A 3UYLA 3A9VA 1XRQA 2GTHA 3ORFA 3H4VA 4KIJA 3KJNA 1SVOA 3HY6A 4G24A 3RS8A 1GL7A 3NG1A 2P91A 3X1MA 5A2QA 1X8XA 3EN0A 4H7DA 2EG5A 2VHQA 3NYIA 3M49A 4PLVA 3N2EA 3PA6A 4CIDA 4AJKA 2D1TA 1NM5C 1ZJJA 2ZJ0A 2AOUA 4OGGA 5B5SA 4JBYA 1FE8A 3EZNA 2P3SA 1A4UA 5BRAA 1JJAA 2X9NA 3ZNQA 5KX5F 4IHJA 2E3JA 1GUDA 2IY8A 2B82A 5LP6A 3F6RA 3EAGA 1JLHA 4KQFA 2BUAA 4F4IA 2JD0A 1CX9B 1YDWA 2O14A 2QUJA 2R25B 2V97A 3G2OA 4R8KA 2HFKA 1EDDA 1PHRA 3BEDA 4X41A 3T5AA 1PU2A 4BN4A 1WPGA 2JLAA 4KSCA 1V43A 3F9CA 3BA1A 2DRIA 5DLEA 1Z75A 2FZEA 2HSZA 2XUOA 3KOXA 3QE4A 2JIMA 4DLYA 3ZWAA 5F1YA 1K4YA 1B8NA 1KIFA 5K6AC 4IFTA 5K8LA 3CMCO 1ONPA 3GEIA 4B35A 2ZUVA 3LGSA 4L85A 5JYCA 4EUFA 5HSGA 1NF9A 4EKEA 3N59A 4ZICA 2QRGA 3T9CA 3GD7A 5HR5A 5KKNB 4CEHB 5EHGA 4B7ZA 1OU0A 3NCHA 2VYVA 1NF8A 3OJEA 4NJMA 3HBNA 2QTVA 3QEJA 2ZSIA 1K5GA 4OLJA 1AQIA 5DXAA 1TU4A 4Y2PA 3PQ2A 1JG1A 4BLQA 4DCPA 3EPJA 2X1HA 1WCXA 1XRNA 4HGRA 4M46A 3G2IA 4O4IA 3GLFB 3GT3A 1PZEA 3AFGA 3OEHD 3QU4A 5EJGA 5DTEA 1ODSA 3SJZA 1P0QA 5HNKA 4G81A 3ROXA 1NVVQ 4MUBA 2OFXA 4MR8A 4RMGA 4H15A 5C5EA 4CU5A 1Q7BA 1UXIA 1ZK4A 3TDMA 3ZWXA 4Q16A 4A0FA 2H1RA 1UT8A 4JLBA 3AMVA 4GYWA 4Q12A 4JI5B 3FYCA 5I5EA 2W8BB 1RWMA 2HI0A 3AESA 3W1VA 2J9ZB 3KEGA 4J0CA 4MQMA 4RK6A 1M33A 3KLOA 3MWEA 3S44A 2GBLA 3SSMA 2ZM6B 1X9HA 2HZBA 3L6UA 3WHLA 4N5LA 2XZDA 3KJQA 3ETLA 4W5QA 4U7JA 1AXGA 2R60A 5ALVA 4CTKA 4FILA 4EZBA 5HTOA 4HDSB 5HIJA 1D2AA 3FCAA 5BR8B 3QEKA 4HTFA 4FN4A 3CKKA 3Q5EA 4L0DA 4RVNA 2EJVA 3EG9A 3H83A 1G3MA 1OXSC 3CINA 4X95A 5CHEA 4ARZA 4DRZA 2BMWA 1W49A 2GDZA 3F6YA 1XVLA 3ASZA 1FFHA 1T4GA 2V1XA 3AH8A 1ORTA 3HCNA 3FROA 1GL3A 4YP6A 3AJ9A 3NUZA 4MPDA 3AVQA 2JGFA 2WWHA 1FU7A 5F3RA 3W7AA 4Z6KA 3T3NA 3ADPA 5D2CA 1M3SA 2AI3A 5ERGB 4D9EA 1HDRA 3CEAA 2O8FA 3SE7A 2B5OA 3JQ8B 1G5QA 3KZMA 4JC4A 2ZIGA 1UFQA 2W42A 5C8DA 4CLHA 3GRVA 1CS4C 7MDHA 1GZHB 1FTQA 2C00A 5EEHA 2I8LA 4OQLA 1EFAA 4IHJB 2ZLBA 5AI8A 2P11A 3H9CA 5TMBA 4A2WA 4XSVA 3OWXA 5KOJA 2SKCA 3FHTA 5BVHA 2AG0A 1WP4A 1BGWA 4JENA 3U3XA 2BHSA 2E49A 3F47A 3EZ7A 2GM3A 3ROFA 3SKXA 1ZJWA 1KFBB 2C4UA 2L19A 5E7JA 1YDFA 1GZ6A 3O0TA 4Y6RA 1TEZA 5CVTA 1XVAA 1ZOOA 1JXMA 3BGOS 2NYUA 3C70A 2JAOA 3VPFA 1G6KA 4G84A 4AJLA 1DJQA 3DBVO 3L8FA 4JOBA 4D3SA 5KPJA 4NCHA 4YAFA 2OBNA 4LDZA 4B82A 4B2LA 1QNLA 3OKPA 2XB8A 3RF6A 1JE1A 1CUZA 2XV1A 1XZCA 3G13A 1QIFA 3NTOA 4WZBA 5D3MA 1LJLA 4Z9BA 1ABEA 3I30X 1B4DA 2IX9A 3C3CA 3PR1A 2W6IA 2J7KA 1P73A 3BFPA 4NYMR 1U5BB 2I6QA 2O6LA 2FCAA 1KO7A 4QATA 5H81A 5GJVC 4PO9A 4GXTA 4A7PA 5K5EA 3EHDA 1YTUA 4CG0A 5H4GA 1QVZA 4FUTA 4YH1A 3D8HA 5EIFA 3UJ8A 4CPDA 7REQA 4XDHA 5K0JA 1ZC3A 3B1VA 3U4HA 4BMPB 3MZ0A 5AM0A 2GM4A 4XGKA 5B4VA 3A37A 3S7ZA 1AX9A 2C5SA 1LK7A 1ETUA 5F3WB 3L4BA 1MAHA 4UPDA 1EX9A 3DVSX 5JAOA 4HXYA 3ZNPA 1ZMXA 1DBSA 1JTEA 4ZDJA 5LNK1 4MUAA 1J8DA 5G40A 2RSLA 4E5UA 5HZHA 4RHCA 1V8DA 2DPYA 3TNYA 3MMNA 2ZW9A 3IP6A 3FDFA 1HZZC 3L7JA 2ODEA 4LHVA 5EMNA 1U8CB 4B4WA 4TVKA 5C51B 2I6UA 3CRRA 3INNA 3NVKI 4YY3B 4PLYA 2R84A 2CXOA 1PSWA 1ZVVA 2P5SA 1JKIA 1SXGA 1N0IA 3C6ZA 2XAAA 4CIXA 3DT8A 3FAKA 3T7JA 2M1ZA 1NNSA 1KAHA 1KC3A 2DT8A 1EQUA 4P54A 1Z8FA 3EIQA 1J5XA 5I7UA 1XJQA 3EPRA 4ENRA 1RQLA 3CLRD 2WLSA 2F55A 4YN3A 4CWAA 1XMIA 4WSOA 2R5NA 1YE3A 2J0QA 1BJRE 5DSTA 3KJGA 1Z34A 2XUHA 2E4WA 2ZWVA 5HG0A 1K08A 2Q6OA 1KARA 2WD7A 4DCNA 2OCBA 1XPUA 2WABA 1C1YA 2E7ZA 3QG5A 1Q1QA 4QJ4A 3VR1A 1AD2A 2ZRFA 1D4ZA 3W2IA 1Y6QA 1A8QA 1XD9A 4TS1A 1BC5A 1HDIA 3FVVA 3DZGA 3SC4A 5JMWA 3V1YA 5KQPA 4OATA 1XZPA 2WJPA 3GROA 4YECA 1QIDA 3U3MA 1CDOA 3ROMA 1PEDA 5BVGA 6YASA 1PL6A 1XPRA 4PC1A 1PNRA 1LNQA 2PGOA 2BHRA 3ETNA 3NJ8A 3T41A 2FGJA 1W85A 3MBOA 1LPOA 3K4PA 2GD2A 3O1HB 4GYKA 4UAUA 3X2EA 1U63A 4NAHA 2AWNA 5JY1A 4NYMQ 3J7AC 4IOMA 1T5TA 4ZQCB 3BSFA 4BWFB 1T9AA 4ZOLB 1IBSA 1XOIA 4HN9A 4K6FA 2QRKA 4WFKA 4BYGA 4QDOA 3DE7X 1FFXA 2BE9A 3BMXA 3OU7A 2JFPA 1DG9A 4TKVA 2EHDA 3CNNA 2JI4A 3H5OA 3TYXA 5HUQA 2FJPA 3G3EA 2C78A 1CHNA 4ACBA 1SUAA 1UKCA 4CV2A 3N6VA 5LQUA 1XQ6A 2ZRCA 4YRDA 1YRLA 3PXXA 4Z2YA 5C31A 1QU3A 1SUFA 3QY9A 1W35A 2BGRA 5D5PA 4Y2QA 4LTMA 4DMFA 3S99A 1A8IA 2W2LD 4ZOAA 3TRJA 1SCKA 3PGA1 3IKLA 3B51X 3WX0A 4DJJA 5KSYA 3Q8LA 2NV0A 4RSRA 2GK6A 5E6UB 2F8SA 3M1IA 4EHAA 5JISA 3BWEA 5EMLA 1NASA 1L7XA 3SY8A 3WRXC 5DHTA 3FTEA 4K87A 3H4MA 2ZYGA 4I50A 4YRPA 4PZPA 3RFCA 2HUNA 4OB6A 5CDTA 1LQTA 1E79D 3Q85A 4RELA 4F84A 2ZB4A 5F4BA 4KQ1A 1Z45A 2JEOA 2Y1WA 3HHEA 1VYVA 2XMZA 5EESA 3FPSA 4XFDA 1FQKA 3N2IA 3QG1A 2P77A 3M33A 2DECA 4JA0A 4OHCA 4QRDA 3TL6A 4BO6A 1F5SA 4WEOA 3B36A 3EQ2A 5KBYA 1EG2A 1TEHA 1OZAA 3WAGA 3W5AA 1YBMA 3ND6A 3UB2A 4B6FA 3IUPA 4BOYA 3ADOA 1G8HA 3JPWA 1THMA 4QDKA 3VHQA 4RVHA 5L3QB 2JK1A 4ZT7A 1KWKA 4WZ6A 5ELXA 1HE3A 3FBTA 1Y4AE 3Q87B 1N5KA 1OBCA 1GN9A 4GPEA 4HTAA 1QFZA 2JLXA 3KHTA 4R1QA 2E48A 4UQLA 2PKCA 2VDJA 4CKYA 4WXHA 1K6EA 4B7XA 5AJHA 3NMUF 1I2AA 1O95D 1ISIA 3EA4A 1NBHA 1W6UA 3IKJA 3V9PA 3M6FA 4UBLA 4X20A 3W9SA 4LE2A 2GRUA 4P33A 1IULA 2AMYA 1UAAA 2FAXA 2FX2A 1T9GR 4ND1A 2C0QA 1O89A 1KWGA 1JKMA 4B3TB 3ANMA 3QVXA 1YL7A 4GSLA 5CT8A 2FUG1 3GVHA 2QSJA 3EMVA 4C2UA 2PZFA 4UDOA 3EHEA 5TT0A 1U2PA 4HGOA 2NU9B 2C1ZA 2H29A 4YUYA 4FQ8A 3FSJX 4XOUA 4HO1X 3K8QA 1BVYF 4QGHA 2ZBFA 3RFFA 2EXXA 1TK9A 4G01B 4Q34A 3NNNA 2IC5A 1KU0A 2YMPA 3QH4A 5I9TA 1EIZA 5DYYA 2JHFA 4I1SA 1MDBA 3RHSA 5ES4B 4NV3A 4NH0A 4V1CA 3D5TA 5FPKA 1XEFA 1BN7A 4CCWA 1CUBA 1XVUA 2Y68A 4DDVA 4KITB 1YE8A 5EXPA 5FUMA 1OUMA 4TXMA 3NEJA 1WB4A 1NQUA 2JFNA 3OD1A 4LX0A 3WJ2A 3U4DA 2E4AA 3QUTA 4QREA 4UXIA 1Y5RA 3WLMA 1G63A 1DAMA 4L8LA 4NRDA 3V97A 1DKMA 4RHTA 2OUKA 5KMGA 4N40A 1LLCA 4RS4A 1XPOA 1A2KC 5J2UA 4H1WA 3TUJC 4QOEA 3VU9A 2BM0A 5BSVA 1EMDA 4CMBA 4MW6A 1HM5A 5EERA 5E6UA 2CV1A 3HRKA 1QIKA 1YQDA 2PBFA 3KYDB 3QVTA 1G6OA 2X14A 3UAVA 1L0BA 4DPKA 2ZJ7A 3B52X 3BHMA 3N7UA 4C07A 4UEWA 1TVKB 3G0HA 1VDMA 2IZZA 1NFFA 1NW3A 1RABA 2CJFA 2JLCA 1G5IA 3MQFA 3HXKA 1Y1SA 3HYCA 4OHUA 1XA4A 3NHWA 3PNQA 4XQEA 3SZOA 5TF0A 1NN0A 1ECFA 1XTJA 4F72A 5KVSA 3A14A 4XJSA 3FB4A 5WRFA 4AJ9A 5JARA 3DQQA 1CLEA 5P8WA 4EECA 1JBKA 1ZP6A 4E6PA 3IULA 3EPKA 3IURA 4FBMA 4WKOA 2AC4A 4BCCA 1TKAA 3FWKA 3AFOA 5JVDA 5B4UA 1B43A 2WG0A 3AEUA 3QWIA 1MQAA 2CGEA 3C3EA 3LDGA 1AIPA 4TM8A 1A5BB 2BEWB 3GU3A 2DJ5A 4HXGA 1XZBA 2VHVA 4UJ3A 5AVTA 4C21A 3FIUA 1WAMA 3AIMA 3KYIB 4G5SA 1QAMA 4MVJE 3W5VA 4R2XA 4W5RA 2UUOA 2VUTA 4Q93A 3DDNA 4JFAA 4MQLA 2JGKA 2IHBA 2XKBA 2JJ2A 4D6XA 3URKA 1CUFA 7ABPA 4EB6B 4HKTA 4RYLA 1AUVA 1S3FA 1YF3A 3LLUA 4L76A 2C4HA 4TKVB 1T1GA 4ID3A 2BSQA 3PJFA 1PQ4A 1HFWA 1SC9A 2CJWA 3ZU2A 3W5DA 4G4GA 1DC5A 1EI9A 2ATVA 4DCTA 3B78A 2H0RA 3L6CA 4ZV9A 2O57A 3DAYA 3OTOB 5TMPA 1FIUA 1KAEA 3NH6A 4HVLA 1MP0A 1HFEL 3AQIA 4HDRB 1CRZA 3WSTA 4P35A 5IXYA 1KTVA 1LK0A 1A8UA 1QUFA 4B85A 3WYNA 5IKPA 2GK3A 1UC8A 3KKNA 3NRBA 4PBSA 5CW2A 2FLVA 1GV1A 3HO8A 3RKRA 3IE0A 1GZ3A 3CV3A 3OJFA 5FL7A 3LGXA 5E95A 4QUJA 1EK6A 4H0CA 1BXRB 4WKGA 4X71A 3VHRA 1OTYA 4L8GA 3ANSA 1GAWA 5GZ1A 5JPDA 4ISBA 2JH9A 3PJGA 3RTGA 3HA2A 4QTXA 5FPPA 5F2NA 1EE2A 4EO4A 2ZRGA 3F90A 3TE7A 2PL5A 1SB8A 1TCAA 3FSEA 3WBKA 4AJPA 4N0EA 3ZDRA 3CH7A 3U9SA 1F51E 1FS5A 3EQ9A 4R2IA 3SC3A 5AI6A 1Q7CA 1POXA 4QOSA 4NE2A 4IG9A 2R6ZA 1P7YA 2XSZD 4Z4EA 4MKFA 1ISPA 4EEKA 1IH8A 2UZ1A 1UEJA 4XIJA 5C5CA 1U0SY 3FJOA 1L4KA 4OKNA 2UYGA 3K9HA 4C88A 1KOGA 5LPNA 5DNCA 4CEJA 4QVIA 3GLIE 3CBQA 1I2MA 3D2BA 4X7MA 4IDPA 4YRKA 2JLZA 3IIMA 2WYUA 1SCUB 1LD3A 1K8XB 4ECAA 1LA2A 2E4ZA 1SOAA 1ZH2A 1HT3A 3FKQA 4BFCA 3MWLA 1OB2A 4OQFA 3T6KA 3OWHA 2RONA 1RM3A 2XXJA 3CTMA 4MZXA 2DAPA 3N2ZB 4FYJA 1FCJA 1E2HA 1CVLA 4MJLA 4OX9Y 3C43A 1Q3KA 4PBRA 3RTCA 1Z2EA 2H92A 1AU9A 3I8XA 4CM1A 3TNDA 2QVGA 2JFWA 5A7HA 1CZKA 5JR3A 1YHZA 4FOSA 3O9ZA 1W0JA 4W6QA 4KR9A 3QFSA 1WHSB 2J45A 4RA6B 1XMJA 2B8TA 5E1OA 1VG1A 3CT6A 2H1LA 1QRTA 3WB1A 3RJMA 1YS9A 4IG4A 4GLBA 4HEA6 1W1WA 4E7PA 4EKGA 5BW4A 4FW8A 5FBQB 4JWTA 4IXMA 4GBED 1KI8A 4Q9AA 4Z0TA 3G6KA 3WL5A 2EFYA 2P0EA 5EWLA 1L5MA 1NW4A 2WD8A 3A05A 4OJYA 4QYMA 3ST7A 1WMAA 3LVQE 1Z4MA 3ZQ6A 3V8QA 3GJ6A 1Z16A 1VHJA 3WS7A 4MUGA 4ZO9A 1QSGA 2Q2WA 3I5XA 4M6WB 4HGZA 1T0UA 1IZZA 1RJ9A 2NO4A 4PHFA 1KYWA 2KMLA 4DRYA 1XTBA 4QXQA 3DAHA 4PPYA 3WFJA 4ESVA 5EA2A 4DNQA 3C5HA 1U98A 1GPBA 1LS1A 2XGOA 2YIMA 4CM6A 2E89A 1KDYA 1AHHA 3SR3A 1N1EA 1M1YA 4I4NA 1G5HA 1PBNA 2Q9AA 3C7AA 4MUIA 1F3OA 4OQNA 5DYIA 3D6TB 2BH9A 4IYJA 1H0RA 3EXEA 5CT5A 3ZDEA 1C0PA 4DLNA 2ZBQA 3EISA 4L8YA 4UASA 4OB8A 2EOAA 3DMNA 5IYZF 1U94A 2OPHA 4FIDA 1SXJB 2FRDA 1QYCA 2YWEA 4FD2A 4ZT2A 2IF2A 4C22A 1UC4B 1FNSA 1ZI8A 3GRFA 1SXIA 2XSZA 5CEFA 2J3IA 1W4RA 4I7EA 2AN4A 2BKLA 1LSOA 3RSGA 2E1RA 5K0FA 1DUVG 1XLWA 3W2TA 4TL7A 3EGDA 2FG6C 2GR9A 5F7XA 1D09A 4NEGA 1P19A 4XVRA 1EFDN 1N5MA 4REMA 4A6EA 5LQJA 1Y8QB 3ISJA 5HE9A 3VH4A 3ZHUA 5D3MB 1LNZA 4AF7A 1QFJA 1S2DA 3CZ9A 5I47A 5IJ9A 5IAGA 4ZI2A 1JJIA 3UMVA 1GLVA 3NTQA 3G68A 2AQIA 1N5DA 3OX1A 3UXHA 3GGSA 2XWPA 4IDOA 2AZDA 2C3UA 5DTMA 2GCGA 2P68A 4IQ8A 2J3EA 2RDMA 5DW3A 4MEBA 3KJEA 3L1VA 4B6GA 4N18A 3LIIA 1E1CA 2NU7B 4QODA 1AHNA 1EFPB 4QUBA 3DMFA 3IA2A 3WLNA 1KAQA 3CLTD 2FMHA 3OI7A 3Q3EA 4HC4A 4YROA 1RXEA 1CR6A 1KXZA 1QOZA 3HWRA 4IMJB 4JS0A 3AC0A 3JQDA 5DIZA 1V6SA </