4CM7A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
252
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQNGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
total genus 94
structure length 252
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm7A00
5F5NA 3KYCA 5CAEA 1LDMA 3I9OA 3JYPA 4AL4A 3UH1A 4NBWA 4BO9A 1HYEA 1GPJA 3FHLA 3FWNA 3G1TA 2Q3EA 1R4MB 3I9JA 4O5OA 2JCYA 2VHXA 4RCVA 5G4LA 2BGKA 4KUGA 4MVJE 1XYGA 4EDFA 2CUKA 2IYOA 4PLTA 2V6GA 3TRIA 4PLYA 4TWRA 3JD3A 1LSSA 4E13A 2WYWA 4B3JA 3PGXA 1E1NA 2NVBA 3SVTA 2O3UA 1VJ0A 2PWZA 4PLFA 1KY4A 3DTTA 3QWIA 4WLOA 4QO7A 2RHCA 5IDXA 1O0SA 4TROA 1Q7BA 3ETEA 3O8QB 2V6FA 4R1TA 4TQGA 4L8VA 4YT4A 1MA0A 2G0TA 4BQRA 4F6LA 4WCFA 4J0EA 1KC1A 3K92A 1WW8A 3KSDO 4J16A 3G49A 4WKGA 1B8PA 3SJ7A 2PY6A 1ORRA 3H9GA 2AEJA 5L51A 4NMHA 5IAAA 2ZB8A 1ZBQA 4AJ4A 4DWVA 4RPGA 3JYLA 5JAZA 2HRZA 3GZNA 3PJDA 4FJ2A 3LC1O 3GVIA 1H6DA 3KTDA 2Y93A 5ENDA 2UDPA 1GEGA 2R00C 3WB9A 1T1SA 5T67A 1LC0A 2EKQA 2NACA 1SEVA 4FFLA 3JQGB 5F21A 3G1UA 1EVJA 4YAKA 4MIYA 5AQ1A 1LLUA 1BHSA 4W4TA 1Y8QB 4FSHA 1L7EA 1LNQA 2JL1A 1ID1A 4HFNA 1ZMTA 3LC2O 1A7AA 2X0IA 1E6WA 1U2DA 3PLNA 1NR7A 4CM6A 1DPGA 3Q3CA 2EJWA 3H5RA 4LGVA 4R16A 1EBFA 3OSUA 4LVUA 4GVLA 4W9NA 4CM3A 1NPTO 1ZK4A 5KTKA 1AHIA 5CDTA 1UUFA 1X7GA 1UJMA 3HDQA 4Y6SA 5EPOA 1JKIA 4FB5A 3DTYA 4B4WA 5TF4A 2P2SA 4JCOA 3IS3A 2VTEA 1WAMA 1A9YA 3DB2A 2TMGA 3D4OA 2Y99A 4D3FA 1E7YA 3VOSA 4JJIA 3KLPX 3DHYA 1S6YA 4R51A 1MXFA 4WLEA 3CMCO 4XJTA 4BGUA 1Y6JA 2O3RA 3L07A 3NUGA 1MLDA 4PRKA 1W4ZA 3H9EO 4OXYA 1QYWA 1UAGA 4PZDA 4CM5A 5EERA 1O6ZA 1P74A 3O03A 3I3OA 1PJSA 4UUMA 2BI7A 2X9GA 4J2OA 2I99A 1DSSG 4MJLA 4YT2A 1Y8RA 3D4PA 5JXWA 3UW3A 5G0VA 4KTTE 3HHPA 3GT0A 3GHHA 2GN6A 4FN4A 1DIAA 1VSUA 4YJHA 4JIGA 1NXQA 1X0VA 4R5HA 1Z73A 3OJOA 1D1TA 4U0KA 2NNLD 2JCVA 5JY6A 5IN4A 2VYND 1HSZA 3A4VA 1LDBA 2Z1MA 1ZXLA 2XAAA 5BQFA 1F0YA 3QWBA 2BLLA 2CDBA 3UCEA 3NTOA 4DGSA 2ZB3A 3WJAA 1KEWA 4D45A 4LSWA 1PQWA 1VJTA 3GDOA 3JQ8B 3JQ6A 1EE2A 3S1LA 1TT5A 3GF4A 3INGA 1B26A 2IDZA 4GI2A 3JQ9A 1DIRA 1D4FA 2OBYA 2ZQZA 3ZHBA 3VTZA 2VOJA 5CEEA 2X0JA 2VRCA 2E6UX 3I9NA 4H7PA 4MVJH 3SC6A 1KBZA 1PJ3A 5HWSA 4IS2A 2O2YA 3TL3A 2IRWA 4PZEA 1C0PA 1X15A 1U2GA 4CMBA 4IDCA 3OHSX 4BVAA 1UXGA 4Q3BA 2ZATA 4DA9A 4QXMA 5I9LA 1DHRA 4BB5A 4FFMA 4IQ0A 5FI5A 4RPLA 3K96A 3M1LA 3V2UA 5L4SA 3AI1A 2P5YA 1R66A 3WGTA 1GUYA 4HP8A 2Y0EA 1IB6A 3WFIA 5L45A 1E7MA 3EYWA 3QQPA 3EVTA 1ULUA 4ND1A 4LRTB 2GO1A 4B7UA 4I5DA 3RASA 3M2PA 4TVBA 2VNSA 1MV8A 4HFJA 3H65A 3NGLA 3EMKA 2VUUA 5KOIA 5IZCA 1DEHA 1E3LA 4DQVA 2HCTA 1HEUA 4CLOA 4E5NA 3CH6A 3ETGA 4DLLA 1K89A 2B5VA 2X58A 3ITKA 1N7HA 4BO8A 5IDWA 3QVOA 4L73A 4GSLA 3GVHA 2DLDA 3I5MA 4OHUA 1QV7A 2VT3A 3VH1A 3U5TA 3H4VA 2HKIA 4KOAA 2I3GA 4ALMA 1PJBA 4FFOA 1T2DA 1N2SA 1ZFNA 4RV9A 2CZCA 2JD0A 3A9WA 2V65A 4IIVA 3KB6A 1E7RA 1T24A 3BZUA 2JJYA 1M6WA 2XXJA 2EKLA 3ANNA 3CPSA 3BTUA 5KKAA 1LDYA 1CDOA 3VVCA 2E49A 1H6BA 2WYUA 1EFKA 2FMUA 5GMOA 4A73A 4CLHA 4NBVA 3TWOA 3C1OA 2ZTLA 4PLCA 3GNTA 3ZGYA 1RWBA 5HA5A 2V6MA 3AK4A 1V9LA 4F46A 1PU2A 3T7EA 1YQGA 4D42A 1BDMA 4ZQFA 4J4BA 1ZUD1 1QP8A 1CETA 3R6DA 4RLSA 1UDBA 2Y1OA 2FSVA 1DJQA 2VUTA 3E6AA 4HWKA 4HXYA 2VT2A 3GN2A 4JROA 4OSPA 1T1RA 4P38A 4ZU3A 3ZWYA 2B0JA 1LLCA 4YYZA 2BGLA 2Q2WA 1E7WA 3ONFA 4UEKA 3KOUA 5MGBA 5L9AA 3BMQA 4CQMB 3PDJA 2BKAA 2OUIA 1ZCJA 4Y6PA 1SB9A 4Z3DA 1P3DA 3TQHA 2FP4A 4EEXA 3DC2A 1XGKA 3DONA 4PLWA 2NTVA 4RF3A 1PQUA 5T8KA 5U4QA 3ADPA 4U8GA 1ZEJA 1R0KA 4Q9NA 1QYXA 2GD1O 4MINA 1Y81A 4AVYA 1LUAA 3PIDA 2E37A 1YL7A 1B2LA 3O4RA 3PPIA 2FN7A 3ABIA 1NAIA 4XDZA 1IL0A 4F6CA 5IF3A 2BD0A 5THQA 1YJ8A 3D64A 2FRDA 2ZQYA 4B8ZA 4IMPA 5KKCA 2FPPA 2B4TO 3DFZA 3LF2A 4OQZA 5AXBA 4YRBA 3PFFA 5ADHA 5B4UA 1ISIA 3ZNOA 1R37A 3I83A 4Z9YA 2EXXA 1UDAA 4EBFA 1ZW1A 1EEHA 1RM5A 2YY7A 4TVOA 1SAYA 4J1NA 4BOYA 2UV8A 2E48A 1DFIA 1H0KA 2PFGA 4B4UA 3AU8A 4LVCA 4D0RA 2D5CA 2Y68A 2QQ5A 1A7KA 4J1SA 4JBHA 4B3HA 2RH4A 4M8SA 5U1PA 4ZN6A 3H9UA 2J5RA 2ZTUA 3F1LA 3U62A 1Q0QA 1N9GB 1B14A 1N7GA 1PZGA 1X7DA 2AQIA 4KDEA 3BTVA 4WE3A 1XQ6A 4RORA 1V35A 3W8EA 2OFPA 1BGVA 1GL3A 5DNAA 1WMBA 4GMFA 3ZWPA 3RUEA 5JAMA 3NT4A 1Y8RB 4NJMA 3U09A 4BIIA 3H5AA 3OJEA 1KIFA 2D1YA 5ICMA 3HNPA 4CUKA 4RPKA 1PJCA 3EAGA 4YJHB 1BXGA 1E7SA 1FXSA 4GX1A 3RUIA 3C7AA 1I3MA 1UXKA 1JKJA 4RF5A 1AHHA 1R12A 3MOIA 2A35A 3X2EA 4N5NA 1A71A 4OSOA 3VH4A 2GF2A 3S2EA 1VL0A 4RVSA 3O38A 1SPXA 2OO5A 1F8FA 3ENKA 1NQOA 4K6CA 4OKNA 3NX4A 3OECA 3TFQA 3WOHA 1Z82A 2Q50A 4IDGA 3B70A 3LK7A 1VL6A 1N5DA 4GGOA 3TSCA 3RBXA 2BHLA 1GV1A 1AN9A 1TT5B 4MVJD 4E0BA 3W6UA 3KYDA 5AXDA 1PQPA 5CEFA 5KJCA 2HMTA 5DF1A 3JQ7A 4YRAA 2Q1SA 3FCOA 1BMDA 2OL4A 2R6JA 4GX2A 3FBGA 1VC2A 1DAPA 2AEFA 3VPXA 4J7XA 4OOEA 4MO2A 3D5QA 4B79A 2H5LA 4OL9A 1F06A 4W99A 4CV3A 2G17A 3LSYA 4CV2A 3C7CB 3RC2A 3GGPA 4ZRMA 1UH5A 3PHJA 4BNNA 2I5PO 1DLIA 3G3EA 2RBEA 3LT4A 1IOLA 2YHUA 2JFHA 1M76A 5B37A 4CUJA 4YBZA 5LDGA 5KJFA 3QSGA 3ULKA 2R2GA 1DB3A 1R15A 5BSHA 5JDIC 1JW9B 3SXPA 3ZHYA 4DPKA 1MC4A 4EYEA 3O8QA 3FPCA 4I9HA 4E33A 2DFDA 4WLUA 1OAAA 2B35A 4MP8A 2IZ0A 3C8MA 5L7YA 2ZYDA 3ANMA 4TRMA 3ZNPA 4OYRA 3MCVA 1SZJG 2C0CA 4E5YA 1E3WB 1E6EA 2GUGA 1BW9B 4BNTA 2JCXA 1LSUA 4TMFA 4CLOB 2A92A 5DDIP 5A5FA 5F3RA 4YAEA 1OC2A 4R1NA 1ISGA 1C1XB 4W6ZA 3B6ZA 2PH5A 3HN7A 4DC0A 1B16A 1N1GA 1NASA 2HJSA 3BHJA 3LVFO 3DMYA 3MJTA 1M66A 1UZLA 1ZVMA 2CF6A 5G0TA 2QYTA 4U0JA 4I5EA 4IZHA 3AY6A 1WZIA 3L4BA 5CPFA 2X0NA 2VOEA 1O5IA 3QVWA 5A03A 2ZYGA 3GAFA 4WCFC 4Y9DA 2YUTA 4YQYA 3H6KA 1Y8QA 4BKOA 2BI8A 4PN3A 3M1AA 1X1EA 1DRUA 1I5RA 1U7TA 1DBVO 3OETA 3DMTA 2DQ4A 1SNYA 3PDUA 3M2TA 4WLFA 2JAPA 3RUCA 1KEVA 4GPD1 4KP7A 4BNFA 2AA3A 4CMEA 2PZJA 1E0DA 1M75A 1U8FO 1LEHA 2FOIA 2O2SA 3AOEA 1I2CA 3PXXA 2AQ8A 3DDNA 5BSEA 4MKZA 5JO9A 2SCUA 4FS3A 3W8FA 2QHXA 3BMQB 1I33A 1X13A 2X6TA 3RROA 4E2ZA 2O4CA 5L3ZA 4CM7A 1ZZEA 1R16A 5IDYA 4GLLA 3H2SA 1HSOA 1E77A 3H9JA 3KV3O 3S2GA 2CDAA 3O9ZA 1E1MA 2BFPA 3AY3A 3WR5A 2VHWA 3RUHA 4BS9A 4XRGA 4IDDA 1ZK2A 3VZSA 2I76A 3OEWA 5AYVA 1GEEA 2RAFA 4H16A 3LT1A 5J23A 4W9NC 2FR1A 3I23A 3NKLA 3ZV3A 1FDWA 4E5PA 5IXSA 2HDHA 4FPXA 3PLRA 3SBOA 3V2GA 5GZ1A 1Z45A 2WTBA 4FQ8A 4ALKA 4UEOA 5C7IO 3OIGA 2HLPA 1B7GO 2Y1CA 2GPTA 3PWZA 4PIVA 5G4KA 3GOHA 5B12A 2FZEA 2VHVA 4L4RA 1CQJA 3WFJA 4B7CA 1GD1O 4K9DA 2Y05A 3DFUA 4L76A 4NFHA 4AJOA 4RPHA 4W82A 4OAQA 2I66A 1ADGA 1R4NB 1XCBA 4BO5A 4OKIA 3PRJA 3Q1LA 1EK5A 1XELA 4KQXA 4NBTA 3HDYA 1YE3A 3DHNA 3ETDA 3R3JA 3NJ8A 3WMXA 4J49A 4BKUA 3TZKA 4BMNA 3ZH2A 4ZQBA 4BNKA 3GDGA 4DTIA 4BNZA 4CR8A 3DL2A 2QRLA 4RPJA 3P19A 3RC9A 4GX0A 2C82A 3C1AA 1GCOA 3OM9A 4BNMA 4EJ6A 4NK4A 2GZ2A 3EZLA 5CPBA 4XGIA 5FF9A 4E6PA 4M55A 4U6QA 5KJEA 4WOJA 4Y6RA 1P1FA 2EWMA 3FTNA 4FD3A 5L95A 1DHTA 3HB5X 4NJMB 4CM9D 1ZEMA 1PL7A 4WLVA 1IE3A 1LBEA 1MP0A 1WZEA 1RKXA 1BXGB 4FW8A 3AI2A 3JQ9C 5JFOA 1GZ4A 4PVCA 1PWZA 3JQDA 5DBGA 3UAGA 3KUXA 8LDHA 1PZEA 3UFXA 4ALLA 2WWRA 5ENVA 2Y1EA 5TX7A 3L77A 1JAYA 4GVXA 5TNXA 1ZK1A 3F47A 2IXAA 3N7UA 3S55A 1GPDG 3W4IA 3U49A 4BO2A 4JP2A 3JCZA 3COSA 4I9UA 2EP7A 1PR3A 5LC1A 4E2XA 5JYEA 1ZO8A 3MWDB 4I08A 3GAZA 4XYGA 2EF1A 3VH2A 1R0SA 4MVJI 1HZZA 2P91A 3K8ZA 4UVGA 4MIEA 3HADA 3K2BA 3QHAA 4BQPA 1YQDA 3WSVA 1EDOA 1HETA 1PJLA 1NHGA 4WUVA 1J0XO 5COQA 3WIEA 3JSAA 3RFVA 4W7IA 4YAIA 3K2EA 3BTSA 4UVDA 3DQPA 4WNCA 5L53A 2WM3A 4XDYA 5T6BA 2PTGA 4J6FA 3DOOA 3GVPA 1KEUA 1I10A 2YV3A 2HMSA 4MKRA 4UVIA 4NG5A 5IZCC 4BNYA 1OBFO 1BTOA 3A06A 4GWKA 1VI2A 4D46A 3KEOA 4FC7A 3HN2A 4P4LA 2ZB4A 5C7LO 1NYTA 4MKXA 2I67A 3INRA 3QVSA 1YB4A 3RU7A 3ZWMA 3WBBA 1NWCA 3EGOA 5ITWA 3F9IA 4Y67A 4IJVA 5FEUA 4CMKA 3EK2A 4LRSB 1YJQA 1GQ2A 3ZV5A 4XQ9A 4CQMA 3JD0A 1J6UA 1G0NA 2DBVO 4KDFA 5TJ9A 2X86A 3QWHA 1P1JA 1YOVB 5JY1A 4M89A 2PKQP 3Q0EA 3V5NA 4DYDA 3PHLA 1T4BA 1NFRA 2UUPA 5DBIA 4OXKA 1LDGA 3AM3A 4IGFA 4ZQHA 3C7DB 1HDXA 2OMEA 4IDBA 4GLOA 3W1VA 4QT0A 4DLBA 3AFNA 2PA3A 3R1IA 1V0JA 3TNLA 5I9MA 2NU7A 2HJRA 3FR8A 2IZ1A 4BNXA 5DOVA 3VZPA 4DPLA 3Q9UA 4YPOA 4P4NA 3NV9A 1Q7GA 5JMPA 3ST7A 2C5AA 1YBVA 4R69A 2H1SA 2CVQA 4Q3CA 4M54A 3FSRA 2DTEA 4PG8A 1ENZA 1QR6A 2NU6A 4J1TA 2DTXA 2BH9A 1XLTA 4TRRA 4DL9A 1I32A 5GZ6A 5T8KC 5CDSA 3JQFA 4O6VA 1HE2A 4J4HA 4LSMA 1WP4A 1X7HA 4CMJA 1XU9A 3FNGA 2W90A 3CE6A 3MTJA 4D44A 4XGNA 1B0AA 5BNIA 2VUSA 3FWZA 4YA6A 3PQFA 1YH3A 1MFPA 3WYEA 1YONA 2DBQA 3NDIA 2QZZA 2BMAA 4AJ2A 3PQEA 1JVBA 2YJZA 2HMWA 4PVDA 5LDHA 5F5LA 1XQ1A 2Q1WA 1WNTA 3IL2A 2C7VA 4DVJA 1Q7CA 4CM8A 3D4NA 1NQAO 1YBMA 5ER9A 1SCUA 3F46A 5IN5A 1N9GA 1LLQA 1XHLA 3M6IA 3SEFA 2E82A 1E7QA 3D7LA 2C07A 4JBGA 3EVNA 4K6FA 4M49A 3RJ9A 1LQUA 1FDSA 3GLQA 3WICA 4R5MA 4AJIA 3HE3A 1CERA 1PEDA 2WJPA 4JNKA 2X23A 2AEMA 3V8BA 1LRKA 4CR6A 1Z7EA 3FR7A 1QSGA 5CG2A 1HDGO 2Y0CA 5G4KB 5I8ZA 3PWKA 1DIBA 4AJLA 3C3XA 3LT0A 4CLDA 1VJ1A 2FR8A 5JS6A 4EGFA 4CLRB 4DREA 4RJTA 2AQKA 1H9AA 3JQCA 1PGNA 3MJSA 1LXCA 1N92A 1C14A 1EVYA 1Y5RA 4M87A 4GL4A 1J49A 1T2EA 5A1TA 1GV0A 3ZWXA 4J2HA 1JWBB 2Y1DA 1AE1A 3I9MA 1D3AA 3IQDB 2V6BA 3NAQA 1LX6A 1KY5A 3UF0A 1NFQA 7MDHA 1JDJA 1RM0A 3H9QA 2FY8A 3QVXA 4P4GA 1C1DA 1PR9A 4YQZA 1GR0A 5DCYA 1LTHR 1QYDA 2VZ8A 3IMFA 3QP9A 1P1KA 2PLAA 3PFWO 2OP1A 4NU5A 5TRTA 1U5AA 1UZNA 4CMGA 3JQBC 4B7XA 4EUEA 3ZDFA 1N8KA 5TS3A 1AXGA 3NGXA 3TJRA 4N5LA 3ZNQA 1U9JA 4GWGA 4PGFA 2CDCA 3I4CA 1NNUA 4JXKA 2NTNA 4FCCA 5I9NA 1E5QA 1KVUA 3SC4A 1QYCA 9LDTA 3QLJA 4XYEA 5K9ZA 1ISFA 2P9EA 5EMHA 4YDRA 1SMKA 3I1JA 1E3WA 3O26A 3R3SA 1BW9A 4BNWA 3F1KA 3HFGA 4K28A 3ZW9A 1C1XA 2P68A 3GNQA 5DOZA 2HK9A 3ANLA 4IINA 3JYOA 3SLKA 3WTBA 5KNLA 1EFLA 3EW7A 4MVJM 3CIFA 4YJDA 1O94A 4XB1A 1O8CA 2HQ1A 4XIJA 1DIHA 2W4QA 2Y0DA 3MOGA 3WBFA 1PZFA 1SOWA 2QRJA 4AJPA 5I7VA 4E5KA 1TXGA 4OIMA 3DZKA 1HDYA 4UVHA 4E12A 5T64A 1P33A 3VDQA 1LQTA 4BGIA 1JU9A 4DBVO 1HYGA 1RM3A 3HSKA 5KWEA 3NTRA 4I5GA 4A27A 4LISA 1OZAA 1NWHA 5IDQA 3KEQA 2YV2A 4PG4A 4BMVA 1NX6A 4HV4A 4IZIA 5FWNA 3DO5A 2O4UX 3WMWA 1WLYA 3MWEB 5LCXA 2VRCD 2W2KB 4E3ZA 1JVSA 1CIVA 1LLDA 3CZRA 4RF4A 2B69A 2F1KA 3S2FA 3RKUA 3WLEA 4XCVA 5AXCA 1PJTA 3PTZA 5HS6A 4ZGWA 4RVGA 2GNAA 1OC4A 3B1KA 3EC7A 3E18A 3ENNA 3VPFA 2O3JA 4OH1A 1G6KA 1M2WA 5A3VA 3WQRA 1RM4A 3S2IA 3H2ZA 3PYMA 1XEAA 3S8MA 1DRWA 3INTA 2OP0A 1EUCA 1Z74A 3DMTC 4LK3A 2AG5A 1LU9A 1H2BA 2NV6A 1HE4A 2PNFA 1BXZA 4EZBA 1RPNA 2EIHA 1U3VA 2ZIZA 3BXXA 4GAEA 4CMEC 3AOEC 2OBNA 4Y8VA 4KWIA 1DC3A 2G82A 1YDWA 1NAHA 4FGSA 4QO8A 4KUHA 5DCUA 2GCGA 1IZ9A 5JO0A 4ALJA 1E92A 4ND3A 4ZQEA 3K6JA 2EV9A 3WWYA 3GK3A 1UAYA 3PJGA 3OA0A 3X2FA 3BAZA 2YZ7A 5EIOA 2J3JA 3RC1A 1C0KA 3WX0A 2YFHA 5BSFA 5IG2A 5DP1A 1FDUA 2AHRA 2EERA 3ONEA 5JDCA 1XWFA 4HY3A 3GEMA 1D8AA 1R4NA 2NVUB 1DC6A 3STHA 3MTGA 2DM6A 1U5CA 1MUUA 1J5PA 3DBLB 3BHIA 4E4YA 1C0IA 1YB5A 2H9IA 3KYBA 4J91A 4RVFA 4IPTA 2UVDA 3NRCA 4XX0A 4CL8A 1PS8A 3UOGA 4ZRNA 5CHEA 4N54A 3WSWA 4CM8B 4FJ1A 2HSDA 3EHEA 2XOXA 2NLOA 2QZ9A 2YHIB 3IJPA 1TVEA 3A1NA 1HRDA 1ENOA 2BRUA 3NTQA 1JKFA 2VRBA 3LZ6A 3DEYX 4IY1A 3UGKA 4R4JA 3OA2A 5L4NA 3WWZA 3E9MA 1WDLA 3VC7A 5G0UA 1UP4A 1DXYA 3ZU5A 3UHAA 1P77A 4AFNA 4E30A 4A10A 3DZGA 4CV1A 4TKMA 1ZH8A 1QG6A 3DXFA 4J9UE 4RL6A 1U1IA 2FR0A 1VPDA 2C59A 3K31A 4WGGA 4XQGA 1GY8A 2ZYAA 2Q2VA 5A05A 4YXFA 1SC6A 4AJEA 2UYYA 1HF3A 3OQ6A 2A94A 4ND5A 4ZA2A 2PD4A 2VWPA 1I8TA 4XYLA 2WDZA 1EE9A 3GEGA 3JQAA 1DDOA 3D1LA 4IUYA 1DOHA 3L6OO 2ILTA 5JAQA 4XYMA 3WGGA 1HT0A 1VRWA 2NM0A 3AWDA 5EQDA 2FSSA 4HUJA 5DP2A 2EW8A 2J5KA 4AG3A 3VHRA 3F6YA 3UUWA 1KETA 3DWFA 1T2CA 4AJHA 3E1KA 4HX5A 3GGOA 3I4FA 3JD2A 1VKNA 1C1DB 3IUPA 2DUUA 1TA4A 4MVJF 3W4KA 2VYVA 3WNQA 5A9RA 4BHTA 4E31A 2NQ8A 4R1SA 1GFSA 1HE3A 4UEJA 2AE1A 2X4GA 4QFDA 4D3DA 4ILKA 2RIRA 1D1SA 4U6SA 1HTBA 1K6XA 4PG5A 3HUDA 3WTCA 4FC6A 2DC1A 3WGOA 4A03A 1JTVA 3FNFA 3FRJA 3VTFA 1Z6ZA 4CMHA 1BRMA 5CDGA 1C0LA 2DFVA 1LDNA 2W2LA 1AGNA 1NM5A 4M86A 3GEDA 2E4AA 2IEBA 2C2XA 3CINA 1HYHA 2PR2A 3E48A 1DC4A 2X7HA 4BB6A 1GU7A 2DBZA 4DQXA 1DFHA 1YOVA 2B83A 4ESOA 4FFPA 3OH8A 5TT0A 1YXMA 3ROQA 1V8BA 1I3KA 3AUTA 4R9RA 1BSVA 1NPYA 4R1UA 1V3TA 1BVRA 3KSZO 4ND2A 1NR1A 1O95A 3RUFA 4LN1A 5JCXA 4I9NA 5COAA 5K6AA 1MG0A 5AOVA 1ZJYA 3LYLA 2IYPA 2C2YA 2F00A 3AM4A 1PJ2A 1CWUA 5ILOA 4H3VA 1KYQA 1U8XX 1H2HA 3CEAA 3RFTA 3BTOA 4JP3A 1E1LA 2AW5A 1EVZA 4BO4A 2CF5A 2DTDA 1FMCA 3B1JA 1HXHA 2EJVA 4GGPA 1DRVA 2PKRA 5A9TA 1GADO 4QX6A 5BNTA 4UVEA 1VSVA 3VZQA 5HTOA 4YAGA 2OHXA 3ORFA 4O63O 1I2ZA 3WQQA 4C4OA 1LA2A 2BF7A 1QMGA 2QW8A 2ZCVA 1BXKA 5EJ2A 1T2AA 1H93A 1CJCA 2I6TA 1YDEA 3ZW8A 1B8VA 4NBRA 3GR6A 1CQIA 2VZ9A 4D41A 1TT7A 4WOKA 2H6EA 3VH3A 3E82A 4KQWA 4NR0A 1PZHA 5ICSA 3H3FA 1EQUA 4NI5A 3DZBA 4CM4A 3EZYA 3NEPX 3UN1A 4II3A 4NIMA 3IOYA 4DRYA 3FI9A 1PL8A 2BFOA 4BO6A 3RQSA 3GUCA 3JQFC 1T4DA 4L9RA 3DBHB 1N1EA 5F1OA 4E32A 4UREA 3ROKA 3PHHA 3JD1A 2Y1GA 5JSFA 1GUZA 4DQUA 5JW6A 1P0CA 4XEHA 1GYPA 2OGUA 4E2YA 3QE3A 4EJ0A 1SEPA 4J7UA 3JQEA 2AXQA 1HE5A 4KTVE 3A14A 2IXBA 4X54A 1V3VA 4MVJG 3KRTA 1P0FA 2GN8A 1DFGA 3AM5A 2PV7A 4IM7A 3AI3A 1P45A 1U3UA 3ASUA 3KBOA 1WMAA 3OP4A 1I01A 4FFNA 2J3IA 3DAFA 4CLRA 4OQYA 2PZMA 1U3TA 3ITDA 1YBAA 3ZWVA 3NJ4A 4FOOA 5JCJA 1U4OA 2EKPA 3WGIA 3E03A 2Y1FA 2DT5A 2YQ4A 1A9ZA 3UKOA 1KVQA 3L9WA 2D2IA 2D3TA 3KO8A 4RZIA 1I3NA 1S7CA 1ENPA 4NK5A 2YDYA 4RVUA 4YT5A 3FD8A 3JTMA 3IDSA 2B37A 3Q9NA 4BNGA 1E3JA 3NT5A 4MP6A 4I5FA 3OMLA 1Q0LA 3FF4A 4AJ1A 4E5MA 4ROSA 3TOZA 4R41A 3ZWNA 5B1YA 4J3FA 3GA0A 1NVMB 3DBRB 4BNUA 3AUUA 5F1PA 2Q45A 4L74A 4YACA 2GZ3A 2WD8A 4BL5A 1H6CA 2D4AA 2YDXA 4XZ3A 1A4IA 1QXSA 2CVOA 4O0LA 4RDIA 5TSDA 4FFRA 1O89A 3C24A 2CD9A 3ZCXA 5KVCA 3TDKA 2FHSA 4CPDA 4W7HA 1EUDA 1VM6A 1LRJA 2B5WA 4EUFA 3T7CA 4CODB 1UXJA 1KOLA 1FDVA 1Y7TA 2ET6A 3CTMA 4D3SA 1PS0A 5B4TA 2Q2QA 1VE9A 1PS9A 2PD3A 4JJGA 1FDTA 1UP6A 4PLHA 1P31A 2WE8A 5K0ZA 2O48X 2Z5LA 4PLPA 4JJFA 3FTPA 1LRLA 3JQAB 1ZJZA 2GLXA 3PYLA 1GAEO 2D0IA 4N18A 1Q1NA 3ROMA 1GUFA 1ZXBA 3CUKA 3GG9A 4Q3EA 3U0BA 4XGKA 3GPIA 1FK8A 1Q0HA 1B3RA 3RSHA 2XPCA 2EP5A 2Q4EA 3GG2A 1E5LA 4Q3DA 5DN9A 3A28A 3HJAA 3ICCA 3ICPA 4YVFA 1UXHA 4AJKA 1A72A 2JHGA 3ZNNA 3BMNB 5EINA 3VPGA 4QEDA 1WDKA 3ZV6A 4IS3A 4KWHA 4YR9A 1MGOA 3PHGA 4JLWA 2P9CA 4JK3A 4XR9A 2VNAA 5KCZA 4DXHA 1I36A 2C29D 3W6ZA 4CLEA 5CDUA 1GYRA 1I0ZA 5DZSA 3GVXA 5JPIA 3VDRA 3K30A 1GCUA 2QRKA 1P9LA 4BKPA 1NPDA 2AMFA 2VQ3A 2DAPA 2OOSA 1JN0A 3PI7A 4S3MA 3G17A 1GQYA 2W2KA 2CNBA 3H3JA 4E21A 4GKVA 5GY7A 3FBTA 4NH4A 4L4SA 5ILGA 1JAXA 2BFMA 4PLZA 3GHYA 2O7SA 4JGBA 3UCXA 2PGLA 1D7OA 1HKUA 4R01A 4D0SA 3EDMA 4IJWA 1OOEA 3F5QA 1NFFA 3PEFA 3OQBA 4J9VA 4BNJA 3TF5A 4NFSA 3QV1A 4A5OA 4PFJA 4Y98A 1SBYA 1WXDA 2B4QA 2JD1A 2TMDA 3HDHA 3RVDA 4YJGB 3AJRA 1TEHA 3K5PA 5JAIA 3ZHZA 3F4BA 3H5NA 4J7CA 3LLVA 3QJ5A 1FF9A 3GVCA 2ZJ0A 3LF1A 1G0OA 4ITUA 5C5IA 1EZ4A 1XSEA 1EVIA 3RJ5A 2AG8A 3KLMX 4BO0A 1MB4A 3WGHA 4CMAA 4TRNA 2Q1UA 2EEZA 1GZ6A 3I52A 4I8XA 3WYBA 3U4IA 1YO6A 3LDHA 2W98A 3PGJA 4UUOA 2WYVA 3D5TA 2GN9A 4IXWA 2FZWA 2GGSA 2VYNA 4U7WA 4DLAA 4R3NA 2NVWA 3GY0A 4YWJA 1K5HA 3F5SA 4YJFA 3U4HA 5CEJA 2QIOA 1ONPA 1R6DA 1YGYA 5TC4A 3RWBA 4AJJA 4F45A 2I9PA 2NVUA 3CZMA 4OOFA 4BO7A 3WIDA 1IYZA 3OIDA 2HK7A 3Q6IA 4BNVA 3BYZA 3DBLA 4Z0TA 3WYCA 5T57A 1ONOA 3Q2KA 2PD6A 2C7GA 2DU8A 3VKUA 2EGGA 4BV8A 4E2WA 3ZU3A 4XQEA 3FPLA 3P5SA 2PZLA 4G81A 4FR5A 4IIUA 4LCJA 4XYBA 4FOSA 3QRWA 1WVGA 1GTMA 1ZK3A 2IZZA 4CQLB 3K73O 3MJ4A 2C5EA 3QIVA 1OI7A 3IKVA 2GR9A 3U3XA 4CM4B 5GZ3A 3BMCB 5U9CA 2YHIA 3SX2A 1VL8A 2J3HA 1Q2XA 1PWXA 2NADA 5IJZA 3GMSA 1EMDA 1GYQA 4YTEA 5JDCC 2X8LA 1F12A 4ALIA 1BWSA 2IEDA 2X22A 4HNGA 4CQMD 1PGOA 4K26A 1PTJA 2Q1TA 5KJ1A 3K9QO 2ZTVA 4YAJA 2HK8A 3V1UA 1U7HA 3AFMA 4J90A 4BO1A 4XWYA 4NJOA 5HRUA 2H63A 1I2BA 1K3TA 1Y9EA 1I3LA 2C20A 3P2OA 5A3JA 8ADHA 4EI2A 3ONDA 4RVDA 3PK0A 2Q46A 2ZTMA 3DAPA 1RYDA 1E3IA 2Q4BA 1YWGO 3ON5A 4URFA 4XA8A 4Z9XA 3IP3A 3PIIA 2X9VA 1DAOA 2HU2A 3GFBA 4O1MA 4M1QA 4RQTA 4RO0A 3NT2A 4WEQA 4ZICA 1E3SA 3AUSA 3LC7O 3N74A 2Q99A 1PGPA 2I65A 2PZKA 3MJVA 2WD7B 1Y5MA 2JAHA 4JBIA 1NTOA 4NHEA 4QTZA 1U28A 2VCYA 2RCYA 4ZHSA 4N7RA 6ADHA 4J43A 3BMOB 4FIZA 3DR3A 3TN7A 3UVEA 1P44A 5JMWA 1NQTA 1V6AA 2DKNA 3OJLA 4IDFA 4BNLA 3QWAA 3RUDA 4EJMA 3OBBA 3ZWBA 4CL3A 2P4QA 1DC5A 1E1KA 3FN4A 1F8GA 4INAA 3LQFA 4ID9A 3PYXA 2BFAA 3LU1A 5FYDA 1ZK0A 1XIVA 3QVTA 4RF2A 2BELA 4D79A 3DOCA 1HDZA 2CVZA 4WASA 1KVTA 2HO5A 4DMLA 1CF2O 4XIYA 1H94A 4L0QA 5H82A 4XD2A 1HWYA 1B8UA 4OJNA 4TZTA 3I6QA 3Q11A 3IC5A 1MG5A 2CY0A 3ZU4A 4GX5A 2VWGA 4NFYA 5IFLA 1QV6A 3TPCA 5DBFA 1EQ2A 4RDHA 1ZKMA 2J5QA 3DZHA 3BHMA 1LSJA 4ALNA 5HM8A 1X1TA 3ZWOA 4NQZA 4CMIB 5A9SB 5C3MA 4HBGA 4EEZA 3B20A 5L7WA 4R3WA 5KVVA 5EESA 4OMUA 5HBRA 5JC1A 2PGJA 3NDRA 3RU9A 3PVZA 3HZZA 4Z9FA 3T4EA 3PJEA 5IZ4A 4HFRA 1ZSYA 4DIFA 5L40A 3PQDA 1PX0A 4BO3A 3AOGA 4BV9A 1WWKA 4MPDA 3TOXA 2JKVA 1ARZA 4ZQGA 4HKTA 4TKLA 3VPHA 4LMRA 3E5MA 4ZJUA 3E9QA 5FI3A 2O23A 2X0RA 1IHXA 1DO8A 3KYCB 1UR5A 3NDJA 1NHWA 2DUWA 1TLTA 2VHZA 2XXBA 3ZWWA 1EK6A 3VPSA 3GNSA 4YCAA 4B3IA 1PL6A 2O3QA 5K6AC 4EUHA 4UULA 3PZBA 2G5CA 3OEYA 1YB1A 3L4BC 3RKRA 1R0LA 4DYVA 4WK6A 4ZVVA 2GDZA 4DIOA 3NYWA 2BGMA 1GQQA 2UUOA 3CSDA 3DZFA 2UAGA 1V3UA 1YQXA 3SLGA 1W6UA 5BR7A 2Z95A 4A26A 4YB8A 5AXAA 1CYDA 3V1YA 1HLPA 1ONNA 4FGWA 1P1IA 3DBHA 3VZRA 1M6HA 3RD5A 4IMRA 1ISMA 2R00A 2O7QA 4LMPA 4YRDA 2PH3A 5EN4A 4D7AA 4IQGA 4WCFB 1HDRA 1ML3A 3P2YA 5BNFA 2Y66A 1B3BA 4NU6A 3JYQA 3ROPA 4B4VA 2DPGA 4Q3NA 4QUKA 2DVMA 3EUWA 1NVGA 4R9SA 4IJKA 3SJUA 3DZJA 3IJRA 4XB2A 2Z1NA 4CLXA 3C1TA 4L75A 1T25A 4BGVA 1XDWA 3L4SO 2W8ZA 5ITVA 1L7DA 4YJFB 2JFGA 2NWQA 4KZPA 1AUPA 1RYEA 3GZNB 4IDEA 4RLHA 3UCFA 1ZSVA 4TSKA 3VKVA 4B4OA 5JBIA 3W8DA 5JLAA 1YS4A 1KERA 4MVJA 1HL3A 4IJUA 2X9NA 1Y1PA 1MFZA 3T4XA 2NTJA 3DZIA 3KM0A 1ADCA 5COBA 3U4DA 3U9LA 2GZ1A 4NNJA 2P5UA 2HUNA 3CMMA 3H7AA 5TJHA 2PK3A 2VHYA 5ER6A 2VWQA 1U4SA 5A04A 5IXYA 1KS9A 1UP7A 1UDCA 3DBRA 3E5RA 1LJ8A 4J4TA 4MIOA 4R68A 4JN6B 1GDHA 3DAGA 1MX3A 3OJ0A 5I7FA 2O50A 3V1TC 1ADBA 3IAHA 3I9KA 3GRPA 1ENYA 3HQ4O 4PLGA 3ZHXA 3L6EA 4NZ9A 2NU9A 1F17A 1H9BA 1W73A 3GDFA 2EG9A 3ZN2A 3QY9A 4HFMA 1LSOA 4BMSA 3IIEA 3TZHA 2IE0A 3MJEA 3KETA 3GZ4A 2D8AA 4MP3A 1NQ5A 4WPGA 1SB8A 5KJ6A 1HDCA 2PKQO 3RBZA 2IODA 1JA9A 1A4UA 9LDBA 1HLDA 2O3TA 1T26A 4IQ8A 5HS4A 1NVTA 1PJ4A 1U3WA 3AUAA 3TZQA 1E3EA 4PLVA 1JWAB 4QFCA 5TT1A 4Z0PA 3WNVA 3FNHA 3DHEA 4WEOA 2DBRA 1J4AA 4CM1A 1YRLA 1KC3A 3D3WA 4IXTA 4KMSA 4YT8A 1BVUA 2GASA 3TZCA 3GGGA 5B4VA 1K0UA 4K1LA 4A2CA 3MZ0A 1YVEI 5EL0A 1QLHA 4RZHA 1NP3A 5JC8A 5A06A 4AICA 3RCBA 4YEDA 2Q49A 3GH3A 2OORA 3CKYA 1LDEA 4IGEA 2VN8A 4EW6A 1QRRA 5JNLA 4TRJA 1PGJA 4HADA 4QECA 2C54A 1CEQA 1G1AA 5AVOA 1F14A 2NQTA 3BMNA 3BIOA 4S1VA 2ZKLA 4MDHA 3JV7A 4DUPA 4A0SA 2ZCUA 2EGHA 3OIFA 5KIAA 3KHUA 3WGZA 2AQHA 3JQBA 2RH8A 2DPHA 1ADFA 1CRWG 3ASVA 4B8WA 2P4HX 5L4LA 1C3VA 4GSKA 4GH5A 4XQCA 2V7PA 1PIWA 4NBUA 3WS7A 4JX8A 1A5ZA 1VKOA 3W4JA 1A27A 1KVRA 3ZZNA 5C37A 3ZU2A 4PG6A 2CFCA 3OFSA 4FBGA 3TFOA 1OMOA 1R4MA 5A02A 3DBVO 3HDJA 3KVOA 1QLJA 1L1FA 1K2WA 4C7KA 5TLSA 4CMCA 2WMDA 3PZRA 4BUCA 3DOJA 2QX7A 1LI4A 2D5AA 4O59O 1ISHA 1HZJA 1X0XA 3HWRA 2HMUA 1NBOA 3GQVA 3RBVA 2YFQA 3N58A 1Z75A 3JYNA 2XF8A 2RHRA 1QORA 3PHIA 1RJWA 1EUZA 2AE2A 4YJGA 5G2OA 4XJSA 5I7SA 2POQX 4PG7A 1EDZA 1XR3A 4GMGA 2A9FA 4MOWA 2EW2A 3EY4A 3ZWAA 1ZIDA 3B1FA 3MEQA 1K6IA 3WLFA 5ES3A 3PJFA 3JQAD 1SOVA 3JD4A 3IKTA 4WNIA 2WEKA 4D43A 3FNEA 4G5HA 4UUPA 2ZK7A 3U4CA 2QYSA 4MVJP 3GMDA 1JLLA 4P22A 1QKIA 5L7TA 4Z0HO 4Z6KA 1B15A 4Q3AA 1WPQA 2LDBA 2VTDA 1E6UA 3UXYA 6LDHA 1MC5A 3RC7A 1I30A 3D0OA 4Z3KA 4JQCA 4P8RA 1TB4A 4BNIA 1XG5A 7ADHA 1LC3A 4H15A 3D3EA 2Y67A 4DPMA 2VZ0A 1QYVA 4BNHA 4I1IA 2FWMX 1ZMOA 2VYVD 3OF2A 4OO3A 1FJHA 1GZ3A 1PSDA 4LW8A 3JQGA 2J6IA 4XKJA 3LT2A 3WGQA 4QQRA 3WQSB 3RI3A 4UAGA 2G76A 4N5MA 4C7JA 3QA9A 3WJ7A 5CP8A 1KVSA 2NSDA 1XKQA 5THKA 3BA1A 3E9NA 1YL6A 4OM8A 3TZ6A 1KEPA 5G0WA 4CQLA 1DLJA 4PCVA 3ZI0A 2FPIA 5CFZA 3BMCA 2LDXA 1IY8A 3WGYA 4J1QA 4U5QA 1ZNQO 5C7OO 5CG1A 4RGBA 2JD2A 2NUAA 2D59A 3G0OA 4J0FA 2ZB7A 3WDSA 2W2LD 3IP1A 4FDAA 2X5KO 4NPCA 4PZCA 4DMMA 2GERA 4TZKA 4R54A 3ADOA 4CM9A 4ONEA 5KVSA 1YL5A 3KXDA 1AXEA 2G1UA 4IBOA 2ZJ1A 3AU9A 3RUAA 3I6IA 5JE8A 2HAEA 3R0IA 3AY7A 5FFFA 5T5QA 4AJNA 1BG6A 2GYYA 1IUKA 3OICA 2WE7A 3I9LA 2QG4A 3RIHA 5KVQA 4DIBA 4WECA 1ISJA 2B4RO 2J3KA 2HRBA 4XR4A 1XA0A 3PWSA 3GFGA 3F3SA 5JYDA 3KZVA 3QWFA 4XRRA 2A4KA 5A5EA 2NU8A 3ZWCA 2JFFA 1MXHA 3LLSA 5DCWA 4OGWA 1M67A 2EHDA 3GN1A 4F3YA 3RAJA 4Q39A 5I8WA 4BKRA 1WDMA 4RVHA 1HDOA 5F1KA 1ZSNA 3E8XA 1DJNA 4G65A 1YKFA 3C85A 2WD7A 2GRAA 1UZMA 1PGQA 4A7PA 3QW2A 3VAZA 5EQFA 3WXBA 3IUSA 3BMOA 3GRKA 3OQ1A 4DC1A 4CJXA 1O9BA 2CSUA 5DULA 2CMDA 3HB4X 3L9XA 3HG7A 1Z7BA 3JQ8A 3L0DA 3GPDG 4WLNA 4G2NA 4L4XA 4QSMA 3V2HA 2HMVA 4GBJA 2O3SA 3P7MA 3TL2A 5TGDA 5TIIA 1UXIA 1VLLA 3H8VA 4LCEA 1XU7A 2OXIA 1OFGA 4KUEA 3GC6A 1BDBA 3HFSA 4ZD6A 1H5QA 3L6DA 3AW9A 5H83A 2VWHA 1IHYA 1IPEA 1P1HA 4BKQA 4WJZA 1I24A 2GN4A 2X5JO 2X1HA 1IZ0A 3WG9A 4NDNE 1T2FA 2YYYA 3D3WB 3G79A 4WCDA 3OJFA 4OXNA 4EITA 5G0SA 5TQVA 3PP8A 2B36A 5DT9A 3UICA 1EBUA 3KSUA 3MJCA 1P1RA 3Q2IA 2J8ZA 1JQBA 2X5OA 5I7EA 4PRLA 1DIGA 4GQAA 5CDYA 1ULSA 4IDAA 4RQUA 5A4DA 4GKBA 1W0CA 4II2A 3F4LA 2YQ5A 4FJ0A 4HNHA 5H81A 3RFXA 3CXRA 5BT9A 2YV1A 4CMIA 5A9SA 5JCJD 4UUNA 4CR7A 2YW9A 5BSGA 2JHFA 4CUZA 2P9GA 1H6AA 2WSBA 4BGEA 1IPFA 4DBZA 1SO8A 1X14A 3VVBA 4ND4A 3GUYA 3KYDB 4CV0A 1IULA 3ZV4A 5MDHA 2OZPA 1W8DA 2PGDA 1Y9AA 1TI7A 2I3AA 3JQ7B 5JDIA 1PJQA 2GSDA 1K6JA 2FPGA
chains in the Genus database with same CATH superfamily
1EWTA 2A0YA 1FMTA 3KYCA 4B82A 1DEOA 3F7MA 2CXUA 1XNJA 3JYPA 3PDCA 3MINA 1S1CA 3UH1A 1C9DB 4CM6A 1KK2A 1HYEA 4GP7A 1GPJA 3FWNA 3I9JA 4YJ3B 1J2TA 3RAEC 4H3KB 5GV7A 4HJRA 4KUGA 1XYGA 2QI9C 4LEIA 2IYOA 4E4RA 1IPHA 3W5DA 1EK0A 3JD3A 4XQ0A 3OIUA 3UQZA 4IHJF 3BE8A 4B3JA 3UY4A 4AURA 1YTUA 2O3UA 8AT1A 2PWZA 4PLFA 1KY4A 5DTJA 3W5BA 3A0RB 2VP0A 3DTTA 2NOAA 4WLOA 4IW3B 1YGPA 3DMDA 1XA4A 3LDUA 2RHCA 5JZSA 1KEEA 4TROA 3H86A 1L3IA 3G8YA 5E3JA 3NVAA 4MQEB 4UMVA 5D3KA 5IU6A 1BHO1 3ZHUA 2PV0A 2W2TA 1XTRA 1U65A 1EFHA 4H4CA 2PXXA 3K0CC 4EO9A 4I55A 4OK3A 1MABA 4WN9A 5CA1B 3KSDO 3QKIA 4OP2A 3G49A 5KYKA 1DO2A 2QUKA 1Q1GA 5H0IA 4Z49A 4ENSA 1OV6A 3BX1A 3V4OA 1DEAA 5BV2P 3FYSA 3GRFA 2GARA 4C87A 2WM9B 2IOHA 5IAAA 2HLNA 1ZW6A 1ZBQA 3LX8A 1SR8A 1U9CA 1XZKA 4ZIRB 3FDJA 4AJ4A 4DWVA 1E6LA 5I5EA 4OLJA 4RPGA 2XCTB 3JYLA 2FG7C 1Q95A 2HRZA 4FYXA 2E3JA 2BLNA 5SYAA 4HZIA 3IEKA 2XBMA 2EZUA 4JQYA 4LJKA 1AG9A 3KTDA 2IIQA 4P3PA 4U6NA 3W5AA 5IASA 4PGMA 4CKXA 3QKSA 4JXJA 5T67A 2EKQA 1PW5A 4FFLA 2HA3A 3JQGB 5F21A 5I6DA 5ADWA 4YRNA 3C3WA 4MIYA 2UU9B 4XGQA 4W4TA 1Y8QB 1OUMA 4FSHA 1L7EA 3CCCA 5KYYA 2JL1A 5KTYA 1CF9A 1ZMTA 3AJ8A 3KXLA 2C3UA 1J00A 2X0IA 2O5EA 5HUQA 3F6CA 1FW8A 1E6WA 1U2DA 1Q17A 4MNTA 1YK1A 4D9NA 2EJWA 3H16A 4PPNA 5LUBA 3S44A 3OFNA 3OSUA 2G36A 4LVUA 1O7JA 4E11A 1DJPA 4AO8A 3UJ9A 5KTKA 1AHIA 2QD5A 3OWHA 1XD8A 5EPOA 4Y6SA 4QAJA 1CQZA 3KVVA 4TV9F 1K27A 3O3CA 4R81A 3SZLA 4CF6A 5FOQA 3DTYA 3V7UA 3BD8A 2XRMA 4B1FA 1XXHE 5TF4A 2Q5LA 2RB5A 2PWAA 5TQ0B 2VTEA 1WAMA 3DB2A 5IBQA 3NM4A 1AS3A 1Z6YA 2WY2D 3RIXA 2X2PA 3NMUF 2BDUA 4RE5A 1E7YA 3VOSA 2GJAA 4IQ4A 4Q3KA 1J1IA 1PLJA 1Y4DE 2NPOA 3DHYA 5AIAA 1KDZA 3QIAA 1R6BX 1E9CA 2ZUCA 2JH3A 3KOMA 2YVKA 2Q1YA 3GT7A 4CTMA 2KSQA 3NUGA 5GM2A 1MLDA 1W4ZA 2ZJ7A 2XGGA 2ATIA 4PZDA 1QYWA 3TK1A 3O03A 2FPSA 3I2JA 4DEYA 1PJSA 4LWPA 4FNAA 2BI7A 4J2OA 5TARA 2YVLA 1DSSG 3D4LA 3WLIA 3BKXA 4Y9UA 5C4GB 1ZOPA 5JXWA 3G2MA 3UW3A 1EWQA 2BVNA 4ASUD 4BUZA 5IC4A 6YASA 3HHPA 1KI2A 1E9VA 1R9JA 2FN3A 1FQWA 4IIJA 5JQGF 1GSOA 1Z5WA 2GN6A 4FN4A 3SSMA 1GA4A 1QGAA 1YZTA 2HA5A 1D1TA 1E61A 4L8WB 4R5HA 1UBCA 2NNLD 2JCVA 4IFEA 1BMFA 3VR0A 5IN4A 1AB6A 3EYAA 3PC4A 1HSZA 1N4AA 3RSZA 2LWIA 1ZXLA 3N0WA 2LIVA 3O9VA 1QRUA 2CLDX 2NXNA 1U02A 1RBMA 1NLZA 1S2MA 2CDBA 3CJQA 2C4UA 1F2TA 2OG2A 4PYLA 3UC5A 2F1RA 3KR1A 4D45A 4LSWA 1YJCA 3JALB 3JQ8B 2HD4A 3JQ6A 3OSZA 5EEHA 1JA1A 3NAGA 3H2BA 2CFTA 5SICE 2H0AA 5FPQA 3CJTA 2B78A 1CE8B 4QBGB 1CZRA 4GI2A 3JQ9A 1MDFA 1Q20A 1Y63A 2QMEA 2VSYA 3C43A 3AL0C 2OORC 2J9ZB 4MQBA 4QULA 4BMCA 1WL8A 4ZT2A 2QRHA 5J5AA 4AQYB 1N2IA 3SC6A 1OWOA 3PPVA 1RWNA 1H2ZA 3AJDA 4FI3C 3EEFA 4G1BA 4IS2A 1NA5A 2O2YA 1CKEA 4PZEA 4LZOA 1C0PA 1X15A 2BMVA 1D03A 3A9CA 3AI7A 2G83A 3MGBA 2BFNA 2FX3A 1AUXA 4MV0A 3OHSX 3WLKX 3W5CA 1YR6A 1UXGA 4UD6A 2N46A 4FZ3A 4EMUA 3B1XA 4Q3BA 2VP9A 3MHPA 5ITZA 3IIMA 1VG9B 1C8BA 4IQ0A 1FP7A 5FI5A 4R83A 4EY8A 4RPLA 3OJWA 1Q7RA 4I1SA 4BGDA 5K6RA 4C0QC 2VJAA 3C98A 3M1LA 4CTOA 4HAZA 2FDCA 4XOIA 1NDUA 1RZRD 1P4RA 1M1UA 2P5YA 4AJ9A 6Q21A 1XRPA 1MAHA 5A1JA 3IBSA 2R0QC 3EVTA 1ULUA 4HWOA 2ILVA 1AV7A 4ND1A 3RG8A 6CHYA 3FIUA 3SM9A 3Q6MA 4G0XA 1Q44A 4JNCA 1Q11A 2R4QA 1GCIA 1RKQA 3CZPA 3IP5A 4WERA 4ZAFA 4E08A 2XTJA 3E5NA 3NGLA 1EIZA 1UMDA 2D1SA 2FEMA 2FSGA 4MUMA 3IA7A 4FZJA 5D3MA 2I7DA 4M1YA 1JA0A 1JG3A 2ECFA 2F9LA 4HWPA 5TVKA 1Y3IA 1B1AA 4JU8A 3GIDA 4LQLA 4MWEA 4W63A 4DQVA 1WBDA 3Q7EA 4WBNF 1DGQA 3NIWA 3BFJA 4YBRA 1RYYA 2J33A 4ZPJA 1K89A 2B5VA 2X58A 3ITKA 2Q5FA 1M8FA 3D3JA 1F5NA 2AVNA 3DYBA 3WLSA 1GPBA 5AVZA 4GSLA 1P9WA 1XHFA 2DLDA 3I5MA 3CN7A 3OTIA 2GD0A 5DSXA 1N33B 2O8EB 1J9EA 3VH1A 3CXUA 2P6UA 1T10A 1XEFA 1ZD9A 1PJBA 2F9MA 2I54A 4D8YA 5B58C 3REGA 3K70B 3A9WA 2V65A 3NHMA 4O4LA 5JS2A 3R3UA 4IIVA 3KB6A 1E7RA 1G8JA 2AKAB 1T24A 3KFVA 4F3TA 1U80A 1M6WA 2JJYA 3ANNA 1U90A 1GKYA 1N0HA 3BTUA 3MF4A 16PKA 1LDYA 2XEDA 3V6MA 1CDOA 3VVCA 2E49A 1FB5A 1H6BA 1TU4A 5BVHA 1BJKA 4PWZA 5GMOA 1XHEA 3B6EA 1K0FA 2YZKA 3KQYA 4PPQA 3TWOA 3C1OA 4UPEA 3AJ9A 4PLCA 5E7QA 1N1DA 1FNDA 4F71A 2XUKA 3S5UA 2YWFA 3IRUA 3PXAA 2FE4A 4C9BA 3AK4A 5ARDA 3LIIA 4L8GA 1XN1A 2XDYA 3F49S 3IKMB 4G2TA 3T7EA 2M2IA 3KPJA 4D42A 2QTTA 1CETA 3KQNA 5GINE 1V8DA 2WTNA 4KSBA 1HYQA 1UJNA 1J0CA 2FFAA 2Y1OA 3QPCA 4C6TA 3QEAZ 1DJQA 2VUTA 4HWKA 4WOCA 5BV0A 1HNWB 3GLGA 1BAPA 4MDFA 3I45A 1L5MA 3PTLA 3ONFA 2Q2WA 3TLBA 2XDWA 4PFSA 2IW1A 5K3SA 2XITA 5L9AA 4I55B 2M6RA 2OUIA 4WN9B 1ZCJA 4ZAZA 4AKTA 2PS9A 2HA6A 1RWWA 4Y2GA 2Y1LA 3PXBA 2RGWA 3IXQA 1OLOA 1ZLYA 1G4HA 2WJ4A 4RF3A 3ZIAD 5SYMA 1WHSB 2GEDA 3A1WA 3VR5D 2PRJA 2OKCA 3ADPA 3EEBA 2H00A 4QLBA 1SD5A 4ZOCA 5TPZD 3MS2A 4EI8A 3JASB 3OLVA 1EFRA 3AV0B 1T9CA 1GRQA 3HI4A 1Y81A 3R7BA 4ZYLA 1TDJA 4JA0A 1P0PA 5FAKA 3PIDA 4ZRDA 1OYVA 3C3AA 2D0PB 1RJEA 2R66A 5FPYA 3BN3A 2VTVA 2AF3C 5BPFA 2UXCB 1P61B 4HPJB 3GJ3A 5LM3A 3G0HA 3JAWA 2OFOA 3O8OB 3UJ6A 2MSEB 5AUNB 3ELBA 3D4IA 3TB6A 2WV9A 4G5GA 3RM3A 3OEEA 3OT5A 4R2WA 3WK6A 4CCWA 1XMQB 1Y9DA 5KYYB 4NV3A 2O2XA 2FRDA 4Q4HA 2FP3A 4YX9A 4PSUA 5SZIA 3LF2A 2GN1A 2PCLA 4YPFA 3JYHA 2NZVG 2ZT6A 2C7PA 1GNVA 1AKEA 3UBMA 1JMYA 2W2NA 3ZNOA 4BE7B 4EUKA 2V7QD 4ON9A 1L8LA 1FUKA 5GIPE 1ETUA 1L5OA 4DSZA 1Q15A 3SY8A 1SQ0A 2OB2A 3AXTA 1ZW1A 1EEHA 5AKYA 5J2UB 3GJ6A 1BWPA 3H3XA 4OA5A 1B0ZA 2UV8A 2E48A 4MUXA 5F52A 3VUFA 1H0KA 2PFGA 3HB0A 4IUCS 4A6EA 5E3HA 2D8MA 3AU8A 1ZINA 4LVCA 4D0RA 4INJA 1Z29A 1A7KA 1KS2A 4JBHA 1NP7A 4B3HA 2RH4A 5KX5F 1KYYA 3FOZA 1GRCA 2O5VA 4CBVA 3OMWA 1Q0QA 1N9GB 1N7GA 1WCIB 4KDEA 4WVFA 1WHTB 3BTVA 2XNDD 3OQMA 3REOA 1VLMA 3TO5A 1LCIA 1V35A 5EZ5A 5C0OE 2OFPA 4ZYYA 5MHTA 1BGVA 3BA6A 4UEWA 2FUG1 4YRMA 4MROA 1X8LA 2RH9B 2YNMA 3ZWPA 1RFGE 1SXJE 3BWDD 3RVBA 4IOMA 1KJWA 1DAEA 4EKYA 3U09A 1EKXA 1JHPA 1UMBA 4IIJB 2GHRA 4JC0A 4NULA 1JYFA 5B36A 3ROGA 4OPMA 3NXSA 1PJCA 4QYIA 1FXSA 3ED5A 2WNSA 4EFDA 1DINA 1H2RS 1WQ3A 1ZQ9A 2Q6OA 3MCZA 3MT9A 4P92A 4BFTA 1UXKA 5G3YA 1QGYA 4YRIA 3JWJA 2X8AA 2J48A 2YX1A 3OLZA 3X2EA 4G0VA 3V2IA 1JEQA 4CDRA 1VL0A 1JPUA 1QVAA 1SPXA 1XF1A 2UYCA 1SBTA 2PZGA 2ZSUA 1F2TB 1NQOA 4K6CA 1KE1A 4BAUA 5I4CA 2C9ZA 4LRUA 4V0SA 2BGWA 1H8HD 1NJ8A 1E2MA 1RXSA 1Z82A 2X2EA 2FXIA 1QR2A 4KZKA 4JZKA 5J59A 3W1WA 3B8EA 3NKVA 4QQNA 1T4GA 1RNLA 1LPPA 4MTLA 5EPUA 4V39A 4JLVA 2ECKA 1Z0FA 5GM1A 2GMWA 3W6UA 2HXGA 2WVGA 2KI5A 1HTWA 3JR3A 4QXPA 4R2JA 3S7ZA 4RK6A 3UG7A 4DCTA 1PW7A 3ET4A 3JQ7A 5DF1A 1GRRA 5JTUA 2E4XA 3QHQA 3IB6A 2R6JA 3FBGA 2WF6A 5CYFA 1E8DA 1T8WA 3UWDA 3T5MA 4Q9IA 2F48A 4BY9E 3D5QA 2VPIA 2H4ZA 3N3BC 3P2KA 4OL9A 2Y0BA 4W99A 3N8IA 3PNKA 4FOPA 3V4VB 4CV3A 5BRNA 3TNYA 3CSSA 3LSYA 3ZE2B 1QTNA 3KWMA 5ITZB 3C7CB 4Q02A 1DNPA 1LBIA 1I1NA 1TF2A 3M1YA 1SU8A 5LUAA 4ZOQI 2XE8A 2XECA 1J8QA 3PHJA 4N7BA 5HW0A 2Y8EA 1N0WA 4Y2SA 3SWWA 2A9QA 1IOLA 2YHUA 3A9SA 4MB6A 1XEWY 5LFAA 2BM9A 1GNPA 4BEBA 3SYMA 3P9SA 5E1MA 5I9TA 2D1QA 2OCYC 3HUFA 2LCIA 5KJFA 1QDUA 1SRRA 4C07A 3ZLUA 2CB9A 3FVWA 3OX2A 4DV7B 2YY5A 2FETA 3IUBA 1GTZA 1MC4A 3O8QA 4QPJC 4JBWA 2ID7A 4WLUA 5K3FA 1U0OC 2IZ0A 5L7YA 2GBCA 1BU8A 5AKKA 2YXBA 2ZYDA 2MCFA 2ZSBA 1TJYA 4OYRA 1ADYA 3BWYA 3NETA 2O07A 4NAVA 3JTEA 1SXPA 5TE9A 4LBZA 3K0AB 1LSUA 2O6HA 1V11A 3OE4A 4LDNA 4TMFA 5DDIP 4C3ZA 1PHRA 1QQ6A 4S1TA 5F3RA 4A6DA 2KW5A 1J7KA 1ISGA 1MOSA 1AMOA 5A0VA 3GP8A 4I9FA 3FF1A 3B6ZA 2CMGA 1II9A 1EX6A 1N1GA 1YR7A 2VO1A 3B2NA 3E58A 3HY4A 4E6EA 5AP9A 4E1BA 3NOOA 3PPWA 5G0TA 4U0JA 1PZMA 4I5EA 1X87A 2JFZA 4YRTA 5FULA 2F8SA 5AI4A 2VOEA 3GP3A 4B75A 1GPKA 1EX9A 2IHTA 4FMCF 2WLTA 2ZIAA 3GAFA 3LFUA 3R6LA 4BJ1A 2H1OA 3KZMA 4NPAA 4QHTA 1W34A 4YQYA 5BVHB 3RK4A 4K81B 4OHOA 4JBNA 1QMPA 2XJ4A 4OBWA 3VR3A 2IPMA 2BGGA 3EVZA 5EWMB 3BBPA 4YGXB 3CEMA 1SNYA 5KU7A 3MUNA 1I14A 1VG8A 2QW0X 1KAMA 4EB6A 3IUJA 2ACEA 1JDBB 1RACA 4WOPA 3BGVA 3E3OA 2E4YA 3KAKA 4EG0A 3A1TA 1LEHA 2FOIA 1SK8A 3ZQ4A 5EYPA 4EA9A 1R0BA 5JRDS 3UW1A 4G0ZA 5BSEA 1CRQA 5AMXA 4I6EA 5JO9A 5JJIA 4LQDA 1XL0A 1W4LA 1I33A 1X13A 3RROA 4E2ZA 4RY9A 3FVVA 5L3ZA 3DW1X 2X8JA 1KJZA 1ZZEA 3G5AA 5L3VA 4GLLA 2WIGA 4JLPA 1C3EA 1QX4A 1E77A 1W8IA 1V5GA 3W9YA 4CWAA 4JVSB 5NULA 1WMSA 2BFPA 2FB9A 1KAGA 1GG8A 1NNSA 2B98A 4FZ5A 4KWCA 4ZAWA 4QDXA 1ZK2A 2HBYA 3HCDA 1XCMA 5GOTA 5KWSA 2CHFA 2RAFA 3U3JA 2J9RA 4W9NC 2ONKA 2XUQA 2WVJA 3DBOB 2QX8A 1N3BA 1NW5A 3NKLA 2BKLA 3ZGVA 3ZV3A 4E5PA 3PEYA 2BIFA 4B7AA 2AR9A 3SBOA 2Z2YA 4FPXA 4MV4A 3S3TA 2WTBA 4FOLA 2IL1A 1TK2A 3I61A 3F3KA 3H18A 4OEHA 3PWZA 4PIVA 5G4KA 3QVJA 2GTPA 3T9AA 2IDJA 2IYNA 3CEJA 2HPVA 1CT9A 1H3EA 1Z6AA 3OG9A 1C3JA 3I62A 3U16A 1GDDA 1DG1G 4IV0A 3WFJA 1UKZA 3TE6A 4P0QB 1CQWA 4L76A 1MEEA 1Q7TA 1GU0A 4RPHA 2CJXA 1Z35A 2ZVDA 1XALA 1N3IA 3DQQA 1U8EA 1R4ZA 2FI1A 4DMUB 2EKBA 1N2XA 2PMCA 2Z08A 2PRIA 3F2VA 5CLIA 4K7JA 1EK5A 5DNWA 1WXGA 4EMBA 3HDYA 1W581 2JLVA 3DHNA 2AFHB 3OT4A 4PAGA 5MF6A 3R3JA 4DJEC 2A5LA 1Z16A 4J49A 3K2QA 5LBTA 2PZ8A 4AT1A 2MSKA 4M0PA 4BNKA 3QJYA 1F2DA 4WA7A 4DTIA 3U4AA 4BLTA 5EHNA 3MM4A 4C4PA 3KJHA 3V55A 2H2IA 4BNZA 3KJGA 2QRLA 2HV8A 3NKFA 4GX0A 1MT3A 5L3SA 4ZKEA 2A1TS 4EJ6A 1QF6A 4QGBA 4ZJZA 3VU1A 2BZGA 3VYWA 3R0XA 3RABA 3LS2A 4KRFA 1P4SA 2RGEA 3GFOA 1Y5LA 4WOJA 2H31A 2GCPA 1K6MA 1T8RA 4QSHA 4N39A 2B2CA 4B09A 1DHTA 3A0UA 3CEPB 4TMXA 1ZEMA 1UMBB 1WV0A 1ODSA 2VSFA 4Q21A 2C8KA 4WLVA 4OYHA 1UBOS 1OTYA 1UADA 2JIPA 5BMVA 3AI2A 5K0TA 1BOOA 3GO4A 2VG8A 3HBAA 4U39A 4X64B 2GZRA 1PZEA 2AMJA 5IBPA 3UFXA 5AW3A 2F4NA 4ALLA 2QGFA 1RKUA 2FUKA 1U1DA 3L77A 3KQHA 4KE8A 3H1PA 3FSGD 1VL2A 2EQAA 1KMCA 1JDTA 3KTOA 3F47A 3LBNA 1U2GC 1SCJA 4X66B 4DRXB 5JQWA 3I64A 4FYWA 3W4IA 3U49A 4I50F 9GPBA 2XMDA 1XN4A 2WQZA 3JCZA 3KJNA 3B5JA 4L9WA 2DEUA 2A0WA 1QANA 4MW4A 4K05A 1PR3A 2JJ8A 4CT5A 3RYHA 4ERNA 5IKEA 3T5PA 1JYSA 3I2FA 2V0GA 1XCJA 5EIAA 2FMHA 4MVJI 5BORA 5AW2A 4IVNA 3K8ZA 1CEEA 4TLDA 2YJNA 4DARA 3W79A 4O08A 3BFVA 3WSVA 1HETA 1PJLA 1U8ZA 3SF8B 2O2CA 1IHOA 1VECA 5COQA 1F6WA 2WAXA 3R9XB 2YC2C 3CVJA 3C5VA 4XM0A 3RFVA 4W7IA 4Z4CA 4KK3A 5GJVC 3TPFA 2HPZA 5LP6F 4N41A 2PTGA 2JLAA 1IBSA 2CBXA 4HB2A 3B6JA 3DO6A 4AZSA 2PGIA 3HFRA 2Q4TA 3I8SA 5CDFE 4ZCIA 3L18A 3R5FA 1N8TA 4JVOA 1NMXA 5DHSA 1QU2A 4UNNA 4FFDA 3OF3A 2QIPA 2JKZA 1E8NA 1O96B 1E2HA 3Q87B 4MW0A 1E4VA 4I1VA 3WZLA 1DX9A 3HN2A 2XODA 4CM5A 3JWPA 2QT0A 4FU0A 5C7LO 3U7QA 4K2HA 4CTJA 5ECDA 3QVSA 4HD8A 4KO8A 4TKZA 2CCGA 2ZRLA 4NYJR 5CIWA 1WD5A 2A2ZA 4ZCSA 3RU7A 3TZBA 4K8RB 3ZWMA 3D31A 4WA8A 4WK2B 5ITWA 5FEUA 2RHOA 4B34A 1D7AA 3WQBA 1RFLA 2OO3A 2HDOA 1EVLA 2GLUA 3CU5A 1U0RA 3HABA 5K3FB 4GE0A 1XRRA 5EXSA 5E2IA 4XQ9A 2W93A 1D8TA 4F2HA 4NZZA 4FCTA 5CD9A 2QT1A 4GUAA 5BN5B 4CQJA 5TJ9A 4FE3A 3V1KA 3VNQA 1P1JA 1JEDA 1YOVB 4G1VA 1ABBA 2XEXA 4HDCA 2FK8A 1F4VA 3Q0EA 1T4BA 1ZKDA 2UUPA 1DUIA 3C87A 4LNUB 4RV4A 2J3LA 1LDGA 5HIJA 3WKEA 3AM3A 3SJAA 4DUGA 1VFPA 3W1VA 1JVNA 4EF4A 2PA3A 3R1IA 3Q8XB 5I9MA 3AKEA 3G2KA 2HJRA 1T9BA 2FSVC 1KGDA 2IZ1A 3OTHA 5C32A 1GT91 4ZI5A 4DPLA 4F5YA 3Q9UA 421PA 4YPOA 1SHJA 2HZ7A 1NW4A 1Q7GA 1XXLA 2PQ2A 2VHQA 5JI2E 5FO0A 4MQFA 2C5AA 2H1SA 4Q3CA 2ZIEA 4M54A 3FSRA 5JAUA 2DTEA 3ZS9A 3WDKA 4M83A 1ENZA 4JWTA 1B41A 1Z62A 4JUAA 2DTXA 3QMPA 1XLTA 1ST3A 2MDTA 3KD3A 1GTL1 4B46A 2VPYA 1I32A 4DL9A 5GZ6A 1L4YA 5T8KC 1N2CE 4IIXA 1P8JA 1HE2A 1NQVA 5IP5A 1G291 3PNPA 5IVHA 4Y2RA 5KNCH 1GTSA 2PSDA 2CNWD 2ADOA 4CDMA 1XU9A 1LVUA 4RMJA 2VBFA 3FNGA 3CE6A 2R6DA 3EUFA 3KQMA 4TUYA 2PGAA 1OXTA 3GCWA 1N0VC 3DE7X 5D5PA 2OY0A 3HM2A 4NCJA 5E7IA 5B1DA 2WG0A 3OESA 5BURA 2QL6A 2VAMA 4L08A 4TWZA 4D25A 2ZZKA 3H5OA 4YRGA 4N3AA 2BMAA 3T5AA 2I2AA 4X1IA 3I1YA 3PQEA 2XMGA 3PQ6A 2YJZA 4PVDA 2J7KA 4RMIA 5JXJA 4FVTA 2WT9A 2CCKA 1PD0A 4QT4A 1F0PA 2P2LA 1DAMA 2NYUA 2O2JA 1HFKA 1YBMA 5ER9A 3CLUD 4Z5XA 2COKA 1R6UA 3M6IA 3R5TA 1DOZA 4JBGA 4B3RB 2UVPA 2XUAA 1FP2A 3EVNA 1L4EA 4K6FA 3L7LA 4CU5A 1LQUA 1FDSA 3GLQA 3PUZA 4R5MA 3WICA 4KN6A 3WAGA 3HE3A 1CERA 1PEDA 2OVFA 3PUXA 4X20A 2X23A 3ER6A 4Y6OA 1NXPA 2WAMA 3QEKA 4Q3OA 3RU2A 3JPWA 2H2DA 3R9IA 3UJDA 4CR6A 1JQAA 3WJ1A 4X8OA 3L8CA 3FR7A 4IF6A 1JSLA 4JWKA 2Y6VA 1JG6A 2YWDA 3A58B 4IDQA 1OXKB 4MW2A 5EP1A 3QI7A 2FPUA 1N6PA 4LHYA 5G4KB 3NQ41 3EWSA 1YVPA 2YV4A 1O9HA 1IRIA 3LT0A 1Z4IA 2DRIA 4CLDA 2VHUA 5LD2C 2FR8A 5TMEA 4CLRB 1MRSA 3VHQA 1NBWB 1AURA 2BFFA 2ZBQA 1OASA 1H9AA 5BYBA 1TQ6A 4WZZA 4BTLA 5IYZB 1G38A 1GLNA 1TW2A 2CXTA 2GKGA 4TYPA 4BCCA 1LXCA 1N92A 5EIBC 3FFTA 3CNQS 1AKRA 2IYEA 4NE2A 1ZWLA 4WL0A 3G2PA 4L28A 3UV3A 5JOQA 1EDEA 3TEFA 2VP5A 1ODLA 3NS7A 4GS5A 3SNKA 4KW7A 4UNPA 5LN1A 1L1EA 1TPZA 4MYTA 5D85A 1DQRA 4GM4A 3V7WA 1KO5A 5DBEX 1T5BA 5EZYF 5E1DA 4ZEVA 3QLVC 1CFJA 4NMMA 4FX2A 2WU8A 1RJ9A 1KJYA 1R9GA 4HRAA 4RAOA 3H9QA 3KEFA 5AVSA 3QSYA 1L5RA 4BWVA 2OE2A 4CF7A 2CNNA 2OENG 1PR9A 3R3WA 4AWAA 5DISB 3OFND 1GR0A 1P39A 4V0KA 1PP4A 2VZ8A 4D8TA 1LS1A 1TCBA 1YJ5A 4UDYX 2V59A 2AUMA 2C83A 2OO5C 3LUHA 2PLAA 5TRTA 4AKEA 4X1KB 4Q1EA 3TLEA 5BYKA 5ERXA 3G8BA 2Y71A 2IZ7A 4EUEA 3ZDFA 1J7JA 1JTEA 2RH5A 3O21A 4YP6A 3NM6B 3D8NA 1PEYA 5FFNA 4Q7EA 3TJRA 2AJTA 5HYVA 3CH7A 5CB4A 4PIPA 4JXKA 3T5GA 5IXJA 2NTNA 2HB6A 3SHWA 3H5VA 1E5QA 5HF5A 1IN1A 5ALVA 1QYCA 2QSYA 9LDTA 3B1ZA 3QLJA 1C3OB 2R6HA 3OZWA 2F1JA 4B5KA 1OTHA 3MIIA 5BT8A 2X9LA 2OHIA 3CO0S 5I4KA 1GUDA 5TEWA 4JU9A 1ZONA 3A6GA 3O26A 4Z8YA 1BW9A 1ZN7A 4Q82A 5K20A 2FEXA 3RYHB 2ZR0A 5ALFA 1BDIA 1KRWA 4IIDA 1UK9A 5B3JA 3ZW9A 2GM4A 1KOGA 4RYLA 4EKIA 3UPTA 1JHQA 3RADC 3SLKA 1BMFD 4KFTA 1NQXA 2CW5A 3WTBA 2ON6A 3DE6X 1EFLA 3KTFA 4YQEA 3T0FA 4FDTA 1UPAA 1DC7A 1THZA 3TKYA 2VHTA 3MN1A 1SBQA 4KLAA 1AQJA 1TXGA 3PL1A 3DZKA 3LP5A 3EUEA 3L7KA 2M32A 1GPUA 1ZG3A 3LVBA 4IEIA 3U7IA 4BGIA 3V00A 3DDZX 5KWEA 3IPLA 1SU4A 1UJBA 3LXXA 4LYGA 4LISA 1OZAA 2C04A 2X8WA 2INGX 3KEQA 1SUFA 1RXWA 4IG4A 2X7JA 5BN4B 2F59A 3MRXA 2H2AA 3FTDA 2PYZA 2ZRNA 2O4UX 3DO5A 4Y9TA 3VO9A 2BJWA 3WMWA 1P0MA 3U7QB 1AKTA 1A04A 1JDUA 2W2KB 4YN3A 4MA4A 2WOOA 3EIQA 3O3OB 3PNMA 3JWIA 1IY9A 1NZDA 2HWKA 3SQMA 4RF4A 5BR1A 1TJ4A 4ZYXA 4GC5A 4DV4B 2GAFA 2B69A 2F1KA 3S2FA 1TCUA 3BD9A 5JD4A 4RD0A 4RNCA 4XCVA 5HS6A 5J1TB 4GZ3A 4LYJA 2QLFA 1THTA 4JP1A 3ZBUA 4HLQB 1C7ZA 4KAJA 2BY4A 1PLLA 2O3JA 2QJRA 1ZHHA 1G8FA 2AWNA 1ZM7A 3PYMA 3RHSA 3S8MA 2J4CA 4FSDA 3C4JA 4BBJA 4HDMA 2OP0A 3CGGA 3K0FA 4R2XA 2WT4A 3CPHA 3OOSA 1ISRA 1Z8FA 2W6JA 4RNDB 3TIIA 3NWPA 2ZZNA 4EVIA 2WFZA 3GYBA 4BPRA 2C5GA 3U2QA 1HE4A 2PNFA 3HU3A 1C2YA 2EIHA 1U3VA 3BXXA 1BFDA 3AOEC 1NLMA 2HDNB 4RIEA 3M70A 4PGHA 3IPXA 3N8GA 3E05A 1DT3A 2GCNA 4GOXA 3O31A 2G82A 3KOYA 1YDWA 1B6GA 1YQEA 2GH1A 3PXEA 3OZTA 4KUHA 2V96A 4GZ6A 2D0DA 4RFSB 5BUQA 1XF9A 5K8TA 2J6CA 4O0MA 5EUQB 5B6JA 5KEIA 1SXQA 1E92A 2Z04A 4HQFA 4ND3A 4JQZA 3HLKA 5LU8A 1XMPA 2HRQA 4HTAA 2EV9A 3B1WA 3CH5A 1V26A 1UT6A 3HZHA 3N0VA 3RS2A 4I1PA 1TM3E 4XUCA 3PJGA 1QH1A 5D6NA 1RCFA 1UBKS 3BAZA 4KE9A 5DLDA 4I3GA 5EIOA 5EJ7A 5HVNA 2I8AA 3WX0A 3ICQB 2ONJA 1MB0A 4LXQA 1I3CA 2DH6A 2P2CA 3AILA 1XTSA 5DP1A 1TPYA 3G9TA 2I34A 1G98A 3LFTA 3OTWA 1DC6A 1QH9A 3MTGA 2DM6A 1U5CA 3D8BA 1J5PA 3DBLB 4MQ4A 3F6PA 4M7PA 1K3UB 4R3UC 5YASA 1NNI1 2GJ8A 3ZJYA 3KYBA 1M1NA 3G2HA 3ENWA 1PV1A 4X1IB 2UVDA 4GPAA 4CL8A 2PUHA 3V6LA 3PUHA 2BEKA 2I62A 2R1ZA 1AY0A 4HX2A 1OWNA 3VNUA 3DEZA 4EHBA 3C6ZA 4IMIB 2NLOA 1HYBA 1WULS 2YHIB 4DCGA 4QODA 1ENOA 1CR4A 1O77A 3OQJA 3BB3A 2IBMA 3NTQA 1P2BA 3N2GA 4NF2A 2F1HA 3MTDA 4BWFB 5DTEA 3EVGA 4FCWA 3ZK9A 2NUBA 2EF0A 4A8PA 1N57A 1IBMB 2PUBA 4YV0A 1FFXA 1WDLA 1ODTC 1II0A 2HQSA 2R6AA 2ZRQA 5G0UA 1UOQA 3VC7A 2JIBA 3SZOA 1XEWX 4KDCA 5KVAA 1OIVA 3NTVA 5K09A 2I2FA 4CV1A 5FLXA 1YZLA 5G3ZA 2VTBB 4M1MA 3K31A 4XQGA 4WGGA 5A05A 4YXFA 5LYYA 1N25A 3GUHA 2PE5A 5E6SB 4ZTUB 5FB3A 2UYYA 3W3ZB 5FBZA 4XCXA 5B3LA 2O1SA 1EFRD 2BFFB 3CWQA 1GL7A 4ND5A 2B3DA 2PD4A 2P8SA 1VYUA 2PPLA 2Z8YM 2R1VA 3GEGA 1CRLA 2ZIXB 2FQQA 4C89A 1DDOA 1XQXA 1HT2E 2BCGY 4MGHA 3DLPX 3N86A 3TLAA 1JT2A 4ML3A 1HT0A 4O4HA 3W5UA 1CUDA 2ENWA 4YLYA 3AWDA 2GK7A 1Z7YA 3VZCA 4HUJA 4LJAA 3OEED 5G41A 3PGVA 3VHRA 4WI1A 3RFFA 3AVXA 2LCQA 4H77A 3T0IA 2ZRAA 4D4GA 3DWFA 3NASA 1X92A 5B3AA 5A5DA 1GNRA 1ZN9A 3IUNA 4ZEOA 4HX5A 1UBEA 5TMDA 3RBAA 1QCDA 1QONA 3M6WA 4YRCA 5LMCA 4K5QA 4K9MA 1QIIA 4MEAA 4R7TA 4AYTA 5LYJB 4FS8A 3LH5A 1QUEA 1R0CA 1WB6A 4TKUB 4DJTA 1MJNA 1F51E 3S1AA 2VYQA 1DKOA 3UFBA 1GFSA 3GLHE 2H5IA 1FUUA 4G84A 4IJQA 4DCVA 1QP4A 3KKLA 2GS9A 4LJ4A 3JU3A 4I4LA 1F4LA 4IVPA 2HBZA 2OGTA 4D3DA 1OU4A 1EHYA 1XRQA 3B7PA 3RSCA 4YP5A 3A4IA 1K6XA 4H1WA 4BIMA 5CJPA 1G3UA 3Q9LA 2R5FA 4BYGA 4F6RB 4FC6A 3WLJA 5AI9A 4PTLA 4WK4B 3WGOA 1G7TA 1HZZC 2FFRA 2CK3A 4A03A 4AZ0B 4XX1A 1JTVA 2EJUA 3F7OA 3WDMA 5J2TA 5CB4B 2UXDB 3FNFA 4LHWA 3FRJA 1TQ8A 3IDZA 2D1TA 3DA8A 4M7RA 4CMHA 4US1R 3WIVA 5CDGA 1C0LA 4HRVA 2CLOB 2DFVA 2PUCA 1M9NA 2ZRDA 2ZPUA 4D5GA 4L0MA 4M86A 2C78A 2NO6A 3NU1A 2YNMD 3FVQA 1U2QA 3ESXA 4YI3A 1P5ZB 2GXSA 3MGAA 4FGKA 4L02A 5G53C 1HYHA 3VRHA 3ZDEA 1TVKA 4N7MA 1JHXA 4C0AC 5DGIA 4C4ZA 3BHNA 3TQRA 4DQXA 1K5DA 1YZFA 3OLCX 1DFHA 2B83A 1NOIA 2BFBB 2E2WA 2ZWOA 3GMIA 4PC6A 1O4VA 4FFPA 5TT0A 4ESOA 2QBYB 1V45E 4MRSA 2QTWB 4E07A 2FMIA 4QOEA 4MDEA 4QPDA 4QYMA 4R9RA 2O0HA 2NTEA 3AEYA 2AD5A 1U9IA 1ZVQA 1BVRA 3CB4A 3KSZO 1U7ZA 1QVWA 1O95A 3X1WA 1W2WB 1DV1A 3IP9A 2FLVA 5FWNA 2E85A 2G70A 3ZZUA 4CDNA 4KR7A 4I9NA 5JECA 5KYTA 1HRKA 3KEGA 1YUNA 5AOVA 4EKDA 3ENQA 3LYLA 4OQFA 4P31A 5A4FS 5C8DA 3D8TA 2BPOA 1NUSA 2A9OA 5CW1A 3QW4B 5AI8A 3Q2OA 5J5VA 2IW3A 5CXQA 4NX2A 3EG5A 4MAMA 3VTAA 4FYPA 1G6OA 4BO4A 2BR3A 1VCNA 4QDKA 4LECA 4RC9A 1FMCA 2RMKA 2VP4A 2WZDA 4GP6A 1FJ2A 1NUAA 1RQLA 1OAOC 4JT4A 1R00A 3DMNA 1ZCBA 4KQ1A 3VBEA 1T0BA 5A9TA 1GO2A 4QX6A 1VMDA 3OPYB 3K09C 2POCA 4UVEA 3VZQA 5B64A 4X92A 4UBKA 1XNQB 4EI9A 3UMCA 2V8BA 3MB5A 5DKFA 1Z0KA 4EO4A 1ZPDA 5ELXA 4MJXA 4B2YA 2SICE 3C0KA 2FJPA 1CJCA 1NUQA 1ZYUA 2IC5A 1ZA2A 1QQ7A 2H51A 3FCEA 3ZW8A 1CQIA 2VZ9A 4HT3B 3II6X 2H6EA 2WFLA 4LOIA 3OM8A 4KQWA 1RCTE 4OI2A 4NR0A 2JJMA 1SKUA 4Y3UA 4CF4A 2GHTA 1FRZA 1Y3DE 2YYAA 5BWLA 3EA0A 4BX2A 3IXMA 3PNVA 2V6JA 4YJ3F 3EZYA 3LL4A 3STTA 4NIMA 3IOYA 4OYLA 3FI9A 2OLEA 2ASVA 1GHTA 1KR2A 4XSHA 3GUCA 1U2DC 1T4DA 3BDAA 4E32A 2D4HA 1GA1A 4HXGA 3QFFA 2O0JA 4TLEA 3JD1A 4I4TF 2XVXA 4Q18A 4M0LA 1U8TA 4FXOA 5LVAA 1D4ZA 3Q8KA 4AXXA 1NRJB 1J33A 1S9HA 3F0TA 3EGXA 3WBJA 3SHOA 2KM1A 3GAAA 1DFGA 2JIMA 1OX5A 1OJLA 3OY7A 2HCBA 2YRFA 1P45A 1M2GA 1T9GS 5JG7A 2VSXA 1UBTS 5KSZA 5IM4A 2P3SA 2VNKA 1WMAA 3KBOA 1ZC3A 2FCRA 3SX0A 2IXGA 2OOKA 1O57A 1AD2A 1QH1B 1XRLA 1ZMRA 2FGJA 2SECE 3DAFA 3NWEA 5EJMA 2VH5R 2H92A 4EQ6B 4HNQA 1X7XB 1U3TA 4L3WA 5JCJA 4FOOA 4L9AA 1AHPA 1XX6A 2EKPA 2NQ2C 4C1BA 2DPXA 2VF2A 2P1DA 5JPCA 4WXMA 1QZXA 5AUQA 4HMQA 5K8UA 2C9CA 2D2IA 2D3TA 2JFUA 3KO8A 3PPXA 2WTUA 2JGNA 3SD7A 1JECA 2YDYA 3T5TA 2Q3LA 1JU4A 1PF7E 3IDSA 2B37A 4PHCA 4YMGA 5JZMA 2QAGA 1E3JA 4JMPA 1M1NB 1KPHA 3AESB 4I5FA 4TTVA 3OMLA 4D9HA 4A15A 3FF4A 1UF9A 4LJ9A 4B17A 4OX9Y 3F96A 4ROSA 5HIIA 5AESA 5KS2A 4R41A 4TTTS 3VR3D 1NVMB 3HB9A 3GRRA 3HJBA 5M2QA 4Y30A 1T4CA 4L74A 3QKWA 5SY9A 1S3IA 4COOA 1Z3IX 1ZX1A 4JEIA 1JSZA 1M7GA 4GYKA 1IHPA 2QVYX 2ZRGA 4NARA 5ALTA 4K87A 5HUHA 1OHHA 1OTXA 2AN5A 3BJMA 3N7AA 3OQHA 3QBDA 621PA 1ZUHA 4IH4A 2FG6C 4A92A 1NVXQ 2CD9A 3B1VA 3PKIA 3K5IA 4DMKA 1DBSA 4R71A 1GAXA 1RKVA 1VCMA 3A4LA 3KZOA 1Z22A 1XVAA 4W7HA 2PL3A 1EUDA 1VM6A 2B5WA 2QRUA 4PF1A 5A7FA 4LYHA 4CODB 3RK1A 4I3HA 5IJ0B 1FDVA 4D3SA 3U7JA 2OM6A 4M60A 2NXEA 4D9MA 3J81A 4R9NA 2EAUA 2W6PA 1FDTA 1PRYA 3HSYA 2ZJ4A 5BV8A 2OAQ1 2B6NA 3QITA 2WE8A 1M6YA 4DIDA 3UYKA 5K0ZA 2O48X 1RE1A 2V5AA 3B9QA 1S8AA 4JJFA 3FTPA 2WQ6A 1VA4A 1JNXX 1M72A 1R6AA 1ZJZA 4Y7DA 3D81A 3HCEA 2GLXA 3KXPA 3PYLA