4CM7A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
252
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQNGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
molecule keywords PTERIDINE REDUCTASE 1
total genus 94
structure length 252
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm7A00
5HA5A 3TN7A 4B8WA 2VRCD 5AXAA 2X9VA 1QYXA 4YJDA 2O4CA 1KS9A 1T2CA 1ZK4A 3NT2A 3LLSA 1HT0A 3TFQA 4E2YA 1HTBA 1T1RA 1VKOA 4E2WA 1NVGA 4BMSA 5JDIA 3L07A 4YQZA 1I5RA 1DPGA 3DBVO 4UAGA 1PWXA 2ZB3A 4ROSA 4MIYA 1ULSA 1NR7A 1TA4A 4GH5A 4IS3A 3KETA 1HDRA 2EEZA 1OI7A 4BO9A 2WD7B 4E31A 2C7VA 4D43A 1DLJA 1HDGO 3CE6A 3VH3A 4DIFA 3OJEA 1J6UA 4ESOA 1NR1A 2VWQA 3WNVA 1E3WA 1P44A 3GNQA 3GVXA 4WNIA 2OGUA 4E2XA 2Y1DA 3BZUA 3MWEB 5U1PA 1Y8RA 4TRRA 8LDHA 3W1VA 3DBRB 3SEFA 3GH3A 3PZBA 5B4VA 1ML3A 3H5RA 3CKYA 1GEEA 1GCOA 3H65A 3MJVA 4RLHA 4TZKA 3K30A 3FTNA 1JAXA 4F3YA 2ZJ0A 3RU9A 1NP3A 1PL7A 2FR0A 2VQ3A 2NTNA 4CQMA 3ICPA 1N8KA 4A0SA 2BFAA 2BFPA 5KJCA 1UH5A 2X9NA 1DIHA 4QO7A 5TS3A 2C5EA 3OJLA 4HFRA 1V0JA 2GPTA 1FDTA 4UUOA 1ADBA 1UP7A 5KVCA 4HFNA 3KVOA 3NTOA 4J0FA 2DBRA 1WDKA 3N74A 4JBHA 5IDQA 3HHPA 1HDCA 5COBA 1QV6A 5CDUA 1F06A 3LT4A 3GPDG 2H5LA 2CF6A 4RV9A 5KVQA 1R16A 3FWZA 1BMDA 1H2BA 4E5NA 3JQAB 1HL3A 1E7MA 3AOEA 4IZHA 3NDJA 5CPFA 4AJ2A 3KUXA 5BNIA 5JCJD 4WNCA 2AG5A 2EGHA 3PFFA 4WASA 3K96A 1HKUA 3B20A 2D1YA 2QZ9A 3UHAA 1V3TA 2DM6A 4H3VA 4R3WA 5COAA 1PL6A 3WYCA 4FS3A 5C7IO 5JAQA 4B4WA 2Z1NA 1F8GA 4J2HA 1KOLA 1QYVA 1PZFA 4HKTA 2PZKA 4HNGA 1UXHA 3DOOA 1YDWA 1PS0A 3PVZA 4MVJF 1FDWA 3LC2O 4R01A 4QEDA 3MEQA 1GV1A 2IEBA 3Q2KA 1HDOA 1YJQA 2Q3EA 1N2SA 3WGIA 4TMFA 1IPEA 4FGWA 2CDAA 3F4BA 1XU9A 5KVSA 1BW9B 3U4CA 4L76A 2FN7A 5CEFA 4BO8A 5F21A 4I08A 3OQ6A 3FF4A 1XELA 2PZMA 1NPYA 2PH3A 4CJXA 1E5LA 3HSKA 5TNXA 4BNUA 3O9ZA 4RJTA 1FK8A 2ZB8A 3H2SA 1HDXA 1IZ0A 3GVPA 2AQIA 1N92A 4RORA 3ZWYA 2I3GA 5JDCC 4GX0A 3F9IA 3GUCA 5JCJA 2IZ1A 1U2GA 3KSUA 1U4SA 3WGYA 3H7AA 4A73A 4ALLA 1XWFA 2A9FA 3ZDFA 5A5EA 2CDBA 2OUIA 2BRUA 2Z5LA 4BIIA 2WMDA 2V6FA 3QE3A 4FDAA 4XD2A 4FJ1A 1GQQA 4N5MA 2X7HA 1J5PA 2NADA 2OP0A 5HRUA 3GMSA 2WJPA 1IE3A 1U28A 3ZWBA 4H15A 2VOJA 1YL7A 4XKJA 3O4RA 1HF3A 4GMGA 4A27A 3MJEA 4AJ1A 4BNYA 2O3RA 3E9QA 3PJGA 3TL3A 2DBVO 3GNSA 3PGJA 4YJHA 4EW6A 5JY6A 1EE2A 3L4BC 4M8SA 4ALMA 1LTHR 1DEHA 2PKRA 2X0IA 4YEDA 3L77A 1EMDA 3NEPX 2OBYA 2W4QA 2OORA 1GEGA 2HMVA 3HB5X 5DZSA 1JN0A 1X0XA 4RDHA 3C1OA 3HG7A 5IZCC 1R6DA 2XAAA 1T4BA 4EEXA 4PG8A 3ROKA 2CY0A 1K0UA 3VVBA 2GSDA 4Q3CA 3CPSA 1LLCA 4GX2A 3RWBA 4ND5A 3VPXA 1QLJA 1SNYA 5LC1A 5CDGA 1YDEA 5AQ1A 3GK3A 2VT3A 3MTGA 4W6ZA 1PQUA 3VOSA 3S2FA 1PU2A 4RVGA 2NVUB 2WEKA 3WBFA 5IXYA 3WXBA 3GNTA 3PHJA 1AHHA 3AM3A 5G4KA 2FZEA 3L4BA 1G0OA 4I1IA 3RFTA 5IDXA 1TT5A 4NJMA 2W2LD 2VHWA 1IULA 1PS8A 3AK4A 3I6QA 4IPTA 2NWQA 2TMDA 1LC3A 3GGGA 2PNFA 3VDQA 3ULKA 4B7XA 3T4EA 1C0PA 3B1KA 4E4YA 4UVIA 4AJHA 4RF5A 9LDTA 3NX4A 1W4ZA 3SC6A 4CQLB 3DL2A 1ZXBA 1MB4A 2GN9A 3GT0A 3SXPA 1NVTA 2J8ZA 1B16A 5I7EA 1TXGA 1VL8A 3AUSA 1EE9A 1YO6A 4DVJA 3IJPA 1DFIA 2J3IA 2VN8A 3PPIA 2DBQA 2A94A 4KUGA 1FXSA 5G0UA 3F3SA 5C37A 3AI3A 4TQGA 4DC0A 1R0SA 3PWSA 2VHVA 1TEHA 4NZ9A 4CV3A 5KWEA 1ISHA 2B4QA 5TGDA 3DBLA 1P1FA 4ZN6A 4I8XA 5JS6A 3JYNA 1PGPA 2OFPA 3I9KA 4PLVA 1NX6A 1UAYA 3DFUA 4S3MA 1UXGA 1LNQA 4BQRA 3AJRA 3PHGA 2J3JA 1X1EA 4K1LA 4RPJA 4CMIA 5L4NA 1HETA 4RDIA 4ZQHA 3F47A 4UUMA 1RPNA 2JCVA 1DSSG 1GPJA 1YKFA 3LK7A 1UP6A 1O6ZA 3GEGA 5B37A 4CUZA 3BMCA 1I33A 3A4VA 3KOUA 3PQFA 3HQ4O 2PZJA 4RZIA 3M1LA 2OMEA 1KC3A 1E92A 5F5NA 3M6IA 1K89A 2NU8A 3UOGA 1IL0A 1B3BA 2I5PO 3RC9A 2R6JA 2PD4A 3E48A 3DHYA 2NVWA 1KEPA 1H6AA 1T25A 1HE3A 3HFSA 3SX2A 1SC6A 4Z3DA 3H2ZA 1RM4A 4J1TA 5BNTA 1ZO8A 1R4MA 3JQ6A 3KSDO 4F6CA 5T5QA 1UXKA 1ZIDA 2Y99A 1YVEI 1QMGA 4GBJA 1YGYA 2VYVD 2VZ8A 3CINA 4DUPA 3RUEA 1MV8A 1Q1NA 2EJWA 4MJLA 4GGOA 4DREA 4BGEA 5JMPA 4FR5A 3DC2A 4MIOA 3H9JA 2EP7A 3NKLA 4IXTA 1Y81A 2ET6A 4CM7A 1CDOA 4GQAA 4XGNA 4FJ0A 1NHGA 3DOJA 3VZRA 1ENPA 3ETEA 3WIEA 2CZCA 1SPXA 1XIVA 1T2EA 3GRKA 2PY6A 3VTFA 3ZW9A 3ZI0A 2FP4A 4A03A 5BSGA 3DB2A 3PYLA 5BSHA 3H5AA 3AU9A 2VTDA 2FPGA 3WJAA 3JD2A 4CM5A 3A06A 4RL6A 2X22A 3UUWA 1QYCA 1PR3A 1X7GA 3QVOA 3VH2A 1J0XO 1YB5A 4G5HA 2HKIA 1O89A 4JIGA 4GVLA 4KWHA 5G4KB 3GN1A 2FMUA 3L9WA 3WYBA 3D0OA 3WSWA 1ZXLA 3KTDA 2JD1A 2UVDA 1HSZA 4L4SA 4GLOA 3AM4A 5DNAA 1DHTA 4F46A 1XSEA 4M55A 2J5RA 3ZWMA 5IZCA 3FBTA 4YRBA 5DCUA 3C1TA 3RU7A 3GGPA 5LCXA 3FRJA 1LDMA 1E3SA 2I65A 4CMCA 2AEJA 4OGWA 1XKQA 2Q99A 2V7PA 3OHSX 5U4QA 2HK8A 4R41A 1LLDA 1X15A 3DMYA 4XB1A 2XOXA 4N18A 5CEEA 3DFZA 2JKVA 1FDSA 4FFMA 5FFFA 3E03A 3GC6A 3QQPA 2GR9A 1P1IA 4I5GA 3DZBA 4WCDA 2J5KA 3TZKA 1N7HA 3PQDA 1DXYA 4ALNA 2NACA 4BL5A 3E18A 2Q1TA 4W82A 4UEJA 2PR2A 2VYNA 4UULA 3VH4A 5JAZA 2JD0A 3IQDB 4J1NA 4BO0A 1ULUA 3CEAA 4Z0PA 2Y1CA 4FFOA 1AHIA 3QWFA 5BNFA 4CM4B 1CETA 2E37A 4TZTA 2DTXA 4M87A 3GFGA 1AGNA 1ISGA 1IOLA 3NJ4A 3KLMX 5IXSA 2IE0A 5U9CA 3FI9A 4YT5A 1PJSA 1QLHA 4LSWA 3FCOA 1NBOA 1ZZEA 1XLTA 5T6BA 2YDYA 3WTCA 4OOFA 2Y1FA 4XEHA 2CF5A 2GO1A 1C1XA 2PD3A 4TSKA 4OQYA 1TB4A 3O38A 4R68A 3ZWCA 2NU9A 3AUAA 1E77A 1R4MB 4RLSA 2GZ2A 2PV7A 3F1KA 5BSFA 3W6ZA 4UUNA 4BNGA 3CTMA 1D3AA 1QRRA 3H9QA 4NH4A 5L51A 1DC4A 3L6OO 1I10A 1A7KA 1DB3A 5T8KA 5IZ4A 1I8TA 3VZQA 2Q1SA 1ZMOA 1NPDA 4FFPA 3W6UA 1WNTA 1WVGA 5JMWA 3U09A 3BIOA 2C29D 3EVNA 4DLLA 3UICA 4XRGA 3LQFA 4GLLA 2PZLA 4BNJA 3JQ7B 3GQVA 2HMTA 3FBGA 3ITDA 5JC1A 1S7CA 3P19A 4AG3A 2OZPA 3W8EA 2GRAA 2EF1A 3O03A 4F45A 3ZWNA 3DWFA 2VHXA 1RKXA 5DP2A 1W6UA 2GF2A 4BVAA 4BKOA 5CPBA 5TX7A 4AJKA 2IXAA 3DMTC 5MDHA 4II2A 1T26A 2YHUA 4LW8A 1MC5A 5TSDA 2V65A 4EDFA 1LDGA 4HP8A 5LDHA 1WMBA 4IJUA 3C85A 4GGPA 1ZSYA 1DIGA 2O7QA 1SAYA 2RHRA 3TQHA 4JLWA 4Y98A 3IL2A 4FPXA 1ZEMA 2EWMA 1WZEA 2GASA 3BTOA 3V1TC 3ABIA 3KB6A 3L6EA 4I5FA 4RVFA 3W4IA 4JJFA 4Z3KA 5JO9A 1IB6A 1LU9A 3EVTA 2HAEA 2A35A 3PLRA 4CMHA 4OIMA 3KLPX 5ITWA 4XYEA 4HNHA 2WWRA 3O26A 1HE2A 4Z9YA 2C54A 1EFLA 5ICMA 4Z9XA 4KDFA 5I8WA 4O1MA 1WXDA 1TI7A 2WM3A 2E6UX 3QVXA 5CAEA 3DR3A 1YQDA 4D0RA 2AXQA 1EVYA 1IZ9A 1KC1A 1NPTO 1LEHA 1CEQA 1F17A 1Z75A 2AQHA 3DMTA 3GVIA 4M89A 1WW8A 3TZQA 1PR9A 2UDPA 4WLEA 1A5ZA 4QTZA 1M6HA 4WEOA 4TVOA 3U4IA 5LDGA 5JO0A 3TPCA 4ZU3A 3WIDA 1BDMA 2X0JA 4PIVA 3NTRA 4Y6RA 1UXJA 1JTVA 3Q1LA 3OF2A 3OFSA 1HRDA 1FMCA 4NJMB 3WJ7A 2Y05A 1YWGO 1PJBA 4R4JA 1WLYA 3ORFA 4NBWA 5MGBA 3V2GA 1LQTA 1P31A 3I6IA 4L8VA 4NHEA 1RM0A 1P1JA 3A1NA 5KVVA 3BMNB 2W8ZA 4WCFA 2PD6A 4MVJE 1PJ3A 5EN4A 1DFGA 4YAEA 3ICCA 1KYQA 4OSOA 3M2TA 4YVFA 4OYRA 2ZTMA 3DZGA 3G0OA 2A4KA 4D0SA 3K8ZA 3X2EA 3BTUA 4KP7A 3UVEA 3Q3CA 4GMFA 1EDOA 4W7IA 1WWKA 5JDIC 4TKMA 5KIAA 1P0FA 3E8XA 3F4LA 3L4SO 3VHRA 1OZAA 2DPHA 3NT5A 4R1SA 2NM0A 1C14A 4LN1A 1XQ6A 2HUNA 3D64A 4XGKA 4D44A 1U1IA 1ZJYA 1U8FO 4NBTA 4R1UA 5K0ZA 2OOSA 2NUAA 2FR8A 3MCVA 3UCXA 2QG4A 1FJHA 2A92A 4NBVA 4J16A 1GD1O 1PZGA 3B70A 3HJAA 2HMUA 1P1KA 3PHIA 1I2ZA 1BHSA 2QHXA 4B79A 1JKFA 8ADHA 3DZFA 3BMCB 3IIEA 1NFFA 2FY8A 3VPGA 2VRBA 1F8FA 3A28A 4NDNE 4XQGA 3UCEA 4E21A 1BXKA 3RFXA 1QYWA 1KY4A 2GLXA 1Q2XA 1E3EA 2ZTLA 3PQEA 1GYPA 3PRJA 4IDAA 3MJ4A 3KEQA 1LJ8A 1CYDA 3RFVA 4D45A 3GAZA 2G76A 4HXYA 1GUFA 3L6DA 2I66A 4ALJA 4BMNA 3JD3A 3RCBA 1H5QA 4XQEA 3RC2A 3OICA 3HB4X 3LLVA 3A9WA 5L40A 4FIZA 4BGIA 3LT2A 3WGQA 5IG2A 3PIIA 1SO8A 4AICA 1P1RA 1F12A 4GX5A 4WLOA 2CFCA 4CLOB 2LDBA 3VKVA 4CM9D 2DFVA 3RROA 4TRNA 1U3UA 5I8ZA 3I52A 3IUPA 1NNUA 1CRWG 1E1LA 3DQPA 3U0BA 2Y1OA 4HADA 4A10A 3DBHA 3BHMA 1R0LA 3S2GA 3PIDA 1V6AA 1DAPA 3WDSA 4YDRA 2WD8A 1GAEO 4DIBA 3JD4A 1E0DA 3G1UA 4QX6A 4PZEA 3W4KA 1N7GA 1B2LA 2BHLA 2QYTA 2ZK7A 3FTPA 4IMRA 1NHWA 1Y8QB 2RH8A 3D4PA 3NYWA 3N7UA 3KBOA 4RPGA 3ZHYA 1YBMA 3WNQA 4OXYA 2G5CA 1NQOA 2IDZA 4A7PA 4Z6KA 1JA9A 4KWIA 4BNNA 1I3MA 5FI5A 4FFRA 1QYDA 3OEYA 5A9RA 2X5OA 3L0DA 4OJNA 2D2IA 3NV9A 3JQBA 3JQAD 3QHAA 4JXKA 4Y6SA 3WGZA 3UH1A 4IJVA 2Z1MA 3KRTA 4MVJP 3VVCA 1HLDA 1ZCJA 3DBLB 2B35A 1Q7GA 2AHRA 1RM5A 3ZZNA 2G0TA 4J91A 3RJ5A 2IYPA 2Y67A 3NRCA 3QVWA 5JLAA 4B4VA 3I9NA 1FDUA 2O4UX 4IZIA 1LDYA 1VE9A 2PTGA 4XCVA 5C7OO 5JDCA 1ENYA 2ZIZA 1UZMA 3RAJA 4CM6A 2Q45A 4B3HA 4WOJA 4ZRMA 1N9GB 1I24A 3MJCA 1Y7TA 4J1QA 1XR3A 2HK9A 4A26A 4HBGA 4U0JA 1D4FA 1PGOA 3LC7O 4O0LA 4WJZA 3VPFA 2FWMX 5A04A 2P9CA 3WQQA 3GMDA 2YY7A 4B7CA 3UFXA 5ICSA 4ALKA 2P91A 4HV4A 1UDAA 3MTJA 3QLJA 4RVUA 3ZV6A 4R16A 5CEJA 3TL2A 4IQ0A 2G82A 1UDCA 2GYYA 4YJFA 1PJLA 3D1LA 3F5QA 4WGGA 2YQ5A 1UZLA 5EJ2A 4J90A 4D41A 4HX5A 3CZMA 3FNGA 2VUUA 3I9LA 1OAAA 4M54A 4ONEA 4BO5A 4KDEA 3WMXA 1MFPA 3ZW8A 2YV2A 4QSMA 4L9RA 1Q7BA 4N7RA 2PWZA 2C59A 4BB6A 1H93A 3H9UA 5BT9A 3ASUA 3I9JA 2Q1UA 1A9YA 2VOEA 3RUIA 3GG2A 4QUKA 3VDRA 3TSCA 4ZQBA 4HFJA 5COQA 1E7QA 2YZ7A 4YAKA 2JCXA 2ZCVA 2O3UA 3DBHB 3E5RA 1V35A 4E5MA 3SBOA 3UW3A 2H63A 1C1XB 3RVDA 5GMOA 1EFKA 1ADGA 2IZZA 5K9ZA 1GUZA 3NGLA 4E30A 1R12A 3VPHA 4ZGWA 5C3MA 2D8AA 3JYPA 4MOWA 3LF1A 1QSGA 2GCGA 3I5MA 2B5WA 3EK2A 4QO8A 2RAFA 1VJ1A 2BLLA 2SCUA 4P4LA 4INAA 1C0IA 2G17A 4PZCA 2D5CA 2OP1A 3HDYA 3ZHXA 3OETA 4IGEA 3U49A 2VYVA 4CM4A 2WSBA 3GR6A 2XXBA 4YR9A 2NQ8A 4MINA 1EBUA 3BMNA 2OBNA 3GHYA 4DL9A 4XA8A 4WECA 1KETA 4MKZA 4UVHA 1XDWA 2Q50A 1N5DA 1NYTA 1WAMA 2X8LA 4NMHA 9LDBA 3HADA 1SOVA 4PN3A 3LSYA 4JJIA 4EZBA 4OMUA 2B83A 3ENKA 4K28A 4EITA 3LU1A 4J7XA 1EVZA 4XQCA 2DVMA 4K26A 1A9ZA 3IJRA 4R3NA 1HDYA 4FGSA 1IUKA 2Y0DA 4II3A 4E2ZA 2UYYA 2ZQYA 3KSZO 4U6QA 5EERA 4YAGA 3ROPA 1ZMTA 3RC7A 5B4UA 1EUCA 2O50A 2DKNA 3LF2A 4MVJA 2GNAA 3H8VA 3VZPA 3RBVA 2NTJA 1X13A 2CVOA 1WDLA 1ZKMA 2B5VA 5EESA 1YOVA 4AJEA 4OKNA 1MG5A 2D5AA 2Y0CA 4UEOA 4TRJA 2X6TA 4CL3A 1DRVA 3KEOA 2E48A 1GV0A 3GDGA 3PDJA 3WQRA 4BO4A 5K6AC 1K2WA 4R5HA 1PGQA 3GVHA 5T64A 4IJWA 4Y9DA 4FBGA 2DTEA 4E33A 4C7KA 1YL6A 3VTZA 1ZUD1 3UF0A 3C7CB 1LQUA 2RHCA 4LVCA 3ZV4A 3PK0A 2VZ0A 3PJEA 3NUGA 4IS2A 1IPFA 1B8PA 1Y8RB 4MP8A 4DLBA 3OA0A 4DPLA 3V1YA 4NIMA 3JQ8B 1GR0A 5DN9A 2AA3A 5A5FA 3QVSA 3TOZA 4CLHA 1I2BA 1QORA 1LDEA 3D3EA 5G0TA 3D4OA 5EPOA 4YQYA 5AXBA 1ADCA 3LDHA 1MC4A 2VYND 1UDBA 2DBZA 2PGJA 1JKIA 1LA2A 1HEUA 1X1TA 3WFJA 1VL0A 4GI2A 2H1SA 1AXGA 1T4DA 1BSVA 1UAGA 4FW8A 3NJ8A 4FSHA 3ZNPA 2PGLA 1UR5A 5I9MA 2VZ9A 4ND4A 3ZWVA 2ZYGA 4EGFA 1CJCA 5F1PA 3OJ0A 3MWDB 5EL0A 5KKAA 4J9UE 1JWBB 3HZZA 1SEPA 3SVTA 3KYBA 1NQ5A 5I9NA 3DONA 5JBIA 4NBRA 3S2IA 3OP4A 4JBIA 3ZV5A 1LLQA 3VKUA 5HTOA 2Y0EA 1Q0HA 1X7DA 4DRYA 3IP3A 1PZHA 1OC2A 4P22A 4CMBA 3ZU5A 3O8QB 4CMEC 5F1OA 3Q9UA 3EHEA 1MG0A 4RQTA 5ITVA 4OHUA 2Y1GA 3ZNNA 4OQZA 4FOSA 2O7SA 3F5SA 1MFZA 3JQ7A 4L75A 3GUYA 2OO5A 1YJ8A 1LI4A 4WE3A 5A02A 1C1DB 3OIGA 2P5UA 1ZK3A 5KKCA 2DT5A 1PSDA 3B6ZA 1HSOA 2EKPA 3QV1A 2C2XA 4PZDA 1HDZA 3RC1A 4DMMA 4CMGA 2GZ1A 4PLPA 4BKUA 4BV8A 1Y9EA 3PFWO 4Z0HO 1ISIA 1Z7BA 1KVQA 2UAGA 1T24A 2ZTUA 1I32A 3LT1A 4QXMA 3L9XA 1I3NA 1QP8A 3AUUA 4NFHA 1JKJA 5DOVA 3OM9A 4CMEA 4I5EA 3E9MA 3WGGA 2PKQP 1RJWA 4XDZA 3QSGA 3INGA 4BNVA 1GZ4A 2DUUA 4P38A 3K6JA 3ONDA 4A5OA 2DAPA 1DIAA 2J3HA 3D5TA 5JC8A 2CVQA 4MIEA 3T4XA 4LGVA 4WCFC 1QG6A 3DZKA 3OH8A 3TOXA 3WQSB 3S8MA 4IINA 1Z82A 1ZH8A 2V6GA 4C4OA 5C7LO 2P4HX 1K6XA 3VAZA 4YT2A 2BGMA 4NFSA 4A2CA 7MDHA 3DAFA 2VRCA 3S55A 5KNLA 2BF7A 3R6DA 1E7WA 4FD3A 4RPKA 5KJ1A 2JFHA 4R1TA 2W2KA 1DDOA 1XU7A 4RVHA 3ST7A 4CL8A 3JQ8A 3I4CA 4W4TA 3AUTA 1SBYA 5GZ6A 1BXZA 4DYDA 1L1FA 4NJOA 1GDHA 4QFCA 3HDHA 3C24A 4UVGA 4OM8A 4IM7A 5EINA 1O5IA 1YB4A 2WYUA 2Q2WA 3V8BA 1JVSA 4LRSB 2C20A 5TF4A 1YQXA 1E7SA 4PGFA 3E6AA 4K6CA 2ZKLA 3NDIA 3IUSA 4I9NA 5IJZA 2C0CA 3AI1A 2X5KO 3TFOA 2BI8A 1LX6A 1LDNA 1XYGA 2Q4BA 1T2DA 3W4JA 1BXGA 4RF4A 5KTKA 5K6AA 2H9IA 3P7MA 4PCVA 5TIIA 2OL4A 4ZRNA 5AVOA 1LDBA 2O48X 2QW8A 4FJ2A 4E12A 1CF2O 4PVCA 3FNEA 3INRA 3KHUA 1XCBA 4JBGA 2EIHA 5L53A 3IC5A 4GAEA 1Q0QA 5FF9A 3QY9A 1AUPA 4XYBA 2AEMA 3HN7A 5IDWA 2NU6A 1GZ3A 1Q7CA 1KEVA 1M2WA 3H5NA 1EQUA 2Q49A 3RI3A 1S6YA 2EGGA 2B0JA 4YT8A 2E49A 1I30A 1Y5MA 2W98A 3CIFA 2NVBA 3WWYA 4BKRA 1HYGA 5IAAA 5HWSA 1V9LA 1DBVO 2P68A 4KUHA 5HS4A 3WR5A 3I23A 4MKRA 4RO0A 4WEQA 2CVZA 3ETDA 3GGOA 3FR7A 1MUUA 1A4UA 2YUTA 2X0NA 1ENZA 3EZYA 3HWRA 3I9OA 1PX0A 3WLEA 1GCUA 2Q2VA 1A71A 1D1TA 3GZ4A 1KVRA 2AE1A 1NM5A 1F0YA 3ANNA 2PKQO 1A72A 4XGIA 4BNLA 1DRUA 2GUGA 1LRKA 2RBEA 2UUOA 2X0RA 4S1VA 4IDGA 3HN2A 3SJUA 4MP6A 2XPCA 1OMOA 1PJTA 3NDRA 3E5MA 4ZD6A 1PGJA 4CV2A 3ZU3A 1X14A 1DOHA 2QRKA 2AQKA 1O94A 4IIVA 5DDIP 2JAPA 3VPSA 4H16A 4BS9A 4IDDA 5I7FA 5JNLA 4QT0A 2HMWA 2WYVA 3AWDA 3ANLA 4PVDA 4Z9FA 4IQ8A 2H6EA 3SC4A 3ZV3A 4EUHA 2YFHA 4FFNA 5CDYA 1V8BA 1Y9AA 2EERA 1P3DA 3ZWOA 1MX3A 3FWNA 4QQRA 1AN9A 4KQXA 3W8FA 2DQ4A 3LC1O 3X2FA 3GLQA 5IN5A 2EW2A 3LVFO 1GL3A 4TVBA 1ID1A 3U4DA 1I36A 1XHLA 1PL8A 2BD0A 1B3RA 3OIFA 4CODB 3Q6IA 1NTOA 2NQTA 4M49A 4JGBA 1H9BA 2TMGA 1PGNA 1GYRA 4ID9A 4D3FA 4WLNA 2C5AA 2ZB4A 5B1YA 3TWOA 2GDZA 4Q9NA 2YV3A 4NI5A 1JAYA 2I76A 4DPMA 1U3WA 1V3UA 2JHGA 3KV3O 1T2AA 3P5SA 1B15A 2P2SA 1KVTA 4W9NC 4YB8A 1M75A 1U4OA 4QFDA 4RCVA 2JCYA 3CZRA 3PWZA 3ZWPA 3JQ9A 5DOZA 1DC3A 4KUEA 2QZZA 2WE8A 3I4FA 1E1MA 4CQMB 1DJQA 4PG4A 5AXDA 4RVDA 1KVUA 1P77A 3C7AA 1I0ZA 2PFGA 3S2EA 3N58A 1Q0LA 1ZK1A 1D7OA 2GN4A 3DBRA 4D46A 4CQLA 3GVCA 4CV0A 4H7PA 4FB5A 3ROQA 1VJ0A 3U9LA 4GWKA 3BMQA 1K6JA 2I99A 5EQDA 3EC7A 4CR6A 4U6SA 1PTJA 5EIOA 5ES3A 1TT5B 1ONOA 2C7GA 4D42A 2XXJA 1HZZA 2V6BA 4BKQA 5KJFA 2JFGA 3STHA 5F5LA 1KBZA 3RJ9A 4CLRA 5HM8A 3ZN2A 2FHSA 1BDBA 3K73O 1MLDA 4MVJD 3TZ6A 5DT9A 3CH6A 1M67A 3RUDA 4KTVE 3HDJA 3GAFA 2X1HA 5ER6A 4EJ6A 1SCUA 1JWAB 5A4DA 1X7HA 4NFYA 1E3LA 2P4QA 3QWAA 4CMKA 3D3WB 5L7YA 1PEDA 4DGSA 5I7VA 5JW6A 2EW8A 4CR7A 4DYVA 1EUZA 5JYDA 2YDXA 1I3LA 1P33A 1W73A 5J23A 4IDFA 4AJNA 4YA6A 3QW2A 4UUPA 4DTIA 1J49A 1JW9B 4EBFA 4BNIA 5BSEA 1CQIA 1N1GA 1DLIA 1BTOA 2DTDA 1M66A 3T7CA 1ADFA 2QX7A 2X5JO 1XQ1A 4HY3A 4IQGA 2IODA 4LCEA 4IGFA 2BGLA 4RPLA 5A03A 4FCCA 4J1SA 3ENNA 4DBVO 2ZYDA 4KQWA 2R2GA 4WLFA 1FDVA 2AEFA 2O3TA 3E82A 3UXYA 1VKNA 4C7JA 3JYQA 1HYHA 4CLEA 3BAZA 4DPKA 4IDBA 3HFGA 4HUJA 2O2SA 3E1KA 3FPLA 4DQVA 4JP3A 2IRWA 4YJFB 2QRLA 2BH9A 5ER9A 3P2OA 4J9VA 5DULA 3OIDA 3QJ5A 4YACA 3JQDA 5JAMA 1GPDG 1O8CA 4URFA 4Q3DA 3U5TA 4GWGA 1Z74A 1KEWA 2X4GA 4R1NA 3PGXA 3DAGA 5F3RA 2ZB7A 3AOEC 3T7EA 1GTMA 1EZ4A 4WLVA 3EMKA 4GVXA 1MP0A 3IDSA 3UN1A 3C8MA 3GZNA 1LBEA 1PZEA 1SB8A 3FPCA 4DLAA 3TZHA 5T57A 1P45A 3Q9NA 3ZWXA 1J4AA 4PLGA 2VT2A 1CIVA 3R3SA 4JJGA 4JQCA 3KM0A 4B4UA 4DQUA 2BFMA 1Y5RA 4GKBA 5BR7A 1O0SA 3GEDA 4XDYA 1EQ2A 2QQ5A 4AFNA 3CMMA 1JDJA 4J0EA 2DLDA 4ND3A 3BA1A 3V2HA 4CMAA 5L4LA 5T67A 4BNTA 1BG6A 4O59O 4O63O 3FN4A 2ZTVA 5TQVA 4ND1A 4K6FA 4XQ9A 3UCFA 4W99A 2HRBA 5TJHA 4XRRA 5A06A 3WWZA 2GN8A 4CLDA 3OQ1A 4GPD1 1E3IA 1ZNQO 4KZPA 1K3TA 4BGUA 5JE8A 1RYDA 4YJGB 3B1FA 1BVUA 4IIUA 4NR0A 2WD7A 4QECA 3Q0EA 1U7HA 3ETGA 3ZHBA 4DIOA 2QIOA 2VTEA 1OOEA 1QR6A 1NAHA 3I9MA 1PQWA 1YRLA 3H3FA 4PLWA 2E4AA 1UZNA 3GF4A 2DFDA 3IP1A 1C0LA 1I3KA 3IS3A 3CSDA 3PWKA 4ILKA 1ISMA 5TLSA 4WPGA 3OMLA 4XWYA 1E1KA 1ONPA 3GEMA 4TWRA 1LLUA 1ZBQA 1EK5A 2F1KA 4W7HA 4JK3A 2ZATA 1NFRA 1RYEA 3ANMA 3WICA 4MKXA 2VCYA 1Y1PA 3DTTA 4IUYA 4BO2A 3Q2IA 3H9EO 3JQ9C 4YPOA 3IKTA 3TJRA 4YBZA 5GZ1A 4IMPA 3ROMA 4EJ0A 2RCYA 1B14A 3OSUA 3I83A 4R54A 1QKIA 5G0SA 1VRWA 1ZEJA 1HZJA 2EV9A 4M86A 2BFOA 4OH1A 4Q39A 1NWHA 1DAOA 3JQGA 4YJHB 3PYMA 4CUKA 3PI7A 1O95A 4XZ3A 5AOVA 5THQA 3JD1A 1YL5A 2HJSA 3R1IA 4IY1A 4L4RA 4LISA 3RUHA 1H6CA 4BKPA 2BGKA 4E5PA 1FF9A 4CMIB 4OOEA 2D0IA 4PLZA 3AM5A 4YWJA 3EGOA 4ZA2A 3UGKA 5L7WA 5ENDA 1NFQA 5JPIA 1G0NA 3F1LA 5AYVA 3RD5A 1G1AA 3C1AA 5L95A 1L7DA 4LMPA 5F1KA 3TNLA 1CQJA 2B37A 4BNZA 2PA3A 4IXWA 2AE2A 3RUAA 4I5DA 3GY0A 3RUFA 4CUJA 1OC4A 2F00A 3HE3A 1DC6A 2Z95A 5T8KC 1B0AA 3JQFA 4F6LA 3M1AA 3IOYA 4XR9A 1GU7A 2VWHA 3EAGA 3PDUA 4NQZA 1JVBA 1NXQA 1PJ2A 4GSKA 3TF5A 1SMKA 4RVSA 3FD8A 3JCZA 2YQ4A 2VWGA 3ADOA 4BNMA 1PWZA 2EP5A 4O5OA 5AXCA 3JQCA 5C5IA 2ZCUA 1MXFA 1PIWA 3DHEA 2FPPA 1EVJA 1R4NA 1TVEA 1ZSVA 1VLLA 1VL6A 1AXEA 4JCOA 5TRTA 3IMFA 4AL4A 4NPCA 3OEWA 2EG9A 4MPDA 4Q3NA 4WK6A 2R00C 3G79A 3WYEA 1VI2A 4L4XA 2EKQA 3ASVA 4G2NA 4B3JA 1GADO 2YHIB 3HDQA 4RPHA 4B8ZA 5CP8A 5HBRA 1A4IA 3PHLA 3QA9A 4JROA 1ISJA 3K2EA 4WLUA 1QV7A 1LSUA 2B4RO 3BTSA 3G1TA 4YRDA 3TZCA 4EEZA 1A27A 3PTZA 3TRIA 5G0VA 5H83A 1RWBA 3EUWA 4BO7A 1VPDA 2FOIA 4Y8VA 4D79A 2NTVA 1UP4A 1U3VA 1HLPA 5L9AA 1EVIA 4J43A 1VC2A 5H82A 1WPQA 3FHLA 4CM1A 4GKVA 2YV1A 3H9GA 4KTTE 2CUKA 1OFGA 4XIYA 2O3JA 3QIVA 1T1SA 4J7UA 3WTBA 4IDCA 2YHIA 2CD9A 2HMSA 3BHJA 3BHIA 4GSLA 1DJNA 1HE4A 4JN6B 1XG5A 4K9DA 1OBFO 3KYCA 4NBUA 1H6DA 2AQ8A 3PYXA 4AJPA 2HSDA 3LT0A 5G2OA 5I9LA 3ITKA 1Z45A 2WTBA 2VNSA 5ADHA 2X23A 2CDCA 2WDZA 5DBFA 3K31A 2GGSA 1LSSA 2J6IA 3PZRA 5CDSA 5A3VA 3GDFA 4PLTA 5DBGA 5EQFA 3W8DA 1DIBA 3JQEA 3FNFA 4PLYA 4JX8A 4E6PA 1JU9A 4XJTA 1YQGA 4I9UA 4N54A 3RKRA 3ADPA 1XA0A 5DP1A 5L7TA 2C07A 1YB1A 5G0WA 3UKOA 1Z7EA 4Y6PA 3RUCA 2J3KA 4EYEA 2NV6A 4NK4A 4PLHA 2Y68A 4LSMA 2DC1A 4B3IA 4P4NA 4DQXA 3K5PA 1VSUA 4HWKA 4UREA 3WBBA 3GA0A 3QRWA 1N1EA 3SLKA 4LK3A 3WS7A 3B1JA 3GN2A 3EDMA 1KERA 4RGBA 4Q3AA 4YAIA 3HUDA 4G81A 3RASA 5A9SA 4RQUA 2ZQZA 3D5QA 4LRTB 4LMRA 3AI2A 2RIRA 1GZ6A 1JQBA 2VUTA 1LXCA 4BNKA 2RH4A 2Q1WA 3GRPA 1ZK0A 4TRMA 3R0IA 2JL1A 4AJLA 3KYDB 5FEUA 4EUEA 4W9NA 2JHFA 6LDHA 1IHYA 4YTEA 1GFSA 1YH3A 4NU5A 3S1LA 5ILGA 4YAJA 5HS6A 1GQ2A 3DZHA 3G3EA 3LYLA 4IDEA 3WGTA 3JQGB 5CG1A 3ZNOA 4DC1A 4I9HA 1ORRA 2CSUA 3BMOA 4NK5A 1YE3A 2PGDA 5KCZA 2G1UA 2AMFA 4N5NA 1M76A 1RM3A 2E82A 1U8XX 3PLNA 3INTA 4WKGA 2CMDA 4E3ZA 1XEAA 1ONNA 4MP3A 4CM8B 1DC5A 3DXFA 3MOIA 4R51A 3G49A 4R9RA 1BXGB 4FN4A 1NAIA 3JQFC 1R66A 3PHHA 3ZGYA 4BO6A 5DBIA 3IKVA 4U7WA 1IY8A 4J4HA 1KVSA 2HO5A 5B12A 1LSOA 3GG9A 4U0KA 3DHNA 3DDNA 2O2YA 2GN6A 4MVJG 1IYZA 3Q11A 1WDMA 1MA0A 1WZIA 4AJIA 1BGVA 2WYWA 2JD2A 4PLFA 4JNKA 1Z73A 3BXXA 3MJSA 2HCTA 4PLCA 4BNHA 4XR4A 3VZSA 1WP4A 2VHYA 4WOKA 3BMQB 4X54A 3JYOA 3KZVA 3OJFA 3PP8A 1O9BA 1MXHA 4MVJH 1ZK2A 3RIHA 4RF2A 1PQPA 1P0CA 2NVUA 3SLGA 2FZWA 2V6MA 4E32A 3H3JA 4O6VA 1HWYA 4J2OA 3V2UA 3DZIA 4DBZA 4GL4A 4CLXA 2B36A 4YCAA 2QRJA 3NTQA 5JYEA 2HQ1A 4L73A 3PEFA 4N5LA 5G4LA 1BWSA 2FRDA 4UVEA 2D4AA 3WG9A 4BV9A 1LUAA 4B4OA 3RQSA 4ZQEA 1E7YA 3QP9A 2HDHA 1ZJZA 2NNLD 5TJ9A 3WSVA 5JCXA 2IZ0A 1BRMA 4CLOA 5FI3A 3E9NA 1GQYA 4ZJUA 1HYEA 2B4TO 5DCWA 3GHHA 1LRJA 5KJ6A 1T2FA 1DO8A 4XYLA 3F46A 3AOGA 1DHRA 3JSAA 5IDYA 1Z6ZA 3WLFA 1ZVMA 1CERA 4ITUA 3EYWA 1DRWA 1K5HA 2YFQA 3QWBA 4U5QA 1E1NA 1PJCA 2PK3A 1R0KA 3KO8A 1ZFNA 3TDKA 1PS9A 3OQBA 5A9TA 4BUCA 2YW9A 2NLOA 4BQPA 1DFHA 4KOAA 1YONA 4YT4A 4JP2A 2UUPA 4PG6A 3CMCO 4J4TA 1C0KA 4J49A 4AJ4A 5I7SA 1EUDA 5A3JA 1NWCA 3O8QA 2I6TA 1U3TA 1B8VA 1UXIA 4XB2A 1EEHA 4TKLA 2I67A 1H2HA 3BTVA 4L0QA 3AW9A 1U5CA 4FC7A 5IF3A 4G65A 3PJDA 2WE7A 2ZJ1A 2EXXA 5EMHA 5B4TA 4OSPA 1U5AA 3H4VA 1A7AA 4CMJA 1MGOA 2AG8A 4YYZA 2VUSA 4CM3A 1YOVB 2VNAA 4R5MA 3K9QO 5JXWA 4RF3A 2I3AA 2Y93A 3GPIA 2VHZA 3U62A 2D3TA 1NVMB 2YYYA 4AJOA 1F14A 3I1JA 4ZQFA 4XIJA 5TT0A 3RKUA 1KY5A 3JD0A 3JYLA 1NQTA 1W8DA 4LVUA 4EJMA 2IEDA 5JY1A 1KEUA 4CLRB 4MVJM 4XJSA 5CFZA 1VM6A 3ZWAA 4B7UA 4XX0A 4D3DA 4YJGA 1D1SA 2GZ3A 3BYZA 2OHXA 5IFLA 3DTYA 1KIFA 5L4SA 1YBVA 2W2KB 1L7EA 1R4NB 5ENVA 1QXSA 3OECA 5JFOA 3WMWA 3EW7A 5L45A 4NNJA 3KYDA 4D3SA 3WFIA 5TT1A 3ONEA 4OXNA 1BVRA 2DPGA 4BB5A 1P74A 5A9SB 4BNWA 3MOGA 4RZHA 1B7GO 2HK7A 2P9EA 2O3QA 5H81A 2CNBA 2FR1A 4D7AA 1LSJA 3WGOA 2EJVA 4E13A 1VSVA 3FNHA 3JV7A 4CM8A 1TT7A 6ADHA 1Y6JA 1B26A 2X86A 4PG5A 1EK6A 2W2LA 4ND2A 1YXMA 3VH1A 3DEYX 3GZNB 1UUFA 2HLPA 2O3SA 1H0KA 1IHXA 2I9PA 4FC6A 5ILOA 1JLLA 1ZW1A 3RSHA 3WX0A 4MO2A 3P2YA 3RBXA 1H94A 4PRLA 4BOYA 1LRLA 3AY3A 5DF1A 2GD1O 3NT4A 4OKIA 2QYSA 3OJOA 3OBBA 1YS4A 3U3XA 1X0VA 4PRKA 4BNFA 5L3ZA 3CUKA 3PJFA 2PLAA 1E3WB 4WUVA 1K6IA 1E6WA 4EI2A 1C1DA 1B8UA 1PJQA 1R37A 3LZ6A 1VJTA 3DO5A 4IJKA 4UVDA 2W90A 1G6KA 2FSSA 3C3XA 1GUYA 4OXKA 4YXFA 2FPIA 1SOWA 1TLTA 4R9SA 4ZICA 3ZCXA 1U9JA 2BI7A 2DUWA 5DCYA 4DWVA 4ZHSA 1V3VA 2D59A 1E6EA 3AY6A 2VWPA 1P9LA 1I01A 2OXIA 4CPDA 4DMLA 5CDTA 4PG7A 3WGHA 2ZYAA 1E3JA 3FSRA 2DU8A 3ZU4A 2EHDA 1SEVA 3ZNQA 3IAHA 2JAHA 3EY4A 4DA9A 4DXHA 4CR8A 3K92A 5TC4A 3ZH2A 4TROA 2C2YA 5GZ3A 5A05A 4J7CA 2O23A 3VC7A 4BO3A 1WMAA 3H6KA 4PFJA 2UV8A 4OAQA 3PXXA 1UJMA 4E5KA 5IN4A 2IXBA 3EZLA 2POQX 2FSVA 3D3WA 3JQBC 4J3FA 5CG2A 1BW9A 4BGVA 2GERA 2R00A 4Z0TA 1HXHA 2HU2A 2BMAA 3HNPA 2ILTA 1U2DA 1E6UA 1GY8A 2HRZA 1W0CA 4HFMA 4YRAA 3CXRA 1D8AA 2BELA 2Y1EA 4GX1A 4MDHA 1ZSNA 4NU6A 1SZJG 4NG5A 3D7LA 1I2CA 2IYOA 1PJ4A 4P8RA 2B69A 2X58A 3MZ0A 3V1UA 3QVTA 3GOHA 5GY7A 1H6BA 3OA2A 1EBFA 4CQMD 5KOIA 3JTMA 3COSA 1ARZA 4OL9A 4EUFA 1NASA 3KXDA 3KYCB 4P4GA 2LDXA 4BNXA 3DZJA 4UEKA 3GDOA 5THKA 3JQAA 2JJYA 2P9GA 1XGKA 3M2PA 4XYMA 4R69A 2C82A 3AU8A 3SJ7A 4XYGA 5A1TA 4BO1A 1N9GA 1M6WA 4ZVVA 3NGXA 4CV1A 4Q3EA 4M1QA 1H9AA 1U7TA 3K2BA 4Q3BA 1ENOA 2NSDA 3NAQA 2EKLA 3QWIA 4FOOA 1LC0A 3QWHA 2JFFA 4LCJA 4J4BA 1YBAA 3FR8A 2J5QA 5FYDA 4U8GA 3C7DB 3V5NA 1GYQA 5JSFA 4AJJA 2BKAA 3D4NA 2XF8A 3WOHA 2NU7A 3I3OA 5CHEA 4MVJI 1R15A 3DAPA 3ON5A 4WCFB 2Q46A 3BMOB 4OO3A 7ADHA 5FWNA 4FFLA 2YJZA 4E5YA 3AY7A 4FQ8A 3MJTA 3ZWWA 2P5YA 1C3VA 4Y67A 1E7RA 3R3JA 4KMSA 4E0BA 4ALIA 1EDZA 1HE5A 3UAGA 1DIRA 1E5QA 1Y8QA 4AVYA 4IBOA 3U4HA 2HJRA 3RBZA 3ZHZA 1CWUA 1AE1A 2Y66A 3AFMA 3A14A 3F6YA 3G17A 4CM9A 3GFBA 1ISFA 5JAIA 1P1HA 4J6FA 4BHTA 2X9GA 4BMVA 2Q4EA 3DOCA 2PH5A 5KJEA 1SB9A 4L74A 1NQAO 4ZQGA 3ONFA 3WB9A 3ZU2A 3AFNA 5BQFA 2Q2QA 2AW5A
chains in the Genus database with same CATH superfamily
3RU2A 1B6TA 5EP4A 3IMCA 5SZIA 4HTAA 2G5TA 2MU1A 3AUXA 1QYXA 3HWWA 5GQSA 4Z1MA 1O95D 1E99A 2XAUA 5EC8A 2W2VA 3F3KA 2C4UA 5BSMA 4EF4A 1V2HE 1HT0A 1WXIA 3W5AA 4Y2QA 4E2YA 1BU5A 1VIAA 2BFBA 3EEYA 3BZWA 2E0IA 3CZ4A 2H0AA 3KOWA 4E2WA 1HR0B 2ENUA 2NSHA 1CQJB 1JRLA 3ABQB 4BMSA 3ZLBA 2JEYA 2B6HA 3X1WA 1TAUA 4YQZA 3CT6A 2LUOA 2XRZA 3VO8A 4ROSA 3LECA 4EW1A 2N47A 2RKBA 2BE9A 4Z7QB 2AOUB 2UZ4A 4B17A 1DTSA 2D5IA 4IS3A 3JU3A 3ZE8A 3KETA 2BSAA 3IIIA 4HAZA 5LA6A 3SWWA 1DQPA 1N9ZA 5MHTA 4E31A 1MKYA 4AN0A 1YQQA 5DLEA 1SM4A 1PHPA 2FWJA 2WSMA 1HDGO 3CE6A 1PW7A 2JKZA 1XKLA 4GBMA 4KSBA 4Q1BA 1SUCA 1TKAA 2P7IA 4TX1A 1ND6A 3DDWA 4UPEA 1J8VA 4WNIA 1IHUA 3S7TA 4E2XA 2CMGA 1Q1BA 3BZUA 3MWEB 1NBEA 3W1VA 1TZKA 2P9JA 3LHDA 2V5UA 3B3AA 4O2RA 5B4VA 3FNQA 5LD2B 4GP6A 1GEEA 2HHHB 3LYHA 5IAOA 1QHHA 3H65A 2HR1A 3AIMA 3NYIA 1JAXA 2FWIA 2ZJ0A 3WISA 1NP3A 1ORDA 2CEAA 3UWDA 3ICPA 1NI4A 1YIDA 5ETJA 1N8KA 3FY4A 3SSNA 2V6JA 1ECGA 1DIOB 1DIHA 2X9NA 2XYGA 2Z3WA 2NXJA 2D1QA 2DFKB 2Z3ZA 3ROXA 2O8FA 4JUFA 1KKUA 2GPTA 5EIAA 4UUOA 4X6YA 5FT9A 4EFMA 3L0IB 4W5OA 2GCNA 2UZ1B 1G8FA 3ECCA 1P7VA 1QYRA 3NTOA 1QH1B 2R5NA 5KNDD 4JBHA 1BH2A 1IOVA 1CUAA 2CL6X 1ZPDA 1HDCA 1V11B 2OFFA 4GLFA 3SOPA 3W9YA 4C0AC 1JH8A 1QTNA 1F06A 1BN6A 2JRCA 1OWNA 3LY8A 4HJXA 3UGJA 1R16A 1JDTA 1BMDA 1H2BA 1Q15A 1HV8A 3F74A 3ESAA 4W5WA 4UOQA 3NDJA 4F72A 1DKQA 2EWVA 4TLLB 1K66A 1TA0A 3UNXA 2OGZA 2AG5A 3HY4A 2HI0A 4Q34A 2PXCA 1G60A 2OXTA 5CIYA 3D6UA 4HNUA 1ZL2A 4PO1A 1JFFA 4RD6A 3L8CA 4GXTA 4IXMA 4LCBA 5DIZA 1N3YA 5KB3A 1KJQA 3PICA 4AY4A 2QE7A 4FS3A 3WYCA 3AP2A 3X1JA 1U8EA 5EE0A 5JAQA 2Z1NA 1E0KA 5JH7F 1W2HA 1NJSA 1BGXT 1N2CB 4LXYA 1E5VA 2BY4A 2R1ZA 5LQDA 3CLRC 5AIAA 4YJ3B 4ZK6A 5B3AA 1JG3A 4EHAA 2BJWA 4I36A 3R0VA 1U0JA 1EFRD 4M6WA 1YDWA 5K9ZA 4MVJF 1FDWA 3MGBA 1Y89A 2J9XB 4P9NA 3T3GA 4AP9A 1GV1A 1HDOA 1U11A 3EH1A 5DYWA 4B71A 4KAJA 1DV2A 1MT0A 1YJQA 2Q3EA 1OLUA 4I99A 4UTRA 5ITZA 1UFVA 2RGNC 3SQNA 4EKGA 3CF4A 1GTVA 4Y6LA 3G88A 1H2AS 3CGGA 2PTHA 2CDAA 3E22A 2PX8A 1FTYA 2AD1A 3OX4A 4L76A 3U4CA 1KPGA 4LJ6A 4BJHB 3OQ6A 4QXQA 1ABFA 2VDOB 2I7CA 1FFEA 1W5AA 1Z6PA 1GITA 1C4KA 1E5LA 3HSKA 5JBNA 5LZ9A 1E3QA 3CYFA 2WTXA 4H9GA 1CRQA 1S96A 2ZB8A 4KLAA 4OYLA 1VTKA 4UC0A 2AQIA 5AK3A 1GA6A 2EYQA 1DBRA 1JNYA 4J6EA 4P4UA 3UH0A 3ZWYA 3ETHA 1PV1A 1XZQA 3KR9A 3E7DA 3O95A 4HGQA 1ANKA 3AJAA 3BXEA 1UBFA 2YJ5A 1XDDA 2Q21A 1U4SA 3GCXA 2KBFA 1XWFA 3ZDFA 4DS3A 4TT3A 2C9YA 3PPWA 4KB5A 3HB1A 3AKZA 2Z5LA 3FVVA 3B9RA 2WMDA 2VTVA 3G23A 4UMVA 3ILHA 1KP3A 1ZJJA 1DBIA 3A7EA 1I0LA 2WJAA 3QE3A 1WCWA 2FLKA 3ACCA 1GQQA 4TV8F 4V0QA 4YLEA 1R5NA 2JVKA 1QUEA 2X7HA 4TMTA 3GMSA 4C0QC 2JI4A 2R7LA 2WIAA 1RT9A 1NSYA 2OHGA 2YHBA 1D2NA 1YL7A 4NVRA 4LV5B 5TGZA 1GQOA 4MARA 1TCBA 3O4RA 1F4PA 3QF7A 2QENA 1HF3A 3QKRB 2FFAA 2Q9CA 3MJEA 3GELA 3WOVA 3E70C 3G9TA 5AHRA 4EW6A 4R81A 5CGZA 5AKLA 4M8SA 5I4CA 1O6FA 2PKRA 1W87A 2FW8A 3L77A 1C8LA 2A84A 2W4QA 2OORA 2YRFA 2HMVA 4Z99A 3G7UA 4HATA 3NVKI 1YASA 1DTEA 3IAFA 3ESRA 2V4MA 4OLBA 3OO1A 2I6XA 3E0XA 3HG7A 5T6MA 5IZCC 3DCJA 5DW0A 1ZD4A 2MOKA 3P9NA 1T4BA 3TB4A 2GI4A 2C94A 3EMDA 1N7IA 3BQMB 5FUXA 4EEXA 3ROKA 1ODFA 2RAPA 4MHTA 4MWTA 1V39A 1LTKA 4ND5A 3VPXA 3OTHA 1QLJA 4QUBA 2PJRA 5K3EA 5AQ1A 4K9PA 5AP9A 2VT3A 3EDQA 3JVUA 3PQ5A 3UMYA 5JSQA 3ETJA 2J5BA 1PU2A 2Y1XA 4RVGA 1XMPA 2ZAGA 2Z2ZA 4JZKA 3WBFA 1WV1A 2Z8ZA 3EQ6A 3WB1A 4QTTB 3WXBA 5IXYA 1AC5A 4FONA 1SD2A 2UYOA 3L4BA 2AI2A 2W2LD 3B3FA 1YB7A 4DXDA 3HVRA 2VHWA 3T0FA 3W5VA 3Q5EA 3R5SA 2NWQA 3GGGA 5E2AA 4RTJA 3U9TA 3WNBA 2ACKA 3EASA 3PNPA 3MELA 2B94A 2IF0A 1EGHA 4UARA 3A1CA 4E4YA 5K99A 5DN6D 3EPJA 2DPXA 4AS2A 1FLAA 3TMAA 1F2DA 1R6TA 4AKIA 4FMPA 3ZK7A 1MB4A 2GN9A 5F2EA 1NVTA 5C1DA 3DGEC 2JGMA 3WL7A 2NG1A 5I7EA 1J2RA 3GW8A 4KIWA 1U5BA 1PL0A 1CJSA 1R4ZA 1VL8A 1ID8A 4PE5B 2NGRA 3KPJA 1FMLA 4EMTA 2OZLB 5LUAA 1FU7A 4V0MA 1Z15A 4ZVKA 2WKQA 1TD9A 5HCNA 3OG9A 2Z30A 2Q2NA 3OZEA 4XFDA 3PPIA 2XD9A 4DCMA 3OZUA 4Q7MB 3W5HA 2WFZA 4HH4A 5LYJB 3CH7A 1F0NA 5C37A 3D3QA 4TQGA 3HLKA 3G9XA 5JXHA 5JYBA 4C2BA 4DC0A 1R0SA 2VHVA 1TEHA 4NZ9A 1FUIA 3C45A 4CV3A 1ISHA 1EVEA 3DKIA 1L9KA 1H9CA 3EIWA 4LMBA 4MWEA 4BVKA 10MHA 1PGPA 5CFOA 5KTYA 2PRYA 3QOWA 4ZU1X 3TD2A 2R25B 3RVLA 4NYJR 3H2YA 2XYRA 3DFUA 3K3PA 3TLJA 4CKZA 4S3MA 5D3KA 3ZIAA 3PD0A 1LNQA 1KFJB 3AJRA 4L57A 3DR5A 3CLTC 2F62A 4CCSA 4EJFA 5L4NA 4RJJA 1N33B 4ZQHA 1KA9H 4MW9A 4E1AA 3F47A 1VB3A 2AFIA 3ZY4A 1FYXA 2JCVA 3UG7A 1YF3A 1NQVA 1QIJA 5B37A 4AQDA 1I33A 3A4VA 2V98A 4LZOA 2QAIA 1OT3A 1KQFA 1XN4A 1KC3A 2Q41A 3DG9A 3K0FB 4S12A 4CKYA 3IGFA 5KWSA 5H80A 3MQFA 1DX6A 2QL5A 3UWKA 5KPJA 3RV4A 2DKFA 2IEAA 2PD4A 3KTAB 1KPHA 3FKQA 2RGUA 2WAOA 1VSBA 3BOSA 3CZQA 3TFWA 4ENSA 4Y2RA 3SX2A 1QAMA 4GBED 2B1QA 3DDZX 1SC6A 1RWMA 5EXPA 1AZTA 4J1TA 4R8RA 1OTXA 3KSAC 1BEEA 4NY1A 3RLFA 1RP7A 1AQYA 1KXJA 3AIKA 2C77A 5T5QA 3P4UA 1G63A 1JXMA 1LWNA 2Y99A 3N2ZB 4IYJA 4J75A 1W9HA 2C88A 1JBEA 5JO0A 4NCAA 4DNFA 5FAKA 3DWGA 2VYVD 1RLMA 4YMTA 1V96A 1D7AA 1R2QA 2FETA 1Q1NA 4MJLA 4QE3A 2TMYA 3DL7A 2OCAA 1DINA 1KMHB 3CRNA 5KSPA 1NZJA 4FR5A 4MIOA 1AB6A 4R9NA 2JLVA 3NKLA 4CHGA 3O8BA 4JXZA 1RJFA 1N36B 5FADA 1AQLA 1JSLA 2EX4A 4E94A 4GQAA 4FJ0A 4PBSA 4HRVA 1ENPA 3HBJA 3ETEA 1D4AA 2H1LA 1MX9A 3GEIA 4N03A 5CTAA 3WIEA 4ZDIA 5DI3B 2ATIA 3ZW9A 2FP4A 1F48A 4FYMA 1L3IA 3DB2A 4I1OA 4D57A 2LCIA 1OYWA 2HYDA 4O4IA 1QVAA 1W0KD 3J7AC 1SWWA 2FPGA 4KOEC 4YFVA 4B3FX 1VIYA 1PZNA 3DMRA 3NKVA 3OE7D 3UK2A 4CM5A 3UUWA 5FTNA 2WYOA 1PR3A 1X7GA 4AY2A 1VPWA 4G5HA 1ABEA 3VHLB 4RTMA 2HKIA 1PF7E 3OU7A 4RKQA 4JIGA 1H1LA 4V0KA 3NHZA 5IEBA 2F3SA 4A0RA 5EJ8A 3U7GA 5FBQB 2FMUA 5I9SA 4P0PB 1QGYA 3DVQX 4KHZA 1KI6A 2UVDA 3CRRA 3P4XA 4XLTA 3SS8A 1DHTA 1MH9A 3DNMA 5TQ0B 1E20A 1W94A 4F5DA 4V2UA 3WAKA 4M55A 1L5GB 1G7TA 4BWVA 1JG7A 3AR7A 3ZWMA 3UTDA 1FRZA 1XQVA 3AO0B 1QTRA 1L7MA 3C1TA 1K7FB 3KQSA 4Q15A 2FOLA 1OI3A 3PFIA 1NVFA 3MA0A 4MYUA 3ZDXB 5EP2A 2ZJAA 3KLBA 1XKQA 2QX6A 3C97A 1N75A 3OHSX 4LC9A 2HK8A 2FDRA 3RRYA 1LLDA 2AOTA 3D2LA 2XOXA 1MT3A 4NYIQ 4LQLA 4BLQA 2YICA 1CUBA 2YVQA 4N18A 4ZGGA 2F43A 4RLQA 1FDSA 1BQ3A 4HX9A 3GC6A 4RMIA 2W42A 2CFRA 3AFIA 1P1IA 1TM7E 3FTCA 3GUUA 1KORA 4U00A 3HB9A 3R9XA 3NGMA 4U3JB 4DR3B 4WCDA 4MV4A 4PV7A 1N7HA 4JCCA 1DXYA 2CBXA 4S0XA 2FH5B 2WKSA 1SCNE 4IOLA 3JVEA 3N05A 2RBGA 4AZSA 2JJ8A 4UEJA 2RK6A 5FPHA 2VYNA 3L7DA 4PYMA 1MAVA 2W6JA 1G21E 1C3OB 3LPAA 5FX2A 3N75A 5IM4F 1VLZA 1XK6A 4CM4B 1CETA 1E9RA 2WJWA 3A2LA 3CPHA 3QUAA 5TPWB 1AGNA 1Q1ZA 3S44A 1CX9B 1O57A 2J3QA 3K70B 4AQ7A 2IE0A 5TY0A 1P3Y1 2QNBA 4HNTA 1QLHA 1MIOA 3FCOA 2GXAA 1ZZEA 4X3CA 3E7XA 2YDYA 4OOFA 2XE7A 5C51B 4XEHA 2JLQA 1XRMA 2YX1A 3I76A 2BFDA 1KFKB 2GO1A 1JQEA 2O52A 2Q1YA 1R0YA 1Z5PA 2EC5A 2R7NA 4R68A 2NU9A 1Z34A 5LMNB 1SJ9A 5BSFA 4WESB 4A82A 3F1KA 4CCWA 2DQSA 3W6ZA 2JFYA 1D3AA 3BIJA 4U7JA 3SSMA 1XYVA 4HYYA 2VDVE 4DIMA 4C0BA 4YAUA 3R7NA 1NOJA 1NW5A 2X9QA 1I1NA 1I8TA 4PBRA 2Q1SA 4S1WA 3SF8A 1WRBA 1NPDA 1CXZA 1RP1A 1S4MA 2AKYA 1ULZA 1Q0SA 1E9DA 2W71A 3HA5A 3W6UA 2GN0A 5JMWA 3U09A 4X7PA 4TTSA 2OY0A 4DLLA 2WWYA 5GIOE 3CVUA 5ESDA 4XRGA 3LQFA 4BX0A 5F7XA 2LIPA 3FOAA 1NE7A 3H6GA 3K09A 3IAM1 3KD2A 2HLNA 3JALB 1A9XB 3GLHA 3R5KA 2OZPA 3F3MA 1E0JA 2GRAA 4EB3A 2EF1A 1Z22A 1SCBA 4CNBA 4LRYA 1Z06A 4Q4LA 1Q0PA 1KQNA 5DP2A 3LOQA 1PT7A 2Q8NA 4AJKA 3MSCA 4BVBA 1EX6A 2QRVA 1OR8A 2ZW9A 3MRSA 4II2A 1D6JA 4ZODA 5ESWA 4EDFA 3RKSA 1SVSA 3LQYA 1B0PA 3EMVA 1MNAA 4KYUA 4L08A 3AF3A 4F86A 4D4GA 4XGQA 3IL2A 2HTEA 1XI2A 1ZEMA 2C2OA 1WZEA 2YBDA 2PLFA 4X20A 4K6OA 3ABRB 4RVFA 4HAOA 4QUJA 3A27A 1RHRA 1M9NA 3QU4A 1OYOA 4J0KA 3M6MD 3LRPA 5IH7A 4IG9A 2J0QA 4V38A 1XMJA 3KLPX 4PBTA 1NJ6A 3LPNA 4PAOA 1A5SB 1JLSA 1K6EA 4NV0A 3ZQ4A 5B3KA 5FOTA 1IDOA 1Z7GA 4Z9YA 2C54A 3NH9A 2FW0A 1BS2A 2NXEA 3B9QA 3N8KA 4QLAA 4I50A 2CB0A 4ZT2A 3A3PA 3DTVD 2O5EA 2VH5R 3EG5A 4BN4A 3DR3A 1UMDA 4D97A 5IAKA 3OTQA 2AQHA 3E27A 3HU3A 3SMQA 1HRKA 3W5JA 3DB1A 3A6EA 2A33A 1BX1A 3VR1A 4ETWA 3DQZA 3II6X 3E3OA 5DK4A 3RK4A 1A5ZA 2XGSA 1M6HA 2Z8YA 3NBXX 3KL4A 3CF4G 1C4OA 3ER8A 3Q1KA 1LFAA 1XD2A 4EF5A 2JIBA 1OSNA 1TOAA 3PUHA 4ZU3A 3SHVA 3WIDA 1QH8A 3NTRA 4Y6RA 2XMSA 1I3CA 2ODAA 2ZDGA 4JZYA 1DJLA 1JTVA 3LVQE 4O4IB 1DEXA 3B3JA 5E2BA 2ANCA 3WJ7A 1SG6A 4Z8XA 1T9GS 5HE9A 1BOFA 4R4JA 3GLIA 1M7BA 4MR7B 5DI3A 1QG4A 1WP9A 4WZZA 2GHTA 4DLZA 2W22A 5JEEA 3LGXA 4JR2A 2ALJA 4CQJA 3CKMA 4UPDA 5CTJA 1LY1A 4Q05A 5K6AC 4D26A 2H00A 4P5EA 1OXSC 2PD6A 3R5FA 4YN3A 1PJ3A 1G8GA 1TC1A 4MQFB 5EN4A 5KS2A 1DFGA 1GZ5A 1XZEA 2F8LA 1KYQA 2PRKA 3ICCA 3LY9A 2VHJA 3M2TA 5D5PA 2ZCJA 1AGPA 3C2QA 3DZGA 3ZV7A 2FVXA 5IULC 4MKFA 4FZJA 1BAPA 2A4KA 3W1EA 4D0SA 3X2EA 5LD2C 1FFDA 1JQAA 3THXA 3GYBA 4M7PA 3GIWA 4IRMA 2FEAA 3NUQA 2MWMA 2B1IA 3QPAA 2DWUA 4H4EA 3ZH9B 5EJ6A 1B8OA 3DF9A 1COWA 2GZDA 3CONA 2EFGA 4W7IA 2QL7A 4OMCA 4TKMA 1DAEA 2FU5C 2VJLA 1T3GA 2XYVA 1DDGA 3F4LA 5GM2A 3VHRA 4Z53A 1HGXA 1EB8A 1JPJA 3NT5A 3GGDA 4C06A 1XTSA 4Q7EA 3R8FA 3D64A 1KE1A 2LP4Y 3AUYA 4WNAA 2R84A 3FDIA 5ICEA 4G01B 4H7IA 5E4JA 4UUAA 4R1UA 2X19A 5CLLA 3W3ZB 2NUAA 5JPDA 3UCXA 4L1KA 4YMIA 5EIWA 5K0ZA 1AS0A 1DC7A 4O02B 1YRBA 2A92A 4P4SB 2YKGA 1XPRA 2GK4A 3N8IA 4NBVA 3ROTA 4Q7QA 1TQHA 3B70A 3CRW1 2HMUA 2WKRA 3WYGA 1TJ4A 1WMEA 5H02A 5EYPA 4NCXA 1H8ED 5HQTA 3RB8A 5BPHA 3I5XA 1YSCA 2X5XA 4NWIA 5H3HA 1UINA 2YTZA 3MT7A 4EPVA 4REQB 1LTQA 3N70A 2FY8A 2GYWA 3QBDA 3QUQA 3A28A 1WDTA 4NDNE 4TWAA 5AI4A 1VE5A 3L40A 1TIPA 3UHJA 2GLXA 1KY4A 3VZQA 3PEWA 5KMGB 2FMXA 1GYPA 2PUWA 3QKSA 3HCOA 4XVHA 3PJRA 3NBMA 2N42A 4H17A 1Y42X 1OIWA 2YZKA 4B1FA 2A8YA 3LP8A 1CYDA 3RFVA 3CLUD 3WBJA 1ICIA 2BF4A 3F7NA 3GP3A 4YMUA 3FPSA 3DLPX 2I66A 3L6DA 1BD4A 4JQZA 4YHHB 4DR7B 3DMHA 3JD3A 5JIBA 1B6GA 1W4AA 2KLHA 2FFRA 1ORIA 3A9WA 5TMDA 4FIZA 3B82A 2IELA 2WRZA 3O94A 4HDMA 5CK5A 1U2TA 3PIIA 4R2HA 1SO8A 3V8EA 2XBUA 3N6XA 4AICA 4BJ5A 4YX9A 2OFXA 1P1RA 2CLKB 4GX5A 2QGZA 4IGIA 4CLOB 3R8XA 1PT9A 3KQYA 4F8JA 3RROA 1AA9A 4TRNA 3ZGNA 1T3HA 2PMDA 3VR5A 4WDRA 3N5CA 5C9ZA 5EHGA 3ZC3A 1KEKA 4BWYA 1JB9A 3U0BA 4ZJYA 4ZYLA 5C52B 4HADA 1N34B 2R6FA 5SV2A 3NIDB 4EY8A 3DBHA 2IS1A 4EYKA 3QITA 2XEXA 3VBCA 3PIDA 5LKAA 3ORSA 1TUGA 2D4HA 2FQWA 4QDKA 1FW8A 2ZGVA 2PSSA 5HMLA 2WD8A 5JT1A 3TTTA 4QPDA 1T36B 4DIBA 1XAHA 4O08A 3G1UA 3OLWA 3VDXA 4PZEA 1C41A 3HPQA 5KYUA 1UKZA 2REQA 4BEJA 1X8LA 2BHLA 2QYTA 3FTPA 3NWPA 4IMRA 4ZYXA 1QF6A 1Y8QB 1U2RA 2PGIA 2RH8A 3R77A 1QNFA 2JF0A 3MJDA 4RPGA 3GD5A 4ZXPA 2APJA 3WKDA 1OAOC 3QU9A 4H1TA 1NQOA 4Z6KA 5B6JA 1U99A 4E1VA 1UZUA 4DARA 3KT6A 4IEEA 3Q3JB 4HB3A 4NS4A 5C8YA 3VZBA 4ENWA 4EHHA 4N0DA 3OEYA 5G3YA 3K0CA 1XEXA 1BNCA 2XVYA 2FSVC 1W581 2CE2X 1JFFB 5D5HA 1ZUIA 1HDEA 2Q4OA 4FCTA 2XV1A 4C07A 1JQDA 2MSCB 5A71A 1XZJA 3VVCA 1WBJB 4EO4A 1ORWA 3RSZA 1FYEA 1G2IA 1RM5A 2FRVA 4AM8A 4FLEA 4BVEA 4WZ6A 2G0TA 3RJ5A 1L4UA 3ZZNA 3C6MA 2Y67A 5FOVA 3LL7A 4EKIA 1SVKA 2O0LA 2O4UX 1LDYA 2PTGA 3CW9A 3K1ZA 4O2AF 3N2KA 5C7OO 2W93A 2R8OA 3A1EA 4MUNA 3WMEA 1SIOA 3OM0A 4E4TA 1TYZA 5JS1A 2BTOA 2Q0XA 1W0JD 3MJCA 3QW4B 1AV7A 1DWQA 1XR3A 2P9BA 3WAGA 1GPBA 2XX3A 4U0JA 3USES 1D4FA 4A1OA 1NRIA 5A04A 1FQOA 3GEBA 1OWLA 3TQQA 3GMDA 4RZ3A 5ALIA 1FTGA 3LDFA 2Y1KA 4LJ8A 3WGUA 2HQBA 2ISQA 1A5TA 1L0BA 5AI9A 3SNHA 3FSGA 5CEJA 4IQ0A 5KNBD 2PH1A 2Q6IA 2DEUA 4YJFA 1VHQA 2X4LA 4WGGA 5SZKB 1DP4A 2VH1A 1G7RA 2BDEA 2ZSBA 4HX5A 4M54A 4LYHA 1D0IA 1W9MA 1NC3A 1IN6A 4IZ6A 2J33A 3IQHX 1MFPA 1XZPA 3WLNA 2QP9X 5DGTA 1BX0A 4MGIR 1O97D 2YV2A 1T6ZA 3PTAA 1E2IA 1H93A 3RSSA 3I9JA 4QPPA 4R2KA 4MS3A 3RUIA 2XLCA 1X7ZB 2VK4A 3GG2A 1IHPA 2WQ6A 3VDRA 3K9BA 2JNWA 4JYZA 3I12A 4HFJA 4HWPA 2XA9A 4XGRA 3RIGA 3HJGA 2YZ7A 1GZDA 5A4IS 3W5BA 3VYRB 3GPLA 4WXHA 2H4JA 4NULA 3RANA 5A5VA 3OPYB 2O3UA 1HI9A 3PB3A 3E5RA 3C3YA 4F04A 3PRYA 5ADWA 2F8SA 2C8JA 3GXOA 2C96A 3ZBPA 2M6RA 2PJDA 2ZR8A 2H63A 3UW3A 3H42B 4PYOA 5GMOA 2ZUCA 1NN1A 2QU7A 2ACWA 1GUZA 4PO9A 5ALRA 5F78A 3VPHA 4Z5XA 3TVYA 5C3MA 2QD5A 4J0HA 4OYHA 1DJOA 5CM2Z 1QSGA 2GCGA 3RIYA 2HJWA 1WULS 3T0IA 2B5WA 2RAFA 2QLTA 1P2FA 5A0TA 2BLLA 1C0IA 1A4RA 5EAIA 2D5CA 3HDYA 4ZREA 3V46A 2HLDA 4IGEA 1JX6A 2VYVA 3EZ9A 4QXAA 1C2TA 4AF7A 3GR6A 2XXBA 4A16A 4YR9A 2NQ8A 2ZAMA 3JRXA 4DL9A 3GHYA 2VBFA 5E3IA 2AN5A 4WECA 2MMCA 4RWZA 1B73A 3PUVA 4BN0A 3KZNA 4CM1A 5KNCD 4O2AA 3LSTA 4QATA 2BP7B 2AX4A 2X8LA 1JDSA 5EYPB 2ZJZA 1XQWA 5EOVA 1T6NA 9LDBA 3LKBA 4CBVA 1N6HA 7REQB 5IT0A 1FDRA 4EITA 2ZUSA 2G09A 2WYHA 4X6XA 1BMTA 5DSTA 1ZH2A 3ONNA 1JR2A 3IP8A 4R3NA 1Q3KA 2Y0DA 1QLWA 4E2ZA 2UYYA 2QUBA 1JEQB 3KSZO 3WZMA 5G41A 4DIDA 5KQRA 1T43A 1SD5A 1O6GA 2FK8A 1UPUA 3V7YA 1G42A 4H3HB 1EUCA 5B4UA 2O50A 2VP4A 5CDFA 1WOMA 4MVJA 2GNAA 3H8VA 3KQPA 2RDMA 1H2EA 2NTJA 5I4IA 2FV8A 1SK8A 1WDLA 4IL5A 1ZKMA 2RKWA 2B5VA 5EESA 2DJ5A 4NL4H 4LF7B 2VDRB 4OKNA 2D5AA 1DOAA 4UEOA 3ICQB 3U7FB 5DMHA 3GDGA 2EFHB 1T5SA 2Z09A 3AR4A 3PDJA 2D5BA 5T64A 5CH5A 1WO8A 3BKWA 3A6GA 3M5WA 4IJWA 4NICA 2NAPA 1N6KA 2DTEA 4Q9DA 4U39A 4Y2XA 5C32A 2PYZA 3EWSA 1U6JA 1O0BA 3VTZA 1UJNA 3CCCA 4RCYA 3ZGLA 2FMHA 2WYIA 2VJPA 2B8JA 3P4YA 2B8TA 3RJTA 4AKTA 1U7OA 3AFHA 2H5JA 4QDZA 3PK0A 2EDAA 1X1DA 1U81A 4ZCSA 1ZNWA 4D4LA 1Q1GA 3MIIA 1RWKA 1Z0FA 3LKDA 3TJZA 1IPFA 4G0OA 1Z0SA 3OQHA 2PBFA 4RCZA 3UT5B 4DLBA 3LCCA 5CBPA 5FWXB 1I6MA 2WG0A 2D7CA 1RC0A 4G5OA 1O5OA 3KE9A 3H4TA 2AJCA 2PBLA 2LPMA 2AA3A 5IUJC 1KMMA 1JJAA 2FCAA 2OO3A 2P40A 2QWXA 2VYCA 4QU8A 5EJFA 3V2IA 1I2BA 5G0TA 1LDEA 2GD6A 3D4OA 3SQDA 1E89A 1HYBA 2REQB 1GGJA 1UODA 1X1QA 5JXJA 2IEGA 4TTJA 4PXSA 4BDTA 3DHWC 2BCJQ 2DBZA 4L8LA 4OQMA 1JKIA 3HEAA 3SC2B 3GQBA 1C30B 4F4HA 4JJ8A 2RGCA 1FSPA 3PDCA 2AC7A 2W0SA 1P2DA 3K09C 2XUJA 5TVGA 2E4ZA 2IPLA 5K05A 2H0RA 4FSHA 2PGLA 1MJNA 3TG2A 2VZ9A 4FI3C 3ZJUA 1O03A 2COKA 4L8GA 5F1PA 3IVMA 3OJ0A 5FTMA 1U3GA 3V7NA 1CUJA 2PZ8A 2VK2A 3F9CA 3GAAA 5KKAA 3EIQA 1JWBB 3CUTA 1S1CA 5KYNA 4WXRA 4B2YA 1JEYB 2QUJA 1WUKS 4ZC1A 1J22A 1LF5A 1TMYA 4CTJA 1NQ5A 5I9NA 5FL3A 3QMMA 1V5GA 3S2IA 1GDDA 1UJ2A 2OBMA 5HTOA 3E81A 3G5AA 3K4QA 2Y0EA 2F9MA 5AESA 3E9ZA 3WYNA 1CUVA 5IKMA 5LP6F 5AVJA 3OZVA 1XLWA 2KB0A 5M7EA 1NRWA 3ZU5A 1YGPA 2EX1A 2YZNA 2G72A 3EHEA 4EVQA 4M83A 4OQDA 4R40A 1K8XB 1TQDA 3AR8A 5ITVA 1TU3A 3MGKA 3EAQA 1XP5A 4FOSA 4OQZA 3M8KA 3T5PA 2G07A 4LX0A 4WCVA 4BMYA 2QTVB 1MO2A 1Q21A 1U2DC 2VA9A 3C5WP 4UZSA 1U0SY 3NIBA 1YZVA 1P8AA 3DLHA 3V1KA 4DJJA 2W6PA 4UNNA 1GZUA 1OXTA 2DT5A 2FF7A 1Q50A 1TFRA 3H99A 2YOFA 4FOTA 2EKPA 5FNVB 4CF4A 1OGJA 1P73A 4F3KA 2IBTA 2NU6B 2GZ1A 4PLPA 1FW6A 3BH6A 4BKUA 3A6KA 2K2WA 1VHDA 1P2UA 2XJ4A 5G1PA 4CG0A 2ZXUA 4LWZA 2UXDB 4PHHA 4IRXA 3QSYA 2X2EA 4OJYA 4WINA 5I8PA 4JNCA 1M2VA 1TJ5A 1N7JA 4BECA 5DX1A 4TTTS 4NFHA 5ADUS 3T1YB 3NXKA 3SCZA 4CMEA 2Q5IA 1FY2A 1U1GA 3NNDA 3L0PA 2H16A 3WGGA 2PKQP 4ER7A 1RJWA 2O59A 3QOYA 1FCJA 4MV5A 5F4ZA 4NPAA 4EHJA 1NY5A 3LY5A 3B2EA 4OG2A 5AHXA 3VR3A 5JXGA 5CT8A 3H1AA 4TM7A 1NYLA 3SYLA 4LGVA 4EX6A 1H2ZA 1KU6A 2E5WA 4YP5A 3DZKA 1AKNA 4LDPA 3URMA 1M2JA 3R5XA 2IDKA 4OP2A 1CR6A 4CTKA 4CDRA 3TOXA 3PDHA 1AF7A 2PSEA 4UQOA 2FDXA 4KIUA 3AGQA 3I4LA 2QTTA 2YL2A 2V6GA 2W8BA 4PX5A 2P0YA 3BVPA 4KCGA 5CBKA 4JBYA 3SVZA 4A2PA 5IH3A 2IKSA 5CFLA 4NFSA 3OJCA 4A2CA 3DAFA 3SE7A 5BRAA 2V7GA 3FTDA 4KO3S 5HZGA 1JLHA 1GTG1 2O8NA 3IEIA 4HLDA 4F91B 3EFBA 3SQLA 2YS6A 3THWA 1NBME 3IEXA 3Q15C 3LBNA 5D1NA 1D4OA 5IUKC 4CL8A 3JQ8A 1EK0A 3AUTA 5GZ6A 1ML4A 3E05A 4DYDA 1MORA 4F7WA 1WCV1 2P2YA 1YRHA 1G4HA 2FFJA 1L1FA 1GDHA 4OXQA 3DM5A 3ERCA 4Z7NB 5A5DA 621PA 1JIIA 4UVGA 5J1TB 2WSLA 4OM8A 4QOSA 3RSOA 4WFKA 5IF9A 1GUAA 2Q2WA 3IRVA 3OT1B 3P0IA 4FSDA 2C20A 5J4YA 2HT1A 4J3JA 4BFXA 4PGFA 3PIRA 5FPSA 2BMJA 4I9NA 2JFWA 5HRAA 3AI1A 4UAVA 2WWWA 3TFOA 5H8WA 1MC8A 2HIGA 4GWLA 3S6JA 1N2BA 2ECPA 4G5GA 2Q4BA 1A2BA 4L3OA 1UBSB 1U2QA 5KTKA 3M70A 3BF7A 1RDFA 4MQEB 3WGLA 3OLQA 1SXIA 2CFOA 3JASB 3L1IA 2V9ZA 3EHDA 1PN3A 2LD4A 2WIKA 3EBLA 4A8HA 5C4MA 4BFYA 1LDBA 4DV4B 4FJ2A 2CN1A 1XA3A 4TSKA 1CZNA 3DVAB 3PNVA 3R5JA 1PDWA 1ZJ4A 1FVHA 4QU5A 1FLVA 4GAEA 4GZLA 4OHKA 5BSUA 4R8MA 1YZFA 3OZBA 3ZXUB 5A7FA 1CHNA 2Q8QA 1RQNA 3VM6A 4FWBA 1Y9ZA 1NLUA 2VUHB 2JIDA 1GZ3A 2GBFA 4ISBA 3UAXA 2BM1A 2VHCA 3K0FA 4OL0A 3VJLA 3TQTA 1S6YA 1URPA 3K0BA 4OAPA 3UB2A 4QUDA 3CF2A 3CIFA 3GJ5A 4MSUA 2QTBA 3HJRA 5I9IA 1OQAA 2BBWA 3W4KA 1KY2A 4MQBA 4PR0A 3VX4A 1L5MA 1DBVO 2P68A 4JVNA 4US2R 4MKRA 3EEBA 4WXYB 5EIFA 3KEMA 4Q93A 1B2RA 1O5TA 2RKOA 4BMDA 4J07A 3SF8B 1LBSA 1ZM2A 1Z2NX 1NA5A 3WBKA 1E2JA 1GCUA 1VMEA 1A71A 3GAMA 3IV7A 3ZCPA 5DWQA 2CLDX 4X90A 2PUHA 1I51A 3HO6A 2Y71A 4AUKA 1KSGA 4MLZA 4BNLA 1ILEA 4BZQA 3L1VA 4XIFA 3A2MA 4RK7A 2UUOA 3PU6A 4S1VA 1L5YA 1RW4A 4G4GA 1WZCA 3N6RA 4MP6A 2C7OA 4EIWA 2HL6A 5CDHA 2L0XA 3NDRA 1FU8A 3GFVA 3EVGA 3TUIC 3AXSA 5JI3E 1Z6YA 5KYWB 2B7BA 1OKKD 4Q9HA 2AX3A 2FSGA 1DOHA 3AEKB 4L8FA 4XJXA 1H3FA 3C6QA 1KGDA 3DZ8A 1N2CE 4IIVA 1R64A 3VPSA 3A9SA 2FZKA 3KJNA 5BN5A 2C5BA 3FWKA 4BS9A 4AS1A 3HLTA 3OM1A 2O7VA 4OHPA 3UK0A 1DX4A 4G8BA 5JNLA 4KRYA 4Z7JA 2XODA 2UZAA 2ZRLA 2N0SA 4GI3A 3V8QA 4EA8A 2PO7A 2VJBA 2VF8A 4Z9FA 4P4TA 4IQ8A 2J31A 3SDSA 3TH5A 4ENVA 5MN6A 3QXHA 5AOBA 3ZVMA 3L8HA 2ZTSA 4TN1A 4N41A 2QNIA 3KKQA 4N6OA 3GT4A 3ZWOA 4F96A 1QIGA 3L02A 1Q12A 2DGDA 2X2OA 3PUJA 4HUQB 1AN9A 3ZVLA 5HF5A 3K6SB 4F21A 1ONBA 1RI4A 4DG8A 5HPYB 3PFNA 4MUMA 1Y4UA 1DEKA 4HNAB 2I2BA 1FTSA 1LPPA 1GHTA 2BJHA 2NXNA 1GN9A 3EXAA 1DG9A 1XHLA 2WDPA 3Q6IA 1NTOA 1VKRA 4JGBA 4Z86A 2TMGA 5BP7A 5IT4A 3BWVA 4PYRA 4CHTA 2O8BA 1SUFA 4LOIA 4WLNA 5IT5A 2C5AA 1CULC 5B1YA 2PHZA 1K8YB 3T38A 2RHWA 1QWSA 1JAYA 1YZGA 2I76A 2B6NA 2MR6A 3AV0B 3EWIA 3PXEA 4RTRA 1PDOA 3MCAA 3UBMA 1WUHS 3KV3O 2Q8PA 1M8PA 3A26A 5HG0A 5JRZA 2ZWAA 3P5SA 4QUHA 1Z8HA 1M75A 2QIPA 4IX1A 3W2EA 4EKDA 2JCYA 2YOHA 4ASUA 1FVFA 3IOCA 4UHCA 4CF6A 3ECSA 2P3SA 3EY9A 3JQ9A 4Y1EA 3EB9A 2QZZA 5JNVA 3MLBA 4CQMB 2AOXA 1DJQA 3RRNA 2IUTA 4L7VA 2V0NA 1ZN8A 5DGCA 4F11A 1N6IA 4U2CA 1P77A 1PJAA 1ZI9A 4LRWA 1G8KA 4GYJA 4XTRA 1VG0B 4INOA 4DSTA 2ZJBA 3S2EA 1RRCA 3VNAA 1Q0LA 4KC0A 1ZK1A 3KPYA 5D7BA 2Y27A 3HEBA 3IEPA 2OVFA 3VYVA 4ZEVA 2GN4A 5EWMB 3DF7A 4K3VA 5IDVA 1KH1A 5KO2A 3LX4A 4JLVA 1V45E 1LPBB 3FMFA 3P96A 3A6LA 3ROQA 2CWDA 3G5TA 2R6HA 4D3XA 1O08A 4GWKA 1K6JA 1UKVY 3MS4A 1WF3A 3CHYA 3EC7A 4MRMB 4P3NA 2ZUBA 3GA5A 4KQMA 3VR5D 4CWAA 4N47A 4JYBA 1CS4C 1ONOA 3EVEA 3UGQA 1OBVA 2BRUC 1QG0A 4BKQA 5DKFA 2JFGA 2A88A 3P2MA 1W4CA 1KBZA 5C46F 5I7HA 2VJMB 1PO7A 2FHSA 1UKCA 2VLBA 2ZROA 1MLDA 2SNIE 1SXGA 4M0DA 4TV9B 4MS4B 1H4QA 5D6OA 1M67A 3MHPA 3TOCA 5C1OA 4J0IA 3VNRA 3TLGA 4WKBA 1R0RE 4OREX 4EJ6A 5A4DA 2VYFA 3HI4A 1GZVA 4I7EA 4BRUA 4IVNA 3ZTWA 3NPMA 2MIIA 3KYJB 4NFYA 1EWQA 1EHYA 3QWAA 3D3WB 1VZ2A 5L7YA 1VCOA 4DGSA 5JW6A 2MMGA 1AKRA 4CR7A 4H7HA 4UTVA 4AJ9A 4DYVA 1FFSA 4O29A 5JMTA 3OTOB 3DC7A 3G7SA 3PXDA 4K9KA 4DB2A 1P33A 1W73A 1ZM9A 4H7DA 4P32A 3PKIA 4B32A 3CKLA 3KHTA 1M2NA 4UUPA 5HZMA 1S5PA 4YUVA 2XA1A 4HRXA 3BSSA 4ZK2A 1IIRA 4FHGA 1DGQA 3DUWA 1O8BA 421PA 5BSEA 4OQEA 5BOVA 3A6HA 1CQIA 1TYCA 3LUAA 2DTDA 1QZUA 3OC0A 1KNQA 3FCEA 2QX7A 2Y4NA 4HY3A 4IQGA 4E88A 4ZI7A 3KJQA 4RPLA 3LM8A 2C8VA 4JD5A 1WHTB 2RGEA 3ENNA 4DBVO 1WB9A 1PR6A 2EF0A 4EJSA 3KTAA 3L4JA 1KEEB 2IL1A 5K2MA 1VKNA 2QW0X 1RWPA 3G2PA 1BJRE 4YJ3A 4C7JA 4C5CA 4JI5B 4CLEA 2Q5OA 1JLKA 4IDBA 1P2VA 1S4QA 3H2BA 1T8SA 2I62A 2KJQA 3B6JA 2VZLA 1DWPA 1W85B 3WI7A 3E1KA 4DRZA 2OENG 4DQVA 5BV8A 1RXWA 3VUFA 4YJFB 5LQNA 2BH9A 3VR6H 3U60B 1XAJA 4A8PA 1J2JA 1J9GA 3S81A 3CY6A 1Y3HA 3W7VA 1OHHA 2JK1A 4JC0A 2R8PA 3HSYA 4PQGA 3FOBA 4XUGB 4Q3DA 1Z74A 2WUDA 1KEWA 2QLJA 1D03A 2VDWB 3EG9A 4ZT4A 2JDIA 3PGXA 2I6GA 5F3RA </