4CM7A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
252
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQNGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
molecule tags Transferase
source organism Trypanosoma brucei brucei
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
total genus 94
structure length 252
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm7A00
1T26A 3IS3A 1LRJA 4FD3A 3ZV6A 2XXBA 1YJQA 1Z75A 1JKIA 3ZWXA 5FFFA 4LVUA 4CM9A 4O1MA 4A7PA 3EMKA 5J23A 1BSVA 4O6VA 5JAQA 3JD0A 2CDCA 3TRIA 2X8LA 3WX0A 3IDSA 1IHYA 3H3JA 1U3UA 3NYWA 4LN1A 1JVSA 3K2BA 1IYZA 1XG5A 3ROQA 2C2XA 4ZQBA 4TRMA 3LF1A 1NPTO 4NBUA 4YRDA 2I3GA 2PLAA 1ZK0A 1XELA 4AJ4A 3JD2A 3WTCA 4JP3A 3N58A 1E77A 3GGGA 2VYVA 1E5QA 3VHRA 5JE8A 4W7IA 1GYQA 4MVJD 5IAAA 3W6UA 1WVGA 3WSWA 1EDZA 1UXIA 2YY7A 3H9EO 4ZN6A 3AOGA 1IE3A 2PGLA 2YFQA 5C7LO 3ONFA 4Y6RA 3OF2A 2X5KO 4FIZA 3LT0A 2PV7A 2HK8A 4L74A 2CUKA 4RLHA 2IE0A 4RF4A 2GYYA 1ZIDA 2ZYAA 2YYYA 2ZTLA 1KVSA 3D1LA 4MVJH 1GD1O 2GUGA 4TRNA 1R12A 4QFDA 2AA3A 3PJGA 3N74A 3RU9A 3WSVA 1X15A 4PLTA 2H5LA 3GRPA 3BZUA 4ND1A 3TF5A 1B26A 3ENKA 4PLPA 4CM9D 1EUCA 1CQJA 1ADCA 4TVBA 3IJRA 3V1YA 3TFQA 5ILGA 3ULKA 1F0YA 1RM5A 3DBHB 1EUDA 3KYCB 3GFBA 2O3SA 1GPJA 3MZ0A 1IOLA 3S2IA 5DULA 1I3KA 1Y8QA 2X0RA 2ZQZA 3D0OA 1B0AA 3B1JA 4J0EA 4JIGA 2RH8A 3AU8A 3H5RA 4MVJI 1U5AA 1YGYA 1ZSNA 1AE1A 3AUAA 4OXYA 4PRLA 3UCFA 3CUKA 4QXMA 4GLOA 3DZJA 3U62A 1T2FA 3VTFA 2B5WA 5FF9A 4RPHA 2FN7A 2FPPA 2QZZA 4Q3DA 4MVJF 1EMDA 1TVEA 3I4FA 1LNQA 2W90A 3H6KA 4U8GA 3U4DA 1BXGA 1WZEA 3PLNA 1LX6A 5K6AC 4JJIA 4BNLA 5KJ1A 1TT5A 2Q4EA 4OIMA 2VWGA 4UVEA 3V2HA 3HE3A 3VZPA 5BNIA 5EQDA 1BMDA 3FTPA 4M54A 1A72A 5EIOA 3PHJA 4XQEA 2Q1SA 1C0PA 2FMUA 2IDZA 1PQUA 4MP8A 3TJRA 2YHIB 4A73A 4EITA 5IZCA 1PZFA 4HXYA 4BNWA 4IDFA 4KUHA 4NU6A 1XU7A 1XCBA 3TZKA 2AHRA 2OBNA 4YRAA 4IXTA 4ZVVA 4ZD6A 2JL1A 3I5MA 3SJ7A 3VPXA 4Q3EA 2I5PO 1DEHA 2BFOA 2PKQO 3DZHA 1X7DA 1S6YA 3JQFC 1E3JA 4UREA 1LLUA 3SX2A 1J4AA 2J8ZA 1YE3A 2HQ1A 3AUTA 3OECA 1YOVA 3D5QA 1T2EA 3DDNA 2E82A 4GX2A 4MKZA 5A9TA 4AJ1A 2PA3A 3HHPA 4GX5A 4RORA 4DL9A 4E2YA 3RUHA 2NTVA 5L9AA 3VVCA 2C7GA 2B69A 2XXJA 1YQDA 3DL2A 3AOEC 5DCWA 4UUOA 1AN9A 2RAFA 3DZGA 3RAJA 3AM4A 3FI9A 4HNGA 3JQ6A 5COBA 2Z1NA 2OO5A 2FWMX 3Q11A 4B3IA 5KJFA 4W99A 4IDGA 3H4VA 5A02A 3T7CA 5FWNA 3ZDFA 4DUPA 1B2LA 5JXWA 3EC7A 4BMNA 5HS4A 1EE9A 1GTMA 1TB4A 2BD0A 4WE3A 2DAPA 2JD0A 3V2UA 5LDHA 1PIWA 1R0KA 2WSBA 2VZ0A 1H93A 3TQHA 4YT2A 3UGKA 5JSFA 5CEFA 1I36A 2HRZA 1I3NA 4XX0A 5DNAA 1RM3A 3TNLA 1JA9A 4RPKA 3KBOA 1SNYA 1I5RA 4N5LA 3GLQA 4QEDA 3ZU5A 4KDFA 4GBJA 2Y66A 5ITWA 1MLDA 1PZGA 1WDMA 4IIUA 4OXNA 2HCTA 4OSOA 4CMGA 3HG7A 4I9UA 2O3RA 3GN2A 2X0NA 1F14A 1L1FA 1YB1A 3PWSA 3RJ9A 2ZB7A 5B1YA 1KVUA 3WTBA 1HE3A 3LVFO 1OI7A 4CQMD 1EVYA 2J6IA 4GX0A 3VZQA 4RL6A 1HDYA 3E6AA 3D3WA 2IYOA 3E1KA 3DFUA 1LDEA 3ZZNA 2NU9A 1EUZA 1WP4A 2B4QA 2FSSA 3F1LA 3PGXA 3ZU3A 4BKPA 3ST7A 1Z6ZA 1NASA 5GZ3A 3SLKA 1HRDA 3DHYA 1H9BA 4CLDA 1HEUA 5B12A 4TZTA 2X4GA 3EHEA 1LA2A 2FPIA 4YJHA 3R1IA 2BH9A 2R00A 2DBRA 3GA0A 5GZ6A 5TLSA 4DLBA 2O7SA 2NWQA 2O4UX 3DBRB 3ZU4A 1R4MA 5A5EA 2DLDA 5JC8A 3MOGA 3CZMA 1U2GA 2Z95A 4XYEA 4E6PA 2VT2A 3G79A 4IZIA 2W2KA 3S2GA 3D3WB 1PGJA 5ILOA 2Y1DA 1VRWA 5GMOA 3WIDA 4IBOA 3PTZA 4Z0TA 1XKQA 2GR9A 2XPCA 3GG2A 5G4KA 5JNLA 2X23A 3A06A 4IINA 2B35A 4GVLA 4QQRA 2NVBA 1ZMTA 5AXBA 2O7QA 1UZNA 4CPDA 1GCOA 2VYVD 2AEMA 1ZEJA 2X5OA 3K9QO 3L9WA 5EL0A 2OOSA 2J3HA 3AWDA 3NV9A 1VKOA 2HSDA 2NNLD 3NJ4A 4R1SA 4ZQGA 3W8FA 4EZBA 1X1EA 2BI8A 4II2A 1HZJA 4R1TA 3RVDA 4ND4A 4QTZA 4CM7A 3GZNA 1Y8RA 2PZJA 1ZSYA 4IMPA 2OGUA 4AJEA 3JV7A 4RVDA 5HRUA 5H82A 4OKIA 3F5SA 2SCUA 3OEWA 4PRKA 1LSOA 2Y1GA 1I01A 2VHWA 3KHUA 1V0JA 5A03A 3ONDA 1NXQA 5A3JA 1Q7BA 4A26A 3ON5A 1DIBA 4WGGA 1WMBA 1QORA 3ZNNA 5G0VA 2JCVA 1MB4A 3ZNQA 3V1UA 4FC6A 4CLHA 1QLJA 4D0RA 4IDBA 5L95A 1PJ2A 2AXQA 3IOYA 4BV9A 4OGWA 2E6UX 2OBYA 3K2EA 4CM8B 1C0KA 3OIDA 2VWPA 2CZCA 4RGBA 4YAKA 5CG2A 3FBGA 3GG9A 3JQFA 2EF1A 1U8FO 4D3FA 1QYDA 1E7MA 2A4KA 4IQ0A 4ND3A 4I08A 1WLYA 3JQAD 3ZHXA 4D41A 4MKRA 4YPOA 1JQBA 4ALJA 1HDCA 2V6MA 2NU7A 1VPDA 2GO1A 4KQWA 5ADHA 4I5DA 1DPGA 4AJKA 1ZSVA 1I33A 2CVOA 4E32A 4YBZA 4Z9YA 1ENZA 1M76A 1Q2XA 2EKQA 1FDSA 4W4TA 3LT2A 3QVTA 3KSZO 2BI7A 4CV1A 5JAZA 4FJ1A 3FNEA 1H6DA 2QYSA 2CDBA 4GMFA 4BNTA 2JFFA 4Z0PA 3WB9A 2VTDA 1ZEMA 1EFKA 1P0FA 3D7LA 1ZCJA 3PVZA 1LQUA 1GY8A 3JQAA 1MFZA 1Y9AA 3DZKA 4LISA 4UUNA 1XEAA 3DWFA 1IUKA 2NQ8A 3U49A 2RIRA 1UAGA 1M6HA 3D5TA 4BNNA 3S8MA 1O95A 1Q1NA 5EQFA 3PHHA 3W6ZA 1E1NA 1SPXA 3WGZA 1HYGA 1XIVA 1SOVA 3ZWAA 1DLIA 1GEGA 4O5OA 3ZWOA 3NEPX 5ITVA 1PJSA 1H9AA 1F06A 4RF3A 1TT5B 3JSAA 4YCAA 4J7XA 2GCGA 4IJKA 2AG5A 2DBQA 4J1NA 3V5NA 1DOHA 4J91A 1TA4A 2HDHA 2OXIA 2LDXA 1U3WA 3JYNA 4D42A 3RBVA 1LDMA 1GUFA 4FPXA 4GWKA 1T4BA 4TROA 1Y5RA 1VKNA 2POQX 4RQTA 3K30A 4W9NC 3S1LA 1QYCA 4IMRA 2DBZA 1ENYA 1K5HA 1QKIA 3QY9A 4JN6B 1N5DA 1GL3A 4ZICA 1E1MA 1N1EA 2NQTA 4DA9A 4NNJA 3LT1A 3ONEA 4J4TA 4P4GA 1DAOA 2X9GA 4CMJA 1NQTA 3EZLA 1DFHA 4IS2A 4ILKA 2JHGA 1O5IA 4PZDA 1ZMOA 3G3EA 4CR6A 5A06A 5G0UA 1D4FA 3OP4A 1VLLA 1W0CA 4D7AA 4YJGA 1DIGA 1S7CA 1OMOA 2P4HX 4XIJA 3WJ7A 4WOJA 3RUEA 1V6AA 5CDUA 4IQ8A 3SC6A 1ADGA 1LQTA 2ZJ0A 2Y68A 1SAYA 3MJ4A 1NR1A 4PLGA 3RC2A 4BGUA 4HV4A 3LC1O 4BNIA 2DU8A 4Z0HO 1O89A 4FOOA 3HFSA 2H9IA 1Y81A 2WJPA 2I67A 1Y8RB 2I76A 3WOHA 4YAGA 1K6XA 3ASUA 5F3RA 3ANNA 1MV8A 3LYLA 4GPD1 1HTBA 1CWUA 4G2NA 4XQCA 4XKJA 2BLLA 4R9SA 5G2OA 1I0ZA 3ZN2A 1JDJA 3AUUA 2O2YA 4EI2A 3FNFA 1DIRA 9LDBA 3MWEB 4WLOA 1W4ZA 4WPGA 4Y6PA 2YV2A 2VHYA 5FEUA 2BFPA 5F21A 1B8PA 4NI5A 4KTTE 4HY3A 5CPFA 1OFGA 5DP1A 2BRUA 3E9MA 3GGOA 1U9JA 2XOXA 4QX6A 4M89A 5CP8A 1NX6A 4FC7A 4XYBA 3UW3A 4E5PA 3GOHA 4N54A 3WXBA 4BO8A 5JPIA 1DRVA 3ZWBA 1BDBA 4IM7A 3Q2KA 5DBGA 3PDUA 3SJUA 3IP1A 4U6SA 4J3FA 3RBXA 3GH3A 3NGLA 4M87A 2PZMA 3L4BA 4YB8A 1P9LA 1UDAA 1N9GA 1UAYA 2AQ8A 4J1SA 2Q1WA 4NBTA 4D44A 3FF4A 2JCXA 1LC3A 2VUSA 3EDMA 4YXFA 5TJ9A 3ZH2A 3JQBA 5T8KA 3AW9A 4DLLA 4Q3AA 4Z6KA 3DO5A 1C1XA 3QVSA 5CHEA 5LDGA 1UUFA 1E92A 1G1AA 1H94A 2OZPA 3DOOA 4YJFB 4CQLA 5F1OA 4ALNA 4NZ9A 1ONOA 3IP3A 4BNMA 3HN7A 4J1QA 4B8WA 1KEVA 1NP3A 4PLZA 3B20A 4NQZA 4YJDA 3ZW8A 1PEDA 4M55A 5ENVA 2P9EA 4TRRA 4AJPA 3GNSA 1MFPA 2DTDA 5A05A 5KVQA 4EUFA 3BMOB 4BL5A 1HDXA 3U4IA 2NTJA 5HWSA 1HETA 3BTVA 1VJTA 4KUGA 3TZ6A 3SC4A 1PGPA 1I3LA 1ZUD1 5G4LA 4ZA2A 3NDRA 3ROPA 4B7CA 4CLEA 1LI4A 3U3XA 2PD6A 3SBOA 2Q99A 4D46A 3E8XA 1BRMA 1TT7A 3ZGYA 3WYBA 4E2WA 1T2AA 1XA0A 5IN5A 1YWGO 4FFLA 2GPTA 3RI3A 2FHSA 1C0IA 1YJ8A 3JQDA 2Q2WA 1E6EA 4O63O 4YRBA 4NIMA 3T7EA 2VYND 1BXZA 1NWCA 4XCVA 3TZQA 1I32A 4TSKA 3WNVA 1ID1A 1Z7EA 1DC3A 2BFAA 1D3AA 2NVWA 3DZIA 3P2OA 5U9CA 3I9KA 3OHSX 2AE2A 4NFYA 1R6DA 3WGGA 4E12A 3OIFA 3AI2A 3HDJA 4BNHA 3DAGA 3PI7A 4OSPA 4IQGA 2H63A 2PWZA 3FHLA 3DEYX 4YT4A 1B8VA 2DC1A 1VSUA 2YHIA 1ULSA 4H3VA 4K28A 4Q3NA 4XR4A 5IN4A 4UVIA 3HDQA 4WUVA 2PK3A 3GVCA 2DT5A 4NH4A 4JCOA 4Y98A 3GHHA 2Q2QA 5T5QA 3BTUA 3PIIA 5JFOA 1X7GA 4YJGB 3TPCA 4F45A 1VE9A 4O0LA 1RWBA 3DXFA 1CDOA 3ZHZA 4BV8A 1UJMA 3P2YA 1L7DA 3PQFA 3ZV3A 3GZNB 2AQHA 3GEGA 2GERA 4JGBA 3S55A 3RU7A 1DC5A 3BMQB 2HMVA 2P4QA 3L07A 2PH5A 3O8QB 4K9DA 4KMSA 4MO2A 4DRYA 1YL5A 4ITUA 1BTOA 1LSJA 1DLJA 2Y93A 3JQGB 3L0DA 2YV3A 3H65A 3CXRA 1EZ4A 2O3TA 2VHXA 2G0TA 4RO0A 3KZVA 4WLEA 2HK9A 4AJJA 3RKRA 3I4CA 4LCJA 4DPKA 3Q0EA 2WD8A 1P74A 2FR1A 3OBBA 4GKBA 1PGOA 4YEDA 3AJRA 3FTNA 2HJSA 1D1TA 1LRKA 1BVRA 2YJZA 4RQUA 4CQMB 4ESOA 2GF2A 3UOGA 2VRCA 4MP3A 2A9FA 1A4IA 4WNIA 5IFLA 1I10A 3PZBA 4BB5A 4NBWA 1MC5A 1CIVA 3GVPA 2QYTA 3H2SA 3HSKA 3JCZA 1RPNA 1T24A 3BHMA 5K0ZA 1E3WB 3ZV4A 1CJCA 1K6IA 1JTVA 1NQAO 1HDRA 4K6FA 1EK5A 3WYCA 1ISHA 4YT8A 1LRLA 4CM8A 2DPHA 1EE2A 1GZ6A 1N9GB 4J0FA 3KYDA 2C7VA 3BMOA 1EBFA 1QYWA 1Y8QB 3MEQA 3QSGA 3NRCA 2HLPA 4CV3A 4L8VA 4B7XA 5JDIC 4GL4A 3D64A 3TZCA 3W8EA 2QQ5A 4BNKA 3LZ6A 4RCVA 2Q3EA 3IMFA 4XGIA 3BYZA 4EDFA 1T2DA 2HK7A 4BO2A 4MIEA 4EEXA 4R01A 5TF4A 1PJ4A 4URFA 1JKFA 1LTHR 2D0IA 5L40A 3DMYA 1X0XA 2R6JA 4CUJA 3ZWPA 5KIAA 3QIVA 3VH4A 5TT0A 2CF5A 3FRJA 1LXCA 1X1TA 1B3RA 2NU6A 4M1QA 4NMHA 4FW8A 3T4EA 4E21A 4PG5A 4BO9A 3VPHA 4M8SA 3N7UA 4XYGA 5TJHA 4IJWA 3DBLB 1ZXBA 1LU9A 2OP0A 5L4LA 2EERA 4DQXA 3JQ8A 3JTMA 4I5EA 1WAMA 1Y1PA 4U5QA 2WEKA 1ZK2A 2HJRA 1P1KA 1QR6A 3GNQA 1OZAA 2NM0A 1K3TA 3S2EA 1PS8A 2PY6A 3I9MA 4R41A 1KVQA 1OC2A 3PHIA 1HLDA 4GH5A 4Q3BA 4XYMA 5DP2A 3NX4A 4KOAA 3EVNA 5EN4A 5GY7A 5DZSA 5JBIA 4H16A 5JDCC 4CJXA 1BW9B 4CM3A 3G17A 1NFFA 3OICA 2VRCD 3Q1LA 5BQFA 3H7AA 1WXDA 1IPFA 4OM8A 3ZWNA 2C2YA 3DBRA 4UUPA 2JHFA 4ALKA 1ISIA 4FCCA 2W2LA 3JQCA 4H15A 5T6BA 1TEHA 3INTA 3K31A 1D8AA 1R0LA 3OEYA 4IUYA 4L0QA 3RC9A 2I3AA 5BSGA 3BMNA 3ORFA 4B4UA 5IXYA 3O8QA 4E2XA 4BNFA 1NQ5A 1DIAA 2QRJA 3GZ4A 4BNYA 2YQ5A 5HM8A 1EVZA 2BHLA 1M66A 3AFMA 1LLQA 1E3IA 5AXCA 4A0SA 2WTBA 5HS6A 4PZCA 5I9NA 1AHHA 3TL3A 5TGDA 4QT0A 4IJUA 4AJ2A 5CFZA 3H9QA 5TRTA 3D4OA 2BGMA 5EESA 3OSUA 3DZFA 3R0IA 5COAA 3F4LA 4BOYA 4GWGA 1N92A 2EP5A 3L6EA 1Q0QA 4UEJA 2HO5A 5C5IA 4WLFA 2J5RA 2DTEA 4JQCA 2X86A 1R4NA 2FSVA 1PL8A 3KLMX 3LLSA 4JBIA 3E03A 3W8DA 1Q7CA 2DFVA 1R15A 3QW2A 4N18A 1HXHA 4PVDA 3IUSA 4ONEA 2EG9A 4JNKA 1A4UA 4CV2A 2IZZA 1Q0HA 1WW8A 1FF9A 3PJFA 4PG4A 2GN6A 1Z45A 2CVQA 1T1SA 4I8XA 2DUWA 3QWFA 4UEKA 4XQ9A 3SVTA 2RH4A 4EBFA 1C1DA 1VL6A 2V6GA 1YDEA 3P7MA 3EAGA 1UDCA 2FOIA 4XB1A 3AM5A 1FMCA 4GGOA 1P3DA 3GNTA 1PS9A 3M6IA 4Y8VA 3QRWA 3VTZA 1PGNA 4EUHA 1XQ6A 3QV1A 3BMCB 4CUKA 1QMGA 1R4NB 4I9HA 4DPMA 4MVJE 4W9NA 1DC6A 4U7WA 4WJZA 4E33A 1Z73A 5CDTA 2ZYGA 4LVCA 1U8XX 4JP2A 3CMCO 5K9ZA 4FSHA 2EKPA 2FR0A 4OQYA 4F6LA 1R0SA 4ZU3A 1KC3A 3RFTA 4OKNA 2C59A 2C54A 2WM3A 4NG5A 5H83A 4EJ6A 2PD4A 1U3VA 3PJDA 3O26A 2Y99A 3ROKA 4BIIA 5DCUA 5C7OO 5JC1A 5ER9A 2Q46A 3WJAA 1XGKA 4AJLA 4RVFA 3GMSA 6LDHA 2YDYA 4CLOB 4IXWA 1KY4A 1M67A 2J5KA 3DBHA 1C3VA 4ALMA 1HKUA 3CH6A 3GVIA 4UUMA 1P1JA 1RM4A 4RJTA 1P33A 2WD7B 2NV6A 3E5RA 4BMVA 1BVUA 1F12A 3NJ8A 1B8UA 3DHNA 4BO7A 3ENNA 3KM0A 3X2FA 1R66A 4BS9A 4MJLA 1ZNQO 4JJGA 4AJIA 3DZBA 3GK3A 4DC0A 3GUCA 4R69A 3G1UA 3PLRA 1DHTA 1HDGO 1G0NA 3NTQA 3OA2A 4FDAA 5L53A 1UXKA 4IY1A 3WQRA 3PWKA 5JDIA 3OJ0A 4CMEC 3L4BC 1J6UA 4FFRA 5I7VA 1EEHA 2GN8A 4OQZA 4BGEA 3EY4A 4J7UA 3S2FA 4EUEA 1EFLA 4I1IA 1RKXA 4B8ZA 4ZRMA 2C82A 3P5SA 3NT5A 5CDGA 3HUDA 4RPGA 4ROSA 4BVAA 3ZI0A 3AK4A 1T4DA 2DFDA 1HSOA 1C0LA 3JYPA 5G0WA 1P45A 4DPLA 4GI2A 4XZ3A 3JQBC 1OBFO 1IPEA 3ZV5A 1JN0A 5AYVA 4MKXA 1CRWG 3IAHA 1PJTA 4LW8A 4WK6A 3LLVA 4WKGA 3O4RA 3HDHA 3KOUA 1DHRA 4FFPA 4E13A 4F6CA 2EGGA 3IQDB 3M1LA 4Y6SA 4XDYA 2VT3A 4IGFA 1YBMA 1UP7A 1R16A 5I7EA 2ZB3A 2C29D 1MG0A 3KB6A 5DT9A 3W1VA 1XU9A 3I9LA 4JLWA 1A7AA 3H9JA 4BKQA 3BHJA 3MJCA 3G1TA 4L73A 3CSDA 4AL4A 4JXKA 3ZU2A 3WBBA 4IDCA 3WQQA 1YB4A 2WYVA 4BKRA 3FPLA 3E82A 1HT0A 3TL2A 4DBZA 1EBUA 1GYRA 3AOEA 3ITKA 2NADA 3WGQA 3WS7A 5C7IO 3PYMA 3SEFA 1SZJG 1N1GA 3LC7O 3LK7A 2GRAA 4CMHA 1PWXA 2X9NA 3KETA 1U7HA 4R5HA 5F5LA 3I6IA 4YWJA 2GGSA 4RPJA 2X6TA 2VHVA 2QG4A 1T2CA 4DLAA 5B37A 4EEZA 3FR7A 5AQ1A 6ADHA 3PJEA 1SOWA 3DBLA 1GUYA 1N7HA 1C1XB 2EW8A 2NU8A 2ZCVA 1NVTA 4L4RA 1NHWA 4CMIB 1LDNA 3D3EA 3GDOA 2X9VA 4QO8A 1E1KA 1MGOA 1U3TA 3JD3A 4MIYA 4CUZA 2ZB8A 4N5MA 1VSVA 4GGPA 3KYCA 4D3DA 1XLTA 2CVZA 2D3TA 1PU2A 1ZJZA 2V6FA 1JAYA 2W8ZA 3MCVA 5BT9A 2OFPA 4DIOA 2BGLA 4IDEA 4RV9A 1WMAA 1CF2O 4DBVO 4CQLB 4NFSA 1P1IA 4NK5A 2AG8A 4YJFA 1OC4A 2Y1OA 3HNPA 4WLNA 4I5GA 4YACA 4CMBA 1TI7A 3NGXA 5IDYA 1JAXA 5A1TA 3AUSA 2PZKA 5U1PA 5TT1A 5KKCA 4WLVA 2Q4BA 2IEBA 3DB2A 3JQ9A 9LDTA 3ZNOA 2ZB4A 2YW9A 1KOLA 2X7HA 3FWNA 5IF3A 3A14A 1WNTA 1KEWA 1NQOA 1OOEA 4NPCA 2YQ4A 3NT2A 1PTJA 5BNTA 3B1KA 3H3FA 5KWEA 3JQ8B 3M2PA 2V7PA 1FK8A 4XEHA 5ICMA 4HNHA 2Y05A 1MA0A 4QFCA 1SB8A 1ONPA 1PQPA 1SC6A 3HQ4O 3F4BA 1O94A 2DPGA 1NPYA 3CINA 4LK3A 4OOFA 4XRRA 4GX1A 3CKYA 4DMMA 3OJLA 3DC2A 3V8BA 1NFQA 3BTSA 3NUGA 4INAA 5JS6A 3DHEA 1E5LA 2V6BA 2FPGA 4R16A 3E9NA 2VWQA 3QWBA 2P5UA 1QYVA 3G49A 4P4LA 4Y67A 4P38A 5JO0A 4XA8A 2Y0EA 1K6JA 3OQ6A 4GMGA 1DRWA 1PR9A 2EJVA 5CEEA 3JD4A 2AW5A 3HADA 4CLXA 2X22A 4DYVA 1YKFA 3OIGA 1HE4A 2O50A 3MTGA 4C4OA 3H8VA 3MJSA 2OL4A 2B83A 3PWZA 4TWRA 2YDXA 2FY8A 4WLUA 3H9GA 4E3ZA 4RZHA 1NAIA 1DFIA 4PLCA 2XF8A 1GV1A 5TS3A 2WE7A 2J3KA 4LGVA 2PGJA 3LDHA 1Z7BA 4FFMA 3C7AA 3HN2A 1L7EA 5C37A 5JCXA 3DAFA 2G1UA 3W4IA 4W7HA 1GQQA 2I99A 3QVOA 2P91A 1Y9EA 3I3OA 4TQGA 3DTTA 3VPFA 2YZ7A 3FWZA 4BHTA 1CETA 5MGBA 2H1SA 4KZPA 2NTNA 4NJMA 2CFCA 4F3YA 1Z74A 4NK4A 5L7TA 2QRLA 1DIHA 4NHEA 1XDWA 2GLXA 4JBGA 1YH3A 1GU7A 4U0JA 4W6ZA 3KXDA 3VKVA 3VVBA 3C1OA 4QUKA 3ZWYA 5DBIA 4BO0A 4YTEA 3X2EA 1E6UA 3BAZA 3WGYA 4WCFB 1YB5A 4E30A 3JQGA 3GAFA 5EJ2A 3WGHA 2ZTMA 3UN1A 3OQBA 1I2CA 2NLOA 3JYQA 1LLDA 4YA6A 3PYXA 2A35A 5L7WA 2TMDA 3SXPA 3VOSA 5GZ1A 2VCYA 4GKVA 2NVUA 4XWYA 1UP4A 3UF0A 4DIFA 4DVJA 5H81A 2D2IA 8ADHA 2GDZA 4OAQA 3MJEA 1ZJYA 2Z5LA 3KUXA 5T57A 2GN4A 1IZ9A 4J4BA 4IJVA 2ZTVA 3RBZA 7ADHA 5G0SA 4D0SA 1H5QA 3OA0A 5JCJD 1HL3A 3F5QA 1EK6A 4GSKA 4DWVA 2GZ3A 2EHDA 4W82A 1H6BA 5JCJA 2B5VA 2PGDA 5EERA 3WIEA 3BIOA 3WWYA 1NVMB 4EGFA 4ZJUA 3KLPX 3RWBA 4CODB 1HDZA 2B0JA 3QHAA 1PQWA 1FDWA 3JQ7B 2JAHA 4GVXA 4XJSA 3WGIA 4E5YA 1NM5A 1ZXLA 2IEDA 1O6ZA 2DVMA 3WMWA 4D43A 4LSWA 4MDHA 1JKJA 3BTOA 3K5PA 1ZW1A 3KV3O 1NNUA 5JYEA 4BNXA 2EV9A 3COSA 4CL8A 4BB6A 1NVGA 3GEDA 2ZTUA 3OJEA 2PKQP 1CERA 3VC7A 3DOJA 2Y0CA 1GDHA 4LSMA 3CPSA 4M86A 3KEOA 1P0CA 4ALLA 4HFRA 1ZH8A 1P31A 5KOIA 4TKLA 3H2ZA 2ZKLA 4BO6A 4CLOA 2BGKA 2Y1CA 3OJOA 4BNZA 4F46A 3RJ5A 2AE1A 4DREA 3CMMA 5CDYA 1T1RA 1YDWA 2UAGA 4I9NA 5B4UA 4MP6A 2DKNA 4FJ2A 4DQUA 3JQ9C 3UICA 4I5FA 2ZATA 3UKOA 4U0KA 1D1SA 1LDBA 3GHYA 4UAGA 3ZHYA 1PSDA 1YBAA 2PNFA 3OM9A 3K73O 1E3SA 3FR8A 1Y5MA 3EUWA 1TXGA 3DMTC 2VOEA 3C1AA 1HF3A 3RFVA 3ICCA 2QW8A 4HKTA 2LDBA 2D5CA 1DDOA 5B4TA 2D4AA 3MJTA 4GLLA 3PIDA 1X7HA 3W4KA 3C3XA 4L75A 2EJWA 4G65A 3ANLA 5T67A 3IC5A 4A5OA 4CR7A 5F1KA 5IG2A 3EK2A 3FCOA 4FN4A 3GPDG 3QVXA 1PX0A 4M49A 1YOVB 5ER6A 5I9MA 3FD8A 3PEFA 1HLPA 3MOIA 1ULUA 5KTKA 3RUFA 1LSUA 1CYDA 1HE2A 1ISMA 1C1DB 2F00A 5I8ZA 1ENOA 3VH1A 4BO3A 5HTOA 2UYYA 3AFNA 3DR3A 4TVOA 2O4CA 3ZW9A 2JFHA 3ETDA 1JLLA 2D1YA 2H6EA 2R00C 2J3IA 4CMIA 3ASVA 1KEPA 4NJMB 4YDRA 1KVRA 4B3HA 4WASA 2Y1EA 3ETGA 3GR6A 5LCXA 3WNQA 4P22A 2BF7A 2Q1TA 3U4CA 4CMCA 4N7RA 4PZEA 1JU9A 4WEOA 4PCVA 3CEAA 3CTMA 1V35A 4CLRA 2ZK7A 1ZO8A 4YAJA 1GR0A 2X1HA 1EVIA 1LC0A 3UUWA 4FFOA 1GZ3A 1F8GA 4NBVA 1HZZA 3HWRA 3I83A 4XDZA 1VC2A 1X14A 3GMDA 4HFMA 4OHUA 1SEVA 3GVXA 4BO4A 2C0CA 1M2WA 3RD5A 3H9UA 1M75A 5JY1A 4YJHB 3K96A 4BNGA 1P1HA 2VYNA 1QLHA 4MVJM 3KTDA 1E3EA 5KVSA 4R1NA 4U6QA 3A4VA 3NT4A 1QG6A 2HMTA 3FNGA 3RASA 5JDCA 5T64A 4RDIA 4PGFA 1U1IA 5IXSA 4C7JA 5F1PA 4Z3KA 2CNBA 3QVWA 5DOZA 3RUIA 4CMEA 4UULA 3Q3CA 2OMEA 1B15A 3CIFA 2OORA 3PRJA 3D4PA 2WD7A 5DOVA 1IULA 2PTGA 2EXXA 3ZWWA 2RBEA 1B16A 1O0SA 5L7YA 1LDGA 2UDPA 5I7FA 1IY8A 3NTOA 4BNUA 3M1AA 4QSMA 4DMLA 2G82A 3RIHA 4TRJA 5T8KC 1GADO 2YUTA 2VZ9A 1GQ2A 2YFHA 2JAPA 3A9WA 3AY3A 1PZHA 3I6QA 1I2BA 1PL6A 4ID9A 4WCFC 4B3JA 3IL2A 3NAQA 1LBEA 3IKTA 1B3BA 4NFHA 3WBFA 4BNJA 3TFOA 1VI2A 4S3MA 4CMAA 2BELA 2DQ4A 1ONNA 1HWYA 4CM4A 2JCYA 3UHAA 3ZWCA 3E48A 3UH1A 1XYGA 1K0UA 1V9LA 2G5CA 4MVJG 4R5MA 1A71A 4RVSA 3UFXA 3C1TA 1H6CA 4FOSA 3L6OO 2FP4A 1U7TA 2R2GA 1RM0A 1ZKMA 3E9QA 3PPIA 4RF2A 4QECA 2B36A 4RZIA 3LSYA 4JROA 4PIVA 1MC4A 4PG8A 4OJNA 5L4SA 2JFGA 1GYPA 3QA9A 4AJHA 4MVJP 5A9SB 3FPCA 2JJYA 1YRLA 4L76A 4RVHA 5EMHA 1HE5A 4LMRA 3LC2O 5A4DA 1I3MA 2NUAA 3PHGA 5IDQA 2IXBA 2D59A 4RF5A 4HADA 4XR9A 3VDRA 1DBVO 3GC6A 3EZYA 1MG5A 1H2HA 2WYUA 3GEMA 4WECA 5FI3A 2AEFA 1QV6A 1ZK4A 1F17A 5ICSA 2RHRA 3A1NA 3R3SA 2QHXA 3MTJA 2D8AA 3RCBA 5JLAA 1N7GA 4Q9NA 3IJPA 4BMSA 2VOJA 3TOZA 1QXSA 4WEQA 2VN8A 4R68A 1I8TA 1GQYA 3QP9A 5U4QA 5AXDA 4MIOA 3LQFA 5CDSA 3BA1A 4OYRA 2EWMA 4IS3A 4J2HA 3OH8A 4XB2A 1LDYA 4FBGA 4KTVE 1IB6A 3ETEA 3NTRA 4R3WA 3Q9NA 2PH3A 1ISGA 3B1FA 5DDIP 3R3JA 4OO3A 2X58A 2RHCA 2OHXA 3I1JA 3JQEA 2IXAA 2VZ8A 3TN7A 1WDKA 2CD9A 3C85A 4II3A 1KY5A 4IPTA 4BO1A 3UCEA 4J7CA 1NPDA 1YBVA 1QV7A 3I52A 4P8RA 4ALIA 2VUUA 4A10A 1DJNA 4D79A 5B4VA 1DSSG 4A27A 3OETA 5I8WA 4PLYA 4CL3A 2HU2A 5FYDA 4DC1A 3RUAA 1KETA 1V8BA 1IHXA 4NR0A 3VAZA 5KVCA 4Y9DA 3AI3A 3M2TA 4BNVA 1AUPA 3L6DA 1PR3A 3AY6A 3KVOA 3W4JA 3WGTA 5JMWA 2X0IA 3IKVA 2VNSA 2PR2A 1LLCA 1ARZA 1I24A 1HSZA 1E7RA 1IL0A 1BGVA 4HBGA 4RVUA 5L4NA 5HA5A 3AY7A 5JW6A 1YQGA 2QX7A 3INRA 3DAPA 3ZNPA 1A27A 1AHIA 1KS9A 4AVYA 3WG9A 4BKUA 1HDOA 2QZ9A 3DTYA 3OMLA 4YT5A 2OP1A 1H6AA 1QYXA 4LRTB 3KRTA 4KWHA 3U4HA 4CM6A 1E7SA 3GDGA 1N8KA 3T4XA 1SCUA 3RC7A 4B4OA 4MVJA 3MJVA 5DN9A 4CM1A 2G76A 4FFNA 5IZ4A 3DOCA 3MWDB 4XQGA 5CAEA 4R1UA 4B79A 4B7UA 1XSEA 2P9CA 3ICPA 5L3ZA 1VJ1A 2Q50A 1PL7A 2E4AA 4RLSA 4MOWA 4J1TA 4WNCA 3VKUA 3Q9UA 4FJ0A 4RDHA 4J6FA 2FR8A 2UUPA 1Q7GA 4UVHA 1LUAA 2W2LD 2X5JO 2GNAA 2PD3A 2O48X 1PWZA 2FZWA 1JWBB 4RPLA 5FI5A 1UP6A 3V2GA 1AGNA 2C20A 4HFJA 1FJHA 4L4XA 4EJMA 1QRRA 2VHZA 1JVBA 4WCFA 3UCXA 3QQPA 1PJLA 4EW6A 1WPQA 3KSDO 3QJ5A 3HJAA 1GV0A 2HMUA 1B7GO 5L51A 4E0BA 1DJQA 3KEQA 3PQEA 3QE3A 1A7KA 4G81A 2C07A 5AXAA 3A28A 3F1KA 3Q6IA 4FQ8A 4NJOA 5DCYA 3VZRA 1RJWA 3GQVA 2EW2A 2UUOA 3FBTA 3TZHA 1P1FA 1YVEI 3CZRA 4HWKA 4JJFA 1YXMA 1VM6A 3U9LA 2FRDA 3GF4A 3Q2IA 4HFNA 4LMPA 5A04A 3KO8A 1BXKA 3JYLA 3H5NA 3RKUA 5F5NA 1EVJA 2W98A 3P19A 5KNLA 4YQYA 4O59O 3EGOA 2Y0DA 4YQZA 1MXFA 1EQUA 4Q3CA 1GPDG 3I23A 1OAAA 1C14A 4PLHA 2HAEA 2O2SA 1X13A 4K26A 4PG6A 3B70A 2QRKA 2EKLA 3GFGA 1YONA 3O38A 4ND2A 2X0JA 1SB9A 2EIHA 3CE6A 4IZHA 1YO6A 2ZCUA 4N5NA 2VTEA 5G0TA 3TDKA 5JAIA 4L4SA 1BWSA 1J5PA 1O8CA 3QWIA 4LRSB 3F9IA 3AI1A 4E31A 1PJBA 1SMKA 4LCEA 1BW9A 3ITDA 1FDTA 1E3LA 7MDHA 2WE8A 3JYOA 2C5EA 1DRUA 1GAEO 2GD1O 1KERA 4J90A 3INGA 1K89A 3ROMA 4YAEA 1H0KA 4FR5A 3GT0A 4D3SA 2CMDA 2I65A 4J2OA 4EYEA 1I30A 3RSHA 1A9ZA 1ISJA 1UR5A 2WWRA 1ADBA 1V3UA 1E6WA 1NR7A 1ZBQA 2O3QA 3PHLA 3PZRA 5JO9A 2B4TO 3AM3A 4NDNE 5HBRA 1WZIA 1SO8A 2JD1A 4CM4B 5A9SA 1E7WA 3NDIA 2P2SA 5TC4A 4ZHSA 2CSUA 4AFNA 3IIEA 1NTOA 3E5MA 2JKVA 2V65A 1R37A 2IYPA 1YQXA 3U0BA 3VDQA 5CEJA 3WFIA 2Q2VA 1NBOA 5A9RA 4B4VA 5KJ6A 1G6KA 3LT4A 3UAGA 1V3TA 3HB5X 3K8ZA 3FN4A 4PVCA 4BO5A 2D5AA 4XRGA 4PLWA 3SLGA 1B14A 5BSEA 3C8MA 2HKIA 1NYTA 1KVTA 3HDYA 3JD1A 2ZYDA 1ORRA 3GDFA 5COQA 3WDSA 2VUTA 4R54A 1BDMA 2O3UA 1XHLA 2XAAA 1NWHA 2HRBA 1PJCA 2GASA 4AJOA 1PS0A 1HYHA 1U5CA 3PQDA 4JK3A 3FNHA 1ZZEA 4G5HA 4IDAA 3GY0A 2VNAA 4JX8A 3BMCA 4PLVA 3WYEA 1U2DA 3DONA 4JBHA 1IZ0A 2O23A 3BMQA 1PZEA 2IRWA 4KWIA 5KKAA 1RYDA 3GUYA 3WLFA 2BKAA 4NU5A 4AJNA 2ZQYA 3FSRA 1G0OA 5A3VA 4CQMA 2FZEA 3ABIA 1GCUA 3NDJA 1MUUA 1DXYA 2PKRA 1ENPA 3QWAA 1A9YA 3GN1A 1KIFA 1ZK1A 2CY0A 1UXJA 3KYDB 2YV1A 5IJZA 3TWOA 1TLTA 5KVVA 1F8FA 1UDBA 1I2ZA 3BXXA 4XYLA 2PZLA 3KSUA 5EINA 3JQ7A 4B4WA 4CLRB 2EGHA 4KQXA 2GN9A 5IZCC 4NBRA 1JW9B 2VQ3A 1XWFA 4L9RA 4YAIA 4CM5A 1KEUA 1DB3A 2A92A 3EW7A 2EP7A 3C7DB 4DQVA 2ZJ1A 3LU1A 4J49A 4E5MA 4FS3A 4DYDA 1E7QA 1PJQA 2BMAA 2HUNA 1NHGA 1X0VA 4KDEA 4WOKA 1SBYA 4IGEA 3B6ZA 3KYBA 4J4HA 4Z9XA 3K6JA 3PP8A 1HYEA 1ISFA 3WQSB 1E1LA 2A94A 4EJ0A 3BHIA 1BXGB 1M6WA 5TIIA 4R3NA 4OMUA 4R4JA 4Z9FA 3RFXA 5AVOA 4ZGWA 2Q45A 4PN3A 3IUPA 1KC1A 4KUEA 2CF6A 3VPGA 4XJTA 3NKLA 2AMFA 1P44A 4ZQFA 5G4KB 4ZQHA 2HMSA 4J9VA 4E4YA 5EPOA 3U09A 2NACA 3HZZA 4OH1A 3ZWMA 2YHUA 3PFWO 2ET6A 3RC1A 4E5KA 4J16A 1W73A 4BQPA 3I9OA 5DBFA 2W2KB 4ZQEA 4Q39A 2DTXA 4X54A 5MDHA 1QP8A 5TX7A 1WDLA 1BHSA 2UVDA 3ADOA 1YL7A 1R4MB 2E37A 5TQVA 2J5QA 2RCYA 3STHA 1FDVA 3BMNB 4XGNA 4K1LA 4DXHA 3GAZA 1EDOA 2HMWA 4DIBA 4P4NA 1U4SA 1KBZA 3OFSA 5KJEA 1DFGA 1U28A 1CEQA 3OJFA 4GSLA 5THKA 4BGVA 1LJ8A 3WFJA 2B4RO 3O03A 1PJ3A 2C5AA 1VL0A 4OXKA 2GSDA 3GPIA 4S1VA 4PG7A 4HP8A 5A5FA 4ZRNA 3RUCA 3ZHBA 1J49A 4OOEA 4A2CA 4E2ZA 1BG6A 3VZSA 3E18A 2EEZA 3L9XA 1UZMA 4YR9A 3WICA 4R51A 2Z1MA 4AG3A 2F1KA 4UVGA 3H5AA 1LEHA 2Y1FA 1PGQA 2VWHA 3F47A 4XD2A 2J3JA 1A5ZA 3L4SO 5L45A 1EQ2A 4TZKA 2P5YA 4HX5A 3VH2A 4HUJA 4PFJA 4PLFA 3EVTA 4C7KA 2BFMA 2AQKA 5JYDA 1NAHA 1V3VA 1N2SA 2B37A 1E3WA 5CPBA 1AXEA 2IODA 1CQIA 1GZ4A 1VL8A 1RYEA 1AXGA 4DTIA 3F46A 4XIYA 4GAEA 3V1TC 1QSGA 4E5NA 1E0DA 2UV8A 4FB5A 3WLEA 1Z82A 1W6UA 5JMPA 1FDUA 4YYZA 2QIOA 5CG1A 5AOVA 4Z3DA 1W8DA 3QWHA 3R6DA 3ZWVA 3PGJA 3WGOA 5IDWA 1VJ0A 3HFGA 3LF2A 3JQAB 3PK0A 4UVDA 2TMGA 5BR7A 2Q49A 3VPSA 3UXYA 1U4OA 5DF1A 3DBVO 3PYLA 1YL6A 3DMTA 4ND5A 1YS4A 3I9JA 5KJCA 3L77A 3DFZA 1DO8A 1UXGA 3PXXA 2DM6A 4RVGA 1GEEA 5TSDA 5I9LA 1MXHA 4MPDA 1Y7TA 4XGKA 1J0XO 4KP7A 4A03A 4QO7A 2E48A 2O3JA 2Y67A 4UEOA 1NFRA 1Q0LA 3QLJA 3WMXA 1FXSA 2I6TA 2P9GA 1XR3A 3WR5A 3PFFA 3HB4X 3RQSA 4GQAA 1LSSA 4WCDA 2E49A 5BSHA 2DBVO 3AU9A 5K6AA 2WYWA 5ENDA 4D45A 1ZFNA 1P1RA 1SEPA 2DUUA 4J9UE 4TMFA 4CR8A 4CV0A 2ILTA 2ZIZA 3TOXA 2PFGA 2NSDA 3ADPA 2P68A 4BGIA 5KCZA 1DC4A 4K6CA 1GUZA 4IIVA 3OQ1A 3D4NA 1UH5A 3RUDA 8LDHA 3TSCA 2W4QA 1Y6JA 1ML3A 5LC1A 1KYQA 2NVUB 1P77A 3ANMA 5THQA 3EYWA 5C3MA 3WWZA 4CMKA 1ZK3A 3F3SA 1MX3A 2G17A 2Q1UA 2IZ1A 4R9RA 5JAMA 4YVFA 4BQRA 1ADFA 5JY6A 1T25A 3O9ZA 3PDJA 3U5TA 4BKOA 5TNXA 2AQIA 4DGSA 4MINA 2JD2A 1H2BA 3GVHA 4TKMA 1DAPA 1UZLA 2VRBA 4J43A 5I7SA 3GRKA 2WDZA 1XQ1A 3F6YA 1K2WA 4IDDA 3I9NA 2I66A 1ZVMA 1MP0A 1WWKA 3C24A 1JWAB 5IDXA 3VH3A 1O9BA 3G0OA 3DQPA 4FGSA 4OL9A 2IZ0A 2CDAA 2GZ1A 3ZCXA 4BUCA 1D7OA 2AEJA 1GFSA 1E7YA 3RROA 1UXHA 4FGWA 5ES3A 5BNFA 4AICA 3K92A 3C7CB 3GGPA 2I9PA 5BSFA 2OUIA 3UVEA 2WMDA 4H7PA 2GZ2A
chains in the Genus database with same CATH superfamily
3GEBA 4D82A 5EP4A 3BJRA 3ENWA 5CVDA 4TM8A 4UNIA 1U6IA 2HA7A 4JYBA 4D99A 1FLDA 4P9NA 4XUEA 1L5NA 4FSDA 3TR0A 3JS5A 2L18A 3EMKA 4O2AA 5J23A 4A6XA 4G0ZA 2DKFA 3LXXA 1ZD5A 3M9WA 1NBWB 1ZU5A 3IUYA 4PBSA 3X0DA 1CUAA 4B7ZA 2JIRA 2L82A 3C5EA 2QD5A 1IHYA 4M1ZA 3NYWA 3KL2A 1HOXA 2C0QA 4KSYA 4R8MA 1AZTA 5A62A 2GF9A 4WJKB 3NRBA 5FAKA 3IDOA 1JNYA 2AR9A 1N77A 3O74A 1H3FA 3LL4A 4TRMA 5CNMA 3UV6A 1NPTO 4IDOA 4P2BA 4MI3A 5HPYB 4MW7A 1I1OA 1J39A 5JDIC 4LPSA 1SUDA 2JLSA 4EQ6B 2CXRA 1SUPA 4W5OA 4MGHA 2I3GA 3NETA 2PLAA 1QVRA 1XELA 5CT4A 5IJ9B 1ELOA 2ZR8A 1YS6A 3G59A 1YKSA 2YX1A 3PSHA 3HJBA 2DX7A 2QPOA 1J56A 3ZDZB 4J0JA 5JE8A 2W2PA 3MILA 2V9PA 4MVJD 4X20A 4KR3A 5IAAA 3IODA 3IHTA 2V55B 3A11A 3WSWA 1EDZA 2WA1A 3NGMA 4QBGB 2XDQA 4PPFA 3TLJA 1N2CA 2YY5A 3K94A 3NASA 1IE3A 2UVPB 5I48A 1DTWA 3N87A 1J21A 1X74A 3CH7A 3N0WA 4U7PB 2PX0A 2I34A 3C6QA 4L74A 4RLHA 3SNHA 4HWOA 1YKGA 2KX7A 3F97A 5AHKA 5AOBA 1A5TA 3TRJA 2GYYA 3VR0A 2PBLA 5A6SA 521PA 5K8LA 3W3AD 2C9MA 4GRDA 3WK7A 2HIHA 2ZYAA 1C5KA 2G9UA 2IUSA 4HQKA 3AJDA 4IIFA 3TTXA 4A6PA 5F3WB 3QXXA 1GD1O 2R6ZA 1EFRA 1G8JA 2ZYSA 3DW3X 4J0GA 3P9YA 4C7XA 1M6YA 4LDRA 2RGCA 1Z26A 3F9CA 3FFBA 3KR9A 4KYVA 4ND1A 5E1BA 4AX4A 3ENKA 1NNEA 3L5KA 3ZHUA 1IN4A 3ETLA 2PCJA 2ORED 2W48A 4QOFA 4RKYA 4KITB 5LVAA 2XEDA 3N70A 1ADCA 3V1YA 2UXBB 5AW3A 5AW1A 1UPTA 2QAJA 3CNNA 1F0YA 3DBHB 1L4GA 4G0YA 4QWWA 3GFBA 2O3SA 2JGRA 4KR7A 3LCJA 3MELA 5JD6A 5DULA 4RZXA 1Y8QA 3RW9A 1Z35A 2X0RA 3ZGZA 5DTQA 1HQYE 5KYWB 1VECA 2OG1A 4CFSA 2E5FA 2RH8A 4U5QA 3ZCPA 1YGYA 2HF9A 3VAAA 4ZARA 3L0ZA 3CUKA 1VP3A 4GLOA 4A9AA 4QLBA 1HTTA 2JRCA 3JR3A 1X19A 3PXBA 1KSHA 2B5WA 3LGSA 1UZAA 2KJQA 4FILA 4ZTUB 2QRMA 1E0JA 4NOKA 4MWOA 1KEEB 4AZSA 3FWHA 4XWKA 5IW8A 3U4DA 2GXQA 1LNQA 1BXGA 1EHYA 4KRYA 4RZ3A 2JH8A 3HI4A 4JBYA 4OHPA 4HLQB 4JJIA 1F2TB 4JZYA 2VH2A 3EIFA 1MO3A 5KJ1A 5KNBA 3L43A 1QBKC 2Q4EA 3V2HA 1QNFA 5DI3A 3CKKA 3ETJA 1T9HA 4ZU6X 5EQDA 4M54A 3AL3A 4MUEA 4UHEA 3PHJA 1SOAA 1C0PA 1FW8A 1GN9A 1FU4A 2YUIA 3MD9A 4PSAA 3W5JA 3WNZA 1WPGA 4BECA 4YV7A 4ARIA 4M46A 4HXYA 3IILA 3ROTA 2QN6A 3A9UA 2O9JA 1WHSA 2Z56A 3BFVA 1XU7A 2WKSA 1MMFB 4KUHA 4X97A 3PS9A 3RM3A 3RSCA 1EUQA 4HYYA 1GXSB 1XPJA 2OBNA 3QXJA 4Z3OA 2D0OB 2NPFA 1N36B 2JJ1A 1JEEA 1DADA 1IQPA 2ATEA 2ZUSA 4U8HA 2BUCA 2QLJA 1Q19A 3SHFA 1U0LA 3ENZA 1YS7A 2CB9A 2V7QD 4ZVVA 1Y3DE 2CNKA 1G7RA 2L0XA 2JIZD 1BXRB 4HEA1 4BB9A 2WVJA 3EA0A 3OEEA 2CW5A 4JC8A 1KYXA 3KFXA 2HLDD 4GQBA 4Q3EA 2I5PO 2PKQO 1ZA2A 2BFOA 2TYSB 1ZGAA 3EF1A 3PDHA 4NENA 4U7HA 1RHQA 5IARA 3WLIA 5IPFA 4EF4A 5TDHA 2RI0A 4WY8A 3JQFC 4ZOAA 2Q5JA 4UHBA 4UREA 4JWTA 1Y6GA 1H2ZA 4G1VA 1PZXA 2QD4A 2NIPA 3IEMA 4MV4A 2J5XA 1KMNA 3OECA 1FLVA 1ZD1A 2E82A 3OFVA 4GX2A 3QYPA 2DQYA 2GEKA 3H9CA 4JLNA 2PA3A 4RORA 4GX5A 4BMZA 5ADUS 1JLHA 5L9AA 3X1WA 4QGBA 3GLVA 5DCWA 1ULAA 3DZGA 4CKWA 5BW4A 5HZHA 4KPEC 3TW8B 2X2EA 3PE6A 3FOCA 2E6KA 2ZBPA 3FI9A 1L5KA 4R84A 2I1WA 3A70A 4DIUA 1ACJA 4DDVA 5IXJA 3BIXA 3S99A 2XYQA 3MERA 2GEBA 5ALWA 2Q41A 1XU4A 1L4KA 3H4VA 1QIFA 3ZZ1A 5GPBA 3H0KA 4DUPA 4ZFNA 1I51A 3BSSA 3EC7A 4KWEA 2WJAA 2B1QA 2WR8A 4RW0A 1TB4A 2MDTA 5JR3A 4DV7B 5BPFA 3JXEA 3V2UA 1SK8A 3OOEA 4C01A 1GRRA 1T1GA 3U31A 2J7KA 1PIWA 1R0KA 5JI2E 1IM8A 1H93A 1SU8A 3O5AA 4YT2A 3H6HA 3NDBB 3DF7A 4RYDA 4JWKA 2ODAA 3COPA 3VKGA 1I3NA 3BDIA 2OA0A 3GUVA 3OTQA 3UFBA 5F7OA 3W5CA 1M5RA 1WZUA 4P93A 4ARSA 4BX9A 2VSOA 1LZKA 1SNYA 1PYGA 4EY4A 1JMVA 1WHTA 4QOSA 1RP1A 1T0IA 4GBJA 2NU8B 3E15A 1SH7A 1KMMA 4C6SA 2GPWA 4ZI3A 2IH4A 4YJ2F 3RPEA 2R8PA 13PKA 2MR6A 1O03A 2RAPA 2Q28A 3O3CA 4FFBA 3KAPA 4G01B 4MUMA 1S2GA 1R1DA 2ZB7A 5B1YA 1KVUA 5DH9A 1V11A 3WTBA 4J0HA 5LZ4A 4WBNF 3IEIA 4FGLA 3UOWA 3OTGA 1G20E 4MS4A 4QFMA 2AD1A 2J6IA 2ZBEA 5LDDC 1W36B 5K2MA 1RYBA 2BMWA 4OK5A 2WKQA 1SD1A 2Q6TA 4E51A 5DEOA 1MPTA 1LDEA 1BEUB 3SJBA 5DI3B 1G1MA 1QQAA 4EGAA 3DXZA 1IVNA 4TV8A 5K3CA 3N8KA 2AT1A 2MWMA 4BY9E 4HH3C 1HEUA 1SCNE 4MYSA 1LA2A 1EFRD 4NVRA 3IDQA 2AZTA 4JQSA 2HO4A 4OUDA 2R00A 4RZSA 2R8ZA 1QTRA 5EFOA 4UE2A 5TLSA 4LOAA 3GOQA 1UWKA 4DLBA 1EX1A 2O7SA 5I4BA 4MB6A 2NWQA 1YRYE 1CP3A 3AG6A 3ZU4A 3W9SA 4YRMA 5JC8A 3N6XA 1RHUA 3F6CA 1P62B 3K6KA 3KB2A 4RCYA 4CF7A 4L4ZA 2BSAA 4HL6A 3UXMA 1E2MA 3MTIA 3O1HB 1R0ZA 2R2AA 5DNDA 1X1RA 5GMOA 1A98A 3C3AA 4B75A 3TLGA 3WLRA 4IHJA 3DEIA 3Q8WA 3GG2A 2ZUVA 5G4KA 3JW8A 2QK4A 4I55F 2WM8A 3WL6A 4B2PA 2B35A 3PX3A 4GVLA 4D3XA 4QQRA 4YJ3B 5AXBA 1KI1A 2C8LA 1M2FA 2ZP1A 5H9WA 3FOEC 3DV0B 1AUOA 1M54A 2AEMA 2X5OA 3AF0A 1ZZGA 4OHWA 3AWDA 1PFQA 1IDN1 3NJ4A 4JT4A 3W8FA 5M34A 2BI8A 4HGZA 5CLJA 5FULA 4II2A 1HZJA 2V03A 1WY5A 2ID8A 3KXLA 1LJUA 1R9JA 3FDXA 3MMZA 3MSCA 3PA8A 4ND7A 3T7AA 4NXMB 2VATA 3N2IA 3II6X 3QMMA 3QX8A 1GSOA 3TX2A 1B6SA 1YB6A 1I6LA 3FKQA 5HRUA 4LCBA 3F5SA 4N39A 2SCUA 3C3MA 4PRKA 3K09A 2NTYC 1KZGB 3VR6D 5KNBH 4TYWA 3KHUA 4MUXA 2FXIA 4V0ME 3I72A 4JVMA 2NUTB 4O2AF 5A3JA 4KCGA 4MVXA 3UM9A 4A26A 3B38A 3ON5A 1GKUB 1ZQ1A 3SQXA 3EOZA 5FOUA 2Q1XA 1ACMA 3V1KA 3ZNNA 3ZNQA 4CLHA 5BXQC 1EGQA 1FFHA 2BFEB 1IXYA 2AXQA 2E6UX 1TJYA 5KTSA 2OBYA 4O29A 3OHMA 2OZEA 1NLYA 4TN5A 4G4GA 4AUEA 4UE6A 4O4JB 4B31A 3A0RB 5CG2A 1KA9H 1Z62A 1KYYA 3DC7A 1SCKA 3RGGA 1RBZA 1AA6A 3OKAA 2QTGA 2VF8A 1QYDA 1E8DA 4Z4IA 3BGIA 3S70A 3OC6A 4ND3A 3KJZA 3JQAD 5GONB 4ZC8A 3VGJA 3ZCTA 4MKRA 4BFXA 4D41A 4LMBA 1G2QA 1OHHA 2VPYA 4OY3A 4B6SA 2NU7A 4PYKA 1VPDA 5EPEA 5BQXA 3I0NA 3HXTA 1IJFA 2CVOA 5D7NA 3JR7A 4Z9YA 3UMMA 2D6FA 2AVDA 3MCZA 1Q2XA 1P2GA 3UK7A 3A1DA 2EKQA 2PUHA 4QDKA 3LT2A 3QVTA 5BW8A 1EFDN 1NBME 1PHPA 2XOKA 1F5SA 3C8DA 4WZ6A 1KAGA 2QLBA 4EJSA 4AKHA 2IZ5A 4JBNA 4KO1S 5CUQA 3FNEA 3M5PA 2F6RA 2FSGA 1R6AA 1ZGHA 2QEQA 3QKSA 1DXOA 2A0FA 3PSAA 4C0KA 4QTXA 1ZEMA 4DR4B 2ZSAA 1P0FA 3HB7A 4N6GA 4WSOA 3PVZA 1H22A 5JRJA 5DBEX 4BWYA 3JQAA 1MFZA 3I2GA 6CHYA 2Y8EA 3GDHA 2DPYA 2W83A 2P11A 3F9RA 1EKXA 4LX0A 4D57A 5K09A 1W5TA 1W47A 3U49A 3D5TA 1EFPA 4BNNA 4KEAA 3S8MA 2QP9X 1O95A 1Q1NA 3G8DA 4ZO6A 3L7MA 1TUBB 2YBDA 4FLMA 4GC5A 4DBLC 2WILA 1Z39A 3CRMA 4AIIA 3KT6A 1XIVA 1SOVA 2PZEA 4RE5A 3ZWAA 1GEGA 4O5OA 4C29A 3RYCB 1JI3A 5TS2A 4RF3A 1TD9A 1F06A 3VR5H 1ONSA 3JSAA 4MV0A 4ZOLF 3K0AA 1RRMA 4IEEA 1Q1EA 2AG5A 4NY1A 5DW0A 3LDUA 1WSWA 1AM4D 1FQOA 3Q7PA 2ZVJA 1TA4A 2RFLA 1MABA 2O2EA 2X19A 2WT4A 4IEIA 1A8UA 3L0CA 3TQQA 2FZCA 2NZVG 4R71A 4K05A 3WL4A 1DT3A 1A95A 1JT2A 1LFAA 1U8CB 2HDOA 2Q07A 3RBVA 5BSVA 1YDHA 3IPAA 2QJTA 2CHUA 2R0QC 2O2DA 2QOEA 4M9QA 4TROA 4Z9BA 3RSOA 1JWLA 3L41A 1O9GA 2PYDA 3S1LA 1U0TA 1Z08A 2DBZA 3HY4A 4IYJA 1XROA 4EATA 4K03A 4WXEA 1K5HA 2IY8A 5DLPA 3QY9A 1K5DA 1N32B 1GL3A 1KXJA 2P2GA 1E1MA 1KARA 3B9RA 4DA9A 1WF6A 1SXIA 3NB0A 1J8MF 4TUYF 3EGCA 3Q87B 4Z4QA 2FFAA 1X1QA 3ONEA 2P35A 2C5HA 3VU8A 4DNOA 1OAOC 1ZI9A 3TZEA 1EFHA 1NQTA 3EZLA 1IIRA 3EDCA 3BRQA 4RZQA 4IS2A 4ILKA 1Z36A 4MV7A 5REQA 5CLFA 1QG2A 1WHSB 4CR6A 2AN9A 2XJ9A 3GRCA 2XXAA 2GLUA 5DGTA 5G0UA 5A7GA 4WD3A 4UPVA 5EUBA 2IDKA 3A6PC 3OP4A 1LPNA 3FVQA 1N78A 2IU3A 5KNBD 2AF3C 1JPNA 1VE1A 4K7JA 5KMGB 4YJGA 2CV1A 4BX2A 5AESA 5ALVA 2HGSA 2GZHA 2GJKA 4KJZA 5F35A 3RUEA 3TZLA 5CDUA 4LF5B 1X38A 1KMHB 2BP7A 1A69A 2Y68A 2ZJ0A 1NR1A 3MJ4A 3TZBA 5A3RA 4HV4A 1O89A 4FOOA 1JG6A 2YY6A 3HFSA 2H9IA 2P9HA 1R7RA 1V39A 4YAGA 1ZWLA 2ZT6A 1K6XA 3ASUA 1VG1A 4ZEXA 4HHEA 4DSZA 4UBKA 4CMAA 2V6JA 2VA9A 1CWUA 3OQMA 3ZLVA 4KBYA 2XGJA 4P98A 1TF5A 2O2YA 1AGRA 4B32A 2DWOA 4MUYA 4INJA 5CTJA 4G0XA 9LDBA 1EGMB 1OFVA 1W4ZA 2AFVA 3LBIA 1NXTA 2IVFA 5IANA 3MMPA 2QN2A 4U2BA 5I6DA 1RQLA 3M82A 2BFPA 3FETA 2IX9A 5F21A 3EEOA 1EWKA 1XZJA 3I9V6 1EAMA 3S5UA 4HY3A 5DP1A 3E9MA 3GGOA 1U9JA 4QX6A 4E5PA 4M89A 1Y8AA 1FXWF 1CZHA 1K3FA 3ZI7A 1RYZA 4ZYUA 4F1WA 4OJKA 4ZVOA 4XPIA 1VRVA 1DRVA 2RGNA 1KAHA 3ZGVA 1RI5A 2Z09A 2QV7A 3RU2A 5BQ3A 3SJUA 1TD1A 5FORA 2E7ZA 4EABA 3GH3A 3LLCA 1DXHA 3FKJA 3EG5A 3TAUA 1L7PA 4M87A 1KK2A 2J6CA 4RELA 3L4BA 3EODA 2JRLA 1P9LA 1UDAA 1N9GA 3I12A 4RD2A 2QUJA 4JP1A 4KQGA 1FP1D 2C7BA 2PSFA 4D44A 2GAAA 3VJRA 1LC3A 2EW1A 2VUSA 3EDMA 1IN7A 3S6JA 1IEQA 4N41A 4M9RA 5T8KA 1NNI1 3AW9A 3FMFA 4XARA 3S27A 4Z6KA 1C1XA 2CFTA 3QVSA 4KLRA 5CHEA 3W06A 4HLCA 3CE9A 4YJFB 5KYWA 3K4PA 1IFXA 4TYNA 5EHNA 2JH9A 1ONOA 3IP3A 4TV8F 1JECA 2COKA 4BMCA 4M98A 2GFHA 3GIWA 4GMDA 5C31A 5MFPA 1KEVA 5A0VA 1XZDA 3A3YA 1NKSA 4PLZA 1N2IA 4BJ3A 2R6CA 3THYA 4MLCA 3C6KA 4NQZA 3Q10A 1J0BA 4CL0A 2P7IA 1SC9A 1T4GA 4S35A 1L7XA 4TRRA 4AJPA 2H1IA 2VJYA 3FTFA 2DTDA 5KVQA 4DWOA 5DGCA 2CZGA 3E22B 2P2LA 4JASB 3IVAA 3BMOB 1NMSA 4K9NA 3UWPA 4CVNA 4ER5A 1H9CA 2GWHA 3ML1A 4O5AA 1BMFD 2P41A 3JY6A 4KUGA 4PR3A 1KFCB 2PO5A 4KMMA 1I3LA 2OC4A 4M7PA 5CBPA 5B58C 3Q4GA 3G1WA 3EUFA 3GIDA 4QJBA 4RLQA 2HLDA 1JLKA 1JIIA 2ONCA 1BRMA 4A3SA 4ADSG 1BCSB 1TT7A 4GXNA 4P1ZA 3CG0A 1OX4A 2FJPA 3LVQE 4A4DA 5IN5A 1TKRA 1IONA 2GPTA 2WMYA 2M6KA 2YXDA 2FHSA 5IK2A 2I22A 1HG0A 1N5KA 3B6EA 3HLTA 2ONJA 5AVTA 3EZGA 3UB2A 5F77A 2VYND 3VYUB 1NN5A 3KZNA 1YZKA 4XUCA 1LH0A 3Q88A 2WAXA 1J1IA 3O4GA 3UJ9A 2P9ZA 1EYZA 1ID1A 1Z7EA 1YR1A 1O95C 2FWIA 4QOGA 1GPBA 1C2YA 3WLQA 1FFAA 3K5IA 3ZYZA 3WGGA 3B48A 3UMYA 4ENTA 4ICIA 3D0KA 4G5OA 5HIAA 3FDZA 2P75A 4LJ5A 2PWZA 3G2LA 1KYTA 4KODA 3KSBC 4BCBA 4HBZA 3IXMA 1AJEA 2YHIA 1ULSA 4R2MA 1XVVA 2BGTA 3KKKA 2VPTA 2IX3A 3PUWA 1SOUA 1P3Y1 5IN4A 1DL5A 1A2QA 1S2LA 2PJDA 1TQ4A 1ZN2A 5B3JC 3GVCA 4L8FA 5FIUA 4U7TB 5FOXA 2Q2QA 4NE9A 3BTUA 2Y76A 3AP2A 1QWSA 3H1TA 3TMAA 2ZI6A 1TTTA 3ZHTA 2CXXA 2QRHA 2P3LA 3AKEA 1OIWA 1VE9A 1P73A 4Y9UA 4KGDA 4YRRA 2G9RA 3DXFA 1CDOA 1PWYE 2DY0A 1V5IA 4Q4AA 3P2YA 5ECDA 3TEFA 3VHXB 3O8RA 1JQLB 2I7XA 3EF0A 1JDSA 3GEGA 3VVMA 1A77A 1FYWA 3CF6R 4MUBA 1JDZA 3EC1A 3O8QB 1OT3A 4K9DA 5DWQA 2IEAA 5KQGA 4WRRA 3L3BA 4LRYA 3ZDEA 4I4TA 2OEPA 3PPWA 4DRYA 2OB1A 2QM8A 4ITUA 3QOFA 1M8FA 2XCQA 5TPZA 1AG9A 2V9ZA 3UG6A 2I4NA 4FDTA 3V2IA 3A1EA 4EUNA 2YV3A 1Z15A 3V3KA 3E9RA 5GIOE 5ERYA 5ALJA 1GNTA 3NUZA 2O3TA 2JIPA 2H2GA 2REOA 1BFDA 4BJ5A 1INLA 2XBLA 3KZVA 4WLEA 1YR9A 4Q37A 4DPKA 5K2OA 4DA7A 4MZXA 3MWKA 1XRSB 2FWRA 2VR1A 2PX6A 5FV4A 1E8NA 1R6VA 2W6JA 2YJZA 1OXSC 2V8BA 4OFWA 4GPBA 4M6WB 5ARDA 1ML4A 2GF2A 4ESOA 5EJ8A 4KAJA 4TMZA 1Q84A 4D74A 1XZIA 3D7SA 4G1BA 1SUWA 4PPQA 3MSXA 4IXMA 4A82A 3PZBA 4HAZA 3U40A 3GLHB 4BB5A 2BGNA 4NBWA 2D74A 1MC5A 3T7IA 3ILXA 4LYFA 2WTMA 1RPNA 1RXIA 4QELA 4QVIA 3QFHA 3AUJB 1UKEA 1KMQA 1IH8A 1SUEA 1FTWA 3KQNA 1JTVA 4PPYA 3WYCA 1FFBA 1ISHA 4PICA 5ILQA 3K09C 3N2LA 1GZ6A 3KQSA 1N9GB 3KYDA 4XOIA 4LC0A 4TVSA 1ILEA 3R9IA 1QYWA 4IZOA 4TOIA 5DNWA 3USZA 1Y42X 2FEPA 3QSGA 3CCCA 2EX1A 1W94A 2ZJ3A 4P5EA 1QFXA 3LPDA 4ZVMA 1TM2A 3P4YA 3QFRA 3D64A 5G41A 1SZDA 4P58A 4LNHA 3N8DA 2Q9UA 1UWVA 1XT6A 3TO5A 2X4IA 3W8EA 4XPZA 3N86A 9MHTA 1RJ9B 2Q3EA 5LBIA 3MWGA 1RHRA 2WQZA 1T2DA 1XZPA 4S1OA 4BO2A 3OPYB 1YBFA 2VJMB 4MIEA 4R01A 3WRYA 1T2NA 4URFA 5GVSA 4RK5A 3OU6A 1EM8B 2NN3C 1T4MA 3BN3A 3DMYA 1JSRA 3HJCA 5M29A 3RAEC 4UCFA 4CUJA 2I29A 3PNVA 1QAMA 3ZWPA 5KIAA 3SJZA 1ZN8A 4QBFA 5EJGA 3D54D 3FRJA 5KSZA 4YRGA 1B3RA 1S8AA 2PUEA 5PGMA 4TTPA 3FMVA 1CY1A 3VPHA 3ZWKA 2W6MA 2ZBQA 3BE8A 3B7GA 4HEQA 5TJHA 1TEXA 5IH7A 3QE2A 2O19A 1QCZA 1XCJA 3UANA 4BVHA 2RHMA 1D6SA 1T5OA 1AS3A 5MGNA 4K40A 2HJGA 2EERA 1GPWB 3EGDB 4B85A 1LBHA 3JQ8A 4A6DA 3JTMA 4F4CA 1D2AA 5JHGB 3C6YA 2WEKA 1ZK2A 2HJRA 1P1KA 1QR6A 3M5CA 1NE2A 3DS8A 3MJFA 4EHAA 5ISMA 1PS8A 2PY6A 3NTVA 4GOND 4K9OA 3PHIA 5J47A 2FDRA 4MQMA 4HUQB 5FTJA 3GDWA 4WBXC 4H16A 4DQLA 3T7KA 3I9V1 2QZSA 3G17A 4CM3A 1J70A 3MUEA 2VRCD 1Q22A 1T5BA 1XMXA 3P9CA 1YJBA 3H7AA 1P4JA 1IPFA 2H4XA 2QYHA 4OM8A 3QZUA 4UUPA 3ZWNA 2JHFA 3KL4A 3KT8A 5CCEA 3T38A 3LY8A 3ZHSA 2ZR7A 5D87A 1UEJA 2I8LA 3WK9A 1UMBB 4QVKA 1H8ED 2V7EA 5TMDA 3AVQA 4G5RA 3AEZA 1PJZA 2HTFA 2F8SA 2HT6A 4L0QA 2EFHB 5FPYA 3Q8MA 1ZD2P 3IRUA 3BMNA 4KHPB 4IO1A 2OCLA 1QGUB 1Y1TA 2LCIA 3FAZA 2AZXA 3QUSA 2QRJA 4R2XA 1QF7A 4XJVA 3A6HA 3TLBA 4HVAA 1VPLA 4LZJA 2C8VA 4N3CA 5A5VA 121PA 1M8PA 3T5TA 5AXCA 3OPQA 1KMHA 2BP7B 2LIPA 2V98A 3GYBA 3IQWA 4F92B 5I9NA 4C0QC 5DGHA 2QP3A 2WG0A 3DLAA 4AJ2A 4IJUA 1NC3A 2ZRQA 3R4VA 5TRTA 5DYYA 4U5XA 3CX6A 5EESA 5ERGB 4BZWA 4POOA 5B7PA 5COAA 1UPBA 1F2UB 1CE8B 3F4LA 1EWRA 4GWGA 3H19A 4CGYA 3SZLA 1Q17A 2HO5A 3P9PA 2HUPA 5T4BA 3TE6A 3NONA 1H0HA 1Z28A 2L17A 4L85A 3ZGXA 5LD2C 3FPJA 2ECOA 3BS4A 3RVJA 3VYWA 1VIYA 1DC7A 3GFVA 4RGVA 5REQB 2FSVA 2OV2A 4HAXA 1S8FA 1XTIA 3LW7A 1WUYA 2Y6VA 4RANA 4DDKA 4D81A 3LCUA 2Q4DA 3QW2A 4M4SA 4PQFA 3IUSA 5KYXA 1E61A 5J63A 3SJCA 4CV2A 3PJFA 3LFTA 3D3QA 4HXFB 4NKRA 2FW6A 1X87A 2K4MA 3QWFA 3HUUA 2CV0A 2HHAA 4HN2A 4N03A 1XAJA 1C1DA 1VL6A 2JA1A 1YDEA 1TUBA 1KMCA 1R3UA 2V6GA 3VX4A 4MNTA 1UXOA 1TKAA 3EAGA 3EZ7A 3AM5A 1FMCA 3GEHA 4GGOA 1PEYA 4OI1A 3L1VA 3GNTA 4Y8VA 1DT5A 3QRWA 1PLLA 2V54A 4GW3A 4ZCTA 1XQ6A 5BMVA 2JI9A 1SQSA 1QMGA 1R4NB 1U98A 2FPKA 3PQ7A 3TTVA 1P81A 3DLTA 4RFSA 2B4KA 3CN9A 1T0JB 3QM1A 4P08A 1JQDA 3RYFA 1FP2A 1NKTA 2NT3A 4PAWA 4Y1RA 4JAVC 4JP2A 5G40A 4F9TA 2BHTA 5CDTA 1PNRA 3IDAA 4FSHA 7AT1A 4IEFB 4OQYA 5J2UA 1NBMD 3IXLA 4QJ5A 1DG1G 4GUDA 3UC5A 3BGSA 1KC3A 4ZU3A 3M83A 4FYYA 3RFTA 1M6NA 4OKNA 2C54A 3ZQJA 3H75A 3OE7A 2WM3A 3B51X 4QUEA 4WI1A 1U31A 1X8XA 3PJDA 1UOEA 2Y99A 3LQ1A 5JC1A 2YJ4A 1BMQA 4R1MA 3ZDXB 5ER9A 4ETIA 5SV2A 5AVYA 3A9VA 4ENPA 5FHQA 2N47A 3TBKA 2AC4A 4MWCA 4AJLA 3M0EA 3RT1A 4MITA 1I7DA 3LQKA 1JSXA 3LUFA 4M6WA 3CJTA 1KY4A 2J5KA 2PXAA 2SICE 1AGXA 1Y7IA 2ZKIA 4GI1A 1I2AA 1K7FB 4TLMB 10MHA 1N2CE 1TKCA 2OAQ1 3SKYA 3T8YA 1RM4A 4UXJA 1ODJA 3I1IA 1BVUA 1F12A 1RWMA 4L3WA 2GXAA 2QGNA 1B8UA 2ORIA 3ZTTA 1QQ6A 3KM0A 3X2FA 4F3TA 1R66A 4P5DA 3HCDA 4MJLA 4W8OA 3UWMA 4BS9A 1H1LB 2F43A 5LQAA 4MXDA 1WA5A 3LV8A 4L8LA 3ECCA 5FI0B 3V48A 4DC0A 4Z5XA 3GUCA 1V96A 4H17A 5ALGA 4ZREA 2AJTA 5BQOA 4W5QA 3ZQ4A 2G63A 4QDUA 1KI9A 1J97A 4MQEA 1WQ4A 2BLNA 3OZUA 1CJKC 1P91A 1HG1A 3I0ZA 3FUCA 4I3GA 3WQRA 1C9NA 3Q0IA 4X6LA 3PWKA 4HXGA 5D5PA 2IXDA 3VZBA 4F93B 4BLPA 1FYVA 3L4BC 2OAEA 2R6AA 2H51A 3L84A 2E4ZA 4H0NA 1E0AA 1L5SA 1HKHA 3NDPA 4KQ1A 1EZ1A 1Z8DA 3KJHA 4J1TC 1M74A 4W1SA 3WKCA 1Q0ZA 4N9WA 4K86A 4BGEA 5JD4A 2F3QA 2ZG6A 1UMCA 4HYEA 5EY5B 5DHSA 1U0SY 2Q6KA 1TU0A 3S2FA 4OGGA 2BGIA 1F3OA 3RRMA 1ICEA 2CYCA 4Y2UA 5JALA 1X39A 3ROEA 3QVUA 1F2DA 3P5SA 1QH1B 3GT7A 4MA0A 2OMKA 2PZAA 2WINI 5E4FA 5E8RA 5DYNA 1JR3A 3R09A 4JENA 1VHQA 3AK4A 4N7JA 1AB5A 3PNMA 5FEMA 3KQHA 3AKZA 4D4LA 2ZRLA 1BJKA 3ES9A 5G0WA 5LYYA 3MPUA 4DPLA 5C8ZA 5CA0B 4QOEA 1W6RA 2WVHA 3I09A 4O3MA 2I6UA 4NBLA 4WK6A 4YC7A 4LW8A 2IPLA 5IRCD 2KQUA 3AR6A 2JLRA 3TMYA 2GT1A 5FBLB 4B3FX 3VTAA 3VU9A 3F6SA 2QRGA 3KOUA 5JAPA 2ID4A 2PVCA 3KKPA 3NHFA 4FFPA 3PEVA 4MDYA 1SXJA 2P79A 2QLNA 4XD7A 4E13A 3IQDB 2WVAA 2VT3A 4DV0B 4QU5A 2FKAA 1GJRA 4QOIA 1W5AA 3AR9A 5HHTA 1R16A 4ERNA 3LCCA 1CY6A 3JZFA 4P0PB 1J9GA 1MG0A 1XU9A 2MSWA 3K20A 1OH8A 1UBNA 3U3KA 1CNFA 5B7GA 3G1TA 3Q5DA 4L73A 4XFKA 4AL4A 4AUMA 4GI3A 4HWGA 1I6WA 2JIDA 4JY7A 3ZU2A 2QRVB 2H54A 3ZW7A 5CXUA 2Q0HA 3ZCVA 1BQ3A 2V6IA 5FT9A 1JU3A 5IT0A 3FPLA 3RGWS 4OSEA 1A9TA 4TS9A 3TL2A 2YN2A 2BKUA 1DX4A 3R7FA 1GYRA 1ZOSA 1L1QA 2AHOA 3QW4B 2CXOA 3D7RA 1P9OA 1U0NA 1ZL2A 1JKXA 2OE2A 4B6JA 9GPBA 2YASA 2HQOA 1MOPA 1EK0A 2PUJA 3LK6A 3LK7A 3ZJTA 5C1IA 1FFXB 5LBTA 1IRIA 1KYZA 1PWXA 4YDHB 3QVJA 1TCBA 4H7JA 4C6TB 3E23A 1V2HE 4R5HA 5BR8B 5F5LA 2I1LA 1T1IA 2IF2A 2EF0A 2GZAA 2VG8A 3NWOA 3U7HB 4ZDIA 1T2CA 3LOUA 4CIWA 1JFTA 1NP6A 3FR7A 5D3KA 1RMYA 2EAUA 4L78A 3PLAE 1SOWA 3NWBA 1UK6A 1GUYA 3W8NA 1C1XB 1SU4A 3AW8A 1NXSA 4L4RA 1NHWA 4CMIB 4INPA 1N57A 1OKKA 3HA7A 3LKDA 3D7KA 2C88A 1LF5A 3WWDA 4DEVA 3I5YA 1V8ZA 5AOAA 4CUZA 1AGPA 3Q98A 4RNDB 3SU8A 3IP9A 5K6TA 1X7XA 4HWSA 4B2YA 1ZRSA 2MOKA 2MSCB 2OUKA 4JU8A 2CVZA 3VYTB 5CXSA 1DEAA 2W8ZA 3IR6A 2H17A 3LUAA 4L15A 1FVFA 3MCVA 4LK2A 1J09A 5K8VA 2FMFA 3N3BC 3OZXA 2G1PA 1JQEA 3KR0A 4ZT4A 4LF9B 4RY0A 4QKQA 1L5FA 3DE6X 5FBRB 1P1IA 3HCBA 2AG8A 4YJFA 3RVRA 4COOA 3SIXA 4ACAA 3GLTA 2QM3A 4DG8A 5AKHA 1IOZA 4B44A 3FSJX 4XWOA 2E4YA 4DR5B 1XCGB 2QZ4A 3NBAA 3CC8A 3A58B 1W93A 5TT1A 2Z4TA 2XMSA 2Q4BA 1TO2E 1C7QA 3ZR4B 2JZOA 3A2LA 3CONA 3Q3VA 4LIPD 4OUKX 3WGJA 3FWNA 5IC6A 3VR4D 1U2QA 4DV1B 3T3NA 3O4JA 4O4LB 5EIBC 2GYVA 5JPCA 1KEWA 1OOEA 2YQ4A 1PTJA 2ONZA 4J76A 3ET5A 3LFUA 1K8RA 3JQ8B 3M2PA 1J1ZA 1W35A 1GNRA 2BFCA 4XEHA 3JRWA 1S4QA 4IAOA 1NVFA 4QIHA 3G7UA 1MA0A 3TTSA 2AIRA 1ZBDA 1XZCA 1IHOA 2OXCA 2WYHA 3R2JA 4YGXB 1SC6A 2DPGA 3PPXA 4PYRA 3L7CA 5J43A 4GX1A 1OVMA 5EAIA 4DMMA 3V8BA 3HXMA 2V1UA 1CUGA 1MO2A 1QE5A 2FQWA 4BP3A 1QPZA 4HGPA 3WYNA 5CVJA 3WHIA 4ATNA 2V6BA 2CEAA 3PR3A 5K3EA 2I6QA 3PCXA 2JIBA 3GJTA 3V8NA 4AIRA 3THOA 3E9NA 1P7CA 3QWBA 1GARA 1GL6A 1MNQA 1Z5PA 1QYVA 3NHRA 4NWIA 4P4LA 4P38A 3I73A 3WDMA 1B0UA 4KQHA 4F91B 3OFND 4FI3C 4GMGA 5E8JA 5KDDA 3IQGX 3I2KA 1DRWA 4QLAA 5JS8A 4N49A 4DLRA 4CLXA 5KWIA 4KW7A 3SE0A 1C1HA 4C2TA 4OQPA 1VJDA 2X22A 4O4HB 4DYVA 3OIGA 4HQ6A 1GG8A 1NQXA 2O50A 4KR9A 4OLFA 2IS6A 1SFRA 1UF9A 4C4OA 4OJTA 2OL4A 2W2VA 1QU3A 1P2TA 2RK3A 3C6XA 3VJMA 1U0FA 3H7IA 4E3ZA 4DUZB 3CR3C 4QHYA 1JTEA 1QRDA 4RZHA 1NAIA 4G9EA 3H2JA 1RI2A 3QVGB 2HCJB 1D1QA 4CKBA 2WE7A 4YPFA 2J3KA 5EFZA 1CLUA 4P86A 3HN6A 2PGJA 4ED9A 1OWMA 2GN2A 5KNCD 4NOMA 1L7EA 4Q9AA 3DAFA 3K1AB 5CLQA 2ETXA 1AKNA 2XUGA 3CZAA 1C4WA 2I99A 4PCLA 3W4IA 2C4MA 5EWLA 2XA2A 1Q1GA 1SCIA 1Y9EA 3BDAA 3DDUA 3DTTA 1DINA 2RBKA 2YZ7A 3QH4A 4ZXFA 3WYAA 1EXDA 3WDKA 4YALA 4C7OB 3A26A 3O90A 1DKNA 2H1SA 3H3XA 2BTOA 1ZGJA 2OXTA 3GLRA 1RWQA 1YR7A 1YFZA 3HCPA 1BA3A 2QRLA 2Y2UA 4TPKA 5DYTA 5L7TA 1WM1A 3PG5A 3TTWA 4U0JA 4RL4A 3FKSA 3VKVA 1HFJA 2G6TA 5CB0A 1SVIA 1Z06A 2I6FA 1GGNA 4EELA 2QLMA 4WCFB 1YB5A 1XCLA 3GAFA 3KKMA 3ZXSA 2ZTMA 5KWJA 3QG5A 3N0XA 4EIWA 2RCNA 1XFDA 2F3PA 3T1OA 1L7VC 3X43A 5KVAA 5A4AA 2WA2A 1LLDA 4YA6A 3PYXA 1I0LA 4EG7A 4I55B 3VOSA 4IVNA 4GKVA 1RKBA 3GFSA 5EJ6A 4D9EA 3OJXA 2OXFA 4XWYA 5CH3A 3F0TA 1XEWX 4HDKA 4ER6A 1E66A 2JFZA 1LPPA 1NL3A 2GDZA 2JK0A 2C2WA 3KC2A 4OAQA 4KI0A 1RXYA 3U5ZB 2XMPA 3AG5A 4PZLA 2GN4A 2WLSA 4KXWA 1NUPA 3EXEA 5AW2A 5LMZA 1QC5A 3MJDA 1Y4AE 3HYLA 1DCTA 3T3PB 5JCJD 2ZUEA 1EK6A 4GSKA 1NRWA 4DWVA 5CURA 2ENUA 2BBWA 4TTVA 4BBPA 3A6JA 3LPCA 2CE2X 5EERA 5FUQA 2WAAA 1WCYA 2WJWA 3WWYA 2B4YA 3SK0A 2VH5R 3TLMA 1FMLA 1HT1E 2R751 4ISBA 1E99A 1UQRA 3RWBA 3KXKA 3NCHA 2B0JA 3ESYA 2GTIA 5AHXA 2PR7A 5MHTA 2DSTA 3JQ7B 2JAHA 3RVKA 1CQJB 1DEKA 3OUUA 4GVXA 2WHPB 3UG7A 1IOVA 3IAUA 2KBEA 5AM1A 1OXUA 1C30A 1M72A 2ROQA 3THSA 4BU1A 4MDHA 5J4LA 2CLLB 1JKJA 3BTOA 3FUTA 3K5PA 1ZW1A 2H11A 3PFIA 1D6JA 3ZTWA 3KV3O 3AL0C 4BNXA 2Q5QA 2EV9A 1OXKB 1VE6A 1JBEA 1NVGA 1XDZA 3OJEA 3DD5A 3DP7A 1U99A 1CERA 3TQTA 3UIEA 4CYMA 2ZS8A 2YWEA 1E9BA 2ZTHA 2FZVA 1YMQA 2AZ4A 2XMGA 3MHPA 3OZSA 4IDHA 1JFVA 1UK7A 4IV0A 3CPSA 5CAEB 1E2BA 4ALLA 5IKOA 4FW9A 4HFRA 4AECA 1CDZA 1ZH8A 1Z7GA 4F5DA 1C7IA 5KEIA 3OZDA 1M6EX 2C96A 1VTKA 3C7TA 3TQOA 3OJOA 5LQJA 3OQNA 4F46A 2R3SA 1Q5PA 2DR0A 2H4YA 2AE1A 3NXSA 3CMMA 3I9FA 1YDWA 2BSXA 5BWNA 1TDJA 1ULZA 2CHEA 2WBLC 1NYQA 3O47A 3LKVA 3MRVA 5HX7A 4ZZ0A 1SA0B 2HF2A 1Z6QA 3UICA 3HCOA 1E64A 2ZATA 2FJ0A 3HJHA 4OK3A 4U0KA 2W22A 2VQEB 3GHYA 1J00A 1DQYA 2GK3A 2RC6A 4O8CA 3RSZA 3ZHYA 4FHCA 1YBAA 2PNFA 2FW7A 1E3SA 3T7JA 1ZIXA 1L9XA 3L18A 2BEKA 1EDEA 1IK6A 1TXGA 4F86A 1PVVA 1ZONA 2ADOA 2PBRA 2RONA 2V5UA 1XNQB 3RFVA 3QLVA 4PONA 2QW8A 4HO1X 2PIAA 1TAQA 1N1MA 2ERYA 5DNCA 1U0OC 3LHFA 5K51A 5HTKA 5B4TA 4Q34A 5FO0A 3HSYA 2DHQA 3FCUB 3IV6A 3CRZA 4F60A 4YJ2A 3HV2A 4NJEB 5E2BA 3C3XA 4L75A 2EJWA 5EJ7A 2ZUFA 4JYAB 3ANLA 2YHBA 3WZLA 1I94B 3U26A 3BB1A 3IC5A 3DUFB 4MKHA 3P9KA 1KDPA 4CR7A 2RDMA 5F1KA 1TFRA 4RTSA