4CM7A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
252
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQNGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
molecule keywords PTERIDINE REDUCTASE 1
molecule tags Transferase
source organism Trypanosoma brucei brucei
total genus 94
structure length 252
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm7A00
4RVDA 4IPTA 4E13A 4WCFA 4ND3A 3MTGA 2W2KA 1DIRA 4G5HA 3QJ5A 3PP8A 3I5MA 1NAHA 3FD8A 4FIZA 1R0SA 2VRCD 2X9NA 1PQWA 1NQTA 3A9WA 2FZWA 3B1FA 1VJ1A 4Q3DA 5KKCA 3LDHA 2O3TA 2QYSA 1YB4A 1U3WA 3IUPA 2AQIA 3HADA 4JBGA 4ALNA 1VL6A 5CAEA 2H6EA 4YAGA 5IZ4A 1VC2A 4BGVA 2V6GA 4R3NA 3WYCA 4NFHA 4L4SA 4AJ1A 3CZRA 4MVJG 2X58A 1QYCA 5BSFA 2CVQA 1R37A 1JVBA 3CPSA 4N7RA 1EK6A 2Y68A 2JCVA 3VPHA 4M86A 1E3JA 1GU7A 4O0LA 1QLHA 4I9HA 2PGLA 5GZ6A 3CE6A 4CLRA 3CXRA 4EZBA 1NPDA 2G5CA 4G81A 3VTZA 2NQ8A 4E5PA 1JTVA 3EAGA 2CDAA 1LSOA 2NVBA 4PVCA 2PV7A 5EL0A 4B3JA 3EVNA 4DPLA 4U7WA 3QE3A 5CP8A 2GN8A 4BKOA 1XYGA 4DPMA 1P3DA 3QVSA 4IDEA 2EIHA 3H9UA 4H16A 4HWKA 4YVFA 3NAQA 1ZK1A 1AE1A 1HYHA 2P9EA 1M76A 1XG5A 4MVJP 4TMFA 4RLSA 2FZEA 1LSSA 1NQAO 4FBGA 4RPHA 3ROQA 3D1LA 1GY8A 2X9GA 4I9NA 3AY6A 4ALKA 2C59A 1RYEA 1Y9EA 1ENOA 1MG5A 2JCXA 3MJ4A 4FJ1A 4BO2A 3WXBA 2FHSA 3ZWYA 1XR3A 1E92A 1B14A 5IZCA 3WJ7A 4XYEA 2PH5A 3MWDB 3BMCB 5IDWA 1C14A 4XDZA 5IDXA 4KTVE 1SZJG 1I2BA 2AG5A 2AQHA 4NJOA 4TQGA 5G4LA 2Y93A 2Y67A 3QSGA 3L4BA 3ORFA 3U4CA 3ULKA 3GGGA 2Y66A 4UVEA 1GPJA 3OMLA 4BO4A 4D41A 2P91A 2X0RA 5L45A 2HCTA 3RJ9A 5ILOA 1ONNA 2AQ8A 3JQFC 4YAIA 3WBBA 4WE3A 2O3SA 3LU1A 3PJGA 5TJHA 3LLSA 2P9GA 3UCFA 2ZK7A 1VJ0A 4DMMA 1E5QA 3JQCA 4LN1A 1PJCA 1UH5A 4QX6A 3MCVA 1VL8A 3GNTA 4JK3A 4Y6SA 2VZ8A 2DUUA 1NWHA 1AXEA 3EY4A 4IBOA 5ER9A 4EGFA 1LRKA 2GASA 1GZ3A 3DHYA 4D3FA 1D3AA 2UV8A 4NFSA 5CEFA 4PIVA 3NDIA 3RUIA 3Q6IA 3WGOA 3KLPX 4PG7A 2Q99A 1UZNA 3T4EA 5I9MA 3RASA 1KY4A 4FGWA 1JKJA 5I8WA 1IPFA 1PS9A 3HDJA 5H83A 1LDBA 2FWMX 5BQFA 3WG9A 1Z82A 3KUXA 3GDGA 2Z5LA 4OXNA 1W4ZA 1K0UA 2C7GA 4BB5A 4CM4A 1A4IA 3FNFA 3FPLA 3L07A 4PN3A 4NU6A 2GYYA 5ILGA 4R51A 3AU8A 3INRA 1GADO 2NTVA 1BXKA 3DBHA 4J91A 1MLDA 3FSRA 5CG2A 3LZ6A 3FRJA 4W9NC 2WD7A 4RLHA 1PQPA 4CV1A 1RKXA 4BGIA 1UZMA 3JYQA 3M2TA 2AE2A 4RPKA 4MP6A 1NPYA 2I3GA 4R5MA 4CM9D 1XLTA 1RYDA 4P4NA 4WK6A 5JC8A 1YRLA 3VC7A 4NBRA 5K6AA 5ENDA 1B15A 3E5RA 4CQMD 1WP4A 3IS3A 1YL5A 2D59A 2VNSA 2Y0CA 4HP8A 4LK3A 1HT0A 4LGVA 2Q1SA 3KYCB 1DLJA 1U5AA 4BO1A 1GYRA 1Y81A 2EJVA 3F5QA 3SXPA 1VM6A 3PHIA 1U3TA 1QYWA 1JVSA 1V8BA 2B4RO 1R4MB 2E4AA 4HY3A 1P9LA 1SAYA 3IUSA 4OKNA 1LNQA 2X5KO 3PQDA 3T7EA 4AFNA 1I5RA 2Q45A 3PZRA 3PJDA 1NTOA 1EK5A 3DFUA 1PGJA 1B8VA 3DBRA 1X1EA 1KEWA 3P2OA 4UVHA 1P74A 1IL0A 3IJRA 3OFSA 1Z7EA 3BMOB 5B1YA 3ASUA 3S2GA 5TSDA 2UUPA 1C1XA 1LLCA 4DLLA 3PZBA 1LXCA 3PHLA 3RQSA 3U4HA 3AU9A 1GAEO 1NQOA 2WJPA 5DT9A 2YUTA 3K2BA 4PRKA 2C5AA 5JE8A 3IAHA 3ZU4A 2FRDA 3I9OA 4PCVA 4MOWA 2YHIA 1KY5A 4FPXA 1EVYA 3WR5A 3TPCA 4XGNA 3D7LA 3S2IA 4J16A 3WGZA 2ZCVA 3LC1O 1SEVA 1ZXLA 3PLRA 4XYLA 4HFRA 4O59O 2PH3A 4Y9DA 5AXBA 3NX4A 1L1FA 2HMSA 1H5QA 3CINA 5I7EA 5C7IO 2C2YA 1PS0A 1VI2A 5JPIA 3A1NA 2Q4EA 2NTNA 3QWIA 3M1AA 5JDIA 3HWRA 3PDUA 5AOVA 1KVTA 1GV0A 3OH8A 3BTVA 3PFFA 2CMDA 3FWZA 3QV1A 5TJ9A 3PPIA 4E5MA 5BSEA 5U9CA 4XYMA 3INGA 3JQ7B 1LA2A 3H5AA 4C7JA 1HSOA 3MOGA 2PGJA 4J1TA 4Z9FA 3HG7A 1X1TA 5DBIA 2A92A 3PYXA 3ZV4A 1FDTA 3JV7A 3WNQA 1IHXA 3AUUA 4OAQA 3K30A 1A7KA 4CQMB 2Q1TA 4B4VA 2F00A 4L9RA 4QEDA 3PVZA 1D1TA 3RU9A 5ICSA 1LC0A 4I08A 2O7QA 2Q2QA 1N9GA 3GHHA 3OJOA 4NFYA 3BMQB 3RI3A 5JNLA 3DBLB 2B37A 2BHLA 5DCUA 1P31A 2QZ9A 3CTMA 5JXWA 3WGQA 1E6UA 3GPDG 1HDRA 4JX8A 3KZVA 1T2EA 4L4RA 2AE1A 5JYDA 4JQCA 4ESOA 1MP0A 1SOWA 4JBIA 3F47A 4AJLA 4RZIA 4QO8A 2HMVA 5TGDA 3BMNB 1I3KA 3RC2A 1PQUA 1NXQA 3TZHA 4Q3BA 1K3TA 3GQVA 3GN1A 4BNFA 1N1GA 3WGYA 1MFPA 1DRVA 2NU7A 2P9CA 3TN7A 1XQ1A 3SJUA 3WFJA 3EW7A 4EJ0A 2P4QA 4XGKA 1IB6A 4TWRA 1UDBA 1H6CA 4YJDA 2YW9A 3F6YA 1ZMOA 1GL3A 1DHRA 3ZWNA 2JFGA 1HE5A 5I7FA 5LC1A 2DPHA 1N8KA 2FPPA 4R1TA 4J1NA 2Z1MA 5ITVA 1JAYA 3OIGA 5A9TA 1U5CA 3KBOA 4EUHA 4FJ0A 3SVTA 1BG6A 3IP1A 5A5FA 1VPDA 3BTOA 4YYZA 1HLDA 2GUGA 3KSDO 4CMHA 3ICCA 3WSWA 1GCOA 1ZCJA 1Y5RA 3GUCA 3KV3O 2OBNA 2ZTMA 1YH3A 4UVIA 4XWYA 2CD9A 5A3JA 2EEZA 2HMUA 1VRWA 3QLJA 4QUKA 3JQBA 3DC2A 3ETDA 2OUIA 2DKNA 2ZCUA 1E3IA 5FWNA 3LVFO 3WIEA 2ILTA 1ZK3A 1UR5A 5ITWA 2I99A 2QRLA 2FPIA 4HXYA 1L7EA 2CSUA 4PGFA 2PZMA 1CYDA 2DTDA 2HKIA 4JCOA 2CVOA 5A06A 5DZSA 2ZTVA 1B2LA 4YJHA 3LSYA 3JYOA 3UCEA 3H9JA 9LDBA 1HE4A 4J9VA 1WDLA 4PLPA 2PA3A 3PWSA 4N5LA 3ENNA 4R16A 5FI5A 4B4OA 1PJTA 3C3XA 4JNKA 4TRNA 3V2HA 2X5OA 2NQTA 2AEJA 1OMOA 5A9SB 5TF4A 1EUZA 3LT1A 5H81A 1FJHA 5DBGA 2YV2A 2WMDA 3DBVO 1LX6A 3D64A 3I6IA 4AICA 4NJMA 1A7AA 4CLEA 4GI2A 1C3VA 1CEQA 2X86A 4XJSA 4G65A 1RJWA 4MO2A 3GFGA 4BO6A 1SEPA 3SBOA 2UDPA 8LDHA 1H2HA 4IQ0A 2V6BA 1GYPA 1YB1A 3IDSA 3UFXA 1DDOA 4W7HA 1P1FA 3VPSA 3G17A 2JD2A 2FMUA 4IM7A 3LLVA 1W8DA 1HE3A 3K31A 3L9WA 4RVFA 4DUPA 1KEPA 3ZHXA 4AJ2A 1MXFA 4WOKA 3ZNPA 2ZKLA 2BD0A 1ZVMA 2O4CA 1ZH8A 3HE3A 1X13A 4WOJA 2VWPA 3ST7A 2PD4A 1F14A 4CMEC 5F3RA 3MTJA 2OBYA 4XEHA 3E6AA 3R3JA 3BHIA 2Y0EA 3NTQA 3CIFA 2PKQP 2B83A 2HO5A 1DEHA 1U7HA 2W90A 5T8KC 4OXKA 3FCOA 3R6DA 4WCDA 1P0FA 3G49A 1CQIA 2ZJ1A 3M2PA 5JLAA 1KERA 3SX2A 1CETA 1K6XA 2R00C 3GZNB 4ROSA 4B7UA 1M6HA 2EHDA 2OZPA 3OP4A 4ND2A 4ND4A 4A7PA 3L6DA 4B3IA 4WKGA 4M89A 4F46A 1LDGA 3ZU5A 3KVOA 3Q2KA 1KVUA 1BW9A 2DPGA 5B4UA 4CMIA 4ZRMA 1HL3A 1E3LA 3GDOA 4LW8A 4IGFA 5COAA 1GYQA 5JMPA 2OO5A 3AOEC 2J3JA 1GFSA 4BO5A 4E32A 2E82A 4FDAA 4HX5A 1TT5B 4DREA 4QSMA 4RV9A 1PR9A 5G0UA 2CF5A 1D7OA 4J7UA 4E2ZA 4RVGA 3CH6A 4LISA 2JFHA 5L4LA 4S3MA 4QTZA 2DUWA 2EW8A 2G76A 4NR0A 3ITKA 3ABIA 3NTOA 2BGKA 3C1AA 4YJFB 5IN4A 2IODA 2W2LA 4J7XA 4CLHA 6ADHA 4L0QA 4Z0HO 2ZTUA 4H15A 3JYLA 3QA9A 1V9LA 4JBHA 5JAMA 3JQEA 3E1KA 4GSLA 4K6CA 4YPOA 3DOJA 4ZJUA 4BNIA 4E2XA 5F5NA 1Y7TA 1IUKA 3WQSB 5BSGA 5KJ6A 3FN4A 2VYVA 4NH4A 4P8RA 2VTEA 3SEFA 2OOSA 4AVYA 3NV9A 3TWOA 1DJNA 1KVQA 4K1LA 4R1SA 4CUKA 4I5EA 4FC7A 1WMBA 1FXSA 1GTMA 2XXBA 3GT0A 4IMPA 3I4CA 3GVXA 4KUHA 1NR7A 1SCUA 3C7CB 3KSZO 1JDJA 2YY7A 4BNYA 3MJCA 4YCAA 4P22A 3KB6A 1P0CA 1P45A 4E4YA 1YWGO 3LT4A 4N5MA 1RM5A 5BNTA 3GAZA 1U4OA 4CMBA 2O2SA 2POQX 1C1DA 4KP7A 3RC9A 4U6QA 1KC3A 3B1JA 3DZKA 4XR9A 1SBYA 1B8PA 1A5ZA 1FDUA 2HUNA 2QYTA 2OORA 2VT2A 4RQUA 3WSVA 2CDBA 2DVMA 4Y6RA 3WDSA 3I23A 1DLIA 1DB3A 2O23A 1K89A 4DQVA 4J4HA 4PLYA 1TA4A 2NTJA 2I65A 4GVLA 1EQ2A 4IJUA 1GR0A 3WJAA 1QYDA 3VPFA 4Z9XA 1ZIDA 1R66A 3WTCA 1LQTA 3TF5A 5GZ3A 1HF3A 4YRAA 5K9ZA 3JQAA 2IDZA 5BSHA 2AHRA 2XF8A 3NEPX 1Z7BA 2JD0A 3D5TA 4D44A 1ISHA 1E7WA 3QVTA 5C37A 1N5DA 1PSDA 5IXSA 5KVCA 3DZGA 3R3SA 1H6DA 2HJRA 3W4JA 3U62A 1EZ4A 4EYEA 2VNAA 5CDGA 1H94A 5HTOA 3LC7O 5AVOA 4A27A 1K6JA 1W73A 1DHTA 1Q0HA 1RM3A 3DZBA 4QFDA 3Q9UA 3EZLA 3UVEA 2CF6A 2I67A 5THQA 2H63A 4CUJA 1OBFO 1J6UA 1YBVA 4R54A 2NWQA 1KETA 2Z1NA 1QP8A 1X7GA 5DULA 1ONOA 4MIOA 3WLEA 1QV7A 2NNLD 5C7LO 2QHXA 3BZUA 2IEDA 4IDAA 1V3VA 1E3WB 3W8DA 5JBIA 1ID1A 1DFGA 1CWUA 1HTBA 1EQUA 4U6SA 3E9NA 5TIIA 1R0KA 3RBZA 3H9EO 2E48A 4M49A 4UEJA 5A05A 3FNHA 4IS2A 1XCBA 1Q7CA 3O8QB 5KNLA 3FR7A 3D3WB 1WVGA 3IOYA 1LQUA 4BNXA 1QG6A 4BS9A 5JAZA 3GVIA 3T7CA 2Q1WA 1UAYA 3BHMA 4R1UA 3VKUA 1NAIA 4EITA 3UGKA 1QORA 2GO1A 4JROA 5LDHA 4BKUA 1GCUA 1CERA 1LI4A 2WE7A 1E6EA 3INTA 5A9RA 3E9MA 4CPDA 2DTEA 4IJWA 2AA3A 4PLZA 5CDUA 4ZQBA 3UF0A 3STHA 3NGXA 5COQA 4EW6A 1Z74A 1PZEA 4DC1A 3WYEA 3B20A 3DAGA 4EJ6A 1I2ZA 3HDHA 3R1IA 5AYVA 2Y0DA 3E82A 4LRTB 4ZQHA 1HXHA 2DBQA 4FQ8A 1PWXA 2IZ1A 1DIAA 4IZHA 5EJ2A 4OSPA 1C0PA 1NFRA 3WMXA 1JKIA 2QIOA 3WOHA 1ZFNA 2AW5A 2DFVA 3VH2A 3RSHA 3ZV3A 5L4SA 2FSVA 4DRYA 4A2CA 2D5CA 4MVJF 2NADA 1HE2A 4MVJM 5IXYA 4Y8VA 3WWYA 5K0ZA 3BMCA 3OQBA 2EV9A 1T25A 4CM3A 1SC6A 3MEQA 3NDRA 3U9LA 4J2HA 5B4VA 1E5LA 4B79A 3F1LA 1AUPA 3SC6A 4G2NA 4BKPA 3GLQA 2NSDA 4WCFC 4KDEA 4ZD6A 1I0ZA 5G0WA 4HNHA 1G6KA 2P5UA 5TS3A 1H93A 3EHEA 3KLMX 4N18A 4LMRA 5DF1A 1NHWA 3VPGA 5A1TA 1OI7A 4CMGA 3ZV5A 2JHGA 1PZGA 2D1YA 4D42A 5TC4A 2SCUA 4UULA 4WGGA 3EUWA 2E6UX 3E9QA 4NBWA 4LVCA 3BIOA 3I9JA 2H5LA 2VRCA 3HN2A 2DBRA 2NUAA 4ITUA 3RROA 1BXZA 4R68A 4YACA 5CPFA 4RVSA 3HN7A 3HSKA 4CV3A 1AGNA 3DB2A 2O4UX 1BWSA 1R6DA 3JQ9A 1OZAA 4GLLA 4XIJA 3PDJA 1EE9A 3KYDB 3PXXA 2VQ3A 1BXGB 4F6LA 1NM5A 3KEOA 1E7MA 2HMTA 2Y1EA 3MJSA 1DXYA 1T2DA 4YTEA 4UREA 3HB5X 3QQPA 1B7GO 2IEBA 4CMAA 4CM8B 5J23A 2HLPA 2HRZA 2BFAA 1LDYA 1P1JA 5JDCA 4OO3A 3P5SA 3DO5A 3TL2A 4TSKA 3A06A 3HFSA 3ZWBA 3PWKA 4U0KA 1LEHA 2JFFA 4BNGA 2HK8A 2FP4A 2IZZA 2VHXA 2W8ZA 5IF3A 1H9BA 1VE9A 1PJ4A 3B1KA 3PIDA 4ZRNA 3TOZA 4J43A 3ON5A 3EMKA 2AMFA 4B8WA 4DIBA 2VHVA 4BNWA 4KQWA 4CM1A 4TRMA 1N92A 4IIVA 2PZKA 2IXBA 5IZCC 1E6WA 3H7AA 2B5WA 3KYCA 3C7DB 5I7VA 4BQRA 3A28A 1NVTA 4YJGB 3DDNA 2TMDA 3OM9A 2ZYAA 3L4BC 1LC3A 4OQZA 2ZQYA 2X8LA 1R4MA 1DPGA 3ZU2A 5C5IA 3C7AA 3QVXA 1WPQA 4AJHA 5DDIP 1ONPA 1ENPA 3S2EA 4F3YA 1U2GA 3ENKA 4ZQFA 5JY6A 4Z9YA 3UICA 4PLTA 1XU9A 2O50A 4A0SA 3EDMA 4ZICA 4W7IA 1MFZA 4BNKA 4J4BA 3GH3A 2BFMA 2RHRA 2P68A 4WPGA 4FJ2A 4UAGA 4DA9A 4DYVA 4BNLA 3BMOA 1MC5A 1JAXA 3DOOA 4CR6A 4E31A 3SC4A 3NKLA 2BKAA 3JQGB 1K6IA 1TVEA 4RO0A 3F1KA 2FSSA 4CUZA 3WQRA 1NQ5A 3W8FA 3FF4A 1YL7A 4ALMA 3QWAA 4B7CA 1DSSG 5AXCA 1ZZEA 4RF4A 5IDYA 1P1RA 4C7KA 2B35A 1N7GA 4JXKA 3ICPA 1MB4A 1NPTO 1BTOA 2HAEA 2WYVA 1SO8A 2EERA 4O5OA 2EGGA 3DEYX 1U28A 5JFOA 5TRTA 3MJTA 4E3ZA 6LDHA 3AM3A 1IOLA 2DU8A 3VPXA 1B8UA 2ZQZA 4NBUA 3CKYA 4AJJA 4ALLA 2ZB7A 4YQYA 3KYBA 4QECA 2D2IA 2EG9A 4AJOA 1LLQA 3C1TA 4CL8A 1B26A 1JU9A 5L40A 4U8GA 2VTDA 2F1KA 1LU9A 1Y8QB 4I1IA 2H9IA 4RVUA 3AUAA 1Y8RB 3WNVA 2NU6A 4BQPA 4JJGA 3L77A 4M8SA 3W8EA 1M2WA 2OP0A 5I7SA 3EK2A 3JQ7A 3U3XA 4MIYA 4O1MA 4Q3EA 1KS9A 4CMJA 1GZ6A 3ZCXA 4RF3A 3TDKA 1R4NB 2GZ2A 2BELA 2XXJA 4X54A 3VVBA 5K6AC 5KVSA 4QT0A 4PG8A 4FFMA 4GL4A 3JQ6A 1HETA 2EF1A 3NUGA 4NI5A 1ZW1A 2RIRA 2Y1OA 4D3SA 4EEZA 3LF2A 4CM9A 1Y9AA 4IQGA 2Q1UA 4UEOA 2NV6A 1ZJYA 4YDRA 3JTMA 4ALIA 4CQMA 3RFXA 1UXGA 3QIVA 3F46A 4MKXA 3WX0A 5A5EA 3GNQA 3BMQA 3QY9A 2GRAA 1U7TA 3DBLA 5KJFA 4LSMA 4EJMA 4CR8A 1Y5MA 1UUFA 1HSZA 1BGVA 3VKVA 4GX2A 1RM4A 1YJ8A 1P77A 5IJZA 3CMCO 2X5JO 3GDFA 4IDDA 5CEEA 2EJWA 4GX5A 2DFDA 2B4TO 4O6VA 1PJBA 4E5YA 4E5KA 1PR3A 4CQLB 4YQZA 2XPCA 1OC4A 3H5NA 3GAFA 3ZH2A 3H3FA 3DHEA 2GLXA 3QVWA 3GRPA 4IXWA 3BMNA 4UEKA 5L53A 2ZATA 1E1MA 2J3HA 5L4NA 1FDWA 4YB8A 4Q9NA 1M66A 2G0TA 3CSDA 3TOXA 3L9XA 1YDEA 1NWCA 1PL7A 1F0YA 3K9QO 3VH4A 1PJ3A 4F45A 3O9ZA 4E0BA 3BHJA 3GGPA 1MGOA 2C2XA 2VWGA 2ZB3A 4DIFA 1YJQA 3I6QA 3KHUA 1ENYA 4YAEA 1VSVA 4XDYA 4MIEA 2FR0A 3EC7A 2J8ZA 4BNNA 1PWZA 4DIOA 1N2SA 3LT2A 1F12A 1H0KA 4HFMA 4IQ8A 5JDIC 3GG9A 2D4AA 2B4QA 3RWBA 1YBAA 4LMPA 4RPLA 3ZU3A 5CDYA 3OJFA 4ND1A 4CLOB 1VLLA 3DHNA 4BO3A 2NVWA 4BMNA 2DTXA 1OAAA 1ISMA 1DC3A 3C85A 3TRIA 2E49A 3FBGA 2J5KA 3RJ5A 4AG3A 3DONA 1GV1A 2B69A 4ND5A 5DCWA 1IYZA 1FDSA 4I5FA 1ORRA 3K96A 4KMSA 2NLOA 2WTBA 4FOSA 4OM8A 3FNEA 4B8ZA 1WLYA 3QHAA 3ZWMA 4AL4A 3E8XA 4ID9A 5HWSA 1I30A 2YDXA 1QLJA 2C20A 3ANLA 3JQ8B 1NYTA 1RM0A 1FF9A 1GUYA 1YQXA 3BA1A 3NRCA 4JJIA 3TFOA 1RPNA 3PJFA 1EMDA 4RF2A 4PG6A 4R9RA 2BGLA 4OJNA 2EP7A 2NU8A 2PKQO 3JD3A 3DMTA 2IE0A 4IINA 3I1JA 2I3AA 4PVDA 1QR6A 1YOVB 5KKAA 1VKNA 4IS3A 4YRBA 2LDXA 1DO8A 3ADPA 4RDIA 5MDHA 1E7YA 2GN6A 3E5MA 3N74A 3FPCA 2RH4A 3JQDA 4MPDA 3AJRA 2OMEA 5A9SA 2W4QA 3K92A 1BDBA 3JD2A 1KEVA 3JD4A 4M54A 3N58A 2IXAA 4BB6A 1PJ2A 4JP3A 2O7SA 3C8MA 4YA6A 2R6JA 1LDMA 2HSDA 4IZIA 4MKZA 3ZWAA 5TLSA 4R69A 4TRRA 4BMVA 1ZMTA 3HDYA 5TQVA 1QV6A 3FWNA 1MXHA 1P1KA 2X0IA 5THKA 4IJVA 1VL0A 5DCYA 1YQDA 3PQEA 2GR9A 4QQRA 3ZHYA 1HZJA 1UXIA 2J5RA 2V6FA 4R9SA 2NVUB 5F21A 2YFHA 5HA5A 4NDNE 3RCBA 4TRJA 5B12A 4BGUA 1MUUA 3D4PA 4DC0A 5JS6A 5L7TA 4OH1A 3FHLA 4BNVA 5FEUA 1BRMA 4U0JA 2E37A 1XIVA 4E21A 1ZXBA 1BSVA 2DM6A 5A4DA 1YVEI 2FR8A 3RC7A 3PIIA 3W6UA 4ZHSA 3AK4A 1TI7A 2VCYA 1UXJA 4W6ZA 1O5IA 1E77A 3OJ0A 3Q0EA 4GGOA 1MG0A 3L6EA 2YHUA 1NHGA 4BO8A 4BNMA 1HRDA 4NZ9A 4PLGA 1ULUA 4WEOA 1EDOA 1LUAA 1IE3A 1SPXA 3JQBC 2O3JA 5JSFA 3N7UA 4RVHA 4II3A 3RC1A 3ETGA 4HFJA 1DFHA 4L76A 4GMFA 3GZNA 2XAAA 3K5PA 3QRWA 2VHYA 3H9GA 4BV9A 5I9NA 1NVGA 3ANNA 4KOAA 4MVJH 1NNUA 3TZKA 3BXXA 1Q2XA 2EW2A 1GQ2A 1N7HA 3AOGA 3PQFA 5C3MA 3RU7A 1V3UA 4RF5A 4D0RA 1B0AA 5JCJD 5T6BA 3H5RA 1WDMA 3GN2A 4FOOA 5L3ZA 3NJ4A 4BNTA 4Q39A 5G0TA 3EZYA 2I5PO 2BGMA 1TT5A 4J0FA 4BHTA 1Q7GA 3NT2A 4BNHA 5CDSA 4AJNA 1I01A 5BNFA 3KETA 3GOHA 2BFPA 2H1SA 4IGEA 1H2BA 2PD6A 4WNIA 1YQGA 4A5OA 2YZ7A 2DBVO 1V35A 1EFKA 3RD5A 1Z45A 2YV1A 2XOXA 4HFNA 4YBZA 3KXDA 3GFBA 3OEWA 3GVHA 3QWFA 4Y67A 3EGOA 5IAAA 1EDZA 1MA0A 2Q3EA 1O9BA 3S55A 4E6PA 1YDWA 3AW9A 3RKUA 1QMGA 4LCEA 3AI3A 2VHZA 4YJFA 4XJTA 2C54A 1Q0QA 4FSHA 2NACA 4TZKA 1X14A 1A27A 2PY6A 4NU5A 1E0DA 3UN1A 1DRWA 1LDNA 5HS6A 2Q49A 2J6IA 3G1UA 4B7XA 3JD1A 1GEGA 1SMKA 2WYWA 1B3BA 3PHHA 4KUGA 4UVGA 2PGDA 1I10A 2EKQA 5BR7A 1G1AA 5T67A 3VAZA 4MP8A 4CMKA 2VYND 1QXSA 5JC1A 5L51A 1W6UA 2ZTLA 4NK4A 4D0SA 2FR1A 3DAFA 4BKQA 3WMWA 3PHJA 4CM5A 4MVJD 2HU2A 4GBJA 1D8AA 2O3UA 3DWFA 1YS4A 3NT5A 3X2FA 4GX0A 3V8BA 3JCZA 1UXKA 1HDXA 1Y1PA 1DC5A 3HDQA 3L0DA 4P4LA 4ZU3A 1DJQA 5HM8A 3DXFA 1HKUA 4U5QA 2Y99A 3OJLA 2CNBA 4WEQA 2GZ1A 5ER6A 1X0VA 3Q11A 4KTTE 3EVTA 4BOYA 4D43A 1CDOA 2OFPA 5ES3A 3GK3A 3P7MA 3GY0A 3P19A 2DQ4A 3VH1A 4CLXA 4HKTA 5FFFA 5ENVA 3R0IA 2VOEA 3BYZA 3WBFA 4J90A 4BL5A 4UUOA 3F4BA 3V1TC 4WJZA 2UUOA 5T5QA 3ONEA 2HDHA 3OEYA 3ROMA 1F8GA 4W82A 4XIYA 5JO0A 4RPGA 3KM0A 4GLOA 3VHRA 4FB5A 2CFCA 4INAA 2LDBA 3COSA 3PHGA 3DR3A 4OL9A 1K5HA 1XQ6A 2QW8A 3ZN2A 4DYDA 1I32A 1WW8A 1PU2A 3U5TA 1ISFA 3VZRA 1YO6A 4BVAA 1O8CA 5G4KB 3F9IA 4H3VA 3AWDA 3HHPA 2WDZA 3LQFA 3ZI0A 2BRUA 4Y98A 1UDCA 3F3SA 1IULA 2TMGA 4GKVA 2JAHA 5JY1A 4YT8A 3SLKA 4GGPA 1PJSA 5EPOA 3TSCA 1C0LA 1BVUA 1E1KA 2RH8A 3HB4X 1BVRA 4S1VA 2G1UA 4XKJA 1H6AA 5JYEA 5EMHA 5KTKA 1AN9A 4N5NA 4W4TA 4BNUA 4MVJE 4A26A 2AXQA 4EDFA 1ZNQO 1O89A 2B0JA 4HUJA 1XEAA 3QP9A 3S2FA 3ZWVA 3GVCA 4ZQGA 5CPBA 1XHLA 3VZSA 3ZHBA 1VSUA 3OICA 5KJEA 1DIHA 2DLDA 5L9AA 3K73O 3C24A 3ROKA 1ADGA 4AJ4A 3AY3A 4MJLA 3C1OA 2PD3A 2VUSA 1C0IA 1K2WA 4J1SA 1EUDA 4AJEA 4WCFB 1U3UA 2W2KB 2VHWA 1PL8A 1T2FA 1DAOA 3JQFA 3K6JA 3DTYA 3O8QA 3PEFA 1JQBA 3D3WA 4PLVA 2ET6A 3IKTA 1I36A 4DLBA 1ARZA 4YEDA 2EXXA 4BGEA 1LDEA 1HZZA 1GQQA 3K2EA 4DVJA 1DC4A 1KVRA 1UAGA 1ZK0A 4TKMA 4XQEA 2WEKA 3DFZA 2JJYA 4Z0PA 4AJKA 3VZQA 2DC1A 2NM0A 3OA2A 4WLVA 5KVQA 1PJLA 1ZEMA 3HZZA 4PZDA 5G0SA 2Y1FA 4WLOA 4L73A 1P44A 3ZGYA 3JSAA 4FD3A 1OFGA 3MJVA 4RL6A 4BO0A 1HDGO 2OHXA 3RAJA 1NR1A 2ZYDA 4RGBA 3WFIA 5A04A 4CLRB 2GCGA 4JP2A 1HDCA 3F4LA 1V6AA 4CODB 2C29D 3AM4A 1AHHA 2EKLA 7ADHA 3DZHA 3MJEA 2B36A 2IRWA 3GVPA 4NNJA 3JYNA 4D3DA 5IDQA 3RFVA 7MDHA 4ZA2A 1U9JA 1ISGA 2V6MA 5T64A 2CDCA 1X7DA 1PZFA 2NU9A 4A10A 3AY7A 4PFJA 3WB9A 3LYLA 3GZ4A 4ALJA 5L7WA 4OMUA 1PGOA 4FS3A 4I8XA 2FPGA 1LBEA 3LC2O 2Q50A 3HUDA 1DIBA 2DT5A 4M55A 4W9NA 3FBTA 3GPIA 2IZ0A 4D45A 2J5QA 4WASA 1LLUA 3IIEA 9LDTA 1IZ9A 2ZYGA 1ZK4A 5COBA 1UJMA 2I6TA 4R4JA 5HBRA 3A14A 3KEQA 5G0VA 1T1RA 3OBBA 2A94A 4FR5A 4XB1A 1OC2A 3NJ8A 4M1QA 4XR4A 4N54A 2AEMA 3G1TA 2FOIA 3VTFA 3UCXA 4GWGA 1CF2O 4QO7A 2O48X 3W4IA 1JA9A 4HBGA 4E2YA 2GGSA 2Q4BA 5CFZA 3ZWXA 4GQAA 3TZQA 2Y1GA 4K26A 3CZMA 4NMHA 1Q7BA 5KOIA 4DGSA 3FTNA 3GHYA 2UYYA 1HYEA 3TJRA 1V3TA 2C5EA 3O38A 4FW8A 1E1NA 5EINA 4WUVA 1ADBA 5EERA 4TKLA 1GPDG 1WDKA 3B6ZA 3OF2A 5BT9A 3RVDA 2YFQA 5DP1A 4J3FA 3KYDA 3I9KA 3WGGA 1BXGA 1CQJA 1U4SA 5DBFA 5A02A 3KSUA 4Z0TA 4IY1A 4NBVA 4OGWA 4DLAA 1WZEA 2RBEA 4LSWA 5L7YA 4E2WA 2OXIA 3O26A 5ADHA 1EFLA 5I9LA 1LRLA 1KOLA 2O2YA 3K8ZA 2VZ0A 4CM8A 2DBZA 2ZIZA 1A9ZA 2QRKA 3UHAA 1PS8A 1YB5A 2GPTA 2X9VA 3DAPA 4TVOA 1R15A 1C0KA 3V5NA 1T2AA 5HRUA 1PGNA 1KC1A 5I8ZA 1O6ZA 3WTBA 3OECA 3WLFA 3AI2A 3KO8A 3QWBA 3WYBA 3P2YA 1HEUA 1LSJA 1EVJA 4XCVA 5KVVA 3AUSA 3ZNNA 4D79A 4GVXA 3I4FA 4CM4B 2D5AA 2DAPA 3W4KA 3H8VA 1SB9A 3HQ4O 5IG2A 3PLNA 4Z3DA 1ENZA 2P4HX 3DBHB 4KWIA 1IHYA 4OHUA 4YJGA 2BI7A 2WD7B 1Y6JA 2VRBA 2WD8A 5FI3A 4HV4A 1DOHA 3QWHA 2J3KA 2GZ3A 4L4XA 3U0BA 4GMGA 3Q3CA 1B3RA 1X0XA 3D3EA 5F1PA 3ADOA 3ZWOA 1TXGA 4FGSA 3HJAA 4B4WA 1M6WA 4YXFA 5G2OA 1KYQA 2GDZA 3O03A 4IDFA 4Z6KA 3TFQA 2WYUA 1B16A 3L6OO 3X2EA 4KDFA 4TVBA 2HQ1A 1HYGA 4J2OA 2C7VA 4FFNA 4DXHA 1GD1O 4AJIA 2VT3A 4MINA 2RCYA 2GERA 3ZNQA 3JQGA 1T1SA 3D4NA 3TNLA 4CR7A 4DBVO 1U3VA 4YT4A 3RUFA 2Q2VA 2PK3A 3WS7A 1T4BA 3DBRB 5JMWA 2BH9A 3PFWO 2IYPA 5JAQA 1SB8A 2X22A 3JQ9C 5EQDA 2PTGA 1T26A 4E5NA 4P4GA 2QG4A 4JGBA 3UOGA 4WLUA 2PWZA 1UP4A 1DIGA 5MGBA 3OA0A 4DBZA 2Y05A 4XGIA 1E7QA 1C1XB 4GAEA 3DMYA 4IDCA 1WXDA 4GH5A 4QXMA 3BTUA 3EYWA 2Y1DA 3H9QA 4ONEA 4Q3NA 1F8FA 5JDCC 3AI1A 2PFGA 2V65A 1NP3A 2D8AA 1I3MA 4YT2A 3H2SA 3NDJA 2GNAA 1VKOA 1NFFA 4K28A 5DP2A 3O4RA 2G17A 1EVZA 2GN4A 3NT4A 2JAPA 2X7HA 2YHIB 4GKBA 1Y8QA 1ZO8A 2YQ5A 1TB4A 4E30A 4IMRA 1DBVO 1Y8RA 3OIDA 4YAKA 2HK9A 4IUYA 5DN9A 4YRDA 5L95A 1BMDA 1ISIA 1R4NA 4NK5A 4UUNA 5DOVA 1G0OA 1P33A 2CVZA 2PZLA 3I9NA 5A03A 4J9UE 1ZKMA 4A03A 1EBFA 4CV2A 1ML3A 1PZHA 3B70A 4NQZA 4IXTA 4R3WA 3TL3A 1H6BA 5GZ1A 5KJ1A 1U8XX 1ZSYA 2VWHA 4MDHA 1UZLA 3H4VA 4MP3A 2WM3A 4UUMA 3MOIA 1A72A 1GQYA 2VUTA 3GR6A 3GRKA 5H82A 4EBFA 4OKIA 3DOCA 1XKQA 1TLTA 1I3LA 3NYWA 2HRBA 1LTHR 1EEHA 1Z73A 4YAJA 2C0CA 4XA8A 3AUTA 1YGYA 3ETEA 4OOFA 3VH3A 4CMCA 5KJCA 5TT0A 3HNPA 1EVIA 3LK7A 1LSUA 5B37A 3U4DA 1G0NA 4CQLA 3PRJA 4MVJI 1N9GB 2ZJ0A 1U8FO 1ZJZA 1GDHA 3WWZA 3GF4A 4B3HA 4BKRA 4PRLA 2D0IA 4UUPA 1D4FA 3I52A 1L7DA 2FY8A 3RUCA 4J49A 4BIIA 3IL2A 1KVSA 4BV8A 1TEHA 1I2CA 4XD2A 1T4DA 2X23A 1HDZA 4JJFA 4KUEA 4TZTA 1LLDA 3WGTA 1F17A 4ZN6A 3ZW8A 3CMMA 4OQYA 2C82A 3G79A 1EE2A 1XU7A 1I24A 1Z75A 4OOEA 4RZHA 1E3EA 4RORA 1QYVA 4FN4A 1QRRA 1UXHA 4BNJA 4XRGA 1UP6A 3U4IA 3D4OA 1XGKA 3KOUA 3Q9NA 3AFNA 5F5LA 3IP3A 4I9UA 3PJEA 1HWYA 4H7PA 1A9YA 2EWMA 5AXDA 3W1VA 4DQXA 4ZQEA 1PJQA 2X1HA 3RUDA 4FFPA 4L74A 4CLOA 1WWKA 5C7OO 2VZ9A 4XYBA 5EESA 4KWHA 3UUWA 3ZWCA 1UP7A 2ZB8A 3OSUA 4E33A 4CM6A 5F1OA 1E7SA 1BHSA 1D1SA 1MV8A 5DNAA 3V1UA 4DQUA 4DMLA 2YQ4A 3D0OA 1YXMA 2GN9A 4KZPA 1NASA 2UVDA 1X15A 1O95A 3G3EA 4CMEA 3MZ0A 3JQ8A 4YR9A 1EBUA 4EI2A 1VJTA 2YJZA 4DL9A 3BTSA 4WLNA 2IYOA 4D46A 1GEEA 2YV3A 4GPD1 4PG5A 3UAGA 5CHEA 5T8KA 5CDTA 1YBMA 5LDGA 2Q46A 5JO9A 4I5DA 1YOVA 4RQTA 4NIMA 1GUZA 4JIGA 4PZCA 3JD0A 4XRRA 3V2GA 1P1IA 3WGIA 1ZK2A 2R00A 4RJTA 1H9AA 3JYPA 3OQ1A 4PLWA 5HS4A 2QQ5A 1CRWG 1J49A 1DC6A 3IKVA 3L4SO 2GD1O 1XWFA 1LJ8A 4DPKA 3BAZA 3GA0A 3PTZA 3PI7A 4GWKA 4YJHB 2I9PA 1GZ4A 1ZUD1 1JWAB 1U2DA 4WLFA 4XZ3A 2BMAA 3I3OA 1O94A 1ZSVA 3GEMA 2JL1A 1BDMA 5EIOA 3ZDFA 4YT5A 4ZVVA 1JKFA 3AOEA 5IN5A 1UDAA 1PGQA 4FC6A 3GEDA 5CG1A 4NG5A 2V7PA 3LT0A 4PLFA 1N1EA 3PK0A 1XELA 2ZB4A 1JLLA 3VVCA 4JLWA 3VOSA 4PLCA 1ISJA 3AM5A 4NJMB 4PZEA 4QFCA 2X6TA 2NVUA 2J3IA 2YDYA 2JD1A 3TZ6A 2D3TA 2AQKA 3ZW9A 2PLAA 2W2LD 1R12A 2PZJA 3ONFA 5EQFA 4II2A 4J0EA 4RDHA 1PIWA 3WQQA 1O0SA 4HNGA 4OXYA 1ZSNA 3V1YA 3DTTA 1FDVA 1YONA 1WAMA 1YKFA 2AEFA 5TNXA 1DAPA 1WMAA 4FFLA 2I66A 3OIFA 4OYRA 3UH1A 1RWBA 5GMOA 3OQ6A 3VDQA 3FI9A 2YYYA 2A35A 2RAFA 4WLEA 1QYXA 3E03A 1P1HA 5AQ1A 5JW6A 5A3VA 2VYVD 2X0NA 3OJEA 4FFRA 1E1LA 3E18A 1ZBQA 2PR2A 3PGXA 3KTDA 5GY7A 2UAGA 4BO7A 4M87A 3IJPA 3U49A 3M6IA 1DFIA 1EUCA 2C07A 4DTIA 3RBVA 3RUHA 1PTJA 3ZHZA 4A73A 2EGHA 4E12A 3FR8A 3OHSX 5KWEA 3PGJA 2VUUA 5B4TA 3DMTC 1MC4A 2A4KA 4EUEA 2R2GA 4BNZA 5BNIA 5JAIA 3D5QA 1Q1NA 3PYMA 4JN6B 3GMDA 1J5PA 4LRSB 3ZV6A 1NX6A 4J1QA 4R5HA 1NBOA 4FCCA 4CL3A 1ADFA 2BI8A 1XSEA 3FTPA 2WWRA 1OOEA 1BW9B 5CEJA 1PX0A 4OSOA 4XQCA 3SLGA 4CMIB 1V0JA 1TT7A 1FMCA 5IFLA 1IY8A 5EN4A 5KCZA 3DZFA 4LVUA 3RFTA 2I76A 3NGLA 8ADHA 4IDBA 4W99A 2CZCA 4CLDA 2RHCA 3I9MA 3GMSA 3IQDB 1AHIA 3ZWWA 3DQPA 1SOVA 1NFQA 2JKVA 4HADA 2P2SA 1KIFA 4CJXA 4GX1A 3JQAD 1KBZA 1Z6ZA 5JCXA 1MX3A 3DZIA 1XA0A 3GG2A 3GNSA 4PG4A 1S7CA 3V2UA 4BO9A 4WNCA 1GUFA 4CM7A 3NTRA 3HFGA 3U09A 1IPEA 3AFMA 1Q0LA 5U4QA 3M1LA 2VWQA 4XQGA 3UW3A 1PGPA 4MKRA 2O3RA 3G0OA 3Q1LA 3TQHA 3VZPA 5DOZA 3ASVA 1PL6A 1ADCA 2O3QA 2VOJA 2HJSA 4OIMA 4WECA 5LCXA 4K6FA 4J4TA 2OP1A 2P5YA 3A4VA 2BF7A 1R16A 4BMSA 2WSBA 2X0JA 3PYLA 3QW2A 1M75A 3RKRA 3RUEA 1I8TA 3I83A 2Y1CA 1J0XO 4AJPA 4EEXA 5FF9A 4NBTA 3UKOA 1LRJA 1WZIA 1CJCA 1HDOA 2GSDA 5F1KA 1ZEJA 2WE8A 1KEUA 1HDYA 4EUFA 4L8VA 4XQ9A 3IMFA 2OGUA 4K9DA 1JWBB 3UXYA 3IC5A 3PWZA 4R01A 2HMWA 1NVMB 2PNFA 4IDGA 1AXGA 4BUCA 4GSKA 5AXAA 4XB2A 2CUKA 3RUAA 3WICA 3GGOA 2Z95A 3ZWPA 3WGHA 5JCJA 4I5GA 2CY0A 5KIAA 2G82A 4KQXA 5FYDA 3GC6A 4URFA 1M67A 2FN7A 1X7HA 1PEDA 2QX7A 5TX7A 4F6CA 3CUKA 4RPJA 2HK7A 2QZZA 3H3JA 3MWEB 4J7CA 4B4UA 3GUYA 3ONDA 1YE3A 1C1DB 1R0LA 2A9FA 5T57A 4ILKA 1A4UA 2OL4A 2PKRA 1E3SA 3H6KA 3ROPA 5G4KA 1T2CA 1I33A 2AG8A 2BFOA 4PLHA 4DWVA 3F5SA 5ICMA 3Q2IA 3VDRA 1U1IA 4CV0A 3KRTA 3I9LA 5TT1A 4IIUA 3TZCA 1SNYA 2EP5A 2B5VA 1HLPA 1I3NA 4LCJA 4O63O 3ITDA 4Y6PA 3DL2A 3FNGA 3H2ZA 4P38A 3OETA 3E48A 3DZJA 3S8MA 1XDWA 3W6ZA 4J6FA 3ZZNA 1ULSA 4TROA 4NPCA 3RIHA 2GF2A 4R1NA 4UVDA 3S1LA 3RBXA 1DRUA 3JQAB 4XYGA 1F06A 1A71A 2QRJA 3SJ7A 1J4AA 2EKPA 4L75A 4R41A 1JN0A 3ZNOA 3QVOA 2JCYA 1QKIA 3WIDA 4Q3CA 4RCVA 4FFOA 2W98A 3CEAA 1CIVA 3T4XA 1IZ0A 1E3WA 2VN8A 4NHEA 4XX0A 1S6YA 4C4OA 1JW9B 2BLLA 1W0CA 2VYNA 2X4GA 3GEGA 3LF1A 5U1PA 1YL6A 1WNTA 4D7AA 1T24A 1FK8A 1E7RA 2Q2WA 4IJKA 4Z3KA 4ZGWA 4Q3AA 3H65A 1QSGA 3ANMA 2JHFA 4MVJA 4YWJA
chains in the Genus database with same CATH superfamily
4RVDA 2EBWA 4WCFA 1RXCA 1SG0A 4ND3A 4F11A 3AUKA 3Q15C 1DIRA 4G5HA 4HWTA 5HK9A 4E70A 4E2FA 3NWBA 1YZTA 3I5MA 3FCAA 3MILA 3LTNC 4ZO9A 1NAHA 1PCXA 3FD8A 3GPBA 4PO3X 2HFJA 1R0SA 4XH9B 4AN1A 4RANA 2OWEA 4EJSA 4I50A 2FZWA 5EHXA 1U0LA 2IYVA 3B1FA 3IPXA 1GGFA 1VJ1A 2C9BA 3BCRA 2Q3MA 3JQRA 3LDHA 3RSCA 4JBGA 4D5GA 5KKCA 2QM7A 3MS2A 5EUBA 2QLMA 1ATIA 4JKOA 3KG2A 1YK1A 2XUOA 1VC2A 2IP4A 3JAWB 3R4CA 3ROGA 5CAEA 2F9LA 3WK7A 2V6GA 2BY4A 1Z0SA 3IE0A 4L4SA 2FW9A 1KORA 1A4RA 2JCSA 1DAIA 2XCIA 3EH1A 3QLUC 1QYCA 3GZTB 3L4EA 8ATCA 1JVBA 4N7RA 3UMVA 3SQDA 4Q1EA 2JCVA 5BN4A 1TYCA 4OYYA 4Q5IA 3UWSA 4C4RA 2OCIA 4OGFA 4FGZA 3CRNA 3E22A 4TN1A 2PGLA 4X8MA 3IDQA 3TGWA 4B81A 2XZTA 3DE2X 3IBFA 2G5CA 4G81A 5KYTA 2ZB2A 1L7NA 1LWNA 1GUDA 1JTVA 4RTMA 4M4SA 3F2IA 4U1RA 2PV7A 3EXEB 2BEKA 4URWR 3I6MA 3VYTB 3S8YA 3QE3A 3FFBA 3TOSA 4L57A 2XUFA 1YR7A 4YAFA 1G9SA 1RJ9A 1TAQA 1IM8A 5KSZA 4IDEA 2EIHA 4IYJA 5CIYA 5BVGA 1CE8B 2CLLB 3ONVA 4AM8A 4FEGA 4URZR 4JYZA 1KTVA 4RC9A 1ZHOA 1PDVA 3VDMA 3VV3A 3BH7A 1Y37A 16PKA 1BKYA 1HYHA 1P2GA 1K88A 4RLSA 5IMBA 1BFDA 1MVNA 1EX6A 1HYQA 1XP5A 3BDVA 4YJ2B 3W6PA 5CB4B 4JXXA 1Z28A 1QP7A 2IY9A 1V37A 1GY8A 2QTGA 3D1LA 4I9NA 4MEBA 4PYQA 3NIBA 4QDJA 2FQ1A 4DMHA 4AT1A 2Z2JA 1IQPA 1N57A 1Y9EA 2UZ1A 3C43A 1MG5A 4YP5A 1NG1A 2ACKA 4FJ1A 4LYGA 3KJQA 4BO2A 4O4HA 2Z9BA 3FH0A 4ENUA 1ISSA 3EA5A 1E58A 2H4ZA 3WJ7A 5K5EA 3LV8A 3MWDB 3Q10A 5TQJA 1P2UA 3BMCB 1Y6QA 1PYDA 1DRJA 1MZVA 1I2BA 1QH9A 1O4VA 1OZFA 5DI3B 2X9LA 5G4LA 1W35A 2Y67A 3QSGA 4AS3A 3RARA 3ORFA 1ETUA 4QUBA 5FPTA 3U4CA 3GGGA 2FHPA 3U48A 3EQ2A 1XK7A 2DSNA 3ME5A 4LY3A 1E1YA 1ZM9A 1Y82A 3MN1A 2CYAA 2N46A 3L0BA 4PX9A 1JJAA 2F62A 2LWIA 3O82A 4O3MA 4WE3A 2G77B 5ALXA 3S68A 1B6TA 5EJ7A 3LU1A 1KKUA 5TJHA 2WWVD 1AKMA 3LLSA 1L5FA 1L5HA 2I2CA 4RTJA 2YH2A 5CYOA 1ELOA 5BW8A 4YCNA 2O54A 1SC4A 3C3EA 4HH3C 4P7FA 3H4TA 1XX6A 4DMMA 2LPMA 2SCUB 4D4KA 1W0JD 1VL8A 4QWWA 4C4AA 1NX9A 4ZV4A 2QRGA 1PRYA 4H4EA 1ODJA 5FX2A 3L04A 3ESRA 3TW8A 2ZUUA 3BFVA 2AKAB 4UBOA 4EVQA 4U2BA 1NW3A 1QS0B 4MSUA 5CTAA 3L8CA 4NFSA 2VL7A 5HZKA 2Y4NA 1M2GA 5HKKD 3NDIA 3RUIA 1SFRA 2AN1A 3Q6IA 2RE8A 2DWQA 5BSUA 2PGOA 3T4EA 1PE0A 1Y3CE 3MJRA 1TO1E 1RI3A 2QY9A 3DULA 3R5JA 4XFKA 1HEYA 3JXEA 3L7BA 1Z4KA 1IPFA 3HDJA 2Z6QA 4JP1A 1LDBA 1PP4A 2VTBB 1Z82A 1KEEA 5HILA 3S2ZA 3C1UA 3RH0A 3A4YA 3LXRA 1B6GA 1TC1A 3AYZB 1M2FA 3FNFA 3FPLA 3KK0A 3L07A 4CHTA 4K3VA 4PN3A 3HPQA 3ZE1B 4NU6A 5E9JA 4EATA 1H8EA 2KSQA 4B3BA 3INRA 1IUOA 2GVZC 3QELB 4J91A 1BXKA 3VU9A 2KB0A 3DV0A 1FSSA 3TG2A 1KL7A 5KYWB 4AY2A 3DKKA 4EKDA 4RLHA 4DDHA 4B3MB 1Q17A 1QZUA 1KI7A 4PHGA 5DWDA 2P2GA 3LFUA 3IFSA 3BORA 1E64A 4JLVA 1GQSA 4MP6A 3EUEA 3IELA 3K0KA 2X41A 2W6MA 5JZMA 4P4NA 1JEAA 1C81A 1YRLA 3ZW7A 1DX9A 2NG1A 1NW9B 2HA0A 2PLRA 3C6XA 3E5RA 3QUAA 4ZXFA 1WP4A 3SHQA 3TSZA 4LK3A 2VNSA 5LYJA 4ACAA 4FI3F 3H1GA 4TMXA 2K7FA 4I4TB 4Z1MD 4GT1A 1QIKA 1Y81A 4ES6A 4EEXA 1U3TA 3OPXA 3FFTA 5KQPA 1JVSA 4WA8A 4WCVA 1R4MB 2WPDA 1P9LA 1SAYA 3E9ZA 4HY3A 4ZYWA 1VJ5A 3G9XA 4K3UA 3EEOA 3IEPA 2Q45A 3PZRA 4M3NA 4NCKA 3DFUA 2Y27A 3V97A 1F4VA 2DULA 3MTQA 3R75A 2OQIA 2RCNA 3RDPA 2XVXA 4BVHA 5IM4A 3B3JA 2G6TA 4F21A 4KU4A 5LOVA 1P74A 1IL0A 5E0OA 1XCMA 2OD2A 3OFSA 1M0TA 1WSBA 5KYVA 3SYRA 3WDKA 2WG0A 3V2IA 4BEWA 3UW1A 3BM5A 5LNK6 2HU8A 3JSXA 1RKQA 1UC9A 1JMVA 3R5HA 2UUPA 2XXAA 1C1XA 1LLCA 3Q8XB 4M37A 2PWPA 4TYQA 1NI4B 2CL0X 1LXCA 2XWBF 1E99A 5HJ2A 3K0CA 4GP6A 4DJ5X 2P3SA 2QI9C 3W2IA 4WY8A 4E1VA 5BYAA 2IOQA 3O8OA 1W36D 1CEEA 1YB7A 5LXTA 4K8RB 5DX8A 1J1ZA 5H7XA 3GZJA 4RA6B 3EOBI 2C5AA 3MUFA 2EZ8A 4AULA 4Q4CA 4WERA 1KDVA 1LK7A 3VR3D 1A96A 1I14A 4KLNA 3BL5A 5AH0A 1WW2A 1Y3IA 4MOWA 4PCVA 4M9ZA 4YLGA 1JR3D 4P2GA 3LL7A 1NYQA 5G53C 5IMSA 3VR4A 2WDPA 1AKEA 4A8HA 4GM0A 3D7LA 3IGFA 4YGYA 4RTNA 4GE0A 5JAHA 3GUVA 3LC1O 1CT9A 4XYLA 4C0WA 4F9FA 5LZ7A 2W2NA 1LTKA 4PBRA 3KP1A 3NX4A 4FLFA 3HFRA 3DQQA 3IQGX 2ICAA 3CINA 5I7EA 1F2VA 2GN2A 2C2YA 2RARA 1NSTA 5JZSA 3KKZA 2W70A 1MO3A 1WXGA 5IULC 3MFYA 2NTNA 1SGWA 3M1AA 4IGAA 4U7GA 3VQTA 4PWYA 1KVTA 1QDUA 1G2QA 2YMLA 2CJPA 1RXEA 4Q15A 5TJ9A 1XNQB 3NHPA 2HEGA 3PFFA 5C3UA 4B31A 3PPIA 2JGEA 5D3ZA 3CONA 2FNAA 1ZPDA 4A6DA 3KKQA 3LUKA 3U3MA 2C9YA 5C1IA 5D2CA 2HMYB 2I2DA 5TY0A 1LFDB 1RAGA 4AMVA 4RNDB 1I4TD 4ZEVA 3EN0A 2GAJA 5BUSA 4KGXA 4QU9A 4M1TA 4OJTA 2XVZA 4TV9F 5FOQA 3WNQA 2HU7A 4NDZA 1OH6A 3CZPA 3IAM1 3EW9A 3GJXC 1G5PA 1USWA 3FJYA 4ETWA 3K30A 3G0GA 3SM3A 4MLZA 4BEVA 8OHMA 2FPXA 2GK6A 4CQMB 3ADCA 5AOBA 1IZ8A 4HYQA 3Q41A 3CLTC 4L9RA 1M1UA 3G5MA 3ZGOA 5I9TA 1L7RA 4PQFA 4I08A 2O7QA 4TL8A 721PA 3GHHA 2AD1A 3CNEA 3PVSA 4NFYA 5ADWA 3B5EA 3R7DA 3R4VA 3DBLB 4O4LB 2ZSEA 4TV8F 1E4OA 3SHVA 3TL6A 4X60A 2QZ9A 3WLAA 4BY9E 3CTMA 4TLDA 4BBAA 2JGIA 5DX0A 3L92A 4YNBA 3WGQA 1Z88A 1N2IA 4KPUB 3WLTA 1H8HD 1E6UA 1FU7A 1LW7A 3DDCA 3EX7C 1H1LA 3CF6R 3R7SA 1T2EA 2NPIA 2QV7A 4ESOA 2I3ZA 5DHSA 2RGEA 2XA1A 1N2ZA 3H19A 1P1BA 3M6LA 4FONA 3QEOA 4MQFA 1ZG3A 5SY4A 5TPZA 4DBLE 5BV8A 4LYFA 4HAIA 3U3RA 2UU9B 1VB3A 3RC2A 1I3KA 3IQFA 1P9WA 3DVLA 1W29A 3S2YA 4Q3BA 5DX1A 1OCEA 1I2MA 1FCJA 4UMDA 2QORA 2Y71A 1XCLA 1N1GA 5SYMA 3WGYA 4B6FA 1NOKA 3TW0A 5JPCA 3SJUA 4OLJA 4N9QA 1Z7YA 2X2OA 3BIFA 4YS6A 5EEGA 2V6IA 3S1SA 1CG6A 1M2HA 4LGCA 4XGQA 1UKBA 4TWRA 2NZJA 3D7NA 3LWDA 1H6CA 4PZLA 5B3KA 3DFIA 3BJEA 2A58A 5EIEA 2CE2X 3F6YA 4RIGA 1GL3A 3W7AA 4DCUA 5IWAB 4DG8A 1GTRA 2JFGA 1HE5A 2NAFA 2YVQA 2HRDA 1TCUA 4BP3A 2ZBPA 1M8GA 2DPHA 1N8KA 4R1TA 4J1NA 2Z1MA 4KN6A 5DXAA 3K9HA 1T8WA 1H2AS 1K5DA 3D3JA 5K05A 4MDEA 3KBOA 3LLCA 5FPQA 4MUAA 3IUBA 1FA9A 1DUVG 4FJ0A 5EXEA 5IANA 4WZAA 4MPTA 4R2JA 1ODTC 4Q1FA 1DGQA 3CFYA 5CA0A 5A5FA 2I8CA 1WETA 3BTOA 1E0AA 2E87A 2GM9A 2ZAYA 1WXIA 4MGZR 3TKAA 1HLDA 1BFKA 3KSDO 4MAAA 4Q02A 2WF5A 1FXWF 2ZVDA 3ICCA 4KACA 1FLDA 4TSRA 5CMLA 1ZCJA 2MR6A 5G40A 2R7MA 2HLNA 3CO0S 2HDNB 3ZIUA 4EHNA 3IO3A 2MTBA 5A3JA 1BN7A 3GLIE 3QLJA 2JLBA 1ZA2A 3I12A 3JQBA 1CVIA 2QYOA 1N33B 2OUIA 2DKNA 4LF5B 5FWNA 3RYCB 5JH7B 1QNFA 2XBMA 1QF7A 3B82A 2QRLA 2RGYA 5FLEX 3K70C 3LO8A 4CBVA 2CSUA 2NYVA 1X2EA 3G2QA 2BR3A 4MRMB 1NY5A 2QTLA 3PC4A 2G9VA 1RTKA 2GB4A 1YFKA 1JDTA 2BEVA 1N78A 1OZ0A 3GLIB 3EOZA 3LSYA 3JYOA 4QOIA 3H9JA 3LUDA 2YIDA 2ZJ8A 4XLLA 9LDBA 4J9VA 1XZQA 5AI8A 1DV1A 2HJWA 4RLFA 4H1TA 3IT1A 2PA3A 3FYSA 4N5LA 2P62A 1HMYA 4IIFA 4KLZA 3NC4A 1RW4A 4QJ3A 1P9NA 4OK6A 4R16A 5FI5A 3U4AA 1PJTA 4JNKA 4MQ5A 1QM5A 2BE7A 4B4OA 1XD2A 1CDEA 3IULA 3RTEA 2X5OA 3DQZA 2WAXA 4X7RA 1OKKA 3D81A 3RYFB 1VP3A 1QAQA 2UXDB 1OWOA 4JWTA 2YYSA 4JEIA 5FPSA 1N6LA 2BE9A 1IATA 1VBMA 3FNRA 4UNPA 2V58A 3BGIA 4ARZB 1PT6A 1T9GR 4M0MA 2V3WA 4X8OA 4CLEA 1E2BA 3VJLA 2IVFA 1IHPA 1RAIA 4HN4B 4V0MA 4MO2A 2RH5A 4X85A 2PZFA 3OEED 4OQNA 1K7SN 3SBOA 2QAGB 2BLNA 2UDPA 1H2HA 3WADA 3K9FC 2V6BA 5EZYA 1T5TA 1YB1A 4TMZA 2F4VB 3IDSA 1NVVR 1P1FA 1XRNA 1CJBA 2FWJA 1KJYA 2AZMA 3HCOA 1ZHFA 2I71A 3WL6A 1A8HA 3KLOA 4BWVA 1ZJ4A 4RBNA 5IAOA 3M6UA 2QTVB 5ALHA 5FCDA 1J8DA 1MXFA 2VK4A 2XX3A 3OZ7A 4AUKA 2QEQA 2BD0A 3B7PA 1ZVMA 3IJEB 4RK4A 4B82A 1X13A 2XA2A 1TYDE 5E6UB 3NOVA 3OF5A 4G8CA 2PD4A 1O95C 4GE3A 4KWCA 3TSWA 3V4SA 2YJTD 3T3NA 5F3RA 2P7HA 1YQEA 2ZJ4A 4X44A 1DTEA 4XEHA 3UMRA 4L3WA 3PQ4A 5KWJA 2Y0EA 4HH1A 4Y1GA 4GKJB 3LYHA 2RJOA 3B51X 3STXA 1NQUA 3NTQA 1P80A 1PWEA 5LU9A 2HO5A 1U7HA 3ZX5A 2V9CA 4KQJA 2NNWB 3FCOA 1LPOA 2H65A 4OXKA 4F3TA 2BFBA 3G49A 5LBUA 3U40A 1E5DA 4GYYA 2G1PA 2ZJ1A 2XY4A 3HJHA 4QDUA 2GO7A 4X8LA 3Q3GE 5TGZA 3M2PA 1QDLB 4JC5A 1DI0A 3DZ8A 4TYNA 3SX2A 3DDZX 1CETA 1K6XA 1QGED 3GZNB 4ROSA 2OZPA 4ND4A 2Y3IA 4ND2A 3MCWA 3L6DA 4B3IA 3O84A 1EYZA 4WKGA 4ANFA 2VCHA 2NO5A 4X00A 5IJXA 1V16A 5A6SB 4HO1X 3KVOA 3FHCB 1WKCA 3Q3VA 3Q2KA 1U2DC 2X4DA 1MZPA 4NMWA 1CPYA 3BB3A 3L93A 4MV4A 4TLBA 2JZNA 2WWFA 4IGFA 4B83A 4X0EA 1JTEA 3G7NA 2OO5A 4QGBA 3AOEC 4U9HS 2J9GA 1MA3A 1T13A 4EGCB 3IR6A 1QU2A 4DREA 4C20A 2L19A 2FG7C 2FV8A 1COWA 3N07A 4KXLA 4O08A 4UM7A 3VX4A 4ECAA 5HUQA 4A0QA 3T0GA 3AF2A 2JLVA 4DV5B 3KJEA 3MAGA 1XV5A 3AFGA 3BREA 1WCIA 3P4YA 5GV8A 2WZCA 2EL9A 3DL0A 1JJFA 4J7UA 5KQMA 2R1VA 3F8SA 3BE5A 3GMIA 1JEQA 3K8OE 3EZ9A 4RVGA 3MINA 5LQSA 5IKEA 1TOAA 3I5YA 4YJ3B 5KQSA 2ZR7A 3D4IA 4S3MA 4QTZA 2G76A 1D1QA 4NR0A 3ITKA 3KHKA 2OA0A 4BASA 4XJVA 5CTJA 1ATZA 3NTOA 5DNYB 2O8EA 3C1AA 4YJFB 1EINA 1OASA 5JVDB 4OI1A 1E6KA 2EF0A 3IB6A 4J7XA 5FTWA 2WT8A 4CLHA 4PYJA 7AT1A 4UOQA 5JTTA 1Q6YA 4L0QA 3D6VA 1G6HA 3CB4A 3OU7A 4JI4B 2YR0A 2XQKA 4Z0HO 5HNKA 3UWMA 1MRNA 1UDRA 2ZEJA 2IT1A 2P6NA 2V7XA 2YVKA 3E1KA 3F5DA 4LYYA 2VF8A 3ZWDA 1DJMA 1Q22A 2AJLI 4BNIA 5D87A 5J47A 2F9FA 4M0CA 1WX1A 1RI2A 2RAPA 3SCZA 1IUKA 5T3UA 3ZQKA 1VKJA 2QA5A 3WQSB 5FUWA 1H2XA 4IDNA 1CDDA 4WFJA 1XYYA 3G2HA 2VYVA 4L27A 3X2SA 4N47A 2JS7A 4P8RA 4OHBA 2VTEA 1SKQA 2JIDA 3IAS1 4IIJA 4LYDA 1PD0A 5E9AA 4AVYA 3TWOA 4P0PB 1KVQA 1IXSB 4ESHA 1TQ2A 2XV1A 2J48A 2OZKA 3V6LA 1KNQA 1T1GA 2WFMA 4N8DA 3ED5A 4OMCA 2ZW9A 4RHTA 4S2UA 2XXBA 3ZY4A 4C3VA 3GT0A 3KQUA 2J59A 1W0KA 2ZJ7A 3SQOA 1BYIA 3KOMA 3I4CA 4JFAA 3GVXA 2BP7B 3QZUA 1BH6A 4MMYB 7REQA 1SCUA 3M6FA 3C7CB 4G0XA 4ZVTA 3U9TA 3UMBA 3ZI7A 4DCJA 5CFRA 1I4DD 1KSJA 3A4LA 4BNYA 2FKAA 5HIIA 2VDJA 4U63A 1VCHA 1P0CA 3DZCA 4MW5A 1ZCAA 3D6FA 4TMTA 3LT4A 1Y8CA 2O06A 3PFBA 4INOA 3BZBA 1P0QA 1RM5A 2EYUA 4MUBA 4OO3A 4Y2TA 4BCCA 4E11A 3GAZA 4HQNA 3E0XA 2O2SA 2V4ZA 3FCYA 4RETA 4DQKA 4KP7A 1L5GB 2OT3B 1JKXA 1N0WA 4G8BA 5KCMA 4BMCA 1BX3A 4UBIA 3HBJA 1SBYA 5E1OA 4EF6A 1FDUA 2OXTA 2JARA 2OORA 4OHMA 3WSVA 2DVMA 1ZUNB 2FWAA 2IPNA 1DLIA 1N5RA 3QLEA 1DB3A 1J0DA 4OI0A 4UUQA 1R8XA 5K3EA 4PLYA 4DLUA 3W0LB 3QXGA 4BU1A 3VZCA 1B6SA 4GI1A 2N47A 4GVLA 5LQDA 4IJUA 4G0QA 4HD8A 1GR0A 4JBNA 1YS9A 1NKTA 4LPSA 3VPFA 1EGMB 3NWEA 2G88A 2FSGA 1KOFA 1TMGE 2P67A 4OP2A 3M5WA 1NC3A 4KH1A 1R66A 1X38A 1E69A 3MTIA 2AYXA 5GZ3A 1BZYA 1Z4IA 4O4JA 3AG6A 1ONBA 3EFEA 3I8SA 4UBLA 4YCBA 4FMPA 4AMUA 4AWBA 1PLLA 2JW5A 2JGDA 3NEPX 4V0OA 5C1BA 2H1WA 3D5TA 4D44A 1E7WA 4UTOA 3KTAA 2SBTA 1Z6PA 3L43A 4WXYB 5JWHA 3UB2A 4ENWA 3R3SA 2ACVA 3DNFA 3JWHA 3EFOA 4PAMA 3N87A 1YJAA 5K45A 3U62A 1J8YF 2BGTA 1EZ4A 4G5RA 4Z4FA 2VNAA 4HNTA 2ZVJA 3LC7O 5AVOA 5TQ2A 5BW5A 5K2MA 2HA5A 1Q0HA 3AT1A 2PJRA 3DZBA 5IC6A 4QFDA 1IJBA 4PBTA 2CF6A 1X1RA 3GRVA 4OQEA 5FXMA 5THQA 2BMWA 2ZRHA 3T7RA 1OBFO 1SC9A 1TM5E 3HVHA 2ISQA 3WLNA 3HA7A 4L6AA 2J5XA 3KOXA 5EMJA 5C51B 2HWKA 1YR6A 5B7PA 4MIOA 2MSEB 4PM4A 1Z29A 1LS1A 2WKQA 3CS3A 4IIXA 4UCXA 4YAOA 5A2GA 3BZUA 3CVVA 3IA7A 5CX1B 2GBLC 4IDAA 1E3WB 1T6XA 5IPFA 3R3UA 1YR3A 1DFGA 1K5PA 1N3IA 4QBFA 3VOSA 3B5IA 1HTBA 3SEAA 2B1QA 1IHDA 1EQUA 3JAWA 1N2OA 4O4IF 3GJ0A 5MN6A 3HM9A 3PFNA 4BRSA 1A7UA 2VP5A 2X19A 3O1HB 1ZIPA 4DCOA 4PYRA 3L7DA 4BYMA 4EYSA 1R9JA 2EW1A 1FVXA 1W94A 3FSJX 3K1JA 4XM0A 3STYA 1UJNA 1Q7CA 2GM5A 5KX5F 2VTVA 3HBNA 4QG3A 1UEJA 1T9ZA 4R2WA 1SVUA 4QQ8A 2A5JA 1IIRA 1JYEA 3PSAA 3P0HA 4BS9A 4CGYA 2XRZA 3T7CA 2IQ5A 5UKDA 4MV9A 1NMXA 5C81A 3BHMA 2IPMA 3NAMA 3VKUA 1NAIA 1S1CA 4JA2A 4YI5A 3L06A 4JROA 4J0JA 2JLYA 3QKUA 1NATA 2WE7A 2GN1A 3INTA 1RI5A 4CPDA 3EXEA 2DTEA 3HCAA 4ZV9A 4PLZA 4AWAA 5I4IA 5TPWB 2HJVA 2DBYA 4WV3A 4ZQBA 3UF0A 3U16A 1CYEA 2AD5A 3STHA 4BLWA 2G4LA 3GPCA 1NRIA 1U3FA 3GJTA 3ZD7A 1CE8A 1JNYA 2GOYA 5AW5A 3WYEA 1TEXA 1XZGA 1VRVA 2WA1A 3B20A 3FPSA 3I4LA 4O2AF 5KWIA 3DGFC 1I2ZA 3HDHA 3R1IA 2XNDA 2Y0DA 4LRTB 2V59A 5DYTA 2DBQA 5E7IA 3W90A 1HOXA 5JQGF 1VTKA 4HF7A 3JW8A 4YJ2A 2I4RA 1SXJC 2JFWA 5CB4A 1NN3A 3VHLB 3HP7A 4Z4IA 1IC6A 2QIOA 3SY8A 5FWXB 4YMVA 1VL2A 3RSHA 5JMOA 2DHCA 1FS6A 4NATA 4YQEA 2WT4A 2XF2A 4RKFA 4A2CA 3COZA 4MVJF 2NU9B 1EWQA 4DLXA 1FTYA 1HE2A 1G1MA 2P4SA 3MWDA 4FHDA 5ALRA 3RJMA 3BMCA 2PUGA 1QAOA 5TGTA 5LB2A 1NV9A 4CM3A 3R40A 4GW3A 3SSOA 2BZGA 2PGIA 3NDRA 1PV1A 3OPVA 5DI3A 4J2HA 4NCJA 1VSBA 1G2OA 1AD2A 2GEUA 3U9LA 4AZ3B 4C2AA 1BCRB 5B4VA 1Z0KA 5C8VA 4QC2A 3GBSA 2NV2B 1AUPA 2W11A 5A6VA 3SC6A 4BKPA 4BE4A 3KV1A 2NSDA 1H23A 1LV7A 2M1ZA 1Y7LA 2DQYA 1T6YA 2HR1A 1G6KA 3ND5A 1L4FA 2G1JA 3SC3A 2EWWA 1KQFA 5DF1A 4C3UA 1Z8DA 2JHGA 1JFSA 4UAJA 3ZK9A 1EM8B 1JG1A 3H11B 2D1YA 1SKYE 3CLTD 3NHRA 1UFVA 2ODNA 3SR0A 5CCBA 4OMDA 1FNSA 1QIGA 3H2IA 2SCUA 4D8XA 3EUWA 4HEJA 3G6WA 3B48A 3SQLA 3QVVA 2C99A 4TPKA 2Q5IA 3T61A 4XE5A 1OU0A 3I9JA 4EPVA 1A8QA 4L15A 4EGQA 2ERYA 4ETNA 4R68A 4YACA 3TYXA 4ZCTA 2C8VA 4J76A 1QS0A 3DDWA 4NYMR 4P5DA 5F9HA 4HLDA 4LKRA 1SKYB 3E7XA 3DEAA 5I4CA 3L8GA 5ESRA 4W1SA 5T4EA 3TLMA 2OCLA 3MT7A 1Y1QA 4B3SB 2PL1A 4HAXA 5LKRA 3UB3A 1YS6A 3UB4A 3KYDB 3WK6A 1XZDA 4F6LA 2QZJA 3DO8A 3TQSA 2VTBA 1QHHB 3O8BA 2HMTA 1XQYA 3FPGA 2NW6A 1ESEA 1W2WB 2OKCA 4QUAA 1JDNA 3NOQA 1A9QA 3OAAA 3QQPA 4DDWA 1KIMA 4M9UA 1JALA 3W04A 2HLPA 1E0KA 3JAMA 5BSKA 3GUZA 2CL5A 3BWMA 1FNCA 1PKEA 2B78A 3JZMA 3NHJA 3QELA 4IVPA 3HFSA 1IJKA 4LFCB 2FFHA 4U0KA 5BSTA 1K0FA 1FDOA 1XJ5A 3FG9A 4DMCA 4YDQA 3T9BA 5IF3A 5KYWA 1GLVA 5FV7A 3TS1A 2QWXA 1ZI9A 2IXDA 1VE9A 2PSHA 4KKVA 5JPDA 3PIDA 3SS8A 4R8RA 1ZBDA 3VU3A 1R6VA 3SP1A 3HRIA 5CXXA 1UQUA 2PUHA 3IOMA 2FMTA 3WLSA 3EEIA 4DIBA 3WK4A 2AF4C 3O4JA 4CTJA 1L5VA 1JLMA 4P9NA 4IIVA 3O0DA 2JFOA 3NTLA 5DW3A 2BM9A 1ESNA 3HVKA 4GECA 3PNBA 4PIMA 5EOVA 1E61A 3A28A 3A7EA 4I4TA 1NVTA 1FUUA 1KI2A 2H5EA 2TMDA 3FCSB 3OM9A 4HQFA 1DAEA 3L4BC 4QGHA 5KKNB 1DJPA 2XQFA 3B2NA 3HWWA 5A3SA 2X8LA 1VG1A 1KDZA 1R4MA 3K9BA 4GOKA 5C5IA 2IKQA 3C7AA 1WPQA 3IBSA 3RE1A 2JZOA 4RELA 1KJIA 3H75A 2O2JA 4K05A 4Z7NB 2VPZA 3LX6A 3NB0A 4ZWNA 3P2KA 1VGVA 3PC8C 4Q01A 3S2EA 1ZISA 3ENKA 3B6IA 5CM9C 3UICA 1H5UA 1XU9A 3VGJA 3VMFA 3MW8A 5M29A 1E3QA 4YASA 3S40A 1VDMA 1YFZA 3K70D 2MJLA 4KR9A 1T8UA 3V46A 4D0LB 4DA9A 2Z0MA 1T1IA 1TIBA 5IKOA 3C74A 1Y89A 2UVQA 5EE3A 1Y5NA 3RTGA 4KXNA 5CA1F 1JAXA 2J4FA 4N12A 1Y48E 3SC4A 1D2MA 2DFPA 2BKAA 3CKMA 1XF1A 1GG9A 1NI4A 2PX5A 1CRZA 3DT8A 3DLBA 1NBHA 3F1KA 3NUZA 2FSSA 4TV9B 4HMOA 4CXMA 3WQRA 3LY8A 3T1TA 3E05A 1I7LA 3FF4A 3SX4A 3CUVA 2GPYA 2R96A 3JZAA 3OY7A 4ALMA 3QWAA 5JBQA 3OQOA 4K87A 4RA6A 4W5OA 4IVRA 4RF4A 3K72B 1ODSA 2PU7A 4RU1A 5JSUA 1OT5A 4AURA 4TYWA 1QP4A 2YXNA 3KJGA 4I4NA 1Q1ZA 1CUVA 5AD1A 3KQNA 9MHTA 2E1PA 6LDHA 4L28A 2VF7A 1LQ2A 3B3AA 4TV8B 4V0KA 3ESXA 1C7RA 5HKAA 1JIJA 4RH1A 1Y3BE 1E5XA 3CKYA 3GRCA 4OAOA 3CVJA 2X0DA 3VR0A 1USKA 2XKJE 3TGPA 4YQYA 1SURA 5FOWA 3R8FA 2D2IA 3H2YA 1RACA 3AJAA 3IVCA 3QYJA 4CL8A 1RLUA 1B26A 3CSSA 1YI0A 2VZLA 2IX9A 5L40A 2VTDA 2WM9B 2WSMA 1XVUA 2PSJA 2QMQA 1UKCA 1MGPA 4RVUA 4UM9B 3FMOB 4EVIA 1ESMA 3DKVA 3DR5A 4V0RA 2VO1A 4LXUA 1TO6A 1VHLA 3GLHE 3M9WA 4JGGA 4JJGA 4B48A 4JA0A 1SQGA 3H97A 2PX2A 1C7JA 5ALQA 4MIYA 1GZ6A 1XLTC 1UDXA 2CHUA 1J33A 2JGAA 3L8HA 3ZJ4A 3N0WA 3NORA 4S05A 5K6AC 3NRBA 1TPZA 2BELA 4X54A 5C1PA 1VPLA 1XAHA 4DEXA 2IL1A 3GRFA 4GL4A 1JBEA 3JATB 3LPNA 1O95D 5CLIA 5CLHA 3OX1A 1MOQA 1ZW1A 3UUFA 2UUAB 4JXZA 3QEJA 1OA0A 2QP9X 3LF2A 5FO1A 3RHSA 3NASA 1Y9AA 4IQGA 3JRXA 4C87A 5LQCA 1BVHA 3GLHB 2FUG1 2ZIFA 2ZJ6A 3D2BA 2DHQA 3PKZA 3T3GA 1HOTA 1RXIA 4CQMA 3FZEA 1P5ZB 1WL8A 3NWOA 3U7QB 4N82A 1BE8A 5JS8A 4EYGA 1PK9A 1EFHA 4V02A 1NJ6A 2F2TA 4OQQA 1ABFA 1U2ZA 3OI7A 5B3AA 4FE4A 4ARAA 1U7TA 3AF4A 1XPUA 4O4LA 3DBLA 1D6NA 2PMEA 4ABYA 3N8HA 4OATA 4EJMA 1Y5MA 2R0QC 4R2XA 4GX2A 2MSWA 1RYZA 1GM5A 1I6MA 5FPYA 4KPUA 3KD2A 3VNAA 2CGEA 3GP8A 4PXYA 3CNQS 5C4GB 1AQNA 2EJWA 1MOPA 3BERA 2AF3C 2NT4A 2Q3FA 2JDIA 1AX9A 2DFDA 1S2LA 3LGSA 4O6VA 4Q1VA 4YBRA 3PTLA 5F23A 3RK4A 4CQLB 3ND9A 1SN7A 3NHKA 4YQZA 1HMPA 3SJAA 3H5NA 4OQXA 1K4YA 5AVJA 1XHEA 3OOHA 2JEZA 5H3LA 4NTZA 1JR6A 4N40A 4UDYX 4UEKA 2H2WA 2B3DA 4U4AA 4LRUA 5KYGA 5H5JA 5L53A 1E1MA 3UQYS 5L4NA 1QQ5A 3FYHA 3WFZA 4BECA 1Q7EA 3Q7RA 4YB8A 1M66A 3N28A 1NWCA 1KQGA 1PL7A 1F0YA 2EL7A 3K9QO 1EXNA 4C7VA 3MBOA 3VH4A 4B0OA 5IUJC 4TXHA 4F45A 1H05A 2R25B 3B6JA 3AY0A 3BHJA 2PUTA 4IMIB 2K5UA 3GGPA 4MV8A 4RK7A 1MGOA 1NUPA 4W9RA 3VUFA 1YJQA 3KHUA 4G1FA 2GXAA 4MR9B 2FF7A 2H4FA 3GFQA 3X1XA 1Y8ZA 2C31A 3DBOB 2XJ9A 2WW8A 3L7JA 3MGKA 3O93A 3FPFA 1M7HA 1M8KA 3GJ3A 3ZGZA 2A8YA 4LTMA 1D0SA 1DZ3A 1MJ5A 4ZI5A 2Q6KA 2X2FA 1F12A 1H0KA 3TJMA 2ON6A 2M6SA 2R7AA 1GNLA 1Y3AA 3GG9A 4IV0A 1RT9A 3M33A 4US2R 1J5EB 2A7XA 3BJZA 4HUQB 2B4QA 4IJMA 2C61A 5B53A 3RWBA 1PG5A 1YBAA 4LMPA 5CDYA 2O8CB 3IP6A 3JARB 1TVCA 1RWPA 2PU5A 3OJFA 3PX3A 4FZ3A 4JOBA 4ND1A 2D2XA 3B38A 1FDIA 4G26A 4J1TC 3UK1A 3HB9A 3PDHA 2DTXA 3QBDA 3WGLA 1V7QA 2E49A 5FFNA 4ND5A 2YYAA 1J20A 3BF7A 4DEVA 3C41J 3RVMA 3LECA 3U1VA 3T1NA 4TTTS 2XD4A 4Y2QA 3RTDA 4DCSA 3FNEA 3RYCA 1ZGAA 2PTHA 2ZAOA 3G8DA 1YZQA 1I9CA 3D4BA 3QJGA 1RD4A 5HWSA 5M7EA 1KFJB 1A69A 1I30A 1VPVA 2A57A 4KR7A 2A2ZA 2IWRA 3CF0A 4MRMA 4KR6A 1RPNA 3SYLA 3CCCA 4DWWA 1CNFA 3BKWA 4RUKA 2QMEA 4PG6A 4OUDB 4B87A 3GLIA 3DFMA 1VZ2A 2IE8A 4ZOBA 3LA8A 3JD3A 2G04A 4IIYA 1N34B 3DMTA 3SU8A 4IINA 3I1JA 1ZI8A 1KH2A 3ZXXA 1K98A 1QQ7A 2JCBA 3NATA 3WYAA 1DL5A 1DARA 2V5VA 5KHLB 5EJ4A 1VCMA 3ADPA 4D4LA 1FNNA 4NU8X 3I5XA 4F1KA 3FPCA 2RH4A 3AQIA 3JQDA 4MPDA 4WOCA 3U7EB 4CNBA 3RYFA 2G9UA 3RJTA 3OD1A 3L0ZA 1T2VA 4DZZA 3K92A 3VNQA 2XCTB 1AQYA 3JD2A 4ARZA 1ABEA 3PS9A 1I5OA 3OE7A 4GXQA 3W5AA 4M1YA 1NW4A 4BB6A 1ECLA 5D3QA 3ZIAD 2CD7A 2D0DA 4M2LA 1AVTA 5FQNA 4OQ4A 2R62A 4ZYYA 2BI4A 2QAGA 4R69A 4UMVA 3A1CA 3HDYA 4H27A 3TFOA 3FWNA 4RK6A 3RU2A 5F51A 2VAVA 1L7QA 1ORDA 3FZNA 3SSAA 4BTVA 5KI6A 1YQDA 3PQEA 1W9HA 2O0KA 3WVNA 2GR9A 1E1DA 3WO0A 3KSAC 1P72A 4HS9A 1GA4A 3OLCX 4YMTA 5JS1A 5C80A 1OXXK 1UXIA 3PNYA 4E15A 4RJJA 2QTVA 3QUBA 1M0EA 1AOXA 4PYMA 4HXEB 1MUUA 3D4PA 1MNAA 4Q7KA 4BNVA 5FEUA 4BAUA 5E6UA 2E37A 1DQZA 4JLDA 4TS4A 4E21A 1KQNA 1ZXBA 1BSVA 1EZZA 1E9RA 5A4DA 1NJ1A 4L7VA 3RC7A 1SU6A 2F64A 4KAXA 5CLGA 5AKXA 3AK4A 3W1WA 2VCYA 1JR4A 5TVGA 1B6RA 1LS6A 2VDQB 3Q0EA 3K0AB 3BWVA 4BO8A 4K2HA 4BNMA 1HRDA 4WADA 3PC6A 3O2SB 4PLGA 4QGAA 4OX9B 1RYMA 5C7YA 2OHIA 1CNMA 4MV6A 5ALJA 1S2IA 2YINC 3DWIA 3QYFA 4BQOA 2XYVA 5EKTA 3RC1A 1BQEA 2A0YA 3ETGA 1ZOIA 2JJ1A 4E22A 1XTRA 1D6MA 2J3EA 3PRKE 4OJYA 2HBYA 4Q82A 4GMFA 2C5LA 3GZNA 3SI7A 3A9CA 2VSFA 3I0MA 1TE2A 1CR4A 2Y76A 3DEKA 1NVGA 3H9GA 3P9YA 4HZGA 4KOAA 3K71B 4TWIA 3TZKA 5DYWA 5A6SA 1R3DA 4M1OA 4NMXB 2EW2A 1TTHA 4GVPA 1EGHA 2B3TA 4YMIA 3AOGA 3N70A 2V1XA 3RU7A 2MT9A 4RF5A 3MXOA 4WKOA 1JA1A 3EXHC 3BPSA 3EWSA 4FKBA 1ULBA 1CJUC 3NJ4A 4IJ6A 3LI2A 2HSZA 4BNTA 1IZZA 4ARSA 5G0TA 3O75A 3ZD8A 3EZYA 4NYJR 2RHLA 1Y6RA 4XJXA 2BGMA 1CR2A 2WAMA 4YHHB 2D74A 5HRCA 3NT2A 4D8YA 3S1AA 4Q3LA 4P36A 3OX3A 1TGVA 4M8LA 4BBPA 2UUBB 2AOUB 3GOHA 2BFPA 5FWDA 5AHWA 5EJ9A 1JSLA 2PD6A 4A5OA 2DBVO 3B12A 1V35A 3N8NA 1VJDA 1JHPA 2QRNA 1ZQ9A 3HABA 4YBZA 2X14A 4HFNA 3LPDA 2VG8A 4D9NA 3EVEA 2IEIA 3GFBA 1DKLA 3KXDA 3OEWA 3OZBA 3QWFA 4YJ3A 3W6NA 1EDZA 1O9BA 3R6LA 2YRWA 1YDWA 3OM1A 3I6ZA 1QMGA 1IM5A 3ZJUA 4YJFA 4XJTA 3NJRA 1Q16A 2C54A 4EPRA 1Q0QA 2RG7A 2XNJA 5JVDA 4FSHA 4HAUA 1OJ7A 4UNSA 2H51A 4NU5A 2GTIA 3WC4A 2HD4A 1DRWA 3SSMA 1SXJD 4GICA 1JHUA 5C18A 3CPEA 2Q5OA 3ZDQA 3JD1A 1GEGA 3FWPA 2Q9AA 1LBHA 2XOKD 3KFVA 4YP7A 1OUMA 4NYMQ 2I4OA 1Z63A 1Z2PX 1G1AA 2AFHE 5EJ8A 3O3CA 3VAZA 2FGKA 4MP8A 1CFZA 4N01A 1KMCA 3GJ8A 3KZNA 2VYND 5JD3A 4BEJA 1NLZA 4KQEA 4LNAA 2ZTLA 3B5JA 2HNAA 3OZCA 1MOZA 2WTAA 4H3SA 4KE7A 4BKQA 3WMWA 3EEQA 3PHJA 2ZUTA 1CUFA 4JITA 1XDDA 3RVPA 1P5HA 1XLVA 1YS4A 2AFHB 3IVGA 1L4YA 5BSRA 4GX0A 1R74A 2DH5A 2XOEA 1JIQA 3DXYA 1UXKA 3HDQA 2HT1A 4ZU3A 1KE2A 4M9QA 3DXFA 2DXIA 4TZ0A 2FLKA 4QOGA 4RMIA 4WK2B 2WTUA 2CNBA 1L6IA 4N6OA 4F3KA 3IPRA 1J90A 4J29A 1MR3F 1X0VA 2XKAA 4KTTE 3EVTA 2FPOA 2BUAA 3NEAA 2QPOA 3HJTA 1WD5A 1ISRA 2Q07A 3R7BA 1CUGA 3R6TA 4NAUA 8MHTA 3BD9A 4BBZA 1A9OA 5KSWB 2CL6X 4OXXA 1IXKA 5FQOA 3GY0A 4ZVPA