4CM8A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 94
structure length 249
sequence length 267
chains with identical sequence C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm8A00
1MUUA 4JGBA 1P74A 1M75A 4EJ0A 1M76A 3LF1A 3EGOA 4Q39A 3ZW9A 1GQQA 1KC1A 1ZK2A 2EERA 3F1LA 1I30A 5F3RA 1BWSA 2VNSA 5B4UA 4IZIA 4AJ2A 5COAA 1ENPA 2P9CA 2IYPA 2JD2A 1N1EA 4MINA 3JCZA 2ET6A 3JD4A 1SB9A 3EY4A 1LU9A 4RF2A 2ZYDA 1NHWA 3HB4X 3AI1A 1KEPA 1I36A 2OBYA 2UYYA 4CM4A 2IYOA 1LDEA 2Q3EA 1P1KA 1K89A 4MJLA 3WNQA 4I9UA 4N5NA 4MKXA 1LDNA 4J1TA 2BFOA 3JQ9C 4PG4A 1NVMB 1VJ0A 3AI2A 3GVHA 1NPDA 4NBTA 1PL8A 4PVCA 3I9MA 3M1LA 4NFYA 2ZYGA 2Y1CA 4XCVA 4P4NA 1Z73A 3ZWOA 1I8TA 1N2SA 3QQPA 5A9RA 1Q0QA 1J6UA 3TQHA 2ZK7A 1GZ3A 3BTUA 1P3DA 4RF5A 3SLKA 3DAPA 1E7RA 3G17A 3N7UA 3RKRA 4G65A 1RPNA 4BNVA 1RM3A 1PS0A 1R4NB 5HRUA 1K6IA 2JHFA 3KO8A 1Q1NA 4Z0HO 4O0LA 1ISJA 4K6CA 1TLTA 1IZ9A 1LDMA 1IHXA 2EIHA 4X54A 5ITWA 1FDSA 1P33A 4YT5A 1UP7A 4PLTA 4DLAA 1BXZA 1EE9A 1EE2A 1I33A 1ZXBA 1PGOA 5FFFA 4BNFA 4E0BA 3TRIA 5KKCA 1TA4A 4F3YA 2X9GA 1T25A 1JWAB 1KY5A 1LX6A 4HWKA 3RC1A 4BKOA 3B1FA 4R69A 5JFOA 4RO0A 2D0IA 1BDMA 4XRGA 2FMUA 3DZBA 4HY3A 4QXMA 5B4VA 2P2SA 2OP1A 2YFHA 4I8XA 3CUKA 1A72A 4RQUA 5ILOA 3IL2A 4IQ0A 5JSFA 2JL1A 1NP3A 2EW8A 4HFRA 2V65A 1LRKA 3M2PA 5IDWA 2VQ3A 1Y8RA 5B4TA 4BGUA 3HDJA 3M6IA 3CSDA 1QLJA 3JQ8B 4NH4A 2P91A 3GF4A 1LSOA 3GY0A 1A4UA 4CR8A 4C7JA 3D1LA 4NBVA 2AW5A 5I7VA 4E2YA 2QRLA 5TX7A 4PLGA 1F8GA 2HMVA 4OHUA 1AUPA 3PZRA 4OSPA 4TRRA 3S8MA 3OJEA 4DQUA 1GADO 2PLAA 4MP8A 1Y81A 4XGIA 4YAEA 1W4ZA 3ASVA 3BXXA 4E21A 1QLHA 3CMCO 3QWAA 4GX2A 2GN8A 3WOHA 5DP2A 3OFSA 4NBWA 1Q7BA 3UUWA 4LCEA 1F06A 4M86A 1XHLA 4KWIA 1VM6A 2P68A 4ZN6A 1LQUA 3PIIA 2J8ZA 5CFZA 1DRUA 4DBZA 2DFVA 1DO8A 3INRA 3QRWA 4FJ0A 4RPLA 4CL8A 2OMEA 3VH2A 2D1YA 4EGFA 5JDCC 1D7OA 1PGQA 3UW3A 1LLDA 3KOUA 3ETDA 4BQRA 2AEJA 4XQGA 3DZFA 5MGBA 3AM5A 4B4WA 3ZWVA 3L07A 1QR6A 2CUKA 3GEGA 2WSBA 2H5LA 4TKLA 5JPIA 4KQXA 1UAYA 3ZZNA 3GVXA 2EP7A 4J2HA 3CKYA 4YVFA 4GKVA 4YJDA 1P1JA 2CD9A 4CMIB 2GO1A 4KMSA 4AL4A 2Y99A 4IJKA 3AFMA 4MVJF 4AJIA 4J0FA 2EP5A 3VPXA 2X5OA 1B3RA 2EWMA 5LDGA 4BNKA 3PWSA 3BMCA 3RIHA 4BKQA 4BO0A 3SVTA 2QX7A 1NR7A 3Q9NA 2YUTA 3OSUA 2HAEA 3R0IA 3WYCA 4RVSA 3F47A 3X2FA 5CEJA 4FFPA 5IXSA 3H9GA 2GN6A 3LC7O 2I3AA 3W8EA 1GEGA 4BKUA 3PJFA 3S55A 3ZW8A 4DBVO 3UCXA 4JJFA 4JJGA 2D59A 4A27A 4QQRA 1QG6A 2DAPA 3GH3A 4PLCA 3RWBA 1O89A 2J5QA 2VWPA 3AOGA 3GZ4A 4RV9A 1Y8QB 2J6IA 2PWZA 4K26A 2P5UA 2Q4BA 1FMCA 2VRCD 2A92A 4RZIA 3A14A 2PTGA 2B83A 5MDHA 4KWHA 4PIVA 2D8AA 4H15A 2EKPA 1PGPA 1RM4A 3DXFA 1AN9A 3NTRA 5T5QA 4NK5A 1B7GO 4WKGA 1G0NA 3PZBA 5TRTA 4TWRA 3VZQA 4J1QA 2WYVA 4R01A 3GAZA 1ZEJA 4JJIA 4WLUA 2DFDA 3VDRA 1X7GA 2G1UA 3L6EA 4E5MA 1LDYA 4CLOB 4A10A 3KETA 4WNCA 1MP0A 4LVUA 4XYGA 1T1RA 2XAAA 4TRMA 4J4BA 3AI3A 5CDSA 1KBZA 4MP3A 3NUGA 2JAHA 1ZXLA 4W9NA 1TI7A 4CMIA 4BNNA 2P4QA 1M66A 1Y5RA 3FTPA 1IHYA 1XCBA 2DPHA 2VN8A 3KYCB 4WOKA 2NU8A 4A0SA 1PS8A 5C3MA 4AJHA 3VZPA 2C20A 1NQOA 1PJSA 3ENKA 4J7CA 4M55A 4UEKA 1QORA 2BELA 4NDNE 5COBA 3U4HA 3OM9A 4ZRMA 6ADHA 1VSUA 4WLFA 4BO6A 3WFJA 2YY7A 1LLCA 2B35A 4W4TA 2GN4A 1L7DA 1R0KA 1WMAA 2I65A 2QZZA 4CLRB 3WGIA 3AOEC 1KVQA 1DIHA 3E5MA 4GAEA 3UCFA 1JVSA 3NDIA 3UXYA 4BNUA 2C59A 1PWZA 2ZCUA 3WLEA 2PY6A 3I6QA 4OJNA 1YQGA 3VVBA 1Q7GA 5CHEA 3FBGA 3BA1A 4GX1A 4CM9A 1O8CA 4OKNA 3RFXA 3MJCA 1SBYA 4HXYA 1PZGA 1OI7A 1U4SA 5G0SA 3GMSA 3DOJA 1DLJA 2OBNA 5KOIA 1YL6A 1EMDA 3A28A 4BMSA 3PPIA 1OZAA 1K0UA 1YQDA 1PIWA 3QE3A 5KVVA 4FBGA 1ISHA 1YDEA 2X22A 1ZO8A 5AXAA 2GR9A 2BKAA 4GLLA 4RGBA 1GY8A 2YQ5A 4OL9A 1DFGA 3T4EA 1CETA 1HZZA 4P22A 4CLHA 4CMCA 1YBAA 1UDBA 5DULA 2QYTA 2Q2WA 1FXSA 3JYPA 2C7GA 2XXBA 3WQSB 2ZIZA 4ZA2A 3V1YA 5JC8A 4Q3AA 3Q0EA 4JP2A 3AWDA 3PQDA 2DPGA 2HLPA 4JNKA 2AEFA 3L4SO 3N74A 1GYRA 2XXJA 4XZ3A 3PDUA 3DFZA 3JYLA 1U5AA 1SO8A 1UXHA 3C8MA 3GNQA 4FIZA 4ZHSA 3E8XA 3FWNA 4RVGA 3VHRA 2JAPA 1NQTA 3P19A 4ITUA 3D4NA 3RFTA 4B3HA 3ZWMA 3KEQA 1HT0A 2W4QA 2YQ4A 1HE2A 3JQ9A 3DMTC 3BTOA 4ZD6A 4RPGA 1V3UA 4CLRA 1JKIA 1VJ1A 4FJ2A 2Y1EA 2Y0EA 4BNWA 2UUOA 5KJEA 1LSJA 1DFHA 3C1OA 2W2KB 5L7WA 1CEQA 4L4SA 5CPBA 3DWFA 4WNIA 1ZZEA 3C85A 1T4BA 3PHHA 5IG2A 1TT5A 1PJ4A 4Y8VA 4B7UA 4WASA 3TZQA 2VHYA 1XU7A 1DFIA 1P1HA 1QYDA 2BH9A 1WWKA 4OQYA 4IXTA 2OL4A 2VTEA 3WMWA 2NLOA 3F4LA 3EW7A 3G79A 3JQFC 3RCBA 3K73O 3WYEA 3C1TA 4IDEA 3KSUA 1QYCA 4QFDA 1YOVB 4RDIA 4L9RA 4DQVA 2FHSA 3VZSA 4FFRA 2AXQA 1R4MB 4R51A 1EQUA 3GLQA 4IJVA 5A5FA 1WZIA 2HCTA 5JY6A 1IYZA 3HHPA 3HFSA 4OO3A 3PHJA 1T2CA 5A4DA 4Y67A 3GUCA 1I3MA 3RJ9A 3GMDA 2F1KA 4YCAA 5GZ6A 4PLWA 2RBEA 4BO7A 2JD0A 1B8VA 3GDGA 3MJVA 5KWEA 5DOZA 2CMDA 3FN4A 2W90A 1DC6A 1CERA 4J1NA 5L7TA 1XELA 2R2GA 5ADHA 1UXGA 3OETA 2IXAA 3PI7A 5DOVA 1ZK1A 1I01A 4WLNA 2FZWA 3RUEA 4WEQA 5JAQA 1PJTA 3LC1O 4WLOA 4OMUA 4Z9FA 5IZ4A 3D4PA 3FPCA 4R3WA 1U3UA 3RD5A 2SCUA 3GEMA 5DT9A 1TVEA 1DIBA 3H2SA 3U3XA 3V2UA 2WTBA 4CM8A 4AFNA 1Z82A 1ZJZA 2H1SA 1SCUA 1WDKA 3D7LA 3GVCA 2W2KA 3LF2A 1DC5A 4IDAA 1YVEI 5EESA 1P9LA 5U4QA 2PZMA 3WTBA 1LQTA 2EW2A 4WUVA 4IIUA 1VI2A 2PH5A 3H8VA 5A02A 1R37A 4ZQGA 1GUYA 4U0KA 4IMRA 5TSDA 4CPDA 3EUWA 4KZPA 1XSEA 3WWYA 1JW9B 1VSVA 1XLTA 1JU9A 1C1XA 4S1VA 1A7AA 4XJSA 3GDFA 2NACA 3BMNB 5CG1A 5JDCA 3GZNB 2E49A 2I9PA 4I5EA 3ZV3A 3S2GA 1BVUA 2IE0A 3W1VA 2C0CA 3E82A 1I2ZA 4A7PA 5HS6A 1XA0A 4XB2A 2IODA 1SOWA 5HS4A 5C5IA 1E1KA 4P8RA 4B4UA 4ND4A 3INTA 1KVRA 3ZNNA 4D0RA 4E2ZA 2J3KA 3MOIA 4DQXA 1ZUD1 3EVNA 2OXIA 1J4AA 1ML3A 3BMOA 3EZLA 4J16A 2BFAA 2HJSA 3DBRA 1U2GA 1O0SA 2AQIA 4J7UA 4FN4A 3OIFA 4XYLA 2BGMA 1KYQA 4IDDA 3MJ4A 4XQCA 2Q2QA 3RC7A 1ISIA 3RUIA 5G4LA 5EERA 2DBRA 3ST7A 5CEFA 3AUUA 4DREA 4E2XA 4IDGA 4CM5A 2I5PO 4IGEA 2VHVA 4R1TA 1SNYA 3IC5A 5F1OA 1T4DA 1V6AA 4BS9A 1C1DB 1B8UA 1QYWA 4RLSA 2C7VA 4Q3CA 4WOJA 2GSDA 4YT4A 4YJHB 4ZGWA 3VVCA 4ND3A 3IJPA 3WGZA 2D4AA 4D3DA 4LGVA 5CEEA 3HQ4O 9LDBA 3AFNA 2JCYA 1GPDG 3HDYA 2JKVA 1H6AA 4PLPA 1IPEA 3WSWA 4GQAA 5L51A 1HWYA 1YO6A 1FDTA 3JQAA 4LISA 3S1LA 2YHIA 3H65A 4RF4A 4ALJA 2I3GA 2P9GA 1PR9A 1PWXA 4C4OA 4E2WA 4Z6KA 1P1FA 4EDFA 1GFSA 2NU7A 4L8VA 1YQXA 2EEZA 4ILKA 1NVGA 1BG6A 3MWEB 4JN6B 1DLIA 1PJLA 2D2IA 3AY7A 3GUYA 2VTDA 2NVUA 4PLYA 2C2XA 3HE3A 3K30A 1YE3A 4XRRA 1HDZA 2O3JA 2AQ8A 1YONA 3LT1A 1MXFA 3O8QB 3JV7A 4E13A 3K96A 2ZTUA 4NJMB 2RHCA 1BXGA 4J90A 3H7AA 1GTMA 2GZ2A 4U6QA 1ENYA 4XYBA 3ZU3A 5FI3A 1K6XA 1GZ4A 2VT2A 5JY1A 4Q3DA 2R00C 4YB8A 2WWRA 3DZKA 3WWZA 1V3TA 3VOSA 4QECA 1JAXA 1LA2A 1LDBA 1ZJYA 4R4JA 4DYDA 2ZTMA 3H9EO 5IFLA 4I9NA 2X9NA 2AMFA 3PFWO 3WX0A 4XJTA 2OOSA 4UUNA 3LLSA 1YBMA 4K1LA 5U9CA 1RJWA 4UVGA 4XWYA 1HEUA 2NVWA 3QJ5A 3D3WA 4XA8A 1X14A 3VC7A 2WYUA 5DP1A 3ZHZA 4YAIA 4W99A 5EPOA 4E3ZA 4L0QA 2OO5A 1ZEMA 3IQDB 3P7MA 5F5LA 4YAGA 1N7HA 5A3JA 2PD4A 4E5PA 4I1IA 3DDNA 2O3SA 4XGKA 1UH5A 4ZVVA 3TFOA 4A2CA 3L0DA 5DBFA 2E82A 3KXDA 4EBFA 4OH1A 3RBVA 4PLZA 5GZ3A 4CMAA 2G76A 2A35A 3CPSA 3DTTA 1DXYA 4IS2A 4DC1A 4YACA 4YAKA 4B7CA 1NAHA 2ZB7A 4CUZA 1T1SA 1GV0A 1Y7TA 3TPCA 4YR9A 5JAIA 1MG0A 1QP8A 4PLFA 1W73A 2HJRA 3DC2A 3L9WA 4I08A 3V2GA 1ZW1A 1IUKA 5JYDA 1YGYA 3AK4A 5C7LO 4BIIA 2W98A 2GDZA 1ZSNA 2O4CA 5DCYA 4IINA 3BIOA 3WICA 3E48A 5A06A 1HDYA 4R16A 2B5WA 2HDHA 3DMTA 3NDJA 4WGGA 1Y9EA 3DBLA 3UGKA 3P2OA 1HSZA 1KOLA 4DRYA 4BNMA 2JJYA 1E6UA 1AHHA 4L75A 4J43A 4CMJA 1U7HA 1NBOA 4F6CA 5KJ1A 1CRWG 3GFGA 3GFBA 2GZ3A 3GEDA 3PK0A 3WG9A 1XQ1A 1NTOA 2V6FA 4RPJA 1ADBA 2YZ7A 3D3EA 4AJ1A 1LC0A 3HADA 4A26A 2YJZA 2IZZA 2PFGA 3BAZA 2FRDA 2UV8A 4PG8A 3E03A 4UUMA 1NWHA 3DBHA 3GG2A 5DN9A 5KJCA 3VH3A 3BMQA 3JQFA 3K9QO 1K6JA 1LSSA 1P31A 3FPLA 4K28A 4TVOA 1XIVA 4ND5A 3D64A 3HJAA 5K0ZA 2EGHA 2PNFA 3EVTA 3C7AA 3VTZA 1YBVA 1IB6A 2FOIA 5L4NA 2CZCA 3HSKA 4CM7A 3G1TA 3KSDO 2GZ1A 5G2OA 5A05A 5LDHA 3JQGA 3DZHA 2BLLA 3I52A 1VKNA 4NI5A 3AU8A 4OYRA 1I0ZA 2BRUA 1E7SA 3PGXA 4M89A 4WK6A 4YA6A 4E6PA 3I5MA 1H2BA 2PKQO 3H9QA 1EK5A 1HE4A 2FY8A 3WDSA 3B70A 4DLBA 1ISFA 4E4YA 1EZ4A 2X0NA 4DGSA 3ZU5A 3EK2A 4BB5A 4OM8A 3A9WA 3QVSA 3GOHA 2WMDA 2HRBA 4ONEA 4J91A 4DPLA 3ZV6A 1VRWA 4DA9A 4E5KA 1CIVA 5CPFA 2A9FA 4GBJA 2GF2A 1ZBQA 3BHJA 3K5PA 4FD3A 1BHSA 3JD3A 5T67A 4CODB 1DPGA 1E3LA 1EDZA 1UAGA 2ZB8A 4RCVA 4W82A 2O4UX 1PJQA 1U3WA 1JKJA 3FBTA 2Y05A 3NT5A 3I83A 4BO3A 3DAFA 4WCFC 1FDUA 1PEDA 1SAYA 1B26A 3OIGA 3K8ZA 3SJ7A 1ZMOA 3OQ6A 3UAGA 2BMAA 1ARZA 1QSGA 5KKAA 4M8SA 2BFMA 2OORA 2J5RA 4CMBA 3U4CA 4YT2A 4UEOA 3ADOA 1A7KA 2Q1TA 2BD0A 1C0IA 5AXCA 3HWRA 1H94A 4ZJUA 5JAZA 3IOYA 4BL5A 1VJTA 4ZQBA 3ETEA 3DZJA 3MWDB 4NJOA 1EUDA 3NT4A 2X0IA 4UVIA 4YXFA 2AG5A 5BSFA 1EEHA 3ONFA 1HYEA 2VRCA 3BYZA 3WBFA 3KBOA 1NFFA 3ROKA 3HNPA 3JQCA 3OJFA 4D41A 4CMGA 1W0CA 2C54A 3ENNA 1FDWA 3VDQA 1R4NA 2V6BA 1GAEO 5I8ZA 4GSLA 4YJFB 3I9JA 3KHUA 4HFJA 2CNBA 2C82A 4BV9A 2HSDA 1V35A 1Z75A 3GVIA 3O9ZA 3FNEA 4R3NA 5EIOA 1MXHA 5T8KC 1J0XO 1XEAA 2WJPA 3OJLA 4M87A 2BGLA 1SC6A 3WS7A 3PYLA 5KIAA 1KIFA 1HE5A 5ER6A 1P77A 2X0RA 1ID1A 1N7GA 4I5DA 3NEPX 4IIVA 3AM4A 3VTFA 1JVBA 1EFLA 1PX0A 5G0UA 1DJNA 4YDRA 4II2A 2BHLA 4UUPA 3F5QA 3PP8A 4YEDA 1KEVA 1V3VA 1E3EA 4CMEC 4E5NA 3TZCA 1DOHA 4P38A 4BGIA 4MPDA 1SEPA 4A5OA 1WW8A 2EV9A 3ZI0A 3WR5A 5KTKA 3S2IA 2UDPA 3DONA 3F6YA 3GRKA 1HDOA 3PJEA 3ORFA 1DIRA 1YJ8A 4GVXA 3P5SA 1LLUA 2FWMX 3JQ8A 5AXBA 1UP4A 3GPIA 1LRLA 3GG9A 2JFHA 1P1IA 3BTVA 3RFVA 4PGFA 1ZKMA 4CV1A 3X2EA 4NFHA 1DRWA 4RDHA 1Q0LA 3K2EA 2PZLA 1E7YA 5JW6A 4I5GA 4OXNA 4EJMA 1ZIDA 2ZQZA 2NSDA 4FJ1A 3HZZA 1WPQA 3RUDA 4MVJE 5I7SA 3DTYA 2O48X 1ENZA 2I99A 3ZHYA 3H9UA 4YPOA 4XQ9A 2WEKA 1E0DA 3ZHXA 1YJQA 4Q9NA 3JQBC 3T4XA 1PGNA 3GNTA 2OP0A 1K2WA 1T2DA 1N5DA 1YWGO 4CLEA 4CV0A 4F45A 2WYWA 3ZGYA 4RPKA 5EINA 3VH4A 3PRJA 1T26A 3ITDA 3R3JA 4B3IA 1T2EA 2GERA 4PVDA 3PWKA 4WEOA 4Q3BA 1YB4A 4MVJG 3RC2A 5L53A 3IP1A 4AJKA 4KUHA 3N58A 3UKOA 3KRTA 1R0SA 2OHXA 3QLJA 4YTEA 4RQTA 5T64A 5TJ9A 5U1PA 3RQSA 1DIAA 1CF2O 3SLGA 4XGNA 3NJ8A 5LC1A 1ENOA 3K31A 3GPDG 3OHSX 4CQLB 5CDUA 2G0TA 1IOLA 1PTJA 1C0LA 1O6ZA 3NYWA 4XB1A 2Q1WA 3B20A 1GYPA 1GPJA 3MCVA 1BW9B 2FSVA 1IZ0A 3HG7A 3NRCA 4TSKA 5CDYA 4JROA 1LBEA 4NPCA 1NXQA 1Q7CA 4RPHA 1I24A 3QV1A 3FCOA 5IJZA 2WDZA 4JQCA 3AM3A 2FPIA 1Y8QA 4UREA 3HN7A 2VZ8A 5JMPA 2QYSA 3JQDA 4D42A 2ZJ1A 1U2DA 2DKNA 2UAGA 3DHYA 2GD1O 4Z3DA 2O3RA 3TZKA 4ALMA 4NU5A 1O95A 1BDBA 5F21A 5FI5A 1VPDA 3JYNA 3MJTA 4ZQFA 3BHMA 4WCDA 5ENDA 5KVQA 1R16A 3TOZA 1XR3A 3PXXA 4YJGB 2B37A 1GQYA 5GZ1A 2VUTA 3S2EA 2FR1A 2UUPA 4Z9YA 1KETA 1NHGA 5IN5A 1WZEA 4CLOA 2WD7B 4AJ4A 3JQEA 2FN7A 1Y6JA 3RBZA 3JD1A 1D8AA 1EQ2A 4EI2A 3IP3A 1LNQA 2PH3A 4EUFA 3E9QA 1ADGA 3PTZA 3KYCA 3PQEA 5FYDA 4LN1A 3D5QA 2DVMA 2O3TA 4FOOA 2VOEA 3V2HA 1B3BA 4CQMB 1EUCA 2W8ZA 1MB4A 4CQLA 4BUCA 2B5VA 2HQ1A 4I5FA 4WCFB 8ADHA 3ICCA 5DCUA 1DC4A 1BXKA 4NZ9A 5L4SA 4CM3A 2XPCA 3RU9A 3L6DA 1UP6A 4QSMA 1OAAA 4W7HA 5TF4A 2HK8A 2IZ1A 2WE8A 4O63O 2GGSA 4ROSA 1QXSA 3FI9A 3SC4A 1PL7A 3MZ0A 1A27A 2AG8A 3VZRA 1IE3A 4MP6A 1CJCA 3ZV5A 3PJDA 5ENVA 1X1EA 4CUKA 1MFZA 3SX2A 4AG3A 5I9NA 5AOVA 1PR3A 1NQAO 2QG4A 3IUSA 4K9DA 1DDOA 4KOAA 4N18A 1X0VA 3H3FA 1G6KA 5JCJA 5AYVA 2VNAA 2X8LA 1I2CA 2NU6A 3QHAA 4IZHA 3LK7A 3ADPA 4TVBA 1ZMTA 2Y66A 3FNGA 2C5AA 1A5ZA 5DF1A 3ROPA 2CDBA 3L4BC 4D3FA 3MOGA 3ZU4A 1F12A 2UVDA 1AE1A 4KQWA 3ZCXA 4RZHA 3ABIA 3U0BA 4IGFA 4XDYA 4NQZA 1EFKA 4GPD1 1PQUA 1UXIA 5THQA 4Y6PA 4A73A 2Z1MA 1U8FO 3W4IA 2HMWA 4JP3A 4RVHA 1HZJA 1X13A 1EBFA 3JYOA 4J7XA 3ZN2A 2O50A 1SMKA 3NX4A 4CM6A 3LDHA 3I9KA 3WXBA 1HYGA 3AY6A 3HDQA 1DBVO 4GWGA 4QTZA 3TOXA 2OFPA 2EKQA 2FP4A 3RUFA 5I8WA 3P2YA 2CY0A 3FF4A 1VL8A 3C1AA 4RVFA 4WCFA 4BOYA 1YKFA 3EZYA 1NR1A 2DT5A 5EN4A 3ITKA 5BNFA 1E77A 4HUJA 5THKA 4IDFA 1QYVA 1P44A 4J0EA 3OH8A 1VKOA 2X5KO 3PVZA 3B6ZA 2HO5A 2GPTA 2EXXA 3QIVA 4LRTB 3Q11A 2CVZA 3KSZO 3KYDB 5CAEA 1LUAA 2HMTA 2VT3A 1BGVA 1N92A 4XQEA 5CP8A 2PZKA 3ZNOA 3H6KA 1YL5A 2NQTA 2AE2A 3B1KA 1R6DA 3LT4A 3LU1A 3QA9A 5A3VA 4R5MA 1Q0HA 4GVLA 1J5PA 3PFFA 1ADCA 2CVOA 3ULKA 2Z95A 4EUHA 5ICSA 4Z9XA 2ZTLA 3CE6A 4CLXA 4DC0A 2YW9A 4CLDA 1WLYA 5ES3A 5JCJD 1CQJA 2X7HA 5DBIA 3F3SA 3M1AA 7MDHA 3W8DA 4GMGA 1XDWA 5B12A 2IEDA 3NJ4A 1MA0A 5GMOA 4AJPA 1HYHA 5T8KA 2CDCA 1YOVA 2Y1DA 4KDFA 2DTXA 3RC9A 4B8WA 1ULUA 2B0JA 4YRDA 4YRBA 1HETA 5J23A 2WD8A 3E6AA 1R4MA 3WQRA 4B7XA 2CFCA 1EVIA 2PGLA 4F6LA 2D3TA 1V8BA 2JFGA 1D1SA 1KS9A 3RI3A 4B4OA 1E1NA 2WM3A 2I76A 3DZIA 1M6WA 3Q3CA 3RAJA 4RF3A 3UF0A 4FPXA 1OC4A 2AEMA 4DTIA 2VWQA 4GGOA 4R68A 3AUTA 4EW6A 4PZCA 5I7EA 3LT2A 1IULA 5H83A 5C7IO 3S2FA 3VAZA 3GT0A 3FTNA 3IUPA 3JSAA 1V9LA 3KZVA 2I67A 1FF9A 5EQFA 2HK7A 3ZWYA 3PYXA 2Q46A 4CQMD 3Q6IA 4Z3KA 5A1TA 1ZH8A 3W4KA 2EGGA 4QT0A 3MEQA 4YQYA 4DLLA 3H9JA 4FFOA 3T7EA 4YWJA 4BKRA 5JC1A 2O2YA 3SXPA 5ITVA 4PG7A 2Q50A 4NG5A 3WIDA 4IXWA 3GGOA 3GK3A 5IDXA 1QKIA 2F00A 3ZHBA 3CIFA 2VZ9A 3O38A 3QWBA 4BO4A 3G49A 1XQ6A 3OEYA 4C7KA 4YAJA 1R15A 4BKPA 3DEYX 3DHNA 4DPKA 3QP9A 4Z0TA 4R1NA 3QWIA 1UDAA 2B4QA 4B79A 1RM5A 2NVBA 2JD1A 1LEHA 4ZQHA 3I4CA 3ZWXA 5BSGA 3KM0A 2BGKA 1D4FA 5G4KB 5G0VA 3QWHA 3BMNA 3JQBA 1M6HA 1NAIA 3GZNA 2XF8A 3WIEA 1JAYA 2JCXA 4AJJA 4FFNA 5HTOA 4W7IA 4XYMA 1U7TA 1HKUA 1RKXA 5L7YA 1YRLA 3ZWPA 1XYGA 2EKLA 3OIDA 2PGJA 2B36A 5L3ZA 2I66A 5JLAA 5EL0A 3L9XA 1QRRA 2Z5LA 4MIOA 4UUOA 3RBXA 5TIIA 2X86A 3PHIA 1E5QA 9LDTA 3PJGA 4O59O 1JN0A 4JBIA 3EMKA 4BNGA 3LLVA 3MTGA 1U5CA 4MVJI 4TRNA 3INGA 1WVGA 3EC7A 3Q1LA 2Q4EA 2PK3A 2YFQA 2NTNA 2FR8A 4GSKA 2OUIA 2GCGA 2YDXA 4TZTA 3F4BA 1P1RA 4UAGA 4BVAA 1CDOA 3LQFA 1E3WB 2Q99A 1C1DA 1B0AA 3E9NA 3WQQA 3BHIA 3Q2KA 3R1IA 4IJUA 4YJHA 3AOEA 3H5RA 4NNJA 2J3HA 1F14A 3AUSA 1H6CA 1O94A 1S7CA 2EG9A 2FR0A 4GGPA 3VPSA 4HNHA 4LVCA 4NHEA 5L4LA 3QWFA 4BO5A 2PKQP 3NDRA 1DAPA 3RKUA 3WSVA 4PFJA 1M67A 2RCYA 4H7PA 3UVEA 4LW8A 4YQZA 5B1YA 1UR5A 3GN1A 5EJ2A 3SJUA 3PQFA 1U28A 1Z6ZA 3FWZA 3GGPA 2VWGA 1E5LA 1PZEA 2Y0CA 2DC1A 1YH3A 3C7DB 2W2LA 2BF7A 3VH1A 4DMMA 5KCZA 2HRZA 5JDIA 4NBUA 4CMKA 4Y6RA 3SEFA 4R9SA 5T6BA 3WJAA 1U3VA 1UJMA 3C7CB 3ONEA 4XIYA 2GN9A 3NGLA 2P9EA 3ZNQA 3NT2A 3OEWA 3HFGA 1HSOA 3NV9A 4RORA 3E18A 1DEHA 3O26A 4ALNA 1E7MA 4OSOA 3UFXA 5DCWA 3O8QA 1S6YA 3OMLA 1BRMA 1UXKA 3DO5A 4D43A 1O5IA 2HUNA 2CSUA 1O9BA 4BO8A 4NJMA 3ZWCA 1ZSYA 3LVFO 1LDGA 4FFLA 2VHWA 1R0LA 2J3IA 2Y67A 4R1SA 4J2OA 2NV6A 3TN7A 1GQ2A 4R41A 3SBOA 2VYND 2GYYA 2V6MA 2E37A 3H5AA 2H9IA 3AUAA 2BI7A 4GX5A 1HDGO 1ZNQO 2VHXA 3F5SA 4EEXA 3ASUA 2NTVA 4BNHA 4IPTA 1H9AA 3V5NA 3VPHA 3ZV4A 1NFRA 5EMHA 1C0KA 4MVJP 2VYVD 4U6SA 3GRPA 1HF3A 4XKJA 1JKFA 2DLDA 3FSRA 4TKMA 5GY7A 4IQ8A 4MVJD 1ZCJA 4OXYA 4PRKA 4ALKA 4DIFA 1X7DA 1P45A 4PZEA 4IUYA 2C2YA 2NNLD 1EBUA 3ON5A 5TT1A 2QIOA 3L4BA 4R1UA 1HTBA 5C37A 4OKIA 3ZWAA 1H93A 5TJHA 3DOOA 3V8BA 1ONPA 1NPTO 2A94A 2J5KA 3U09A 1PJ3A 3DAGA 4RVUA 3BZUA 1Z7EA 2NUAA 3OQ1A 2PZJA 2W2LD 3PHGA 1OMOA 1PU2A 2PGDA 4GMFA 4FR5A 1MC4A 2DBVO 3D0OA 5TC4A 3W6ZA 4MVJM 3B1JA 3A4VA 1F0YA 1Y8RB 4LSMA 5DZSA 5HM8A 1PL6A 3QY9A 3I23A 5BT9A 1HDRA 2EJWA 5JDIC 5G0WA 4KTTE 4O5OA 4BNJA 1JA9A 1PZFA 3COSA 3FNFA 3GVPA 4J49A 4R5HA 1ULSA 1C0PA 1CYDA 1W6UA 1OFGA 4IQGA 4J1SA 3DHEA 1E1MA 3EHEA 4E31A 3ANNA 1SEVA 2QRKA 5BSEA 4ZICA 2VUSA 3SC6A 1SB8A 5DDIP 3TWOA 4S3MA 1JTVA 2Q2VA 4J4TA 3OBBA 5JMWA 2ZKLA 1KVTA 2IZ0A 3E1KA 3HUDA 4OGWA 4IMPA 3U62A 3OF2A 2YYYA 1KVSA 3ROQA 4IBOA 2OGUA 5JNLA 1GU7A 2Y1OA 3IDSA 1UZLA 1EVYA 4IS3A 1C14A 1GZ6A 2V6GA 3JD2A 4HFMA 4TZKA 1X7HA 5HA5A 4MO2A 3F9IA 3QW2A 4N54A 2RH4A 4BO9A 4MIEA 2GNAA 2CF6A 2NU9A 1HLPA 1ZK4A 3ZH2A 4E30A 1DC3A 2HMUA 4UULA 5ILGA 1NPYA 3FHLA 1GDHA 3JQ6A 1N9GB 5BNIA 1LRJA 3GGGA 4HP8A 5IZCC 3QVTA 4FC7A 5K6AC 1DB3A 3BMCB 3NTQA 1RWBA 2FPPA 3JTMA 4FB5A 5IF3A 2C07A 2FPGA 1DJQA 3A06A 3HN2A 1AHIA 1NM5A 1LLQA 1FK8A 3G1UA 3KUXA 1GYQA 2EF1A 1ONOA 1QV6A 4GWKA 3TDKA 4W6ZA 3I9LA 4AJLA 4XEHA 5AQ1A 3JD0A 4CR6A 3MJSA 4E12A 5JYEA 1JQBA 3IJRA 3LYLA 4PRLA 1H2HA 1LTHR 3O4RA 3BTSA 2I6TA 1HXHA 3QVXA 1R12A 3PEFA 1WNTA 1WP4A 3I6IA 1B16A 1LI4A 4MVJH 5JO0A 3L6OO 3WLFA 5B37A 3G3EA 4HV4A 2QZ9A 4BGEA 1PSDA 4D44A 2X23A 3TFQA 5BNTA 2YV2A 4DYVA 3WGHA 2GRAA 4FW8A 4UVEA 4FGSA 4XD2A 2WE7A 4HFNA 2VHZA 1MLDA 3GHYA 5COQA 4CR7A 3ZWBA 3VPGA 3HDHA 5TT0A 3KLPX 4U8GA 1BVRA 2NADA 3LT0A 4G2NA 4N7RA 5G0TA 1YDWA 4GX0A 2X5JO 5JO9A 3FD8A 3U4IA 4HKTA 4OOFA 1X1TA 4RVDA 3WB9A 3CXRA 4Q3EA 1N9GA 3TNLA 4I9HA 4XYEA 1I10A 2GLXA 3U49A 3OA0A 1H0KA 4FFMA 2Y0DA 5AXDA 2D5CA 1U4OA 4ID9A 4OIMA 4U0JA 5C7OO 3ETGA 3R6DA 2EHDA 5TQVA 4WJZA 3W4JA 1WDLA 5TNXA 4YJFA 1GUFA 2QRJA 2EJVA 4CJXA 5F1KA 1ZSVA 3FR8A 1PGJA 3H3JA 4BMNA 1I3KA 1GR0A 2YV3A 3PLRA 5T57A 2DTEA 4L76A 4XR9A 2CDAA 2HU2A 1UUFA 3WNVA 3MJEA 4TMFA 4OOEA 2R00A 5L95A 3WJ7A 4G81A 1I32A 3GC6A 2YV1A 3ANMA 4BNZA 4J9UE 3GHHA 3ZDFA 1FDVA 1KVUA 2B4TO 3M2TA 2O23A 1P0FA 2DUWA 1D3AA 4MIYA 4QEDA 4LMRA 3QVOA 4Y98A 1XG5A 4ND2A 3V1UA 4IY1A 3IKTA 3C24A 4LMPA 4AJOA 3AJRA 5A04A 4ZRNA 1CWUA 5JE8A 5TGDA 2Y1FA 4FSHA 4JK3A 1LC3A 1QYXA 4CL3A 1PQPA 3R3SA 4J3FA 1L1FA 3TL2A 4D45A 3JQ7B 2CF5A 4NU6A 4AJNA 5AVOA 4HX5A 4IJWA 3KYBA 2VZ0A 4B8ZA 1NVTA 4DVJA 3RVDA 4N5LA 1KERA 2BFPA 3W8FA 4U7WA 2RH8A 3TJRA 1E1LA 4J6FA 4WLVA 1ZK0A 1LJ8A 1YB1A 3UN1A 3OP4A 3DOCA 3C3XA 3KV3O 1DHTA 2OZPA 4BNXA 1I3NA 2YDYA 1KY4A 2O2SA 3K2BA 2C29D 3GDOA 2AE1A 3K6JA 3K92A 5IN4A 5JS6A 4QFCA 1KEUA 1UDCA 1B14A 3I9OA 4GH5A 3H2ZA 2Q49A 4GL4A 4TROA 2Y93A 2HMSA 5BR7A 2ILTA 3RUHA 3PWZA 4CV3A 2DQ4A 4FDAA 2B4RO 1E6EA 4EITA 5F1PA 4K6FA 3RSHA 1SPXA 5ER9A 4M54A 3GAFA 3NGXA 4B3JA 4H3VA 2PD6A 2PR2A 1TT5B 2XOXA 4WE3A 3D5TA 1H6DA 1NFQA 3UOGA 2IRWA 1E3SA 1WDMA 3DBVO 1HL3A 1E3JA 1X0XA 1P0CA 2ZQYA 5JXWA 4HNGA 3DR3A 1E3IA 3WMXA 1YB5A 2Y1GA 3GR6A 1XU9A 3VPFA 3Q9UA 3WYBA 1Z7BA 2O7QA 3UHAA 1I2BA 4EUEA 1XWFA 3F46A 1I5RA 2Z1NA 1IPFA 1BW9A 3ANLA 3UH1A 1C3VA 3JQ7A 1EUZA 1WAMA 2R6JA 5FWNA 2LDXA 2X1HA 1R66A 2E6UX 3WBBA 3GNSA 4J4HA 4EZBA 4NFSA 3G0OA 4DL9A 4MKRA 1AXGA 4DIOA 5JBIA 3OA2A 1B2LA 1GL3A 5F5NA 4IDCA 4M49A 1ZK3A 4Y9DA 4NIMA 2O7SA 3EAGA 3ICPA 1OC2A 1GV1A 1PJCA 1B8PA 2JCVA 3UCEA 4UVHA 2ZCVA 2FSSA 5DBGA 5EQDA 2DTDA 1EK6A 4URFA 5IDQA 3H5NA 2J3JA 4AVYA 3PLNA 1VLLA 1XGKA 2NWQA 1F8FA 1GCUA 1GUZA 1T24A 1Z74A 2NQ8A 2G82A 1NQ5A 2O3QA 1TT7A 4FGWA 5CDTA 2ZB4A 3WGYA 4CUJA 1DRVA 4YJGA 1TEHA 1ISGA 2DBZA 1B15A 3CZMA 2HK9A 2AHRA 4CM8B 1E7WA 1EVZA 3DMYA 4OXKA 5FF9A 1J49A 2WD7A 1V0JA 1A4IA 4DXHA 2PV7A 3WGOA 4UEJA 4DIBA 1HRDA 3QVWA 4AJEA 2G5CA 4BQPA 1JLLA 3O03A 1ISMA 4CM9D 2P5YA 3TZHA 1MGOA 2H6EA 2X6TA 3FNHA 3KTDA 1PJBA 4JIGA 4CQMA 1C1XB 1HDXA 1QMGA 4OAQA 5L40A 4D0SA 2ZYAA 3RU7A 4PN3A 4N5MA 4BHTA 2VOJA 5JCXA 1Z45A 5KJ6A 4E33A 4ZQEA 1UXJA 2E4AA 3VKUA 5A9SB 3TF5A 1T2FA 3CTMA 3RUCA 1H6BA 5ICMA 4UVDA 3U5TA 1LSUA 4DUPA 4PG5A 1HLDA 1Q2XA 1ZFNA 4WLEA 3CH6A 4FCCA 3LZ6A 4JX8A 4B4VA 4ESOA 3BMOB 1OOEA 3A1NA 2RIRA 8LDHA 1D1TA 3DBRB 4QUKA 1T2AA 3NAQA 4L74A 5IZCA 5K6AA 5TLSA 1DIGA 3GA0A 1PZHA 1Y5MA 2VUUA 2ZJ0A 4WECA 1MG5A 1N1GA 2VRBA 1GD1O 3AY3A 4D46A 2A4KA 3PHLA 4GI2A 4MKZA 4BO1A 5KJFA 2NM0A 4O6VA 4RJTA 2AA3A 1H5QA 1VL6A 2E48A 1XKQA 3ZU2A 1RYDA 1TB4A 3WFIA 4A03A 1RYEA 2RHRA 4IM7A 5IDYA 4BB6A 3I9NA 5IXYA 5FEUA 4RL6A 3OQBA 4ND1A 3U4DA 3OECA 2JFFA 4Y6SA 3WGQA 1X15A 4FS3A 3TSCA 1L7EA 4KDEA 2DBQA 4PLHA 1YXMA 1HDCA 2VCYA 1E7QA 3IMFA 1SOVA 1WXDA 2VWHA 1U3TA 2Q45A 1GCOA 4P4GA 1YS4A 2PD3A 5H81A 3RUAA 2IDZA 3CINA 1U1IA 1KC3A 1ZVMA 3DB2A 3KB6A 4J9VA 4XDZA 5BSHA 1ORRA 2DM6A 3E5RA 1FJHA 1NYTA 2LDBA 2C5EA 3JQAB 4BO2A 5IAAA 4GKBA 2QW8A 4GLOA 2YHIB 3OJOA 2PA3A 4CMEA 5L9AA 1UZNA 3NKLA 4YBZA 5A9SA 4JXKA 2PKRA 4BNLA 2IEBA 4E32A 2GUGA 3I1JA 3IS3A 1F17A 4F46A 3KYDA 4LRSB 1HE3A 4NMHA 5TS3A 2NVUB 1M2WA 3T7CA 4JLWA 4CV2A 4EJ6A 3STHA 2BI8A 4ALIA 1MFPA 2AQKA 1E92A 3WGTA 4FC6A 4D7AA 2TMDA 1G0OA 2X0JA 3FR7A 2FZEA 2H63A 3ZWWA 2QHXA 1BXGB 5CG2A 3RROA 3F1KA 2CVQA 3GN2A 5DNAA 3H4VA 4QO7A 4KTVE 4XIJA 5BQFA 3TZ6A 5K9ZA 4KUEA 4BV8A 4D79A 4JCOA 3PDJA 4TRJA 2POQX 3ZWNA 2ZB3A 4KP7A 3AU9A 3TL3A 2DU8A 1GEEA 1WMBA 1K3TA 3KEOA 4O1MA 4BNIA 1A9ZA 1AGNA 2QQ5A 1EDOA 3GQVA 4FQ8A 2X58A 4DWVA 3D3WB 3QSGA 1JWBB 1JDJA 2P4HX 1YL7A 3PIDA 1A9YA 6LDHA 1PJ2A 1N8KA 4RLHA 3UICA 2X4GA 1MV8A 3W6UA 3KVOA 1K5HA 4CMHA 1MC5A 4M1QA 2HKIA 4NR0A 4R9RA 4MOWA 2DUUA 2VYNA 3DL2A 4PZDA 2NTJA 1VC2A 1Y1PA 3JYQA 4YT8A 1H9BA 4XR4A 3I4FA 3CMMA 1BSVA 4DPMA 3ROMA 3MTJA 1RM0A 2VYVA 2Q1SA 4PCVA 5I9MA 1UZMA 3DQPA 5KVSA 1ADFA 4TQGA 5A5EA 4MVJA 2JHGA 2V7PA 3AW9A 4ALLA 3PYMA 5CDGA 1G1AA 3FRJA 1NX6A 4DMLA 1BTOA 1U9JA 4EYEA 3CZRA 4WPGA 1PS9A 4Z0PA 3KLMX 4P4LA 4G5HA 3OJ0A 2Q1UA 4II3A 2YHUA 5L45A 1QV7A 1VL0A 2G17A 5G4KA 3L77A 4FOSA 3DBLB 2AQHA 3D4OA 3LC2O 4ZU3A 4QX6A 4W9NC 5H82A 4LK3A 2Y68A 3ZNPA 1NWCA 2ZTVA 5LCXA 3RJ5A 1DSSG 2RAFA 4BNTA 7ADHA 2B69A 4D3SA 4Q3NA 5A03A 5I7FA 1ONNA 4CM1A 1A71A 4H16A 4JBHA 4BNYA 4CM4B 1KEWA 4EEZA 3WGGA 1VE9A 4YYZA 3Q2IA 3DZGA 4R54A 3VKVA 1TXGA 5KNLA 4LSWA 4U5QA 4NK4A 1U8XX 3I3OA 1NASA 3DBHB 4AICA 1AXEA 1NNUA 4KUGA 4PLVA 3BMQB 4IDBA 2ZATA 3OICA 1W8DA 1IL0A 2TMGA 4OQZA 4PG6A 1MX3A 2X9VA 3JQAD 3V1TC 5KVCA 1EVJA 4QO8A 4HADA 4JBGA 4YRAA 3NTOA 4LCJA 3CEAA 3HB5X 1SZJG 2GASA 4E5YA 3RASA 2D5AA 1PQWA 3JQGB 4L4XA 1E3WA 5JAMA 1IY8A 3EDMA 4BMVA 5HBRA 3ONDA 4L73A 5I9LA 3IAHA 1DHRA 4HBGA 4INAA 1DAOA 1Y9AA 3E9MA 3WTCA 1E6WA 5HWSA 3EYWA 4MDHA 3U9LA 3DFUA 5A9TA 4BGVA 3IKVA 1BMDA 4NBRA 3LSYA 3IIEA 1LXCA 4XX0A 2O3UA 1CQIA 1I3LA 1OBFO 3PGJA 4L4RA 2IXBA
chains in the Genus database with same CATH superfamily
1NNLA 2QMEA 4J3JA 1QRSA 1I2DA 1Y6RA 4BX8A 3EGOA 4HBZA 1QGAA 5DSZA 5BW5A 4CCYA 1TIKA 1W4BA 5B4UA 4IZIA 4AJ2A 3ICEA 1U0LA 3T1YB 3HXTA 2FKNA 3GV0A 1C3JA 5IAOA 4N9WA 1L8OA 3JD4A 3EY4A 4JH0A 5EPUA 3JXEA 3Q3HA 4C0JA 4HDOB 3HB4X 3H5OA 1GCIA 2REQA 3D7NA 4Y2RA 1AZWA 4OBEA 2GYUA 4CM4A 1I51A 2IYOA 3EF0A 1LDEA 5DI3B 3IJ5A 1OUMA 3BRCA 1IY9A 3I0NA 1JHOA 2ZRAA 3A6JA 2ZAIA 1Q12A 3KWMA 4H1HA 2XMDA 4MKXA 4N5NA 1LDNA 1T0UA 2PPVA 1RPZA 1MU0A 2GCPA 3F71A 3GQBB 4GHWA 3RK1A 1WF3A 2GBGA 3EPPA 1M1YA 1JIXA 1GRQA 4F5DA 3NORA 4GOOD 4PG4A 4RHXA 1F8UA 1NVMB 2AOUB 3FCXA 2BL4A 2VTBB 1LNZA 1PL8A 4BUJA 1OH8A 3FPAA 5JISA 2ZYGA 1V11B 4WY5A 5CVEA 4FMPA 3EVZA 1NSYA 2R8PA 2JFPA 3N05A 1MO3A 4KPUB 4I66A 2PG3A 5IBPA 1HL7A 3USES 1GZ3A 3BTUA 1P3DA 4IR7A 4RF5A 3A7DA 1KYYA 3ZBTA 1E7RA 2BM9A 3RKRA 1U9IA 1RPNA 4HGRA 1N3LA 1EFCA 1PS0A 3KZCA 4WK2B 1Q0SA 1MCZA 1MZVA 1CJTC 1Q83A 1RACA 4WI1A 3BB4A 3KO8A 2GD6A 5DK4A 5HZGA 1Q1NA 1XZFA 5JTUA 3E5NA 2IXEA 5B30A 2HHLA 4CKCA 5DMHA 1EH5A 3SN6A 1TLTA 4B75A 2Y0BA 1T3GA 5ITWA 3C43A 2YVQA 1OQAA 2YYZA 4TOIA 5CLHA 4YRFA 1Q84A 1QCCA 3JVUA 4MWSA 4YT5A 3ZTWA 2AFIA 2Q6OA 4PHGA 4PLTA 4DR4B 4DLAA 1EE9A 3JSXA 4N82A 1W29A 1ZXBA 3ABSB 3O0DA 4PAWA 4US2R 2YCLA 1WOMA 3MRVA 3VNAA 4BLOA 1DP4A 5JVDF 1CULC 1JWAB 3B8EA 5IH3A 4B31A 4P31A 4DLZA 3D5EA 2QGNA 5FTLA 1PR4A 1NE7A 2R47A 2FMKA 1RU3A 1MQ9A 1VIVA 3SBEA 1SC4A 3C3WA 3TINA 1A8IA 4QXMA 3KQWA 4LDJA 3JWIA 4LVNA 2X4LA 3GFVA 3CUKA 1VI5A 1Q19A 2F8LA 1JU4A 4IILA 4NCXA 5IM5A 4MLPA 2OSBA 1FFGA 1U0GA 1UMCA 2ERCA 4I36A 3GFQA 3THYA 4JCCA 5E7MA 1QBKC 1J8YF 1LRKA 1ZNYA 2VQ3A 2GKOA 1LK7A 4OTZA 3VDMA 5B4TA 2CEAA 4LXTA 1OREA 3O4FA 3WLKX 4X85A 1WSAA 2JIZA 2GJKA 1T5BA 2LRHA 2ZEJA 3HY6A 3M89A 1GPMA 4Q37A 1QLJA 2EKZA 1SQ0A 2CEKA 2R7MA 2ZI7A 3MS2A 1SXQA 4M76B 2F9FA 5EQJB 1L9XA 1NW4A 3A9RA 3Q5DA 3N2NA 5C80A 1OIVA 3TR5A 2J9ZB 4NBVA 5FOQA 4P9NA 2AMLA 2B2NA 3MGCA 2ZYSA 5FOSA 2LD4A 3M70A 5CFRA 1AUPA 3BWDD 3SDZA 1SXJC 4MP8A 3NOVA 1Y81A 2WWFA 4YAEA 1TCAA 2JDIA 3DTVB 5CITA 2KB0A 5BSWA 3CMCO 3TK1A 5JNUA 3QBVA 3FHCB 5EZYF 5DP2A 3N2GB 5DHTA 2R4UA 5K8LA 2JANA 4EHJA 2Y27A 4I50B 3C8UA 4JEIA 2C04A 1VM6A 2P68A 4ZT2A 4ZN6A 2IHUA 2N1MA 3CIOA 3PIIA 1XLTC 4DBZA 1TF7A 2OMEA 4EGFA 2E1PA 4RFSB 1IM8A 3AZPA 4CKBA 2NPOA 1P8JA 3E27A 2XZOA 1XD2A 3RIEA 3TX2A 3N1UA 2AEJA 3UKDA 2QB5A 4BQRA 3AM5A 1AS0A 4YASA 3K70B 5KQMA 4N5IX 2ZKIA 2W2OA 5KI6A 2ZYRA 1P4JA 4KQXA 2J0QA 2QNBA 2WC1A 3ZZNA 1RXWA 4OI1A 4YVFA 1K86A 2OFOA 3M0EA 5ALPA 3BB1A 2MYNA 4NTZA 4YJDA 1YVPA 2CD9A 4CMIB 3GCXA 1F48A 5K3FB 2BOVA 2BV3A 2DH5A 1F2TA 5HKAA 2PKCA 2VPZA 4IJKA 4MVJF 4IIJB 4AJIA 5IDVA 3EPJA 2X5OA 3IUMA 1KBOA 2EWMA 3VSDA 1UAAA 4RTQA 3ISJA 3CX7A 3RIHA 3TAUA 4BO0A 3QBEA 3SVTA 4QXPA 4LCBA 4DR2B 2HAEA 1FSPA 4LUCA 1E79A 4LECA 3P27A 1QVRA 2NIPA 3BH6A 4JI8B 3LC7O 4CWAA 2VJLA 1VXOA 1EFDN 3NV7A 1LK5A 1V37A 1NXPA 3CKKA 4A0HA 2D59A 4F8YA 4FX2A 1QG6A 1V16B 1OBVA 2NTEA 4LZWA 5B1HA 3TD6A 1J00A 2OOKA 2P2DA 2Z3VA 5ALHA 3M1YA 4DA7A 5FLXA 3FRHA 3RWBA 4WV3A 2VPXA 2VWPA 3AOGA 2ZBDA 3H42B 3OQIA 4X24A 4RV9A 3UUFA 1Y8QB 3NKFA 4EEKA 5HRAA 5LYJB 4MVWA 5BW8A 4RY8A 2XMRA 1J2YA 1KRWA 2NNWB 4K8OA 3GJXC 3CRRA 1IN5A 2Q4BA 4B47A 5BN5B 4XLTA 4HX9A 1CUIA 4AROA 1ZOSA 1XVLA 3QITA 5I01A 2VSYA 4RHYA 3EIFA 4KWHA 4M22A 1JXMA 2D8AA 4PIVA 5IKOA 5C32A 1RM4A 2IS1A 4O4HB 1NA5A 3ERCA 2NXWA 5DO9A 3Q9LA 4F2HA 1ZR4A 4NK5A 2ONKA 3PZBA 4TWRA 3C6QA 2WYVA 1ABBA 4JJIA 2H9YA 4XPIB 4AWXA 5D2CA 1NP7A 4NMMA 3GFRA 4YMIA 2G1UA 1AGRA 3GLKA 4HZUA 4A10A 2XQGA 4CLOB 1MP0A 1XRPA 2GJ9A 2ZE8A 3DBIA 1REQA 3CRQA 2IDKA 1M54A 1NUSA 4LF9B 1D2HA 5F33A 5CDSA 2WVAA 4DKXA 3ZXXA 4MP3A 3NUGA 2R6R1 3ZHUA 4E7OA 5E6UA 1JDBB 3OCVA 3MJDA 4TQ9A 1AK9A 3WLSA 5KHOC 4G0YA 2NU8A 2DPHA 1TK9A 3A1WA 3EFOA 3KYCB 3QJYA 4WOKA 4A0SA 2BDTA 4DV2B 4K9MA 2O8CA 1WW2A 1QGZA 4HEQA 1H4TA 2O54A 3PFHA 3VZPA 3SKVA 2C20A 2VG8A 1NQOA 4B82A 1GL6A 4HI0E 5KYUA 3ORYA 1W2WB 1RIIA 2YWBA 3E8MA 4UEKA 4J7CA 4ZO9A 4AO6A 3CVOA 1E64A 2BELA 4NDNE 5COBA 4G5RA 3U4HA 5A6SB 3DE2X 4R0MA 3BWYA 4TTJA 3OX4A 3G2MA 5DE3A 3UK0A 3WFJA 2YY7A 1ZXXA 4W4TA 4QGSA 4O2RA 1Y6FA 1WMAA 1PLLA 4TLEA 3WGIA 1FUEA 1KVQA 1T1EA 3AOEC 3E5MA 4TZ6A 1JVSA 4LYJA 1PWZA 3C70A 3I6QA 3LKBA 4OJNA 4QEKA 1YQGA 1T9GS 4RW0A 1Y33E 1QK3A 3UHOA 4UJ3A 1CFJA 3RTBA 4QARA 3A11A 3VO9A 3UXHA 4QDJA 2XDQB 3KKQA 1KI8A 5KCMA 2O8FB 5LQSA 1KDPA 1U1EA 1Z08A 1WDWB 4X20A 1NW3A 5J63A 3SMVA 4FM9A 2OBNA 2EC5A 5CYGA 1E2GA 1EMDA 2XTAA 3DTVD 3DWIA 2TMKA 2B25A 4JUAA 4P6VF 2WPNA 5EC8A 3WRXA 1OZAA 4MUGA 1YQDA 1PIWA 5KVVA 4MRPA 4R98A 1ISHA 1E4OA 1E4YA 5FL3A 3MUEA 5AI0A 4BJ5A 3ROXA 4M88A 2G9NA 4RGBA 4GLLA 2YQ5A 3KJIA 3T5DA 1JMYA 4BAGA 3IEIA 4Z3OA 1G6HA 2FG5A 1CETA 4J0HA 3T4EA 4CF4A 4IGKA 3RTAA 4H31A 4CLHA 3DW3X 1QO9A 4H7IA 4ZYTA 2IYVA 3K70D 1BH2A 1RVV1 2LP4Y 1XO1A 3IHLA 2C7GA 2QUHA 1CJKC 1M2KA 4ZA2A 5JC8A 2FP4B 4Q3AA 4V0QA 4JBNA 1JR3D 4JP2A 3P0HA 3PQDA 1V3QE 3WRWA 1P81A 3A10A 4QDXA 3HCFA 3RHFA 1XPUA 4HAVA 5F2OA 1FRFS 3GRAA 3NP9A 2A1TR 1U8AA 5T3YA 2ZSHA 3UYLA 2ZWVA 2MTBA 1XF9A 4JZYA 1TYEB 3RJZA 4J0QA 5IM4F 2P8JA 4FIZA 2CXSA 1YR2A 3E8XA 5ETJA 1CVRA 3EPKA 1DNPA 3WYFA 1BQ4A 2XY4A 1NQTA 4JJKA 4ITUA 2NGRA 1VL5A 3CUWA 4B3HA 3ZWMA 9GPBA 2Q2NA 4ZRDA 1HE2A 2HHCA 3JQ9A 1I7PA 3K8YA 3BTOA 1V3UA 1WNFA 2XA2A 3RR2A 3HACA 3PICA 5L3SB 1M2VA 5DCLA 2VT6A 4YMWA 1STOA 2PZBA 3B1XA 4B2YA 5LP6A 4JUBA 4RK1A 4QVIA 1Z4MA 2J6HA 3C1OA 5L7WA 3ADCA 4HYTA 5CPBA 4BLSA 4W5JA 2FG7C 2H11A 1PYGA 4Y9TA 3REQA 3ZJUA 1T4BA 2YMLA 3MELA 2G72A 3ZK8A 5KYXA 4Y8VA 2V7EA 3D6MA 4YMVA 1EEXB 2VHYA 2HADA 1X7YA 2Z2XA 5CW2A 4I8DA 2XNKA 4KNYA 4X8MA 3A9VA 3ABQB 2FRDC 1OF1A 2HYDA 1EFHA 1JYSA 4BVKA 2IZ6A 3NVMB 5FIUA 3F4LA 5CW1A 3TRJA 3C1TA 4C4PA 1GZ5A 3F97A 4LXUA 4ENQA 1QV9A 2MHCA 4I8IA 4L9RA 2FWPA 2OC4A 5B3AA 1R4MB 2Z2ZA 3MPUA 3KVYA 3AUJB 4IJVA 3OLVA 3TXAA 4JR0A 3RE1A 1IYZA 4UQOA 2PWAA 1ML4A 3QUCA 4OO3A 3G2JA 2WQ7A 1NNI1 2JVKA 3GUCA 1NZDA 4FXOA 4R2MA 4C05A 2ODNA 3V8NA 5CNJA 4NXMB 2FN8A 1GPNA 1UPUA 1VJGA 4XW2A 4YCAA 2XF2A 1YI1A 5GZ6A 4PLWA 2JD0A 3CH5A 4YRQA 2EBHX 2PRIA 2QUIA 1CUYA 3FN4A 1KORA 3F2IA 1JIIA 4NULA 4REQA 5YASA 1SURA 2LR0A 2VP0A 4IHKA 3Q7RA 5KTSA 5LA6F 1MAVA 1O97D 2YIVX 5C8YF 1QH1A 4DA4A 1DGQA 1UXGA 5FBRB 3FZQA 1XZBA 2FSPA 2IXAA 3FDZA 2IU3A 3PI7A 5DOVA 5EWMA 3SZRA 5EJ9A 1EZ1A 3BWVA 4K9NA 1J2JA 2MT9A 5C35A 4WNAB 2LIPA 3KD2A 3E58A 5FWYB 1VFNA 5JAQA 4IZ6A 4BMDA 4B44A 2EU8A 4WACA 3QU5A 4TN1A 1LBHA 1YJ5A 3FPCA 1U3UA 3GWGA 3R40A 4NSNA 3ILXA 2BZSA 2SCUA 2VP5A 1Q1EA 3NPMA 4MEAA 5DT9A 5IAEA 3TVYA 4CEHA 3V2UA 4KQHA 1E2DA 2FOLA 4TXNA 4YAWA 4CM8A 1BNCA 2Q5QA 3H19A 3L1VA 4KIGA 2JJ1A 5DLEA 2PUBA 4K2AA 2GEDA 2O2JA 3LF2A 3S1AB 1DC5A 4IDAA 1N2XA 1YVEI 1P9LA 3CRW1 4M1WA 5ALYA 4AS2A 3RVPA 2EW2A 3FFAA 3LXUX 3RRBA 4IIUA 1A9RA 1R37A 1X42A 2FYTA 1E89A 4IMRA 5DLPA 1G60A 2VVTA 2Y2VA 5DYYA 2W2PA 4EB6A 2O9JA 4QBIA 2I1VB 4LSZA 4D1YA 1C1XA 4NWIA 4C43A 4XJSA 3DEJA 4HWGA 5JDCA 3UWMA 2W6ID 4I5EA 4L8YA 2WF6A 2VDLB 4I4LA 2IE0A 3T3EA 5JJIA 2OXEA 5DW0A 4A7PA 3B6JA 1WTCA 1FUYB 3EG5A 2DH6A 2RC6A 1SOWA 2IF0A 3AFGA 3AP1A 3JRXA 1XZAA 5WRFA 2GBLA 1VMDA 5JD4A 2ZSBA 3JY6A 3RVSA 4I2NA 4DQXA 5EZYB 1ZUD1 2F6RA 2UVQA 4FZ3A 4L57A 4TKZA 2OXIA 4LF8B 1G3RA 4J16A 3LKDA 2RJ3A 4D4KA 1A5AB 4DA6A 1XZJA 3DBRA 3VDXA 1N6KA 2AQIA 4FN4A 4KQ6A 3OIFA 4MQLA 3HCWA 3SF8B 2Q9BA 4XQCA 2Q2QA 4UMEA 1ISIA 2NT3A 5G4LA 1P2UA 2DBRA 4Z7JA 3RFCA 3AUUA 4JDPA 1JQ5A 4ZQCB 3A6GA 4AF8A 4DREA 4GI3A 4DSAA 4G56A 3I92A 5ARDA 1QF7A 3EUEA 4X8HA 4R1TA 3RSQA 3UJDA 4NYMR 1XWWA 5F1OA 4MW6A 1V5IA 1ITZA 3QOWA 3EGXA 1CU1A 2BGJA 3P9QA 3CLRD 2HSJA 3AR5A 4WOJA 4DLRA 4YT4A 1Z83A 2GSDA 4IV0A 3RRYA 2UYCA 2YNMD 1DC7A 3ICOA 3O5AA 3ZDYB 3HXOA 4ZGWA 4ZOLB 4Z2AA 1EX6A 2A1UB 3LXXA 1BEZA 4D3DA 5AVWA 3F4KA 4LGVA 5TQ2B 3IFSA 3AFNA 4ZDKA 4HAZA 1ORVA 2XODA 3HDYA 4G0NA 3JWEA 4A5SA 1H6AA 4HT3B 4TKVA 4ZCIA 1E2UA 2IZ5A 1U94A 4GQAA 1XZKA 5L51A 1RRPA 3KJQA 4YRJA 1PK9A 4OI0A 2CLLB 2ZXFA 1I6MA 1QOZA 2FQXA 3JQAA 4LISA 3TZLA 3H9CA 1PR1A 2XRFA 5EMJA 4QWMA 2YHIA 2VJMB 4LWZA 2P9GA 4BVHA 1PWXA 1VE3A 3D0RA 3E84A 3TTWA 4Z6KA 3NEYA 1W5BA 2ZWPA 5AJXA 3ZE8A 13PKA 3QX9A 1D1QA 2HNAA 2NU7A 5F35A 4JLJA 3G8BA 4EDFA 4EDHA 1R4ZA 3G02A 3K9WA 1BG6A 3LWNA 1SCQA 5EYPA 3AXSA 2R11A 4BV2A 5F3WB 3AY7A 1C8BA 3JTEA 2G09A 3MTQA 5G02A 5J2UA 4KNVA 1R5OA 1ZGJA 2C83A 1R7RA 3HE3A 3K30A 1T5IA 1Y4ZA 2WBLC 2P9FA 1YDMA 1E9RA 1MXFA 5F9MA 1HK7A 2R6HA 3PT5A 3IXMA 1SN7A 3QX7A 5FKJA 3UPTA 2C95A 2RHCA 4GECA 4J90A 3MB5A 5ALVA 3H7AA 3RIGA 2ZI5A 1XJQA 2HDNB 3O3MB 2QVXX 1ENYA 2Z2IA 4QL3A 5AJWA 5FRDA 3TL6A 3UT6A 1K6XA 3G0HA 2I1QA 1H1LA 4HQ0A 4WZAB 4YB8A 4WFJA 4FB4A 5DEOA 4ZZ0A 1U11A 1EHIA 1WPGA 1EX9A 3B38A 1LA2A 2VXCA 4KODA 4DJFC 4KEAA 4YMSA 3U6BA 4DUZB 2VTKA 3IDOA 4R4JA 1XDUA 4UTXA 2ANBA 1CY7A 4W5OA 2XR1A 4MMYB 4D9EA 3CUVA 2Q9AA 3K7EA 4FYPA 4DIKA 1ZR2A 1DG3A 3MUNA 1DXOA 2V0GA 4BN4A 2BFDB 1ZVKA 1G5PA 3QPAA 3X1WA 4BBPA 4XJTA 4CTMA 1HH4A 4H3SA 3SZOA 4XCXA 4UUNA 4EX7A 1YBMA 5C53B 4KRGA 1CUSA 2EG5A 2VS1A 3SP1A 3VPDA 4BMXA 5HP4A 1HEUA 3M6WA 3K0CC 3VC7A 5BUCA 1X14A 1Z5ZA 2WYUA 5DP1A 3STWA 3LP6A 2FSVC 2W00A 5GADl 3KCQA 1HKHA 2OO5A 4L0QA 3PX3A 2PMDA 1XCPA 5JSHA 5JQGF 1Y9ZA 2PD4A 2H4YA 1L7OA 4PICA 3CQ9A 2UVPB 5EJFA 3EPLA 4P7FA 4EL5A 4ZVVA 2XLBA 4A2CA 5B57C 3AVPA 3P4XA 2OCXA 2BP7A 3U1BA 4OEHA 4PLZA 3HKEB 3R24A 1XRQA 3V9AA 2AYYA 1QAMA 2ZRFA 2A35A 3CXUA 4HZGA 4YMLA 4KXUA 4HQOA 4UZEA 3GP3A 4V1CI 4RKRA 3W77A 2XUHA 1TQ8A 4WK0B 5E38A 4IS2A 1J33A 4KXWA 1UMKA 4YAKA 3EZGA 1JPJA 1T29A 4GP6A 4NYJR 1UZUA 4NMWA 5JAUA 2FDCA 4H7FA 1WVIA 1WETA 1AB5A 4YP9A 2HO4A 3TPCA 3W2GA 4YR9A 4A2PA 4DYHA 1EJ6A 1W73A 4FYHA 3L9WA 3DC2A 2Q5LA 5IC6A 3R75A 1VDMA 2EARA 2GF9A 4AO8A 3T9DA 1G5HA 3AK4A 1M72A 4PZ0A 2EP8A 1C9YA 2GDZA 3A3OA 4YP0A 3JASB 3UMJA 4MWCA 1I3CA 1PHRA 3AVUA 3QJGA 4L08A 4RV5A 5IUJC 5D3ZA 1M2GA 2B5WA 4K8RB 5D01A 3KDPA 1KQPA 1OCEA 1K8YB 1Y9EA 2DR3A 3DG9A 3NDJA 4Q9IA 3UGKA 1TUBB 4OG2A 5IYZA 5CM9C 3NAMA 1KOLA 4DRYA 3A4NA 4YUXA 1XTQA 4CW7A 1EVLA 1MOPA 1UOPA 3PR2B 4CG0A 4UDNA 1N25A 2I4LA 2RH5A 4G8BA 4CMJA 1QRDA 2GTIA 4TLMB 3RYHA 5DGDA 2F4VB 2AFHE 2QRMA 3ONNA 1ZGAA 2W42A 1CTQA 5KJ1A 3LGSA 2RIPA 3O9MA 5ADWA 1SULA 1V9CA 3GFBA 4EIWA 1O94D 3UMBA 2LKDA 3PK0A 4JIMA 2WWHA 4NZNA 1NTOA 3HXPA 3D3EA 1GPLA 4ER3A 3EW9A 3R9XB 5T7BA 3HADA 4PHHA 3W7VA 2PFGA 1C3OA 5DEIA 3E03A 3CT4A 2NVOA 2VJBA 3VTAA 2HWWA 3A4MA 3AF4A 2C57A 4L28A 4X5OA 2WPDD 1XIVA 2QY6A 2HC9A 3H1FA 3BMXA 5I7WA 3D64A 3MT9A 1L4GA 1QP4A 1Z26A 2PNFA 3EVTA 1SIWA 1TJNA 3NDPA 1DAGA 3VTZA 1YBVA 2CJFA 2DZDA 5CTAA 2FOIA 4ES6A 1TGVA 3X1ZA 1F2DA 3DV0B 3E2PA 1F4VA 5G2OA 1YDHA 2VPQA 5LDHA 2VDKB 2QUKA 1LBQA 3UNXA 3AVTA 4EY7A 2V7GA 1QQ7A 4NI5A 3UAVA 1E7SA 1EFAA 1VTKA 1IG3A 1HC7A 2EHJA 2OHFA 5K3CA 5BMVB 3MILA 2J0UB 2QORA 3C6YA 2FY8A 3HM2A 1HDIA 4TYQA 4B9EA 2AZXA 2GK7A 3F74A 4MSUA 1TQ2A 2HPAA 4YPFA 3AFIA 4Y2JA 1OD6A 2ADFA 4NKRA 2JCSA 4BB5A 3TQQA 4UHBA 2WMDA 2ENWA 2WSMA 3NHSA 1NBEA 4FFBA 2ZBRA 4E94A 1T3SA 4ONEA 4R83A 1EJ2A 2H3HA 1RE0A 2A9KA 2OT3B 1M6YA 4FTWA 1KNXA 1KK0A 5IC4A 4A6XA 1AKMA 1E1CB 2BFFB 2R4TA 4GBJA 4I1VA 3VNBA 1S01A 1UT5A 3AR9A 1G5TA 2GBFA 5T67A 4OXIA 4D5EA 3WNCA 2VA8A 1S96A 2ZB8A 1BA2A 3P8ZA 4QRIA 2PQ6A 3Q7TA 2JBWA 2PUTA 2QP3A 2O4UX 1PJQA 3I3SR 3RHZA 2VZEA 1XP5A 1M2NA 2CLHB 3NT5A 4PYLA 2VBIA 3P52A 4O0MA 1FDUA 1YR9A 2HIAA 1B26A 1HO3A 4L51A 5DI3A 3P9SA 2JI8A 3SJ7A 4DLPA 3UAGA 3CNHA 3WLMA 5FBLB 4Y2HA 2BFMA 5ANRB 2GPAA 3O2NA 2AOWA 2J5RA 3CCCA 1WU8A 3GQBA 3KVVA 3AVVA 1KH3A 4JL6A 2LV8A 4H35A 1HEIA 5HIAA 4KR7A 3HCCA 2HQOA 2HU7A 1OROA 2AOUA 1H94A 4ZJUA 5IVPA 2H4FA 4GM4A 5JAZA 1PDVA 2NTYC 3FYTA 1VJTA 3U1VA 3FCCA 1VMAA 3WNBA 3E1SA 4D9NA 1UKAA 3DZJA 3PD1A 5ED0A 3JZIA 4F12A 3EIUA 3ZY6A 4UVIA 1JRLA 5BSFA 2XTNA 4HJXA 1E9FA 2YY6A 1PVOA 1O58A 3ONFA 2HZBA 3R5HA 4ENRA 2A9QA 1XNRB 2CJXA 4MQFB 3KBOA 1YZTA 3SU8A 4BFWA 1NFFA 1X3LA 4FEEA 4H6VA 4H3KB 3GT3A 5K8JB 4DRXB 1OU0A 4JVMA 1Y7PA 1NQXA 1X9IA 4CMGA 1W0CA 3ENNA 3QPUA 1ZUWA 2PUAA 5AW2A 1Y8CA 1FE8A 2ZOSA 4EJSB 4K86A 1DMRA 4GSLA 3H86A 4HFJA 2JHAA 1E1DA 1ZD5A 4IH9A 4A36A 2HSDA 1P9OA 3NALA 4WK4B 2O5VA 3H18A 3GVIA 3O9ZA 4HNSA 1MXHA 2WMOB 2WJPA 4QVKA 3NYQA 5B36A 1WQ1R 1KJQA 4PBRA 4Y2XA 5ER6A 3WNZA 3A3NA 5B3JC 4U5XA 1SELA 2XW6A 1U2SA 1F2UA 3NEPX 3O8CA 2FI1A 2GX6A 3CRMA 1COWD 4FFVA 5K4AA 3KL2A 1QGDA 5IXJA 1JVBA 3TLZA 4C0AC 1EFLA 1QVWA 1Z36A 2P7IA 2ZRMA 5B3LA 4DV1B 5BMOA 4YUAA 1FNCA 4JODA 1DJNA 3BREA 2NUTB 3M5DA 3OMWA 4G5FA 2BHLA 4TTTS 5K3AA 2A4MA 1JIQA 3M3DA 3RTDA 3TM4A 3F5QA 3PP8A 1FIUA 3BE6A 4XUGB 2WWVD 4BEJA 1V3VA 1F8XA 2E18A 4L5CA 2O2HA 4PNHA 5LQRA 3WL6A 2ZIEA 1WMFA 4UM8B 4E5NA 3OWHA 4CI0B 4R9UC 4EABA 3TZCA 2H1VA 4K88A 3CF2A 1WW8A 1T8PA 3UMSA 1XBTA 1J7JA 2QS9A 5CLGA 5CXSA 3WR5A 3ZI0A 4A6EA 2NYUA 3DONA 3WBKA 2WFAA 3GRKA 5K6TA 2EBFX 2ES4A 2IPAB 3PJEA 4EG8A 4HTFB 4UFOA 3SVZA 1PQYA 3O73A 1YJ8A 3K0KA 3P5SA 3T61A 1YU9A 2VT7A 2YXLA 4GVPA 3A6DA 3VTKA 2B1JA 5AXBA 4GBGA 1LRLA 1SJ9A 1UF9A 2WSSD 3R2JA 3STYA 3F6PA 4MAAA 5GIPE 3CLTD 4ZEOA 1GJRA 4PGFA 3MRSA 4C0KA 1PVVA 3I6MA 4RABA 1NJFA 1P19A 4LOAA 5E4TA 3X2EA 4R3UC 1KDTA 2ONYA 3K2EA 2PZLA 2YXPX 1WXGA 3PHCA 4ZVMA 4EELA 4I5GA 5JW6A 2CZGA 2FMTA 1NKTA 3AKEA 3DTVA 3WK7A 5B55A 3WLIA 3A2NA 4B84A 4XOUA 1C5KA 1DT5A 3H16A 1WPQA 3N2GA 3RUDA 1IAQA 3WK9A 4C4TA 3SHOA 1JDSA 2O07A 4I50A 4KMRA 3W1WA 2I99A 4EYSA 4KV9A 4UE3S 4FE4A 1JHUA 3BQMB 4KSCA 2A14A 4B6SA 1PGNA 3GNTA 4RFSA 1CUBA 1SR8A 2OP0A 5CA0B 5EIAA 3VJLA 1N5DA 1YWGO 2I2WA 2WYWA 4QDTA 4UBJA 5KEIA 3KZXA 1FLNA 1SZPA 2OHHA 4IDHA 4UASA 3VH4A 1XVUA 2P65A 3ITDA 1AN0A 4XXHA 4B3IA 3BGOS 2GERA 4FQ7A 3MQ2A 3PWKA 3SYTA 3RW9A 3QMPA 2R6ZA 3L7MA 2ID8A 4CBVA 1YB4A 2FMFA 2WSLA 3SPXA 1JR3A 2JIRA 4XOIA 5L53A 2I8AA 2QIPA 3IP1A 1U99A 4KUHA 5K3FA 2R6AA 4LI3X 1IQPA 1R0SA 3LDFA 5AVVA 2VSFA 4O2LA 1VRVA 4O02B 5TJ9A 1JDUA 1T36A 1SCJA 4MPTA 4IFEA 4XGNA 3NJ8A 1JH8A 2SICE 3R6TA 5KO2A 2HJGA 4UKDA 3GPDG 1VG9B 5CDUA 3MT0A 1QJ4A 1C0LA 2DHRA 3BXPA 3NYWA 4XB1A 3B20A 4HNQA 1GYPA 5TY0A 4KRFA 4DOMA 3VKGA 1BW9B 1Z2CA 1HEYA 2F17A 1DQPA 1ECGA 2HF9A 1J9EA 2RGEA 3OIYA 1V16A 2H4XA 4HLQB 3ZE6A 2WA1A 4J75A 3IJEB 2XCUA 3NYIA 2DWQA 3PJRA 3OE5A 2HJHA 2WDZA 1JEEA 1FSGA 1WL8A 3AM3A 3K8QA 5AKHA 5D3KA 5HIJA 3GZTB 2FMXA 2XMCA 4IWYA 5LYJA 3KAJA 4A15A 1Y8QA 4MTLA 4JFRA 2R8ZA 1R9GA 2EQBA 1DTWB 2VZ8A 1P5HA 1USKA 4R0VA 5I9TA 4D42A 3WLLA 5BN5A 2UAGA 1KMQA 5JD5A 4UFPA 4Z3DA 1TX4B 2D0OB 2IBTA 1FFDA 1K7XB 4EYOA 3S70A 5F21A 2R66A 1EFRD 3K0AB 4QFBA 3DKKA 4ESHA 4UPEA 3BZBA 4KE6A 3OMXA 4PAGA 1XZNA 1U28C 4O4HA 1QHGA 1C3XA 4ZQFA 5JEDA 2C3YA 1GO2A 1QU2A 5G3ZA 2AC4A 4PO8A 4DNXA 1QZ3A 4JELA 3BERA 3AESB 3PXXA 4YLGA 4YJGB 2IWHA 3LLMA 3TKAA 1O4VA 1M10A 2Z58A 4OREX 4PSCA 4XPIA 4I9FA 5BUSA 3GLIE 1PR5A 4KZKA 4EVQA 1RJDA 4CLOA 3UMGA 4B71A 1DKQA 3DF7A 4ANFA 5A3QA 5AHOA 3E9EA 1R4AA 1VI6A 3N86A 4HJRA 1A96A 3JD1A 4WZ6A 5FV7A 1DU4A 2C2HA 2O8NA 1YCGA 1XTSA 1JLLB 2FLKA 3QTTA 2AFHB 4GFDA 4NBNA 1AB6A 4GXRA 5HEKA 2BF4A 2IA5A 3KYCA 2QW1A 2NZUG 4UOEA 1V7QA 2X0FA 3NR2A 3ROFA 4WQMA 3D5QA 1JV2B 2ZDHA 1W47A 2OENG 2VOEA 1CR4A 3V2HA 4CQMB 5DASA 5K2OA 2W8ZA 5GP1A 3S29A 3L01A 2H57A 3GAAA 3KR2A 3F3YA 4NZMA 1DC4A 2CUNA 1BXKA 2QWXA 4KXYA 1KAEA 4NZ9A 1E8NA 1CR6A 3RU9A 5A6SA 1UP6A 3JZMA 4QSMA 4XCQA 5DGIA 4ZPXA 5TF4A 3DEZA 4UE6A 3TKYA 3LFHA 5CX1B 3FB1A 2ECQA 3MC1A 3OZFA 5TB5A 3MCZA 4O63O 3W9BA 1XJWA 2GPBA 2PVPA 3FMPB 1EDDA 1DDGA 1MV5A 1SUWA 4YCJA 1EA5A 4MP6A 1ECCA 3S5JA 3W8RA 3GPBA 4P2GA 4W5HA 3SQMA 5J47A 3SJAA 3ZV5A 2H1IA 3L40A 5JEEA 4YRRA 4AULA 1XLUA 4CUKA 1XMOB 1G66A 1Y9JA 2VK2A 4EG4A 4DB4A 4TLBA 1JG3A 1NQAO 2QG4A 4ER0A 4LC0A 1DDOA 4N18A 1X0VA 3GJ3A 1T1IA 3H3FA 2HWYA 4L7QA 1NBIA 1JHVA 1UEJA 4G1BA 1AMUA 2O8FA 4KXQA 1ZAKA 1R9JA 3T1NA 5F2EA 3S8YA 1ZMTA 2Y66A 4TKUB 4ABTA 5MFZA 1JAZA 2PR7A 2WJYA 3RT7A 4B32A 3HDVA 2VJDA 2OZLB 4V0RA 5TF0A 4Q00A 1FNBA 4P0PB 3B5IA 3EGCA 1XMPA 2UVDA 4KQWA 1CY0A 1IDOA 3BJIC 4WFIA 1F0KA 1O95D 3U0BA 2O0LA 1YS2X 3ZDAA 4XDYA 3T9CA 4NQZA 1W25A 4QAQA 3V42A 1Y5LA 3GMIA 1IUPA 3GGDA 3AJDA 1E4VA 2Z1MA 2XDYA 3W4IA 3GXOA 3BGWA 5I47A 3IPLA 1J21A 2QMYA 4KDCA 3T0FA 3DAYA 4CVNA 5ED4A 1HZJA 1CUWA 2Y92A 2QRUA 3K4HA 4J7XA 2W0MA 2K2WA 4QU8A 1SMKA 1OU4A 1Q22A 3L7JA 3WYGA 3I9KA 4MYHA 4OP1A 1FS4A 4RK6A 4O4JB 1ODKA 1YR1A 5NULA 4ETWA 1DBVO 3TOXA 4PQGA 3ZGOA 1CZKA 2QUJA 4PO1A 2FP4A 1TVCA 5LKAA 4E88A 2P1DA 3EEOA 3FF4A 4GKAA 4RVFA 3E7FA 4BCDA 3ITKA 3K5HA 1OZ0A 1XOIA 4HUJA 3ISTA 3AR7A 4IDFA 3RYIB 3FZYA 1P44A 3OH8A 5EZ5A 4EG6A 1DWQA 3AP2A 4MVYA 1T9AA 2UYOA 2YC2C 1SOMA 2KHZA 2V74B 4K87A 5AT1A 1KY3A 4KWEA 1RAHA 1SHJA 3S0JA 2NQ2C 3PXAA 3KSZO 4XVCA 3V1NA 1P29A 2PKWA 1K97A 2ATEA 2XVXA 1R6XA 1AC5A 2YNMA 3I28A 3KYDB 4QLOA 3F90A 4PSVA 3WWCA 4BC1A 4DBLE 2R62A 5CCBA 2QTFA 1AJEA 5L3SA 1LI7A 1RJFA 3E05A 3HYLA 1WUTA 4O4LF 1IFXA 1OX4B 4XVUA 5FBVB 1U5BB 3MIZA 3NHLA 1R6DA 2H07A 4L5YA 2G04A 5FTWA 2DPXA 4R5MA 5EKUA 3TB6A 4Y2YA 5M3BA 5T41A 3LUHA 3JAWB 1E58A 3PHBE 2CVOA 3WLPA 4FHEA 4ZMSA 1UWCA 1W49A 4EUHA 1KU6A 4ZXPA 4H7KA 2ZTLA 3CE6A 3R5JA 3M34A 1XEWX 4KMOA 3RSCA 5IWAB 1ZVVA 3BAFA 2G9ZA 1RYNA 4CLDA 1WLYA 5ES3A 1NVVR 4C22A 3F3SA 3TE6A 3CLUC 2PVCA 1Z7WA 1T15A 4N12A 1XL0A 4PWZA 5LPNA 1ZY2A 2ZYHA 5DM0A 3BXHA 2NO1A 5GMOA 3AB3A 4EA9A 4B8WA 1UC8A 2QN3A 3AJ9A 4GM0A 2IXGA 2ASVA 1R4MA 1GDDA 4HDKB 1UBHS 2D3TA 3OJCA 5AM1A 4L02A 3WKEA 5FADA 2JFGA 3DDOA 1D1SA 1KS9A 5E0OA 4B4OA 1E1NA 2WM3A 2I76A 2YJTD 2OHJA 2FE1A 2OO3A 4LTDA 2GCNA 4RF3A 3T41A 1ZOPA 3UF0A 5IAJA 2GQ0A 4GZLA 5E6RA 1KO4A 1OC4A 5DIFA 1OXUA 5DHPA 4UQLA 4R68A 1CY2A 1PX2A 1GSIA 2VSXA 3AUTA 4OA8A 5B2EA 4CL2A 3BOSA 4EW6A 2QLNA 2IS2A 3P97A 3B51X 3LVBA 3HFJA 1IULA 3LT2A 5AO9A 1M1NB 1TQ6A 3S2FA 5C7IO 1GU1A 4I55B 4CI9A 3GT0A 1V9LA 3ZWYA 3BZWA 1N2BA 3DVRX 1Y4UA 5KYYB 1U0OC 1NY5A 4R1QA 4CQMD 1ZH8A 3V7UA 1T43A 1SHTX 3D4BA 3MEQA 4KWCA 2X6QA 3LUAA 4LPKA 2DPLA 3TRKA 4D9HA 4DLLA 3OPVA 3DH0A 1NKSA 1JX6A 1SOUA 1TYCA 5FWYA 3A1TA 1Z5WA 5FBWB 1W75A 2Q50A 1ZESA 3CZ5A 1MB2A 3EDYA 4XH9B 1QKIA 4MUYA 5JVDA 2VZ9A 4UXIA 2GAAA 4BLWA 1X70A 2I54A 1G291 1KKMA 2BGUA 3QWBA 5JASA 3S1AA 4QPNA 4F2PA 2QZ4A 4HPWA 5HFAA 4C7KA 3DEIA 4BKPA 4Y2GA 2YY5A 1KYZA 3EJ6A 3PIRA 3PUWA 5AK6A 3W6PA 2V4UA 4FDMA 3ZDCA 1EGQA 1PJ8A 1DBIA 1TTHA 3OZCA 1UDAA 5JJ5A 2B4QA 2PX5A 3IT3A 4X90A 3KXKA 4B79A 1IUOA 1JT2A 4EL0A 4KR3A 1R3DA 2R6DA 2CNOA 4FR2A 1PCXA 1RCFA 4BP8A 1ZJWA 3I4CA 3VISA 1Z2PX 5BSGA 5ESXA 2JLVA 1EG7A 1RLUA 3F7NA 5T4FA 5ALJA 4LX0A 2I2DA 1HGXA 3WIEA 2W71A 3THOA 4B35A 2VK1A 3CFYA 1KYWA 4X1KB 2DXIA 5GONF 1CY1A 2VHEA 4X1IB 4ZT3A 4YV1A 3ZWPA 4AQYB 5EP1A 3TUIC 1JFFB 1BFDA 1RBZA 3CLSC 3IUNA 4G0ZA 2JEOA 2I66A 3EIOA 3G89A 4H7HA 2V8BA 5JLAA 1FTNA 3DD1A 3GP8A 1FJXA 1RRKA 5EZYA 3WHLA 1UQUA 2WWWA 5EXXA 2QVLA 1QHHB 4KCGA 3S40A 1N34B 1PEAA 4GYYA 4O59O 1JN0A 2P9QA 1CPYA 3WZMA 3SF8A 3HYSA 1W36C 3TPFA 1O77A 1A4RA 2H51A 3INGA 1L3IA 3KZ1E 1XB2A 2QROA 3R5XA 3U5ZB 2PK3A 1N3IA 5BORA 1K7YA 5J4KA 2NTNA 3MIIA 4OJTA 2OUIA 5ITZB 2YDXA 4W1RA 1DCMA 3F4BA 5J43A 5ALEA 3IAS6 1CDOA 3TTTA 4BVAA 1OXSC 4P7KA 2QAGC 3WQQA 3BHIA 3NHKA 2ZIUB 4PIPA 3KUKA 2O59A 3GA7A 2GYWA 3D81A 4ZOLA 3FM9A 1C3LA 4PPFA 1AV6A 1O94A 1G9TA 1WABA 3P9ZA 4GGPA 3UGQA 1Y1RA 1S7GA 5TQ2A 4EJFA 4YFVA 3QWFA 3C45A 1RDFA 2OXTA 4BO5A 3PFKA 2A57A 1T0HB 3UG6A 5TMBA 4PFJA 2RCYA 4H7PA 4YQZA 3RVKA 1UR5A 2CFSA 5CUQA 1W1WA 2WPDA 2LIVA 3GN1A 3GLIB 5EJ2A 3IBFA 3NJRA 3PQFA 2IZOA 1G3QA 2P41A 2X5XA 3GGPA 2B3DA 1P7VA 4OH7A 2VJMA 1YH3A 4DCOA 4OFWA 1Q0PA 2W2LA 3LZDA 2BF7A 3NHBA 3QVVA 1GVHA 4R2HA 1NRJB 4O2BF 3FOFC 2HRZA 5FTKA 4BVBA 1ZNZA 2ZB2A