4CM8A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
249
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 94
structure length 249
sequence length 267
chains with identical sequence C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm8A00
2Z95A 3ZU5A 4JJIA 2Z5LA 3UXYA 5COBA 3I4FA 4KZPA 5GY7A 4BB6A 4O0LA 4CLEA 3BHIA 3JQ9A 5EJ2A 5DP1A 3RKUA 3PWKA 2DFDA 4YYZA 1PJTA 4NJOA 5IF3A 5IZ4A 4FFPA 2H1SA 1HKUA 4R1UA 3F1LA 3WSVA 3W4JA 1F8FA 1GZ3A 2RHRA 3GFGA 3ROPA 3ZNOA 1A4IA 4RDHA 5JDCC 2ZTLA 1JN0A 2AQHA 2EF1A 1B8VA 4BGVA 3WNQA 3BMNB 1H2BA 3D0OA 3PWZA 4CLDA 1U3WA 3TZHA 1XELA 3SBOA 3IJPA 2BGMA 4EZBA 1C0PA 2X5KO 3B20A 2BD0A 3RQSA 3QVOA 1PS8A 3H2ZA 4FR5A 4OSPA 1WVGA 3E8XA 4RDIA 4K26A 2H9IA 1BVRA 4BQRA 4CMIA 3AI2A 3JYNA 4S3MA 4MVJE 1DRVA 4B7UA 5IXYA 1M75A 4TQGA 4DPKA 1PIWA 4ROSA 2Q4BA 3EMKA 1V0JA 3D4PA 4AG3A 4XDYA 3BYZA 1P74A 1M76A 3EC7A 3I83A 1I0ZA 3GQVA 3RUEA 3OETA 3JQ9C 3GG9A 3WYEA 2P4HX 5JC8A 4XB2A 3WBBA 1KY4A 1GQYA 4JNKA 4FDAA 4NJMB 1MV8A 1BTOA 5GZ6A 2IE0A 1U2GA 4N54A 2E6UX 3GVPA 3IUSA 4KDEA 1B2LA 2NTVA 4J1SA 4XD2A 3S2FA 2WE8A 4FC7A 2HK8A 3H9QA 4Z0HO 3BHJA 1F12A 4TKLA 2Z1MA 4KUHA 4CM9A 2JJYA 5EL0A 5ILGA 2JFGA 4BNGA 1HDCA 2YV1A 2EP5A 4FGWA 4IQ0A 2A92A 4WEOA 3RFXA 1I3KA 5L40A 1KYQA 2XF8A 1RJWA 4R1SA 1E3WA 2NWQA 4XQEA 4GX1A 3DEYX 1E3LA 3RJ9A 5J23A 1T2DA 1T25A 1LNQA 3GLQA 1B26A 3Q11A 4UVHA 5EESA 4EW6A 2IRWA 2CDBA 3G17A 1E7WA 1EVYA 5IDXA 4EEZA 2IZ0A 3JSAA 5A02A 5AXAA 2FPGA 5C3MA 3CE6A 2DBZA 1ZXLA 3WYBA 5IG2A 3D7LA 2DTEA 2C54A 2NQ8A 4WLVA 4E4YA 1V8BA 2D1YA 3VVCA 2Q1SA 4WNCA 1NPTO 1SEVA 1MXFA 4J90A 3ZWCA 2CDCA 4GBJA 3WFJA 3M1LA 3NJ8A 1BXGA 4H7PA 3FNFA 2FPIA 1YKFA 2PZJA 4NBVA 3MTJA 5BR7A 3UF0A 2NVUA 3F1KA 3ZCXA 4IDFA 4EBFA 3H2SA 5BNIA 4YB8A 4JX8A 2OXIA 5I7VA 4L4XA 4AJIA 4UUMA 1NP3A 3DFZA 1ZK1A 3EDMA 2C2XA 2OMEA 4L76A 3R3JA 3NTOA 1PJCA 4J4HA 3VH1A 2VHXA 1D8AA 3RUHA 1JVSA 4N18A 3O4RA 5KJ1A 4D45A 4NFHA 3A06A 4J1TA 4NIMA 3FPLA 1Y1PA 4XGKA 1IHYA 3BXXA 1I8TA 5HS6A 3GK3A 2XAAA 2UUPA 4DMMA 1QSGA 3V2UA 1GUFA 4O1MA 5LC1A 4FFRA 1EVJA 1I2CA 4MKRA 5KVVA 2V6BA 3E18A 5T8KA 4BNKA 1FDSA 3BTVA 4Q3BA 1ZJYA 1X13A 3EYWA 3ZWWA 4WLOA 3FPCA 4MP3A 5DOZA 3RC9A 3JD3A 4ALMA 3VKUA 1I2ZA 4QEDA 1QYXA 5JFOA 3ASUA 5TJHA 1XA0A 3BIOA 3LU1A 4Y67A 1RM0A 2PKQP 1LTHR 2HJRA 1N7HA 3LLSA 5IXSA 1UDBA 1HE4A 3RWBA 1KETA 1UP6A 2J5RA 4WKGA 1B16A 1E3WB 2DU8A 3GC6A 4BKUA 1VM6A 4MJLA 5G2OA 5KVCA 3GNSA 4ALIA 1I24A 4B3JA 1LA2A 2O3RA 4PG4A 4WLFA 4ALLA 2D5AA 3HDJA 3PIIA 5T57A 1KIFA 4MDHA 4MVJA 4YJHA 5EMHA 4II3A 1UDCA 2VWQA 2VRBA 4R3WA 2O50A 3UICA 3WBFA 4DWVA 4R41A 3JQGA 3JQFA 4M49A 2PGJA 5T8KC 2O3JA 2V65A 3GH3A 1E1NA 3RVDA 3IMFA 4GWKA 5FF9A 1EBUA 4E2ZA 1P33A 3WXBA 4G65A 1LDNA 2Q99A 4BKOA 1BXGB 4ND1A 4RF4A 1YBMA 3RU9A 1Z7BA 3Q1LA 4WGGA 3VZPA 3GUYA 3RI3A 4Q39A 1AHHA 4R1NA 3KTDA 2NVUB 3RJ5A 1T4DA 1P1JA 1VL8A 4FD3A 4IPTA 1P1FA 4UUOA 4DC0A 1ZK2A 2GLXA 3PPIA 2X58A 5DBIA 2FZEA 3ZWVA 1YB5A 1R37A 2CVQA 3ZW8A 2HDHA 3U0BA 1YWGO 2ZB4A 4IDAA 1LUAA 3ENKA 1LRKA 3ZDFA 4DXHA 1VJ0A 2O3SA 3DC2A 4B7CA 2CFCA 3M6IA 4GVXA 1B7GO 3QV1A 5L7WA 1NNUA 3C3XA 4XR9A 5K0ZA 3UVEA 2FR0A 1VJTA 1D4FA 5T67A 3ZNPA 3TF5A 4M54A 4I9NA 2HK7A 4FIZA 2XOXA 3Q6IA 5KKAA 3NV9A 4L75A 3JD2A 4Y9DA 3N58A 5TJ9A 2JAPA 3Q9UA 1E6WA 4H16A 1XR3A 3JQFC 7ADHA 1E7MA 1WP4A 2Q50A 2J3IA 3H9EO 3UKOA 1K0UA 3DOCA 3F4LA 4BKPA 2IYPA 1N2SA 1R16A 2BFPA 1IUKA 1PJSA 2YW9A 2BI8A 3WTCA 1RPNA 2QRLA 4HFMA 3X2FA 1QXSA 2PZLA 1NR1A 1E7QA 1FDVA 3G49A 4OXKA 5TQVA 1Y8QA 4CMAA 2PNFA 5BSGA 3SEFA 3GAFA 1NTOA 1X0VA 3BTOA 1Q7CA 2OP0A 4OOEA 4BMVA 3B1JA 4YRDA 2V7PA 2W2KA 1VJ1A 2F00A 3OA0A 4A03A 1ENZA 2NU7A 2P5YA 3RUDA 4R5MA 1SPXA 1C14A 1SCUA 3HHPA 4J49A 4MP6A 2O7SA 3QY9A 4WE3A 4AJ4A 3U09A 4YJHB 3C1OA 3WQQA 2D2IA 4XGNA 1UXKA 2GGSA 4B3IA 3JQGB 4X54A 4DLAA 3D3EA 3D5TA 3GGOA 5JPIA 5HRUA 3NRCA 2Y1CA 5IZCA 1E7YA 5TSDA 2EIHA 2H5LA 1XWFA 4PLYA 4BNJA 4E30A 3PFWO 1KBZA 2O4UX 4CM6A 4RORA 1OC2A 4NU6A 3GA0A 3QQPA 1QYDA 1ONPA 1ZVMA 2E37A 4NR0A 1TT7A 1YB1A 3QWAA 4B3HA 1FDWA 2QZZA 4ZD6A 3NGLA 2C5AA 1DIHA 3CSDA 1R0SA 2PZKA 3AY3A 1PWXA 3PGXA 1BG6A 5CHEA 4RVSA 3NDJA 4TRMA 4UULA 3TZ6A 2ET6A 3D4OA 3DBRA 1XLTA 3AM5A 1HYGA 3OJOA 4OKNA 1LBEA 2VHVA 1NQOA 2G5CA 4DLBA 4FS3A 3N74A 2WJPA 3FHLA 2FMUA 2DLDA 4FFLA 1ISGA 4IDDA 1Y9AA 3H65A 3WX0A 3VHRA 1R12A 4II2A 3QSGA 4CM9D 3ZNQA 4A5OA 4CMCA 4WOKA 5A06A 3H9UA 1HDRA 3JYLA 5CDSA 5A03A 3IIEA 2GNAA 4J7UA 3NT4A 3QA9A 4CPDA 5IZCC 4GLLA 1YGYA 3MOIA 4BO3A 3TL3A 4WLNA 4ZGWA 1KVUA 4ID9A 3COSA 4Q3NA 4J91A 4U5QA 3O8QA 3NDRA 4J0FA 1PX0A 4K28A 4GWGA 3DHEA 4N5LA 4R5HA 2FWMX 2PH3A 1O8CA 1Y8QB 1ONNA 3VPHA 2UYYA 2BKAA 4FJ1A 4OYRA 1QV6A 4TRRA 3ZWYA 4DIBA 1BRMA 4DUPA 5A3JA 1MX3A 3MWEB 2IODA 1PR9A 2W2KB 3AFNA 3KOUA 3W4IA 1UZLA 1ZCJA 4TZTA 1E77A 3VH4A 3ZWPA 4Z3DA 3F46A 4WPGA 2YQ5A 3IP1A 1V3UA 3HDQA 3TDKA 3PJEA 2EHDA 4E3ZA 4G81A 1T4BA 1CDOA 2X7HA 4GLOA 2EW2A 5ENVA 2CDAA 1CQIA 5TS3A 4RVDA 3RSHA 1O6ZA 5JY1A 5L45A 3R3SA 5I9NA 3LF1A 4XA8A 3AFMA 1R4NA 3D5QA 1OMOA 1HDXA 1PL6A 2GD1O 4YJFA 2CSUA 1TB4A 2PWZA 1DJNA 2Y68A 2Y1GA 3ICPA 4GMGA 3I9LA 4AJ2A 4PLFA 2DBVO 1I36A 3GVHA 3DONA 4DQXA 1OOEA 1WNTA 4RL6A 1ZSVA 2C20A 1O94A 4GX2A 4YVFA 5AXCA 3FD8A 4IJWA 3DMTA 2GUGA 3UCEA 4GAEA 4CM1A 4NG5A 3C7DB 4QXMA 1XIVA 2BFAA 1O89A 4HADA 1NYTA 4NBRA 5DP2A 4BOYA 2JD1A 4UVIA 4XJTA 2GERA 1CIVA 2VHYA 2X6TA 3DBRB 4TMFA 5IDQA 4BNTA 1LDMA 4HP8A 3VC7A 4E2XA 3JQAD 1RYDA 3PJGA 4RPGA 1XQ1A 4H15A 3S2IA 4BUCA 5JC1A 4I1IA 5CDYA 4LISA 2A9FA 3QHAA 5IDWA 2GN8A 4NFYA 4I9UA 3H7AA 3K30A 4A26A 2VQ3A 4BO7A 1GQ2A 1HDZA 3KSUA 3WWYA 1V3TA 4IJUA 3VPGA 3TL2A 3GDOA 4CJXA 2VNAA 5A9TA 1I10A 1X14A 4MVJM 4XEHA 2Q3EA 4DMLA 2BHLA 3NEPX 1UXJA 1S6YA 3TOZA 5ENDA 3C7AA 3NKLA 1BMDA 1T26A 1IZ9A 2I65A 4CM4A 2C7GA 2FHSA 3O8QB 3WGTA 3DMTC 3FR7A 3O38A 3O03A 4R51A 3WS7A 4DVJA 3I23A 2ZB7A 2ZATA 1LU9A 1E3IA 3PJFA 4MVJD 3OIFA 1E7RA 2ZYDA 1GCUA 1PZGA 2HMWA 1N1EA 3LYLA 5COAA 1M67A 1GAEO 3B1KA 3IOYA 2QYTA 4TSKA 5F5LA 1ZZEA 2QRJA 1EFLA 2O7QA 2R6JA 3WGZA 3BA1A 3PRJA 8ADHA 1WDLA 4RGBA 1A4UA 4Y6RA 4MVJG 1GL3A 2Q49A 2IEBA 1JKJA 3A28A 1U7HA 1LX6A 3VH3A 1QORA 3PJDA 2BF7A 1Y5MA 2PA3A 5KJEA 3KEQA 3G1UA 1T1RA 4E2WA 2A35A 3QRWA 5FI5A 4WASA 1R4NB 3CZMA 4ILKA 4YJFB 3JV7A 4YA6A 4XRGA 5G4LA 1ADFA 1FMCA 4IQ8A 4OGWA 2CY0A 1IOLA 2I3GA 1NR7A 1PJQA 3EVNA 4CMEA 4HKTA 2EEZA 4EEXA 1U9JA 4QO7A 4ZHSA 4NK4A 2GASA 4XDZA 4AJOA 1OC4A 4J1QA 1E3JA 4JJFA 4UUNA 1E1KA 2PK3A 2ZKLA 2F1KA 3JQEA 4TROA 2XXJA 4Q3AA 1H93A 2HMUA 1ISMA 2DTDA 3RU7A 1OBFO 1A7KA 4L4SA 1L1FA 3GF4A 2HK9A 2DM6A 3EVTA 4J43A 4EJMA 2NTJA 2PGLA 2WYUA 4XYMA 3EUWA 2Y05A 1QYCA 1GZ4A 1ARZA 2BMAA 2D8AA 1KEVA 4KTTE 2V6MA 2VYND 4GGPA 4RVGA 1I3NA 4RO0A 1X0XA 4ZQFA 3DL2A 3ENNA 1RKXA 2E4AA 4XR4A 4AJJA 3V2GA 2AE2A 2FR8A 4OM8A 4QSMA 1ZK0A 3QVTA 1Z74A 1I01A 3ZV6A 3UW3A 1X1TA 2WDZA 2H63A 2XXBA 4UEOA 4CM4B 4E6PA 4AL4A 1XSEA 4CMEC 3F5QA 2WM3A 1DHRA 3KV3O 1A72A 5JO9A 4IZIA 3H9GA 4KDFA 2X22A 3NAQA 5KJFA 4CUJA 4OMUA 4FN4A 4HUJA 4DPLA 2IYOA 4MP8A 3TOXA 5JSFA 5JAZA 1UXIA 3Q3CA 1RM3A 3FCOA 3JQBA 3GEGA 3AUAA 5LDHA 3HZZA 3JCZA 5B4UA 3F47A 3JQDA 3AWDA 1EVZA 2Y0DA 1VSUA 4DTIA 2GSDA 2AE1A 4BO0A 4D42A 3RAJA 5KNLA 4JP2A 1LLCA 3MCVA 1P0FA 2QYSA 2PD4A 4Y98A 4YAGA 2NLOA 4CM8A 4XX0A 5TRTA 1PGPA 4FQ8A 3KLMX 5U9CA 2UDPA 2P91A 4E5MA 3S55A 4IY1A 2JCXA 1YXMA 4J2HA 5G0WA 4B4WA 5B37A 4B8WA 1IYZA 3N7UA 2EKLA 3NT2A 4GGOA 2BGLA 1P3DA 1LDBA 1H6BA 4I9HA 4CMBA 2VYVA 4LMRA 4BNXA 4Q3EA 1QKIA 3VDQA 4CQMA 3JD4A 4L8VA 4CL3A 3AUUA 2NU6A 4E32A 1DPGA 4R9RA 5DBFA 2DC1A 4F6LA 1J0XO 1WLYA 1LRJA 4IZHA 1Z75A 2OBYA 1LXCA 1Y7TA 4BNNA 4C4OA 2GZ2A 2VHWA 5DF1A 1Q7GA 3JQBC 3LC1O 1F06A 3STHA 3R1IA 4LCEA 3ROMA 4EITA 3UAGA 3UUWA 1Q1NA 5BT9A 2NNLD 3DAFA 3CINA 2AG5A 4YBZA 3EHEA 2WD8A 3CMMA 2AEFA 4BO6A 1VRWA 1PJLA 4ALNA 3DZBA 5ITWA 2EKQA 3ADOA 3W8EA 4AJLA 1PS0A 3BHMA 3ZN2A 4WUVA 4FBGA 3PIDA 1ZNQO 4O6VA 4WLEA 4DGSA 2B35A 2DPGA 3GRKA 3OMLA 3L07A 1UZMA 2NV6A 3AM4A 1MP0A 1QG6A 1PGJA 2Y93A 1A9YA 3ORFA 4P4LA 1H5QA 5EIOA 2HMVA 4L0QA 1KEPA 4PG6A 2X4GA 1YOVA 2CF6A 3UCXA 2HAEA 3PFFA 5G4KA 1YRLA 4FJ2A 4W9NA 1Y81A 1LQTA 4PLPA 3U4DA 1SO8A 4BO2A 4R3NA 1UAYA 1WZIA 3OEWA 4GQAA 4NHEA 3OEYA 3E5RA 1NM5A 4NQZA 4DIFA 1Q0LA 1D1TA 3OFSA 4HWKA 5F1KA 1RYEA 4CM8B 1RM4A 3ON5A 4CL8A 9LDBA 3FBTA 4LVCA 1LDYA 2FZWA 1L7EA 5IN4A 3WLFA 5THKA 2WTBA 5KTKA 2P9CA 2WE7A 2Y66A 4WNIA 4PRKA 1OI7A 5C7IO 3I6QA 4M55A 4OIMA 4PLCA 1CJCA 4YJGA 1G0OA 2PLAA 1DAOA 4KQXA 1U7TA 4DBZA 3OH8A 1WWKA 3IUPA 3WMWA 1PGQA 1ZO8A 2NVBA 2SCUA 2QQ5A 4CQMB 1HZJA 4BGUA 3AUSA 5DNAA 5JAIA 3GEDA 3DTTA 4NK5A 1R66A 1ZFNA 3P7MA 5CEFA 3V1TC 3I1JA 4CV0A 2DBRA 4ND3A 1O95A 4W6ZA 4W9NC 3FWNA 3L6EA 4OXNA 3INTA 1XKQA 4Z0TA 4FOSA 1W6UA 4ZRNA 4DL9A 2NTNA 4IGFA 1SAYA 4OHUA 1CF2O 4GH5A 4URFA 5CPBA 1NHGA 1XYGA 1NVGA 2IZZA 4BNHA 3OQ1A 2YQ4A 3PQDA 1E7SA 4FFOA 4UVEA 4BNZA 2HO5A 5JCJA 5BSEA 3JQ6A 4GKVA 2PFGA 1H9BA 1EUDA 5G0UA 1B3BA 4PLZA 1Z73A 3NUGA 4P22A 4CMIB 1HT0A 4MIOA 2AQ8A 5CEEA 5F5NA 4RQUA 2EXXA 3FWZA 2HRBA 2YV3A 5I8WA 4RF2A 4R1TA 4BO8A 1HSZA 1LLDA 1U8XX 1NBOA 2X9GA 4M87A 3KB6A 2G17A 4LRSB 5ILOA 1LI4A 2EGGA 3KLPX 5IN5A 1YOVB 3LK7A 4R16A 5G4KB 3GOHA 3CIFA 4E5KA 1QV7A 3H4VA 3HG7A 2VT2A 1HZZA 4WCFA 2B0JA 3EGOA 5L7YA 2H6EA 3LZ6A 5A4DA 4NU5A 4B7XA 2PY6A 5A3VA 4D0SA 2AXQA 2BLLA 3M1AA 2EG9A 3AY6A 3JQAA 5C7LO 1XDWA 1HLPA 1DIRA 3SVTA 1Z6ZA 1WMBA 1XCBA 3VZQA 2W98A 4BNLA 2O3QA 4DC1A 4LW8A 1HEUA 3FNGA 3I9KA 4A27A 1GPJA 4L73A 3KZVA 5T6BA 2B4TO 4E13A 4Z3KA 3K92A 3DBLA 3VAZA 2Q2VA 4LRTB 1N7GA 3H3JA 2JCVA 4YQZA 3C24A 1Y6JA 1A27A 3KEOA 3VTZA 4GSKA 2Q4EA 4JXKA 1PQPA 1I2BA 3ZWOA 2AG8A 5GZ3A 4JBHA 4YJGB 4CODB 3RBZA 4IDBA 1GD1O 2GZ3A 4Q3DA 4YEDA 2RH4A 3IJRA 1EE2A 1ZW1A 3VKVA 4GX5A 1H6DA 4KWIA 2VT3A 4PG7A 5IDYA 4EI2A 3HB5X 2HKIA 5A5EA 4WCFC 3MWDB 3WGYA 5HM8A 3OHSX 1HXHA 2YFHA 2IDZA 3V1UA 1B0AA 3MJCA 2GCGA 3RUFA 3FF4A 4OH1A 5DCYA 4NZ9A 6ADHA 3GDFA 5TLSA 4FC6A 3GPIA 4CMHA 4XYLA 1P1KA 4J3FA 4U0JA 3ZWAA 3Q2KA 3QP9A 3U5TA 1BDBA 5GZ1A 4R54A 2CVOA 4O5OA 3ASVA 3JD0A 3R6DA 4JP3A 1XHLA 1JQBA 1ENPA 3E48A 4NPCA 4S1VA 2OUIA 4A0SA 4J7XA 3L4BA 2ZB3A 4BB5A 2NQTA 3A14A 3LF2A 2WEKA 4PGFA 2FOIA 1CETA 3GN2A 3ZV3A 4PIVA 1YH3A 3DZIA 1DIAA 3PEFA 3GMSA 1VKNA 4WCFB 1NFQA 2GR9A 1NFFA 3VZRA 3WJ7A 3RASA 5TT1A 4FSHA 4JJGA 1XG5A 5ITVA 1HDYA 3E03A 3JQAB 1V6AA 4HXYA 1E0DA 1GADO 1I32A 2VYVD 1ISHA 5L51A 4IMRA 2ZTVA 2W2LA 4CQMD 1PU2A 5DN9A 2NUAA 1JU9A 2CZCA 1N5DA 3MTGA 2E82A 3DBLB 4BHTA 1IPFA 3AOEA 3KO8A 4I5FA 2VYNA 4J9VA 2WYWA 3RROA 4WK6A 3AJRA 4Q9NA 2QW8A 4NBTA 3QWBA 1ZJZA 2X0RA 2BI7A 2B83A 3L4BC 5EPOA 1M6HA 2J3JA 4RZHA 5KJ6A 2PD3A 1WPQA 1GDHA 1YQXA 2IZ1A 4AJHA 4RVHA 1IPEA 1EBFA 4RQTA 1NX6A 3GDGA 3FN4A 3EY4A 3WWZA 1HE5A 4XGIA 1U1IA 4L9RA 1VC2A 2O4CA 1JA9A 1KVRA 2B5WA 4QTZA 4Y6SA 1WW8A 4OQYA 1UXGA 4ZU3A 1X1EA 4UVGA 1GPDG 2X23A 2AA3A 3O26A 3PI7A 3VVBA 2OGUA 4D41A 4A10A 3L6OO 3ULKA 1U8FO 5A1TA 2E48A 3I9JA 5CDUA 2VWPA 1EEHA 5EERA 4WJZA 3JQCA 4RV9A 3HFSA 4MVJF 5HBRA 3S2EA 1EE9A 3KHUA 3LT0A 2NM0A 1N9GA 1GY8A 3ITDA 4R9SA 4IIVA 3AOEC 3TNLA 3VPSA 1PGOA 2B5VA 5CG2A 5I8ZA 4CR7A 2JHFA 2AEMA 4OJNA 2I6TA 4WLUA 3DBHA 2QRKA 3ONDA 3RCBA 4FFNA 3PZBA 4BO4A 1LSUA 3WB9A 1G6KA 4QQRA 2VZ0A 5TIIA 2RH8A 4AJEA 4R68A 1A5ZA 4F46A 1EVIA 1HE3A 3WIEA 2JD0A 5AXDA 4MVJH 2ZQYA 4YJDA 1ZSNA 2YFQA 2O23A 4R69A 1TVEA 2I67A 5JMWA 4BNUA 1R0LA 3WNVA 4XYEA 2Y0CA 1DO8A 2WYVA 1F0YA 1JTVA 1LLUA 1YS4A 4Z9YA 5JCXA 4UEKA 4B79A 2WSBA 3DFUA 1E6UA 1LEHA 3GG2A 3BMOA 1WDMA 4XYGA 3WG9A 3PZRA 1M6WA 3JYQA 3GEMA 2NSDA 2PTGA 3U9LA 4J2OA 1NASA 1O0SA 4LK3A 2ZCUA 1GTMA 2C07A 4OKIA 1KEUA 4BNWA 3EZYA 1K3TA 4UEJA 2CMDA 3LC7O 5JY6A 2RIRA 2R00A 4WEQA 1GCOA 3K2EA 5KVQA 2Y1OA 1YONA 4UUPA 2Q2QA 1IHXA 3GNQA 2O3UA 1P77A 1BDMA 4GX0A 1A9ZA 4JLWA 5JMPA 1PWZA 2G76A 4EUEA 3PP8A 1P1RA 3ZV5A 4RZIA 3PHIA 1P45A 5JCJD 4CMGA 3QJ5A 4D3DA 4EJ0A 2EW8A 3LT1A 1AHIA 3KXDA 1YO6A 4QX6A 2G0TA 1LDGA 3MJTA 4JIGA 2I99A 4EUHA 5TGDA 3EZLA 2YV2A 2X9VA 1R0KA 5IAAA 2GF2A 2UVDA 1HTBA 3F6YA 1BXZA 3PYLA 4BKQA 4K6CA 3T4EA 3DXFA 1PR3A 3E9NA 4W82A 5CP8A 4QO8A 1N9GB 5C5IA 2C5EA 4G2NA 2YJZA 2ZJ0A 3A1NA 3ZWNA 3QVSA 2VNSA 2VUUA 3NDIA 2HLPA 3DMYA 1G1AA 1DC3A 1K6JA 3DBHB 3VPFA 4XQ9A 4AJNA 2RBEA 1VLLA 4AFNA 2DPHA 3PDJA 4DRYA 4FB5A 1SOVA 2R00C 2OL4A 1MC5A 4N5MA 3DB2A 4J1NA 4CV3A 3ZHXA 1YL7A 4P8RA 1XU7A 5ICSA 2GN6A 5JLAA 4CV2A 1GUYA 3ROKA 4BO9A 1Y5RA 2GN9A 1JDJA 2HJSA 1GR0A 2E49A 1DRUA 3MJ4A 3NTRA 4ZRMA 3WMXA 4YR9A 1K5HA 4RPJA 4CQLA 4KQWA 1KY5A 2NACA 5JW6A 4IXTA 1WZEA 4PLGA 3PHLA 3ZZNA 4BNMA 5BNFA 3C1TA 3QWHA 3RKRA 2UV8A 3UH1A 1B15A 3AY7A 4YT5A 5JYDA 4L4RA 2ILTA 2ZB8A 2IXBA 3KRTA 3AW9A 4NI5A 1ZSYA 1LRLA 2FY8A 2QX7A 2ZQZA 1HYEA 3ZHBA 1KC3A 3AK4A 3BMOB 2VWGA 1C1DA 1Q7BA 4CM3A 1SB8A 4XWYA 1ZEMA 2I66A 2UAGA 3GVCA 2O3TA 2Q1TA 3KYBA 4M86A 1E6EA 4JCOA 2R2GA 3TZCA 4RF3A 2JAHA 3FSRA 5HA5A 1Z45A 3VTFA 5L4LA 1YE3A 3Q9NA 4TVBA 1U2DA 3HWRA 3GY0A 1P1HA 3BAZA 1Q0HA 2AEJA 3L0DA 4IXWA 4UAGA 3WFIA 3H8VA 4IJVA 5DT9A 4BNVA 2X0JA 5HTOA 2JL1A 4YXFA 3WR5A 3FR8A 4JBGA 2VUSA 1J6UA 3OF2A 1HETA 3E82A 3ST7A 4BS9A 1UJMA 3QWIA 3SJUA 2W4QA 4YACA 1GFSA 4ND5A 2DBQA 1VPDA 4ZVVA 5L9AA 4IDEA 4UVDA 3KSZO 1DIGA 4OSOA 2JFFA 1FK8A 5HS4A 1LSSA 4PG5A 4P4GA 3CEAA 4IUYA 3W6UA 4B8ZA 5IJZA 4QFCA 3SC4A 3TJRA 5F3RA 3ZU3A 4CUZA 1GQQA 1LSJA 3WGHA 4BL5A 3E9QA 1SZJG 3PK0A 1EZ4A 2X0NA 3TWOA 3PGJA 4NNJA 3TPCA 1VKOA 3MEQA 3TQHA 3UHAA 4QFDA 3W8DA 1UDAA 3HDHA 4IBOA 3L77A 1AUPA 3QLJA 2X5OA 4KMSA 2EV9A 3IL2A 5CG1A 3ADPA 1E5LA 1YBVA 3OSUA 3F3SA 2W2LD 3I6IA 4OXYA 2VRCA 3WGOA 2HCTA 4I5EA 3NJ4A 1PTJA 5I7FA 3GZ4A 3OJFA 4XIYA 3P2OA 3PVZA 1TI7A 1HE2A 3DZFA 1MFPA 3ANLA 1MA0A 1GV1A 1YBAA 4CQLB 8LDHA 3T7EA 2OBNA 4YQYA 1FJHA 1JWAB 3H9JA 3VH2A 4D43A 4ZQEA 1R4MA 4MKZA 3DO5A 3GVIA 1C1DB 2EJVA 3OA2A 3OJLA 1JLLA 4PVCA 1YJQA 4Z0PA 2ZIZA 4DQUA 3NYWA 1CERA 3PWSA 4YT4A 1NQTA 4J16A 1NVMB 4XQGA 1T2CA 3ZHYA 2AQIA 5CAEA 4E5PA 3WQRA 3DOOA 5KOIA 4ZICA 4QECA 3DAPA 5JO0A 2HMSA 1ONOA 4TWRA 1T1SA 3TFQA 2O2YA 1EQ2A 4BNFA 4PLVA 5DDIP 5KIAA 3HE3A 2AHRA 4ESOA 2OHXA 4GI2A 3SJ7A 5L95A 3MZ0A 4G5HA 3PLRA 5KVSA 1XQ6A 4AJ1A 1QLHA 2ZCVA 5LDGA 3NGXA 1ULUA 3W6ZA 5MGBA 1M66A 3GUCA 3ZWMA 5KJCA 1LC0A 1E92A 2BFOA 2YDYA 1EK6A 1NAIA 1NPYA 2A4KA 4E5YA 5T64A 1PGNA 1X15A 2JKVA 1YVEI 3W8FA 3I9NA 4NFSA 4MPDA 3MJVA 2NU8A 4DLLA 3SXPA 1LLQA 3OIDA 4NBUA 4XZ3A 1PJ4A 2HRZA 3GPDG 1YJ8A 2C59A 4U8GA 1OAAA 2V6FA 4HFNA 2X9NA 4AICA 3HFGA 1B8PA 3I4CA 3GHHA 4GPD1 4NH4A 3ZWXA 5KCZA 1CEQA 4YAJA 4B4VA 2W90A 5COQA 3WLEA 2DUWA 3FTPA 2ZTMA 3OIGA 3INRA 1Z82A 4FJ0A 1EQUA 2GYYA 3F9IA 3M2PA 5A5FA 4HV4A 1V35A 3V8BA 4ZA2A 3GHYA 3FNEA 1H2HA 3HQ4O 2CNBA 4IIUA 3RFTA 1X7DA 4KUGA 4F6CA 5EQFA 5AOVA 4AVYA 1DC6A 1E1LA 4J0EA 4J4TA 1GYPA 4MVJP 4MVJI 5AYVA 1R4MB 3ZU2A 2JFHA 4M1QA 2C2YA 3T7CA 3PTZA 4OL9A 5IFLA 4RCVA 1H6AA 1I3LA 1VI2A 5TX7A 1KVQA 3C1AA 2I5PO 4RJTA 1GYQA 4W4TA 1PEDA 1E5QA 2B69A 3L9WA 1E1MA 1XU9A 3K73O 1ML3A 1D7OA 2FPPA 2HUNA 4R4JA 1DC5A 2C0CA 3ZWBA 1FDUA 3LDHA 4YRBA 1IL0A 2PKRA 4FPXA 3RIHA 1QYWA 1MC4A 4D3SA 3ETDA 5G0SA 3ZNNA 5JDIA 5F21A 4HX5A 3WDSA 2FSVA 3GR6A 2DFVA 3LSYA 4EYEA 4D7AA 4LGVA 3VPXA 4ZN6A 3A9WA 3K6JA 1Y9EA 1OFGA 2B37A 3FRJA 3H5RA 5F1PA 4CUKA 4D46A 2X1HA 1W8DA 4OOFA 1H6CA 4I5DA 3CTMA 2DT5A 1U3UA 2VTEA 4A7PA 5MDHA 2P68A 3ONFA 3PLNA 3KSDO 3K31A 5U4QA 5TF4A 1ISIA 2ZJ1A 2PKQO 1PJBA 2IEDA 1BWSA 4ND4A 3RUAA 4EJ6A 3WJAA 4XQCA 5GMOA 1U5CA 1MUUA 2Y1EA 3A4VA 3TRIA 2YYYA 2P2SA 3G0OA 1BXKA 4TRNA 1HSOA 1TT5A 3B6ZA 3SC6A 2DVMA 4W7HA 2OORA 5FWNA 2CF5A 1V9LA 1M2WA 4HNHA 3GGGA 1SNYA 4TZKA 4W99A 3IAHA 2LDXA 3PQEA 3K5PA 4JQCA 1F17A 5KWEA 3KYDA 4MKXA 5JDIC 2J5KA 4O59O 3I9OA 1U28A 3RC1A 2Y67A 3IP3A 4K1LA 4P4NA 2P4QA 3I3OA 1B14A 2HQ1A 4DPMA 1BVUA 4U6QA 3CKYA 3IC5A 2WMDA 1KERA 1ZBQA 1ZMTA 3HN2A 1AN9A 1HL3A 1QMGA 4M8SA 3L4SO 5THQA 4GSLA 4Z6KA 3QIVA 1SEPA 3K8ZA 3ZGYA 4MINA 1QR6A 2O48X 3PHJA 1CYDA 1DLIA 2J5QA 1IY8A 4A2CA 4U6SA 2C29D 2VCYA 3AI3A 5EQDA 1VSVA 4PLHA 3K9QO 2EKPA 3I52A 4PZCA 3D4NA 1KVSA 1TEHA 3GN1A 1KOLA 3RUCA 3JYPA 4BV9A 3UGKA 4BO5A 1VL6A 4PRLA 4KP7A 1AGNA 2J3HA 4D0RA 1FF9A 4Y6PA 1H0KA 1HLDA 5L7TA 1ZK4A 5FFFA 4CM5A 4HBGA 3JQ8A 1MLDA 5EINA 4BKRA 3K96A 1PZFA 4JK3A 4M89A 4WECA 1J4AA 3G3EA 4JROA 1UP4A 3I5MA 3INGA 4BO1A 1OZAA 3JYOA 4QT0A 1UZNA 4EGFA 4JGBA 1DOHA 2GZ1A 3E6AA 1X7HA 2VN8A 4KUEA 3CMCO 2ZTUA 3R0IA 1K89A 1UUFA 3KBOA 3BTUA 4WCDA 4C7JA 1JWBB 3W4KA 4B4UA 3CZRA 4XYBA 1IZ0A 2ZYAA 1P1IA 3LT2A 1F14A 2VRCD 4UREA 3Q0EA 4IDCA 2GRAA 3E1KA 3OQ6A 4IS3A 1U3TA 1Q0QA 1TT5B 1E3EA 3ZU4A 1P0CA 1YQDA 3B1FA 5L4SA 3WOHA 4EUFA 2BFMA 3JTMA 1O9BA 2JD2A 4IM7A 4A73A 3ANMA 3WTBA 2QG4A 3OJEA 5ES3A 2AMFA 3RBXA 2NVWA 2VHZA 3JD1A 3KYDB 4XIJA 2D5CA 3E9MA 3VDRA 4ZQHA 2I9PA 1MB4A 1SOWA 3GVXA 1PQWA 3T4XA 4CR6A 1GEGA 4N5NA 3IKTA 5C7OO 5AXBA 5TNXA 4E12A 3H5AA 4DYDA 1B3RA 5H82A 4J9UE 1DRWA 1ISJA 3ITKA 1NHWA 3MJSA 1BGVA 3H5NA 1P31A 2DAPA 5JAMA 1Q2XA 2YHUA 4MOWA 4DYVA 1DC4A 4IDGA 3JQ7A 3VZSA 3U3XA 3DZGA 3SLGA 5FEUA 4FW8A 3UFXA 1YL6A 4Z9FA 2B4RO 4YRAA 2YY7A 2OZPA 4RF5A 3EW7A 3ZHZA 1HDGO 1QYVA 1N8KA 3LQFA 3WQSB 4KOAA 1IE3A 1W4ZA 4LSWA 3GRPA 2W8ZA 3MJEA 5HWSA 1ENYA 1FDTA 5I7EA 1YDWA 3HJAA 9LDTA 1W73A 4LSMA 1KC1A 4BVAA 3ZH2A 3JQ8B 3ETGA 5DCUA 1K6XA 5H81A 4CMJA 5KKCA 2TMGA 3TSCA 3PXXA 4GMFA 1I30A 1JW9B 1JAXA 2X86A 4OO3A 4HNGA 5H83A 2J8ZA 1GU7A 1T2FA 4O63O 3U4IA 4RVFA 1V3VA 2FN7A 3OJ0A 3BTSA 3OBBA 3P19A 4YT2A 5K9ZA 3M2TA 3RC7A 1BHSA 2PR2A 5TC4A 3QW2A 4E33A 1HDOA 3IDSA 4DIOA 1JVBA 4TRJA 2DTXA 4CM7A 3WICA 1EK5A 4CR8A 2DKNA 1NFRA 1WXDA 2B36A 5I9LA 1ULSA 1XGKA 3GFBA 1O5IA 5BQFA 2D59A 1ORRA 1DJQA 2I76A 3IS3A 2BELA 1IULA 4E5NA 2IXAA 3PQFA 3Q2IA 2LDBA 3S1LA 4Q3CA 3NX4A 1U5AA 4FCCA 7MDHA 2EGHA 5DULA 3HN7A 4E21A 2GDZA 4JBIA 3C8MA 4PFJA 5EN4A 1EMDA 1H94A 2ZYGA 5FI3A 5A04A 1PJ2A 3WGQA 2EWMA 3FI9A 4OAQA 1DSSG 4RLHA 3G1TA 1LJ8A 2D0IA 1PL8A 3X2EA 3WGIA 3OICA 3WGGA 3S2GA 1CWUA 3ZI0A 4XRRA 3DR3A 4NDNE 2D4AA 4TVOA 1JAYA 4F3YA 5LCXA 3H3FA 1EFKA 4LN1A 3ROQA 2BGKA 3O9ZA 3IKVA 4IJKA 4QUKA 4PG8A 4BQPA 2VUTA 4FGSA 3RUIA 4C7KA 3AOGA 3JQ7B 3GGPA 4MIEA 4YAKA 3QE3A 1JKIA 2BRUA 1C0KA 1ID1A 1DFGA 4XJSA 1PJ3A 2B4QA 3AI1A 1C1XA 1G0NA 2Q2WA 1KEWA 2HSDA 3DOJA 5CFZA 4CLHA 1UR5A 1YDEA 3L6DA 2D3TA 4YWJA 3B70A 3TFOA 4PVDA 1TLTA 1T2AA 3TN7A 2WD7A 5CDGA 3KETA 4DREA 5JE8A 1AXGA 2CUKA 3GNTA 4XCVA 1BSVA 4I5GA 5ER9A 1W0CA 2Y0EA 1CRWG 4YTEA 3V2HA 1D3AA 2FRDA 2CVZA 1ADGA 4RVUA 4BMNA 3CUKA 4HFRA 1HF3A 1LC3A 2YUTA 3RD5A 1GEEA 4NBWA 4J4BA 3W1VA 1DBVO 2P9EA 2A94A 3LC2O 4GL4A 5A9RA 1RWBA 5TT0A 3GZNA 1I33A 1SB9A 1HWYA 1DEHA 1Z7EA 5G0TA 3NT5A 2WWRA 1NAHA 4I08A 4EDFA 4I8XA 1U4SA 3QVXA 3DZJA 4CLOA 2VZ9A 2J3KA 4PN3A 1MG0A 4XKJA 4KTVE 1DHTA 1ENOA 2UUOA 2VWHA 2X8LA 4B4OA 4CV1A 3TZKA 3H6KA 3RFVA 5CPFA 2G1UA 1IB6A 4E0BA 4Y8VA 1ZIDA 1ZUD1 4JN6B 2DQ4A 1UAGA 3BZUA 1DFHA 3HNPA 4ITUA 4YAEA 4IINA 1HYHA 1J49A 2ZK7A 4PZDA 4U7WA 5DBGA 4CLRA 4PLTA 2HMTA 1MG5A 1ZKMA 2Q46A 4MIYA 4YCAA 1NWCA 1KS9A 3UOGA 1N1GA 4CMKA 2P9GA 1ZXBA 3AU8A 3ICCA 2CD9A 3OQBA 1PL7A 2X0IA 4D3FA 1D1SA 3PYMA 5A9SA 3DWFA 2Y1DA 1UXHA 2BH9A 1ISFA 1ZEJA 3HB4X 3HDYA 5B1YA 4BNIA 5ADHA 2YDXA 2QHXA 3DZHA 3KUXA 2EJWA 1EUZA 3BMQA 1E3SA 3GT0A 2QZ9A 4K9DA 4L74A 1C1XB 2I3AA 3IQDB 4H3VA 2G82A 3WSWA 4Z9XA 5JS6A 1PZHA 1GZ6A 1R6DA 2FR1A 5JYEA 2QIOA 3LVFO 4ZJUA 3CXRA 3TZQA 1TXGA 5FYDA 1TA4A 3WYCA 1XEAA 4OQZA 1I3MA 1R15A 4PZEA 5AVOA 3DBVO 1K6IA 2OOSA 5BSFA 1QRRA 5JAQA 1RM5A 2WD7B 5BSHA 1DIBA 2PH5A 1N92A 2YHIA 3D3WA 1J5PA 5U1PA 2PGDA 6LDHA 1Y8RA 1P9LA 1YB4A 4HY3A 5ER6A 4YT8A 1YL5A 3NTQA 5L4NA 3AUTA 3BMCA 4BMSA 4DBVO 5JXWA 3OP4A 2JCYA 3ZW9A 2GN4A 2Y99A 3PDUA 4YDRA 3HUDA 5C37A 1T2EA 5F1OA 3D1LA 3LLVA 1VE9A 1EDZA 2Q1WA 1DLJA 1LDEA 3OM9A 4BGEA 4INAA 3GZNB 2J6IA 3EAGA 3L9XA 4PLWA 1NWHA 1VL0A 4D79A 1DXYA 3PYXA 4CLOB 4CLXA 3DHNA 2EERA 1WDKA 2XPCA 2V6GA 3GMDA 4J7CA 1NXQA 3KVOA 3DTYA 4DA9A 1PS9A 2OP1A 3FTNA 4HFJA 4PCVA 3U4HA 3C7CB 3OECA 3SLKA 2VOJA 5CDTA 5DZSA 2VOEA 1P44A 3V1YA 3K2BA 4NMHA 3RBVA 5JNLA 1NVTA 2PD6A 3GAZA 3MOGA 5G0VA 3S8MA 1LQUA 4CLRB 1BW9A 3DDNA 4P38A 5JBIA 2OFPA 1B8UA 3KYCA 2O2SA 3U49A 3V5NA 3ETEA 4ALKA 1WAMA 4BIIA 4FFMA 5CEJA 4RPLA 3PHGA 5BNTA 4ZQGA 5I7SA 1JKFA 5A9SB 5DCWA 3HSKA 4KWHA 5K6AA 1NQ5A 4AJPA 4BNYA 2HU2A 3ONEA 3P5SA 2NU9A 1A71A 2JHGA 3QVWA 3BMQB 4GVLA 4MO2A 1GV0A 2RAFA 1ZK3A 3F4BA 1QLJA 3DHYA 3DQPA 3P2YA 4IQGA 4IMPA 5DOVA 1C0LA 1MGOA 3CPSA 5I9MA 4AJKA 4WOJA 4YPOA 1HRDA 1U4OA 2Q1UA 3D3WB 2YHIB 4ONEA 3E5MA 3KM0A 1Y8RB 2AQKA 4N7RA 1QP8A 1YQGA 2FSSA 1H9AA 1ZMOA 4F45A 2YZ7A 3BMCB 3BMNA 2VZ8A 2PZMA 1F8GA 1MFZA 2OO5A 3ANNA 4W7IA 1T24A 1SMKA 3F5SA 4K6FA 2RHCA 3CH6A 4U0KA 5A05A 4ND2A 4E2YA 1UH5A 2PV7A 3I9MA 5B4VA 1GUZA 1NPDA 3AU9A 5L3ZA 4FOOA 1LSOA 2Q45A 3QWFA 3U62A 1ZH8A 4GKBA 1CQJA 3UN1A 1DAPA 5K6AC 3DZKA 1C3VA 2NADA 3WIDA 4BV8A 1A7AA 2DUUA 1SBYA 3C85A 2C82A 1ADCA 3VOSA 2AW5A 2POQX 2P5UA 2C7VA 3EK2A 4IGEA 3UCFA 1PSDA 1UP7A 1AE1A 1EUCA 1X7GA 5ICMA 5L53A 3SX2A 1L7DA 2FP4A 4LMPA 3DAGA 3D64A 1U3VA 4NJMA 3ZV4A 2EP7A 4R01A 5JDCA 1MXHA 3ABIA 1DFIA 2GO1A 2TMDA 1PQUA 3FBGA 3HADA 4J6FA 3LT4A 5B12A 1AXEA 2Y1FA 2X5JO 1C0IA 1NQAO 1WMAA 2Z1NA 2GPTA 3AM3A 1BW9B 3G79A 4TKMA 4ALJA 4DQVA 5B4TA 3RC2A 1EDOA 3PHHA 1DB3A 1FXSA 4IS2A 3FNHA 1K2WA 1KVTA 1I5RA 2RCYA 3KYCB 3U4CA 1GYRA 4XB1A 5T5QA 1ADBA 1DDOA 1S7CA 4LVUA 4E31A 4LCJA 1PZEA 4BGIA 2VTDA 4RPKA 4YAIA 4RLSA 4RPHA 1SC6A 5AQ1A 4D44A 4ZQBA
chains in the Genus database with same CATH superfamily
4EGAA 1QIIA 4QUJA 3UXYA 4O2AA 3PQ4A 1Y7PA 2IHUA 3DPIA 4JBNA 5FWYB 1DE0A 4MZXA 2OYCA 7AT1A 4AYTA 4BB6A 1C7ZA 3HJTA 2JAXA 5EZQA 3LRTA 1DO0A 2EKBA 1ODJA 3BHIA 3OOJA 3WKDA 5IF3A 3C7KA 1S3FA 2ZIFA 4YYZA 1SHLA 2GO7A 2H1SA 5CIWA 5B1DA 3DDWA 4EHDA 3B85A 1E4YA 3K3PA 2CXQA 3OO1A 3QPBA 2GUWA 3UMJA 1VLHA 3OTHA 4YWHA 2O07A 1A4IA 4IOKA 1XALA 4IDQA 4GVPA 1Z2OX 3P27A 2G6TA 4P3OA 1XQ9A 5DOVA 1CIJA 2A57A 2AQHA 2D5BA 1Z88A 2E55A 1RT9A 1T8PA 1Y1QA 3H13A 1B8VA 5FEMA 5TE9A 2FZKA 5DHPA 4BZZA 1UIRA 1KI6B 4LXTA 5DI3B 3K0SA 3N0TA 1AB5A 2QL9A 3ZXUB 3NBQA 4G3XA 4DY6A 3WAGA 2GCOB 3MRTA 2Q6VA 4BQSA 5ITSA 3IJPA 1I7NA 4LVOA 3F3KA 1C0PA 2YVKA 4ER0A 5CJ2A 1JG1A 2QGFA 3QVOA 1KU0A 1XCLA 1W8IA 2I6GA 1K92A 3NOXA 3UC9A 2JIRA 4UPEA 2V7VA 3H2ZA 1QH8A 1M2VB 1VSBA 2OAP1 2H0QA 3GGCA 2H9IA 2I03A 3H6GA 3M7IA 4IGIA 4N0MA 1F4VA 3JYNA 4S3MA 3EISA 1KYYA 4WVLA 3OO0A 1L5HB 2MINA 3CNEA 2QQ0A 5JWHA 1M75A 2C8LA 2XGGA 1KI9A 5EPEA 5BUSA 5JXIA 4B09A 2Q4BA 4QJBA 1V0JA 1XTQA 3BWEA 5CFOA 3A6JA 1S3SA 1P74A 1QGUA 1HEYA 1EHIA 1P2GA 5FNZA 3GQVA 2R86A 3QH4A 2QUAA 2W6ID 3OETA 3CR3C 1W9MA 1EUCB 4YP1A 2EX1A 4KSBA 1BX1A 1KR2A 3GG9A 5IUNC 5AW2A 4DLTA 1JLSA 3F6PA 3WBBA 2XKJE 2XSZA 3VSDA 4RTPA 4ZV4A 4I1SA 4NJMB 1MV8A 1OXSC 1OXXK 1BTOA 4B33A 5GZ6A 5K0CA 2IE0A 1J8YF 2X8JA 4HRVA 4MAMA 4MW2A 5CYPA 3WIBA 4FZVA 2H4XA 3BDIA 3QUSA 4KDEA 4ZCLA 1W52X 1FQKA 3S2FA 1NBAA 3MBIA 5DLDA 4GMXA 1RMQA 2DMRA 3IVAA 4LXQA 4CIVA 2B1GA 4N01A 4MQUA 2H0AA 2Q2NA 3H9QA 4LGYA 4OFXA 2HA0A 2ZBUA 1DEAA 4TKLA 3UB4A 3BA6A 3L93A 1KQGA 1XL0A 4N0QA 16PKA 4YUZA 1Z13A 3AVOA 2JFGA 1EEXB 3N2KA 3QOXA 2ZJ6A 3CWQA 2ZJ4A 3CO0S 2A92A 2WC1A 4HDQB 4WEOA 4UDNA 1B0UA 1WU7A 3RRXA 1SBNE 1V6CA 2WT8A 3IJEB 4R1SA 5HDBB 3F6RA 2NWQA 4IVRA 3AYXB 4Q4AB 1NSTA 1TW3A 2W6NA 1V7ZA 2AXNA 2HRQA 1EK2A 4DUYB 1B26A 1T2NA 4D9EA 2F9MA 2BTEA 3CVXA 4ETIA 4ZI7A 1ZU4A 1E7WA 1EVYA 2Z2KA 3HKCA 1H8ED 3LA6A 1EP2B 4L7QA 1NJSA 4ZYTA 3ZQUA 1L8AA 2FPGA 1JQAA 1ZD3A 2DBZA 3G2OA 1NT2A 1UBGA 3AO0B 1NVBA 4AULA 2FPLA 4E7PA 2VF4X 3TE7A 2V1UA 1RPAA 2RG7A 3A4LA 2D1YA 4GPTA 4KCGA 2WNHA 2ZIXB 1SEVA 2B20A 2QU8A 2WFMA 1W47A 2L42A 3EMDA 2IJGX 1IVSA 2QLMA 3AF4A 3BB3A 3FNFA 2CXHA 3G9UA 4H7PA 2H16A 4M6WB 2PZJA 3T94A 3W3AH 4Z99A 1MO2A 4F2DA 5BR7A 2XMZA 4X20B 1QGAA 2Z56A 3THXB 4ME6A 5H16A 2PUBA 2A1TR 3NASA 4I6JA 4CWAA 4MWOA 5BWOA 5BNIA 4YB8A 3QU9A 2OXIA 2G7MC 4L4XA 4AJIA 1Z33A 1ZESA 2C4UA 2RG1A 3ACBA 3DFZA 4KYTA 4OL9A 4Q19A 1C7JA 3NTOA 1OYYA 5TQ0A 2SKEA 4MW7A 3T3HA 5BQXA 2XOEA 2WB4A 3PX3A 4JQYA 2QX6A 2QLLA 4GZ3A 4LQ4A 4N6GA 4C3ZA 1BS1A 3BORA 4N18A 4KVZA 1MVLA 1R7RA 3FPLA 2M6SA 1Y5IA 3F6SA 3GK3A 2UUPA 2FRVA 3SBEA 4YJ2B 1RE1A 1GUFA 2IA5A 2ZSDA 4O1MA 4L5AA 1AQLA 5GOZA 5JG7A 4MKRA 1CY2A 3EULA 1QNLA 4O4HF 4IHJF 1NONA 4Y30A 2CV2A 4ARZA 2PUVA 1A3CA 2HPHA 3E18A 4LZLA 4YLGA 3DTVB 4JFAA 3L7BA 3DVAB 4WLOA 3FPCA 4UARA 3ZD9A 1D6MA 2QP9X 3KELA 3OZDA 4X45A 4JI5B 2QTWB 4HXEB 3OEHD 2HF9A 4QEDA 4DLWA 2WPDD 3PU6A 1RWXA 3HB7A 1QCYA 3IP9A 4F5EA 4ARBA 1U0TA 3ODGA 1G8FA 1NKTA 2CLSA 2AFRA 4GOJA 1PUXA 2BBSA 4GIBA 2C4NA 4Y67A 3WLPA 4JLOA 1NP6A 1RM0A 5HF6A 5IXSA 2HJRA 1N7HA 4KR6A 1E20A 1UDBA 1JTEA 2NN3C 2I9KA 1KETA 1X8JA 2DLNA 2MYTA 4A92A 5FWDA 1H2WA 5DGCA 1F1BA 3H4IA 1I7PA 2X14A 3A3PA 2B4AA 3EA5A 3G88A 1NUSA 2QP3A 4YP5A 1TCBA 3R41A 4MJLA 1OT5A 4CKBA 1PK8A 5G2OA 3BIJA 4CF7A 2VJMA 4JYZA 2ZG6A 4ALIA 4LY6A 4YQEA 4TMYA 2VJDA 3TCXB 3V4VB 5ECGC 4WLFA 4K8RB 1W5BA 2GQ0A 3AIMA 2XUJA 3PIIA 3OZSA 3H75A 3EQ9A 3GLHB 1E1CA 5EMHA 4UUBA 3QBJA 5H70A 4CL0A 2VRBA 4DWVA 2O50A 4YNBA 3MJHA 1PLLA 5FL7A 2MWMA 4M49A 4R41A 4MW0A 1GM5A 3P9KA 3RFUA 4CNBA 3H17A 4C5AA 3GH3A 3T5AA 1JF8A 1NLZA 2R85A 2FVXA 1P33A 1PFVA 1LDNA 2ZBEA 2Q99A 3GARA 4PU0A 4ND1A 4E14A 3D02A 3FIJA 5EXPA 4AT1A 2FPIB 5DJ5A 1Z08A 1R6XA 1SUWA 4FKMA 1BH2A 4Q39A 2MYUA 3NWJA 3NHKA 3KTDA 4MW5A 4BJ1A 4Q6BA 4YCNA 2W71A 1DL5A 1M6EX 4X94A 1T4DA 4Y2PA 1P1JA 5ALIA 3O2NA 3NTXA 5EYPA 4JUBA 4B44A 3ZE0B 3HXTA 1FMFA 2VPQA 4G5QA 4UZEA 1BZYA 1Q91A 1E89A 2JH8A 3LH5A 3NW9A 3FKJA 2HDHA 3AJ8A 4M38A 5BV0A 3MAGA 2ZB4A 4PINA 3RR2A 3ENKA 1LRKA 3W6NA 2H1RA 3MOSA 4BMXA 1ZH4A 1J2YA 1VJ0A 2O3SA 3DC2A 3M3HA 4B7CA 1U3DA 2XQIA 1B7GO 2AH5A 5L7WA 2XT9A 2ZYTX 3C6BA 2POCA 3GCZA 1YKGA 3SOZA 4H0CA 1SQ5A 3I5UA 3NC4A 4PBSA 4URZR 3ZNPA 4TV8B 2ZRDA 3QKIA 4DLXA 4UD2A 4I9NA 1CB0A 2IHZA 1RQ2A 2HK7A 4FIZA 2H7XA 2RGWA 4OP3A 4TVSA 3OOHA 1H0RA 1L6RA 5C8DA 4PN7A 1NW5A 3O9VA 4RXUA 1SUIA 3WK4A 2R6FA 3N58A 2CBGA 3ADKA 2VDUE 5IYZA 1JIXA 4QG7A 2FPOA 3A0UA 3Q9SA 4H16A 1QRDA 1NA5A 3TIXB 7ADHA 2XCTB 3H9EO 1WP4A 2FOLA 2J3IA 4IILA 5K05A 1WETA 3V1LA 5LKRA 2ATCA 3WLNA 1U80A 5JIBA 4G0VA 2PZBA 4FM9A 3L1HA 2IYPA 1IAQA 3QTBA 1RTTA 4JLSA 4EQ6B 5JSUA 1NQWA 3IAFA 4Y6GB 1E2LA 3VJKA 1AF7A 4L72A 3DEAA 1DDGA 1FNMA 4E5UA 3CONA 2W6JD 5H68A 3V33A 1E7QA 4EG6A 1P7ZA 2FB9A 3QYPA 4JX9A 5AI9A 2H2GA 4C07A 1RLMA 3E7WA 3GT4A 5TQVA 1C50A 1XJCA 2FN3A 1ULZA 3FGOA 3NHMA 3R7WB 1NTOA 1X0VA 3BTOA 1YZVA 3K1TA 4M0PA 4BMVA 3BQNB 4NZZA 3MWEA 2OV4A 2W2KA 4I46A 2WWTA 4FMCB 4V0OA 1IZ7A 1KMHA 4C0BA 5KYKA 2A6PA 3RHFA 2VSFA 4XLTA 4PC6A 1TIKA 1PBTA 4REQB 2I8AA 4ZREA 3CRVA 4WJLA 5KTOA 2QE7D 3HHPA 1ZHHA 2CHUA 4LPKA 1ZRMA 2QSZA 2HRCA 3NNDA 3K0CA 5EI5A 3HDGA 3HI4A 4PNEA 3PGA1 1D1QA 2L18A 4AJ4A 4MGYR 4FZRA 3C1OA 3W5BA 3PHCA 4KHPB 1PF7E 3OEED 1L1QA 2SNIE 2VO1A 3STVA 3CRW1 1X3SA 1E9CA 5JBQA 2PUCA 3EVBA 3D3EA 3D5TA 3GGOA 4CF6A 1NT4A 1V45E 2BCJQ 3GA5A 1JAZA 1P1BA 2Y1CA 1VHJA 2WILA 1KS2A 2EIHA 4PLYA 4E30A 1VPEA 2CEAA 1KEKA 1KBZA 1E5VA 2G5TA 5FJJA 3HJFA 5FUWA 4NU6A 3ZJ4A 3GA0A 3HEBA 4M9SA 5ESWA 2WJHA 2C04A 2O0HA 5BMVB 1D4OA 3BICA 2G80A 1YB1A 1FDWA 3F7OA 1JVNA 3ESXA 3NGLA 1T5OA 2C5AA 1DIHA 3EQ7A 5HUHA 1XX6A 1UADA 4NE2A 3AFGA 3S7ZA 3W9BA 4MKGA 2ZE8A 2Z3WA 4TRMA 4UULA 4MGIR 3VYSB 1XV5A 3TZ6A 3DBRA 3VHQA 5EMKA 3AM5A 1E8DA 3ZD6A 3OJOA 2YW2A 1FPQA 1LBEA 5K0EA 4DLBA 4FS3A 3N74A 4W5OA 2DFTA 3TEMA 1UBRS 1KWGA 3LYUA 3DMDA 4OQ4A 1OAOA 5BRAA 4YCJA 4BX8A 1ZCBA 4UHEA 1ZIOA 2MCFA 3ABQB 3EVEA 3K0CC 4UFOA 4WMLA 4KPFC 2WVGA 5KNDH 1RZRD 3U3MA 3ETJA 2IUUA 3QLEA 2IYNA 1JXAA 1FSFA 1VG0B 2CCKA 2WIAA 3N8KA 5B57C 3G8AA 3H97A 5CDSA 2IYYA 1MOPA 1J23A 2Z2XA 3DH0A 2GNAA 3F7NA 1ISSA 3QI2A 4J7UA 5M7EA 1XRSB 1UBNA 4PNPA 1M1YA 1J0BA 5FFMA 5P8WA 5EJ8A 2OSVA 1A97A 1Q7RA 1DBRA 3SGLA 4Q3NA 4U5QA 4G6ZA 3NDRA 4HGNA 1VJ5A 4P6VF 4GWGA 3DHEA 4WESB 4XVCA 3C4QA 4M1MA 1M73E 5EQTA 3L8FA 5PGMA 4F2HA 3C8DA 1Y8QB 4QTTB 1Y1LA 2COKA 2FJPA 4CT5A 3ZWYA 5DGDA 1HORA 1MX3A 2R79A 2IODA 3X1JA 3QEBZ 1O7JA 2E21A 2CZQA 4OHMA 3OQVA 3PFKA 3E7DA 4QYTA 1ZCJA 4IIDA 4KFSA 3SZMA 3ZWPA 1NVDA 1G20A 4FGLA 3FFBA 1UF9A 3DPUA 3F46A 3UA3A 4WSOA 2XMCA 4WPGA 2YQ5A 2JGJA 3DMFA 1V3UA 3L46A 3VNBA 2QYHA 3AKEA 3PS9A 1OWNA 3A6HA 3TDKA 3A7DA 1IBRA 2A1IA 3TTVA 3MXTA 4G8CA 1OAOC 3LY9A 4UCFA 5HFNA 1YBHA 3LK6A 2ZYSA 4G81A 1G4AE 1ZQ9A 2AJBA 3EWNA 3H2KA 1EGAA 2CDAA 4YRFA 1CQIA 5TS3A 4RVDA 3TTYA 1WD5A 3T7IA 1TVCA 1AS3A 5J47A 3LW8A 3CNNA 4I3HA 3F96A 1FYXA 3KD2A 4KQIA 1R0CA 1R4NA 2QX9A 2P4UA 2EBUA 1UFQA 4CEIB 3ND7A 2DBVO 3QE9Y 3GP8A 3PE3A 1OOEA 2Y92A 2C20A 5LYJB 4MWSA 3FDXA 1PHPA 1F2VA 1UPFA 2HO4A 4GX2A 5AICA 3TVYA 4ZOCA 4GAEA 1AMOA 4RFSB 4LYJA 5C46F 5AUOB 1JHQA 4K9OA 1FP6A 2GS9A 2D6FA 1T15A 3EMBA 2O05A 1M33A 4F2WA 2XCQA 3NV7A 3IGFA 4PCAA 5IDQA 2YKGA 2JFZA 5LOVB 1LDMA 4HP8A 3S99A 2ZJFA 3L7CA 3PJGA 4JEMA 4OYYA 4BRWA 3S2IA 4ZDJA 4EKYA 4NECA 1FTGA 1OXTA 5KNCH 1GFWA 4DY4A 2GN8A 1RYHA 4I9UA 4B9AA 3K30A 1ZOPA 4GOND 1H8EA 1V7QA 1WO8A 1XZ8A 3DNMA 4UOQA 1GQ2A 2I6UA 2RI0A 3WWYA 4DLKA 1RXIA 2VK4A 4IJUA 1FU4A 1GNLA 3C16C 3LXXA 4N7MA 2BPOA 2ZBRA 3L7OA 3R24A 2VNAA 1X14A 5ELLA 1M8GA 4MVJM 2A67A 3MCAA 3QX9A 4F3CA 1JPVA 1YI1A 3NEPX 4DCJA 3SR0A 2DPXA 2C8KA 3TOZA 3PXUA 4H7EA 1QOQB 1M34E 1OHHD 1GKIA 1WLSA 1BMDA 2FEKA 4UTOA 5FTWA 5L6LB 1IZ9A 1PTKA 4TQUS 3EF3A 4OQEA 4N6NA 3I8OA 4MARA 4HNAA 3ZK8A 3F8SA 4FNAA 3FR7A 3O38A 4R51A 3P9YA 3S2YA 3WS7A 3QBEA 1Z0KA 5CGZA 2ZATA 3A4TA 3ONWA 2AZ4A 2EX0A 3CCBA 1OX4A 3BMXA 1Z29A 5F3DA 4IUDS 4PW0A 4HDOB 3BD8A 4B35A 3C3BA 1Q57A 2ZUWA 3N59A 1M67A 1T1JA 4KH0A 3FAKA 4OM7A 3G02A 4TOIA 3WL8A 5HZMA 5M2QA 4V0MA 3DJFA 4TSKA 2Q0HA 2ZAOA 2E6KA 1ZZEA 2OKCA 1EFLA 2O2DA 2O7QA 2WHEA 3GEEA 2BEVA 4TMWA 1FFGA 1ULHA 1ZNWA 3KTOA 1CT9A 2FWAA 3R4CA 2YXNA 4RGBA 4Y6RA 1XVLA 1JJVA 1KGSA 1EKXA 3O1LA 3PVSA 3IUQA 4M1YA 5EJAA 3N1UA 1U7HA 1LX6A 2BL4A 3VH3A 3HBFA 4H3HB 2DHRA 3NM4A 5KJEA 4HX2A 1TF2A 2BUAA 2IYUA 1T3SA 3IIIA 1PWEA 3G1UA 5F2NA 4XXHA 4NENB 1ND6A 5FI5A 2KX7A 3EH2A 3LUJA 4WASA 1YR6A 3HY4A 2KW5A 3JARB 4YA6A 5KZMB 1Z5GA 4KQ2A 4AY4A 2VA8A 5EXTA 1QAMA 1DOZA 1NBMD 1ZM4A 2N9UA 3KQPA 5C4MA 3AT1A 1N8TA 4HKTA 5BPHA 1VGVA 2WPDA 3OQMA 4DLPA 4NYJR 3RF6A 2VJKA 4ZHSA 4L6CA 1P3Y1 1RRCA 1WOMA 1JQ3A 2RHBA 1G8SA 2F1KA 2HA5A 3I58A 1LPAB 4RWZA 4W5RA 2O8CB 2XXJA 3LV8A 2EEPA 2DTDA 1QUEA 1OBFO 3KJGA 1N6LA 2BR4A 3DKIA 4EI9A 1OA0A 5CA0F 1G66A 2FW7A 3JALA 3MBKA 4L4SA 4N3BA 2JATA 2NZ8A 4NMLA 3B3QA 4J0JA 1JSRA 3EVTA 2QY6A 2QTAA 2WPNA 1IBSA 1YZFA 4MGHA 2E87A 2N47A 3Q6MA 4FYIA 1GUBA 4I50F 5DM2A 1VMKA 2VUIB 2ZYRA 2I7DA 4QXPA 4F2PA 4E1BA 2B25A 3RT7A 4DSUA 4QBKA 3A26A 2BMAA 4CCWA 4DIDA 1E9DA 1G3UA 1WUJS 2VYND 3BXPA 1I3NA 4RVGA 5AKEA 4PIMA 1REQB 4I7EA 4GZMA 5JZVA 3U7HB 3ND9A 3ENNA 1ZZGA 2O57A 1AKYA 1LPMA 1W2HA 4NESA 2KBFA 2MDTA 1ZK0A 3RRMA 2WMYA 3KSRA 4QPNA 5TQJA 3NG1A 3GLKA 3QPDA 3NVMB 2WDZA 1WZ2A 4GZ5A 2XTJA 3MJRA 3G6KA 4TVKA 4E6PA 4NDZA 4W5WA 3MCWA 3V97A 2VDWA 2PWPA 3KV3O 4RTOA 4DQLA 2W4IA 1KP9A 2QM8A 5DLPA 3HWWA 5YASA 4I1PA 3RVOA 4YGYA 2C9OA 1OLSB 1RCUA 4CUJA 5JSHA 3EIXA 4TYWA 4IGAA 5LXTF 3W34A 2DWQA 3TOXA 3QFHA 6REQA 2KSQA 2EFDB 2Z9BA 3Q3HA 4PYQA 4URXR 4MV1A 1ZAYA 3JQBA 3GEGA 2D2XA 1MAHA 2WK1A 3HZZA 3PUKA 1EFVB 1YQUA 1FDIA 3F47A 4XAQA 4BYMA 4B6SA 1QDUA 2DWCA 2FQXA 1NQXA 1EVZA 2F3TA 4M7WA 2VXOA 1GLGA 4URVR 2Y0DA 3HYTA 3SFVA 2XW6A 1HV8A 5B3LA 4RVNA 2Q6KA 4MWBA 1Z56C 1VBFA 4K3UA 3RAJA 2PX2A 1TO6A 1LLCA 2EBFX 1NXSA 1BHJA 1P0FA 2I4IA 1RLIA 2B8JA 1ZQ1A 2XUOA 2N46A 2NLOA 3FXAA 3IEXA 3KJIA 3KWMA 3URMA 4YAGA 4XX0A 4FNGA 4Q3KA 5K0BA 1PGPA 1GT6A 3U1BA 1SG0A 2CFRA 1ZJJA 3DE3X 3S55A 4O4IB 4KN9S 2WWGA 1XZAA 4IY1A 2BC9A 3A1DA 4J2HA 3NB0A 1XAIA 1ZH6A 5B37A 3L8GA 2ZDHA 2HH9A 4QHTA 5LP1A 3VR3D 1VCMA 3N7UA 4GGOA 2PEYA 1RJ9B 3J80A 3ZVRA 5TQ2B 5F98A 3FPAA 4WNAA 4I9HA 1LDBA 3KJXA 4EQZA 3PT5A 4LMRA 4OGKA 1BDIA 3KL2A 1GTL1 3JD4A 1KO4A 1WZCA 4CQMA 5EJGA 2W6JA 5BURA 1M2OB 2JLUA 1CPYA 1TO1E 2HSGA 2NU6A 4QWMA 1OBOA 5FTJA 3RFFA 2UZ1A 1MB9A 4E32A 1YFLA 1D9XA 3AUXA 2DC1A 4F6LA 1U65A 2PGOA 5BVGB 4MRAA 1Y7TA 1T6XA 4QOJA 4C4OA 2GZ2A 5D7BA 3JQBC 3PB3A 5IT5A 3R1IA 4EGCB 4LCEA 5KOHA 1Y34E 3MQ2A 4XWOA 3TXYA 2CLHB 1QVZA 4D4MA 2NNLD 1QCZA 4YBZA 2NUBA 1F6WA 2IYTA 2QE7A 4LRXA 3IUBA 4L5BA 3CMMA 4CTJA 3G85A 1CRLA 1J8MF 2C98A 2I54A 4OL0A 2KS6A 4KQHA 3GXOA 4DCUA 4CKWA 2PZFA 3K0AA 1F2UB 1CRQA 2IU0A 1CUZA 3E61A 3TYXA 2GEVA 1G8JA 2QMZA 3CF4A 4FW9A 1B8OA 1ZNQO 3PIDA 4WLEA 3IIMA 1UIMA 1RRVA 1L7AA 1VKRA 3CLKA 3X1DA 1UZMA 4Y7CA 1PGJA 1N2CB 1FRZA 3HP1A 2F62A 4Q4CA 2IUEA 3T4PA 1Z35A 2FDXA 1N0UA 2OKGA 3LUGA 8MHTA 2QM3A 4L0QA 3NWEA 4TYNA 4KLAA 5FTNA 4R0MA 2CZGA 2XRYA 5EJFA 1U2EA 1DXOA 3BGVA 1G21B 1MX9A 4PG6A 4D6PA 4RHFA 4DOMA 4FCTA 1SUBA 4PZYA 5G4KA 1L1RA 1OIVA 1R00A 3FUCA 4I4TB 1MVNA 3H1BA 4PPNA 3FOZA 2O0LA 3U3KA 1T8YA 4NBSA 1CEXA 4LFCB 2MYNA 2C0PA 2YXPX 1SO8A 4NHEA 4W9MC 2IP2A 4WIAA 3VJRA 3OEYA 1UOPA 3E5RA 4YFYA 5DM70 4DIFA 5HXAA 3OFSA 4F84A 3KUUA 4LZJA 5BNFA 4D9JA 1RYEA 1FX1A 5FD8A 4CM8B 1G6OA 2ZJ8A 3ON5A 4G0XA 2JGIA 4Q4DA 4YUYA 9LDBA 3FBTA 4DSAA 3C3KA 4B9EA 2Q4TA 2FZWA 4EG1A 1L7EA 4PIPA 1W59A 1U8ZA 3YASA 5JD4A 1NBIA 1UBCA 2A4MA 3ADBA 1WF3A 5KTKA 1NVUQ 1GZUA 2ZETA 4I9FA 1FB5A 3SM9A 4PO8A 4YJ3A 1PFYA 1QFSA 2Y66A 4AKHA 3NAMA 2H08A 3I6QA 4PLCA 5J2TA 3G8BA 2RJNA 1ZL0A 5BN3A 1WB4A 5BNZA 1L4MA 4I1RA 4L2IB 3W06A 2REQB 2SCUA 2QQ5A 1ICIA 1HZJA 3C8ZA 4PGGA 2RARA 4BGUA 1FYEA 3A9TA 5JAIA 3PPVA 2EARA 1H4SA 5KU1A 4OLAA 4FGZA 1H2RS 3QEOA 1YB6A 5I5EA 4FN5A 1ZFNA 3P7MA 5BV1A 2WZDA 3CY6A 3K6RA 5BWMA 1E4VA 1KJJA 2AF4C 2YQZA 3ZLBA 5A6SA 1XEXA 2W9XA 1W88A 4UE3S 1T36B 3IBCA 3PC7A 4YDQA 1W6UA 2IEAA 5J1SB 2PPVA 3G7SA 5LSAA 2QMOA 5CDHA 1SAYA 2BEWA 1CF2O 4EKIA 4MQ5A 4UAVA 1XYGA 1J06A 1YHYA 1B93A 1NMYA 1NVGA 2C00A 4MI3A 4BNHA 4NRDA 3GJ4A 4TLAA 1ZGHA 1D5CA 2XGJA 1ZDMA 3KXPA 3JQ6A 5EVCA 5BSEA 5CM9C 3K09A 3OM0A 4BQQA 1HL7A 4JKIA 1B3BA 3HJGA 5FPSA 4DLZA 1GZDA 5DT2A 1EBBA 1QH1A 4ZAVA 3BH0A 4DLRA 2EXXA 3I0ZA 4QDTA 4EF6A 2NXNA 1NRWA 3HK2A 2J5XA 3USZA 1FNCA 1T9HA 1U8XX 3AEQA 4FYWA 2WICA 1R5BA 2X0KA 2UXCB 5DO9A 1Z38A 2G9RA 3K4PA 3KB6A 4JBYA 5CLFA 3OD5A 4DJJA 3BIWA 5ELMA 3ED5A 5KYXA 1QU2A 2R25B 3FCYA 2JNWA 1JFRA 4P0TA 3GOHA 2REOA 2XWJI 3BL6A 3CIFA 3F9RA 4C3VA 2FZLA 2CL6X 1C7FA 3KZOA 3D7RA 4DHEA 2H2AA 1SVSA 5A7HA 2VH1A 1RJEA 5EHQA 1ZLXA 4PNZA 3UHFA 1F2TB 2PY6A 3DQQA 4N5HX 5IDVA 2AXQA 4LDQA 3C6QA 1FCJA 3AY6A 4JI2B 1JQ5A 3NJRA 4BFVA 1PAUA 1XK6A 1XVTA 3VZQA 5DB4A 4PYNA 4UPDA 1IBKB 3L02A 4YJ2F 3IKJA 5DSXA 1JTFA 4OYLA 4CKYA 3I9KA 1CUEA 3CRQA 4R1PA 4L73A 3ZXYA 2C4KA 4E13A 3AUKA 4Y1EA 3VVMA 5LU9A 2ID4A 1BDHA 2OBFA 1PG5A 4EMSA 4WUTA 3W5AA 3OCXA 2BKVA 3EBPA 4YQZA 3K09C 1YQQA 3WV5A 3FH0A 1C9MA 2L69A 4GSKA 4S04A 2Q4EA 3KPJA 3EFOA 4NYIQ 1PQPA 4NHOA 1I2BA 4MRRA 2AG8A 4UNPA 3SVLA 5GZ3A 2NW6A 2VPWA 4JBHA 4MHTA 2Z58A 3ZK7A 3OLCX 4X6LA 5DIFA 3N6XA 1SUCA 4U3JB 1QWSA 1USWA 2C78A 3RBZA 3IRUA 4JASB 1VG9B 1NY5A 1ELOA 1BD4A 1W1IA 1OTXA 4M0KA 4J0IA 5I4CA 4Q3DA 4HN2A 2DWOA 1ZH2A 4Z2YA 3Q3GE 4RDXA 1Q0SA 1H0HA 1JQJC 1RRFA 1SUAA 3KAJA 4KWIA 4OJMX 1I0IA 3USES 2IXTA 3EXHA 4HGPA 4ZT3A 3P9ZA 1ZKDA 1U1DA 2QJRA 5M3BA 1OSNA 1RI3A 3X3HA 2YFHA 2IDZA 2Q1YA 2W93A 4DQ0A 3CNLA 2AFIE 1B41A 1GL9B 2XCUA 4ZEXA 3MJCA 2RSLA 3FPEA 1JEYB 1XCOA 3FF4A 5DCYA 4NZ9A 5F12A 4P82A 1Z0AA 5TLSA 1YIDA 2WP8J 3VQTA 4U0JA 3Q2KA 4XUGB 5GZ1A 3HJRA 1U2QA 4RNCA 1VI6A 1AQYA 3G8CA 1TCVA 1ZGJA 3TRJA 2K7FA 3JD0A 3SSMA 5C8ZA 1K7YA 1ZS9A 2V5AA 1XNHA 5DM0A 3KSMA 1X39A 4R2LA 1ENPA 1F3LA 2YIDA 1GU1A 2IBMA 1W29A 4RSMA 4Y2GA 4CG1A 2EFHB 1NXTA 5FI1B 4XDGA 3L4BA 4BB5A 5CA1A 2F3RA 3A14A 2N0SA 1NBMA 3LF2A 2A0XA 2DFLA 4Q37A 3H04A 1MKYA 3NHUA 4RD3A 1Q2UA 4X3OA 2FTKE 2W43A 2ZB2A 3D0QA 5IAEA 3I12A 3CVJA 1J99A 3DZIA 2W11A 1DIAA 1ZA2A 2X6QA 2WM9B 1A7UA 3AMVA 3PPWA 3I64A 3TRFA 1UKAA 3EXHC 1NFQA 2GR9A 2QVBA 4CN8A 1L7VC 1Z15A 2IU6A 3W2HA 3SIXA 2CLEB 1KZHA 2DXIA 3LZCA 3ASZA 4HWRA 4BUZA 2OBBA 3HCFA 3I2GA 4MHOA 5ITVA 4BPBA 1VP9A 3QNUA 2QUHA 5JHHB 1Z6XA 1WVMA 3T5MA 1U90A 4JLDA 4O2BB 1I32A 1DX9A 2ORIA 5F3WB 1BHQ1 5FBWB 5BP7A 1BMFD 1XZDA 3NALA 2B6HA 2ZRMA 3K5WA 1WBJB 5BYAA 2G1PA 4TV8F 4FWTA 1WTAA 1N78A 2ZRLA 4BHTA 4A6XA 4JT8A 3MTGA 1YS9A 4HDSA 1LFDB 3I45A 5LLSA 2QU7A 1UMKA 5T7BA 2VYNA 4J9VA 2VNKA 2RHTA 3RROA 4WK6A 3A3YA 3RLFA 2J6HA 1YCDA 4DARA 2ABWA 3KT3A 3OPYI 2IZ6A 1XZCA 3L05A 4NBTA 2PRZA 1CY0A 1JYEA 2VQSA 2VPXA 1MH9A 4MLZA 1V4VA 2VT7A 3L4BC 3SZGA 3BF7A 5I3ZA 4IV8A 2J3JA 1W34A 3NKVA 4RZHA 1J7KA 3PEEA 1A8QA 3ROEA 1DADA 5TPZA 3TVDA 2CFTA 3UANA 5A4JA 1WW2A 1NX6A 1GZSA 1I1HA 3IQHX 2J3LA 5C81A 4Q7MB 1TAUA 2RGCA 2B3TA 3NIDB 3OKAA 1VC2A 2O4CA 4RKQA 4NZOA 2VS1A 4QTZA 1JP7A 3NHZA 1L5QA 2GFHA 2IIBA 3BBLA 4QOIA 2OCLA 2WR8A 4DN6A 4FMCF 1QYIA 5ECYA 1Y7LA 3QE2A 3O26A 4CMEC 2NP6A 1IATA 3WMEA 2H2HA 4EZIA 3ULKA 1U8FO 4GU5A 5GVRA 2E48A 5IBQA 2C94A 3RLIA 3S2SA 4D92A 2QRVB 5A1TA 5CLJA 5KSZA 3L0BA 2I4OA 4M46A 3SHFA 1RFGE 3U17A 2CXOA 3JQCA 1WSDA 1FLDA 1L7OA 4H35A 5HBRA 3S2EA 2O59A 1EE9A 1FNBA 5TVGA 2LCIA 5FWXB 2OVFA 1B6GA 1ADYA 1PGOA 2B5VA 3R9WA 3PL1A 5FKJA 1YR2A 4YMWA 5AKXA 3P9SA 5BNWA 5JATA 3DBHA 2VJCA 1MO6A 2HN9A 1NBWB 1NYQA 1TUBB 5IKEA 1YBFA 4I6GA 1XMIA 1R3DA 1MIOA 4K88A 5BMVF 3O0TA 3QU5A 3PDWA 2YINC 3FIUA 4UDXX 3BXGA 5TIIA 3CZAA 2RH8A 3SWWA 2Q6TA 4LWZA 3CIOA 4AJEA 4DXAA 1KDZA 1XEFA 5E6SA 4G1UC 3EGDB 8AT1A 2Q07A 4F46A 2A9KA 1I6MA 1P91A 5AXDA 2VK1A 4MVJH 1AQ6A 1J25A 2ZQYA 2AJCA 3FOAA 4G1EB 1U0LA 1TVEA 3QITA 2DUNA 4BNUA 3FFWA 4ZOLB 2FK7A 1ZOLA 2Y0CA 2F1OA 2D2VA 2I78A 3DE6X 5TVKA 2O8NA 1MHTA 5JWOA 1JTVA 2P8JA 3OQJA 3KB1A 4QTXA 4DLNA 1SCNE 4ZCRA 1KWKA 5JCXA 4QYMA 3PCXA 2F8MA 3CLVA 3H0EA 4QHYA 4B79A 4DJTA 1JFSA 1TM2A 4P3PA 3BMOA 3DLAA 3I62A 1TKRA 4Q1AA 1M6WA 3GEMA 2WIKA 5DU2A 3L5OA 3I2HA 5KYVA 5C0OE 2I8LA 1RKQA 1NASA 1CUUA 2ZCUA 2IEGA 1OT3A 1WXXA 3KFVA 1GCGA 4OKIA 1SUFA 2X2PA 3TBFA 3ICVA 1K3TA 5J5AA 1IJKA 4UXJA 5BW8A 2R00A 1GCOA 2ID8A 3IELA 3K2EA 4ZAYA 3VYWA 4JSRA 3F5MA 2HX1A 1ND5A 1QF7A 2ATEA 2BE9A 5KS2A 2EJUA 1E4EA 2P9FA 2O9JA 4EPVA 1QO7A 4MJ3A 1L4GA 2JZNA 5F7ZA 1Z4LA 1GN8A 3DOHA 4EUEA 2G76A 3IBFA 2CLLB 1ZP6A 1P1RA 2JANA 3M3DA 2RH5A 1RZ3A 2YY6A 3PHIA 3RE1A 1KE1A 1P45A 2I6FA 4B6QA 3I0MA 3VU0A 1KI2A 4QGAA 3QJ5A 3TLZA 2EW8A 1C30B 4U9HS 1AHIA 4Y2QA 1EQAA 2JLSA 2G0TA 1M2GA 1OJLA 4GMKA 4N0EA 2IBTA 1VL5A 4TM8A 4NCKA 4Z7JA 3B1YA 2VTVA 1JXQA 4OI0A 2QTFA 2QSUA 1DG9A 1BXZA 4M2LA 2W2QA 5E1DA 4BKQA 3T4EA 3OZEA 3E9NA 1XLUA 3H2YA 3OBIA 3MUOA 5ALSA 2JGAA 1HGXA 1N9GB 2E4YA 2NAPA 5C5IA 1NULA 4MWGA 3RVSA 3THWB 4G2NA 1VIMA 2YJZA 3EXFA 3A1NA 3IHKA 4J3JA 4OQPA 3QVSA 5TEWA 4RULA 2VUUA 3PL5A 2HLPA 2C4TA 1NRIA 1DC3A 2IYEA 3L18A 3MLEA 4CIYA 3FPBA 3IEVA 1Q20A 1JFFA 1SUEA 2RBEA 2ZRHA 3B6IA 3PDJA 3PC3A 3TUIC 2R00C 2OL4A 2DG2A 3ORQA 4N5MA 5K0SA 5IMSA 3TLKA 4GP7A 1D2GA 5LYJF 4UBMA 5LA6A 2RK6A 3M6FA 3ZHXA 4P8RA 3ITNA 4KLCA 2B2XA 3DKKA 3KB8A 4WW0A 2GN6A 4CV2A 4YJKA 1GUYA 4BO9A 2I3BA 3WWCA 2AZXA 4FSDA 2OLEA 2ZRFA 3ANSA 2P3LA 1WBBA 3KQOA 4Y3UA 5LUBA 2HJSA 2E49A 4V0SA 4X1YB 2AKEA 2O20A 2JJMA 4DB2A 3SNHA 4KLZA 3MJ4A 1GKLA 2XA9A 4MGZR 1C2TA 4ZRMA 2NT3A 4LC9A 4RPJA 2HPVA 3FSJX 3MD9A 1OR8A 2B8WA 4G5FA 5LOVF 4BNMA 4Q01A 4D9BA 1C3OA 1FUIA 4ZT2A 1U7OA 1G18A 4B4DA 1FFDA 4IMJB 4P32A 3QWHA 3ZZUA 1B15A 2OFXA 3D6TB 4F1JA 3VM6A 2PKYX 1XD9A 4DCTA 3V1MA 3R7DA 2QX7A 2ZQZA 3HV2A 5AVWA 5FOWA 3PUHA 2GCNA 3DL4A 1Q7BA 1QGDA 4WI1A 1KDVA 2A5YB 2COEA 2I66A 2UAGA 1HR0B 5E1BA 1X3LA 2IIVA 2C83A 2H4JA 3CW2A 4JCOA 2CLOB 2R2GA 1E2HA 4EFKA 5B6PA 1Z45A 4YLEA 4EF4A 5BNTA 4TVBA 1VE3A 2H00A 3E7FA 3PFHA 2BMDA 2WJGA 1SCJA 3GY0A 1P1HA 1CUBA 1Q0HA 1VJCA 5EKDA 3SI7A 4UAGA 1E9AA 3WFIA 1B1AA 1DUSA 1Z4NA 4IJVA 5DT9A 4BNVA 1G9XA 4B48A 2UVPA 3FR8A 3N7AA 3SMQA 2G67A 4JBGA 2IHTA 5ALLA 4BS9A 1HETA 3E82A 9MHTA 3F6EX 3QVUA 5D7NA 3QWIA 2WSIA 3LDUA 1LGYA 4LJ5A 1GFSA 4B6JA 4IJQA 3FNQA 1SN7A 2LCQA 1VPDA 4AKTA 5CIYA 3O5AA 1TU0A 3T3PB 5KC8A 4WTOA 4IDEA 3UXHA 4UVDA 1VRCA 1DUVG 2PQ6A 4IP0A 2JFFA 1NF2A 4L9AA 2WU8A 4DXDA 5HS4A 1D07A 1WCWA 4PG5A 2OFOA 3CEAA 4YRJA 4B8ZA 4HN4B 3W6UA 6AT1A 4A8HA 2HA2A 4NKRA 4EI8A 1MDBA 1JNYA 1PK7A 4QUAA 1V41E 4BL5A 3TTXA 3N0WA 3WGHA 1T3TA 3CRZA 3E9QA 5BWLA 1OLOA 4JUFA 2X0NA 2PUWA 4OIFA 1WHSA 3TPCA 4ABYA 1OH8A 3RIMA 4QFDA 3ZPXA 3HDHA 4ABTA 2BF4A 2RGGA 2X5OA 3EVDA 3QLJA 2IKQA 2EV9A 2IV7A 3ZXXA 4U2CA 5CG1A 4MR9A 4YH1A 4K2AA 1E5LA 2BTOA 2M1ZA 2Q0XA 3F3SA 3I6IA 3OSUA 4OXYA 3BB1A 4L4YA 4WZBE 4G0QA 2PFKA 1G55A 4HGQA 4I5EA 1BX3A 4QQKA 4RQBA 3PFBA 2BTQB 1FJXA 1XTIA 4ANFA 3H86A 1IHDA 2VHUA 3OVMA 3P2OA 3PVZA 3DZFA 5AWFC 5K51A 3ANLA 4CQLB 2DKFA 3SSNA 3PUIA 1XPJA 4OUDB 1ZOIA 2OBNA 2SICE 4V3BA 4YQYA 1N8SA 1FJHA 3FNIA 1NE2A 4QGBA 1A5BB 3BWDD 5DEIA 1LNSA 1A0OA 3KWJA 3DO5A 4AMZA 4C43A 5GINE 1Z0JA 3GVIA 4B75A 3FB1A 1ZUNA 3UAOA 4ADSG 2GKSA 5AM5A 1C1DB 1PJRA 2ZZKA 3OA2A 2YMLA 1HYQA 1JLLA 2FK8A 3PNPA 5JI2E 2JA2A 1FUEA 5CVVA 1XVVA 3L8DA 2ZIZA 4QE3A 3UPDA 2O1EA 4DQUA 4MR8A 4E11A 1CERA 4PR3A 3PWSA 1W5FA 5JD3A 1NQTA 3TRHA 4CG3A 1T2UA 1UC5B 2PBFA 3ELUA 3WQRA 4EPRA