4CM9D

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
248
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 95
structure length 248
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm9D00
4PLVA 1KVSA 3A28A 3HHPA 3FF4A 5A03A 2AHRA 3W8FA 2G82A 2GDZA 3PI7A 2PD3A 3JYNA 3PYMA 2AQIA 1M75A 4MKZA 3CMCO 2QRLA 1IPEA 1UXKA 2GR9A 3WYCA 1YB4A 1SCUA 1WW8A 4MIYA 1YB1A 1C0KA 3DBRB 2JCXA 3DMYA 3WJAA 5A06A 4F6LA 4OQYA 1K6IA 3PPIA 1PGNA 1YJQA 2UDPA 5K6AC 3LF2A 4N5NA 1ZEMA 2X0JA 2R00A 2O50A 4KMSA 3DZKA 4GQAA 4CV2A 4IDGA 2CZCA 4OXNA 1H6BA 1BVRA 4A73A 2RIRA 4QFCA 4CL3A 2CF6A 1NR1A 2AEFA 2PWZA 3Q2KA 5F5LA 4DGSA 3WWYA 1IB6A 3E5RA 5AYVA 3AY3A 4IIUA 2GN9A 1UAYA 3FNFA 5KJ1A 3OECA 2C59A 4YJGB 3ROPA 3NTRA 3F5QA 4BVAA 1HDZA 4EUFA 1YONA 4FSHA 2UUOA 4W9NC 2W2KB 4D43A 5LDHA 3G17A 1YJ8A 1V8BA 2PA3A 2VZ8A 1C0PA 1GU7A 4DC1A 1LC0A 3GHYA 1C0IA 2X5OA 4BNUA 2NUAA 2NU8A 3PYXA 2I3AA 4S1VA 3ADOA 4EJ0A 4NU5A 1HE2A 4BNXA 4CM4B 1ML3A 1H6AA 2DTXA 3DQPA 4HWKA 2Y1EA 1B3BA 4JNKA 2EEZA 4UVIA 5THQA 3ZNQA 1NFQA 2IZ1A 3GQVA 2R00C 1NAHA 4IDCA 2VRCA 4ND1A 1C1DB 1DC6A 1ZJYA 4UAGA 3TZQA 2B4QA 2C2YA 2VUTA 3H2SA 1B26A 4NHEA 4ZRMA 3TZHA 2Y0EA 3V8BA 4ZQFA 1U28A 3V1TC 4HFJA 2CSUA 1DFGA 1ZMOA 1HZZA 4YTEA 2P5YA 2HDHA 2CDBA 4GX1A 3A14A 4G5HA 5KTKA 4K6CA 4HNGA 2Q50A 3K2BA 4P4LA 2YQ4A 3VPFA 4TROA 4BIIA 1VL0A 3PQFA 1Y8RB 2Q2QA 4KWIA 4ZQEA 1PJ2A 3C1TA 1RM0A 3EGOA 3WX0A 4RPLA 3H9QA 4NBVA 3DWFA 3V2UA 3WMXA 1LDMA 1A71A 5CAEA 2I5PO 1FXSA 1BW9B 3X2FA 4M55A 3VPXA 3ITKA 1DBVO 1ZMTA 1J0XO 1K2WA 3IKVA 4N54A 4ONEA 3GAZA 3MWEB 4R9RA 1JA9A 4WK6A 1TI7A 1D3AA 3OH8A 4R3NA 1RPNA 2NSDA 4ALNA 3GG9A 3HWRA 3H5AA 4OSPA 4MVJI 3UF0A 3GN2A 4F6CA 2GLXA 3JSAA 1DEHA 4B3HA 3ON5A 3OIGA 3A06A 3ROKA 4J4HA 4NR0A 1B3RA 1UAGA 1NWHA 4BGUA 1HSOA 1PGPA 3PJDA 1K89A 2PZJA 3HZZA 4FBGA 2D8AA 5AXCA 5THKA 1UUFA 3DTYA 5L53A 4PLFA 2JFFA 1DSSG 1HZJA 1Q0HA 3DZBA 3DZJA 2VOJA 1VPDA 4CMHA 4BMNA 2V6MA 2I67A 2OFPA 1V3VA 3R3JA 5KKAA 3CE6A 4BNFA 5C3MA 4XWYA 3W6UA 1C3VA 3Q1LA 1J5PA 1HE5A 2X0NA 5L4SA 1SOVA 2JD0A 1IE3A 3NDIA 4D46A 3LC1O 3FI9A 2TMGA 3VKUA 2G17A 1LLCA 5BSFA 5K9ZA 3EW7A 1JKIA 1ONPA 4QEDA 3H5RA 4W99A 3ONEA 1KOLA 2O4CA 1XLTA 1FDVA 2B4TO 3W4KA 1I24A 1UZNA 3AI1A 1PJCA 5CPBA 2ZYGA 1T2CA 2ZYAA 3D7LA 1X0XA 3ZNOA 1GQQA 3GFGA 1LQTA 2QQ5A 4AJKA 2EKQA 2EP5A 1SAYA 4RGBA 4I08A 1ID1A 3EC7A 2IXBA 1U3WA 4Z0PA 1QV7A 1EVYA 3ULKA 4CM4A 1ZFNA 4FGWA 3FWZA 2X9VA 3MCVA 4YACA 2HMSA 4D7AA 5JYDA 2O2YA 2UAGA 2JHFA 4A0SA 4DC0A 3COSA 2FRDA 2C54A 1JQBA 3H9EO 1P0CA 4OSOA 1TEHA 3SX2A 3WFJA 1JAXA 4RZHA 5IN4A 4PG5A 5DBIA 4JROA 3STHA 5J23A 5KVQA 3ANNA 1XG5A 3PZBA 4RZIA 3ZV3A 4R9SA 4FQ8A 4CR7A 4YJFA 3C7AA 1X7DA 4E12A 4BKUA 3KUXA 3JQGB 5ICSA 3IUPA 4BKRA 3ZWNA 2HMWA 3KYDB 3MTGA 4AJLA 1KETA 4J91A 3SVTA 5L45A 1PWXA 4RF3A 1Q7BA 3U09A 4OH1A 1Y7TA 5A9SA 4K28A 5CDTA 1NASA 1JWBB 1NPTO 4AJEA 1HE4A 1EZ4A 3D4OA 3ONDA 4FJ1A 5G0TA 1BXKA 3H7AA 4URFA 4E5YA 4Q9NA 1GFSA 4CL8A 1U7HA 2VCYA 3LQFA 4MKXA 1LDGA 5AXDA 1PQPA 4HFNA 4IJKA 4PLHA 3WLFA 4DYDA 2AG5A 3L6OO 1JTVA 3C24A 2E49A 3LT0A 1CDOA 1QRRA 4NBRA 1DHRA 1ZXLA 4HBGA 5F21A 1VJTA 4DQXA 1UDBA 3C1OA 2WD8A 5DT9A 2YJZA 2FZWA 1HYGA 1RKXA 1GADO 3QSGA 5FYDA 4ZVVA 4CM9D 3TWOA 2Q3EA 1E5QA 1RWBA 3RBVA 4YJHA 4D3DA 1H2HA 4IQ0A 3MOGA 2CNBA 4BNYA 2Q46A 5HA5A 2POQX 1P1IA 2PZMA 1F06A 2E4AA 2VNAA 1PZFA 4XQ9A 3E6AA 1YH3A 2J3IA 3VPHA 4R1SA 2VHZA 1ONOA 2OO5A 1QYVA 4NZ9A 3L0DA 5FI3A 5MGBA 4RLHA 4IZHA 2HMUA 3GVIA 3AI2A 3QWBA 4OMUA 4IMPA 4XCVA 2EW2A 1GYPA 2O3UA 1QV6A 3OJFA 4YRBA 1GAEO 4L8VA 2C5AA 3PEFA 4WKGA 5EERA 3DZGA 4AL4A 1CIVA 1XWFA 2VQ3A 4O5OA 3ZWPA 1EUDA 1YO6A 5HWSA 1RM4A 2WYVA 3G1TA 3RD5A 2IYOA 4OAQA 3K92A 3WWZA 2Z1NA 1OC2A 4QUKA 3ZV4A 1T24A 1UP6A 3JQFA 4KWHA 1NHGA 1DB3A 2C07A 4UULA 1NHWA 1R0LA 1XU9A 2NWQA 5EINA 2EGGA 2EV9A 1ULSA 3DZHA 3HDQA 3IJPA 1K5HA 3WS7A 3GGGA 1R66A 1WP4A 1NTOA 2C82A 4PLPA 3MWDB 9LDBA 1U9JA 2QZ9A 4FD3A 2FP4A 1UDCA 3GH3A 3OICA 5TT0A 4IMRA 3W4IA 4CQLA 3RUFA 4IDEA 1Z45A 4RDHA 4CQLB 2YW9A 3F1KA 2GSDA 3LZ6A 5H82A 1IOLA 3NGXA 1L7EA 3PJGA 2HRBA 3PXXA 4O1MA 1PGOA 1XEAA 3PRJA 1P1KA 2HK9A 3GVHA 1ISMA 3WR5A 4YT8A 1ZK0A 1VJ1A 2DFDA 4WE3A 4N7RA 2B37A 2VUSA 4NFHA 3BMNA 3BTUA 3V1YA 3KVOA 3WQQA 3G1UA 2ZCUA 2ZYDA 3QWIA 4MVJH 1H94A 2NVUB 5DBGA 4P8RA 2WTBA 1PGJA 4NH4A 3JQAD 5JCXA 6LDHA 1IHYA 4BNGA 5IDQA 1DFIA 3AM4A 4A03A 2EXXA 2PK3A 4D41A 3I6QA 3AM5A 3F4BA 2X58A 3ZWCA 1Y9AA 2ILTA 3BMCA 3H65A 3RUDA 4BV9A 5C7OO 1A72A 5KVVA 3ONFA 3GC6A 1UZMA 4NNJA 1WDKA 4C4OA 4CM1A 4YDRA 2EGHA 2YZ7A 1E3LA 5KVSA 3UCXA 1OZAA 4FJ0A 2GNAA 3T4XA 1E6WA 1GV1A 4II3A 1ZCJA 3JYLA 4MIOA 3VH4A 2Y68A 4DYVA 5L51A 4MVJA 3S2FA 3WBFA 1S7CA 4M1QA 3FBTA 3BMOB 4GMFA 7MDHA 4U0JA 3PWKA 4RVGA 4E5PA 4XA8A 1XHLA 3GDFA 1XIVA 1E1MA 4Q3NA 4NFYA 3PQEA 3PHGA 3ETGA 1B8VA 1DC5A 2AEJA 1R6DA 2A92A 4Z3DA 4DUPA 3NDJA 1SB8A 1B15A 2HMTA 3FPLA 2DBZA 2J3HA 4DLBA 2D5CA 5CEJA 1TT5A 3ZHYA 5F1OA 1X13A 1YL7A 3PZRA 4YVFA 1PQUA 3H9GA 1OC4A 2W2LD 2I3GA 1ORRA 4IGEA 3OF2A 2C29D 2ZTUA 5AXAA 1N9GB 1ZBQA 4Z9XA 5HTOA 4YJFB 2I99A 4BGIA 2J8ZA 4R1NA 1HLDA 2UYYA 4RPKA 2FPGA 3RQSA 3PHIA 3EZLA 3N74A 3L4SO 3VOSA 1PZEA 3QP9A 4QT0A 2YV3A 3PGXA 3TPCA 4BO1A 4Z9YA 3INTA 1ARZA 3C85A 4BO2A 3GHHA 5H83A 4DTIA 3ZHZA 1EMDA 3TL2A 4I8XA 2DTDA 4GX5A 1GDHA 3WGGA 3FRJA 4R54A 2YV1A 3AUSA 3WQSB 4W9NA 2D4AA 3UCFA 2WYWA 5LCXA 4W82A 2BGLA 3AUUA 2GGSA 1QYCA 4HY3A 3ZHXA 5HS6A 4EJ6A 4GSLA 4JX8A 5I9MA 4Y9DA 3FD8A 2OOSA 3PYLA 4XYEA 2WD7A 2OHXA 4XJSA 1E7SA 1E3IA 3OQBA 2P68A 4HUJA 2DTEA 4Q3EA 4GH5A 3QVXA 3GNTA 4WCFB 5U1PA 4BHTA 3N7UA 4RPGA 4LVUA 4J1QA 4BNKA 3WSWA 1KERA 1HE3A 2NM0A 4ZJUA 2W8ZA 3QE3A 4J9UE 4B7XA 4BQPA 1X14A 1O9BA 2Q1UA 3OSUA 4HFRA 1IY8A 3UN1A 4OOFA 4BKPA 4Q3AA 1ZZEA 3VAZA 1UXIA 1Z73A 2Q1WA 1K6XA 4XQEA 3HQ4O 1PJBA 1LC3A 1E77A 2CVOA 3JQ8B 3H9JA 4B7CA 3JD2A 5CP8A 2P2SA 3NYWA 1YBVA 3PK0A 5JFOA 4LW8A 4I5FA 3WDSA 1JDJA 4DQUA 5A5EA 1BHSA 1EBUA 3H4VA 5EN4A 4J1NA 3AU9A 3O4RA 1B8PA 1GPJA 3KYCB 2HKIA 2HAEA 2UV8A 3S8MA 1DHTA 2GYYA 1JVSA 5CHEA 4N5LA 1CQJA 4TKMA 1F12A 3DONA 3DHEA 3P2OA 4BL5A 3SBOA 1ONNA 1HXHA 2BFOA 4ND3A 4NK4A 4BO6A 2ZB7A 2X7HA 3TOZA 1E6UA 4MVJE 2Q2VA 3H6KA 3I9MA 3B1KA 4FIZA 4NG5A 4U5QA 4W6ZA 4CV0A 3F1LA 5L40A 5CEEA 1XELA 1MFZA 2I9PA 3V2GA 1E1NA 4QXMA 5IDXA 4I9NA 2JCYA 5FI5A 4E2WA 2FR1A 3DC2A 2D2IA 3AFNA 1N1GA 1VSVA 3FN4A 3JQBA 4J2HA 4CMAA 3NKLA 1T2AA 5IDYA 4H3VA 4Y6PA 1G6KA 1TVEA 2Y0CA 2R2GA 4YCAA 4KTVE 1DC3A 1M66A 1U3TA 3INRA 1PJTA 3AY7A 2LDBA 5IFLA 3T7EA 5KOIA 2C7GA 4MO2A 3FTPA 5G4KB 5ILOA 1NQ5A 4E33A 1R0SA 3IMFA 4GSKA 3KYCA 4QQRA 3SC4A 1DIBA 3IP1A 1AN9A 1GQYA 2DBVO 4D45A 1LRKA 4JJFA 5DOZA 3Q6IA 3TZKA 5B4UA 1B16A 2GUGA 2J3JA 2Y05A 1O94A 4IY1A 1FDUA 5BR7A 4O63O 2W98A 1BWSA 1IHXA 1BG6A 2HSDA 2O23A 2EP7A 4UVDA 2AMFA 3GEMA 3QQPA 4ZD6A 1ZNQO 5JLAA 4DL9A 3B20A 2B36A 3TRIA 5B1YA 4NK5A 1E0DA 3FR7A 2YV2A 5DCWA 1E7QA 1CETA 2RHRA 4CLXA 2NV6A 3PHJA 1PS0A 3WGYA 1M67A 1IULA 2BGKA 5AVOA 2QRKA 3LT2A 3A9WA 3RU9A 3L6EA 1PZHA 1NVMB 3RFXA 3KSZO 3KOUA 3GPDG 3V5NA 1HYEA 5IDWA 4R1UA 4B3JA 3ZH2A 1YRLA 3CXRA 1QG6A 1U1IA 3ST7A 2IZZA 2OBNA 4UVGA 4PZDA 1KVQA 1AHHA 2GF2A 4JP3A 2WE7A 4AJHA 4RVDA 2O3TA 4INAA 3DMTA 4GAEA 2FR8A 2NTVA 4YT4A 3WMWA 1NQTA 1P74A 3HDJA 4DPLA 2DC1A 3F6YA 5G0SA 3LVFO 1ZSVA 3FPCA 5T8KA 3VH1A 2Y93A 3NTOA 3PFWO 2PKRA 3AOEC 3WJ7A 1BMDA 5B37A 3VDQA 3I9NA 5TIIA 4WLOA 1E6EA 3U3XA 3UGKA 2W90A 2B4RO 3GZNA 1R16A 3GVPA 2DLDA 3G79A 4NMHA 1YDEA 5JAZA 2FR0A 8LDHA 2IEBA 3L4BC 4CM8B 1O5IA 4NJOA 5DBFA 2X4GA 3ASVA 4Y6RA 1ENYA 5CG2A 3KHUA 1X1TA 4EEZA 4NIMA 1V35A 1GD1O 4XJTA 3JYQA 3GK3A 1LUAA 4JGBA 2JAPA 1PTJA 1E3WB 3W4JA 1JKJA 1FDWA 2GO1A 1PQWA 3RI3A 2HJRA 3KLPX 4OHUA 4NBUA 3F3SA 5BSEA 1YWGO 3IP3A 2SCUA 5T5QA 4NQZA 3QV1A 3IL2A 3H2ZA 3VHRA 1EDOA 1YB5A 5CG1A 4PLWA 1G0NA 1KBZA 2JAHA 3ZGYA 1WVGA 3QLJA 3ZDFA 4XQGA 4PG8A 1DIHA 5IJZA 1T4BA 3M1AA 2BHLA 2CVQA 1FK8A 4GX2A 4J4BA 1P3DA 1XSEA 1C1DA 1PJ3A 5ES3A 2Y1OA 1ZO8A 3H9UA 4PG6A 2IODA 4J4TA 4G81A 4CMEC 2CDCA 3OJEA 2H1SA 4MP6A 4OXYA 4RLSA 3A1NA 5I7SA 2XAAA 3E9MA 2ZTVA 4XB1A 1V3UA 3DR3A 3DL2A 4TQGA 2Q2WA 3F46A 1P45A 3ZHBA 5I9LA 3HN2A 4OKIA 4R16A 5JC1A 3B1FA 2EF1A 5F1KA 4CLRB 2W2KA 4TKLA 4CMGA 5TC4A 3QWHA 2RBEA 2H5LA 4ALMA 4MJLA 3JQ9C 2VWGA 3NJ4A 3JQ7A 5F5NA 5IXYA 1O0SA 3GT0A 3LSYA 5GMOA 1GYQA 1NVTA 2WMDA 4B8ZA 2NNLD 4MP3A 3BHIA 4KUHA 3UICA 4Y67A 1PJ4A 1A7KA 1DAPA 4ZU3A 3JCZA 1C0LA 4Q3BA 4TSKA 2O3QA 4FCCA 4ILKA 2A4KA 4B7UA 1YQGA 3B6ZA 1GZ4A 2PD6A 5I7VA 1GZ3A 3KETA 1GCOA 3DTTA 3CEAA 4P38A 2AE1A 1MC4A 4ZN6A 4QX6A 1P44A 3GLQA 4FOSA 4J2OA 3T7CA 3ABIA 5KJEA 1H2BA 4B4UA 2OGUA 1LU9A 4YYZA 2PH3A 3JQCA 4AJIA 5TRTA 4OM8A 4UREA 1P1RA 1X7HA 5TS3A 2AQKA 3ZZNA 3O8QB 1W73A 4IJUA 4FN4A 5AXBA 4JIGA 2GPTA 5JDCA 2JD2A 5K0ZA 2B5VA 2JL1A 4RF5A 5L95A 1A27A 1MUUA 5FWNA 1V6AA 4J0FA 1PS8A 5A5FA 3I9KA 4LRTB 4FB5A 1SBYA 5IZ4A 3WGIA 3UHAA 2ZJ0A 3WGQA 2CUKA 1R4MA 4CUJA 4AICA 3CPSA 1DIGA 3TOXA 2QHXA 5CFZA 4JBHA 4CM9A 1I33A 3GNSA 3QHAA 3MJ4A 4CMIB 5L4LA 1Q2XA 1I01A 3FCOA 3VH3A 4XR9A 3IJRA 2YDYA 1WMAA 2JFHA 3BMNB 3OIFA 4RO0A 3GEDA 1I3MA 5ENVA 1MC5A 3CMMA 3E1KA 3LT1A 1R37A 1HDXA 5T6BA 1KEPA 4YR9A 2Y66A 3BHMA 3NTQA 4GLOA 1VJ0A 1MV8A 4BNNA 1KY5A 3AU8A 1I30A 1BXGA 4XGNA 4ZQBA 1CJCA 1JN0A 1RYDA 4M49A 3TL3A 3PDJA 1SEPA 1Y8RA 2WE8A 3RFTA 4QTZA 2PY6A 4ZGWA 4B8WA 2PKQP 4DBVO 2EKPA 4UUNA 4RVHA 5BNFA 3RKRA 4CLEA 2GASA 4PLYA 1PS9A 5T8KC 4DXHA 3AWDA 4IQGA 1JAYA 3R1IA 1HDOA 1TB4A 3BYZA 3W8EA 1ADGA 1UH5A 3MEQA 1DRVA 3OQ1A 5LDGA 1N7HA 5IAAA 4MIEA 1K3TA 2J3KA 3DFZA 3OHSX 3D4NA 4GGPA 5A9SB 1CYDA 5IZCA 4J16A 1DLIA 1LX6A 1C1XA 4IS2A 2D3TA 2QRJA 1HT0A 1BGVA 3E18A 2C2XA 5L7TA 1A5ZA 1OMOA 3INGA 1OFGA 4ITUA 3M1LA 4D42A 3CH6A 4WLNA 4YPOA 2GZ2A 4YA6A 5FFFA 4PG7A 4F3YA 4I5GA 4LRSB 2WEKA 3OMLA 3DDNA 3EDMA 3TZCA 4IBOA 4L0QA 4PIVA 2B0JA 2X5JO 1ZUD1 4ROSA 1U2DA 2AW5A 2ET6A 3RROA 3ICPA 2VYVD 3OM9A 2PD4A 4ND4A 4RV9A 4NFSA 4CLOB 2EIHA 3DB2A 3WNQA 5EQFA 1V3TA 3VDRA 2BGMA 4Q3CA 1GUFA 4BB6A 3D4PA 4BNHA 1N1EA 1YOVA 2O3JA 2VZ9A 1HDGO 1NBOA 2PGLA 3FSRA 2VYVA 1KVTA 3TJRA 2C0CA 1GEGA 2H63A 4I9HA 3KEQA 1L7DA 1Z6ZA 2YY7A 8ADHA 2VWHA 5G0VA 4CR6A 2Q49A 1Y6JA 2RHCA 5BSGA 4XYGA 1D1TA 2CF5A 1MG5A 2HMVA 4IM7A 4HFMA 3O9ZA 3HNPA 2WD7B 4ID9A 1I2ZA 3GPIA 2BF7A 3CSDA 4XGKA 3MZ0A 4RVUA 4CV3A 3KEOA 5JE8A 1IYZA 2IEDA 3BXXA 3ZU4A 1F0YA 1QYXA 1IL0A 3MJEA 2FWMX 3L9XA 1A9YA 2E6UX 2W2LA 1NP3A 3GGOA 1Y81A 4HV4A 4KOAA 1HDYA 1EQUA 1W6UA 4NDNE 1EUZA 1LSUA 3NRCA 3NV9A 4U7WA 4CMIA 3ZU3A 2B5WA 1X1EA 3EHEA 3Q0EA 2NACA 3RUEA 3UVEA 5AOVA 2BRUA 2BMAA 2V6GA 3KBOA 4D79A 3GDOA 1YQDA 1DFHA 4XRRA 1Z75A 3E5MA 4FR5A 5A9TA 4DLLA 2GRAA 3JQ8A 3ANMA 1R12A 1WDMA 2NQ8A 4RVFA 3WYBA 4ALIA 4DIFA 3ZW8A 4KQWA 1XKQA 1CERA 5TGDA 4TVBA 1R4MB 4NI5A 5JPIA 1GL3A 4JCOA 1JWAB 4CQMB 4XYMA 2GERA 4ND5A 4WPGA 4YRDA 3VZRA 1XQ6A 1A9ZA 4DBZA 1Q1NA 1E3JA 4IXTA 1SC6A 2VT2A 1PJQA 4Z3KA 5CEFA 4GVXA 3F9IA 1GYRA 3ZWYA 1WPQA 3DBVO 1WAMA 5BNTA 2DVMA 3D5QA 3FNGA 2OUIA 3I52A 5G2OA 5EJ2A 5L3ZA 3C7DB 1VRWA 3HFGA 4PZCA 1SZJG 1T2DA 3JQEA 3NT4A 4KDFA 1I0ZA 4FC6A 2V7PA 3JQAB 4HX5A 2HQ1A 4C7KA 2C20A 1ISIA 3MJVA 2NVWA 3IOYA 4BKOA 4L73A 4GL4A 4G65A 2NVBA 2Y1GA 1UDAA 3ZU2A 3IC5A 3JQDA 3RJ5A 4WOJA 3K73O 2EG9A 5CPFA 3WXBA 4P4NA 4CJXA 4IJWA 1TA4A 2GN6A 4QFDA 4GX0A 3FHLA 4D0SA 3VH2A 3HB4X 3JD3A 2JFGA 4YXFA 1U4OA 2BFPA 5T64A 1DAOA 2EWMA 4FFOA 1KEVA 1R0KA 4PGFA 4PRLA 3OA2A 4J6FA 4W7IA 1MLDA 1Y5MA 1T1RA 5DOVA 1I3LA 2HU2A 4YEDA 1SPXA 1KYQA 4BUCA 4EBFA 1N9GA 2H6EA 3NDRA 4BO9A 3S2EA 5KKCA 1ZXBA 2J5RA 5JMPA 4OJNA 1ENOA 3F5SA 1QLHA 3KO8A 4DMLA 4E5NA 2Q4EA 4LK3A 4H16A 4XIJA 2GN8A 2X0RA 3OIDA 2EKLA 4IDAA 3ETEA 4DRYA 4W4TA 5DF1A 4YT5A 5U9CA 1M76A 3TN7A 2VRBA 3E82A 7ADHA 1Q0LA 5K6AA 2V6FA 2ZB4A 5B12A 4AFNA 3ZWBA 1I3NA 1ZVMA 3G3EA 3E48A 1L1FA 2HCTA 2FPIA 4E4YA 4E31A 5T57A 3HJAA 5ENDA 2OZPA 4JK3A 4BOYA 2QX7A 4HADA 3C8MA 3IIEA 1AE1A 1KEUA 3RUAA 2V6BA 5C7LO 3RVDA 4D3FA 4BS9A 2XOXA 1P1JA 4R4JA 2PGDA 1Z7EA 1ZKMA 4PG4A 2VTDA 2F1KA 3HE3A 4AG3A 3PJFA 4JBIA 1VI2A 4UVEA 4EZBA 2JJYA 4AJ4A 1SMKA 1YOVB 1EVIA 3GRKA 3SC6A 5IXSA 1EQ2A 3I3OA 3OA0A 2Y1DA 5TT1A 4XGIA 4ZHSA 2J5QA 2FSSA 2RCYA 1O89A 4PVDA 3ZCXA 3PWSA 1PEDA 1T4DA 3ADPA 3I9LA 2AQ8A 1E1KA 2BELA 2CDAA 3PGJA 4BO0A 3IAHA 2Q99A 2DBQA 3VZSA 3PJEA 4E0BA 1SNYA 1YBAA 3U49A 2PV7A 2AEMA 4PLTA 4E32A 1ISFA 4CMKA 3AY6A 3JYPA 4BB5A 1MG0A 2Y1FA 3S2GA 3VKVA 2PTGA 1DDOA 3JD1A 3ZV6A 1P0FA 4AJJA 5ER6A 1V9LA 3U0BA 5T67A 1BSVA 3DBLB 4KUEA 5I7EA 5JDIA 3CIFA 4UUPA 1E7RA 4WCFA 2G1UA 1NFFA 1QR6A 5A3VA 4IUYA 1LDEA 2X8LA 3IQDB 1GUYA 2DT5A 2Z95A 3FBGA 4YJDA 1NPDA 3NUGA 4EI2A 5JY6A 1QORA 3RSHA 2Y99A 1A7AA 5KIAA 2ZK7A 2PZLA 3KYBA 2VHYA 4K1LA 5U4QA 3E03A 3UW3A 1PJSA 3EVTA 1XGKA 1BDBA 2CVZA 2IE0A 3EUWA 4ZQGA 3DBLA 4N5MA 4KP7A 3KYDA 2VWPA 1FDSA 2Y1CA 3I9OA 4ZA2A 3WTCA 2DU8A 2NLOA 3VPSA 3ORFA 4J7CA 5KCZA 3JQ7B 4EEXA 3M2PA 1UZLA 2VWQA 1H93A 3D0OA 4IINA 4MVJP 4X54A 5TJHA 3HUDA 3GVXA 4CLOA 5IZCC 2BI7A 3GVCA 2FOIA 3TFOA 2OP0A 5B4VA 4GWGA 1YKFA 1I10A 3BZUA 1B14A 4GKBA 4BNWA 3DO5A 1R4NA 4FDAA 1VM6A 1EFLA 1N2SA 4S3MA 1A4UA 3GDGA 4AJNA 4YAJA 1KVRA 5IF3A 2NADA 2IRWA 3DHYA 5EQDA 3PHHA 2FZEA 4IDFA 2Y67A 2WM3A 4H15A 4PLZA 3DZIA 2VYNA 4WLUA 3R6DA 2P9EA 4D44A 4MPDA 3QW2A 5C37A 5ADHA 5C5IA 2YFQA 4GPD1 4BNZA 4RORA 4XDZA 2X9GA 2PFGA 3GUYA 1WMBA 1MFPA 1LRJA 4LMPA 3S2IA 2UVDA 4R51A 4GKVA 4PLGA 5GZ6A 2VHXA 4RVSA 2ZTLA 3GF4A 1NNUA 1VL6A 2I6TA 5TSDA 1ZW1A 3BIOA 3VC7A 3I23A 4EUEA 4FFPA 2J5KA 1IZ9A 4WLVA 2P5UA 3LDHA 5GZ1A 2YUTA 3G0OA 2HO5A 4J43A 2OP1A 3OJ0A 4BNJA 3JQGA 2X1HA 4TRRA 3AOGA 4I5EA 3OETA 4XDYA 4XD2A 1HSZA 3LC2O 4MOWA 4B4WA 3LF1A 1PZGA 1LA2A 2VOEA 1MX3A 4CM8A 1LRLA 2PKQO 4U6SA 4IDBA 1E3WA 4IXWA 4BKQA 4PN3A 1GPDG 1PX0A 5CDUA 3PLNA 3D3EA 1J6UA 1X15A 4E2ZA 4MVJD 4TMFA 1DRUA 9LDTA 1K0UA 1KY4A 1B2LA 1WZEA 1I2CA 4DIOA 1DJQA 5I8ZA 4EW6A 2X86A 1MB4A 1S6YA 2VN8A 1E7YA 1NAIA 3JQ6A 4BGEA 3PQDA 4KZPA 4M8SA 1XA0A 2VHVA 2GZ1A 2FY8A 1I8TA 4U0KA 1F8GA 1YXMA 4CR8A 3Q2IA 4NBTA 4IZIA 5DULA 2GD1O 4E2YA 4YAIA 3JTMA 3SLKA 3PHLA 4BMVA 1PL8A 4BNLA 4DWVA 1DXYA 1T1SA 5G0UA 4J3FA 5G4LA 3U4CA 2DPGA 1CWUA 3KLMX 1RYEA 2XF8A 4YBZA 2WWRA 4J9VA 3ZV5A 2VUUA 1YS4A 2AA3A 3PP8A 1D8AA 3OEWA 1LSSA 3WOHA 5JXWA 4L4SA 1X7GA 4RPHA 5HBRA 1HEUA 5DN9A 1NYTA 3OJOA 4WUVA 5I7FA 3GFBA 2A94A 1YDWA 3K8ZA 1MXFA 3JQ9A 4BNVA 3FTNA 1KVUA 1WNTA 1ADFA 1QXSA 1E7WA 1BTOA 1HRDA 2FN7A 1M6HA 3O03A 1BXZA 3K5PA 2A35A 3KSUA 1BRMA 3KZVA 4FFNA 4U8GA 1P31A 5TNXA 2P9GA 2C7VA 2IXAA 5A02A 4WCFC 2OXIA 1PGQA 1HDCA 3QWAA 4NPCA 4CMEA 3RUHA 3GR6A 4JQCA 3ICCA 2ZQYA 4XIYA 3VVBA 3E8XA 4CM3A 4FOOA 5BQFA 2VHWA 1U3VA 2VTEA 1DJNA 4XYLA 1Q7GA 4XRGA 1DIRA 3FWNA 3KV3O 5DP1A 3S1LA 1ISHA 1N5DA 4GI2A 1GUZA 1YL5A 1F14A 1QLJA 1XU7A 2QIOA 3I83A 3M2TA 4XX0A 2HK8A 4LVCA 3RKUA 4M87A 1CF2O 4YT2A 2QYSA 1U3UA 4B79A 1ADBA 1EK5A 1UXGA 5ICMA 3OEYA 3QA9A 4Q3DA 3HFSA 3K9QO 1ZJZA 3GOHA 2WSBA 5CDGA 4J1TA 5BSHA 4L75A 5KJFA 1QYDA 5A05A 4DQVA 1HDRA 4CUKA 4RDIA 2CMDA 2YFHA 2ZJ1A 1HYHA 4P4GA 1P1FA 2BFMA 1IZ0A 1J4AA 2ZIZA 4GMGA 4L74A 4UEKA 4CUZA 1OBFO 1QP8A 1PU2A 5JCJA 1H6CA 2FHSA 4XR4A 3GUCA 4GBJA 3WSVA 1KC3A 3A4VA 2IDZA 2X9NA 1EUCA 4RJTA 1KS9A 1PIWA 5COBA 3JV7A 3NT2A 5JAMA 3UH1A 2GN4A 1H6DA 3K31A 3UXYA 4UEOA 1LDBA 1LDYA 1TLTA 1U5AA 3SJ7A 4HNHA 4M86A 2NVUA 5BNIA 4CODB 4R1TA 1MP0A 3HG7A 4WASA 1Y1PA 4JBGA 1HL3A 3V1UA 1E92A 2C5EA 1YBMA 4WLEA 5DP2A 1IUKA 4KUGA 1B8UA 2F00A 1EDZA 3PVZA 2DUUA 1U2GA 3DBHA 4GGOA 3BTVA 3UAGA 2I66A 2AXQA 3DMTC 1D7OA 4G2NA 4MVJF 2YQ5A 2XPCA 3W8DA 4FPXA 2V65A 1SOWA 3KSDO 3B70A 5DCYA 3HDHA 2B83A 3QIVA 3DAFA 3RBXA 3W6ZA 1EK6A 5JMWA 3V2HA 1PR3A 1B0AA 3HDYA 5KJ6A 4OIMA 3JQAA 2RH4A 3RC2A 4BO7A 4XZ3A 4LCJA 4N18A 3HSKA 1WLYA 4D0RA 1HWYA 5L9AA 4IDDA 3ZWXA 1GY8A 2Q4BA 1GQ2A 2I65A 4ZQHA 4ALJA 4DVJA 3KRTA 4WGGA 4J7UA 4M54A 3TDKA 1HF3A 3WGZA 1ZK1A 1O95A 4OKNA 4DA9A 1BXGB 1YL6A 2BLLA 2QZZA 2UUPA 3RC9A 3RFVA 1HLPA 2WJPA 3AM3A 3I4FA 4PRKA 2G5CA 3GN1A 4WCDA 5GZ3A 3U62A 4XB2A 4B3IA 2VT3A 3Q9UA 3WBBA 4BO5A 3WTBA 4EUHA 5A04A 4FC7A 5TF4A 5JS6A 4O0LA 1U8FO 4OL9A 4TRMA 3RUCA 3QY9A 4QO7A 1AXGA 4AJ2A 3RUIA 2OBYA 3AJRA 1EVJA 3DEYX 3PIIA 2O3SA 3GMSA 3VTFA 4YAGA 2OORA 4BQRA 5IG2A 2XXBA 2JKVA 1ZSNA 3C3XA 4YB8A 1FJHA 2NQTA 4BO8A 4YQZA 4CM6A 3U9LA 2NTJA 3GZ4A 1DO8A 2EERA 1B7GO 3AK4A 4XQCA 2XXJA 4HP8A 4CM7A 4R5HA 1WWKA 2RH8A 3QVSA 1JLLA 1DC4A 4IS3A 4UVHA 1FDTA 3TF5A 3ZNPA 3BTOA 3JQBC 1HKUA 3WNVA 4R3WA 1H0KA 2EJVA 1PL7A 3D64A 4I1IA 2DKNA 2FMUA 3H5NA 2ZB8A 1P9LA 4FFMA 1PR9A 5JNLA 4A27A 2NU6A 5DDIP 3TZ6A 3U4IA 1TT5B 3GA0A 3DHNA 3I6IA 4QECA 2VRCD 3LYLA 1ZSYA 2Q1SA 3BMOA 1QSGA 3LLVA 4OQZA 4YRAA 1LSOA 3GEGA 1LLQA 3VTZA 4LSWA 2GZ3A 4AJPA 2DPHA 4IGFA 3PLRA 1NWCA 4RF2A 4XKJA 1LLUA 2X6TA 4CLHA 3L9WA 3Q3CA 1N7GA 1QKIA 3JD4A 4YWJA 2VZ0A 3C1AA 3DXFA 3ZWOA 1RM3A 4OYRA 4BO3A 5KWEA 4LN1A 4A7PA 4UEJA 5H81A 1LDNA 3C7CB 3WIEA 3JD0A 3WIDA 5B4TA 3X2EA 2O7QA 4WOKA 1EEHA 4LCEA 4PZEA 4EITA 4EJMA 3GMDA 3T4EA 4J49A 3ZNNA 3R3SA 3B1JA 1EE2A 1EVZA 3H3JA 1E7MA 4GVLA 1ISGA 2E48A 1CQIA 1XYGA 2IZ0A 3EZYA 1RJWA 4MDHA 3DFUA 3WGTA 1X0VA 1RM5A 5AQ1A 1E3SA 3O26A 4YAEA 4DMMA 4K6FA 1I2BA 2E82A 3OP4A 4FW8A 5JY1A 2WYUA 2B69A 2I76A 4OGWA 3WB9A 2NTNA 2P91A 2PH5A 3PIDA 2EJWA 1ZK3A 4R68A 5EPOA 4R69A 3GG2A 4MKRA 1CRWG 4TWRA 1LLDA 1H5QA 3HN7A 1XR3A 4MVJG 3R0IA 1E3EA 3H8VA 4PFJA 1P1HA 4R01A 5LC1A 4A5OA 1TXGA 3WICA 5A9RA 3EY4A 1XDWA 3P7MA 1O8CA 3FNHA 2JHGA 3EK2A 4A26A 3SLGA 1Y8QB 1VE9A 1W4ZA 3O8QA 1XCBA 4J90A 4CLDA 4TVOA 5EESA 4WLFA 1D4FA 2DFVA 3HADA 4WJZA 4CMBA 4Z9FA 1BDMA 2PGJA 1AHIA 1I36A 4WNIA 2CY0A 3KB6A 4K9DA 2FPPA 2IYPA 2PNFA 2B35A 1F8FA 4OXKA 1DRWA 3RAJA 1F17A 1DPGA 3H3FA 1N92A 1VC2A 5COAA 3FR8A 5ER9A 3F47A 1P33A 4FJ2A 3W1VA 2X5KO 3DOCA 4JLWA 4P22A 2X0IA 2YDXA 2QG4A 3EYWA 4UUOA 1ZK4A 4HXYA 1NVGA 4B4VA 4MVJM 1AUPA 4ESOA 1DIAA 4CV1A 3L07A 3QRWA 1GEEA 3AI3A 1PWZA 3VZQA 5IN5A 1ZIDA 3S55A 3UUWA 5TLSA 3ROQA 4ND2A 2R6JA 4JXKA 1BVUA 1P77A 1JVBA 2YHUA 4Y8VA 5HS4A 4AVYA 1UP7A 2G0TA 3LT4A 1E1LA 2BI8A 3QVOA 3U5TA 5TJ9A 3IUSA 5JAIA 1WZIA 3BAZA 2HJSA 3CZRA 4J1SA 2QW8A 1KC1A 4A10A 2RAFA 2BD0A 3ZWAA 2P9CA 1GV0A 2J6IA 1U8XX 3KXDA 1WXDA 4QO8A 4BNMA 1JKFA 1Y5RA 3BA1A 3RC1A 3DZFA 4WECA 1LTHR 5DZSA 4E2XA 2X22A 3I9JA 3WGHA 2W4QA 5F1PA 1PJLA 3EVNA 4HKTA 2VYND 3GY0A 1OOEA 5G0WA 4E3ZA 1GR0A 3ROMA 5JSFA 3KM0A 4E30A 3WQRA 4NBWA 1U7TA 4UUMA 3VZPA 3LK7A 2P4HX 2PR2A 3LU1A 3U4HA 1FMCA 2DBRA 4Q39A 1XQ1A 4O6VA 1G1AA 4EGFA 5JDCC 3WGOA 4IPTA 3CKYA 1M2WA 3G49A 3ZWWA 3VVCA 4Z6KA 3NT5A 1G0OA 3NJ8A 4IQ8A 1UJMA 3LC7O 1HTBA 3GAFA 1W0CA 4LMRA 2JD1A 3DOOA 1JU9A 1VL8A 4PLCA 1U4SA 3ZWMA 5FEUA 1VLLA 1LXCA 3KTDA 1I3KA 4DLAA 3MJTA 1MGOA 4NU6A 2ZTMA 2AE2A 1VKNA 2P4QA 1LI4A 2ZKLA 5EL0A 3TSCA 1Q7CA 3MJCA 2G76A 5A4DA 1SEVA 1LSJA 3BMCB 3DBHB 4I9UA 1YVEI 1FF9A 3U4DA 5GY7A 3E9QA 2O2SA 1NPYA 3ANLA 3WYEA 4L4RA 4L4XA 1Z7BA 4QSMA 5JC8A 3NAQA 2EHDA 3BMQA 4B4OA 1KEWA 3CINA 4FFRA 1NQAO 4CMJA 4RCVA 3GZNB 4BNTA 3K30A 3UFXA 3ZN2A 2HK7A 3WFIA 3P5SA 3JYOA 4RF4A 2FSVA 5C7IO 1NXQA 1UXHA 2NU7A 4IIVA 4ZICA 5JAQA 4MINA 3E9NA 4WNCA 3I5MA 1YE3A 2NU9A 5COQA 2YHIA 3AUAA 2Q45A 3QWFA 1ZK2A 5I8WA 2GCGA 4L76A 5JO0A 4KTTE 1MA0A 4AJOA 2AQHA 3JQFC 1UXJA 4YQYA 1DLJA 3CUKA 1CEQA 3DBRA 2H9IA 1V0JA 1T25A 3UKOA 5EIOA 5MDHA 1VKOA 4JP2A 4E21A 4BO4A 4R5MA 3L6DA 3PFFA 4CMCA 3GRPA 5ITVA 4CQMA 2A9FA 2O7SA 3BTSA 1UR5A 3TFQA 5HM8A 3O38A 1NR7A 1LEHA 1T26A 1UP4A 1Z82A 3NEPX 4R41A 3P19A 3P2YA 1ENZA 4NJMA 5L7YA 1Y9EA 5KNLA 2DQ4A 1KIFA 2TMDA 4IJVA 4CQMD 3K2EA 2BKAA 2Z1MA 3SEFA 1JW9B 1R4NB 2CD9A 4M89A 4II2A 3OFSA 4JJIA 1LNQA 4TZTA 4XEHA 4DPMA 3N58A 1NX6A 1O6ZA 3NX4A 3I4CA 2OL4A 4O59O 3RJ9A 1NM5A 4BNIA 4CM5A 3D3WB 3FNEA 4NJMB 1QMGA 1ADCA 1NFRA 2QYTA 3ENKA 4Y98A 1BW9A 3DOJA 1Z74A 5FF9A 3RWBA 4Z0HO 1GZ6A 3BHJA 3UOGA 5TX7A 3L77A 3ZU5A 3K96A 2EW8A 1LBEA 4FFLA 1W8DA 1T2FA 3D1LA 1J49A 1I5RA 3D5TA 1ZH8A 3DAGA 2WDZA 3MJSA 1EFKA 4PVCA 3L4BA 4OOEA 4LGVA 5F3RA 1MXHA 3K6JA 2O3RA 1OAAA 4WEQA 4J0EA 1ISJA 3MOIA 4LSMA 3ASUA 3ZWVA 3QVWA 4KDEA 5JO9A 4RQUA 3ZI0A 2HLPA 4XYBA 5DCUA 5ILGA 1D1SA 1U5CA 2HUNA 3PWZA 5BT9A 5I9NA 3OQ6A 1YGYA 4E6PA 3AOEA 1YQXA 2ZB3A 4F45A 4BV8A 3NGLA 3OBBA 2ZQZA 4EYEA 1EBFA 1GTMA 5EMHA 3QVTA 4AJ1A 3ENNA 4Y6SA 3DAPA 3TQHA 4DPKA 4I5DA 3SJUA 1ULUA 2Y0DA 3ETDA 4D3SA 3RC7A 3I1JA 5CDSA 1Q0QA 4WEOA 5A3JA 1A4IA 3EMKA 5A1TA 1TT7A 2YHIB 2LDXA 4TRNA 4GWKA 2E37A 1HETA 4W7HA 4J7XA 3RBZA 3F4LA 4MP8A 1GCUA 1C14A 3PDUA 3RCBA 3AW9A 2PLAA 3GGPA 3MTJA 5KVCA 4FGSA 3TNLA 1AXEA 3BMQB 4YJGA 4RQTA 2YYYA 4ALKA 5G4KA 4RL6A 4OO3A 3CZMA 2O48X 4FS3A 3SXPA 2X23A 4BMSA 2Q1TA 3IS3A 1K6JA 2ZATA 4E5MA 3IKTA 4CLRA 3M6IA 3LLSA 5L4NA 3EAGA 1IPFA 4YJHB 2Z5LA 1PL6A 1OI7A 3AUTA 2D5AA 3ZW9A 1C1XB 2HRZA 4DREA 2DAPA 4H7PA 2BFAA 2D1YA 3RIHA 3WG9A 5JW6A 1ENPA 2O4UX 2D0IA 4RPJA 1QYWA 4Z0TA 4L9RA 1E5LA 1N8KA 6ADHA 4DIBA 1EE9A 5JDIC 1DOHA 3QJ5A 4A2CA 5JBIA 4F46A 3IDSA 5KJCA 1LQUA 1R15A 1ZEJA 3PTZA 1H9BA 1I32A 4K26A 5DNAA 4JJGA 3UCEA 4LISA 4YAKA 1Y8QA 2BH9A 1PSDA 5ITWA 2ZCVA 2DUWA 2AG8A 3RU7A 2OMEA 2CFCA 4C7JA 3GNQA 4JN6B 3Q9NA 1H9AA 1T2EA 4E13A 2JCVA 4U6QA 5L7WA 4BGVA 3ITDA 1SB9A 4CPDA 2PZKA 1WDLA 2DM6A 3D3WA 4PCVA 1VSUA 4GLLA 3WLEA 5CDYA 4EDFA 4ZRNA 5HRUA 3AFMA 2VNSA 1AGNA 4E5KA 1SO8A 5TQVA 4KQXA 4TZKA 2D59A 3VPGA 3HB5X 5JYEA 1M6WA 3RASA 5JCJD 3CTMA 4ALLA 1LJ8A 3OJLA 4TRJA 1NQOA 3Q11A
chains in the Genus database with same CATH superfamily
2O59A 1KVSA 2DUMA 4ZO4A 1G9TA 3NC4A 1E0KA 4H31A 3OQVA 3I61A 4GZ6A 1JQJC 3EXEB 2YIVX 3N1UA 1OWNA 4CL2A 3PGLA 3Q85A 3V8PA 3G8AA 2PD3A 3WGNA 2H3EA 5BRJA 3N6RA 2AQIA 1M75A 2AC4A 4PO3X 3Q7PA 1MIOA 1TTPB 3CMCO 2JLAA 1JEYA 2G04A 4GOND 1SCUA 1WW8A 5KQLA 4NZYA 2AFIA 1C0KA 1NI5A 4YMGA 1TJYA 4R98A 1K6IA 4PANA 4US1R 1G8PA 2WA1A 2CL5A 2OKGA 3BJEA 2W6CX 3OCYA 3DG9A 3DDWA 1IMOA 2NZJA 3AHGA 3HB9A 2OHJA 4Q4JB 1ZPDA 3S5JA 3A4MA 2BSAA 2WD9A 2O50A 3DZKA 1RIFA 3IBCA 4GNRA 5E3IA 4YV1A 3B1XA 4MEBA 1E2MA 1THZA 4OYLA 4GQAA 3MAJA 1XZEA 1FTNA 1OTYA 4OXNA 4QPNA 4CV2A 3ZHSA 5CURA 2E4VA 3UT6A 1BVRA 4EG5A 1XZNA 4CL3A 3DOFA 1W0KD 5F7OA 1W4AA 3NRBA 4LZZA 1O95C 5IAEA 3I58A 5H70A 3STUA 4NBNA 4ATNA 1IB6A 3E5RA 1EVLA 4EG7A 5J2UA 1ZD3A 4QRHA 2JEZA 3QFHA 4AO6A 5H4HA 2F64A 1NF3A 1SGWA 1D6NA 1PV2A 5LYJA 3VU9A 4ZYLA 1V1JA 1UM8A 2RBGA 3L1KA 4MWGA 2WWVD 4BX8A 1R0YA 2Z3WA 3NTRA 4GS5A 2QN9A 2CBZA 5HUJA 1CNFA 2V58A 4L8FA 1DAFA 1EFRD 5AFSA 2YFYA 4JH0A 2CXTA 4EUFA 4DZTA 3WRXA 4FSHA 4W9NC 2ZFUA 3WLOA 4INOA 2W2VA 3RSOA 4O63O 1C0PA 1GU7A 1RQ2A 1ILEA 4WD3A 1C0IA 2X5OA 4B76A 3DLAA 3PC7A 4UD6A 4B3FX 2W5UA 5FBVB 4HLNA 1NUHA 1P4GA 3DE7X 3OO0A 3RT1A 3JXEA 3ND5A 1AKRA 3DQPA 4HWKA 4UVIA 5ER6A 5THQA 1B3BA 1NL3A 1NG1A 1NFQA 4EIWA 1NNEA 1P91A 2D7JA 2FP3A 1R4ZA 3FHOA 4DCTA 2YIDA 4PEVA 2R00C 3R3HA 2JLQA 4KE9A 2VRCA 4I2VA 5FT9A 5B6IA 4ND1A 4OCZA 2IQIA 1NSFA 3EF1A 4LJLA 4BP8A 1CUYA 3OP1A 1D04A 4B6SA 4UAGA 2KBEA 4AZSA 2G06A 2B4QA 1XD2B 2C2YA 2CNWD 2JBHA 3TZHA 5C5CA 5C51B 1ZGCA 4A91A 3ISTA 1U3GA 1U28A 4ENSA 3D2AA 1ORDA 2PJZA 4LMBA 4M60A 1PP4A 3GFPA 3CWZA 1WABA 1HZZA 3A1WA 1YR3A 4YJ3A 2P5YA 2HDHA 1RLJA 2NUPA 1X9IA 4E4TA 3H9CA 4PX3A 3RVSA 1SBIA 2W4IA 4NENB 4F3NA 3SI7A 1TIBA 3PPVA 5JARA 3R3ZA 5JADA 3RF6A 3BWYA 2B3DA 4YCSA 2Q4OA 3PQFA 2YCLA 1X1QA 5KTRA 1PJRA 5CLQA 3WX0A 4RPLA 3IV7A 3V2UA 2JFQA 4AKGA 1JDBC 2QJTA 5JAOA 2A58A 2SCUB 4PSAA 1FMJA 1SCUB 4M55A 2WJ3A 3FE2A 4FYXA 4KG7A 1ZMTA 2BSXA 4N54A 3U17A 5FUQA 5KMGA 4NXMB 2EDAA 4WK6A 1FUYB 1SBHA 1HRKA 4W5RA 2ZXUA 1U8ZA 3L8EA 2R1ZA 4BKMA 1QRAA 1QM5A 1V41E 1L7OA 5E6SB 3W3AD 1CC1S 3GG9A 3HWRA 3OPMA 3FZNA 4JCCA 3H5AA 4OSPA 3UF0A 1ZM2A 1KK3A 3CLKA 1XMJA 2PO5A 2XADA 4RULA 3EGXA 1KMIY 5AJYA 4B3HA 4RLQA 4DRZA 5JCPA 2B25A 2V97A 3I9V1 4GEKA 4GOMD 2KW5A 4OHOA 4RHFA 3ZE1B 4DDHA 2I2DA 1DCMA 2P0YA 3DOHA 5IJ0A 5DFAA 5EKXA 2ZE8A 2C00A 3PJDA 3VYTB 1G98A 1Y7LA 3ROZA 1PEYA 3M6MD 4MQFA 2D8AA 5AXCA 2H2DA 1YFKA 4RLFA 2HA6A 2AF3C 3DTYA 2JFFA 3NRJA 3K0HA 3DZBA 2VPTA 3TLXA 4R9VA 2I87A 2PMFA 2UVPB 5FWYB 4PC7A 3TRFA 4G67A 3CNNA 2MINA 1DO0A 4KH0A 4OQNA 4TPKA 4BNFA 2FW8A 1P29A 3Q1LA 5L4SA 4KO2S 2XIJA 1SOVA 3D1VA 4LZWA 2PUDA 3LC1O 1Z17A 1IN8A 1IBLB 3WLMA 4E08A 2QVCA 4OQXA 2O20A 2HXYA 4GDMA 3GRVA 1LH0A 1CS0A 1E3MA 1ZU5A 3IA2A 4W99A 2VVTA 3QXSA 4QHSA 2O4CA 1UMCA 1XLTA 2XT0A 3OO1A 3QHPA 4OBXA 4QDTA 3AY0A 1FDVA 4UHCA 5T4HA 1RR6A 3HYLA 3KQOA 4OHKA 3BCUA 1YBHA 2H1IA 5HHTA 3A1FA 3ACBA 3B3QA 2L17A 4RFLA 1P9OA 5AVQA 3D7LA 1O4WA 1GQQA 2HHLA 3BL5A 3L46A 2IYFA 3SG0A 4JBNA 2YN4A 4ABTA 2WT9A 4UW9A 2EP5A 1SAYA 2REXB 1ID1A 3BSWA 2IXBA 1QB7A 2F8MA 3LCRA 3AW8A 1DIOB 1YQWA 3OZGA 3UMSA 2AGVA 1PV1A 1Z4LA 1FFCA 5K3SA 1IQUA 4D7AA 2JHFA 1DKRA 4A0SA 3K70C 1BEZA 3COSA 1NULA 2FRDA 4DJEC 5DTJA 2Y1XA 1ESNA 3EGEA 4UU8A 1PQYA 1LBSA 1PFUA 1TEHA 2H4YA 3NBAA 4RZHA 5IN4A 5LMNB 1QVZA 1SURA 4P32A 5DNYB 1N0VC 2XYVA 3ODPA 2HK6A 2QD5A 2GZSA 5KVQA 1JALA 1TEXA 4FHZA 5B2FA 4HOYA 4E12A 1X7DA 5AW2A 1TUEA 1V1RA 1EESA 1VTKA 1PX2A 3JQGB 3GEEA 2H1FA 2FZ4A 1V6CA 3ZWNA 1NLMA 3BM5A 2ZUSA 3KYDB 4WZ6A 3SHFA 1XK7A 1WUJS 2QORA 5JT1A 4RF3A 3I42A 4OH1A 5A9SA 2PBZA 4TWBA 5CDTA 5KTYA 2ODWA 1NPTO 4O0MA 4AJEA 5C8XA 3ONDA 1MAAA 2RK6A 3QMVA 1BXKA 3H7AA 4E5YA 2MMGA 4IXMA 4G07A 1GFSA 2JHCA 1E1YA 3OVMA 4B1FA 1K7SN 4E1AA 1LDGA 3VHQA 1PQPA 4Q4DA 5FWAA 3FAKA 4ADSG 3LTNC 1EIWA 3C24A 4OHPA 5LLSA 3BORA 2ST1A 1QRRA 2WAOA 4FKZA 3U3JA 3KB1A 5DHTA 4EHDA 1C9MA 3ME5A 1DHRA 1ZXLA 4HBGA 1W5TA 2Z5FA 4BEVA 3JPWA 3BDAA 1UDBA 3C1OA 2COUA 2JFZA 2J48A 3HDVA 4G1UC 4BMOB 1PZMA 3F2VA 4Q00A 2W43A 5D2CA 3RTEA 3V7WA 4RHCA 4CM9D 2GFQA 2E7ZA 3TWOA 4KE6A 3PHBE 5FBHA 1QWSA 2I6QA 3RBVA 3TEFA 4DWWA 2YVAA 1DEOA 1H2HA 4YJHA 2J9ZB 4DC9A 2ZUVA 3VTAA 2CNBA 4KW7A 1OU4A 3AFHA 4V03A 4F9EA 4NXNB 1R8XA 3OE7A 2BEJA 2B61A 1BE1A 4GRAA 5GQSA 3REQA 4ENUA 4IFTA 2AXPA 3C74A 4ZCQA 2CWDA 2FKNA 2J3DA 4ENRA 1YH3A 2J3IA 5AI5A 2W58A 1OD6A 3VPHA 3VVLA 4B31A 2PSFA 1JJ7A 1JQAA 5ECGC 3TFWA 2ZSHA 5DCLA 3WRWA 1G64A 1E9CA 1AOXA 3H7IA 5MGBA 4RLHA 4IZHA 5JS7A 3RS0A 2HMUA 3GVIA 3H4IA 4OMUA 4KQGA 5LIPA 4XCVA 3UPUA 2EW2A 1GYPA 2HMAA 3OJFA 2QZJA 1VMKA 3K1AA 4M9RA 1GAEO 5EERA 2C5AA 2QAGA 3IELA 1Z16A 3PEFA 1W49A 1JNXX 4AL4A 2VQ3A 3TKLA 5CGQB 4EKGA 1I4TD 1R6AA 3A70A 3G85A 3HRKA 3SSMA 4C0HA 5BWCA 2NT3A 3RD5A 5LP6B 4ARCA 4K6HA 3K92A 3WWZA 1OC2A 1SXJA 1TJPB 3ZV4A 1GCGA 1UP6A 2VDRB 3JQFA 3NS7A 4MCIA 1XK6A 4KPUB 2C07A 4UULA 4R2JA 1NHWA 1XU9A 4DR5B 1Y7IA 3FOCA 2OXTA 1ZH2A 2O06A 3OG9A 1GNSA 2WUFA 3B2EA 2NN3C 3DZHA 4QRDA 3GGGA 1NF8A 1R66A 2DRIA 3MWDB 5F7JA 2R6CA 3ESAA 2GCIA 2QZ9A 1JYFA 5D1HA 2V8BA 3Q88A 2FP4A 1AO3A 3MQFA 4IMRA 4OYHA 1SHKA 4A8HA 5E6UA 2OPHA 4KYVA 4CQLA 4P0QB 4IDEA 2ZSJA 1RBMA 1Z45A 1JLMA 3PD1A 3BK2A 3Q6MA 3KJEA 2XXAA 3T5GA 4FMCB 4GOLD 1WNFA 1OYVA 3PJGA 3W79A 4O1MA 3U4GA 4D8TA 3FUTA 5IJXA 3THRA 2C95A 4RC9A 1J9GA 1GRCA 5TF0A 5F9HA 1FUUA 5EZYB 3NKFA 1ISMA 4B0PA 2Q6TA 5HIIA 4PSUA 5FADA 3H75A 1KQOA 5CLLA 2QJWA 1AY0A 1P4SA 2OOKA 2Z9DA 4QFMA 3X44A 4JJEA 4N7RA 1XRNA 5K2MA 4EG4A 5CFLA 4NFHA 1XDZA 3M6XA 3ABSB 3DMGA 2WWFA 4D9GA 4HDCA 4KXYA 3SBDA 3CPHA 1M2VB 3QWIA 2CXXA 4H4DA 3GLGB 4PAMA 3TCXB 2D74A 5ALHA 3QVJA 1VPWA 3DKPA 3JQAD 1MZPA 4BNGA 4C0AC 1FY2A 3T1NA 3T3GA 1DFIA 3AM4A 1K9SA 3R4CA 5AHKA 4UUQA 4HDNA 4A03A 3IBTA 3F4BA 3QHQA 2OV1A 4NYIR 5DIFA 3T1QA 4UC0A 4KIWA 4YRLA 2YJGA 3A6DA 3KR0A 3BMCA 5HSGA 2C31A 3KP1A 3RUDA 2XGOA 3WGMA 3D6FA 4X0EA 4CM1A 5J2TB 5KYWA 4ZRDA 2EGHA 1MB3A 2YZ7A 2W11A 1WZCA 3ITEA 2DY0A 1E3LA 2B20A 3KKZA 1KA9H 4FQ7A 5KVSA 1VIAA 4FJ0A 1HGXA 2GNAA 3DKVA 1J8VA 1WHTB 3T4XA 3R7DA 4HEA1 4LWPA 1CUXA 4N41A 4NU0A 2FMHA 1AV6A 4C88A 1L6IA 3CB4A 3P27A 2WOOA 4EJ2A 2Y68A 3CFYA 4MW6A 3IAEA 2W6QA 2ZREA 3WBFA 4FCWA 5BT8A 5I7RA 1DBRA 4QDOA 7MDHA 1NMQA 5DXAA 4YRRA 3WIUA 4WX2B 5B55A 2HX1A 4IOKA 2XYHA 4U0JA 5DYWA 3GMTA 4JYZA 2HF2A 2FI1A 3OKCA 3L0SA 4XA8A 2HZ7A 1C9KA 1PV4A 5LUBA 4NZZA 3WL5A 1N6HA 2FB9A 1G66A 2NSYA 4NFYA 4UHDA 3CH7A 3GGJA 2HLDA 2A92A 3OUUA 5I4CA 1RBYA 2G80A 2WICA 3D4BA 2X7XA 3L49A 3A8TA 4HYEA 4JA2A 4JHLA 4R8RA 4KFTA 4DV4B 4FYJA 1EFVA 1E9RA 1TT5A 1AKWA 4M38A 4MGEA 5F1OA 4DQLA 1KTIA 4ZAVA 3R9KA 1OC4A 1N33B 2V5AA 2A1IA 3V46A 1DZIA 3L05A 4IGEA 2PT5A 5IVHA 1QTIA 5AXAA 1YKGA 1A77A 4Z9XA 4OJMX 3VR6A 2AN4A 5HTOA 2D1SA 1J1UA 4YJFB 4DNXA 2QXYA 5AO9A 4D9FA 3J7TA 1L5SA 3IQZA 3O75A 3ZQKA 2J8ZA 2RI0A 3FOWA 1DAEA 1HLDA 4R1NA 4BGIA 4RTMA 2FUNB 1O5OA 4OHMA 1HORA 2ZUDA 3SIRA 5LYJF 3I9V6 5TB5A 3EZLA 3C15C 2BJWA 3L4SO 4HDNB 5AKXA 5SZIA 1PZEA 1LWOA 3QP9A 2DWPA 3E9DA 821PA 1J97A 4Z9YA 4QIHA 1T8TA 1EGAA 4RD0A 1JSXA 2BF4A 3MQ2A 1GITA 4G89A 1D7AA 4GOXA 5FO1A 4BO2A 4WN9B 3U7JA 2WJZB 3JWJA 4DTIA 4Q18A 3RVBA 3GJRA 3VNRA 3UATA 5LQUA 1U1DA 1PF7E 1GDHA 1XFDA 2PMBA 3I9FA 4KSBA 3FRJA 1AJEA 3TDMA 5FL7D 3L1UA 3AUSA 2IHZA 1VFPA 3WQSB 1ZJ4A 3G0DA 1IOZA 3UCFA 3G2MA 5LCXA 2RGUA 2BGLA 4HY3A 2A9OA 1QYCA 2LXNA 4GPZA 4M8NE 2E89A 3B3AA 3NIFB 4O4HB 4GSLA 1VHWA 3DMFA 5IT0A 3L01A 1GVHA 2ECPA 2X0DA 4KRFA 3MS7A 1Y9DA 4LYJA 4Q48A 2AJ8A 4XYEA 1JX6A 2HUPA 3KSMA 2OHXA 5AJTA 1E7SA 1E3IA 4Q7EA 3WYGA 1YZ3A 4N0EA 2MTBA 3ZCPA 4MXDA 4F4FA 4Z1OA 2JFOA 6PFKA 3A2NA 3JPYA 3N7UA 2V7GA 3K0CC 3WSWA 4I55F 4MZXA 1SCKA 4LE2A 1WSBA 4TL8A 3MWDA 4D8XA 4ZJUA 3QE3A 3T0IA 4EECA 3C2QA 3IUYA 3I45A 4BQPA 3MTQA 1P4JA 2P6MA 1SD5A 1U1FA 2QTNA 4HFRA 3OPNA 2CLOB 1L5LA 3ZVKA 5AM3A 3SN6A 1UKVY 3CE9A 3P9NA 2NXEA 2EKZA 2J9YB 2SKEA 1E77A 3A6FA 3HCRA 1L9XA 3C4JA 3OJWA 4IHJA 4R1OA 4HRAA 3MG9A 4ON9A 3JD2A 4B7CA 4F9FA 5CP8A 2XZPA 3THOA 4L50A 1U11A 1KDZA 2XGMA 3BF7A 1HBJA 4IUCS 3K0BA 5HGXA 4LGYA 3T9CA 1N2JA 5CX4A 3ELYA 2JJ2A 4OLFA 1RHKA 5IT9A 4Q1FA 3WRVA 3H4VA 2B1QA 4DQUA 1QU2A 4J1NA 3AU9A 4AULA 1Q84A 4D56A 1B8PA 1MTOA 4PSKA 1SBQA 1MOPA 2WTUA 1CNMA 3S8MA 1MJFA 3EIQA 2UZ1A 4LNAA 3ZK9A 3AJ9A 3UGQA 4JYCA 1NNLA 3QVGA 4N5LA 4CTOA 1JFFA 1KI8A 3VPDA 5JAPA 3LHIA 4WERA 4Q1BA 3JWIA 4BLUA 4Q93A 5FBWB 3A04A 1ONNA 3OEHD 3C7KA 1KHHA 1S02A 4ND3A 2O2DA 2ZB7A 4BO6A 1G16A 1E6UA 2E5FA 3H0CA 1QHYA 4KQFA 4MVJE 5K3BA 1FRVA 5EE0A 3H6KA 1GRRA 3B1KA 3F5MA 1QC5A 4CV0A 4XWOA 2Q5QA 3F1LA 5L40A 1TTTA 2O54A 4RHUA 3V2GA 4WXEA 1KMHB 3QOYA 3BGIA 3TGLA 1NIJA 1W85B 1Y5LA 1JTEA 2JCYA 4V2IA 4WKNA 4EW1A 5TGTA 2P3QA 4Q9AA 4PQGA 4NEGA 2JGRA 2FEXA 3IEKA 3FN4A 4J2HA 3QYAA 4W1PA 1TX4B 1L4UA 3G13A 4OLBA 1PQ4A 3ZBQA 4BLVA 2L42A 1G6KA 1G20B 2ACKA 4ZT7A 1J33A 2ZZMA 1DC3A 3INRA 5IFLA 4O4JA 1EP1B 1FX0B 3LY7A 4GYJA 4OGLA 4WKBA 4Q1DA 3PUZA 4ER5A 4FU0A 1TCUA 1DX4A 4WZBA 3PFKA 1XI2A 1WD5A 1CQWA 3FTPA 2NSHA 1FDIA 3C1UA 3NI2A 4G25A 4TTAA 4TT3A 4P9NA 2V8OA 5G4KB 3BSYA 4BRUA 1R0SA 3NBYC 1NI4A 3KYCA 3QU4A 4FMBB 4A6DA 1R6VA 1DIBA 3MTIA 1AN9A 2P9ZA 1VZ2A 1LRKA 3C6XA 4B3MB 4M9QA 5FV4A 3Q6IA 1P6UA 2H1LA 2GBLC 2GUGA 2B1JA 1FBTA 1A0OA 1O94A 2XVZA 1KZ9A 2Y05A 2Y4OA 2J7PD 2JK0A 2W98A 1BWSA 1IHXA 2PSHA 3DB1A 3GJZA 1WZNA 3L79A 1WE2A 2HSDA 1SOAA 3DL7A 4MW1A 5K0GA 2P6NA 2Q5LA 2W42A 3CUEF 4DL9A 4ZD6A 3B20A 2ZI7A 5B1YA 2V74B 3JQRA 5FJJA 2N0SA 3MT8A 1NZDA 2Y1KA 3W3AH 2ZYWX 3B9QA 1CDEA 1M74A 2PQ6A 5FPPA 3I0MA 2Q5OA 3QYPA 1E4EB 1EDEA 4NCKA 3WGYA 2WVGA 4Y1GA 2WHEA 2QTRA 3LT2A 5EE9A 5JRJA 3A9WA 3RU9A 2XWJI 1UFRA 2HPVA 1PZHA 3LPNA 4B82A 4BAZA 4RAQA 4OGGA 4MAFA 3N2GA 1M1XB 1NJ2A 4Z0PA 5FWDA 1EJBA 2AZMA 2QN2A 3KSZO 1YDGA 3MMZA 4KOEC 1ZMXA 3TTTA 5IBQA 4P36A 4KXWA 1HYEA 3CS3A 4N5HX 3V5NA 1QGAA 3GRRA 2XYGA 1QDLB 1IZYA 3BGSA 3RV3A 2IZZA 2OBNA 2D7CA 4PZDA 2GF2A 2J9FA 4IJQA 4X61A 1IUNA 4GMKA 4RK7A 1JR6A 2Y3IA 2WE7A 4AJHA 4RVDA 4INAA 1D9XA 1N2BA 2CKMA 1XVAA 1B2RA 1XAGA 1QE0A 1Z8FA 3ZBPA 1ULHA 4BRZA 1OIXA 1P75A 3H8WA 2DT8A 1P74A 1O6FA 5G0SA 2PV0A 3RRMA 1ZSVA 2IGTA 2V45A 4R1QA 4ZI7A 4OMDA 3BJMA 2PKRA 2WWTA 3NHYA 4BJHB 5E9WA 2GDJA 1EUYA 1BMDA 3C8ZA 5B37A 3AF1A 3VDQA 4JQOA 2XVXA 4D9KA 1G3QA 4MVXA 3TIVA 4DJJA 4EMTA 2IDMA 5FWYA 3RRYA 1E6EA 3U3XA 5AOCA 2UXCB 4URYR 5D5PA 1HOTA 5CJJA 3WKEA 1TVMA 3G5LA 1WF6A 2B4RO 2QMHA 1VA5A 5M7EA 3GVPA 1LJLA 3G79A 3ZE2B 2HWKA 2PANA 2XVYA 2V3CC 1ACLA 3U7QB 3ACDA 4NJOA 3MD0A 4O2AF 3RRNA 1ENYA 3UK2A 2WHQA 4GI3A 3KHTA 4OF4A 3S7ZA 2MSWA 4U7TB 1E6KA 3MT0A 1BX1A 5HE8A 5REQA 1Z6PA 1QH0A 1V35A 2QENA 3DPIA 1RQGA 3JYQA 4NIMA 4XJTA 4CT5A 4NYJQ 5C8YA 4DMHA 3TTSA 1GXSA 3CC8A 1GKLA 2G7ZA 2JFNA 1USIA 4JOBA 1FDWA 1MH9A 2GO1A 1JG2A 1EWKA 1CJBA 2A9QA 3PQ2A 5BSEA 2QTFA 3AHDA 3F3SA 5H7XA 4V1CA 3GNLA 4PGGA 4AQDA 2R65A 4JL5A 3RGWS 2QRHA 2SCUA 3DE6X 4TKUA 4NQZA 4EHHA 3R9IA 5ESWA 1CUSA 3VHRA 4XSVA 4AU1A 1G17A 1KBZA 3JAWA 1WVGA 2RGEA 4LYAA 5JCZA 1AUVA 4XQGA 3ADBA 1J06A 1R3DA 1YBFA 3NOOA 4JA0A 5IJZA 2JVIA 3M1AA 4I5IA 4MV7A 2OXRA 4F12A 1FFYA 1GAQA 4V0SA 2RD2A 2I0FA 4QBHA 3LKVA 3OZDA 2W0MA 4DF3A 1I3OA 3GFFA 4E2FA 3FTQA 4BVKA 3UMVA 1SVUA 4YJ3B 1IG0A 2C97A 3JAWB 4BWVA 3GFQA 3HXQA 4HV4A 4DEYA 2ANBA 4KXXA 2FEPA 2GPAA 1VLVA 3H9UA 3KQKA 2BM0A 1N75A 1K66A 4G81A 2N1MA 1A8QA 3I73A 2HRCA 2A0KA 3CNQS 4MP6A 4CMEC 3SHTA 4W5OA 2AG6A 2XQKA 2H9AA 1CQPA 2MYTA 3NFRA 3UMJA 3ZZMA 5I7SA 5JR3A 1L8LA 1FOEB 3TSZA 2FU5C 2ZTVA 4R2XA 2JGDB 1P3Y1 4TSFA 3DL2A 1SCJA 4N40A 5EJFA 4ERXA 3PVCA 4JVMA 3HN2A 5I9LA 4HQFA 5KSYA 1GPMA 4OP3A 1JTFA 1CUDA 2HXGA 4CLRB 3MERA 3L1VA 5FQNA 2BEVB 4YPVA 2EJBA 3KHSA 5TC4A 1NYQA 3ELUA 4DR6B 2RBEA 1BN6A 1JILA 3QOWA 3NETA 1Z5WA 5IXYA 3NJ4A 3TM5A 3ED5A 4LBZA 1O0SA 3PUWA 4IRXA 4OB6A 1FVOA 5FFNA 5GMOA 3OCWA 3AO0B 1SCIA 2WMDA 2A1UA 1SHLA 3L4JA 2VSXA 3R6GA 3EAQA 1PK7A 3EMBA 4Y67A 3COJA 5FIUA 3BRWD 3IQIX 4XFJA 1DAPA 3O5AA 4IV5A 3WYAA 3FVWA 3PL5A 3RAFC 3PXEA 4TSKA 4YMWA 4GE0A 4ILKA 4ERNA 1BYUA 4B7UA 1HQDA 1Y7HA 2W2NA 3OZBA 4RHEA 3TNYA 4F92B 1GZ4A 2DWCA 2C5HA 2G72A 1Q2UA 3AONB 1F2TA 5I48A 5D86A 1GCOA 4FZ5A 3OAAA 5IK2A 1DVRA 4P38A 4PAQA 4RABA 2AE1A 4ZN6A 5BQXA 1KEEA 3FCUB 2VKQA 1P44A 3GLQA 4B6JA 1IBRA 1TYCA 2NTYC 4GXNA 3T7CA 3VBCA 4A2PA 1WY5A 5P21A 3VNUA 2JC3A 2BDTA 2RFLA 4JHXA 4KGXA 3EWAA 4NESA 4ZO7A 2ZUUA 4B4UA 2X2EA 3PNQA 4EPYA 1OBVA 4GZMA 5F9MA 2CXUA 1J0EA 1QX4A 1M5UA 3V2IA 5FR2A 3BWBA 3ZE9A 1R6TA 3MGCA 5TS3A 2AQKA 2H4WA 3ESBA 1JI3A 3T6KA 4REOA 3DVSX 3ZGNA 1IJEA 4BFWA 3H3XA 4QXRA 1OKKD 4JFRA 2HD4A 1QVAA 3ISVA 4KZKA 3O83A 1H5UA 4MI6A 1Z33A 4B6PA 1KFEB 3HUTA 1RHQA 1A27A 1N6PA 1TJ3A 2PPLA 5IP5A 3TQRA 1KY2A 1CUIA 5DI3B 4A0QA 3G88A 1UM9A 3ZY2A 3AKZA 2O7VA 1UDRA 5CXUA 3GLIE 3WGLA 4ZVMA 3WAKA 2IX3A 4FB5A 1CLUA 1DQYA 1OBCA 4L85A 3RM3A 5IZ4A 3FOEC 3WGQA 3QLUA 1N2XA 1G8KA 2GXQA 1DIGA 2DHDA 2ZYTX 3H4MA 3A7DA 1JIKA 3SMVA 4JBHA 3TD2A 4ICIA 1I33A 3UGJA 1OH5A 2DULA 3FI0A 3X2SA 3FCOA 1XZDA 2KWIA 2WJ6A 3C98A 4YXWA 3VSAA 2I6SA 6REQB 1XQXA 1CJVC 4GXTA 2ODPA 3GEDA 4LC1A 4KVFA 4ZIRA 4GC5A 1MC5A 5ENVA 3Q4GA 4Y0VA 4ZQCB 4MJ7A 3LT1A 3DXXA 3TBFA 2GZMA 5B58T 1FLNA 1GA4A 1MOZA 1Y9JA 2DFKB 2Y66A 3HUFA 3OZTA 3NTQA 2H65A 4Y6QA 3D3KA 1VJ0A 4BN4A 1MV8A 4DNFA 3AU8A 5FI1B 4X5OA 4RK5A 1JG6A 3IAS6 1I30A 4EYSA 3GO4A 3LUHA 1JPVA 4HCJA 4M49A 5CH5A 3TL3A 1VPLA 2H1VA 3GQBA 1UT8A 1IH8A 2NGRA 1CQXA 2Y9PB 3PDJA 2WE8A 3RFTA 3WJ1A 5IAKA 1X7YB 4YP9A 4DBVO 3LX4A 3NAZA 2I2AA 1JHUA 1O77A 4JU9A 3UZUA 3GA5A 2KS6A 5BNFA 3RKRA 1GTG1 1X2BA 2I78A 4MA4A 3OE1A 1AQ6A 2P6PA 3MCTA 3MS2A 4L7VA 3R7FA 1ISPA 1TB4A 3KL2A 5A4AA 1J70A 1UH5A 2ZULA 1ZNWA 1L5MA 1M2HA 4BMDA 2HLDD 4HEQA 4MIEA 1FXUA 3ZUGA 1ZUWA 4G5XA 1JFFB 1XV5A 4TL9A 4GGPA 2G88A 2MR6A 4DCOA 3FZQA 1KE2A 3EEQA 2HTEA 2KJQA 1IXKA 3TAUA 1LX6A 1UK8A 2WHRA 3G2OA 3OPYB 1C1XA 3HM2A 3IERA 3JARA 5DLPA 5TQ0A 3E18A 1HT0A 4MKHA 1V11B 2C2XA 2EBWA 3DDHA 3I28A 1E63A 3KVNA 3N2LA 3QU7A 4X6XA 3INGA 4B09A 1K08A 1W93A 4JI8B 1SJ9A 1X1AA 4YRQA 2JLUA 2R7KA 3AKCA 3CH6A 4BWFB 1FEZA 4UBMA 4YPOA 5BORA 2GZ2A 3A37A 4YA6A 5FWXA 4I5GA 2WEKA 3JAKA 3FYHA 5DK4A 2BTEA 1G8FA 4FEGA 1BVYF 2UZ0A 1KBOA 1USVA 1TAHA 1TUBA 4IBOA 1QGUA 4L0QA 3NYIA 2B0JA 2X5JO 3IE1A 5DE3A 2PVCA 2VHEA 2H8KA 3FYCA 2C88A 2PWAA 5KVAA 5KMGB 1GU0A 1KP2A 2OE2A 3CM0A 4OY3A 3WXMA 2BFEA 3PNKA 4P4SA 4RD2A 3HWSA 4AUEA 3FPHA 3SBXA 2O3JA 1Z4MA 2YXLA 1NDUA 2VZ9A 1CV2A 1HDGO 4GZ3A 4NULA 4RKQA 1IQ0A 1JWLA 1MEOA 2R1VA 4NL4H 5BN5A 1ESZA 5E2IA 1KVTA 1GEGA 4TTTS 3U3MA 2YY7A 4KXMA 4CR6A 5ILQA 4HNUA 2PEZA 1XFAA 3LL7A 4OJQA 1VCHA 1G2QA 2HMVA 3COZA 8OHMA 1AGYA 3SS9X 3AG5A 3WHIA 4KN9S 1GAWA 1OU0A 3AF0A 4FMPA 2OCKA 4KO8A 3GFTA 4EQZA 1I2ZA 2IYRA 1ONBA 4M7PA 3SZOA 4TXMA 3U3ZA 3LTEA 3QELA 4XGKA 2XMPA 4OI0A 3ZS9A 2CV1A 1LPNA 2WC1A 1XJWA 1Z3CA 2JZOA 2A0WA 2XUKA 2YY6A 3Q72A 3RSCA 1JT9A 4EG8A 3GLFA 1MW8X 4XM2A 4KACA 5BWOA 1J24A 3V8NA 1N4DA 3G2IA 3WLLA 4E6EA 4BP9A 1K0FA 1EXVA 1A9YA 2E6UX 3EXIA 3KQSA 3NHBA 2W2LA 1XRPA 4JLSA 5DTMA 2WG2A 3ZEIA 3DOIA 1R9NA 4NATA 5EWJA 1EQUA 1BC5A 2QAJA 2VHJA 3EXG2 3FSGD 1EUZA 2OAEA 1LSUA 2RGDA 3IP9A 4CMIA 4DCSA 1POWA 1LF0A 5GVSA 3RYCA 1OAOA 3SX4A 1GSAA 5T4FA 1X1EA 1MB9A 5SZHB 4CKCB 1CY6A 1OAKA 2Z8YM 1SWWA 2OB2A 1U5BA 2NACA 4G01B 5E9AA 5JSZA 3RUEA 4HQOA 1UADA 3UVEA 1YRYE 5DYYA 1O7JA 2BMAA 2V6GA 3KBOA 4YNBA 2IU3A 4PXAA 1BOOA 1Z75A 1OH7A 2ACWA 1CHDA 3D3JA 4ND8A 1NUTA 1E8DA 1P7ZA 3OCVA 4ALIA 1THTA 5JQGB 3HI6A 3NBKA 4AUNA 2XCQA 3CZAA 1R4MB 2NQ2C 5JPIA 1Z68A 1MJGM 2CGEA 2NP6A 4ND5A 4YRDA 2G07A 5TVKA 4PN7A 3VU9B 5LYJB 1ZI9A 1EM8B 4FYKA 3COVA 2R4TA 1VI5A 1MRNA 4FCVA 4RE6A 1UBEA 1FYWA 1PBNA 2XQFA 5K0BA 2C2HA 2OO7A 1EZ1A 3QUQA 5K4GA 1Z7GA 1HE8B 2FPPB 1PJQA 2GJ8A 3GLIA 4UCFA 1GYRA 2C96A 2R9VA 3NW9A 1WPQA 1V16B 2ZVPX 3H0KA 3OE4A 1MBZA 2XODA 2HXSA 2OUIA 1BN7A 2IVFA 4PXSA 4G63A 1PK8A 3KXLA 3C7DB 3CXUA 3HFGA 3D7MA 4EQ6B 2X4IA 1T2DA 3C5HA 4O2LA 1Z56C 2WSLA 4L6IA 1LVHA 1BYIA 2Q3DA 1K88A 3FKJA 1YIDA 5AMXA 1SZCA 2UYQA 4L8LA 4QXPA 2C9CA 1ISIA 3MJVA 3IOYA 3QX8A 3A3NA 4L73A 4D4IA 1KJNA 1RAAA 1WHSA 4G0YA 3AL2A 1CHNA 1WU8A 1XKLA 3IC5A 4Q1EA 3W5VA 5DNDA 3RJ5A 1MO4A 4WOJA 3K73O 4DILA 1E6LA 1LFDB 2X40A 4I4NA 5CPFA 5F2NA 2ZR9A 4CJXA 2HT1A 2G36A 4QFDA 1OX5A 2FJUA 3FHLA 4DIEA 2YICA 1W5BA 3K8QA 1BFDA 3IBGA 2JANA 1NGSA 4LSZA 4YXFA 1S96A 2HCBA 4DY6A 1DAOA 5D00A 1IXZA 3LECA 4BLPA 4BP3A 1TPYA 2WTAA 2C2OA 4JKYA 1MLDA 3G8YA 5DOVA 4DMRA 2HU2A 3PNOA 4JBWA 3TNJA 5K3EA 1DKOA 1KYVA 5EVJA 3SCZA 2AK3A 4KK3A 1ST3A 3OMXA 3LYAA 4ARVA 3HCWA 1S9DA 4H4CA 1Q92A 1E6MA 2EYUA 2WJAA 3TGWA 5JNSA 3RQIA 2FFQA 4P33A 4C76A 2I4MA 4E5NA 4DMLA 5CA1B 3SU8A 1JIJA 4LK3A 1NJGA 1NUSA 3BXZA 4Z5XA 5IUNC 2X0RA 5ECYA 4JI7B 2CFTA 3O4HA 4IDAA 5ECWA 2RI1A 3B6IA 4U2FA 3K35A 4W4TA 5DF1A 4RV4A 3OEHA 2UXDB 1QCYA 5TQ0B 1Q0LA 3CKLA 1AHNA 3KQYA 3UV6A 4ETIA 5B12A 3LFUA 3LQ2A 2CXOA 3ZWBA 1AXRA 2HF7A 1ZVMA 1YZVA 4JXJA 1RAEA 1CIPA 4LC0A 1YZHA 1IIBA 2WJIA 3CJTA 5ARCA 1UPAA 3GCXA 1PYGA 2HFKA 4BOYA 2QX7A 5I3ZA 3C8MA 3IIEA 3GUZA 4LXIA 2YZKA 3SYRA 2R68A 4X90A 1AE1A 3PRKE 4IWXA 3RUAA 5E0KB 3P9KA 5C7LO 1NQXA 1XZIA 4XARA 5BURA 2C7QA 3GEBA 1KZ6A 2G9ZA 4BS9A 2LNDA 2XOXA 4CXMA 2CFSA 2FNAA 4WK4B 2G9NA 3OESA 4QVGA 1ACJA 4DVGA 3TS1A 1ZKMA 1VL1A 4TLEA 2D13A 4FGKA 5FOWA 3PJFA 1JKJB 1VI2A 4QGBA 4UVEA 2JJYA 4AG3A 2BP7B 4AJ4A 1E5VA 3KXKA 3RS3A 2FLKA 4H2DA 2DQYA 3I3OA 2X4DA 4B45A 3OA0A 5TT1A 3R5KA 1UBSB 1UBKS 1YZUA 2FSSA 3HYSA 3M5WA 2VK8A 4DT1B 4N8DA 1UPXA 4KJXA 4E14A 3PWSA 2WF5A 3KFXA 1PEDA 1T4DA 2QTHA 3GIDA 4AX4A 2AQ8A 3Q3HA 2CDAA 4RCYA 3DQZA 4BO0A 3S70A 2P69A 3JATB 2Q99A 1XX6A 1IOVA 2F9MA 3VZSA 5AH0A 2OV3A 2FLVA 2XYQA 1LLFA 1G63A 1QONA 3QUAA 5F4ZA 1M83A 5C31A 4QQFA 4Y6GB 1BU8A 4BB5A 2QX9A 1X9GA 3N5KA 4HDMB 3UBMA 2WSSD 2PTGA 1DDOA 3W3AA 3ZV6A 1P0FA 2D1QA 5C1IA 1C1YA 3RFUA 3OTOB 3E3NA 2P4SA 1V9LA 2JNWA 4IOLA 1T10A 1M2NA 1MVNA 1RXUA 1KAEA 3H9BA 2Q6IA 2VDLB 4I2NA 4OEHA 1T0PA 1VLHA 3D81A 1Y48E 5FX2A 3F4KA 4DMKA 5ALVA 1MO6A 1JLHA 1PT7A 3E3OA 3OQMA 1WV0A 1QR6A 2JLBA 1L5OA 3O7WA 4IUYA 3W5CA 1XNRB 3P9PA 2OKCA 3UWSA 3NV7A 4DADA 4D0GA 5ARBA 3SVLA 4UDOA 3DDCA 1GUYA 3C3YA 5HRAA 3OQIB 1H8ED 4RESA 3FBGA 3SIXA 5LZ2A 4JEUA 2WTMA 2WTXA 3AIIA 1QORA 1ISRA 4J8PA 5JY6A 3V7NA 3FIUA 3RRZA 3GDHA 4HSGA 3GJ8A 4M0LA 3QFTA 4GMHA 3RG2A 1H9CA 1Z5VA 1QDEA 1RXCA 3I76A 3T9BA 2ZBRA 1WPXA 3I92A 1GR1A 1A2BA 3CGWA 2CVZA 2AS0A 2H1RA 1X1BA 1KK0A 2CJWA 4IP0A 3WKAA 2M9MA 1CZKA 3DBLA 4N5MA 4RMNA 3FZGA 4ZQGA 4ZGBA 5HR5A 3KYDA 2W00A 1ZRMA 1COZA 1FDSA 1P6XA 3WTCA 4C7XA 3WA6A 4YP1A 4K1XA 4F72A 4DR3B 4J7CA 3O6VA 1JHDA 2NXCA 4EEXA 3UYKA 4KDRA 3SKVA 2C61A 1F9AA 3IVXA 2QRVA 1KZYC 2PIDA 1PD1A 4MVJP 3IJ5A 3EA5A 1XTZA 4GBGA 3MK31 1ZBDA 5DM4A 3DZ8A 1AT1A 5JV5A 2OG2A 3DVRX 4IEFB 5J4KA 3VR5A 1VIVA 3GVCA 3E61A 3ZXUB 1QP7A 4UBJA 1EHIA 4GKBA 1QGDA 3ZS8A 3MMSA 2R5FA 4AYWA 4BNWA 4LPSA 2E5WA 1R4NA 4J3JA 1GDDA 3CZ4A 2F1HA 1JHPA 1VKRA 1EFLA 1N2SA 4GW3A 1USGA 2CL0X 5BR1A 5FNZA 5B7GA 1IWBB 3TCKA 1W4LA 4YAJA 1KVRA 3E2PA 3A1VA 3H2JA 4TM8A 2NADA 2Q2OA 4JLDA 4C43A 1CY1A 2FZEA 4IDFA 1JG4A 3BH6A 3IUMA 1RE1A 3NM4A 2WM3A 4H15A 3O9MA 1Y34E 2VYNA 2RAUA 2BTQB 3ER8A 1M8GA 1EYZA 3IMKA 1JMKC 2QMOA 1I6KA 3CRW1 3QW2A 2GJSA 1NONA 3W5HA 3EE6A 5BRNA 4AKIA 4O4LB 1PDOA 2YWRA 3FLBA 2ESRA 1L7NA 2YYAA 2HGZA 2PFGA 3UXHA 1MFPA 4EKYA 1LRJA 4MRRA 1Y7PA 1Y6FA 3S2IA 2LPMA 2UVDA 3EX7C 4U7GA 1G5HA 3ITNA 4LXQA 1TNDA 3H2GA 4CKYA 5BUCA 5GZ6A 4C2UA 2W6NA 1II9A 4ZT3A 4EHIA 3FOFC 1RNLA 2J09A 3WISA 2FLWA 3O94A 3VC7A 3I23A 3QPDA 4FFPA