4CM9D

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
248
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 95
structure length 248
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm9D00
2Q99A 2ZK7A 4CMJA 2X22A 3NJ8A 3UH1A 3RJ5A 4CV0A 3GR6A 5DNAA 2JFHA 1DIHA 4F6LA 2HQ1A 2GASA 3OH8A 3UVEA 1KEVA 5CHEA 3H6KA 1Q7GA 2HMVA 1VM6A 1L1FA 3JQBC 1CF2O 2QIOA 3RC9A 2QQ5A 3KZVA 5TJ9A 4NU6A 3JYNA 4PLZA 4DYVA 1BHSA 1GZ3A 3D3WA 2YYYA 1JQBA 2RAFA 3S55A 3N58A 3ZGYA 1PS0A 5DCUA 2TMGA 3H5NA 4Q3DA 2G1UA 1MC4A 1Y9EA 4XIJA 1R4NA 4YT2A 3ZI0A 1HDYA 3SEFA 4MO2A 3FWNA 4GGPA 3U62A 2D5CA 1CERA 5I9MA 4JP3A 5AVOA 4IGEA 5COBA 4P4LA 4PLHA 3KHUA 1UDCA 1F8FA 2NTVA 1WZEA 4DUPA 4MVJE 4N5NA 3B6ZA 4B7XA 3NV9A 2AW5A 1KEWA 1X7HA 4PLFA 5DDIP 2ZTUA 3PYLA 3CSDA 3WWYA 4A26A 3W6UA 2IYOA 2R00A 2NADA 5BQFA 1Z7BA 2J5QA 2VWGA 4WCFB 5F3RA 4E31A 1GR0A 3KRTA 2AEMA 3AM4A 3O03A 2I67A 1HZZA 1SB9A 2JL1A 4JBIA 2AG8A 4DTIA 4CM1A 3NJ4A 2OP1A 4E0BA 1HYGA 2IRWA 3M6IA 2VHWA 5HS4A 1D8AA 4JIGA 4NFYA 3W1VA 1ULUA 1T2AA 3QY9A 1LRKA 1PGPA 3PPIA 4P38A 2BFPA 1HE2A 1IULA 3IP1A 3MWEB 4IJWA 4J7CA 5TC4A 1BG6A 3D4PA 4ZRMA 3WS7A 1ZZEA 3RC7A 4PVDA 3ZHZA 1EVYA 3PFWO 4MVJH 3HFSA 4BO3A 1Q0QA 3OFSA 4L9RA 5IN4A 1U3UA 4CM5A 1PGQA 4FS3A 1HRDA 3RC2A 4CLXA 4Q3AA 3TZQA 1CQIA 3RUIA 4OXYA 2PZMA 2PA3A 3JQDA 2OHXA 3OEYA 3OJOA 4BHTA 3AY3A 1IHYA 2GPTA 1PS9A 4JCOA 4RVHA 3KSUA 4KP7A 2AXQA 5DN9A 5T8KC 1ENOA 4NDNE 2FN7A 3PTZA 1KVTA 4QXMA 5BSFA 4N54A 5EESA 3AUSA 4MJLA 4UVIA 3WICA 1DLIA 2NV6A 5DCYA 1MC5A 1WAMA 1PL7A 2Y1GA 3AOEC 4XRGA 4FQ8A 1U4OA 2D2IA 1X0VA 4AJNA 1GAEO 1GUFA 3E8XA 5CP8A 5TGDA 1B0AA 4CLRA 2YW9A 3L4BA 2VYVA 4LSWA 5TRTA 4D3DA 3PLRA 1V3VA 2HMTA 4L75A 1KIFA 3K30A 4YAIA 5FF9A 5JY1A 5CPBA 3DZKA 4BB6A 4HX5A 1Y8RB 5L4NA 4HADA 4RF4A 2ZQYA 2Q1SA 2Y1OA 5IZCC 2R6JA 3IL2A 4GKVA 5IFLA 5DT9A 1A9YA 3PQFA 4DQUA 4IDEA 5G0UA 5DBFA 5U9CA 4FC6A 2P5UA 3HUDA 1YJQA 4R69A 5FYDA 2PTGA 4NPCA 5THQA 8ADHA 3OJLA 3F47A 4HBGA 3ITDA 4I08A 3I9MA 2IEDA 4WK6A 3BMOB 1IOLA 4GGOA 5GZ1A 2J3IA 3EC7A 4CMBA 3PHGA 4JROA 3B1FA 2B69A 2GRAA 4I5GA 1QYVA 1OOEA 3ST7A 4BB5A 2BFMA 4BNLA 3TWOA 5BR7A 3QA9A 1DC5A 1YBMA 1KBZA 3DC2A 1ZK4A 4WCFA 3FN4A 4E30A 3A4VA 2Y1DA 3EVTA 2VT2A 3IIEA 1LLQA 4R4JA 4DC0A 3STHA 1YKFA 5IN5A 3JQFC 1SO8A 1BRMA 5F1KA 1WDKA 3GGOA 2EKLA 4HWKA 4YWJA 3ETDA 1E7RA 3NX4A 3GMSA 2EW8A 2PY6A 3NDIA 5CDGA 5JY6A 3ENNA 5JO0A 3BAZA 4XQCA 1Q7BA 1AHIA 2O3JA 4BKQA 3P2OA 1IPEA 4BL5A 1BDBA 4O59O 1AE1A 4GLLA 3LK7A 3OHSX 1ARZA 1I3LA 3RUEA 4LGVA 4IMPA 1QV7A 4RVUA 1E0DA 3ZWWA 2O3QA 1ZKMA 1QYWA 1ULSA 1F14A 4C7KA 3QWAA 1LQTA 3EUWA 3ANMA 1EK5A 3GN2A 3RU9A 3PWSA 3HB5X 4BNFA 1Z73A 1MXHA 5A04A 3VPSA 4Z3KA 3ZWYA 1Q2XA 5AXDA 4UREA 1NYTA 2AEFA 4O1MA 1TXGA 3ZWAA 2OOSA 5ILOA 4DPLA 5C7LO 2OBNA 1YO6A 1RYEA 1LDYA 3VPFA 4EYEA 3K96A 3TF5A 4RQUA 3C85A 3FR7A 3LC2O 3GVPA 3JQFA 1JLLA 2HO5A 1FXSA 4OMUA 1KS9A 1P1RA 1KETA 1LRJA 2OP0A 3PDJA 1PS8A 1EUDA 1P45A 3RASA 4XRRA 4ZRNA 1WW8A 3PGXA 3GDOA 3W8EA 1NQAO 4ONEA 3WTCA 1HWYA 1ADBA 1D1TA 3GDGA 1I36A 2B36A 2VYND 3BTUA 3DZBA 4JBHA 1LBEA 2J8ZA 3GEMA 3DHYA 1YVEI 4D0SA 4JX8A 1PJCA 4CUKA 4DMMA 5IAAA 4CJXA 1C1DB 4D3SA 1LEHA 1N2SA 4WEOA 3PYXA 5FEUA 1ZJYA 1U3TA 3UICA 2Y1FA 4BV9A 2VNSA 5A4DA 1LDEA 4Y6SA 5H82A 4E2YA 1PR9A 3PIIA 2ZKLA 1XKQA 2E82A 3ASVA 3DR3A 3WGTA 3CZMA 4A27A 2C20A 2BKAA 2O7SA 3GVXA 4DA9A 1KVRA 1SOWA 2GERA 4HNGA 1KVQA 5AXBA 2Y1EA 4YA6A 1C0KA 3QIVA 4W9NA 5JC1A 1CEQA 4JK3A 2LDXA 1X14A 4JNKA 4U8GA 4TVOA 2O7QA 2HK7A 4ZQGA 5EERA 4IIVA 1XG5A 5DP2A 4XX0A 1B15A 3BMCA 4TROA 1EBUA 1NHWA 1QP8A 5JC8A 1DEHA 2V65A 2EW2A 3WGHA 2EHDA 1QG6A 4IIUA 4IDFA 1C0PA 1YQXA 2BLLA 3NT2A 4BNZA 4CM4B 7MDHA 4MIYA 1P1KA 3VH1A 1LSJA 1DFHA 4Y8VA 3DONA 3I9KA 3ONEA 1XQ1A 4UVGA 4GQAA 1F0YA 3AI2A 4K28A 2P9EA 3MCVA 3S2FA 3DAFA 3INGA 4AL4A 3DMYA 4CV2A 3TNLA 5I7SA 3FWZA 3RBZA 5JAMA 3MOIA 2H6EA 5A3JA 2ZTLA 1P0CA 4CLOA 4WPGA 3NGLA 3IP3A 5AYVA 3KBOA 4S1VA 4CLEA 4D43A 3WSWA 5IZCA 1ZMOA 1E77A 3ZNPA 2DTEA 3H9QA 4BO9A 2X23A 3E5MA 1U3VA 4AJLA 5C5IA 3QRWA 3FNFA 3U0BA 1I2ZA 3D1LA 4W9NC 2E49A 3RFVA 5L51A 2I66A 1I3NA 1A4IA 1V3UA 1NFQA 3AJRA 4XYBA 2FOIA 5IDWA 1PJBA 4FJ1A 4HFRA 4FN4A 3FBGA 4H7PA 1P0FA 3PDUA 2W8ZA 2CZCA 1PGOA 2IZ0A 3JSAA 3F4LA 3KM0A 4KMSA 1LDNA 1KY4A 1YOVA 3ZV6A 4BO1A 1EDOA 2H9IA 4IQ0A 4PG8A 2FPPA 2HMSA 2PZJA 2C7GA 1E7WA 1CWUA 4L8VA 1TB4A 3OEWA 3AOEA 5K6AC 5I8WA 1T24A 1HETA 3GVCA 2CVQA 5CDYA 4LRTB 4BNXA 4MP6A 3I52A 3JCZA 3KSZO 1O9BA 2PLAA 2YV3A 4IDCA 2NQ8A 1EE9A 1E6WA 1HSOA 2ZQZA 4RORA 4WECA 1ZK2A 4WJZA 5CDUA 3JD4A 3ONFA 2C2XA 4H15A 4L74A 3W4KA 2B4TO 1DIRA 4HNHA 1J6UA 3PK0A 1EZ4A 1UP4A 2ZTVA 4OKNA 3Q0EA 2Z5LA 4QO8A 5COQA 4EUFA 2EF1A 3S1LA 3S8MA 3COSA 3FSRA 2E4AA 1I2BA 1ZCJA 3GLQA 3JQ7A 3U4DA 1DC3A 3PHIA 3MJTA 3K73O 4YJHB 2VCYA 1XA0A 4BNVA 3MTJA 1IUKA 2RBEA 2G76A 1J0XO 1RWBA 4Y6RA 1JN0A 4H16A 5FI5A 1ZNQO 2VHXA 4XDYA 2PGJA 3DBRA 5EN4A 4YRAA 5J23A 2X1HA 4JLWA 4OJNA 1YH3A 3SLGA 3RKRA 1Y1PA 3GAFA 4O5OA 4YYZA 1FDWA 3RKUA 2PNFA 3B70A 1JWAB 3GFBA 3VVCA 3ZHBA 4JP2A 3BTOA 2J5RA 2CD9A 3WGYA 3QW2A 4GPD1 2GR9A 2Q46A 4Z0TA 1UXGA 4IDAA 3ZU2A 5ITWA 3HJAA 1GEGA 4FC7A 4OQZA 3WIEA 4A5OA 5L7TA 4IINA 2Q1TA 4IMRA 3DZGA 4ILKA 4Z3DA 3SX2A 3IKTA 4RDHA 3RROA 1T4DA 2GD1O 4XYLA 2BGMA 2XF8A 1E3WA 2DPHA 2Q3EA 1DBVO 2BELA 2EXXA 3CTMA 1ENYA 4TKLA 4D46A 4ROSA 4XCVA 4O6VA 5DOVA 2O23A 3G3EA 4OHUA 3VH2A 3Q2KA 1MP0A 3C7CB 4XGNA 2UDPA 3LF1A 1N8KA 4FW8A 5JDIC 2WDZA 2C7VA 2GN8A 1NQ5A 3GF4A 1WXDA 1U8FO 3BMOA 1YRLA 4UVDA 1UUFA 1LDMA 1UXIA 2PZKA 3K9QO 4G5HA 3WXBA 4CQLA 3HDJA 2DBZA 5G4LA 1JA9A 1KYQA 4NG5A 4J9UE 2B35A 3LT1A 3PJGA 3Q6IA 5HS6A 1RM5A 1VL0A 2IZ1A 3GAZA 3Q1LA 4RVGA 4II2A 4W82A 1E6UA 1YL5A 1ZEMA 1R12A 2HRZA 2Q45A 4NHEA 4J91A 5DP1A 2VYNA 2J3JA 3DAGA 1GU7A 1VL6A 4BO5A 3KV3O 4YT4A 1DRVA 2AMFA 2FZWA 3ZDFA 1ISFA 4BMNA 4CLDA 1NPTO 4GLOA 3TSCA 1UZNA 3LLVA 3NDRA 1GQ2A 2C0CA 3BIOA 3HSKA 4FPXA 5K9ZA 2YHIA 1ADGA 2GN9A 2CVOA 4KTTE 2ILTA 1BW9A 3VAZA 1V35A 4LRSB 3Q9UA 5EQFA 2HK8A 2HSDA 1TEHA 1I33A 4XGIA 5EPOA 3UAGA 3JQ8A 3I4FA 1SC6A 1MA0A 3K2BA 3WLFA 2X5OA 2RHRA 4CR8A 3GUYA 4RVFA 5EINA 2BRUA 4PZCA 4NIMA 3D0OA 3OF2A 4MINA 2O4UX 3WR5A 3JYOA 1PZGA 3AFMA 4XZ3A 2X9NA 3GA0A 2Q2VA 1NFFA 3K8ZA 4GX2A 4LMPA 3ADOA 5KWEA 5JPIA 4B7UA 2Z1NA 4HP8A 5DCWA 4TZTA 4O0LA 1YBVA 3TZCA 3HQ4O 2I6TA 3HN2A 4NJMA 4KWIA 1LC0A 3H9GA 1UH5A 1R16A 2QZZA 3OJFA 4FFNA 3S2GA 2CDCA 3PXXA 4RJTA 1JU9A 1D3AA 1U8XX 1R4MB 4Y67A 2PFGA 3OQ6A 2WYWA 2Y66A 3DBLB 3VC7A 4KOAA 4NK5A 3KO8A 1LDBA 1NM5A 1WDMA 3FTPA 5BNFA 4BO2A 3ROKA 1P3DA 3NTOA 4M8SA 4JGBA 1F06A 3BMQB 1LDGA 2EERA 2HLPA 2VQ3A 4W99A 3TL3A 4R1SA 2C07A 4JJIA 1Q0LA 4NFHA 2DUWA 4PLYA 4UUOA 2UAGA 4PG6A 1KVUA 2WM3A 4RL6A 3FRJA 2WD7A 4BIIA 1NQTA 3DZFA 5KJFA 4EUHA 4CMIB 1SB8A 2V7PA 4M87A 4WCFC 5L40A 4PLVA 3GEDA 3SVTA 2GNAA 3C1OA 4XR9A 4B4UA 4YRBA 1W8DA 1HEUA 2NNLD 1VPDA 4LCEA 2FSSA 3QE3A 4J9VA 3NT4A 4RPKA 4EW6A 3WG9A 4NFSA 2CFCA 1ONPA 4R5MA 1PWZA 2X9GA 2JKVA 4RGBA 4A2CA 2NSDA 1BXKA 3DOJA 4C7JA 2B0JA 3V1TC 2VHVA 1B3RA 4YJGA 5BSGA 2FR8A 2EGGA 2OMEA 3DOOA 5B4VA 3M2PA 4FDAA 5TLSA 3UCEA 3H4VA 3F3SA 3PEFA 3WGIA 4B4VA 3KTDA 1YOVB 1GEEA 2DUUA 3VTZA 4EUEA 1E3JA 3WOHA 5CEFA 3PI7A 3ADPA 1DRWA 3C7DB 1H2HA 4IS2A 4GSLA 3U49A 1VSVA 3MZ0A 3ROPA 2X58A 2WD7B 4PG5A 5ES3A 2IZZA 1ZSVA 1PWXA 5IXSA 1ZMTA 3GDFA 4OQYA 2Y0DA 3UGKA 1YWGO 1SCUA 3OIFA 1QV6A 2EGHA 4HXYA 3JQGB 4N7RA 5JYDA 4FJ2A 4M54A 1SNYA 3CE6A 3ZN2A 4R3WA 1DHTA 2PD6A 4RZHA 4AVYA 3E9MA 3SBOA 3DO5A 1K3TA 3BMNB 1DJQA 3L4BC 1V9LA 2PKQO 4U5QA 1J49A 3L6EA 1SBYA 5L53A 1PL6A 2C29D 3LC1O 1ONNA 1U7HA 2JCVA 3T7EA 1T2EA 3RD5A 4BQRA 1PTJA 1E3IA 1A4UA 3GPIA 1E92A 4NK4A 2VWQA 2HMWA 4I1IA 1DB3A 4DL9A 2D5AA 5IZ4A 4ZVVA 2W2LA 5T6BA 1PX0A 1YBAA 3OMLA 1U2GA 1ORRA 4MKZA 1UXHA 2WEKA 3ZHXA 3RUFA 3KUXA 2ZB4A 1OFGA 2FP4A 1WPQA 1AXEA 3BYZA 2J5KA 5KCZA 4MVJP 1WDLA 4OSPA 3WGGA 3ZZNA 3LYLA 2NVWA 4BNWA 3FHLA 4OM8A 4XYMA 3OIGA 3EGOA 1PGNA 1ZXLA 5G4KB 1QMGA 1ISJA 4LMRA 5H81A 2VUSA 3EAGA 4BMSA 4YDRA 1Y7TA 4QTZA 3F1LA 5CG2A 4DQVA 4IXTA 2ZJ1A 4J16A 1B26A 2YFQA 1DHRA 1I0ZA 1NPYA 4GX1A 4ND1A 4X54A 1UXKA 3G49A 1A9ZA 1E1MA 3CINA 4E5YA 1E3WB 1B14A 1QYDA 4QO7A 1OAAA 3OIDA 1TVEA 3OA2A 1XR3A 4CM8A 1N7GA 3OA0A 3GC6A 1Z74A 1JDJA 1MLDA 4YJGB 4F45A 2DKNA 4B4OA 3D5QA 2NACA 4OYRA 4CMAA 3WQSB 4KZPA 1IPFA 5JNLA 3OJEA 3BZUA 2D1YA 3UUWA 2O3SA 4XYGA 2XPCA 4DLLA 3P19A 3F4BA 3O9ZA 5ICSA 1XYGA 4MVJM 4E4YA 1ZXBA 3F5QA 4FGWA 4RQTA 3OQBA 4RLHA 1PQUA 3JD0A 4FSHA 1U28A 4F3YA 3MJVA 2GN4A 2CVZA 1T2CA 4PLTA 4J90A 3UCXA 4MIOA 3E5RA 5A9SB 1NR7A 3GOHA 3KYDB 4MVJG 2NVBA 3VH3A 3WYCA 5BSEA 4GKBA 1UXJA 4MVJI 1HDGO 4YJHA 1D7OA 4KDEA 3WIDA 4K26A 3IQDB 1S7CA 3ZCXA 1CRWG 3WMXA 3GN1A 4MVJD 2PWZA 1RKXA 1Z7EA 3I23A 3MTGA 3BHMA 3OETA 4QECA 3JD3A 3B20A 4XYEA 4M86A 1RM3A 1R4MA 4BNKA 1SZJG 1BXZA 3V5NA 4R51A 4Q3NA 1GY8A 4R1NA 4U7WA 1ADCA 4D7AA 1BXGB 4YTEA 1K6XA 2Q4BA 1F17A 1ENZA 1ISHA 3G79A 1KERA 2D4AA 4MP3A 1MFZA 3CKYA 3EW7A 1Q7CA 4L76A 4YJFA 3L6DA 4M49A 3DDNA 5F1PA 1HYHA 2E48A 4J1NA 3EK2A 1G6KA 2GLXA 1JKFA 1I24A 4OKIA 5U1PA 3V1YA 4A73A 5TF4A 5C37A 2HU2A 3V2UA 5KOIA 4CV1A 4QX6A 1AXGA 5AXCA 5C3MA 4R3NA 5G2OA 3B1KA 2W2KA 4Z6KA 2JJYA 2B4QA 2NTNA 2VHYA 3AUUA 5A5EA 4IUYA 4NR0A 3TJRA 2NU6A 3TZ6A 1U2DA 1T1RA 3QVWA 4B79A 5KNLA 4A7PA 3O38A 4CLHA 2RHCA 5IJZA 1PZFA 2WSBA 5KVCA 2WYUA 3WFIA 2X0IA 4RO0A 3QWIA 4HUJA 4D44A 2VOJA 5HBRA 3AUTA 4YRDA 4GWGA 3ROMA 1OBFO 2NU8A 3NAQA 5EMHA 4EGFA 4CQMB 1F12A 3QVTA 4J1TA 3MJ4A 5B4UA 2B4RO 1GV0A 1EEHA 1IHXA 4MPDA 1YB5A 2CF5A 4J2OA 2X86A 3SJUA 3MEQA 3L9XA 3R0IA 4NBVA 2DTXA 3MWDB 3G0OA 1X1EA 1OC2A 3EVNA 3A1NA 3CIFA 3JQ9C 3L77A 1MXFA 1P44A 3WJ7A 4YQYA 1EK6A 3QJ5A 2A94A 4YPOA 3VKVA 5EQDA 2RIRA 1HT0A 2DFDA 3AU9A 1CQJA 3QWHA 1AHHA 2NQTA 2ZYDA 4NBUA 2IXAA 4AG3A 2XXBA 4ND3A 2DU8A 1PJSA 3R3SA 4CR7A 3INTA 4BO4A 3ZU5A 1V3TA 3BXXA 3H3FA 4J43A 2QHXA 4BMVA 1WWKA 1IL0A 4WKGA 5EL0A 4IS3A 4TWRA 2V6MA 1P9LA 2Y05A 3GZNB 3INRA 1GUZA 2GCGA 3HZZA 3WWZA 4IBOA 5DF1A 4BOYA 3AI3A 1SOVA 1PZHA 4IJUA 5KJCA 1HSZA 3CMCO 4RV9A 4BS9A 4Z9YA 1E6EA 2AQ8A 3OM9A 5ER6A 3GRPA 1KEPA 4BO8A 4DREA 4FB5A 2NU9A 1EUCA 1NTOA 2QG4A 4R54A 4HV4A 4OXNA 3NDJA 5JMWA 1Y81A 2DC1A 4PZEA 1O6ZA 1E7YA 4GMFA 1P1IA 3NUGA 4IXWA 4XIYA 4NNJA 2FY8A 2TMDA 2WE7A 2EIHA 2G0TA 2O4CA 5TT0A 2VTDA 2GSDA 3WSVA 4WLFA 3PP8A 1WNTA 1LRLA 3DFUA 1T4BA 1YL6A 3LZ6A 1U9JA 4UUNA 4W7HA 1EVJA 5L95A 1U5CA 3JQAD 1JKJA 3AWDA 5TSDA 2AE1A 4CQMA 4EDFA 2J6IA 2DBVO 3ENKA 3U09A 1GDHA 4R68A 4B3HA 4EITA 4P4GA 1HKUA 4ITUA 3TZHA 3LLSA 1A72A 2WD8A 4AFNA 1UZLA 4RCVA 1EBFA 1EFKA 3LU1A 2X4GA 5JDCC 5LCXA 3Q11A 4AJ1A 3PWZA 5LDHA 3DBHA 5G0VA 2Y93A 3VDQA 3WBBA 5TQVA 3PWKA 2IDZA 3I83A 3RC1A 1DJNA 5A02A 2D8AA 1BSVA 3UXYA 1UAGA 1I30A 1YB4A 1XCBA 2QRLA 5JE8A 1V0JA 4WCDA 2JCYA 1NBOA 4JXKA 2JFFA 4UUMA 5A9RA 1I3MA 2XOXA 5G0WA 3OQ1A 3O8QB 1XWFA 4OOEA 3DHNA 3RUCA 3U5TA 1ML3A 1C1XB 1LSOA 1T1SA 3A14A 4URFA 4E5NA 3X2FA 2ZB8A 5ILGA 5JAZA 2GF2A 3IUPA 1NQOA 2G82A 3JYQA 3CH6A 1H6BA 3SC4A 3WYEA 1N1EA 1W73A 4YJFB 2CSUA 1XU9A 4AICA 1XU7A 3AW9A 3HN7A 3RCBA 2ZYAA 3GNQA 3PRJA 1ADFA 3KLMX 3WDSA 3QSGA 4PLCA 2C59A 4U0JA 2I3GA 4YAKA 1N1GA 1U7TA 2HRBA 3ZU4A 3ZWCA 2E37A 4L4XA 3WGOA 1BDMA 1NNUA 2Y99A 4WLVA 4GSKA 1JAXA 3QVXA 4BO6A 1H94A 2C5AA 5A06A 3MOGA 2HK9A 5U4QA 3NRCA 3M1AA 4WNCA 1YB1A 2RH8A 3PVZA 3JV7A 4JJFA 3E6AA 4W4TA 1SMKA 1DFGA 2AQIA 3GT0A 1UDAA 4ZA2A 4EJ0A 1DIBA 4XA8A 4DVJA 2FRDA 5CFZA 1P1JA 1R15A 4MKXA 4IQGA 1E3SA 4TVBA 1O89A 1QYCA 3ZHYA 3DZJA 4E6PA 5HM8A 5HWSA 1O5IA 1W4ZA 1LJ8A 4IJKA 5A1TA 3OP4A 5JO9A 4ALKA 1LC3A 1G0NA 1KC3A 5BSHA 1WLYA 3DB2A 4R01A 3C1TA 4AJPA 4ID9A 4IJVA 1WMAA 2O2SA 2ZJ0A 3CMMA 1XSEA 2X7HA 1G1AA 4N18A 4BKOA 4CM4A 3IS3A 3W4IA 1A71A 3V2HA 1OZAA 4K6CA 4TRNA 2PR2A 1KEUA 4CM6A 2CY0A 1DC6A 2VNAA 5I7FA 2YUTA 2QW8A 3FD8A 1ISMA 2HDHA 5AOVA 2QYTA 4RVSA 2F00A 4J3FA 2Q2QA 2GDZA 3DL2A 1IZ0A 3QVOA 2F1KA 4PGFA 4JBGA 2PD3A 4J4HA 3GZNA 3GVIA 5C7OO 2AHRA 3C8MA 2VZ8A 4PLGA 5ENVA 5CPFA 1HTBA 1DO8A 3AY6A 1B8VA 1E3LA 3L4SO 1GL3A 1VE9A 2EJWA 3G1TA 2LDBA 1V6AA 2ET6A 3KOUA 3ETGA 4J4BA 4EBFA 2Q1WA 1PU2A 1Y5RA 1I01A 1OI7A 1EUZA 5IXYA 4DPMA 2JHGA 2POQX 1LQUA 3VKUA 3WLEA 2CMDA 2X5KO 4B8ZA 1M76A 4TRJA 2OXIA 1ZFNA 4BKUA 4CQMD 1E1NA 3AFNA 2GZ2A 4OOFA 4J6FA 2P68A 5L45A 4YT5A 1VSUA 3DXFA 5DOZA 4G65A 1LLUA 5CEEA 5C7IO 5F21A 1Q1NA 4N5LA 3OICA 4YXFA 4XJSA 2DM6A 3RAJA 1GD1O 2A35A 4WOJA 3WTBA 1JWBB 4XB1A 3BHJA 5GY7A 5AQ1A 4UAGA 1UJMA 4A0SA 4L73A 2CUKA 4P4NA 5GZ6A 3RJ9A 4AJHA 4FGSA 5KVQA 3WGQA 1MG0A 2ZIZA 4K6FA 2PGLA 3AI1A 4DGSA 1H5QA 2HCTA 1Q0HA 1H9BA 1I32A 4XJTA 4ALMA 2PD4A 4E21A 3WMWA 8LDHA 1LX6A 3ZV4A 1U3WA 1V8BA 4J7UA 2VRCA 1PQWA 2UUOA 3VVBA 3GNSA 4CMKA 1N92A 3IKVA 4PFJA 1I2CA 3BMQA 1KOLA 3E9NA 4E5PA 4LISA 1H93A 5THKA 1H9AA 1ZBQA 3DEYX 1XHLA 1Z82A 4DYDA 4DBZA 5L7YA 1VKOA 2VHZA 1MB4A 4Y9DA 5CAEA 4MP8A 1C3VA 3TZKA 4JJGA 1LA2A 1BXGA 3ZNNA 4FJ0A 3A06A 4YACA 1ZK3A 1NXQA 5MGBA 2BF7A 4AJIA 2X0NA 1TA4A 2D0IA 2H63A 3ZV3A 1UZMA 2YY7A 4MKRA 4NJMB 3T4XA 3ZV5A 1C14A 1GQYA 1IB6A 3PIDA 4NI5A 1K0UA 4FBGA 4XD2A 2Y1CA 5JFOA 3JQAB 2C82A 3RWBA 2P9GA 3D7LA 4FFMA 1QKIA 1LUAA 4ALNA 4CL8A 4GVLA 4D42A 2JHFA 2C5EA 4R9SA 1PJTA 3QHAA 4K9DA 1N9GB 3AUAA 2O3UA 1PJ3A 2PZLA 4Z0HO 1E7QA 5KKAA 1TT5B 2JCXA 3VZSA 4R41A 1QLHA 4BNMA 3VDRA 3K2EA 1BVUA 1ZK0A 3ZU3A 3PYMA 1K6JA 4KDFA 5JBIA 3CUKA 3R1IA 1EDZA 4ZICA 3TOZA 1FDTA 3EY4A 4II3A 3EHEA 3IJRA 1S6YA 3GMDA 3PHJA 1BW9B 4LVUA 2O2YA 3AK4A 4FCCA 2PK3A 3K31A 5JCXA 4MIEA 3F46A 4CV3A 1UP7A 1SEVA 2AE2A 1YONA 3EMKA 4PG7A 6LDHA 9LDBA 2JD2A 2PKQP 4E13A 4FR5A 1X7GA 4YCAA 2VWPA 3ASUA 3IMFA 3IOYA 1GPJA 3PQEA 4J4TA 2YZ7A 4HFMA 4M1QA 4OH1A 4QFCA 5A9TA 2OO5A 1Y8RA 2O48X 2O50A 1A5ZA 1FMCA 4IY1A 3VZPA 2H1SA 2GYYA 4Q3CA 1IZ9A 3HADA 5TT1A 4B7CA 1U4SA 1K89A 2DLDA 2EP7A 4IDBA 2B83A 2J3HA 2UUPA 2VYVD 3MJEA 4L0QA 1H0KA 2A4KA 3FPCA 4WEQA 3H9UA 2A92A 1ZSNA 1JVSA 4R1TA 4TQGA 2XXJA 4CODB 1EMDA 4CLOB 1DIGA 4PRKA 4G81A 5G4KA 4I9UA 4ALJA 1H6DA 2HMUA 2PGDA 4BNNA 1QORA 2JAPA 4PVCA 3NTQA 5EJ2A 5I7VA 3JTMA 3N74A 5TIIA 1PJQA 4F46A 1VJ0A 4XQEA 1YXMA 2NU7A 3I4CA 2AG5A 3ABIA 1ISGA 2BFAA 4IGFA 4NMHA 4I5FA 5LC1A 3P5SA 4GI2A 1UP6A 1XGKA 2ZYGA 3UCFA 7ADHA 1P77A 1I8TA 3TRIA 2B37A 4XWYA 3JQCA 3CXRA 3C1AA 4J1QA 2AQHA 2NUAA 5HTOA 1GCUA 3BMNA 4UVEA 2O3RA 3H2SA 4B4WA 1RPNA 1HDZA 4DQXA 1DXYA 1O94A 1GADO 3P7MA 3U4CA 1X15A 4CUJA 1D4FA 1HXHA 2P2SA 3M1LA 1ZSYA 4WLNA 3X2EA 3T7CA 1NX6A 1J5PA 2R2GA 5IDYA 3TOXA 1KC1A 4CQLB 5JW6A 4J1SA 1IYZA 4EEXA 2VOEA 3DMTC 4A10A 4DIBA 1T2FA 3LC7O 5AXAA 4RF3A 3WGZA 1VKNA 1B3BA 1R37A 1VRWA 1GV1A 2EJVA 2QRKA 1P1HA 1Z6ZA 2Q50A 4I9NA 1NHGA 3PZRA 3H65A 1P74A 4YR9A 2VUTA 1YL7A 3D4NA 1X13A 3IUSA 2BI8A 4AJJA 3RQSA 2FMUA 3IC5A 4CUZA 4E2WA 3BA1A 3TFQA 1GYRA 2VRBA 4KWHA 4ZGWA 3F5SA 5ER9A 2Y0CA 4GL4A 3QVSA 3JD1A 1MV8A 2BGLA 3LT0A 3F9IA 1B16A 1NAHA 3V8BA 3OSUA 3WNQA 3E18A 5IF3A 4UEOA 3FNHA 4IDGA 4LVCA 3HDHA 4YEDA 5B37A 2ZB3A 3TFOA 2I99A 3FR8A 3KSDO 3QQPA 1GZ6A 1FDUA 2EG9A 5HRUA 4EJMA 1HE4A 2BH9A 1Y5MA 3D5TA 3ON5A 4E5KA 3ZWXA 1R6DA 3OECA 3B1JA 3V1UA 3VTFA 1N9GA 2QRJA 5DULA 3ZWPA 4E12A 1DLJA 1DAOA 1QRRA 3DBHB 5T64A 5CDTA 1ZH8A 3HDYA 4BGEA 4RZIA 4OXKA 2EKQA 4J2HA 4CM9D 3E03A 3WJAA 4GBJA 4L4RA 5TX7A 3SXPA 5IDXA 4I5DA 3HNPA 4R9RA 4UUPA 4NH4A 4J0EA 3GQVA 2VT3A 3ROQA 3TQHA 4AJOA 3JYLA 3KETA 5A3VA 4AJEA 3VZQA 3K5PA 3M2TA 4KTVE 1AGNA 2VRCD 4GMGA 2YHUA 1XELA 4HFJA 4WGGA 4WLUA 1SAYA 1MG5A 1A7KA 1A7AA 4Q39A 5KVVA 3OJ0A 4BNIA 3DAPA 1X0XA 2FSVA 1JW9B 3JQ8B 2YHIB 1JAYA 3DBLA 4RDIA 1E1KA 4KUHA 4INAA 3KB6A 2YFHA 3DTYA 2PV7A 2I3AA 3RFTA 4YAGA 4CR6A 2DQ4A 3TL2A 3H7AA 4TZKA 5A03A 1VL8A 2Y0EA 3HDQA 4DRYA 2DBRA 1BGVA 3JQ9A 5JAQA 5JCJD 2P5YA 3NTRA 4FFRA 5ICMA 5I7EA 4ZQFA 5KTKA 5KJ6A 1LNQA 1Y6JA 2GZ3A 3D4OA 4E2ZA 5CG1A 3PJDA 3PZBA 3U4HA 1UAYA 4CM8B 4CMCA 3MJSA 4RPJA 1CYDA 2YV2A 1GPDG 3W6ZA 2OZPA 2Q49A 3FCOA 4R5HA 4N5MA 5KVSA 2W4QA 3Q9NA 4ZQHA 1F8GA 1L7EA 5MDHA 3D64A 1NVTA 1GUYA 2EKPA 2WWRA 2Y68A 4PLPA 1AN9A 3CEAA 3IAHA 1WP4A 4PZDA 1MFPA 2CF6A 1NPDA 3H3JA 3L6OO 3SJ7A 4PRLA 3FNEA 3I9OA 4BGVA 4WOKA 3DZHA 1PL8A 2X9VA 4DMLA 1CJCA 1LSSA 3PHHA 3HWRA 4MVJF 3GK3A 5T5QA 3CZRA 4UEKA 1CETA 3ZWNA 1HE3A 1VI2A 1D1SA 1EVIA 1R0SA 2DBQA 4QEDA 3VZRA 1H2BA 1EVZA 2GGSA 3ZWVA 1Y9AA 4PCVA 1T2DA 2RCYA 2NWQA 4UEJA 5A05A 3AU8A 4JN6B 1PIWA 1EQUA 3BTVA 3JYPA 4DWVA 3NT5A 4NBRA 1LXCA 3OBBA 3RU7A 4PG4A 4BQPA 3L0DA 3KXDA 2ZB7A 2D59A 4DIFA 3EYWA 3WBFA 1W0CA 1QXSA 4MDHA 3C3XA 2PKRA 1U5AA 3PJEA 4GX0A 1E1LA 1HZJA 5KJ1A 2FR0A 4UVHA 1E5QA 3PFFA 4RPHA 3AM3A 3Q3CA 5JDCA 1JVBA 4NBTA 5F1OA 2D3TA 4IPTA 4FFPA 5T8KA 4OSOA 5L7WA 1CIVA 1NWCA 1M67A 3FI9A 4QT0A 5H83A 5JDIA 2P9CA 2WJPA 1KY5A 3KEOA 1HLDA 1JTVA 4PIVA 3GHHA 1SPXA 2W2KB 2EP5A 3EZYA 3GHYA 4XDZA 1Z75A 3F6YA 3QV1A 2G17A 1HE5A 3I9NA 5JLAA 3ZWMA 4BKRA 3K92A 1NVGA 1M6HA 1ONOA 3JQ6A 4FOOA 4GWKA 3DHEA 4MVJA 3UFXA 4BGUA 5TJHA 3S2IA 3JQBA 3I9LA 4GAEA 1HYEA 3GFGA 4RF2A 4Q3EA 1C0IA 1HDOA 4FFLA 3E1KA 3H8VA 4RPLA 1T25A 3VOSA 4M89A 1P1FA 2BI7A 4CM7A 5JCJA 1UR5A 3U3XA 2YQ4A 3GRKA 3ZNOA 4YVFA 4BNGA 3QP9A 3GG9A 1HDCA 3VHRA 3UOGA 4DBVO 3LT2A 4KUEA 6ADHA 2GZ1A 4KQXA 3WQQA 2UYYA 4E33A 1GYQA 4BNTA 3UHAA 3LQFA 3GEGA 1LTHR 3GVHA 4O63O 4YAJA 1NAIA 1FDVA 2EEZA 3DZIA 5KKCA 2XAAA 2W90A 5DBIA 4YB8A 2OGUA 4EZBA 2I5PO 1EFLA 1H6CA 2X6TA 3E82A 3QWBA 3BHIA 4TSKA 3U9LA 3ULKA 5BNTA 3KEQA 1MGOA 4B3IA 1LU9A 1O0SA 4WLOA 4BNHA 1HF3A 4J0FA 5FI3A 1X1TA 3W8DA 5BNIA 4CPDA 1M75A 4CMHA 1B8PA 1NVMB 1ZO8A 4L4SA 4Y6PA 4WE3A 4Z0PA 2FHSA 3TN7A 3FBTA 5IDQA 4DC1A 4WLEA 5TS3A 1XDWA 1P31A 1DC4A 1ZK1A 3HB4X 2FWMX 3H5RA 4CM3A 4ZN6A 2OL4A 2O3TA 1GTMA 3C7AA 1YGYA 5I9NA 2WMDA 4W7IA 3G17A 2CDAA 3NYWA 3PJFA 4IZIA 4BUCA 5JAIA 1HL3A 2YJZA 3QLJA 5F5NA 4U6SA 4D0RA 2JD0A 3LF2A 4IZHA 1ZIDA 3IJPA 2I65A 3RUAA 3R3JA 2VN8A 3VPXA 1GZ4A 1XQ6A 3O8QA 5TNXA 4CMEA 3DOCA 3KLPX 1LLCA 5ENDA 1Z45A 1GQQA 1OC4A 2VUUA 3JD2A 2YDYA 4WNIA 3I1JA 5CDSA 3UN1A 2DAPA 4LN1A 4CMIA 1K5HA 4GVXA 2JFGA 3WYBA 3BMCB 2ZTMA 4R16A 2IODA 4FD3A 5GZ3A 3GG2A 1RJWA 2I76A 4ND2A 3WX0A 3DQPA 3O4RA 4XGKA 1PEDA 3SLKA 4TKMA 4EEZA 3G1UA 3BTSA 5JMPA 1XEAA 1KVSA 5B12A 3ICCA 5I9LA 3A9WA 2CDBA 3ITKA 2FR1A 4RPGA 2UVDA 3H9JA 9LDTA 1O8CA 2GO1A 1E7MA 1X7DA 1VJ1A 3GY0A 3P2YA 2Q2WA 3AM5A 3D3EA 4FFOA 2IE0A 1QYXA 2AA3A 5K6AA 3DFZA 2NM0A 3PHLA 5I8ZA 4ALIA 1YQDA 2VZ0A 4QSMA 2Z1MA 4H3VA 1YDWA 2HAEA 3C24A 5DBGA 2GUGA 3NKLA 1HDRA 2I9PA 1TLTA 2IYPA 4OAQA 1GFSA 3WQRA 3W4JA 5L4LA 1C1DA 1DRUA 3FTNA 1A27A 4LCJA 1B8UA 5B4TA 4KQWA 4CMEC 2PH5A 4XB2A 3O26A 1DSSG 3WB9A 2CNBA 3ZNQA 3KVOA 1B2LA 5G0TA 2X8LA 2IEBA 5COAA 4D79A 4GH5A 2EWMA 1R66A 1U1IA 5HA5A 2P4QA 4F6CA 1M2WA 1PJ2A 1XLTA 4AJ4A 4CL3A 2NVUB 2DT5A 1UDBA 5T57A 4DXHA 3IDSA 4UULA 4P8RA 3KYBA 2BFOA 3HE3A 2QZ9A 4MOWA 5CEJA 1TT5A 5B1YA 4I8XA 2V6GA 4BKPA 3DWFA 2UV8A 1W6UA 1YE3A 2FPIA 1JKIA 2FPGA 1FJHA 1IY8A 1I3KA 3L07A 2OBYA 3N7UA 4TRMA 3EDMA 3I6QA 2WYVA 3E48A 4Z9XA 4LW8A 1BMDA 1BVRA 2Q4EA 4WUVA 3AOGA 2OUIA 4KUGA 2QYSA 2DFVA 2V6FA 3I5MA 4QQRA 4C4OA 3GNTA 4ND4A 2V6BA 3VPHA 1XIVA 1H6AA 4OGWA 1FF9A 4LK3A 3RUDA 5L9AA 2VZ9A 4NU5A 4HY3A 1ZVMA 3I9JA 4DLAA 4E3ZA 4YT8A 2HJRA 2IXBA 4YQZA 4BO7A 3RIHA 5K0ZA 4XQGA 4U6QA 1QLJA 1TT7A 4EI2A 1PR3A 4M55A 3FF4A 4AJKA 1MX3A 2HKIA 3GGGA 2DPGA 1CDOA 3ANNA 3JQEA 1PGJA 3GPDG 1VLLA 2E6UX 5G0SA 5JSFA 2YV1A 4BVAA 3AY7A 1C1XA 1YS4A 2P91A 3WFJA 3PLNA 3EZLA 5KIAA 2JD1A 4B3JA 1R0KA 5KJEA 2RH4A 3ZWOA 1ID1A 3DBRB 1P33A 3W8FA 5FWNA 1FK8A 1PZEA 2WTBA 4NZ9A 1BTOA 3ANLA 4OIMA 3DMTA 1FDSA 4Y98A 3RVDA 4FIZA 4WASA 3H2ZA 4BNUA 3JQAA 1HDXA 4RF5A 4BV8A 5GMOA 5T67A 4XEHA 4CM9A 2YQ5A 1YQGA 4G2NA 2Q1UA 3I3OA 4Z9FA 2C2YA 5F5LA 3F1KA 3LT4A 1NFRA 2W98A 1HLPA 1L7DA 1PSDA 4NBWA 1B7GO 4ZD6A 4LSMA 2X5JO 1GCOA 1VJTA 2YDXA 3NEPX 2HJSA 3U4IA 5A9SA 1R0LA 4ZU3A 3FNGA 5FFFA 2P4HX 1WMBA 3RBXA 3DTTA 2R00C 2B5WA 1EE2A 2AQKA 1I5RA 3VPGA 1VC2A 1N7HA 3D3WB 3H9EO 4TMFA 1E3EA 3V2GA 2PH3A 1C0LA 3A28A 2B5VA 3H5AA 1DOHA 4ALLA 4DLBA 5L3ZA 2BHLA 1WVGA 1K6IA 3LSYA 3MJCA 1DPGA 4YJDA 1E5LA 1WZIA 1SEPA 1MUUA 1M6WA 3GUCA 4CLRB 3ETEA 3R6DA 1YJ8A 3S2EA 4BGIA 4GX5A 3KYCB 1PJLA 1NASA 3ZW9A 4E32A 1YDEA 5ITVA 4RVDA 4D45A 1RM0A 2X0RA 3E9QA 3GH3A 1Y8QA 2WE8A 4E5MA 3UF0A 3I6IA 1O95A 1M66A 3NGXA 2ZATA 4HFNA 2AEJA 1J4AA 4U0KA 1LI4A 3KYDA 3LVFO 5JS6A 1NP3A 4ND5A 4OO3A 2NVUA 1QR6A 4ZJUA 2EV9A 4IDDA 3LDHA 4YAEA 4ZHSA 2A9FA 4D41A 1G0OA 2HUNA 3HHPA 2G5CA 3TDKA 4RLSA 4I9HA 4I5EA 4FOSA 3GGPA 1IE3A 4OL9A 5JXWA 2OFPA 4E2XA 4XKJA 2VTEA 1RM4A 4JQCA 4QUKA 1DFIA 2H5LA 2VWHA 1RYDA 2BD0A 3ONDA 3PGJA 4NQZA 4B8WA 4ESOA 2JAHA 5DZSA 3WNVA 3TPCA 4W6ZA 2DVMA 1DAPA 3ZW8A 4HKTA 2Y67A 2NLOA 3GZ4A 4AJ2A 2Z95A 3ZWBA 5JYEA 3Q2IA 3PQDA 2W2LD 1AUPA 3UW3A 2BMAA 3DBVO 1TI7A 1LLDA 3K6JA 1Y8QB 4QFDA 1E7SA 2J3KA 3HFGA 3SC6A 1ZJZA 2C54A 4J49A 5BT9A 2OORA 3KYCA 3QWFA 1OMOA 4Q9NA 4XR4A 1K2WA 2DTDA 1T26A 4BO0A 4S3MA 1BWSA 1DIAA 1PQPA 2X0JA 3ORFA 5L4SA 1EQ2A 4PN3A 5ADHA 4DPKA 2NTJA 4NJOA 3RFXA 1NR1A 5LDGA 2FZEA 2BGKA 4TRRA 2GN6A 1ZUD1 4CMGA 1R4NB 2ZCVA 1DDOA 4BNYA 4J7XA 4D3FA 4ZQBA 3ICPA 3UKOA 3RUHA 3VH4A 1GYPA 5A5FA 1ZEJA 3T4EA 1LSUA 2SCUA 4R1UA 4YBZA 4ZQEA 4EJ6A 4Q3BA 4DIOA 2QX7A 4K1LA 4BNJA 3FPLA 4IQ8A 1N5DA 3JQ7B 1ZW1A 3ZH2A 3CPSA 4IM7A 1QSGA 5EIOA 3RSHA 4P22A 4XQ9A 3RBVA 5IG2A 2ZCUA 3L9WA 4A03A 1I10A 3JQGA 1PJ4A 4PLWA 3HG7A 1NWHA 1ENPA 1ISIA 3RI3A
chains in the Genus database with same CATH superfamily
1C7RA 1G18A 2D5IA 1HFWA 3BXGA 4ZCTA 1BCRA 2ZEJA 3RJ5A 3UH1A 1FS4A 1UKYA 5DNAA 3MCZA 3I2IA 4TX1A 4MYCA 3DLTA 1KEVA 3IQEA 1EFVA 3UH0A 1PFQA 3QLVA 3L0CA 3WYDA 1QOZA 4RS4A 1Q7GA 7MHTA 2XOKA 3UT5A 1L1FA 1A8HA 1CF2O 2QIOA 2QQ5A 3V3KA 2PUCA 2IYUA 1UMDB 5AM1A 4ZZ1A 2II6A 4LHYA 4O4LF 1BA3A 1MAHA 1II8B 3BM5A 3JYNA 4B6FA 4C76A 3D3WA 3PWTA 1F51E 1SC1A 2L19A 2O2ZA 2VS1A 4OTZA 3TTXA 3E53A 2VLIA 1S2NA 3MIZA 3S81A 4FBLA 3ISJA 2GCNA 3O3OB 3CX6A 5DKFA 1Y9EA 2K7ZA 3IALA 1C3OA 2BN4A 1R3DA 3KR1A 4BMZA 4MO2A 2GM5A 1P6QA 3GI1A 1ZGZA 2KB0A 4GGPA 1KFEB 5GONB 3U62A 2AWNA 2D5CA 2WZQA 1ZUHA 2PU7A 5B2ZA 3LA8A 2ZT6A 2QLJA 3D3JA 3DE5X 4IX9A 4TL7A 1F8FA 4N7JA 3RHSA 5HM6A 1K4KA 1GARA 4KE8A 4DIDA 3AF4A 5H02A 4IW3B 2AW5A 4Q1FA 1KEWA 3H8JA 1AB5A 1GRQA 3BICA 2ZTUA 3PYLA 4S0ZA 4YV0A 1I4TD 3HKDA 2R00A 3TNFA 2NU7B 3A26A 3PRKE 4ISBA 4NOLA 5BW4A 4E31A 5F3RA 1K7FB 4CIVA 2AC2A 4KRFA 3AM4A 3PVCA 1J39A 4HDNA 2RDMA 4YCMA 4WFQA 1YJAA 4DTIA 3GFSA 3R0JA 2F1JA 2OP1A 4M7PA 2V7TA 4E0BA 4HEA6 1IQ0A 5CYOA 1KEKA 5LYJA 1SG9A 4R0NA 1EGHA 3QG5A 4P34A 1WUIS 5J1TB 3PPIA 3MAJA 1V1RA 2BFPA 4IHAA 2FFAA 2M1ZA 4P4UA 4Z9AA 1P2SA 1HE2A 3DBOB 2JLZA 1BG6A 2C4KA 4ZRMA 1ZZEA 1RWKA 4PAOA 4PVDA 1EVYA 3VV3A 2JFPA 4UUQA 5F7XA 1L1RA 1DKPA 2R8ZA 4BO3A 3REFA 3KT3A 3CA8A 3OFSA 2L17A 3S29A 4BTLA 1V5EA 4KR3A 4Q3AA 4FMCB 1OA0A 3U3ZA 1Q22A 4WT7A 5AVSA 1RT9A 2Z6UA 3FOWA 4OXYA 1WY5A 2PZMA 3U7QA 2OHXA 3A0RB 1NJGA 3OEYA 3OJOA 1IOZA 1IHYA 1FNCA 1MU0A 2IYAA 3AF2A 2GPTA 1KSHA 4GVPA 4KYVA 5IYZF 3TIGA 2PX2A 4JCOA 1JR3D 2EU8A 2RHJA 3KSUA 3HY6A 3AJ9A 1J90A 4JOQA 4RVHA 5DN9A 4N6GA 3RYIA 1ENOA 1QK3A 1UBHS 2NO9A 1JDBB 2FN7A 3PTZA 1EG2A 4G6ZA 5GQSA 4D9HA 1K8YB 3WJ1A 3TXXA 1FC0A 3QBDA 4UTXA 3TLBA 4UVIA 2ZRGA 3VPDA 4ASUA 1CIJA 5ICFA 3O3NB 3WX0A 4R8SA 2NV6A 3T9BA 5JAPA 3ZJTA 3SM3A 3D8SA 3X1MA 1PL7A 1FXWA 5K0EA 1AK1A 4JEHA 4U63A 1A5AB 3C3AA 5EMKA 4CL2A 2QE7D 2JGNA 3GD7A 2PMFA 1VDZA 3UWDA 1X0VA 3UANA 2AS0A 1HNWB 4NE7A 3ONVA 5CA1F 2WLTA 3E8XA 5SZKB 1OVGA 4FGJA 3L4BA 2QPAA 3TQFA 1O1YA 1W44A 4D3DA 1SXGA 1V3VA 1DC7A 1VLZA 2GYVA 3H17A 4FWBA 4JEMA 1YZTA 4L75A 5EJMA 1ULTA 3K8QA 4YAIA 4OLBA 2NMVA 5CPBA 3DZKA 4BB6A 3OLYA 4LV5B 1JHPA 3DCNA 4YMIA 3H4MA 3IDOA 5DWDA 4OATA 5L4NA 3GQBB 3PGMA 4RF4A 3WLTA 4PCLA 3K1JA 1UC9A 2Q1SA 2Y1OA 4RMHA 3IL2A 2J0SA 2WIBA 4GKVA 3B13B 3IQZA 3C7TA 4YROA 1MH9A 5DM2A 4E09A 1W93A 2H1FA 2BUAA 5BN4A 2EX4A 2BMDA 3O75A 2W6MA 3KSRA 1Q19A 3K0CC 3W7AA 4EF4A 5E9QA 3F6BX 1Z34A 3IXLA 4G4GA 2PTGA 4N0QA 2R60A 3ZVKA 2ZCJA 4XGQA 3F47A 4M3NA 3NVDA 3QPBA 1P9WA 3BMOB 1IOLA 5CXQA 3EC7A 1FY2A 4GKAA 4IMJB 3B1FA 1E2LA 3HI6A 1KAQA 4LRWA 4Q6WA 4LXXA 5E6SA 1DELA 2FRXA 4LZOA 3EGDB 1FA9A 4QU8A 4EHHA 5D3ZA 4O2BA 1QYVA 2QB5A 4ZVKA 3LFUA 1TKAA 3JAWA 1Q1AA 3VSAA 4BNLA 3MINB 3NHLA 5J5VA 3RS4A 3TWOA 4Z7NB 4GUDA 3QA9A 2PTHA 1MAUA 1DC5A 2J0QA 2P5SA 1UKBA 2GHQA 1ZK4A 1RWMA 2DQYA 4H0NA 2JGFA 1BE8A 2QKYA 3QKTA 1RLJA 5EGNA 1NVEA 2GPBA 2I03A 2OC4A 2IVZA 4RGVA 4B2LA 3PUWA 3W5HA 3IOBA 2J87A 2OHVA 4R4JA 1U2PA 2DE0X 2A9JA 1BE1A 3Q6MA 1SO8A 1BRMA 3ZCVA 3GJRA 2XB4A 3K94A 4W5OA 2C94A 2P0AA 2EKLA 4HWKA 1Y5LA 1E7RA 3NX4A 4EP1A 3CWQA 1DNPA 3N0VA 5JY6A 2ZS8A 1JA0A 5K8UA 1J7JA 3CRNA 1EX1A 4XQCA 3TDNA 3PNBA 4PNHA 3GCWA 1AHIA 4UOZA 3H1GA 4O2AB 2FLKA 3I6ZA 5B7QA 1J1ZA 5FUYA 4O25A 4BL5A 2P3LA 1BDBA 1ULBA 3WAJA 1AE1A 1E0JA 3SG0A 1JR3A 2ZSIA 2AX4A 5B3JC 2XRMA 4RD2A 3O1JC 1SU6A 3PNVA 3SI7A 3JZDA 3V8NA 4EA6A 4LF4B 1P3JA 2MYNA 3RTBA 3SC2A 1Y5NA 4H31A 1AG9A 1E0DA 5JZOA 2O3QA 3EAFA 2MSLA 3KKZA 1ZKMA 3ANSA 3QYFA 2BHSA 4D0LB 2DERA 3RYFB 1MH1A 4LWOA 2QLLA 4UPDA 2V8BA 3FLMA 3NHFA 3QWAA 3N6VA 1KEZA 2YZNA 5BQ5A 3VR2A 1OXXK 4IVRA 3AKZA 2FSHA 2QBYA 1Z73A 1FS6A 3PCRB 3OF3A 4MYSA 3EPLA 4DV0B 2V03A 3ZWYA 1Q2XA 2C0QA 5F7JA 1A9OA 2H4XA 1NYTA 1PEKE 1RMYA 2A0WA 1PF7E 1QIJA 1RVV1 2AEFA 2XWJI 3CN9A 3D4LA 3ZHOA 3ZWAA 1U7XA 4DPLA 2IHUA 2VDWB 5H3CA 3GJSA 2HYIC 5C7LO 3DDOA 3LUBA 3NNDA 3BUSA 4J03A 5GONF 3NWBA 4YCDA 3VPFA 5A7FA 5FJJA 2H0AA 3EZ9A 4WDQA 2FCRA 4X00A 4GI1A 5KC9A 4M8NE 1TUEA 3W8EA 2IU0A 2HO5A 3WRYC 2I22A 4OMUA 4XUGB 1P1RA 4BKMA 1XJQA 1W85B 3PDJA 4FCWA 3A25A 1PS8A 3P8ZA 1SXJC 3BF7A 1JXQA 2XTJA 4ENWA 4QLBA 4XRRA 2ZAIA 4ZRNA 4RXTA 5E4YA 2ZRMA 3PGXA 3PKIA 2EFCB 2HI0A 3K4QA 3EPRA 3ESRA 3IIMA 3LVBA 3MWYW 1EWYA 4LJ5A 4B3RB 3EC1A 1KI9A 5EE0A 1HWYA 1ADBA 1D1TA 1DXQA 1I36A 1SXIA 2FK7A 2E89A 2B36A 3GDGA 3ML1A 5AK0A 3GARA 2A7QA 2J8ZA 3GEMA 3OURA 3UMMA 2NZJA 3EPHA 2O8CA 4F1JA 4JX8A 2FPRA 1ND6A 4JZYA 4P2GA 3RTCA 2Y6VA 1ZGGA 4DMMA 3ZJ5A 1RCTE 3VR4A 4E4RA 1C1DB 1A8QA 1R0CA 4IDQA 1ZJYA 3T7DA 4R8RA 3R9XB 4RH3A 2OCGA 4BV9A 1XNRB 4L95C 4C9BA 3QF4B 1POXA 4Y6SA 5H82A 2UU9B 2IEGA 2GK3A 4OMDA 5JI2E 1PTKA 3HA2A 1JU4A 3DR3A 3GXBA 3ZHQA 3TLAA 3WGTA 4DDMA 2IYSA 2OV4A 4DA9A 3QIAA 4JX9A 1PJRA 1SOWA 4J3JA 3TK1A 2ATIA 5FPTA 5AXBA 5I7RA 3HY3A 2QD3A 4W9NA 5TMBA 4BJ3A 4JK3A 1BX1A 2O7QA 1RYMA 2LKCA 1T3GA 3I6MA 3IXMA 3LQ4A 4G5YA 5DP2A 1B15A 3A3OA 4UZFA 2PMCA 3HYLA 3BMCA 3IMKA 3OUUA 1EBUA 1NHWA 4Y18A 5CA0F 4NP6A 2P35A 2QI9F 3E61A 5C53B 3ER9A 3ROTA 1DEHA 3KQYA 4EFKA 1OBVA 1RQLA 4D9MA 4V1CA 4IDFA 1YQXA 1LBHA 1XTJA 5JAUA 3M81A 3OQJA 3LCMA 4MV0A 5FFMA 1FFCA 2J09A 4MIYA 5AQEA 3FAZA 3F74A 3IEUA 3VH1A 5C5CA 1YIDA 2E85A 2WZDA 1RMQA 1LJLA 4DA7A 1EK1A 5KREA 2NO5A 4GQAA 1PT6A 3E22B 1F0YA 3UATA 1RPZA 3QTLA 2YBEA 2P9EA 4HEQA 2J30A 2RGNA 4GS5A 3S2FA 3W77A 3EEYA 5CXSA 4CV2A 4RY8A 4TKVB 3LXMA 3TNLA 1G7SA 3MOIA 421PA 2H6EA 5ERGB 3AGQA 4WPGA 2NZVG 3HABA 1LX7A 1CUWA 3E2IA 3IRUA 1MT3A 1Z5PA 1FL9A 3L0OA 3WSWA 4MKGA 1V71A 3PXCX 1U3VA 2C9ZA 5C5IA 4KODA 1BEEA 3ZK9A 3WGVA 2OV1A 1XVTA 3X1ZA 1JFLA 4ZC8A 3PXBA 3DTVD 4EMSA 1DOZA 2AVNA 1TJ5A 1XDGA 4HGOA 4DUYB 3O92A 5K05A 5LMNB 1I3NA 4JKYA 1NFQA 1ZS9A 4XYBA 2VL7A 1V4BA 3C15C 4FN4A 3FBGA 4HXGA 2OG2A 1P0FA 2XCIA 4WKOA 3FLAA 3FDZB 3NB0A 2Q5FA 2ZJ2A 4UMVA 5JNVA 1N2CA 1DQPA 1PGOA 2YY6A 1EB9A 1HFEL 1TZ2A 2V5VA 3SOZA 1BFUA 1D2RA 2XWSA 1W34A 1YGPA 3SX0A 4INJA 1W5BA 1LPMA 2NQ2C 1PDWA 4IQ0A 4I66A 2QN2A 4DCUA 4PG8A 1DJMA 1MR3F 2H17A 1JKJB 4GR9A 4C08A 2VLBA 3AFIA 1CDEA 1E89A 1NJSA 2L0XA 3AF5A 1TB4A 1R5BA 5ED4A 3OEWA 3TLMA 2A57A 1QZZA 2CVQA 4B48A 5CDYA 2WWWA 4NXMB 4LK2A 3OIUA 4LRTB 3HPRA 4MP6A 3KSZO 4LC9A 4BC1A 1W48A 2E55A 2YV3A 3C3BA 4IDCA 5JCPA 1E6WA 1IWOA 4RORA 4WECA 4N5IX 4PZZA 5CDUA 3JD4A 1RZRA 3ONFA 1UFOA 3O8BA 3S4YA 2QAGA 1IN5A 3OFKA 4L74A 2B4TO 3IBYA 3GEPA 1OJ7A 3PK0A 2IS6A 5E0OA 4F4UA 4FMDF 3Q0EA 3FJYA 1IK6A 4P58A 3QKUA 3HR8A 1R8JA 2PYDA 5E0KB 4IHJF 5CNKA 5COQA 3S1LA 4EUFA 1Y5IA 3THXA 3T5AA 4DLPA 2OB1A 1K5PA 2O0KA 2ODAA 3FSRA 1I2BA 2HHJA 3KK0A 1QF6A 2ZB2A 1QGOA 3HYSA 1MQ9A 2AFHB 4JCCA 3ZOZA 4MUBA 4OQMA 2VCYA 3ZY6A 1RDFA 3BIJA 4DG8A 1TF7A 3D02A 3FFWA 4G56A 1UEIA 4P53A 4M7WA 4NE2A 3CR7A 5DMXA 3SOPA 3LL4A 4D92A 1C1YA 5CFMA 1DCMA 3D3NA 4C4XA 5IBQA 3PUXA 2P11A 2YHBA 2QI9C 1DCTA 3PC8C 3JTEA 1KY2A 2D1TA 3PX3A 4IIGA 4DSAA 2JJ2A 1KI1A 4YRNA 1H0SA 3FCAA 1ZNQO 2MOKA 2PT7A 3GUUA 1DP4A 2EGUA 3AFHA 4W1RA 4YRAA 1U8UA 1UODA 2QUIA 2XA2A 2X1HA 5J23A 3F78A 4QDUA 2APJA 1FLNA 2AB0A 3RKRA 1ISPA 1HGXA 1MB9A 2PLWA 2Q3LA 5KYXB 1FDWA 4EO4A 2V74B 2PNFA 9MHTA 3B70A 1SK9A 5CT8A 3S7TA 4E7OA 1OIXA 1OU0A 1WKBA 4RZ3A 4JP2A 2NO4A 4PZLA 2A9RA 3BTOA 3MMPA 4FYPA 4I4IA 2CD9A 3G9QA 2NO1A 3KKEA 5ALQA 5FUWA 4DNQA 4POOA 5EHZA 1KWGA 2QM7A 5BUZA 2OPBA 1PNVA 4XIGS 4ZVOA 2EX1A 1QHGA 3FPEA 4LBZA 4QYIB 3T3DA 2ZI9A 3WGNA 1D4ZA 2C57A 4ILKA 4Z3DA 5AJZA 3PD7A 4IFTA 4XYLA 4FHEA 5DRTA 2HWYA 2I8CA 5IS2A 4FYWA 1A3CA 3CTMA 4D46A 1ENYA 4PAWA 4ZJPA 3QU4A 3PLAE 5LOVB 1UPAA 3A6EA 3HKCA 1NLZA 2O23A 3G3EA 3K32A 4XCVA 5DOVA 3VH2A 3ZIAD 3TG8A 1MP0A 4QRDA 5BR1A 5FJIA 1SC3A 3IO3A 3DCIA 4KAJA 5JDIC 5JJKA 1TDJA 2I6UA 4NH0A 1WXDA 1NRXA 2O7NA 5CLHA 1U2GC 3TPFA 4WOBA 1UQUA 2OCAA 1LDMA 4MWDA 4G5HA 1NBHA 4Y1RB 3AETB 1FDIA 2DBZA 1XEWX 4PO8A 5G4LA 4R81A 3FWHA 2NNWB 3O93A 2OV3A 1WUYA 4R0MA 1M2KA 5FO0A 1KDVA 3C1UA 4J9UE 4PPYA 1EFPA 1QH1B 2VSQA 2OTCA 2JH3A 4URXR 2IZ1A 2GS9A 3VTKA 3PNQA 1QFXA 1VJDA 3KKOA 4RVGA 5L3RA 3W9SA 2HNAA 5BN3B 1GTSA 3HZRA 3IX7A 1TAHA 3ZDDA 1JLRA 1E6UA 1YL5A 1GTRA 1COWA 1ELOA 1M34A 1YI1A 4BVKA 2HRZA 2G8NA 2QN6A 3O8OA 3ZCTA 5DP1A 4ARVA 2J3JA 1JZSA 2ZWIA 5AUNB 3G9UA 2WG1A 3LLMA 4YT4A 2AMFA 3G2OA 3DQQA 5AK5A 3GLUA 5AKXA 4YFVA 1S02A 5HR5A 3AH8A 1GQ2A 1EJ2A 1KIAA 4JIMA 4D57A 3N7AA 2YRFA 1W85A 3DVQX 3KPVA 3OT1B 2AFRA 4FPXA 1XMJA 2ILVA 2RHBA 1SKAA 2W6NA 3E3OA 4HX2A 1ADGA 1JLLB 2A1UA 1U0EA 3HVRA 1YAHA 4KTTE 4RUKA 4AF8A 1C8BA 1V1RB 1W0KA 3EIWA 1RACA 3H1FA 3OAAA 4RY0A 2ATVA 4BU0A 5JRDS 2J4FA 2VJKA 2ZBQA 1P5HA 2SNIE 2HK8A 5EQFA 4C0AC 4HNUA 3CRRA 4AKGA 3INNA 3AETA 1B8OA 3AMVA 3MPUA 1TQDA 4TLEA 4Y2SA 3WLFA 3K2BA 4A4DA 3O4VA 3BJMA 2VAWA 3QX8A 4L0MA 4CR8A 2TMYA 3ZV7A 2V6IA 4RESA 3AVQA 5EINA 1RCFA 3R7FA 2ECKA 1RRFA 4PZCA 5TB5A 4EGAA 3QQ5A 2C5LA 3IAM6 4W8HA 2OCBA 3BOSA 3D0OA 4JI6B 4D6XA 1M0WA 3G2PA 3DOHA 1PZGA 1UEJA 2ZYWX 3FWYA 4ZU6X 3E9ZA 1E64A 3G89A 3IE2A 1KPIA 3OHPA 1NFFA 3ROZA 2MWMA 4GGMX 5ECYA 3CZCA 1UQTA 3H8WA 3ADOA 3OZFA 3PT9A 1U1GA 1CY8A 3EB9A 5DBHX 1UCFA 4RCZA 3HQ4O 1RFGE 5KYXA 1T6ZA 2H48A 2PIDA 4NJMA 4QOFA 3ZGLA 4KWIA 3HWWA 4ETNA 2WP8J 4KLCA 3PQ3A 1C8VB 1SCDA 3S2GA 2JBWA 5HQ3B 1NBME 4HN4B 4GOOD 4JQZA 3PQ2A 2EZ4A 3SR0A 4O1HA 5AUPB 1U8XX 1R4MB 4H35A 1YZVA 2QD2A 3AT1A 1ZIXA 4YCSA 1G8FA 1I13A 2EKBA 3ILHA 2XB8A 3B6MA 4E70A 4KOAA 4I4TB 4W9MC 1YQEA 1IONA 1WDMA 1NM5A 3OO0A 4BO2A 1ITZA 1Q21A 3D3QA 3LVQE 3G2HA 5FPYA 3NTOA 5HCUA 3JXEA 4NPHA 2X42A 1ILWA 3KR9A 3TM4A 2PUVA 4M8SA 3ZCRA 5DM70 4PQRA 3V8VA 2P6MA 3BMQB 5IKMA 1LDGA 3NUQA 5DLPA 1M9NA 1UWLA 4JB0A 3QXJA 2PRZA 5HG0A 1NA5A 3TL3A 5LB4A 1JHMA 5AW8A 3TDMA 4JGIA 1Q0LA 1LV8A 5H8WA 4NFHA 4ZOQI 3ZE9A 1EG7A 4UUOA 2UAGA 3A31A 4F2HA 4GLFA 5GOZA 2C9CA 5JQGB 5KNCD 2VK4A 4GWLA 1G5HA 4BIIA 3SFTA 4GQIA 5KJFA 4EUHA 1U2SA 4O4HF 1G21A 1YS2X 2ANCA 3EODA 5C8XA 4IH4A 3EC2A 1IBSA 4R1QA 3P2MA 4YAWA 5CVJA 1GA1A 4JLAA 4L6IA 3RS8A 4D98A 1UBKS 2AFIE 4LCEA 1VPDA 1QRSA 2FSSA 4J9VA 2OG1A 3NT4A 3BXEA 5DHFA 4OI4A 1U8YA 2AFHE 4FK8A 2CLEB 1W4LA 2DSTA 3JSXA 2CFCA 5DXFA 1T0IA 1ONPA 4A2CA 1ILEA 4G4JA 2IPOA 4RGBA 1SHZA 2NSDA 1G6OA 5C8YF 3DOJA 1S8FA 3V1TC 4C3OB 2XNDA 3CRMA 2GAIA 3ENZA 5K0FA 5K3OA 4K9QA 1P6XA 5FXMA 1L5YA 2FR8A 3LUPA 4C0HA 1Z18A 4CIAA 5KWJA 2GKOA 2P4UA 5TLSA 4Y9TA 3UCEA 3BZWA 3F3SA 1VA5A 2FNAA 4P0PB 4OAOA 1YOVB 2Q9CA 2WOOA 2DUUA 3FZQA 3HB1A 4L8WB 1Y42X 1ZQ9A 3SSMA 1LQ2A 3A6LA 1T1EA 4QJBA 4QUJA 3C7DB 5EZYF 4IS2A 3VGJA 2IHVA 1W5AA 1VSVA 1BKSB 4LXYA 2B1RA 1CNEA 2X58A 4V3CA 3STUA 5TPWB 4G0VA 2CLCX 3TVDA 4OKSA 3GWGA 1ZSVA 2AOTA 4QGHA 3H97A 4LC1A 4WW0A 3ZWQA 1I14A 4B31A 4V0QA 4MGYR 2Q9BA 3IB3A 2PXCA 3HK2A 1ZMTA 4M0MA 4YREA 1DWPA 2Y0DA 4GLJA 1YWGO 2OD2A 4FI3C 2YVUA 3IV9A 3E84A 4UXHA 1I2MA 1QV6A 3D4BA 4MMZB 3T38A 1EP3B 4BLTA 5FLYA 4LTMA 5JYDA 2VNJA 1E8MA 2Q4RA 4FJ2A 2EHJA 2XT0A 4M54A 1SNYA 5LL6P 3TFWA 1R64A 1Z4IA 1GRCA 2O05A 2SICE 3E9MA 3FB4A 3NONA 3SBOA 1DBSA 1WETA 2Z2XA 4HL6A 2ATCA 1X94A 2QX4A 3BMNB 1Y3DE 4U5QA 2PKQO 3C7KA 3L6EA 3RVQA 2O2HA 5L53A 1SQGA 2C7RA 1ZIOA 5C35A 3LC1O 1Q16A 1ONNA 1U7HA 5MFPA 3RD5A 3FYUA 2P30A 3FMIA 4F11A 4QUGA 1PTJA 4C6SA 3OE4A 1WTCA 4UEQA 1E92A 4NK4A 2HMWA 4HWSA 4J07A 4BQEA 1A2QA 5EJ8A 2JJ1A 4QFMA 4JBXA 3LHIA 2JFWA 4DL9A 1HURA 2C8JA 5CU7A 3J7TA 1E9VA 1IM2A 3KBBA 1PX0A 3M49A 5FHQA 3P2IA 4ZVVA 5T6BA 1GZVA 2HU7A 3D9QX 4B75A 2IOFA 5FX2A 1JA1A 2WEKA 5E6RB 4YP0A 3EGXA 5EIWA 2ZB4A 4QUIA 4M1TA 4EAAA 2P8SA 2Q28A 2RI0A 1TTHA 2Z4SA 5EIEA 4X0EA 1JQ5A 2J46A 5KCZA 1E4VA 4JDUA 4XLZA 3S2SA 3VNUA 1VJRA 3A36A 4OSPA 1PX2A 1AKUA 3PFBA 3NHPA 1M0TA 3QLEA 1QIEA 2NVWA 3ESQA 2HMAA 5HJ2A 2IA5A 3FHLA 2P62A 1Z2AA 3MM4A 2F2TA 1EAMA 4PRYA 2C0PA 1ZXLA 4K8OA 5G4KB 1QMGA 4Y7CA 2IYRA 2QTRA 5JV5A 3IUJA 4BMSA 4RIHA 3AUYA 5F51A 2VNIA 1RI1A 3F6EX 4UNSA 2DRIA 1Y7TA 1HNXB 4PHCA 2KBFA 2VT7A 1J09A 2WBLC 4EPTA 4N0MA 1NPYA 4ND1A 4NESA 4X54A 3G49A 4N3NA 2H3EA 1E1MA 1I7DA 3A6ZA 4QHTA 3ZDYB 2Z6AA 1C2TA 1OAAA 2GJ9A 4LX0A 4X20A 1TVEA 5CW1A 3QVVA 3HS3A 2MYTA 4I6GA 1XR3A 4FYXA 4P84A 5ALHA 3TJZA 3WLLA 1ZR4A 4ECEA 4B3GA 1JDJA 1NXWA 2PBLA 4RTSA 1H05A 3EARA 4GW3A 4TXHA 5CFOA 1IY9A 5AVTA 4M8LA 2HH9A 1OFUA 1NE2A 2IIBA 2V7WA 4UE3S 5JNLA 3OJEA 2JIDA 4O1IA 1TW2A 2RC6A 1OV6A 3CLTC 4NX2A 4XSVA 1OROA 1EB8A 1ZJ4A 2Z2KA 1GQRA 3VU0A 5ICSA 1M1YB 1CKEA 3AKYA 4H08A 4E4YA 1ZXBA 2BHRA 1YFKA 3OWHA 3PA8A 4UJ3A 3W5VA 3PA6A 4EPWA 2P6NA 3VBCA 4RLHA 3H7IA 1DKQA 3CUSA 1OB2A 1ZINA 1AF7A 4IV5A 3IHKA 3W5JA 4F3YA 3S8EA 2C1EA 3NKFA 3ZE6A 4R1OA 4ARAA 2DPYA 3D6MA 5EXDA 3E5RA 5FV4A 2R1VA 1OZGA 3D4IA 4FUQA 1D03A 3CLKA 2ZUSA 1N5MA 1NP7A 4MVJI 2V7QA 4KFTA 3HRIA 3JX9A 4NF2A 1VG0B 4YJHA 4D3ZA 1D7OA 4IV8A 1L5VA 1COWD 1NRWA 2RMKA 3WIDA 4C22A 5A4AA 2E2WA 3U7IA 1LV7A 3IQDB 3N59A 3ZCXA 8ABPA 1SUFA 2JLCA 5AVXA 1Y1SA 3WMXA 2QTTA 1R1DA 1TLLA 2NW6A 3EIHA 4MYTA 3HR4A 1HORA 1YDHA 4MVJD 1EHIA 4Q6BA 3I30X 1PKEA 2F1OA 1Z7EA 3TSWA 1OTXA 2V4MA 3SZRA 4QECA 3H1PA 4LYJA 5HW0A 3GDWA 1CR0A 4GR5A 1VG8A 4HDSB 3WLQA 3UHPA 1JF8A 1Z5UA 3UM9A 2Q27A 4BFTA 5BSKA 4RTLA 5IT4A 4BNKA 1SZJG 2Z8ZA 3MLBA 1DAFA 1CFJA 1NW7A 2UZ3A 3V5NA 2FETA 3L7YA 1OGYA 4I2VA 1ONSA 3FYHA 3R5JA 1ADCA 4Q3NA 4R1NA 3MYYA 4D7AA 3O3MB 4Y0AA 4YTEA 1DQYA 2R4UA 4LWQA 4L2IB 2XSZD 1DU4A 1UC5B 3VOAA 4EY7A 3TXYA 1RCUA 1JAIA 1XZ8A 4DA0A 2D4AA 3GEIA 4MP3A 1KPHA 4L76A 4YRQA 1CUBA 1QE5A 4X9XA 4H1TA 2P9JA 2BRUC 1G20A 3ORSA 3K0SA 3LPDA 4JH0A 3UAOA 4COOA 1KRWA 5F1PA 4J1NA 3RVKA 5JD3A 3H5OA 2YZMA 3ZGNA 3FOAA 4IYRA 1I24A 1MV5A 5H9VA 3PF9A 4XWTA 1MC8A 2IUTA 3FPBA 4GEKA 4G4SO 4PSCA 5BQOA 1B0PA 3T3EA 3OFNA 1YB6A 1PUXA 2ZJFA 2J3MA 4L6CA 4CV1A 2I4LA 3IRVA 4N6NA 4DKXA 4Z7QB 2QTMA 1E5DA 1V1JA 5IFKA 3T52A 4B40A 4M0CA 1N57A 1OIVA 2ZIEA 5EP3A 4HLQB 3U3JA 4M9XA 2ODNA 2VHYA 5A5EA 1Z8NA 3LPMA 3NALA 4IUYA 4ZI7A 4KIUA 1W6RA 2QUBA 1KGSA 1KO4A 3TZ6A 2N9UA 4MI9A 2WWIA 4B79A 1DCFA 1US8B 3RDPA 3W06A 3VYVA 4CLHA 5F9MA 2XUHA 5FAKA 3V97A 1P2TA 4B43A 5EUBA 1KRHA 2HB6A 1OLXB 2V45A 5KBYA 1SBQA 4KNVA 5M2QA 3KG2A 2WYUA 4O3FA 3WFIA 1L5FA 2RHOA 3QWIA 4Q1AA 4ZJZA 4O33A 4MGHA 3OP1A 5L3QA 3PC8A 1JNXX 4I55B 4QGAA 1RC8A 4DYHA 1F12A 3M3HA 4J1TA 2FQXA 2B4RO 3ELBA 4MI6A 5FR2A 1J33A 2DH6A 4B6JA 2RI1A 4ON9A 4M0EA 1G4HA 2BFCA 5KZMB 1ESNA 2XA1A 3SJUA 4B35A 3ZHTA 4YK7A 2ZDHA 4TTSA 5DHRA 5JATA 4TQAA 4Q12A 3C0KA 3MEQA 1OFUX 3L9XA 4G8BA 4M2LA 4QIHA 2YN0A 3GJ3A 3CIFA 1Y4AE 1KF0A 4Y6LA 4LX8A 1O0CA 1MXFA 2QIPA 4JB8A 3L06A 1QIKA 3GT7A 1BYIA 3R7AA 2O07A 4CWAA 1VE5A 2P90A 4YPOA 4XDHA 3ZQ4A 2ZUFA 1RXCA 1HT0A 3OZWA 4G1EB 4GI3A 1CQJA 4ISCA 1AHHA 5BMVF 1P4JA 1YU9A 3C6QA 4KRXA 4R8MA 3QXGA 1P2VA 2IXAA 3FWKA 1X92A 2GZRA 2RHHA 4F85A 1SBCA 4ZFNA 3NEYA 4JJ7A 2GF9A 1Y63A 3TLYA 4BO4A 1J1UA 2IV2X 4P86A 3VC1A 3AM1A 1QYRA 2OA0A 2GM4A 1U3GA 4J43A 2QHXA 5IVHA 4M36A 1SD1A 4NS4A 4IIFA 2WNHA 4TWRA 3GZNB 1JUDA 1Z0KA 4L8FA 3TUIC 1GUZA 3KC2A 5EFZA 3WWZA 1WX1A 4MH0R 4OK5A 1D6MA 3H5LA 3LYAA 3IP5A 4ZMSA 1MO4A 4KH1A 1SOVA 4B83A 5DXAA 3O5AA 5AFSA 1HSZA 4BS9A 4L9AA 4AG5A 2CEKA 1QGUB 2O5RA 5I48A 1WSWA 2C58A 2WUVA 5A3SA 5F3WB 1R8YA 1FTYA 1XTZA 3O83A 3UJ8A 2NU9A 1EUCA 2NAFA 5CFNA 2QTBA 3DMHA 1CB0A 3VKGA 4OQXA 4XWAA 3T06B 4C6RA 1P17A 1M2NA 2R8YA 2RK3A 4OXNA 1Y81A 2DC1A 2GEBA 3SYKA 4KGXA 1WB5A 2KHZA 4Q9HA 1O6ZA 5BWMA 1JIQA 4UE6A 4ZV7A 3ZHSA 1KJ8A 4DDUA 4OD0A 4WXRA 1Q5PA 1P72A 1YJBA 4FFWA 1CEEA 2XWPA 2VTDA 2GSDA 2X3UA 1OU4A 2Z9BA 1G7TA 3PP8A 1WNTA 1LRLA 3TBHA 1Z0JA 1T4BA 5KSWB 1WVMA 5JASA 4RLQA 4BUJA 3HGQA 2XTMA 5TSDA 4EDFA 3V4LA 3QFFA 1DARA 1VFNA 3M82A 5JR3A 3ENKA 5EWLB 4EITA 3B6EA 3MF4A 3NCTA 1IZ7A 3KXPA 1TTQB 1H42A 1VPTA 1SA0B 1A72A 2WD8A 1NVUQ 4H0CA 4RJKA 1EFKA 1JFFB 5LCXA 3OCVA 4V0RA 1FZTA 1AGPA 1GG2A 1J25A 1NV9A 2Y93A 2YWBA 3GRFA 2EATA 3HRKA 4DC9A 2BCGY 2XHZA 1VB3A 4H3KB 4HGNA 3LQYA 2F64A 4NDAA 1F0PA 2B99A 3ZE7A 2C5SA 3PWKA 2YC2C 1CUDA 4Q01A 3W8NA 1KMHA 2V0NA 4L1KA 5EOVA 2Z57A 5EXXA 2DSNA 5DX8A 4C89A 1A82A 1BSVA 1FQKA 1UAGA 2VH2A 1YB4A 1XCBA 1NUHA 3LUAA 3II6X 1MC1A 4IICA 4JXKA 4KH0A 3R7BA 1OF1A 2XOXA 5B3JA 3G0HA 5B6IA 4EWLA 4CEIB 1NMSA 3SQMA 5EI5A 5T3UA 3RUCA 5LUBA 3U5TA 2CEAA 1C1XB 2HWXA 3A14A 4URFA 1L8AA 2PUDA 2ZSUA 1M5UA 1CUVA 2KX7A 4GKKB 5AW5A 2XTNA 2OVFA 2ZU0C 4RJJA 4KPUB 3ANTA 2R96A 1H6BA 1V9SA 2CHVA 2Q62A 4JOBA 1W73A 2ZIXA 4IOLA 3BSFA 4QVIA 2C7OA 2CV0A 1XU7A 3VKHA 1BQ4A 1IZ8A 2WR8A 4P1ZA 4LDPA 1L4UA 1W25A 3HJUA 3PRJA 5DNWA 1ADFA 1GGFA 1I1NA 3KLMX 3MGAA 3QSGA 3VR4D 1Z4QA 1NMQA 5ITZB 2O8BB 2Y9PB 3QU7A 2X1LA 4K6KA 4DM7A 4H3HB 4YBRA 1L7OA 2AFVA 3WYGA 3OCYA 5E95A 2HRBA 4NCXA 5CW2A 1VKHA 3ZU4A 4EOGA 2E37A 5EQJB 3WGOA 4DKJA 2I29A 1SZDA 2EDCA 2QU8A 2R65A 4LJLA 4X95A 2HA4A 1IEVA 2ZWPA 3AZOA 3QHQA 3U7RA 3GJXC 4UTNA 2O8EA 4L0CA 3HXKA 5A06A 1H94A 1KI4A 4YCNA 3CLRC 1CY1A 5C4GB 1ZNZA 1XK7A 4XUCA 4YALA 4EDHA 4U9IS 3PVZA 3JV7A 5EIFA 2PT5A 1N33B 5BYBA 4TTIA 5ALRA 4M8KA 5GJCA 5GOTA 5JD5A 2IP4A 3SC2B 8AT1A 2GD0A 1E5VA 2CL6X 3PCXA 1UDAA 4F60A 1C30B 1WOMA 5KU1A 3KOYA 2F8TA 3DV2A 3N6XA 2BH2A 1M8PA 2WAYA 4V0NA 3THWA 3C8DA 4QFBA 4ABYA 1P1JA 4QM7A 4LMBA 2DECA 1JV2B 3IUEA 3Q88A 2ZXEA 4OJYA 3LZDA 5HK9A 2XF2A 1KZHA 4IQGA 4TVBA 1R8XA 1QYCA 4E6PA 3DZJA 3RIGA 1FNMA 4DADA 2QL5A 1W4ZA 3G5LA 2ABWA 4PGMA 4B87A 4CKYA 4Q16A 5A1TA 5JMTA 2C4WA 2ZANA 4ALKA 4LDJA 1M2OB 2KS6A 2V1UA 4DT1B 1LBQA 5BSHA 1V37A 1A5SB 3DB2A 3FHJA 1ZC3A 2MYPA 3C1TA 1ZAKA 4AJPA 3I8OA 4RGYA 1Y6QA 4IJVA 2PNJA 3NPAA 3FHCB 2O2SA 2D1RA 1OI3A 2QX9A 3DE0X 4IXDA 2X7HA 2C7BA 5T4FA 4TZ6A 1ACLA 5DSZA 3PU6A 3W4IA 3I0MA 2BHNA 4REOA 1B41A 1RXVA 3SHWA 4D99A 1OZAA 2QL9A 4AZVA 4TRNA 3TNDA 2PR2A 1ZUNB 3N2GA 1NRIA 4O29A 4BCCA 1DC6A 2QW8A 4RHYA 1YBHA 4GZ3A 5TQ2B 4C06A 3HU2A 3KJEA 4NY1A 4F2DA 2Q2QA 2W11A 3DL2A 3E3AA 3I34X 1VKJA 3QM1A 1KZ4A 2DX7A 4QQKA 3ZG6A 2AV6A 2YVLA 1ZI6A 2LUOA 2XMQA 2QQEA 3MPOA 3CNOA 1YF3A 1MF7A 4E94A 1O95D 2WYOA 2ZJZA 4LBWA 4OHBA 4I1SA 4ZYWA 3NNSA 2ZJYA 4PLGA 5ENVA 3PNYA 1IU9A 2Z2JA 3OZCA 4TV8B 1HTBA 4US0R 3AY6A 5CPFA 5H1YA 3TEMA 2W2QA 2WWGA 1SVWA 3K0FA 3L4SO 2FZVA 2V6JA 4GPEA 1ATIA 3G1TA 4OHFA 1V6AA 2GBGA 1G66A 3TI7A 4BWFB 4C5BA 2BGRA 1PU2A 3QOXA 1OI7A 3JS5A 2BGWA 2HO4A 3V8MA 5IXYA 5FPSA 4DPMA 2EFEB 2JHGA 4RD4A 2RGNC 1R6BX 1RQGA 2XADA 1FUEA 4ZI7B 4CKBB 5C18A 3LW7A 4LRUA 1RQNA 2OXIA 4BKUA 3AFNA 3F49S 2QDKA 3IKMB 1PR1A 2P68A 3L41A 1IMJA 4JLVA 5L45A 3WL8A 2VK1A 3DXFA 4HGYA 4G65A 4CTKA 4K88A 1E58A 2IHTA 1U1EA 2WDPA 4OBEA 1G8HA 4MWGA 5CEEA 4QICA 5JLJA 2BFFB 4G9GA 1XDZA 2F9MA 3OICA 4S1TA 1U31A 1SHJA 5C8YB 2GUWA 4AYWA 3R6LA 1AQUA 1QIMA 4GYYA 3BHJA 5LA6B 5GY7A 3V55A 3HXOA 1YK1A 3CVVA 1VIYA 2OZKA 3F90A 5KTMA 3Q5DA 4L73A 4Q9LA 3SBXA 4TL8A 5BN1A 3TTUA 1C9DB 1VLQA 3BD9A 3JASB 3WGQA 1MG0A 4G1CA 2VRNA 3OT4A 4MS3A 3EF0A 4L15A 2SHKA 3FZYA 2HCTA 5LDDC 4AZ3B 1Q0HA 1H9BA 1WO8A 3LMKA 4MPJA 1VL5A 3IBFA 1VMKA 1QPGA 4HJXA 5A7HA 3WMWA 4C2AA 2XXAB 1LX6A 4ZU1X 5BOSA 3TOCA 2O20A 1U3WA 1V8BA 3AZPA 1EJ6A 1QK4A 3DM9B 2VBIA 2IHBA 1HEYA 2A78A 3WGLA 3KU1A 2BUBA 3JVUA 4UTOA 1N92A 3E9NA 4OMFG 4L4YA 4LISA 4X61A 1H93A 1RXEA 3C74A 2FF7A 3RFUA 2CZQA 3OOJA 3DEYX 2WWXA 4RPIA 4UTRA 3WLAA 4DBZA 4IF4A 3OC6A 3B6KA 4KK4A 1IEXA 3HVIA 2FGJA 4Y9DA 1F3LA 1KI7A 3UOAB 5CAEA 1P62B 3BWYA 3PQ5A 5ECDA 1BXGA 2Q9UA 1JB1A 1A8UA 3HWX1 3A06A 4FJ0A 1G5PA 3JQRA 3QBJA 1QUFA 4JVLA 5HKAA 2P69A 3I2HA 2X0NA 1TA4A 3DE3X 3UPUA 4Y1GA 4BYMA 3ZV5A 1MX9A 1QHFA 3O8RA 1A8IA 4H7EA 1JQEA 1QE3A 3H83A 3GIWA 4OP2A 4FBGA 4WN9B 4AKIA 1YNOA 1E6MA 3JQAB 3OBIA 3JPWA 5KYTA 1OAOA 2CXUA 4C14A 4EHBA 4KAXA 4YMGA 3M6XA 1UC4B 4H7IA 5AKJA 5FEMA 1PVOA 1VHLA 3V4FA 4RTNA 3UKJA 1Q1EA 3ZR4B