4CM9D

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
248
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 95
structure length 248
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm9D00
4RJTA 4M55A 1I2BA 1SCUA 2SCUA 3GRPA 2I6TA 1K5HA 2JL1A 3PHGA 4Q3CA 3INRA 3C7CB 3RC7A 3RROA 1JKFA 4JJFA 4YJHB 4XX0A 1ZFNA 2CF5A 5KOIA 4TKMA 4WGGA 3WSWA 3DONA 4AJ1A 4BNVA 4D3DA 2E48A 3GAZA 1CETA 4A0SA 5TRTA 2QYSA 3V5NA 4CMBA 3O03A 4KMSA 1RM5A 2C7GA 3FR8A 1Y81A 3GN2A 3ZWPA 3O38A 3CXRA 3AM4A 1GADO 1SC6A 3FTPA 4NNJA 3ZWWA 5EMHA 1Z73A 2ZIZA 4J7XA 3IJPA 4B8ZA 2Y0DA 1DRWA 2AQKA 3OF2A 1A7AA 4XZ3A 4B4WA 2FWMX 3LZ6A 1Y6JA 2J5QA 4B4UA 2I76A 3UAGA 5GY7A 4FFPA 3V1TC 1WZEA 3PFWO 3D4PA 1B14A 1PEDA 4AG3A 4OKIA 2ZQZA 1W8DA 4U0KA 1AXEA 1E7WA 1K2WA 2DQ4A 1DC6A 2C2YA 2WEKA 1P9LA 3UF0A 4XB1A 5IDQA 3QQPA 5JNLA 2JFHA 4NBVA 2NQ8A 2VT3A 2PKQO 2X0IA 3SJ7A 1C1XB 2HMUA 3CZMA 5KJCA 3CMCO 4IS2A 5L95A 2C5EA 4GWKA 1E92A 4AJOA 3PGXA 3U4HA 5C7OO 2Q3EA 3ZWXA 4PLZA 5JSFA 4IIUA 5JMPA 4N5LA 2V6FA 4P8RA 5I7VA 1XGKA 3VZQA 4GX1A 1U1IA 3WFIA 5DCUA 5A06A 3TL3A 1GFSA 4DIOA 4XYLA 1VJ1A 4GI2A 4XEHA 3ZWNA 2ZB8A 3S8MA 2Q49A 1B7GO 4CODB 1GV1A 1MFPA 2AMFA 3L6EA 2IEBA 5TC4A 4BGVA 3R3JA 3CKYA 1P31A 3FR7A 3HDHA 3RKRA 3ZI0A 2BGMA 4AFNA 5JAIA 4LSMA 2GF2A 2JHGA 1B2LA 1DHRA 5KVVA 3JQ7B 1NYTA 4FJ0A 4XYEA 1BW9A 1KVUA 4TWRA 4BNZA 4II2A 3LU1A 4OJNA 1NVTA 4BNWA 3I83A 1A4IA 1NBOA 3IQDB 4Y6SA 3GEGA 1YOVA 4O63O 1NR7A 3ANNA 3GRKA 1MLDA 3KLPX 4WJZA 1P1IA 1PGOA 1PJ2A 4PZDA 1LSUA 3D64A 1SOWA 2D1YA 3MEQA 5DBFA 3TOXA 5DNAA 2CF6A 2QW8A 3H9QA 3L6OO 5DN9A 3DZFA 3B1KA 3CPSA 5HA5A 1Y8QA 4RVFA 3HN7A 2DTXA 7MDHA 4WEQA 3WGYA 4HADA 2O3RA 2A94A 2VWHA 4ZQHA 2CVQA 2WYWA 4XGKA 3PQFA 3GHHA 4NI5A 4YPOA 1QYXA 4J7CA 2QIOA 3C1TA 3PIIA 1FDWA 4ND2A 5IZCC 3VH3A 3LC2O 2VTDA 3V8BA 3TSCA 4CM6A 3D7LA 1HE3A 3PLRA 1D1SA 2O7QA 5KVQA 4WCDA 2GYYA 5I9MA 3E9QA 1PJSA 3ANMA 4CUJA 3MTJA 4MPDA 1KY5A 2B35A 3ETGA 1NVMB 4E5PA 4BS9A 1GQ2A 4I9HA 3U62A 3PWKA 4BGUA 3C3XA 3ETEA 3ONFA 2YY7A 3F46A 1VL0A 4XYGA 1KY4A 3ZV4A 1MC4A 1SAYA 3GZ4A 1DFGA 4N5NA 4FR5A 4QX6A 1N7HA 2BMAA 4DQXA 3EMKA 1WNTA 3WMWA 3WNVA 5KVCA 2ZJ0A 1OMOA 2ZTUA 2I9PA 1NASA 4JQCA 2BF7A 2ZYAA 2RHRA 1Y8RB 3GN1A 5F3RA 2IZ1A 4A03A 1ADFA 5T5QA 2RH8A 5I8WA 3QWIA 3QVTA 1YL6A 4EEZA 1I2CA 4OYRA 4YRAA 2NADA 4J9UE 4KP7A 4UAGA 1EEHA 4B7UA 1DOHA 5G4KB 3DEYX 3H5AA 1ONOA 2J8ZA 1M67A 2J3KA 5U1PA 1BVUA 4NBUA 4PG8A 3B20A 2EG9A 1I2ZA 2Q4EA 4QQRA 1M76A 1MC5A 4UREA 1GZ3A 1EDOA 1RYDA 5IN5A 3P2OA 1E5QA 4J90A 4E5YA 4BMSA 5KWEA 4AVYA 5TT1A 3GNTA 1HDYA 3I9KA 1E7SA 3GF4A 4KZPA 1ZH8A 2DLDA 3RU9A 4CQLB 5JDCA 3AUUA 3K31A 5AXAA 2Y1GA 1KS9A 4R9RA 2C20A 3I23A 1I32A 2R6JA 5JDIC 2DTDA 2HQ1A 4PG7A 1H6BA 3ZW9A 1X13A 3SX2A 3GH3A 3G1UA 1E7QA 2E49A 3UUWA 2H1SA 3M1LA 4DREA 3BA1A 5LDHA 3DMYA 1D4FA 1LDEA 2X5JO 4NFYA 5ILOA 1O94A 2DT5A 2ZB4A 1FF9A 2CDCA 3VPGA 2XOXA 3U9LA 1HDXA 1BXGB 4WNCA 2FR1A 2VHWA 4GL4A 4M89A 3K96A 3RBVA 4ALLA 2DVMA 5IDXA 2HK7A 3RC9A 4ZICA 4J1TA 4PRKA 1X7DA 2HMSA 4MVJM 1P3DA 2X23A 4N18A 3JQAB 1ZXBA 3OA0A 2BKAA 5T6BA 1LU9A 2I99A 4IGEA 1UZMA 5L7TA 5EIOA 2FP4A 2X86A 2IRWA 4J4TA 1B0AA 5F5NA 1KIFA 1Y5MA 2DPHA 3NV9A 1LLQA 3EW7A 4NPCA 1EVIA 3M1AA 2IEDA 4GGOA 4IQ0A 1NHGA 4G65A 1I3MA 3A9WA 3WG9A 4BO0A 1QLHA 2W2KB 2GPTA 4UUPA 3GAFA 3JQGB 2QHXA 1FDTA 3WBFA 4KWIA 4Q3AA 1QYCA 1BWSA 2Y1CA 2Q46A 1DRVA 1OZAA 3INGA 1P1JA 5CEEA 4JJGA 3S2IA 3I9NA 3WNQA 2A92A 3RI3A 4MO2A 2JAPA 4HKTA 3TN7A 2GO1A 4CQMB 2E82A 4D79A 4RDHA 2FSSA 4QTZA 4CMAA 1UR5A 3DAFA 5C37A 1Q0QA 4D7AA 5HWSA 4E31A 1GL3A 3AY3A 3D0OA 8LDHA 3NRCA 2PD4A 4CV3A 4DTIA 3IIEA 1V3TA 3NGXA 1N92A 3JQDA 1NFFA 5EPOA 3L9XA 2P4QA 5FI5A 3QVSA 3JYPA 3DZBA 4WOKA 5G0TA 4CLEA 2PGJA 4TSKA 2DM6A 3HQ4O 1ADGA 3DQPA 2PWZA 3FSRA 3I6IA 5ICMA 1DSSG 1R66A 1OC2A 1EQ2A 5EN4A 4CMCA 1Y8RA 4GGPA 1K0UA 1AXGA 4RCVA 4BO4A 4ESOA 4PLTA 3TFQA 4I5DA 2VN8A 4Q3DA 1LDGA 4ZGWA 1E3SA 2PFGA 5ENDA 2HUNA 1FDSA 1NQOA 2Q1WA 3HSKA 1EDZA 2X6TA 5G4KA 2FR8A 1U4SA 4ILKA 1U9JA 2I3GA 4C7KA 2AQ8A 2R00C 4RVUA 1JVSA 4IIVA 1SEVA 2GN6A 4LCJA 4Z3KA 4ZHSA 2PLAA 1TT5A 1ZSYA 1ENYA 4CLOB 1YB1A 1M66A 1Z45A 2VWQA 2CNBA 4J0FA 3OJ0A 1QYVA 2AA3A 5AVOA 1DC4A 1EE9A 2VWGA 4YJFB 3RUHA 5HS4A 4OM8A 1DJQA 1PJQA 4XR9A 5JE8A 1C0PA 3RUCA 2BGLA 4RPJA 3HB5X 2HCTA 3PJGA 3WGIA 5BT9A 2J3IA 4BNFA 1AN9A 1FJHA 2ZTLA 1HZZA 5CP8A 1U3UA 1OC4A 3DBLB 1PQWA 3QWHA 4UEKA 4XWYA 1RPNA 1DIAA 3OM9A 3ZGYA 1K6XA 3L9WA 1CRWG 1EMDA 5T64A 2Q1SA 4OIMA 3FNFA 1WW8A 2AEFA 2Q1TA 4B4VA 4YCAA 1ZXLA 5FFFA 2X22A 1Z82A 1ZW1A 2AW5A 5EESA 4BMNA 1PS8A 4CMJA 4D46A 7ADHA 1R4NB 3KEOA 5JO9A 2I66A 1BXGA 4QT0A 5L7YA 5A9RA 3JYLA 3VC7A 5LCXA 3H5RA 1EVYA 4WLUA 4FGWA 3KO8A 1NVGA 4TRMA 2EGHA 3PRJA 4D44A 3NTOA 3JQAA 4TROA 1RM0A 3BMCB 1LJ8A 3QJ5A 4R1UA 2BFAA 4DMMA 1LEHA 5L53A 1CQIA 1PJ3A 2DFDA 3KYBA 3WIDA 1N9GB 3H9GA 1PR3A 3BTUA 4Y6PA 4ZU3A 4IDEA 1E3LA 1HE4A 4R5HA 3JCZA 5G0UA 4INAA 4A73A 2W2KA 5G2OA 1YXMA 3NT2A 3JQGA 4FN4A 5TT0A 3FPCA 4GVXA 4L0QA 4YT8A 2HO5A 4GSKA 3EGOA 3H5NA 1Y9EA 3JQ6A 1Q1NA 1U4OA 3NTQA 1BVRA 1HYGA 2GNAA 5CFZA 2D3TA 3NUGA 2GR9A 1NWHA 3GVXA 2NQTA 3WJ7A 1IOLA 1F12A 4HNGA 4WE3A 3SJUA 1WVGA 3GMSA 4NDNE 5IAAA 5GMOA 2X58A 1BXZA 2C54A 2GCGA 4QXMA 1UUFA 2AQIA 1HT0A 2GN8A 1HL3A 3GG2A 1HLPA 4F46A 1U5AA 2FPIA 3AUAA 4B3HA 3ENNA 1DBVO 4CMEA 4GMGA 1GTMA 2H9IA 3QHAA 4JNKA 2Y1FA 4URFA 5JLAA 1XLTA 5T8KC 4U6SA 3WR5A 1WAMA 4IXTA 1B8VA 1EVJA 4YDRA 4MVJI 1MP0A 4F3YA 3IL2A 3V2GA 4J4BA 2DFVA 1BRMA 1ZEJA 2YV2A 3FWZA 4KUGA 3CUKA 4W4TA 2OORA 3WGQA 5L51A 3PFFA 5L3ZA 1JQBA 5CAEA 3CE6A 3ZU5A 3FTNA 4BO6A 1HF3A 3ZN2A 3ZWAA 4OSOA 1PL6A 2UUOA 2IODA 3BZUA 1QP8A 3IKVA 3WOHA 4PN3A 3MJSA 2BFMA 3WYBA 2PZMA 2G5CA 3G0OA 1CF2O 2Q2QA 2JD2A 3TFOA 4TRJA 4CL8A 1ONNA 1ZK2A 4WLFA 4DA9A 3FI9A 1MB4A 4RQUA 4YRBA 1NHWA 3WIEA 4FQ8A 4CLOA 1SNYA 4PLHA 1ZUD1 3UGKA 1NQAO 3VPXA 3ZWVA 4ND1A 4D3SA 2D4AA 4YJFA 1GYQA 1LRLA 2HMVA 1TI7A 2YHUA 3RFVA 2XXBA 2BELA 3TL2A 3HZZA 4Y67A 4CMKA 3WB9A 4Z9XA 2NM0A 3MWEB 2AG5A 2Y05A 4BQPA 4UEJA 1GQQA 5HS6A 5A9TA 4E30A 1T2DA 2DBRA 4RDIA 3JQ8B 1NXQA 4CQMD 2JHFA 4J1SA 4OH1A 2EKLA 5HRUA 1T2AA 2XPCA 4OXYA 4BNIA 2P2SA 3QLJA 1DLJA 3DOJA 2Y1EA 3E18A 3KYDB 3M6IA 4H15A 4PLGA 5DT9A 4BUCA 5A3JA 4Y8VA 3AOEC 5JAMA 3U4IA 1E3WB 2UDPA 2PV7A 3WGGA 5C7LO 4IINA 4E2XA 3FPLA 4RPHA 2P9EA 2CY0A 3F4LA 5G0WA 4CM9D 4NIMA 1NAIA 1UZNA 4YAKA 1MFZA 1KEPA 5B4VA 3F4BA 4AL4A 4BNYA 5CG1A 2G82A 3GK3A 3PJFA 4J2OA 4B3IA 3ON5A 3PDUA 3KM0A 3ZWOA 3LT2A 4B7CA 3JTMA 1C1DB 3GUYA 1NPDA 2EERA 3RJ5A 1BW9B 4ZQEA 1A9YA 4C4OA 3IDSA 3VAZA 1N9GA 1WDLA 1I24A 3DFUA 2NV6A 3F5QA 4IDAA 4FFOA 1X0XA 1E7YA 3I3OA 3UFXA 5JDIA 4FS3A 1EVZA 2BFOA 2EHDA 3D5TA 4Y98A 1LX6A 4ZVVA 4BQRA 3P2YA 3GZNB 2JCXA 1HYHA 2VZ0A 3PHHA 1YJ8A 4HFMA 4IDDA 4RVDA 4XGIA 4E32A 3PDJA 1DDOA 2DKNA 2X0JA 3JQ9A 4CLDA 5I8ZA 2WM3A 4J91A 1Y8QB 3IS3A 3IUSA 3IUPA 4BO3A 5F1KA 3ZV5A 4OMUA 3LVFO 3TOZA 4XQCA 5CPBA 1LSSA 3PYMA 4ZRMA 1HZJA 1BTOA 4FOSA 2PY6A 3Q2IA 4K28A 4ZJUA 3AI1A 1P45A 4WUVA 1V6AA 3AUSA 3ETDA 4KUHA 1CYDA 1F14A 1XU7A 1CQJA 3PXXA 4XRRA 4GSLA 2GLXA 4DIBA 2BI7A 4E13A 1K89A 3HG7A 5TSDA 3CMMA 5HTOA 2ZCVA 4MKXA 2WWRA 1T24A 3AU9A 5AXCA 4BNJA 1O8CA 1B16A 3B1FA 4OQZA 3F1KA 5L45A 3UCEA 1XKQA 5IN4A 2C29D 3MJCA 1XA0A 2Q2VA 1PJLA 1QLJA 2C2XA 1JAXA 2V6GA 3F1LA 3HN2A 1O5IA 2VRCA 4LK3A 3WGTA 1SB9A 3AFMA 4J1NA 2C07A 3ASVA 2OXIA 3DAGA 1I3KA 2J5KA 2JD0A 4ALMA 1M6HA 3DMTC 1YO6A 3VPFA 4GQAA 5TGDA 4MIEA 1DIHA 5TQVA 4W6ZA 1JVBA 2A35A 1AGNA 2VNAA 4QO7A 2NTJA 4CM4B 3R1IA 4U8GA 1R37A 2RCYA 4YAIA 4A10A 3NT4A 3RAJA 4ND4A 3PP8A 4IJUA 1IPFA 2PH3A 4GLLA 2YZ7A 1E1KA 3ROMA 4WOJA 2AE2A 4KQXA 4L9RA 2WD7B 1RYEA 1ZIDA 1ZMTA 2HJSA 4X54A 3WXBA 1R0KA 1VL8A 4FGSA 1VSVA 2P5YA 3KB6A 2PZLA 4YACA 3KSDO 3A1NA 3ABIA 3KLMX 3NDJA 1GPDG 2Z1NA 2QRJA 4W7IA 3O26A 3V1YA 1PGQA 1YQDA 3VVCA 4BB5A 1HDCA 1YBAA 3T4XA 1GY8A 4A7PA 3A4VA 5KIAA 3WX0A 1ORRA 3K9QO 4XJSA 4N7RA 2E6UX 1ZNQO 3JQ8A 3ORFA 4CLRB 2YW9A 3PYLA 4TKLA 4U7WA 4AJLA 4WPGA 2J3HA 1EUDA 4ALJA 3G17A 1C0IA 3VH1A 1NAHA 4JP2A 2NTVA 2X9NA 3KYDA 2D0IA 2X7HA 4EUFA 2QZZA 4PG4A 4IZHA 3ZZNA 2I67A 1E3WA 3EYWA 4CV1A 4GLOA 1IPEA 2VYVA 4CM8B 2Y1OA 5JC8A 4MVJA 4XKJA 1WLYA 4IPTA 2R00A 4QUKA 3L07A 3RC2A 4FIZA 1KEVA 4ROSA 1PJTA 4Q39A 3WDSA 5BSHA 3OECA 3VH4A 1E1LA 4CR6A 3F3SA 5DF1A 4W7HA 5KNLA 1T2CA 1H9BA 4BKUA 1C1DA 4NU6A 1SO8A 1JN0A 2V65A 4WEOA 2JAHA 1MG5A 3GVHA 3NDIA 3SC6A 4R54A 2QG4A 1Y1PA 4Z0HO 1NPYA 1G6KA 3NX4A 1PJCA 2PNFA 5H82A 1YH3A 3GHYA 4O0LA 3SVTA 1P1FA 1VE9A 3ONDA 4NZ9A 1HLDA 3Q1LA 4Q3NA 2FZWA 4U6QA 3WYEA 3GZNA 1TA4A 3I52A 3JYNA 2FMUA 2RBEA 1IUKA 1EFKA 4JJIA 5A04A 1LSJA 3LK7A 5H81A 2NLOA 3KXDA 1ENZA 1LDBA 4AICA 1WWKA 5ITWA 3I9JA 3LF1A 3OFSA 5TIIA 3FN4A 1VKOA 4F45A 3BAZA 5CEFA 4ZA2A 5H83A 1NTOA 1ISGA 4NJMB 2D8AA 4HFRA 3GMDA 2XF8A 1Z6ZA 2W90A 2BHLA 4J4HA 1V0JA 3GPIA 4LW8A 1BG6A 1UXIA 5TX7A 4NU5A 2GN9A 5KKAA 3HHPA 3PK0A 3HFGA 5K0ZA 1ISFA 1XIVA 1C3VA 3ZWMA 2I65A 1E3EA 3SLKA 1FK8A 3KSUA 2B4TO 1ZK4A 3E5MA 3K6JA 1RKXA 4J16A 4Q3BA 3ZU3A 3SC4A 1C14A 3JYQA 4R9SA 3X2FA 5A1TA 4M54A 5BSFA 3ZHYA 1P74A 3RWBA 4BKRA 2EW8A 4CM7A 4BO5A 4YT5A 4BHTA 3JQBC 1YVEI 1UDCA 2LDBA 2NU6A 1KEUA 3O9ZA 3B70A 4DBVO 4Z9FA 3X2EA 5ITVA 3ICPA 4DLBA 2GZ2A 2LDXA 3E03A 3K5PA 4CM4A 1GUFA 1N1EA 3S2FA 2X0RA 5FF9A 3FWNA 4D0RA 2HJRA 2JFFA 1E7RA 1YKFA 1K6IA 2X1HA 2EF1A 3IP3A 4ND3A 4CL3A 3E1KA 4YQYA 2WD7A 4BNNA 1QMGA 1LNQA 4R16A 3RUAA 1ADBA 3KVOA 1MGOA 1ZKMA 3E8XA 1DIGA 1OI7A 1TT5B 2VTEA 1U28A 3IAHA 5T8KA 3TDKA 3OEWA 3RUDA 4DGSA 3WQSB 4IJVA 1KOLA 3QWBA 3F47A 4RF2A 1P0CA 1DO8A 1NFQA 4MKRA 3JQFC 4CLRA 2F1KA 1YBMA 4J1QA 5GZ6A 3C85A 5L4LA 2Y99A 4IY1A 1B15A 3EK2A 5G0SA 4CMGA 4WLNA 1AHHA 4RVSA 4OXKA 1H93A 3VTZA 3F5SA 4MINA 1XQ6A 3ROQA 1YQXA 3EHEA 2VHYA 3K2EA 1PZEA 3GT0A 5JCJA 3WGHA 4CM8A 4EGFA 3ZU4A 2POQX 2YFQA 3AM5A 3GEMA 3TF5A 2V6BA 3PVZA 4HUJA 1J49A 1OOEA 3K73O 1J5PA 4XQEA 4PLPA 3JD0A 3HDYA 4KQWA 4NBWA 5JYDA 4R68A 1QXSA 5JW6A 4DPLA 4OOEA 3FD8A 4O59O 4MP3A 1WPQA 4G5HA 4E5NA 4RORA 3FBTA 4MIOA 3AFNA 4WLVA 1U8FO 3CH6A 4IDCA 3ZHXA 4OAQA 5K6AC 2E4AA 4HX5A 4LSWA 5HM8A 3E48A 2GDZA 3EDMA 3LC7O 2OHXA 4L4RA 3QIVA 3DWFA 4U5QA 1GCUA 2D5AA 5TJHA 4IMPA 1O89A 2HMTA 3ANLA 3DO5A 4L8VA 3ZNNA 3JD1A 4EITA 1UP7A 2FOIA 2EP7A 2X8LA 4FBGA 1GCOA 4FFRA 4CV0A 5BNTA 2NU9A 2WYVA 3P7MA 1EK6A 4Y9DA 6ADHA 1N7GA 2W8ZA 4Z9YA 4UUNA 3R0IA 1KETA 1U3TA 1H6CA 1ENOA 3U4CA 4NJMA 2FHSA 4NG5A 3ZW8A 1ZSNA 3AJRA 2EJWA 3RUEA 4Z0TA 4L75A 4XQGA 2HMWA 1Z74A 1UAYA 5COBA 4YBZA 2H63A 4BKPA 4DLLA 4YB8A 1HEUA 3PGJA 4HFJA 3H2SA 4CV2A 3JV7A 1X1EA 4JROA 1T4DA 1IZ9A 1H5QA 3HDQA 3S55A 1I3NA 1E77A 4L73A 2FSVA 2GN4A 4GMFA 4BNHA 1NWCA 3OQBA 4UUMA 2CDBA 1ZCJA 2BI8A 2DUWA 3MCVA 1DLIA 4IS3A 5B1YA 1NR1A 1I10A 4E0BA 2YDXA 4NH4A 3WGOA 4DXHA 1QRRA 4HWKA 3NJ8A 5DP2A 4HBGA 1LDNA 4I8XA 2BGKA 1U2GA 5JMWA 4A2CA 5JAQA 4IXWA 4PLCA 1LDYA 3EAGA 5LC1A 4RLSA 1LBEA 1U7HA 2PGDA 2PA3A 1Q0LA 3UN1A 3LSYA 1T1SA 2NTNA 4BNKA 1GEEA 3EZYA 3OMLA 3D4OA 4IM7A 4PGFA 3H7AA 4YJGB 4DWVA 2VHXA 3BTVA 1R0LA 1SEPA 1KC3A 4TRRA 1XG5A 1FDUA 3RBZA 4FD3A 4XJTA 4MKZA 4DC1A 4MIYA 2VCYA 1VRWA 4P4GA 2ZK7A 4R1TA 5CPFA 4BGEA 2J5RA 4QECA 4YJDA 5KTKA 4NMHA 1LQTA 2WE8A 2EKPA 3QP9A 2WYUA 4XD2A 1UXKA 5B12A 1T2FA 3PI7A 4FDAA 1L1FA 4E5KA 3CIFA 1YBVA 5TNXA 1YGYA 2IYOA 1KC1A 4E2WA 2ZJ1A 4YR9A 2JCVA 1XCBA 2Q2WA 1YONA 2PZKA 3BIOA 4S3MA 2IE0A 3NJ4A 2H5LA 3I4FA 1N8KA 2IZ0A 3UICA 5CDGA 1XQ1A 4YRDA 3W8DA 4ZN6A 1HDRA 1ADCA 1GYRA 3P19A 4BO9A 4PRLA 3LLSA 5BSEA 3W8FA 1MV8A 2G0TA 5I9NA 5L4SA 1AHIA 3GR6A 1PWXA 4OKNA 2OO5A 3KSZO 1W73A 2D5CA 5A4DA 4I5FA 4J2HA 1A71A 4YWJA 1L7EA 3PIDA 5CDTA 3FNHA 1P1RA 1VSUA 4YTEA 3HE3A 1JAYA 4XQ9A 1NFRA 2AXQA 3GGGA 3NGLA 3FNGA 2IXBA 3I9OA 2I3AA 1R0SA 3G79A 1WMAA 4AJ4A 1U3VA 3BHIA 5A3VA 3D4NA 2CVOA 1WP4A 2B5VA 5KKCA 1EK5A 5A5EA 4CMIB 4D42A 3G49A 1SB8A 1E6EA 3GC6A 4JBIA 2VOJA 3EVTA 4UVEA 3BYZA 2O3QA 4TZTA 4GPD1 3L4BC 5COAA 3SEFA 4BO8A 3JD3A 3W4KA 4JLWA 3E82A 4OO3A 3HDJA 3PHIA 1ULUA 4PCVA 1IHYA 1TLTA 1I0ZA 4I9NA 5AXBA 4GX2A 4M49A 4RPGA 4LN1A 5ICSA 3U4DA 2G17A 1BHSA 5THQA 4KDEA 1HSZA 4A27A 2X0NA 2Y66A 3L0DA 5DCYA 2C5AA 3WTBA 4YXFA 3QSGA 1VJ0A 3OJEA 5ILGA 5ER9A 4R3NA 5BQFA 1SBYA 1X15A 3ZNPA 3DZIA 1W0CA 1E1NA 1P0FA 1V3UA 3C7AA 3RSHA 2BFPA 4MOWA 2PD6A 2J3JA 3DL2A 4YAJA 5FI3A 1ZVMA 3V2HA 3I1JA 4CM5A 3W6ZA 3W4JA 4XIYA 3D3EA 3QWAA 1ZZEA 3SXPA 4PZEA 4YAEA 5MDHA 3ONEA 1LI4A 2BH9A 4MJLA 1UXHA 2Q4BA 3CSDA 5DULA 3VZRA 3VZPA 1X1TA 2PK3A 1VL6A 1R6DA 2VZ8A 4HY3A 2EV9A 1T1RA 3JQAD 1ZO8A 5T57A 2I5PO 2FN7A 3UW3A 2PKQP 1Q7BA 2TMGA 3ADPA 3LF2A 3C1AA 3C8MA 3UHAA 5IZCA 1IHXA 2IDZA 4A5OA 4YT4A 2WD8A 2ZB7A 5A5FA 2CSUA 3KYCB 3MJVA 1RJWA 3U49A 3MOIA 5JDCC 4CLXA 1QSGA 5CEJA 4IJKA 3DZHA 4YJGA 1HKUA 3MZ0A 1LTHR 2GZ1A 4DRYA 4DQVA 3VDRA 3AWDA 3RBXA 1QV7A 4BKQA 3I6QA 3B6ZA 8ADHA 3OIDA 4GAEA 4MVJF 5J23A 4S1VA 4JCOA 3WICA 1Z7EA 1JWBB 3GG9A 3WS7A 1SOVA 5B4UA 4J0EA 4WNIA 3M2PA 3GDOA 4FW8A 4LGVA 3RUIA 4BKOA 2WTBA 4AJ2A 2EEZA 4DMLA 4E33A 1WXDA 1LRKA 4C7JA 3DTYA 1MUUA 1B8UA 3K2BA 3PHJA 1DFHA 4JP3A 2YDYA 2ZYGA 4MVJE 5B4TA 2IZZA 4B4OA 4NBRA 4AJJA 4RO0A 2P9GA 2Y93A 3PTZA 4EZBA 4ZD6A 4OXNA 1DFIA 1QR6A 2PGLA 5IFLA 3WYCA 4O5OA 4D41A 5A9SB 4R51A 3PWSA 5THKA 3ZWBA 5JY1A 3RFTA 1PQUA 1CERA 3DDNA 5EQFA 2Y0CA 5DP1A 4ZQBA 1ISIA 4PLYA 4QO8A 2V6MA 4NJOA 1YB5A 1IULA 3DOOA 2A9FA 2OMEA 2ZB3A 3MJEA 3RU7A 2EGGA 4XYBA 4NK4A 4E3ZA 4E21A 4YYZA 1HDZA 2ZQYA 3BTSA 1PJBA 3LT1A 4B3JA 1NP3A 4JIGA 2Y1DA 4GX5A 1YJQA 2QRLA 4EUEA 1UZLA 2FPPA 2ZKLA 2ZTMA 1VKNA 3NDRA 4K26A 1ZJZA 3HB4X 4IMRA 3GVPA 3Q0EA 4CUZA 4CMIA 4E2YA 5CDSA 3AI3A 3AI2A 4RZHA 1G0NA 1H6AA 3QVOA 5JBIA 2B5WA 2DTEA 5HBRA 1EQUA 2HRZA 1I3LA 3DR3A 2YV3A 3NAQA 1PL7A 3WLEA 2EKQA 3BHMA 1HDOA 3H8VA 4BNUA 1AE1A 4QFDA 1K3TA 4GBJA 4MDHA 3U09A 4M87A 2XAAA 3DBRA 1X7GA 3GPDG 1J0XO 4A26A 2B0JA 5ER6A 4XB2A 4J7UA 4Z6KA 3ICCA 3N74A 5COQA 3OH8A 4G81A 1MXFA 2DUUA 2EXXA 4DQUA 3GGPA 3KZVA 3VTFA 4QFCA 2CZCA 3EC7A 3WQRA 4DIFA 4XGNA 4B8WA 3DBHB 5TF4A 4EI2A 2VZ9A 2EIHA 1WDKA 3NYWA 5CHEA 3Q9NA 3GNQA 4ID9A 3QE3A 4M1QA 4BOYA 5JCXA 1LC3A 4FSHA 3R6DA 3LDHA 3S2GA 3AOGA 4I5EA 5DDIP 1O6ZA 2YHIB 4BNLA 1HXHA 3U0BA 4BMVA 4E2ZA 4R69A 3RKUA 4LVCA 4O1MA 3LT4A 1UXGA 2X5OA 3PWZA 3GQVA 3N58A 1NM5A 2O4UX 3GDFA 3TWOA 5L4NA 3MOGA 1IE3A 1YWGO 2EW2A 1GV0A 3DOCA 1DIBA 2VHZA 3HADA 3OETA 2Y67A 5JO0A 3KYCA 5DBIA 3T7EA 4CMHA 1MX3A 2CUKA 2XXJA 2CDAA 3G1TA 1XYGA 2C7VA 1VM6A 3WSVA 3ZWCA 1A4UA 1Q2XA 2VOEA 4XIJA 2VQ3A 5IDYA 3FF4A 4CR7A 1HTBA 3EY4A 4ALNA 1GUYA 1Q7CA 2NNLD 5KCZA 1I8TA 2R2GA 1ISJA 2BLLA 1EBUA 4WECA 2B83A 1UJMA 1BSVA 1QKIA 4AJIA 4N54A 5A02A 3MJTA 5U4QA 4WLOA 4R4JA 5C5IA 5KJFA 1DPGA 3K8ZA 1HDGO 4NFHA 2AHRA 4PVCA 5FWNA 1XWFA 2QX7A 2Q45A 3T4EA 2JD1A 3O8QB 3OJLA 3U3XA 1PU2A 3GUCA 1DJNA 2WDZA 9LDBA 3WLFA 5JS6A 3GA0A 3CZRA 4W82A 1F17A 2NWQA 2VRBA 1QV6A 4CPDA 1I5RA 1W4ZA 1XU9A 2UVDA 2UV8A 3OQ1A 5A9SA 5IXYA 3VPSA 4RLHA 3ZDFA 1AUPA 1DHTA 4NR0A 4WCFC 1H0KA 4KTTE 3VPHA 2IXAA 3KOUA 1KVSA 3DHNA 3C24A 4AJNA 1B26A 3ZV6A 3QVXA 2FZEA 4RZIA 2VRCD 1UH5A 1VLLA 2GGSA 3RVDA 1D1TA 1Q0HA 1D3AA 2DBZA 2RH4A 4JK3A 4TRNA 1Y9AA 4E12A 3OHSX 2O7SA 3TZ6A 3KTDA 1EZ4A 1P1HA 1OAAA 4F6LA 2VUSA 4HNHA 1MG0A 1L7DA 1N5DA 2O3SA 1SMKA 1TB4A 1U3WA 4O6VA 1YDEA 2GERA 1S7CA 4FC7A 1JTVA 3C1OA 1ZK1A 3AW9A 2VNSA 3N7UA 4JBHA 4UVDA 4UVGA 1OFGA 2QYTA 4G2NA 1J6UA 2OGUA 2ZATA 1GEGA 3RC1A 1G0OA 4UUOA 5BSGA 4DYVA 3GDGA 4D43A 3PLNA 4DPKA 2UYYA 3AY6A 3KUXA 3IJRA 4B7XA 1PTJA 1LQUA 1JLLA 4GVLA 1ML3A 1ONPA 2CFCA 4CMEC 3RUFA 4MVJG 1ISMA 1MXHA 4AJPA 3R3SA 1LXCA 3AK4A 3V2UA 1OBFO 1O9BA 4OGWA 1KVQA 1XEAA 2ZYDA 5GZ1A 4KUEA 1ZBQA 3W8EA 1DIRA 5FYDA 3OJOA 4XDZA 2DBQA 5I7FA 4JX8A 4Z0PA 2YJZA 4JXKA 1CJCA 4RGBA 2Z1MA 1PIWA 3H65A 2Z95A 1M75A 3FNEA 3NEPX 3DBHA 4GX0A 4I1IA 5AOVA 5JPIA 4CLHA 1FDVA 3RD5A 4LVUA 3JD2A 4UVIA 5I7SA 3JYOA 4CM1A 1I33A 1YL5A 3VKUA 4YQZA 4W99A 2UUPA 5IZ4A 2VYVD 3IKTA 2GASA 1Z75A 2VT2A 4MVJD 2YHIA 4DBZA 1Q7GA 3L4BA 5BNFA 1I36A 3UH1A 1YRLA 2C59A 1YS4A 2DU8A 3HFSA 2RIRA 3TZCA 5TJ9A 4EBFA 2BRUA 3PHLA 1G1AA 4P38A 3DZGA 1E7MA 4K9DA 1KEWA 1PX0A 2Q50A 4IDFA 4YJHA 4W9NC 1F0YA 2W4QA 4LMRA 1GPJA 1N1GA 4NHEA 4PLFA 3PEFA 5AXDA 3RIHA 4IDBA 2B4QA 1UDBA 4BV9A 1CIVA 1EE2A 3F6YA 4D3FA 3CINA 3DZKA 4BB6A 5A05A 1WDMA 4YT2A 3VHRA 1DRUA 1PZFA 2FRDA 4ALIA 4TVBA 1DC3A 3ADOA 2HK9A 3L77A 1GU7A 3KEQA 3STHA 4P22A 2FPGA 3LLVA 2ZCUA 2P5UA 3PJDA 1NQ5A 2F00A 2WSBA 1KBZA 4PLWA 1HYEA 3MWDB 4KTVE 4OL9A 4FC6A 1P1KA 5ENVA 1GD1O 3SBOA 3ITDA 1C0LA 2GRAA 1DAOA 3WTCA 2YV1A 1DEHA 3K92A 1PL8A 3Q9UA 3O8QA 3ZCXA 4H3VA 4AJKA 1E5LA 1I01A 2NVBA 4FB5A 2W98A 2H6EA 4K6FA 5TS3A 5I7EA 4FJ1A 1P44A 1QORA 2OZPA 3NKLA 1U8XX 2VHVA 5KJ6A 4BGIA 1C1XA 1JW9B 1E6UA 5AYVA 1S6YA 4M8SA 1A27A 4GKBA 1QYWA 2HKIA 3DAPA 2P68A 1RM3A 3D3WB 3OICA 1HETA 2HSDA 5BNIA 1C0KA 3B1JA 4WKGA 1I30A 5EL0A 3D5QA 3GLQA 1PGNA 2RHCA 3ENKA 1FXSA 3H2ZA 5EJ2A 1VPDA 2J6IA 4H16A 1LLDA 4BO7A 4N5MA 2X9VA 2YFHA 3L4SO 4TVOA 3BMNB 3JQ9C 1YE3A 1PQPA 4BIIA 2AEMA 4FOOA 4HP8A 4PLVA 5K9ZA 4ZQFA 4YA6A 1H9AA 1X7HA 4K1LA 1GUZA 4K6CA 3BMOB 4P4LA 1MA0A 1XDWA 4RQTA 1CWUA 3F9IA 3NT5A 3GGOA 4NQZA 1ENPA 1T25A 3GVIA 3H9JA 3BMQB 5DCWA 3DFZA 1F8GA 1R4MB 2HLPA 4MVJH 2C0CA 1ZMOA 4Z3DA 1JDJA 1KVRA 1VC2A 3E9MA 3JQ7A 2PTGA 3AOEA 1T26A 4DLAA 4NFSA 3UVEA 3PPIA 4AJHA 4ONEA 3GY0A 1XSEA 4L76A 4WCFB 3OJFA 4XR4A 4XRGA 2FY8A 2O3JA 2IYPA 3A14A 1SPXA 1F06A 2CD9A 3GNSA 3K30A 1B3BA 4J9VA 3I9MA 3JSAA 3P5SA 4DVJA 1JKJA 4R41A 5KJEA 4DC0A 5U9CA 1T4BA 2GUGA 4LRTB 3EZLA 3ZHZA 2O3UA 3HWRA 1BGVA 2EJVA 1X0VA 3COSA 2JJYA 2ET6A 1R12A 3S2EA 4BNTA 4KOAA 1WZIA 2RAFA 1GQYA 3ZWYA 4FFMA 4RV9A 1LLCA 5JXWA 2GSDA 1E6WA 2YUTA 3OA2A 3ROKA 2OFPA 3DTTA 5JCJD 1EUCA 1DXYA 1Y5RA 1HE5A 2QZ9A 4HXYA 1LDMA 3GVCA 4RF3A 3OSUA 3QA9A 4I08A 2EP5A 4Q9NA 4B79A 3AUTA 4CM3A 1R16A 2TMDA 3TRIA 5IG2A 2DPGA 1ZSVA 1LUAA 1Y7TA 2O2YA 3IOYA 1BXKA 1B3RA 1M6WA 3OP4A 3W4IA 1HRDA 4DYDA 3OEYA 3ROPA 2HAEA 1HWYA 2OOSA 2BD0A 5LDGA 3WBBA 2B36A 1PR9A 1YDWA 5KVSA 3QV1A 2A4KA 3GFBA 3INTA 4RF4A 1QYDA 4EJ6A 5IF3A 1YB4A 3IP1A 2OBYA 2B69A 2PR2A 1E0DA 4FJ2A 4UULA 3E6AA 1LC0A 4Y6RA 1IZ0A 1Z7BA 1X14A 1NNUA 4J3FA 5JAZA 3C7DB 2CMDA 1H6DA 2NACA 4EYEA 3RCBA 2ILTA 5ADHA 2PH5A 1XR3A 5FEUA 3DMTA 1PS0A 4LCEA 3PZRA 4NK5A 4PZCA 4WASA 4OHUA 4HFNA 4XYMA 3H6KA 1E1MA 5CDYA 3O4RA 4L4XA 1KYQA 4PG5A 4IQGA 2Q1UA 1VJTA 1CEQA 1TT7A 3CEAA 2YQ4A 3DBVO 1IY8A 4OQYA 1EFLA 3Q11A 4BVAA 1UXJA 4PIVA 1A72A 4M86A 2VWPA 2O3TA 1R15A 1ZK3A 1F8FA 4IBOA 4TZKA 4LISA 2AEJA 2QQ5A 3W1VA 5C7IO 2O50A 4CQLA 1GDHA 3H3FA 3LYLA 3EUWA 3AY7A 3VZSA 1LSOA 1D7OA 3D3WA 2X5KO 4E5MA 2AQHA 5I9LA 3ST7A 4BNGA 4HV4A 3SLGA 3PQEA 5IJZA 4FCCA 3RJ9A 4EW6A 4D0SA 3VDQA 3TZKA 2HU2A 3WJAA 3U5TA 4XCVA 1A5ZA 3BMNA 4JBGA 3EVNA 3ZNQA 2PZJA 3GFGA 4BL5A 5TLSA 1BDMA 1V3VA 3RASA 2NUAA 4E6PA 2NVUB 5G0VA 3KV3O 2WMDA 3BMOA 4YVFA 5F1OA 3JQEA 2JCYA 1XELA 4LRSB 3Q2KA 1TEHA 3UXYA 3BMQA 4UVHA 4CUKA 5AQ1A 1R4MA 3LT0A 3ULKA 2FR0A 1PZGA 3BHJA 1WMBA 3CTMA 3IMFA 4RVHA 1LRJA 3TZHA 1QG6A 4XA8A 1PJ4A 3TPCA 1A7KA 1V35A 3GEDA 3OQ6A 2Y68A 4E4YA 1H2HA 4WCFA 2HDHA 2OP1A 1NX6A 2NSDA 2GZ3A 3ZNOA 3A28A 3UKOA 3DZJA 2O23A 4WK6A 3BTOA 2VYNA 4RF5A 5T67A 1UDAA 3DBRB 3ZU2A 3VH2A 5L40A 3VOSA 3PZBA 4MVJP 3ZH2A 1UP6A 4AJEA 2DC1A 1SZJG 4EJ0A 3I9LA 1CDOA 3H9EO 4PVDA 5EINA 1LA2A 4XDYA 4RPLA 4RPKA 4R3WA 3FHLA 5B37A 6LDHA 4JN6B 3KETA 3DC2A 1JU9A 2VUUA 3W6UA 5DOVA 3MJ4A 3E5RA 4GH5A 1U7TA 3DXFA 1GR0A 2O2SA 2QRKA 2Z5LA 4Q3EA 4IJWA 4KDFA 4CQMA 2YYYA 4FPXA 3DHEA 3QY9A 5L9AA 3MTGA 2UAGA 1UP4A 4MP6A 3LQFA 2OBNA 2Y0EA 3BXXA 4U0JA 1K6JA 5DOZA 1H94A 3JD4A 3H9UA 2EWMA 3PQDA 1E3IA 4RVGA 3M2TA 2JKVA 3G3EA 3WQQA 1PZHA 4BNXA 1ARZA 2B4RO 4BNMA 1ISHA 5G4LA 3L6DA 4ITUA 2ZTVA 4CM9A 2PKRA 4R5MA 4BO1A 1IL0A 2P9CA 3OIFA 4PFJA 3HUDA 5JY6A 2C82A 3DB2A 2OP0A 3DHYA 5GZ3A 1GYPA 2HK8A 1KERA 2NVWA 1U2DA 2WJPA 4F6CA 4J43A 4EEXA 2O48X 4L74A 4DPMA 1ZJYA 2D2IA 2G76A 2E37A 3ASUA 2P91A 1PSDA 5IXSA 4TQGA 3VVBA 4OSPA 1PWZA 3TZQA 5C3MA 2NU8A 3I4CA 4IUYA 5JFOA 1BDBA 2DBVO 2CVZA 2P4HX 1YQGA 3UCXA 3PYXA 1PGPA 3V1UA 3RQSA 3ZV3A 1KVTA 3JQBA 2VYND 2AG8A 2W2LA 1T2EA 1V8BA 4ND5A 5L7WA 1RWBA 3Q3CA 4R1SA 3S1LA 1LLUA 4W9NA 5JYEA 1DB3A 1UAGA 1DC5A 1ZEMA 2Q99A 4P4NA 3WGZA 4NBTA 3IC5A 3HJAA 1M2WA 5F1PA 3I5MA 3ZHBA 1JWAB 2GD1O 3HNPA 4EDFA 5A03A 2G1UA 4KWHA 1O0SA 3KBOA 1D8AA 1XHLA 2DAPA 3QWFA 1IYZA 4II3A 4EJMA 1PGJA 1TXGA 4FFNA 3A06A 4JGBA 4D45A 4IGFA 1B8PA 3KHUA 5DZSA 4ZRNA 3NTRA 4H7PA 1J4AA 4I5GA 1TVEA 1W6UA 1E3JA 1ZK0A 2X9GA 3DBLA 1A9ZA 2HRBA 5EQDA 4EUHA 1ID1A 5CDUA 4QEDA 5CG2A 3PJEA 5MGBA 3TNLA 3FBGA 1H2BA 4ZQGA 4MP8A 4GKVA 3UCFA 1GZ6A 3OIGA 1GZ4A 4J49A 2NVUA 1EBFA 1R4NA 3AU8A 3LC1O 5BR7A 2AE1A 1GAEO 1FMCA 3JQFA 4YAGA 4IDGA 3FCOA 3Q6IA 3QVWA 3T7CA 3ITKA 1RM4A 4FFLA 4CR8A 4DUPA 3H4VA 3D1LA 3WMXA 3BMCA 3WFJA 1N2SA 3JQCA 4IQ8A 3RFXA 1PS9A 1V9LA 3H3JA 3WWZA 5JC1A 1IB6A 1P77A 4LMPA 1NPTO 1NQTA 3KRTA 4OOFA 4R1NA 2D59A 3QW2A 4I9UA 5EERA 4CJXA 5ES3A 2VUTA 1YOVB 1O95A 4WLEA 2YQ5A 3WWYA 1JKIA 2OL4A 4DL9A 3GOHA 5IDWA 4GWGA 2B37A 5F21A 2O4CA 4YEDA 4ALKA 3FRJA 1DAPA 1EUZA 3TJRA 2W2LD 4BV8A 3UOGA 2WE7A 9LDTA 5KJ1A 3TQHA 4TMFA 4PG6A 1YL7A 3VKVA 4RL6A 5K6AA 2PD3A 1BMDA 2NU7A 1ULSA 5DBGA 5F5LA 4BO2A 1HSOA 4UEOA 2JFGA 1VI2A 3QRWA 2OUIA 4L4SA 1U5CA 2X4GA 3AM3A 4J6FA 4QSMA 3OBBA 1JA9A 4IZIA 3E9NA 2V7PA 1HE2A 1P33A 4R01A
chains in the Genus database with same CATH superfamily
2R5NA 4RJTA 1I2BA 3NIWA 3T3GA 2I6TA 1K5HA 2JL1A 2PRZA 2VDNB 3GYBA 2HNKA 1NVVQ 2XKAA 3C7CB 5LYJA 2G83A 3X1YA 1D2EA 3X2SA 1ZFNA 1LBIA 2WJ4A 2ZZKA 3QU4A 4TKMA 4DJJA 3GJ6A 5TB5A 1JG7A 2EFGA 2ZBDA 3BDIA 1XTQA 2A0XA 1Z5PA 2P77A 3GAZA 4TQAA 4BNVA 3ZJTA 2QUKA 4DF3A 3ZXXA 5ERXA 5D87A 5TMPA 1QVZA 2GFQA 3D1JA 2QPAA 3WK5A 4NYIQ 1ULZA 2BY4A 2PKEA 3NTUA 3GN2A 3W2EA 3IKLA 1L4NA 3A3OA 1WKBA 4OGKA 3RF7A 2BCEA 3ZWWA 3EX7C 4NNJA 4IH9A 1CEXA 4CIWA 3KHTA 1H8HA 4I50F 2ZIZA 4ML3A 4MSUA 4J7XA 5EI5A 3TIIA 4B8ZA 1DRWA 3G0IA 5MN4A 3FUCA 2FWBA 1Z6AA 3OF2A 4XZ3A 1SQ5A 2FWMX 4Q4LA 1SCAA 1Y6JA 5FAKA 2IU3A 1G8FA 2ATVA 2VF4X 5IP5A 3V1TC 1WZEA 3R77A 2OC4A 1U63A 4JVSB 2B0CA 1C7EA 1DEXA 1JI3A 1K4MA 2GD6A 4TMYA 4A6XA 5JALA 2H31A 1W8DA 2WA1A 4GD3Q 4UTXA 3ZD8A 4JVNA 4DT1B 1WBDA 4BJ6A 1E7WA 4C06A 3K9HA 1CY7A 1ULAA 3IQEA 3ERCA 1P9LA 3DE7X 4YMGA 2OO5C 5IDQA 2QJRA 3PFBA 2O14A 2QAIA 5JNLA 3EBOA 3MFQA 4RIEA 5H9WA 3AVXA 1ZPDA 2NQ8A 4OFXA 4IV0A 4H7HA 1UBTS 2DOKA 2FLKA 1W0JD 2X0IA 3A1FA 4PX2A 5L95A 1NF2A 2IY9A 1Z08A 2PR7A 4ZKEA 1ZUIA 4AJOA 4COKA 2C96A 5IKEA 3RAEC 1AK1A 2CK3A 3QNWA 1F0PA 2VFAA 4YP0A 1CJKC 2WAOA 5FUQA 4UVEA 4I3FA 1SIWA 1AMNA 4Z0NA 3DTVD 2VDQB 3Q87B 2BV3A 3LPDA 3FLAA 4IIUA 4KKVA 4N5LA 2OG2A 2ZRJA 4M1WA 1W59A 3VZQA 3ZHUA 2J45A 4CWAA 1XMJA 2QN1A 5DCUA 3B3FA 3KAQA 5TMDA 2WJGA 4B71A 2GFHA 2LZ0A 4O08A 1XALA 2W2OA 5CJPA 3SS8A 1FVHA 1LW6E 3ZWNA 4UMEA 3EDOA 1Z5WA 2G06A 4IVPA 5GONF 1CE8A 1ZOLA 1VMKA 4RK7A 2MR6A 2WZBA 4FYPA 4Z1OA 2HRDA 4LY3A 2V3VA 4Z4EA 1SUIA 5JAIA 2A9JA 3SYMA 3H2BA 4B75A 1RYNA 2FV8A 2IELA 1SCNE 4JVOA 3UWSA 4U5XA 2M6KA 2D5IA 1U3GA 4KXVA 1ODJA 1NYTA 4RD6A 5CT9A 1LVGA 3Q5GA 3HDTA 1F38A 2ZAGA 4FNAA 2DRIA 4QFBA 4JASB 1ECBA 3DHWC 2PUTA 4KU4A 3S6JA 1Y5LA 4BC0A 1PF7E 1ZC4A 2WAAA 3KBBA 2C3OA 2NO1A 2D74A 3EPKA 4U9HS 3KB1A 1A4IA 3RIXA 5IAJA 1V16B 2O1WA 5B7QA 2FUEA 4Y6SA 4P86A 3CW9A 1XBTA 2FQWA 3ANNA 4POOA 3GRKA 3HY4A 4TYMA 4I0WB 2Q21A 5IH7A 4K86A 3SIWA 3EDQA 3D64A 1SOWA 1L0BA 2P9HA 5AUQA 4P81A 4XB6B 2MSKA 4IIHA 4NZMA 5DNAA 1KGDA 2GHQA 2IOFK 4IVNA 4LG1A 4RHEA 4Y2SA 5FTKA 3B1YA 5K0JA 3L6OO 1LF0A 1OXMA 1FTWA 2ZE6A 2RONA 2XMQA 3ZWDA 2YXPX 4LA4A 5I3CA 2AG0A 4JSTA 5J1SB 3U4QB 4A0GA 3HSSA 4OX9B 1JR3E 7MDHA 2K5UA 2WPNA 2J9XB 2AJTA 3WGYA 5SV2A 2O3RA 2A94A 2R8ZA 3T38A 2WYWA 4YP9A 1EGMB 2FPWA 2O8DA 1KS2A 3OQIB 4BE7B 2AF4C 3KYIB 3A1EA 3PIIA 1MQAA 3GLHE 4XUCA 4YLEA 4CI0B 1A96A 4BJ3A 4Z4CA 3DE3X 4EQ6A 3D7LA 3X1WA 1YI1A 1HE3A 2P3OA 5LB2A 1D1SA 4IV5A 1IQRA 4UPEA 2GYYA 2KBFA 1PJSA 1NYRA 3MTJA 4UFOA 5JCPA 4Q12A 3KJGA 3NVMB 4CCAA 4E5PA 2G0NA 2NZ8A 3ED5A 1TW3A 4TXNA 1RQLA 3RVLA 3WHKA 1MDBA 1RAHA 1WNFA 4M7PA 3HJHA 3V4ZA 1NC1A 3F46A 5LOVA 3QKSB 4XYGA 1BFKA 1MO5A 1N8SA 1TJ3A 2AFIA 1F1BA 2LWIA 2QJOA 3GLHB 1MC4A 1MX5A 2IQIA 2AN3A 3OPVA 1KP9A 2P79A 3GZ4A 3IVGA 4FR5A 5EAIA 1TQ8A 1RHKA 2VJYA 2ZRPA 4GYYA 1HC7A 3D7MA 3ESRA 4DQXA 2C4UA 4JENA 5AW8A 1HY3A 4ZO6A 2ZJ0A 1OMOA 3IT3A 2ZTUA 4PNEA 2OMKA 2VQEB 4N6OA 1BE1A 5DNVA 1Y8RB 1I3CA 5BQOA 2G67A 2H57A 3GELA 4P5PA 4R98A 3DGFC 5I9SA 2WKPA 3CCBA 3RRZA 2RH8A 4C08A 2I4MA 2XYQA 4KAAA 2FKNA 4OYRA 3QV2A 3ZXSA 4F92B 2PPVA 3UJ9A 3EISA 2JLZA 1VRCA 1TLFA 2PH7A 2PUFA 5D5HA 1U7OA 2WABA 3C3DA 4OLFA 4UBKA 5LMZA 2C7RA 1UT6A 4LYEA 4NABA 4WOBA 1DARA 4PG8A 4N5DA 1MO2A 2PG3A 4HDMB 4L15A 2BTOA 4PO1A 5GJCA 1ZA1A 3BCRA 5IN5A 3UJPA 3AHGA 1T1EA 2PKWA 4MWSA 1XMVA 1USGA 5ALWA 5FLKA 2FDCA 1SKAA 4J90A 2VPIA 4E5YA 2A5JA 3LUGA 3N05A 4BDTA 1I7DA 2DJ5A 4DCGA 1L5NA 2YYZA 3L40A 4G8JA 3GF4A 5ELMA 4EY4A 3IAXA 1PLKA 2JI8A 4OYYA 3CYFA 3AUUA 2WJ6A 4YJ2B 5EHXA 1KS9A 2SHKA 4JJ7A 4OP3A 2J4DA 4R9RA 2XT0A 1R0CA 2GRJA 2IPLA 2HQ1A 1FS5A 1RJFA 2ZBUA 3N76A 4Q24A 1X13A 5CIWA 3I5AA 3ZW9A 3SX2A 4CKEA 1CY6A 1KAMA 1AKQA 3GH3A 4HTAA 1E61A 1L9XA 1AK2A 2R6AA 3L93A 5IEBA 1WKVA 2E49A 3UUWA 3M1LA 4I7EA 2A84A 1VTKA 1EVKA 3KKPA 3CRVA 1Z2PX 3W5UA 5BMVF 3RUPA 2QX4A 1LDEA 3K3PA 4R9UC 1O94A 2MMGA 2ZWVA 4HH4A 4GP7A 3GIDA 1HDXA 3EGCA 3RU3A 1ZS9A 2VXYA 4M89A 4GL4A 3SVZA 2DVMA 1UT8A 4GDFA 2PX8A 4ZICA 3VUEA 4TWBA 5BWNA 2Q5QA 4MVJM 3EEFA 4PR0A 4RZQA 4XVHA 1DJMA 1A2OA 1KDYA 5K6TA 1ZXBA 3IQHX 3L7KA 3ZCVA 3GFQA 3GFPA 3DPUA 3OJWA 1FU8A 2I99A 1UZMA 3I30X 5L7TA 3T1TA 2FP4A 3JASB 2KI5A 3WAGA 2VZLA 4EKNB 1CQIB 3I1IA 1AKTA 2DPHA 2WFZA 3GD5A 2VJQA 4EM6A 1LLQA 5H3HA 3U56A 2PX0A 4NPCA 3K71B 1EVIA 1L3CA 1T5TA 4IQ0A 3NYRA 1I3MA 4ZVRA 4BO0A 2V54A 2QSJA 4MI9A 5BMVB 2IHNA 5ALKA 2PJRA 4I6JA 1QHNA 2PFSA 4PNPA 4NDAA 3ANXA 3I4LA 3L46A 1BWSA 1ZAKA 4U1RA 3B82A 1JP7A 4OK6A 1E58A 1VECA 1XZDA 1ZC3A 2JH9A 3SYLA 3INGA 4JEHA 1XPJA 3SHVA 3BFKA 3S2IA 2BKUA 3IHLA 3EH1A 1JG3A 1XRLA 3SDSA 3G9ZA 3ZE1B 5HE8A 2FE1A 4R71A 3BGDA 1KU0A 3QLUA 2A92A 3RI3A 4MO2A 2ZRAA 2GOYA 3S1SA 3E27A 1JSLA 2OVFA 2X2EA 1UKBA 1VGQA 3LUAA 3WA6A 2E82A 3C3MA 4ADSG 1KNQA 1Y42X 2FSSA 2JFQA 3FY4A 1UR5A 1OLSA 2JIPA 4D9CA 1S4MA 1Q0QA 5H5JA 3TH5A 3LFHA 4GO1A 3PR3A 1DAGA 2QXYA 3AY3A 4PC1A 3WRWA 3BSYA 4EHNA 4RKRA 5A4IS 1FZQA 1ZD3A 3MSXA 2RB4A 4QRHA 2XUIA 2Z83A 1V3TA 2CDNA 3JQDA 2BDUA 2P4QA 4C3ZA 1A4RA 1SVMA 4EB8A 1Z6GA 1CU1A 2F4NA 3GJXC 4HOYA 2I7CA 3S1AA 3B3QA 4EGCB 1E4OA 2IDKA 3HQ4O 2NT4A 1B4DA 4MYDA 4TSKA 5IMBA 3UV3A 4F7WA 3CO5A 4RQAA 4Q6WA 3IEUA 1TQ6A 2PWZA 3FSRA 4U2BA 4BXOA 1MC1A 4IUDS 1JMVA 2ZSHA 1QHHA 4OJTA 4ARUA 1SXJA 5CAEB 2W5UA 4BRWA 4PYRA 5MHTA 5EN4A 4FMCB 5DWDA 1HA3A 3AHCA 4D4LA 1LS1A 4MCHA 3R76A 2XCSB 1AX9A 2OLJA 1O4VA 5BRAA 3H2IA 3P9YA 1SU6A 1EFHA 4K9KA 3K70B 2QMZA 5P21A 3GCDA 3ND6A 5C1DA 4C2TA 4BFVA 1FPMA 1YSCA 2A8YA 2OV3A 2VN8A 3AKZA 4Q3DA 2XGJA 5HG0A 3R40A 1P2VA 1FDSA 1R9MA 5F7OA 2H0RA 2HC9A 3NASA 5HYVA 3RAFC 5G4KA 3FIUA 1MD9A 3AVOA 2C0PA 2O8EB 1U9JA 1U94A 2GETA 3CNOA 5ELLA 4GZMA 3PTAA 2I3GA 4C7KA 1GTSA 2ORIA 4UMDA 1HFWA 2ST1A 5IBCA 3U7EB 4RVUA 1E3TA 1U1EA 3QOXA 4Q4HB 1SEVA 4Z54A 4LCJA 3QFTA 3NFRA 1KE2A 1PHPA 4CLOB 1Z45A 4RCZA 4DUGD 1QYVA 5G53C 1W88B 3DTNA 4YJFB 4P83A 4Z9BA 1PJQA 1TGYA 3G59A 3ER9A 4XR9A 3NEAA 3R41A 4FQ7A 3OQVA 4GEKA 4RFSA 4MWGA 2BGLA 5BRJA 2FG7C 3QVUA 4RPJA 4REOA 3ZV7A 3AHJA 4EFNA 2Z6UA 3PJGA 3HV0A 1VJCA 5E2AA 1X8XA 1GTL1 4BMZA 4F5ZA 1FJHA 2R6DA 4POAA 1NQVA 1EFVB 1CIPA 4DNFA 1PQWA 2XMSA 1WJGA 1DIAA 2HCBA 3ZGYA 1K6XA 2BFBB 2O6LA 4B4VA 1QCYA 4CT5A 4ZJZA 2AEFA 2Q1TA 5CX1B 2FW6A 4YCAA 4U2CA 1OJLA 1R64A 4FHFA 4UE6A 3UUEA 4QBFA 1ZW1A 2AW5A 2H5EA 5EESA 2NZUG 4CMJA 5HRCA 3KE9A 4D46A 1BXGA 2CE7A 4YN3A 4YCSA 1N5MA 4UNNA 1H2ZA 1U6IA 2A67A 1USWA 5LCXA 3VC7A 1A9TA 2NTYC 1WW2A 1CVLA 2ZANA 1LGYA 4TPKA 3FFAA 4RACA 2PMEA 2EGHA 5CVCA 1P5RA 3C5HA 3PRJA 5JR3A 3NOQA 4CVNA 4D44A 4HC4A 3AVUA 5JNRA 3TM5A 2DLCX 3MVEA 3HUUA 5CB4F 1PUXA 4CCYB 3HBLA 3IOBA 1FP4B 1Y6ZA 1SA0A 4P31A 3EQ8A 4PGGA 1PJ3A 3LZDA 3MS2A 4TN1A 1L8LA 4AJ9A 3P9QA 3OPYI 3KYBA 2GEJA 4IX1A 3WIDA 4L5IA 4AY3A 7MHTA 1B0UA 2AFHA 1PR3A 3H9GA 2X0DA 4F7DA 1JNXX 1E3LA 1PWEA 2HJVA 3BHNA 3FHCB 4LV5B 4E1VA 4MRVA 3RJMA 4DR3B 3UFXB 4RH1A 2G0AA 4KVZA 5ILQA 4L78A 1O3YA 4LX8A 3IEMA 1VI5A 3FPCA 4L0QA 1CRQA 1Z8FA 3IGFA 2I1VB 4KI7A 1FYVA 1B76A 1KR2A 2HO5A 4DJDC 5C32A 3I58A 1RLJA 1I7QB 1ZCFA 4RXMA 2C61A 4AZ0A 1Q1NA 5DX8A 4Z49A 1IVYA 1C9NA 1D6JA 3M6WA 1GL7A 3VPDA 3IP8A 1A9SA 2ECOA 4QHTA 4HNTA 1GGVA 1HDEA 2ZDGA 4E1BA 4EPTA 5JYBA 4UUAA 2H85A 2D3TA 2QTZA 2PXAA 3E2MA 1SBQA 3MJHA 4DM7A 5GGYA 3G2KA 1XZBA 4DNXA 5IC5A 3SR3A 2CLMB 5CB4B 3E4CA 4YP5A 2ZRGA 3CLSD 4DMHA 4V1CA 4NDNE 4PAMA 3MCUA 3AXSA 2LP4Y 4RKYA 5IPFA 2FXVA 3WKEA 1XEXB 5FPTA 1UUFA 1CQJB 2AQIA 2HNBA 5BNFA 5A4AA 3GLFE 2GN8A 3HA7A 2IPAB 2ZYRA 3T7KA 1FFDA 1E59A 4L0DA 4ZVUA 4A36A 1U5AA 2FPIA 4YRJA 5IAKA 2YMLA 3LPCA 1YQTA 3L3BA 4B3HA 1DBVO 5SY4A 2HL6A 4GMGA 2B21A 1GDDA 1T0PA 3FZQA 4HLUC 2OBBA 4CMEA 1AV6A 3UJDA 4X7MA 3UC9A 1L5ZA 3OLQA 3OPQA 1JDNA 3HZHA 4RS4A 3TXYA 2WA2A 1M9NA 4QLOA 2E21A 4QUBA 1WAMA 3K1ZA 1B8VA 1IATA 4L28A 1R8QA 4F3YA 5I7WA 1B6RA 3D8SA 3IL2A 1DBRA 4TV8F 1BRMA 3G6WA 3G0BA 3OZIA 1C8VB 4KUGA 5L51A 3CUKA 3PFFA 4EA7A 1L4MA 1JQBA 2ES4A 3Q3HA 3T1YB 3OLZA 3OD5A 4EG1A 3CR8A 4BO6A 4MK4A 3ZWAA 2OGTA 3Q6MA 1DG9A 4YDSA 2IH2A 1PQYA 3C0KA 1PL6A 3PD7A 4F1JA 1XZIA 2IODA 3HB7A 2SKDA 4E6EA 2IXEA 3BZUA 3FETA 1QP8A 4GOND 4JDUA 4XPZA 3AETB 4BE4A 3H04A 5FBZA 3WYBA 2PZMA 3DCIA 2Q0HA 3NM6B 4F04A 5JARA 1N78A 1CF2O 2Q2QA 3L7MA 4HG2A 4ENPA 5I6DA 1W0KA 3TFOA 1Q0UA 3AKYA 2I62A 1XO1A 3H11B 3TIFA 3UHOA 1PK7A 1BQ3A 2AUTA 5T41A 1HQKA 3TNFA 4DA9A 3CTPA 5E7MA 4OQDA 3IBYA 3LI2A 3WIEA 1XTBA 1LH0A 4BFCA 1XCLA 1YFZA 4PE5B 4EY8A 4R6XA 3QF7A 1FSPA 2MTBA 1DAHA 1SJ9A 1SNYA 1UOOA 4MMYB 4R8LA 4UNPA 5JH7F 3SJZA 3EWAA 4Q1DA 4QVIA 5E7JA 1J70A 2D4AA 2WKRA 4GZ6A 1O54A 4Y6OA 2HMVA 1TI7A 5AM0A 4U2GA 3RFVA 3SSAA 1EXMA 1P2GA 2Z6QA 5EMLA 1KMIY 2BELA 4PC7A 3W77A 3HZZA 4HGZA 4Y67A 5KBYA 1JHYA 2VBIA 3DHVA 3MB8A 4Z9XA 3RARA 2Y05A 4JP8A 1GQQA 5HS6A 4PYJA 3RHZA 1EUQA 5J59A 1G41A 1QK3A 3AZPA 3JQ8B 5E38A 2GM5A 2PMKA 2RHGB 3GA5A 4GRAA 4CQMD 2C9OA 3BM5A 1VLJA 2ZXFA 3CXUA 4HUQB 4J1SA 4RULA 3GZTB 2QYHA 1AHNA 1KJJA 2QTLA 5HRUA 1EUDB 3KDPA 1YTUA 4W1RA 5FB3A 5JAPA 5FT9A 2YMQA 3HDVA 2P2SA 1DLJA 1Y98A 3E18A 3M6IA 5LSAA 3U7IA 4L3WA 2G7ZA 4HZGA 3G0HA 5JAMA 4QDTA 1EP9A 3U4IA 4QD3A 3AZQA 1DI0A 4XX1A 3WFZA 4ITVA 2G4CA 1ZISA 2FZGA 1J8FA 2G6TA 3FMIA 2ZBQA 1RKVA 2PANA 3V32A 3M4ZA 1FFEA 4D98A 4ZI2A 3F9RA 2VLIA 1CEYA 2YWXA 3UMRA 4DMUB 4BNYA 3PJFA 1MAVA 2CXXA 3ZK8A 2QY9A 2RMKA 1X7YB 3LD9A 4TQUS 2XIJA 3ZWOA 3REOA 1SHTX 3W9UA 1KSFX 4B7CA 3PC7A 4JJAA 1RAEA 5BORA 1DKQA 1W8IA 5B6PA 4Q1FA 4B3GA 1F9EA 1QIIA 1YS1X 2RK4A 1ULTA 3JALB 2W93A 2HA6A 1I24A 4FE3A 1TQ4A 2VJAA 3LY5A 4XPIB 4FFOA 2A5DA 4E70A 2O5CA 1ZQ1A 5KYXA 3A6PC 2JIZD 2X4DA 3A4NA 4RVOA 1QRTA 4Y98A 1L8QA 4OG2A 3IVAA 3RG8A 3DBOB 1LX6A 3AUJB 4ZVVA 4EB0A 1HMYA 2ZEJA 4UEWA 4RHYA 1UBNA 3RVOA 2JCXA 1HYHA 4HDKA 1YJ8A 2A0UA 3A6DA 3RGGA 1V71A 4E32A 3VR2D 3M0EA 4OK5A 3BA6A 3PVSA 2X0JA 3SX0A 3WGJA 5I8ZA 5KWIA 4J91A 1M7BA 2HGSA 2R8YA 3ZX4A 4DV1B 3HKCB 4Q9AA 3N86A 5FWDA 3IUPA 1ID8A 3ZV5A 2ZJ3A 4L5BA 3FJ1A 5I7OA 3O0DA 1BTOA 2DKOA 3QPDA 4G97A 4Z4FA 3L7DA 1XV5A 2E6KA 4HN9A 5E6SB 3AI1A 4BLTA 1L4FA 1SKBA 2BYTA 1ZM4A 3AUSA 4I81A 3G8YA 4KUHA 1CYDA 3ZBPA 4NV0A 4JP1A 3OKCA 4W5QA 4LRXA 2VK4A 5HEKA 1DDGA 1V25A 2G04A 4RANA 5KREA 4JMPA 4QOEA 2GLXA 2G9UA 1FSZA 3TXXA 3A3PA 3R5HA 4TKUB 2XYHA 3HG7A 4Y3UA 3UMGA 1SBNE 1PFUA 2WC1A 3EFEA 5CFMA 1E9BA 1T24A 1O8CA 5AK3A 1RWNA 2C1ZA 1UMBA 1M2EA 1X7ZB 3F1KA 1ZM9A 4OQZA 4DY4A 4WBNA 1N0WA 3EXFB 5B7GA 4G4IA 3ACCA 1G55A 3DD1A 3JZMA 3MJCA 2XECA 3QUQA 4F2HA 1GAJA 1PJLA 1YULA 3KUUA 2C2XA 1ANKA 1JAXA 3KYJB 4MPPA 1O5IA 2HA2A 3O83A 5FNZA 1E2IA 5B57C 4I4TB 3GLSA 3G2HA 4DJFC 3FRIA 3EPHA 1TADA 5FOWA 4RK6A 5IDVA 4YUXA 1MO4A 4MIEA 4MYTA 5B1HA 4REQB 3UPUA 4OHWA 4P93A 1B43A 2A35A 5CR9A 4C05A 2VJMA 4AUKA 3AONB 5JCOA 5TQ0A 3RRJA 2J7PD 2XNDD 3FAZA 5TGZA 1NJ5A 421PA 5JXJA 3WLKX 2H1IA 4QBGB 4QUHA 4U8GA 5H59A 4WFIA 4YAIA 3FPFA 4BU0A 3NT4A 4K6GA 5FO0A 1Y4SA 2Z58A 3JZDA 3CKMA 3IMCA 2YVQA 4KO8A 4ND4A 4H60A 3GROA 3QX9A 1WXEA 3M4JA 3IPRA 3O74A 4GBED 2ASEA 4OBXA 2AE2A 5DW3A 4MR9A 4DIEA 4QQKA 5I4CA 4G3XA 1ZMTA 1AMUA 1O95D 3WXBA 1Z68A 3HCNA 4FGSA 2BE9A 1TYZA 1Z5OA 3ABIA 4ETMA 1USKA 1EWVA 4WJLA 1EWQA 1NQWA 3DXZA 3R3ZA 4GRIA 4D81A 5EP1A 1T15A 3ZCRA 1M33A 1NYLA 5F33A 4IOJA 4R0VA 3HLTA 3BXFA 1R8XA 2R86A 4P7FA 5TQ2A 3K4PA 4NJEA 5KIAA 5L8VA 3TQFA 1FYXA 4LJYA 2P90A 3JWIA 3S5UA 3VVMA 4AF8A 4DJAA 4JLPA 1XDDA 2ZRKA 2IYEA 3EVEA 4XJSA 2O8CA 1ATZA 3HU2A 3LQRA 4N7RA 2HJGA 2I4IA 5JQGF 4CLRB 5P8WA 3RS5A 4BP8A 1KXZA 3OZGA 2ZR7A 4LI0A 5IJWA 4FX2A 4TKLA 1CUGA 5K7SA 3EG5A 2VF5X 5FA8A 4WPGA 2J3HA 2VG8A 4PZUA 5K8IA 5KU7A 1C0IA 2O0MA 2ZYVX 4IH1A 4YCBA 4JXXA 4JP2A 1IY2A 4V0OA 2O06A 2H4XA 2XNJA 4EUFA 3UKDA 2RJOA 3PXEA 1BOFA 1IPEA 2FPUA 3RO7A 5TPZA 3M7IA 3ZHQA 7GPBA 3NI2A 3IDAA 3VC2A 4MVJA 5JQWA 1MX9A 2PDAA 4L8YA 2FMTA 2M6LA 5DM70 3L07A 1ORIA 2YJGA 3LBHA 4FIZA 2JIQA 5D6OA 4Q1EA 4TLCA 1SUEA 3VH4A 3WYAA 3D2CA 4A3SA 1ZXXA 3LOUA 4W7HA 1I5OA 4TOIA 1N0IA 3SF8A 4CIBA 1M8FA 1T2CA 3ODGA 4KVFA 2XNHA 4BKUA 1OX5A 1X2EA 1W29A 1C1DA 1HO3A 3E61A 2TS1A 4B81A 3WDKA 4MWBA 1AGPA 1YBHA 3O2NA 1Q44A 1JN0A 3BAFA 4DAEA 2ZCJA 3D6AA 2UZ1B 4FOPA 4WEOA 1US8B 1EFPB 1H8HD 3CVJA 2BTEA 2LR0A 1G6KA 3NX4A 3OLYA 1HPLA 1PJCA 1WUKS 1WXHA 2WWWA 4AO8A 1YH3A 4O0LA 1RP1A 1THGA 2CXUA 1G291 3KPUA 2QDKA 3MGGA 3PT5A 4U3JB 1DPFA 1P1FA 5SICE 1O5OA 1VE9A 2R65A 4O4IA 1HLDA 1JA1A 2RKOA 3A4TA 3OIVA 4Q3NA 3V4LA 3WYEA 4JI1B 3PX2A 4MQFA 1MZVA 2LE0A 2LUOA 2RBEA 1Z38A 3C3KA 1PKXA 4AKSA 1Z4QA 2YHBA 4JJIA 2H5JA 3PC4A 5A04A 3SJAA 1Q6YA 4PZZA 5I5GA 1LSJA 1ST2A 3P52A 4A8TA 3DWEX 1ENZA 3OFSA 1Q1BA 2FMFA 4RGVA 1W4AA 2QZJA 4P33A 1RE0A 3FN4A 1WULS 5EYPA 5FTWA 1YHNA 1YUMA 3BAZA 1NTOA 3BFVA 3MCTA 2NSYA 5BQ5A 5K8LA 1ISGA 2VNHA 1Z16A 3NCTA 2PVPA 3ISVA 2XF8A 2CK3D 4O4LA 4J4HA 1V0JA 5YASA 3EXAA 1G5HA 4LW8A 1QWSA 4P2BA 1O58A 2J9FB 1Q1EA 2X40A 3IPYA 4U7PB 3U13A 4MDEA 3CVXA 3V00A 2FMIA 1G5PA 5DM1A 5KKAA 4BWYA 1KFEB 1A2BA 1GPMA 2VK2A 3HHPA 3PK0A 3HFGA 4OGFA 4KJXA 3V1LA 1XIVA 1F2DA 1IB0A 3O3CA 4H17A 2VAXA 4LFCB 2HQSA 3FGZA 1ZK4A 4J16A 1EK2A 3DGEC 2REXB 2CNWA 3ZU3A 2E0IA 2D2EA 5LJLA 4R9SA 5BSFA 3LO8A 4TV9B 1YJXA 3BZWA 5DISB 1SG9A 4HCJA 4ETNA 1Q1QA 1ZVJA 4B5LA 2EW8A 4BKRA 4CM7A 5BN4A 1WF6A 4BHTA 1G8GA 2EKDA 2LDBA 4B3TB 1U2RA 1A9XB 1KEUA 3O9ZA 1WCXA 4DBVO 1W4LA 4QYWA 3AY0A 3UQYS 3K0CA 2QR2A 2GZ2A 3O8NA 4YO7A 1K4YA 5B64A 1YT5A 3I04M 4FFBA 3I73A 4CM4A 1AKMA 3H4TA 3UK7A 5K6RA 1IXSB 1T35A 1IN5A 3AH8A 1KKLA 4MQ5A 1P72A 1ZNYA 3AV0B 4ZO7A 2WBLC 4CCWA 2HJRA 3COPA 3UV7A 1E7RA 4HYYA 5GIOE 2OM2A 3W78A 2JRLA 2B94A 5ICCA 4KWEA 4BVJA 1NVEA 5AM1A 5DI3B 3UXHA 4AZWA 1I4TD 4BNNA 5CA1F 1YASA 3IAUA 4R16A 1ADBA 3AHIA 3LW8A 2F48A 2QAGA 5DHAA 3WQHA 1ZKMA 1JQ5A 1TT5B 3ILYA 5EWMA 1Z6YA 4UBLA 2ZJFA 1QU2A 3IAHA 3A4LA 2QU8A 4QLAA 5M34A 2PL9A 2JLBA 4RL4A 1C41A 3H2JA 3ORQA 3Q3GE 4I1RA 1T5IA 5CURA 3F6PA 3RYHB 3DCYA 4B73A 4YPFA 4M0KA 3I45A 2XE6A 2K7FA 1Q15A 3HYNA 4Y1EA 4HDNB 4D9MA 1P9NA 1LPNA 4UHEA 2PX5A 1XVAA 1YBMA 1SUCA 5DLEA 1YQUA 2I80A 2QVBA 4ZV9A 3B5JA 3EGDA 4Y9RA 4E11A 1HNNA 2VUHB 2Y99A 4ENUA 4KAXA 5ALFA 3IHKA 2HF9A 4Q19A 3L1VA 4ZO8A 1Q14A 3WLPA 3KQSA 4OXKA 1H93A 5JAHA 3T5GA 2QTCA 4O25A 3VTZA 2GXAA 1M6NA 4MINA 4MGYR 3E8SA 1PEYA 3ROQA 5CTAA 3I1YA 4KYUA 4PFQA 3AERA 3FCCA 3MN1A 4KXQA 5EC8A 2PL5A 2IV2X 5CA1B 4LYHA 2QUZA 1R0BA 3MQ2A 2POQX 3ZU4A 5HIJA 1JEQB 4C78A 1FTNA 1IC6A 4Y2GA 4B33A 3TF5A 2RE8A 1UPXA 3ENWA 2I78A 3K32A 2AXEA 5HDQA 2DECA 4QXRA 1J49A 2BSXA 4C3VA 3MUNA 3CS3A 4M98A 1VHTA 2CWDA 4ZAGA 5FWXB 5A7FA 3G6KA 4I6EA 1K98A 2N75A 2E5WA 3HKEA 3QKTA 1HI9A 1WPRA 4MJXA 1FXWF 1RXYA 3E05A 1E8DA 3KJNA 3JAKA 4R9VA 3A36A 4X1YB 2X1VA 3FD8A 2XB9A 1T9BA 4O59O 3WV5A 5HKOA 4KEAA 2QW1A 4ARSA 2GA9A 4EARA 3ZGLA 4BVBA 2JKYA 1TUIA 2Y9MB 5I4KA 1EWYA 1K5PA 1WV1A 3OOHA 2WM9B 5K6AC 2FQXA 4FZJA 4NBSA 5I9TA 5B30A 5KKNB 2FETA 4YDHB 1L6IA 3EVZA 1U5BA 4OHXA 3KKNA 2PMBA 4M4SA 4N3GA 1E9RA 4RIIA 1OE0A 1E2MA 4QDZA 2O0KA 4GZ3A 4JYPA 2WDPA 4MGHA 5BQ3A 1GCUA 2J30A 3VO1A 2IIVA 2HMTA 3ANLA 2JCGA 3AEUA 3KTOA 3ZNNA 4WFQA 3ROTA 3EQ9A 1X9IA 4AS3A 1NDUA 2VP5A 3OCJA 4Y1RB 3SKYA 3CNNA 3RYFA 3WZLA 4D82A 1TAGA 4FBGA 2EFCB 4RZXA 3WYFA 1S2MA 1IVSA 3TAXA 1R8YA 4EKIA 2DR2A 4CV0A 4BWGA 2NU9A 1LI7A 4XVCA 1NM5C 5CJ2A 5BSUA 4Y9DA 6ADHA 2BFWA 1GG5A 1XRNA 1U3TA 4GGMX 4RH3A 1W49A 5LD2C 4ZCMA 1WZ2A 4NJMA 1P5JA 4P3YA 2FHSA 1REQB 2H1LA 4JA2A 4NG5A 5EJ4A 1KF0A 3JARA 4TMVA 2WICA 3U39A 1QQBA 3U7JA 3IKMB 4MI1A 3AJRA 2C4KA 3N0VA 1P3Y1 5DXJA 1JQDA 2EJWA 3W7BA 2AOUA 4WV3A 5A5GA 4L75A 2HMWA 2WU1A 3HVKA 2IOHA 4KN6A 2O7RA 4Y2PA 3A1TA 4YBZA 1ZHOA 5LUAA 4BKPA 4YB8A 1Q91A 1KMQA 3PGJA 3H2SA 3T0GA 1HYBA 4MYUA 3TKAA 1C3OA 5DM4A 1V11A 1L7PA 3EZXA 3S55A 4BZWA 3QUAA 4R84A 5KYYB 1YDFA 1O94D 4DFDA 4BNHA 3HH8A 5KYWA 3N8KA 1NWCA 3A58B 4QOGA 4QODA 4ARAA 4UUMA 2CDBA 3C41J 2IV7A 2DUWA 5K8TA 3MBIA 3FH0A 1E2LA 3NWPA 3NBUA 5JZVA 2X3UA 4IX9A 1I10A 2JVKA 2YDXA 2RGDA 2ZWOA 3I32A 2O8FA 3T3HA 1QRRA 3U3OA 1S3GA 2AWNA 5JADA 1NN3A 2LW7A 1CF9A 3DFMA 3TTYA 4D9JA 1VZ2A 1E1CB 3RWMB 3H17A 2BGKA 4JHXA 2JGJA 3QE0A 3ZE8A 1QZZA 3C6BA 5JAQA 5BOSA 1SHZA 1N33B 1TD9A 4RLSA 1LBEA 2Z09A 2QWXA 3LSYA 4I6GA 3VM6A 2H1RA 1HE8B 2NTNA 4BNKA 3EZYA 3MT0A 3DBIA 3H7AA 4RY9A 4E46A 1L3IA 2PYZA 2XSZA 1PV2A 2VHXA 1MKYA 2M9MA 4H1UA 4PZYA 1KC3A 3BEOA 3HYCA 3LXRA 1M1UA 4CCSA 2VTBA 3FLMA 2VCYA 2GKSA 5CPFA 2G7MC 3T95A 5DI9A 4CKWB 2J5RA 4JEMA 4QECA 1UWKA 2P9YA 2VDOB 4KLCA 5F7JA 3USCS 2OHGA 1LQTA 2WE8A 3ABOB 3CLUC 1BS2A 3QP9A 2WYUA 1O0CA 1UXKA 2JGDB 3MT9A 3PI7A 4P5DA 4Q7MB 5I48A 4E08A 1K1EA 3B60A 4E5KA 2C4VA 3CIFA 2ETXA 2LGJA 4CBVA 5JMTA 2ZJ1A 1O77A 2R6FA 4L2IA 3J81k 2JCVA 4DBLE 4MW7A 1NIJA 1RYMA 1QRAA 4GXTA 2HWWA 3BJIC 4TMTA 3RTDA 4L4UA 2DZDA 3NJ4A 4OBEA 1SVOA 1G63A 5CDGA 2QLFA 4BEVA 2WJYA 1OLUA 2H1WA 2X14A 2XGGA 4JR1A 4ZN6A 1HDRA 3CWZA 4PRLA 3W2FA 3K09C 3LLSA 3M3PA 3L0OA 1ZYUA 4DB4A 3G1WA 1A82A 1Z0UA 2OLEA 4H4CA 1N6OA 2O2DA 4LXYA 2Y1XA 4N8EA 4Q9KA 4YMHA 3CVWA 2XUDA 4GP6A 3NFYA 2OO5A 3KSZO 2Z8YM 3GB9A 1BXRB 2ECKA 1SZPA 4V2UA 3FSGA 3KZKA 4BLRA 1KAHA 4E14A 3KL4A 4DWWA 3PIDA 3MJRA 4RHCA 1SXJD 1JFFA 3GUZA 1VG9B 1M5RA 3PF8A 5AM4A 1YK1A 4XQ9A 4DJEC 4DSZA 1FMTA 3GGGA 2H51A 4B7AA 1XP5A 2BI4A 1AUQA 3L18A 1R5JA 5FAXA 3I9OA 2I3AA 2ENUA 2XB6A 3CURA 3G79A 4YH1A 5MN5A 1N36B 3MCZA 3BHIA 1POXA 3FCUB 5BV0A 5A3VA 1T3SA 1WP4A 1D4OA 4UQPA 2FU5C 3JWGA 2C2HA 1Q3KA 4B32A 2ZUBA 5IYZA 1XMOB 2O3QA 3P27A 5DBEX 1VKHA 3JD3A 1VCOA 3L1KA 3NYIA 4JLWA 4KE8A 3W4KA 1MB2A 3HVRA 1UJ5A 2OZVA 3B2NA 3QOFA 2IT1A 1TLTA 1I0ZA 3FDZB 3AFHA 4JBNA 5AXBA 5D7BA 5B6JA 1OZGA 2HT6A 4RPGA 3OE5A 4LN1A 4V1CI 1WCIB 2YW2A 1L5SA 3VUFA 4BLPA 3L8MA 2B2NA 1YCFA 4NCXA 4OATA 4DR4B 3NHFA 1WXIA 3FPGA 1U6KA 3O91A 2ONCA 4OK3A 1HSZA 4L8GA 4KLNA 3VGPA 5ALLA 5DCYA 3QSGA 16PKA 2JEZA 3OJEA 1DCTA 5REQA 1JKMA 2P6NA 4L7QA 5DSZA 3KX2A 2G08A 4MO9A 4R7ZA 4YLGA 2DMRA 1WDTA 3DZIA 3PPWA 1BEUB 1V3UA 3KQLA 3RSHA 5IX8A 2VHTA 3CG4A 5DO9A 4X85A 4DADA 4QDKA 5E1MA 4HH3C 1MABB 3DTVB 3A1WA 2F8LA 1QO0A 3BIXA 1ZZEA 1UPAA 2IEZA 2ZWIA 1J24A 3CBGA 3D3EA 4HH1A 1E0KA 1GZUA 4Q9LA 4B7ZA 5C81A 3QF4B 1PVVA 2AT1A 4GOLD 3QEOA 3ID6C 5JPDA 3CSDA 4LE1A 1V26A 3V8QA 1KXJA 2G1AA 3KJIA 4URYR 4DDWA 4HY3A 2EV9A 5T57A 5CA0A 1L2TA 1BCSA 1GGEA 3TI9A 4EDHA 1XD8A 2I5PO 2QUIA 4GI3A 3UW3A 2PKQP 4Q3LA 5JD3A 3N0TA 1ZD1A 1HG0A 4WK2B 2PU5A 5M7EA 1JIJA 2MT9A 5HCNA 5KSYA 1RJWA 1UKEA 1KRHA 2ZYSA 5JDCC 2FSGA 3CRRA 1QSGA 1SXHA 3CX7A 4M0EA 4XJXA 5KX5A 4IJKA 3DZHA 4EPXA 2CUNA 4LJSA 3MZ0A 3E3OA 4EMTA 1HDIA 1WABA 2ZZMA 1VIAA 3VDRA 1AGYA 1N6RA 3RBXA 3U3RA 1QV7A 1XDSA 1ND6A 3I9V1 5KOJB 2JLSA 1GQOA 2CXSA 5H0IA 3RVNA 5MF6A 2A58A 1DUSA 3UJBA 1N0VC 3PWTA 2EYQA 1KZYC 3KB8A 5KPJA 4F86A 1TCBA 1RABA 3SXUB 5A2QA 4QM6A 4WXEA 4Y2QA 4TWZA 2FW1A 3HO6A 4O4HF 5AVJA 1ZOIA 5CM9C 1JEJA 4Q9IA 4DMLA 1JNYA 3L84A 1MUUA 2XA9A 2B9EA 1X7WA 1J8MF 4GOJA 4HRVA 3CPEA 2IZZA 4FK8A 2GZHA 1UPBA 3BVPA 4M36A 4M7RA 3RREA 5DT2A 4KV7A 1DC7A 1U98A 2ZUCA 5F3WB 3B8HA 5EG5A 1NW7A 4OXNA 5LIRA 2OR3A 3FPHA 3L05A 3FE2A 4IFIA 4ZEMA 1U8AA 3BFPA 4JBXA 1ZM3A 1ZN7A 1PDOA 4G0XA 1DKPA 4HWGA 4QXOA 4TL9A 3V8MA 3WYCA 4BYGA 4R51A 4BTLA 5THKA 3DOHA 3ZWBA 3RFTA 4GBMA 1Q74A 3N2YA 3QE2A 5EQFA 3CY6A 1GZDA 1U90A 5DP1A 5JS1A 4ZQBA 1EJ2A 4QO8A 2ZJ8A 1XZPA 2X5NA 4LSGA 4WW0A 1O1YA 4N8DA 1KHTA 4RLQA 1IULA 3TIVA 3TTSA 5AI6A 5AJUA 4DLPA 1OT5A 2OMEA 2WVJA 2CJWB 1Z6PA 2DF8A 2R1TB 3MJEA 4RK5A 4E3ZA 1W35A 3EA5A 4YYZA 3H5TA 2CD7A 3E23A 2DFTA 2YIJA 3LT1A 2PWPA 4KYVA 4LXIA 1NP3A 4X1IA 2ZT8A 3N8NA 2WTEA 2Y1DA 3CUVA 1TC1A 3SN6A 1YJQA 1LQ2A 1ZN2A 3MW8A 1G6OA