4CM9D

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
248
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 95
structure length 248
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm9D00
3K96A 1T1RA 1IZ9A 3LLVA 5EPOA 3ZHBA 3IUPA 3BHIA 3OJEA 2E82A 2I6TA 3JQ6A 3O38A 2C54A 5A3VA 5DCYA 4IIVA 2AQHA 1ONPA 1ZSVA 3BMCB 3U4IA 4CLEA 3L6OO 4S1VA 2Q45A 3CKYA 4OAQA 3TZHA 1F8GA 3MWDB 1GEGA 1QYVA 3G1UA 2HAEA 4D0RA 4UAGA 3U62A 1F0YA 2JFGA 3ICCA 4DIOA 1O8CA 5CDGA 5F1KA 4CR8A 1UZLA 2WYVA 1P33A 4GLOA 4CR6A 5L51A 5U1PA 4W7IA 3WIEA 4MINA 2GUGA 1WLYA 3OA0A 4KOAA 1MV8A 2ZJ0A 2OP0A 1X14A 5JXWA 2ZJ1A 5GZ1A 1PQWA 3GGOA 2AEFA 4FIZA 5JC8A 1OAAA 2NQ8A 3CIFA 3VOSA 4HFRA 2VHXA 3H5RA 7MDHA 2F1KA 3AOGA 4BQPA 4ZA2A 4QT0A 3IDSA 3H9UA 2RCYA 1YBVA 4IQ8A 4AJOA 2PA3A 2DBZA 5A03A 3QRWA 2JAPA 1PZGA 1Q0HA 1GY8A 3FR8A 2XOXA 1U5CA 3EY4A 4BNIA 4CM9A 2NVWA 3LT4A 3PLRA 4E5NA 3PI7A 2BKAA 4CMJA 1GQ2A 3ABIA 1LX6A 1TVEA 3WX0A 3P5SA 3SC6A 3Q2KA 1BHSA 1H5QA 3Q9NA 1P9LA 4CMCA 4RVUA 4DIFA 4MIYA 3LU1A 4TVBA 4YB8A 4B3JA 3I6QA 4NFHA 2PZMA 4IDDA 3RSHA 3ZN2A 3LF1A 3K73O 5COAA 1P0FA 4R4JA 5T67A 1HLPA 4IMRA 4UUPA 2YQ4A 3JD0A 4WCFA 3E18A 4W4TA 4WGGA 1XU9A 3DXFA 4DL9A 3DFZA 5JDIA 4CM9D 4CMGA 5IFLA 4XQEA 1JW9B 1XLTA 1ZSYA 4E3ZA 5CAEA 1ZEJA 4GH5A 1GV1A 4CM8B 3GT0A 4TROA 3QVXA 1X0XA 1I3NA 4AJIA 4NBTA 1IULA 1YBAA 4R69A 4FJ2A 1NFFA 1DFHA 2WM3A 1B8PA 3AW9A 4UVGA 3A28A 1A72A 3AY7A 4AICA 2V6GA 5TQVA 5L95A 1TT7A 3S8MA 3AK4A 1PJCA 1VC2A 1BG6A 3IP3A 4XJSA 5I8ZA 3FR7A 4R1SA 4EW6A 1N1GA 1V3TA 1KEUA 4O63O 4OXNA 1HE2A 3DBVO 2YDYA 3PQFA 4QX6A 4XKJA 2J5RA 2WMDA 4PRKA 1PWZA 4OJNA 4CM6A 1V9LA 4GVLA 1DJNA 3VH3A 3INRA 3NX4A 3ONFA 1EMDA 1ZCJA 2VHYA 2JD0A 1XQ1A 2NU8A 1Z6ZA 1GADO 3DZGA 4OM8A 3PHHA 4BO3A 4Y9DA 4OXYA 4CMKA 3PK0A 3KBOA 2EGGA 5TJHA 5MDHA 4ZQFA 2D2IA 2ZIZA 1MC5A 2CSUA 4YR9A 3FD8A 5KTKA 2VWGA 1EUDA 1KC3A 3AY3A 3DZHA 2ZKLA 4GX1A 5JYEA 3SBOA 5L9AA 3ZWPA 3ZHYA 4W7HA 4M54A 1P45A 5LC1A 4HBGA 1GDHA 1SAYA 3JQAB 3Q2IA 4QTZA 2P9CA 1I24A 4WCFC 3ZU5A 5JDIC 1Q1NA 2X0RA 5FI5A 3WG9A 1Z73A 3ADPA 1TI7A 3PYXA 4DYDA 3B1KA 1TB4A 5DBFA 4NBRA 3WNQA 3MJ4A 4FGSA 1J6UA 3BTUA 3ENKA 1DAOA 4ZU3A 3QVWA 4FPXA 1B7GO 3JD4A 1W73A 3WTCA 2JD2A 3WS7A 2OMEA 2QHXA 3QY9A 4Q3NA 1WVGA 4A27A 2HMTA 4DBZA 3E9MA 2C7VA 2PR2A 3ZHZA 3JQGB 1UZNA 4BNXA 4ND2A 3OSUA 2RHCA 5A9SA 4PCVA 1ZJZA 4YCAA 1SO8A 1GR0A 3EYWA 3I9OA 4AJ1A 4BMNA 3GFGA 1E7MA 1TT5B 2X5JO 3O03A 1SZJG 3RKUA 2YQ5A 4DVJA 1ZIDA 3HDJA 1EUZA 1UJMA 4M55A 1XCBA 4I5GA 1WNTA 5ENDA 4IINA 5ER6A 4C7JA 4NFYA 5LCXA 1LRKA 1UXKA 1ISFA 3GZNA 3RUIA 3OEWA 4EYEA 2E37A 5TT1A 3WGGA 1R4NA 3WGQA 2CDAA 2FHSA 3HE3A 1UXJA 4BQRA 1HZJA 4G2NA 4D79A 4R01A 1DC3A 4NZ9A 4FC7A 5KCZA 4BKRA 4TRMA 4F3YA 4BNMA 4I5FA 3RJ9A 1U3TA 2IYPA 4D3SA 3WDSA 4YT5A 3NTOA 3SLKA 5AYVA 2A94A 4NDNE 5CDTA 2TMGA 4LN1A 3WXBA 1NR7A 1PQUA 4AJKA 2PD6A 2C82A 3H4VA 4FD3A 3IOYA 1ADGA 2JJYA 5C7LO 4L73A 5L7YA 2AQ8A 3PPIA 3I4CA 3LK7A 2Y0EA 1HEUA 3BMOB 1R4MB 4J1TA 1Y7TA 2A9FA 1UUFA 3F5SA 4Q39A 1Z75A 2QG4A 4NK5A 3F1LA 2NADA 3EVTA 3EC7A 4D3DA 3DDNA 3AOEA 3VTZA 2DTEA 2GZ3A 4Q3DA 1X7DA 3OJFA 4GKBA 3GEGA 4G5HA 2YV2A 1EBFA 3CZMA 2EW2A 3RUFA 4CL3A 4ZQBA 5A06A 2UAGA 1ZK3A 2Z1MA 2O3RA 4NH4A 1XQ6A 4ALMA 1NWCA 1N92A 4DQUA 2B36A 1GYRA 5CEEA 2ZK7A 2X22A 2G17A 1N1EA 4XGIA 1G0NA 2B4RO 4J49A 4XDZA 1EDOA 2C2YA 4YJFB 1YJ8A 3TSCA 2HO5A 3LQFA 2ZQYA 1YOVA 4RPJA 4TQGA 2IZZA 1PSDA 3H8VA 3JD2A 5FI3A 3G0OA 4DPMA 4BNWA 3W4KA 2DFDA 1I2BA 4URFA 2Z1NA 4TWRA 3PP8A 1IL0A 3NDRA 3I9NA 4XDYA 1T24A 4WJZA 5F1PA 2YW9A 4RV9A 2O4CA 1QSGA 4GVXA 5BT9A 1RJWA 4L4RA 3UF0A 3VPSA 3X2FA 3GMSA 4KWHA 4M89A 4B8WA 4YBZA 4DC1A 1D4FA 3PHLA 3FTPA 3ZGYA 1M6HA 4LSWA 4XQCA 3OQBA 3PIIA 3QJ5A 4DC0A 1HDOA 4E5YA 3FN4A 4XWYA 5CP8A 5HWSA 2YV1A 3N58A 1GZ6A 1BRMA 1R0KA 3B70A 4F46A 5KNLA 1NBOA 2V6BA 4JCOA 3CH6A 3I83A 4XIYA 2V6FA 4JK3A 2GR9A 2X6TA 5A4DA 3DAPA 5A9TA 3PRJA 3HADA 5ES3A 1QYXA 4UVEA 3AOEC 1Y1PA 3E9QA 2AHRA 1NFQA 1CF2O 1GQYA 3WR5A 4HWKA 5F3RA 3STHA 3HFGA 4IDFA 3UHAA 4YDRA 1E7QA 2WD7A 1P74A 4L75A 2EXXA 4GAEA 4II2A 1YVEI 3QLJA 1OOEA 3G1TA 4UEJA 5BQFA 1OFGA 4MOWA 1ZO8A 1YKFA 1JVBA 3UKOA 3HN7A 3NDJA 3MWEB 5HBRA 5JAMA 5K6AA 1EQ2A 5DCUA 1N8KA 4LRSB 5JO0A 1ZEMA 1EEHA 1KY4A 4YWJA 1CEQA 3A4VA 2OXIA 1K5HA 3VZPA 4I9NA 4RF2A 1K0UA 4QO7A 3JCZA 1I0ZA 1EUCA 2G5CA 3GRKA 3S2IA 1LRJA 4M87A 4H3VA 4EZBA 5L40A 5LDHA 1YB4A 3EAGA 3NAQA 3RBXA 3ONEA 2JHFA 4P4NA 4P8RA 4IXWA 1QG6A 1RM4A 3FTNA 2AA3A 1E3SA 4J90A 1SCUA 3VPFA 5AVOA 3U4HA 2GF2A 2EP5A 2OP1A 2XF8A 2XXBA 3DO5A 2I65A 1DIBA 3F9IA 3WICA 3EGOA 1D8AA 4FQ8A 4GX5A 2VZ0A 4Q3AA 1F12A 1UR5A 2YHIA 4O0LA 2Q46A 4R1UA 1PX0A 4GGPA 1I01A 4WLNA 1LBEA 2AEMA 4HXYA 4WCFB 5F5LA 2GSDA 4N5LA 3CE6A 1HTBA 5COBA 3T4XA 1A71A 2NSDA 1PTJA 4GLLA 4BKQA 3KEOA 2HQ1A 1P3DA 2A92A 2W2KA 4I9HA 2D3TA 3KLMX 4OXKA 5A9RA 2POQX 2O3QA 5HM8A 3JQ7A 4Y6PA 4OSPA 1NXQA 4UUOA 5ILGA 5MGBA 1U2DA 5BNIA 4EI2A 1PJTA 3I9LA 3K2BA 2Q1WA 4JQCA 2W8ZA 3LSYA 4AJ2A 2FSSA 2X4GA 2NV6A 4QUKA 3WBBA 2XPCA 4W99A 4CPDA 2CDBA 4B4VA 5B12A 3W6ZA 5K6AC 3LLSA 1A9ZA 4MVJM 1DB3A 4BKUA 4MO2A 1R66A 4WLEA 3FF4A 3WNVA 2H1SA 2QZZA 2J3KA 1B26A 1JLLA 1GYPA 5KVVA 1X0VA 4LVUA 4Q3EA 4IZHA 5KJEA 5TJ9A 2PTGA 3QE3A 3H5NA 2A4KA 1V0JA 4I5DA 5T57A 3R3JA 2DTDA 3H5AA 1NVTA 4XCVA 8LDHA 3T4EA 1DHRA 1MXFA 1T4BA 1EFLA 4ZICA 3ADOA 4KDEA 2P9GA 3CZRA 3AUSA 3W8FA 4DIBA 1DIRA 3NRCA 1NYTA 4TZKA 1X15A 4MVJG 3WLFA 1YRLA 1QYDA 1PQPA 4ZJUA 3W6UA 3UCXA 3VPHA 1ADBA 1ISGA 1PJ2A 5DULA 1JKIA 1A4UA 1XYGA 4FW8A 4Z9XA 2QYTA 2UDPA 3ITKA 1GU7A 4KUHA 1EK5A 3F3SA 4II3A 1QKIA 4UUMA 1U2GA 4U5QA 2I9PA 7ADHA 1SEVA 4ALNA 3HJAA 3TNLA 1AXGA 4INAA 4OMUA 1F06A 2P5UA 2ZCVA 2UV8A 1MGOA 3U0BA 5U4QA 3PHJA 1LDMA 1ISMA 4DXHA 3F5QA 4OOFA 1LRLA 4J7XA 2PKRA 2YFHA 5FF9A 4E30A 3INGA 3BMQA 2JD1A 4DA9A 4DYVA 1I10A 2PV7A 1DJQA 1GQQA 1H93A 3OETA 3JTMA 3ON5A 4RZHA 4YAJA 5A04A 1ZMTA 4YEDA 3BTVA 2IODA 2JCXA 3PQEA 2HU2A 3RJ5A 4EEZA 3FWNA 2DKNA 1YE3A 1ULUA 2VRCA 2YY7A 3A14A 3HHPA 1I8TA 3GZNB 3BTSA 5KKCA 4MKRA 2C5AA 2GO1A 3CINA 3NUGA 2GGSA 3OJLA 2OFPA 5DP2A 4DQXA 1ID1A 1R4NB 4NU6A 2EERA 4J7CA 3EVNA 3Q3CA 2IE0A 2QRJA 3DZJA 4I08A 1M66A 2O23A 2UUPA 2VN8A 4AJLA 1KEWA 4ONEA 4R5HA 4GBJA 2WWRA 4BNJA 1B3BA 2C0CA 2DBQA 4E33A 4BNHA 3H9GA 5K0ZA 5TNXA 4D43A 2Q2WA 3D3WA 5C3MA 3PWSA 1PGOA 5IN5A 4LCEA 2RIRA 2UUOA 3RU7A 2AMFA 3G79A 3AU8A 2VRCD 3RU9A 3KYCA 1ZMOA 2CDCA 4CQMA 1LLQA 5A05A 5G4KB 4WK6A 3Q11A 3RWBA 1OMOA 2BRUA 4K9DA 4W6ZA 2E6UX 2XXJA 4PZDA 4FOSA 5I9MA 3D4OA 3VHRA 4YPOA 4GWKA 3OM9A 3MOGA 2NVBA 3JYOA 3GNSA 3LYLA 5ICSA 3C7AA 4GGOA 4CLXA 2EP7A 4W9NA 3PQDA 1P1RA 3C85A 5JDCA 1SB9A 2HJRA 3B1JA 3O9ZA 2FRDA 2WE7A 1AXEA 1NNUA 3L6DA 4XYEA 1LQUA 1RYDA 2OGUA 5JMPA 5IXYA 1EK6A 1U9JA 1PJ4A 1U5AA 2PKQO 2BFAA 1R12A 3VKVA 1SMKA 1Q2XA 2BI7A 2Q1TA 2Y1FA 2Y68A 4EJ0A 3U5TA 3DR3A 1KVRA 2Q1UA 3KYBA 4CQMD 3TZCA 1JVSA 3JYPA 3S2EA 5KJFA 3IQDB 2G76A 1CIVA 2OO5A 2O48X 1YS4A 1QV7A 2DVMA 3WSVA 5JSFA 3UVEA 5B4VA 3EZLA 4BMVA 4N54A 3PWZA 1UAGA 3ZI0A 4FCCA 1D1TA 1YQXA 3GHYA 1H2BA 4H15A 5ITVA 1YOVB 3QWAA 3EUWA 5TF4A 3DFUA 5KOIA 3AM4A 1K89A 3WGIA 3PEFA 3KRTA 2FZEA 5JFOA 1PU2A 3LT0A 2AG8A 2PWZA 2UVDA 4J7UA 3I52A 1NHGA 1UDAA 2B69A 3MEQA 2RH8A 4B4UA 3QIVA 5KVCA 1NFRA 4XZ3A 1Z74A 4U0KA 4J4TA 4HNGA 1NR1A 4FR5A 4GKVA 2GLXA 3TWOA 3EZYA 4AL4A 3CMMA 3SC4A 4FFNA 4P4GA 2QRLA 5C7OO 3V2HA 1Y5MA 4CMBA 3MJCA 1VL6A 1RWBA 3HZZA 2C5EA 5T6BA 4XJTA 2YDXA 1EVIA 3DTTA 3I9JA 4MIEA 4QEDA 3RC9A 4CM7A 2DM6A 1F17A 1E3LA 4QO8A 3B20A 4W9NC 2HMUA 5JDCC 1CQIA 5G2OA 4UVDA 1ZFNA 5T8KA 3JQFA 1VI2A 4M49A 3TPCA 3O8QB 1A5ZA 2FPGA 3TJRA 1AGNA 3BIOA 3PYLA 5G0SA 4PLWA 2GNAA 1GUZA 4EBFA 1LEHA 5IG2A 4RZIA 3ZWBA 1T4DA 1DXYA 2G82A 3KYDA 1LA2A 2WD7B 3KV3O 2VYNA 1VL8A 2X86A 4BKPA 5L4LA 4Y8VA 3WTBA 2Q4EA 1HZZA 1T2AA 3WJ7A 4NBVA 4CV3A 1R37A 1X1TA 1X1EA 3WQRA 3GDFA 5G0WA 3ZZNA 4E2XA 1RM3A 3HFSA 3D64A 5KJ6A 1MXHA 5CHEA 2H9IA 3ZWMA 3EHEA 3JQEA 2I99A 3IJPA 1M2WA 3E5MA 2HKIA 1X7GA 2PGLA 5L7TA 5GZ6A 1BXGB 3ZWAA 1VSUA 4BNUA 2VT2A 2VYND 1G0OA 5JAZA 3HWRA 1PZEA 2ZCUA 1J4AA 4KUGA 4L8VA 1EVYA 1HYHA 3KXDA 3MJTA 3OHSX 1N7HA 4Q3BA 3H9EO 5BNTA 2JFHA 3RIHA 1AN9A 3GAFA 4BNLA 1AHHA 1JDJA 4J4BA 4PFJA 4Q3CA 2DU8A 2NVUA 1BXZA 3U9LA 1Y8QA 4PLHA 5T8KC 3JQFC 1GFSA 3VAZA 3I23A 2QZ9A 3PGXA 3EMKA 5ENVA 2NUAA 4IQGA 1PGJA 4IQ0A 4BUCA 1E6WA 2OZPA 3GPIA 3GUYA 3N7UA 1IPEA 1J49A 2W2KB 4MKXA 4PLTA 2ET6A 2Y67A 3OEYA 5IDQA 1OZAA 2DAPA 1JTVA 3IKVA 3JQ7B 4IJUA 1W8DA 2PD4A 1PS0A 1DIGA 3R0IA 2O3SA 4B8ZA 1PEDA 3VVBA 4DGSA 1ZXBA 5B4UA 4FGWA 5IF3A 1KVTA 4PG5A 4HFJA 1KY5A 3RVDA 2Y99A 4U6SA 1H6CA 4KTVE 1YJQA 3M2TA 4Z0PA 3TRIA 4B79A 3LVFO 3IUSA 1KEVA 3D4NA 4QSMA 1N2SA 3D1LA 1S7CA 3ZV6A 1CQJA 1YH3A 2HLPA 2B5WA 3ANLA 1NPTO 1PS9A 3KSZO 1EFKA 4PLCA 5EJ2A 1LSOA 1H6AA 3AUUA 2RBEA 4TRJA 2P4HX 1NX6A 4PLFA 3WGOA 4BL5A 2XAAA 1YONA 3QA9A 1ZK0A 4RF3A 4DLLA 3P2OA 2EJWA 3CPSA 4WASA 2Q4BA 5TS3A 3UICA 1BVUA 2JFFA 2R2GA 2Y1GA 4BNNA 4C7KA 1H6DA 2EHDA 1PWXA 4GX2A 2Q2VA 3ST7A 4RPLA 1U1IA 3GC6A 4LVCA 3RFTA 2RHRA 1W4ZA 1GTMA 4A5OA 4BNVA 4C4OA 2FP4A 3WOHA 3FI9A 3GVPA 2VTDA 5FEUA 1SC6A 3AFMA 4PRLA 1GV0A 5BR7A 1SEPA 1RPNA 2CUKA 3TZQA 3OBBA 4E4YA 2H6EA 1DOHA 1CWUA 4FBGA 2X8LA 3WFIA 1MG5A 3PZBA 4QFCA 3FPCA 2AEJA 5I7VA 1YDWA 4LRTB 2NNLD 4KZPA 3DZBA 1UZMA 5G4LA 3A1NA 1K3TA 4FFLA 4ALJA 4EDFA 5CEFA 5I7FA 3RC1A 2HSDA 5DBIA 4MP6A 3BHMA 3DAGA 3JSAA 3ZWOA 1K6IA 2IEBA 1VJTA 4P22A 3L07A 4R51A 4HNHA 5TSDA 2C07A 3PHIA 1Q7BA 4GWGA 3WLEA 4JJIA 1VLLA 3ETEA 4FSHA 2P2SA 2VT3A 4CMHA 4LSMA 4OQYA 5KVSA 2BLLA 4HV4A 1UXIA 4OL9A 3VH1A 4TSKA 3C7CB 3DEYX 1SBYA 3IAHA 4NBWA 4BO8A 4K6FA 1WXDA 4HX5A 4B7XA 1R6DA 4NJOA 4WNCA 1SOWA 1X7HA 1YQDA 1YQGA 1E5QA 3GNTA 2ZTMA 4BIIA 1IHXA 1DC6A 1GUYA 4PVCA 3A06A 4ND4A 4XQ9A 3UAGA 3UXYA 2VNAA 4CV0A 4GMGA 4P4LA 1U3UA 4ZRMA 4AJJA 4JLWA 1BDBA 1A9YA 2B4TO 5G0UA 3GG9A 4HFMA 3KOUA 4YRBA 4YRDA 4ZQEA 3MJVA 2BGKA 1E7WA 1B14A 3EW7A 1ZZEA 3AUAA 3D3WB 1PGPA 2I76A 1KS9A 1Z7EA 4PGFA 1V6AA 1CRWG 1L1FA 4JBHA 3KYCB 1UP6A 3ENNA 5DT9A 1Z45A 4CQMB 5BSEA 5C37A 4A2CA 4WCDA 1HLDA 3OIFA 1GZ4A 2PGJA 3OA2A 4FB5A 3AUTA 1O94A 1ZH8A 3SLGA 3NV9A 3FBGA 2TMDA 4FFOA 4E21A 2NTVA 3F4BA 5DNAA 4RF5A 5JMWA 2VWHA 2Z95A 4ZRNA 1E7YA 3GLQA 1P1IA 5AXDA 1CJCA 1ZSNA 5GMOA 5JBIA 2DUWA 2VHWA 4BV8A 3AJRA 1VRWA 1NWHA 1P0CA 4BNKA 4J1QA 2YV3A 3P2YA 5IZ4A 4G65A 5EN4A 1WDKA 1E1KA 2QW8A 2IXBA 1O6ZA 3QWFA 4R54A 3D0OA 3ANNA 1KVSA 3W4JA 2EF1A 2GASA 2VUUA 2VZ8A 3DBLA 4UREA 3RFXA 2AG5A 2FZWA 2P9EA 1UP7A 1VKNA 1F8FA 1HETA 1F14A 5I8WA 3DZFA 4IJWA 2WJPA 2EKPA 3PXXA 1C3VA 2DBVO 3CSDA 4Z0HO 2Z5LA 3RD5A 4LW8A 2B5VA 3CTMA 2J3IA 1AHIA 4CR7A 2OUIA 2YUTA 4CLRA 1P1KA 3VPGA 1R16A 3TN7A 3AY6A 3DONA 3RROA 3FSRA 1H0KA 1LJ8A 3VDQA 2JCVA 4YRAA 3CUKA 3WWZA 2QRKA 2EJVA 1I3MA 1JWBB 1YGYA 3D5QA 4FDAA 1JQBA 4Q9NA 2WEKA 4UVIA 3H9JA 1ZUD1 4H7PA 4L0QA 3BMCA 1UAYA 1ISJA 2PLAA 3HDHA 3V8BA 3GNQA 3I4FA 4J9VA 3ROKA 1MX3A 4BNZA 1P1HA 3V5NA 4BO4A 4MP3A 2E4AA 2WYWA 3JQDA 4AJPA 4L9RA 4BOYA 4YXFA 4CUZA 4DMMA 4RDIA 4E5MA 4MPDA 4IDGA 1R15A 1IHYA 5ILOA 2VYVA 1U7HA 2D8AA 5L45A 4IM7A 1MA0A 1XGKA 4E0BA 3KSDO 5JCXA 3QWHA 3MTGA 1KERA 3JYQA 1V3UA 4A7PA 3RUHA 4XYGA 1T2FA 3L77A 4PZCA 3U4CA 3Q9UA 1Z7BA 4R5MA 3KYDB 1O5IA 3RC2A 3H2ZA 2EG9A 4LCJA 4A10A 2EGHA 1HDRA 3ZNNA 1TA4A 3G3EA 1DO8A 1E7RA 1I33A 3GEMA 5I7SA 5L53A 2X0IA 3B1FA 4ITUA 5JY6A 4BO5A 3QWIA 1PR9A 1VE9A 1TEHA 2ZB4A 3S2FA 4QQRA 4BNYA 1ZK4A 4JIGA 4PVDA 4O5OA 1T25A 3PLNA 1ZBQA 2VYVD 3UCEA 4KTTE 4X54A 5T64A 4K1LA 3GG2A 1VM6A 3S55A 5JC1A 3GVXA 4WE3A 1YL5A 4AFNA 1HF3A 1NQAO 1R0LA 4HUJA 1PJBA 5BNFA 2YHUA 5CG2A 4KMSA 4O59O 4D45A 1MUUA 3NGXA 1QR6A 4IPTA 5DOZA 2Q3EA 5JAIA 2B4QA 3LF2A 3IP1A 3NKLA 5CFZA 1E6UA 4RLHA 3P7MA 3VZSA 3QSGA 2Y0CA 3QW2A 4ID9A 5F21A 3HNPA 4AG3A 2GDZA 3R6DA 4DQVA 3DBHA 4R41A 2E49A 2BELA 4BO0A 1MLDA 1PZHA 4PG8A 4YJGA 4B3IA 2FSVA 1M76A 3GN2A 3VPXA 4WEQA 5DBGA 2RAFA 3D5TA 4DLAA 2HMSA 5LDGA 3LT2A 2VUTA 2NVUB 3JQ9A 4WPGA 5TRTA 3VDRA 1MP0A 1D1SA 2PH5A 4HKTA 3N74A 1Y8QB 2VWQA 5IAAA 2YZ7A 3OQ1A 2BF7A 2X5KO 3G17A 3L9WA 4CM8A 2OHXA 3FNEA 2DFVA 3OJ0A 3PIDA 2O3TA 5L4NA 3PJFA 4U6QA 5A5EA 1VJ0A 3PGJA 2X0NA 1WP4A 3E6AA 4CM1A 5IZCA 3RUAA 4YA6A 3O26A 5AXAA 1WDMA 4CQLA 4CM5A 3Q1LA 3G49A 3LDHA 4I1IA 5THKA 2Q2QA 1K6XA 1PL6A 5CPBA 1E5LA 2C29D 2Y1OA 3SXPA 4ZHSA 1NVMB 2VOEA 2IDZA 1HYGA 1FDVA 3DQPA 1E77A 4ZVVA 3E8XA 4N7RA 4Y6SA 3K8ZA 2VWPA 2PFGA 3OH8A 3P19A 1LTHR 3HDYA 5HS6A 3Q6IA 1O89A 1WZEA 1E1MA 3DHYA 3ITDA 1XWFA 2W98A 1YBMA 2BGMA 2GN4A 4BHTA 1Q0QA 3GF4A 1YB1A 2NU7A 2X58A 3NT5A 1PJSA 1NTOA 1U3VA 3BMNA 3OJOA 1GPDG 3GEDA 3S2GA 3O4RA 4PG7A 4G81A 4OHUA 5L4SA 3CEAA 2AE1A 1JAXA 1LC0A 3ZDFA 5ADHA 2FN7A 4I9UA 2I67A 1HDGO 3ANMA 3OF2A 5EIOA 2GZ1A 3UOGA 4WLOA 3SX2A 1Y8RA 2GD1O 3NT2A 1B2LA 1DLIA 1FJHA 4F6LA 3K9QO 3JQ9C 4WECA 3DB2A 2NU6A 3LC2O 3RUDA 4BNFA 3C3XA 3ZH2A 3C8MA 5CDSA 2BMAA 3I5MA 5B4TA 4J1NA 3I1JA 4W82A 3NEPX 4EUFA 2YFQA 3DC2A 3OICA 3L9XA 1M67A 1V3VA 4RQTA 4EJMA 4WEOA 3OP4A 4NI5A 3WYBA 3ZNOA 5JS6A 5IZCC 2BHLA 4K26A 3WMXA 2ZTVA 5A9SB 5B1YA 3ZV3A 3AFNA 4UULA 3W4IA 3GQVA 4J6FA 4R1TA 4MIOA 1VPDA 4J16A 3L6EA 3QP9A 3IL2A 3QV1A 1FDWA 3T7CA 1PIWA 1DSSG 1TT5A 2HK8A 2BD0A 2Y05A 2J3JA 4XYLA 2RH4A 2PKQP 1MG0A 2PZLA 4IJVA 2X9VA 4NPCA 4XYBA 2PNFA 3QQPA 4RVGA 5EERA 3AWDA 4NQZA 1HKUA 3GVIA 3RQSA 2ZYGA 4DBVO 4HADA 1HRDA 1YB5A 1CDOA 1U4SA 2IXAA 2CF6A 5G0TA 4GQAA 2W4QA 3GA0A 3GDOA 4B4WA 3ZWVA 4LMRA 3MTJA 4IY1A 1XR3A 3B6ZA 3JD3A 3KTDA 4RDHA 5DP1A 3PYMA 3ZWXA 1H9BA 2BH9A 1Y6JA 2PY6A 4J1SA 5KVQA 4N18A 4JBGA 4D46A 2GCGA 4IUYA 4TZTA 5A5FA 5DN9A 9LDBA 2WD8A 4NIMA 3K6JA 3TL2A 3PJGA 3VC7A 1L7EA 2VQ3A 3GAZA 2GN8A 1DHTA 2D1YA 2PGDA 2FR0A 1NHWA 1PL8A 4NU5A 4P38A 1ZNQO 1XKQA 4TMFA 3ULKA 4Y67A 4CUJA 2IRWA 2FPPA 5FYDA 1K6JA 1Z82A 3HSKA 2V65A 3PJEA 4CM4A 3E03A 5T5QA 3E48A 1G6KA 2HK9A 1YDEA 3GRPA 3ZV5A 1KEPA 1FDTA 1XSEA 4KQXA 4A0SA 2ZATA 1R4MA 4CLOA 1C1XA 5JO9A 1PGQA 2HMWA 4JXKA 4ZD6A 3SVTA 4E6PA 5K9ZA 3WQSB 2HCTA 4ROSA 3ZHXA 2Y93A 4HFNA 3BAZA 1I2ZA 1ISIA 2D0IA 4JP3A 2GRAA 2VHVA 1HSZA 4HY3A 1M75A 4E2WA 4I5EA 4DTIA 3V1YA 1WMAA 5CDUA 3TZ6A 5EESA 5J23A 3AI2A 3V1UA 1OC2A 2CNBA 1EVJA 1C0PA 1ENZA 1OBFO 2GPTA 1IPFA 2I66A 1DC5A 2P4QA 4XD2A 3ZU4A 3RKRA 1LUAA 1JKFA 1KVQA 3DOOA 1DRUA 1UH5A 4YJFA 1XELA 1EE9A 3IIEA 5B37A 3DBLB 1NP3A 2X1HA 3A9WA 3V1TC 4E2ZA 5JAQA 2OBYA 3WIDA 3BTOA 4NG5A 2EWMA 4YAEA 5BSGA 1U3WA 3W1VA 4BV9A 3HB4X 4EUEA 1HE4A 3FNFA 1I36A 4IDBA 5DZSA 5THQA 4R3WA 4OKIA 1JWAB 4J4HA 3TOZA 1GL3A 3UFXA 3UUWA 3RCBA 2AXQA 3H3JA 4XA8A 3E9NA 1ZW1A 1CETA 2PD3A 3WJAA 1IB6A 4CV2A 4E32A 1E3WA 5CPFA 3HB5X 4YVFA 5I9NA 4AJNA 3KEQA 3F6YA 5IN4A 1XEAA 3OFSA 4XR9A 2EEZA 5JLAA 1LLCA 4AJEA 4R3NA 4BB5A 6ADHA 3ORFA 3L0DA 3WFJA 4WLFA 2HRBA 4K6CA 1LU9A 2E48A 2O4UX 2WTBA 1KETA 3DZIA 1YL7A 4BO9A 1HDXA 4XB1A 4F6CA 3RI3A 4OIMA 2HK7A 1KOLA 3TOXA 2PZJA 2SCUA 1QLHA 4A73A 4CODB 5AOVA 3ZNQA 1DIAA 3ETDA 4XB2A 2Q99A 3PFWO 4R16A 4YYZA 3VZRA 2NQTA 5FWNA 1NM5A 4PN3A 4KWIA 1LSUA 1MC4A 1WDLA 1PZFA 3F46A 2ZB3A 2GZ2A 4BGEA 5HTOA 1A27A 1AE1A 1QORA 1DBVO 1I3LA 1MB4A 3HQ4O 2ZTUA 9LDTA 1TLTA 1FMCA 1U4OA 4OKNA 3RUEA 4EEXA 5JW6A 3WSWA 4CMIA 4Z3KA 1Q7CA 1DIHA 4M8SA 1HL3A 1XG5A 3RBZA 4RVDA 4NNJA 3R1IA 4BB6A 2I3AA 1QYWA 4NR0A 4MVJI 3GDGA 1HE3A 2CZCA 1KVUA 1B8UA 4QFDA 4RPKA 3JV7A 1GZ3A 2DPGA 1O9BA 4IDEA 5TT0A 1T2DA 3R3SA 3FRJA 1NPDA 3HUDA 4CJXA 1BSVA 3WYEA 4ND1A 3OMLA 4IDAA 5FFFA 4A03A 3NYWA 4N5NA 2YHIB 3KUXA 4WUVA 1ONNA 3OIDA 3DBHB 4LMPA 4MJLA 3S1LA 2CVOA 2NWQA 3BHJA 4YQZA 4YJGB 3AU9A 3UH1A 1PL7A 3GPDG 4AVYA 5C7IO 1B15A 5EMHA 2ZTLA 1P1FA 3ASUA 4E2YA 3TFQA 1T2EA 1WZIA 2H5LA 3ZU2A 3D4PA 4J3FA 4Z0TA 1LI4A 3U49A 2O7QA 1Y9EA 3TZKA 1LSSA 1EBUA 3JQBA 2FR8A 3OQ6A 2D5CA 4XX0A 4BGVA 3BXXA 1DEHA 3F4LA 3TDKA 1LDGA 2P68A 5EINA 1XA0A 4AJ4A 1OC4A 3VH2A 2FPIA 2ZYAA 3GY0A 1CYDA 4WOJA 4CQLB 2DLDA 3H6KA 1IZ0A 1SB8A 1T2CA 4J0FA 4XIJA 3MOIA 2J8ZA 4U0JA 5ER9A 3ASVA 3HG7A 3NDIA 4YAIA 1O0SA 1PJLA 1U28A 4XGKA 1DFGA 5HRUA 1C1DA 4OOEA 1PJ3A 2CD9A 4XRRA 5F1OA 4ZQHA 1I5RA 1B0AA 1IY8A 2BFMA 2Y66A 3M6IA 2GYYA 2BFOA 1LDNA 4J91A 5ICMA 4DWVA 1GCOA 3KLPX 3KO8A 4EGFA 1G1AA 3ONDA 5GY7A 4OO3A 3L4BA 4FOOA 3BMNB 3NTRA 2FOIA 2I3GA 1UXGA 1TXGA 4JN6B 1QLJA 3GUCA 5DDIP 1ENPA 3WBFA 2OOSA 1BMDA 4DUPA 5HS4A 2DTXA 4MDHA 1SPXA 4XQGA 3INTA 4O1MA 1DRVA 1RM0A 2PK3A 4DLBA 1LQTA 3ROQA 5H83A 2CVZA 5H81A 2X0JA 5BSFA 5KJ1A 5AQ1A 1Y8RB 3H9QA 4NK4A 3H7AA 8ADHA 1E92A 1LSJA 2HJSA 2VZ9A 3V2UA 3WGHA 4RJTA 3U4DA 4LGVA 3K2EA 1RYEA 3X2EA 2QX7A 4CLDA 3JQBC 1JKJA 4S3MA 4RVSA 1ZVMA 5CDYA 4XYMA 3V2GA 1R0SA 4D7AA 4J2HA 1H2HA 1LXCA 4EITA 4R1NA 4E5KA 4OSOA 3PFFA 4XRGA 3W8EA 4UEOA 1UXHA 1W6UA 4GPD1 3W8DA 1EE2A 2VHZA 1L7DA 3BMQB 1B3RA 1N5DA 1ZK1A 3NTQA 4ZN6A 4ESOA 1ARZA 1N9GA 2J6IA 2JHGA 2DBRA 1E7SA 2VOJA 4ILKA 4KP7A 4BO1A 4KDFA 1PS8A 1HDCA 2GN9A 4D3FA 4RVHA 3GHHA 2Q50A 2IZ1A 3U09A 1U7TA 4D44A 2C59A 2HDHA 1LDBA 3ETGA 1EDZA 3E5RA 1MFPA 3WWYA 2ILTA 5KJCA 3GVCA 1BW9A 4GMFA 3PVZA 2EIHA 5H82A 4FFRA 4BGUA 4BNTA 2NTNA 3LT1A 4YT2A 1D3AA 4NJMA 1X13A 3GR6A 4BGIA 2FY8A 3L4BC 4HP8A 5JCJA 1DDOA 3MCVA 3RAJA 3AI1A 3PHGA 1DPGA 1FDSA 2Y1EA 1VJ1A 1BVRA 4O6VA 1V8BA 3WGYA 3GK3A 4MVJA 1XIVA 3DZKA 3GGGA 1VSVA 1XU7A 2WE8A 4Z3DA 4TVOA 4RQUA 2EKLA 3DOCA 4PG6A 3AI3A 1LLDA 4OH1A 4MVJH 3BZUA 1DFIA 4OQZA 3IS3A 4WLUA 4CMAA 3KM0A 4OGWA 2CVQA 2PZKA 3D3EA 5G4KA 4E31A 4RORA 5JCJD 1KBZA 1E3EA 5AXBA 3AM3A 3JQ8A 1GYQA 3IKTA 1HDYA 4CM4B 1LDEA 3DWFA 4CV1A 3RBVA 5L7WA 3DOJA 1IUKA 4CLOB 1C1XB 3BYZA 4IGFA 4MVJD 1FDUA 3WQQA 3UCFA 4ZQGA 1PJQA 4M86A 5KWEA 2DUUA 3DBRA 3GFBA 3H2SA 3CMCO 2WYUA 2X9GA 3WMWA 1ZXLA 3PZRA 1KYQA 3ZU3A 1UP4A 4YACA 4BVAA 1H6BA 2AE2A 2YYYA 3KB6A 1UDCA 1HXHA 5IJZA 4YJHA 4B7CA 4RVFA 4J0EA 4YAGA 3VTFA 3H3FA 2AQKA 3MJSA 4LK3A 1FXSA 4BO6A 1GAEO 1IE3A 3MJEA 3PTZA 1P31A 4IGEA 1B16A 2WDZA 3UGKA 4L4SA 1Y81A 4PG4A 1BTOA 4WOKA 5GZ3A 4PZEA 3NJ8A 2CFCA 1ZKMA 3KZVA 5CG1A 3NGLA 4GSKA 4XR4A 5A1TA 2O2SA 4JJFA 1J5PA 4RGBA 1ONOA 1JU9A 1DRWA 1NAHA 1KIFA 4RL6A 2Y0DA 1ORRA 1E3WB 1DAPA 3KVOA 1VKOA 4BO2A 3QVTA 4PLVA 1VL0A 1LDYA 2AQIA 1E1LA 3IMFA 1ENOA 2OORA 2EW8A 2YJZA 1YWGO 3WYCA 1JA9A 3VVCA 2A35A 5A3JA 3I3OA 1EQUA 4L76A 4B7UA 3VKUA 1YL6A 3ICPA 3O8QA 2FWMX 2P91A 4E5PA 3GN1A 4L74A 4B3HA 1E6EA 2X9NA 3FNGA 1HYEA 4PLZA 4UEKA 3JD1A 4Z9YA 1E3JA 4QECA 1GD1O 4FJ1A 4DRYA 4WLVA 4M1QA 1S6YA 1NQ5A 4PLYA 4I8XA 1P44A 2O2YA 5DF1A 4OYRA 5CEJA 1C0IA 5G0VA 2JAHA 2X23A 3VH4A 3FWZA 2NTJA 1XDWA 3ZWYA 2BGLA 1P1JA 1GEEA 2LDBA 4MVJP 3QVOA 1K2WA 4JNKA 1ENYA 4CMIB 3VZQA 1BGVA 3OECA 4LISA 4IMPA 4NHEA 1ISHA 4IZIA 2I5PO 3H65A 3UW3A 3WB9A 4FS3A 3ZW8A 1MFZA 2QQ5A 4DMLA 4R9RA 3C1OA 1Q0LA 3M1AA 4XGNA 5HA5A 3JQCA 4IS3A 4F45A 2R6JA 1CERA 3FPLA 1WAMA 3DAFA 1BXGA 3LC7O 5TLSA 3GOHA 4ALLA 2J5KA 2DPHA 3DMTA 1O95A 4FJ0A 1Q7GA 5JY1A 3GH3A 1YO6A 3K92A 2EV9A 3SEFA 4DPKA 3IJRA 4Y98A 4A26A 2VUSA 1E3IA 2WSBA 3ZWNA 3UN1A 1C0KA 4NBUA 4JX8A 1B8VA 3E82A 3PDUA 1H9AA 5BSHA 1NVGA 4BS9A 5JYDA 4U8GA 1EZ4A 1PGNA 1I30A 2R00A 3NT4A 1I32A 2JL1A 5F5NA 2B37A 4YAKA 2D5AA 1HDZA 5IXSA 1H94A 2PH3A 3RUCA 5KIAA 1A7KA 3I9MA 4EUHA 3SJUA 4EJ6A 2EKQA 2Q49A 4D41A 1GPJA 3K5PA 3EK2A 3PJDA 3F1KA 4PLPA 1ADCA 2LDXA 4FC6A 1A7AA 5JPIA 4J43A 1BWSA 4PIVA 1WWKA 4WKGA 4YT4A 4RLSA 2O50A 3T7EA 3E1KA 2X5OA 4U7WA 2B35A 4FFPA 4Y6RA 4BNGA 2VTEA 2C20A 3D7LA 2Q1SA 3C1AA 2G0TA 3M1LA 4R9SA 1C1DB 4J2OA 1I2CA 4JROA 3KHUA 3Q0EA 4N5MA 2QYSA 2DQ4A 2NLOA 4MVJF 3DMTC 5ITWA 3I9KA 4DREA 5JE8A 3U3XA 3K31A 2B83A 1W0CA 3TQHA 4L4XA 2O3JA 3MZ0A 4AJHA 1M6WA 3JQAA 3GVHA 5EQDA 4CL8A 3WGTA 4IDCA 1XHLA 4IIUA 1QXSA 2JCYA 2ZB8A 4UUNA 5DOVA 4ZGWA 4D0SA 5KKAA 3TF5A 1SNYA 2VRBA 3ZW9A 2BFPA 4TKLA 1N7GA 2D59A 4ALKA 1EVZA 4R68A 1LNQA 1NQOA 1KC1A 2AW5A 2J5QA 4YT8A 2F00A 5EL0A 2R00C 4RPHA 3WGZA 3ZCXA 5TX7A 2IEDA 2IZ0A 3PDJA 3KETA 2J3HA 4TRNA 1QV6A 4TKMA 2ZQZA 3ZWCA 1AUPA 1FF9A 5IDWA 3NJ4A 1WMBA 3QHAA 2VCYA 1RM5A 4DPLA 4BKOA 3JYNA 1WW8A 3JQGA 4B4OA 4KQWA 4ND5A 3RC7A 1ZK2A 3JQAD 5JNLA 2C2XA 2W2LA 1BXKA 3SJ7A 2OL4A 4GI2A 2NACA 5L3ZA 5COQA 1BDMA 1P77A 1ADFA 2CF5A 1IYZA 4CUKA 3AM5A 3LZ6A 2X7HA 2HRZA 4JGBA 1YXMA 1HSOA 4IXTA 4JBIA 1N9GB 1GCUA 3C24A 1C14A 4MP8A 5TC4A 1ML3A 2P5YA 4J9UE 3IC5A 4E12A 2B0JA 4IS2A 5I7EA 2FMUA 3HDQA 2BI8A 3C1TA 3FNHA 5TGDA 4RPGA 1U8XX 3GGPA 3L4SO 1PR3A 4KUEA 2VNSA 4YJDA 1DC4A 2G1UA 4FN4A 3KSUA 3HN2A 3QWBA 4CMEA 2W2LD 3GZ4A 3PWKA 1BW9B 3RFVA 6LDHA 2CY0A 2OBNA 1E0DA 1LLUA 1ULSA 4NJMB 2Y1DA 5EQFA 5I9LA 1JAYA 4GSLA 3DTYA 2O3UA 2W90A 1SOVA 3ZWWA 1NPYA 4NMHA 4YQYA 4ND3A 3FHLA 4GX0A 2HUNA 1T1SA 4MVJE 1Y5RA 2ZYDA 1T26A 3BA1A 4ALIA 2DC1A 2H63A 3DHEA 4YTEA 3ZV4A 2O7SA 1WPQA 1QMGA 3CXRA 4IJKA 3COSA 3FBTA 2Y1CA 2DT5A 3ROMA 4UVHA 4QXMA 2QIOA 4CM3A 1A4IA 4E13A 3DHNA 4WNIA 1NAIA 3BMOA 4JP2A 3OIGA 4FFMA 1OI7A 4XEHA 1HWYA 1Y9AA 2CMDA 4NFSA 4BO7A 3FCOA 3JQ8B 1HT0A 4GL4A 1RKXA 3LC1O 3M2PA 1E1NA 3TL3A 1DLJA 2V7PA 1JN0A 2FR1A 3C7DB 4Z9FA 1C0LA 4BMSA 1NASA 1V35A 1U8FO 3DL2A 1FK8A 1HE5A 1LC3A 1UDBA 3RASA 2NM0A 3EDMA 4CLHA 1ZJYA 3DMYA 3QVSA 5IDXA 3DBRB 2NU9A 1J0XO 1I3KA 2IYOA 2V6MA 4TRRA 1NQTA 4IBOA 3GMDA 4H16A 2UYYA 5C5IA 1GUFA 3JYLA 1IOLA 4D42A 3K30A 4CMEC 4JJGA 3F47A 1QYCA 2HMVA 4YJHB 4RO0A 5DCWA 5IDYA 5U9CA 4RF4A 4Z6KA 2GN6A 3ZNPA 1QP8A 2GERA 1D7OA 3I6IA 5TIIA 4CLRB 2JKVA 2ZB7A 4RCVA 3ROPA 3TFOA 2D4AA 4MKZA 4PLGA 2C7GA 5A02A 1QRRA 5AXCA 4K28A
chains in the Genus database with same CATH superfamily
1L0BA 2FEAA 4MQ6A 3ZHQA 1FS4A 5LOVB 5TMPA 4HT3B 2R6FA 1BKSB 4K3VA 2NP6A 4RCZA 3BWBA 1RD4A 3D2LA 3O38A 3HEBA 5DCYA 3WLPA 4PBSA 4IKEA 3BMCB 1ZSVA 3IVCA 2Z6VA 4OB7A 4AQ7A 3DNPA 4ZVRA 2I03A 1B42A 2QVXX 4OAQA 3WHPA 3ASZA 1N2CA 1P73A 3MWDB 3L0IB 1T4GA 3THWA 2JF0A 1IXZA 1QM5A 2IEZA 4D0RA 4F3CA 4JHLA 1U5BB 4G1EB 1F0YA 2ACVA 2NSJA 1O8BA 3Q87B 4ZCLA 3MHTA 1XTUA 2GEUA 5F1KA 2AJTA 4CR8A 2OOKA 1P33A 1PR0A 3L7BA 4FKMA 4DTCA 2RKOA 2OECA 4W7IA 1RAHA 3CY6A 1SOAA 1T0JB 4M0DA 4MINA 2QRZA 4ENRA 2VQFB 4R7GA 1A8UA 3R9XB 3OA0A 3KOWA 3TOSA 4PRLA 5FB3A 2ZJ0A 2CJPA 3AWIA 4DNPA 2DY0A 1LVHA 1X14A 4MV9A 1QGDA 4ZVPA 4C07A 1AGXA 3AL2A 4Z8XA 1U7OA 1UDXA 1XAHA 2AEFA 4F85A 3CT4A 1G8FA 3KZOA 2A57A 1OAAA 3PIRA 4OSEA 3NC1C 7MDHA 1PL0A 1U0LA 3KQSA 1IIRA 4PE5B 3HACA 1YB6A 5F35A 4ZMSA 5MN5A 4PGHA 4BQPA 4ZA2A 5BMOA 4BVFA 3I62A 2FUG6 3IDSA 4PYNA 5JQGF 2ZZNA 2MTBA 1M1NA 3H9UA 4BFVA 5EJ6A 3OM0A 4UHHA 4AJOA 2YIMA 4KXUA 4JLMA 4MRMA 3LAWA 5G3ZA 3O3MB 5CX4A 2DBZA 1OTYA 2JAPA 3A4YA 3AP1A 1A5AB 2PMFA 3QLUC 3SF8A 3H3XA 4A8PA 3GBVA 2H51A 2J7PD 2GARA 1PJAA 4O2RA 3OTWA 4HI0E 5KI6A 1UMDB 4MGHA 2CK3A 4M1WA 2ZUEA 4JEIA 4Y9UA 3PI7A 4LYDA 1IMJA 1E6MA 1EFPB 2CL7X 4HRVA 1THZA 2ACKA 3BB1A 4MUFA 1VMDA 3ER9A 1C9EA 3SC6A 3TAXA 4D3YA 5IK2D 4BNDA 3Q9NA 2EBWA 4QM6A 4RK0A 2XYQA 2HK6A 1P9LA 2BM9A 4RVUA 4K81B 3LU1A 1GGKA 4L7VA 5G02A 2JAOA 4TVBA 1D09A 3GD5A 2HNBA 2Z83A 3NNNA 1U9CA 3OLQA 3I6QA 1FSGA 4N0QA 1VBKA 4RY0A 4UMFA 4GL2A 4LK2A 4YHBA 3TLCA 3MMZA 3LF1A 1KDRA 2NPOA 2OBXA 3K73O 3VR5H 1DQNA 3CJRA 1FUYB 4FHCA 4GMXA 4OREX 2VK4A 2YQ4A 3FNQA 5IC4A 1CEEA 3CVYA 4WCFA 4N7MA 3E18A 4RHUA 6GPBA 1BWPA 2ESRA 4XQEA 4H08A 2Z2KA 3MMSA 1OIXA 2VXCA 1HNZB 2EIXA 3N2YA 1NW6A 5FCDA 3NYQA 3W5VA 1BC5A 5JV5A 1FFYA 7REQB 4XFDA 3UJ6A 3WP1B 3OZDA 2I6QA 1GV1A 3V4PB 4MI1A 2GPNA 2ZROA 1KDTA 2I4MA 3V00A 1N2EA 1QX4A 3TNDA 1HX7A 1V8OA 1NFFA 2WM3A 2OC4A 1XAJA 3AW9A 3WBKA 3A28A 4AICA 3AY7A 2V6GA 1L5LA 5IJAA 4MUBA 4Q9LA 1PD1A 3NUZA 1BG6A 4XJSA 5I8ZA 4EW6A 1W4AA 1IATA 1GXSB 2Z5GA 3FR7A 3L1UA 1V3TA 1XA3A 1J2YA 1QQBA 3NVAA 3DBVO 2FW9A 4HCJA 3SKYA 3H2IA 4NWIA 1T1JA 5C5CA 4M6WB 4CEIB 1SIWA 4OJNA 4MDFA 1V9LA 2WM8A 3OZRA 3TSYA 3ZVMA 3LX5A 4QT4A 2EWVA 1RQXA 1YJXA 1Z8FA 3A9CA 2OXRA 4O4JB 4EA9A 2D6FA 3ONFA 2CMHA 4RV5A 3QUTA 1WPGA 2WUFA 3ICVA 4C7MA 3PNVA 4H3HB 1Z6ZA 1GADO 3SE0A 4NS1A 2JLZA 3Q7RA 4OXYA 5BUQA 4WESB 4ZQFA 1MF7A 2ZIZA 3G02A 1NGSA 1XZLA 4F5DA 4BY9E 2CSUA 2ICAA 2WFLB 2XQJA 5AQEA 2PUTA 2G06A 4XWTA 3DZHA 4Q6WA 3AY3A 4GX1A 5JYEA 3THRA 5E1MA 3OIYA 5IFKA 3SBOA 4W7HA 3U44B 2Q6KA 2CXNA 4HBGA 1L1RA 1SAYA 2Z8XA 4N41A 4U1RA 3VKHA 2P9CA 4C5AA 2G1AA 1I24A 3ETJA 3F8WA 4G0PA 4HB2A 4HX2A 4LHEA 1Q1NA 3R3UA 5JDIC 2X0RA 2WT9A 4LQLA 5FI5A 3HYRA 7ABPA 2BKUA 4P5PA 4O4LF 3EGXB 1SHKA 1TI7A 1VB3A 2YJ6A 3G8DA 3BFVA 3VU8A 4NBRA 1J6UA 4RSRA 5HFAA 5K0EA 3KQOA 3GRZA 3PD0A 3PTAA 3BWYA 3R41A 5CFLA 1VFPA 1KP3A 1Z8NA 2OMEA 2QHXA 3QY9A 4MCHA 4MW9A 4Z9BA 1AZTA 3TX6A 4RTKA 2HMTA 1E3QA 3QU9A 2VP3A 4DBZA 3E9MA 2C7VA 4OHRA 1CPYA 4L50A 1JJAA 3OSUA 5EZYA 1RYMA 1VECA 4LFBB 4RWEA 5FOQA 5LUAA 1OYYA 4IW3B 4AJ1A 1NUPA 1RKUA 2PRIA 3GFGA 4JT4A 4HQFA 3IEPA 2BONA 1O96B 1RRVA 1PFKA 3ZS8A 1BZYA 4CQJA 1EUZA 5KNDD 1ZIOA 5FRDA 4C5BA 2B20A 1WNTA 4TPKA 1E79A 4FYYA 1G20A 2IOFK 3AFOA 5F2KA 3U3JA 4C7JA 5H16A 3IEKA 3L8DA 4NFYA 2MSKA 4KSBA 3HKDB 3QU7A 2PX5A 5CJPA 3SFTA 2RHMA 3WL6A 3E9EA 3CUTA 1LRKA 1UXKA 1ISFA 3GZNA 4G4IA 3AF2A 3JVUA 3OEWA 1QH9A 1PTKA 1MNQA 4UHKA 3PFCA 2C92A 1YR8A 3PC3A 3QYPA 4K0KB 1GKKA 2QW1A 2XT9A 1KMMA 1QO9A 1QPGA 2Z9CA 3LUGA 4G2NA 2IDJA 4P34A 3PENA 5AJVB 1NW9B 5IAGA 2CSXA 3A58B 1XF9A 4MS4B 3FZYA 2RHBA 4KLRA 5DH9A 2HSWA 4MW5A 5HNKA 1PLJA 5KCZA 4MRRA 1L7NA 4TRMA 4F3YA 5LP6F 1XCMA 4I5FA 4HNVA 3OCJA 4Q4DA 1P7YA 2C4UA 3NTOA 4GG1A 3N2NA 1HOXA 1R88A 1T9AA 1S4QA 4Q82A 2IS6A 4E3WA 3QVGA 1HA3A 4FLFA 1G8KA 1KI8A 2TMGA 3HYLA 4X85A 4LF6B 4N6OA 4LN1A 1SCBA 4YV1A 1ULBA 3WLLA 3T06B 3H4VA 5JJBA 1T2VA 1XQ9A 3PQ2A 1OXSC 1W2HA 3SZOA 1XZBA 3HCFA 1SKYB 2JJYA 3QE2A 4L73A 2AQ8A 5C7LO 3PPIA 1IZYA 1V1RA 3ETNA 1HEUA 3LK7A 1R4MB 1VRVA 3Q3GE 3WGNA 4B6FA 4BJHB 4ZI7F 4MRNA 4NKRA 1Q7RA 3M6XA 4Q39A 2H06A 4RZSA 2ZUFA 1GU1A 2DQKA 2NV0A 3QXSA 3AG6A 3IIJA 3LMKA 1WVMA 5A7HA 5LB4A 2IXTA 4QPCA 3EC7A 4LDQA 1A1VA 2PMWB 4MV1A 2HA2A 4C06A 3ECSA 3VTZA 2DTEA 2GZ3A 1PW7A 3NNSA 1E99A 4RFLA 2QNRA 1XJCA 2V7EA 3BFJA 2VPYA 3BA6A 3EF3A 4G5HA 4M83A 4NAVA 3LXUX 2PVSA 3W0LB 4QGHA 1FZTA 1ZK3A 2BI4A 3ZDAA 4OHVA 1XQ6A 1NWCA 1N92A 1QE0A 1BS1A 3FFBA 2ZK7A 4W8GA 5I7AA 3TCKA 2JKZA 1TL7C 1DZ3A 1CUUA 5BRAA 5LJIA 2Z0MA 4Q7MB 1W1WA 3TSCA 2HO5A 3BIFA 1OCEA 4RPJA 2J31A 4TQGA 5ECYA 2C3UA 2IZZA 1QVVA 3JD2A 3EEIA 2IYTA 3G0OA 3E8SA 3KUUA 2WT8A 1PG5A 4IG9A 4PYMA 2DFDA 4BNWA 2O8CB 4NDAA 2UZAA 4KQ9A 1I2BA 1WDTA 2WPDD 1SUDA 1PZMA 3I01M 2Z1NA 3VR3A 9ATCA 1L5YA 2QAIA 1K68A 4DIMA 2IY8A 1DNPA 1H42A 2AI1A 3MCUA 3EQ6A 3K9NA 3DAOA 4KXLA 2NX2A 3QLEA 3IVMA 3P5BA 1BQEA 1OZGA 2PZEA 4YONB 1GLGA 1OLSB 3PB3A 3UF0A 2CV0A 4M89A 5IPFA 3WGLA 1N7IA 3LTEA 4GPEA 4LSWA 4XQCA 4ZCPA 3QVLA 1EK0A 3TNYA 5F73A 4B8YA 2BUAA 2I2WA 2AOVA 4M8KA 5JH7A 1HDOA 4KVFA 2PMCA 1FDRA 3N6RA 1LWOA 4XWYA 1F1BA 3B6IA 3N58A 4KQHA 2AOWA 4F46A 3B70A 2VHCA 2ZI5A 3IEVA 3CH6A 3IR7A 4J1TC 3AB8A 3I83A 5AUNB 4XIYA 2V6FA 3HJGA 2QQFA 1X7ZB 2V0NA 4MWTA 2FG7C 4RKFA 2YV5A 2GILA 2Y71A 2X6TA 5CYOA 5A4DA 1ZJJA 3DAPA 1KQPA 4C76A 3HWWA 4XGQA 1HY3A 1IRIA 1G7RA 4MPPA 3TOCA 4KLAA 4K9NA 3FLBA 2UUBB 1DI0A 4RHCA 5DM2A 5KWVA 1I2AA 4UVEA 1F3LA 2ZE5A 1XU4A 2CJFA 1CF2O 2GSWA 3ESYA 5DPMA 3HFGA 5AJYA 3ES9A 4WOBA 2QLJA 3HBNA 2Y0PA 3PR2B 4QBIA 2BGWA 1B93A 4UAJA 4EKDA 1L7MA 4BAGA 4KNYA 1C7FA 5ALIA 1P74A 3PQ7A 4KBGA 5ITZA 3BK2A 1YVEI 2Z5VA 1ZYUA 1SWVA 2PGNA 3TM4A 5BQFA 1CB7A 2C77A 1OFGA 4LVOA 1ZO8A 3CZ5A 3MN1A 1LW6E 4ZTBA 1JG4A 3HA3A 3CR8A 3MWEB 5HBRA 3SFZA 4DIDA 1N4AA 5K6AA 3RU3A 1KPHA 1T43A 3QENA 2XNDA 3TQSA 1CVIA 4BWFB 4JFAA 3CG0A 4LY9A 3AHJA 2X0FA 3CEJA 3FSGA 3NONA 1BJKA 2NYAA 1KY4A 1NKSA 3JU3A 4FVTA 3D7NA 2PQ2A 4Q3LA 4X95A 1CEQA 4XLZA 1X2BA 4IQFA 1U0JA 4I9NA 3WWCA 1WHSA 1JS1X 3F7NA 4ZALA 2G5CA 3GRKA 1NJ6A 3OOJA 4LVNA 3S2IA 4EZBA 5L40A 2OV4A 4RMGA 4Y9TA 3AHGA 1GPKA 3RBXA 2O2HA 3NAQA 3PFNA 1Q2UA 4P4NA 4P8RA 5ULLA 3OQNA 3A31A 2DQYA 1XNHA 3UV3A 2CNWD 3UTDA 2DPLA 1QPBA 1SCUA 2EFEB 1I1QB 2OCPA 4I4IA 5AVOA 3R9IA 2XB9A 1P2DA 2C84A 1RW4A 1WA5A 1H66A 1YE5A 2FOXA 3NBFA 1DWUA 1VQ1A 4M3NA 5CCEA 3BXFA 4I55F 3O4IA 3NTLA 4Q4HB 3A6KA 2C03A 2X7XA 4Q9HA 4Q9KA 2XGJA 1SC4A 3AVUA 3EGOA 4EHNA 1F12A 1FC0A 4WOCA 1UR5A 3KLOA 5JZOA 3HZHA 1PX0A 1ZI8A 4HXYA 4GPBA 2XLBA 4KGDA 1DTEA 4MGIR 4XSHA 1GGNA 2Q5LA 3KXIA 1A71A 3T4XA 1PTJA 2B1JA 1YBHA 4Y2RA 4B74A 4BKQA 1WB6A 3TW8B 5DYIA 1UFQA 3L43A 4S24A 1T1EA 1W4LA 3BD9A 3CLRD 1X7WB 3C5CA 5ITSA 4LJAA 1PLLA 2BP7B 3T9FA 1XZCA 4PX5A 3NH6A 1WCIA 4F5YA 5ILGA 1YQUA 1U2DA 2WWXA 3X1YA 3C5HA 1PJTA 1BIFA 2B7CA 3I9LA 3N1UA 1G98A 3K2BA 4H18A 4NU0A 2OBBA 3KJXA 5HXAA 2FSSA 2ZCJA 2NV6A 4OB6A 1O7JA 2VYQA 1MZVA 2B3TA 3LLSA 4RTNA 1M1YA 4YLYA 4PX3A 2JRCA 3LWNA 5DBHX 1R66A 4WHMA 1LBTA 1GARA 2H1SA 1ZRSA 2JGKA 3L0PA 4B40A 5HQTA 1B26A 5KNBD 1JLLA 2KX7A 3LYHA 4LUCA 5LZ5A 1EUQA 1U98A 1PBNA 1V1MB 1HTWA 1Z4PX 1KKLA 3QFTA 5DK6A 4IZHA 4GO1A 2H4ZA 2CNDA 1E4OA 4TTSA 4MA5A 5KNDA 3FB4A 5AIBA 2XRMA 1P1BA 5D6OA 2E9SA 1VE6A 4PCUA 4W7SA 4L8LA 1YCGA 3G85A 3KR1A 1O2DA 4I5DA 4KW7A 5T57A 4FUQA 2DTDA 3H5AA 1ECLA 3P4UA 2EQAA 4G56A 7AT1A 3T4EA 1DHRA 3ZGXA 1IFXA 1C7RA 2MYUA 3OP1A 3ENVA 4R05A 3ADOA 4KPUA 1BA2A 3TLGA 1YBFA 3FY4A 4UC0A 2O8BA 1U0GA 1Y3HA 4KQ1A 2VTBB 2F1RA 1X15A 4MVJG 3WJ2A 1YRLA 1POWA 4PGGA 3GUZA 1QYDA 1U99A 1WSAA 2X4DA 5E9AA 4Q00A 4EG0A 3FPKA 4CF4A 1ISGA 2G7MC 4PYIA 4BMPB 2ZUSA 4FW8A 1VMKA 2UDPA 4Z9XA 3ITKA 3TLBA 4RTLA 2FZKA 3CLHA 4WINA 2QVBA 1FLVA 4KR2A 4RMNA 1JKJB 5BQOA 1EK5A 3KLNA 1ZVJA 1PX2A 1T0BA 2X1VA 3B2EA 2D7JA 3P0RA 3PC6A 4KDCA 4QEKA 4QTTB 4EPRA 4F86A 7ADHA 3MWLA 3JZIA 5B1DA 4C0LA 4DM3A 1QGYA 4ALNA 3DMRA 3N8IA 4IHJA 1P7WA 2F4NA 3ICWA 1ESEA 4INAA 4RFSA 4OMUA 1IPHA 1F06A 2ZCVA 2UV8A 3L6UA 1NNSA 2IBMA 3CRW1 1OUMA 4NV3A 5U4QA 3D2CA 1MTZA 4US1R 1LDMA 2A59A 1ETUA 3F5QA 3IMCA 3WOVA 4IUCS 2R6CA 1DWQA 2R47A 1NDHA 4NJEA 3RRBA 2DFKB 3FHJA 3H7IA 4FNMA 2JD1A 3WLKX 2HJHA 2QU8A 5GAJA 4BMCA 4YK7A 1H93A 2CE7A 2WIKA 3JTMA 5EUBA 5A2GA 2XMSA 1C3JA 3D7KA 3Q7QA 4MTCA 1R1DA 2J59A 5EIBC 1ZGGA 2BDUA 4NRDA 4A0FA 4X1IA 3KTAB 4ZI5A 3PNMA 3AINA 3NHLA 5T6MA 3RJ5A 4B09A 3FWNA 4RXTA 1DQSA 1YE3A 2DKNA 2H5JA 4YP7A 1ULUA 2VRCA 2YY7A 3K0AB 2WA2A 1M2JA 2IYSA 3Q88A 4DUGD 3JVVA 5KKCA 1QDUA 2GO1A 4MKRA 5JNVA 3OJLA 3PGKA 5MN6A 2OFPA 1Y4SA 2HF7A 4K9SA 1JF8A 5CVCA 5KYTA 3L1KA 1CUYA 2R84A 2H4XA 4YMLA 1AB6A 4K6GA 2FMHA 4N48A 2BAGA 2MT9A 1M66A 2WU0A 1AC5A 4X7BA 1QZTA 4B2YA 4CGYA 1ZD2P 3HGQA 1OD6A 3T3NA 3DFIA 3ORRA 5IBQA 4R5HA 5ICGA 2WWRA 5DRTA 1Y1KE 1H3EA 1OY1A 4E4TA 3H9GA 3EYAA 5TNXA 3RVMA 4AZ0A 1KA9H 1N77A 2Q2WA 1KPIA 3ND6A 3CCBA 3CJTA 5ICFA 3HCBA 5IN5A 3WGUA 5CNMA 1NU6A 4TS1A 1RZ3A 2OXFA 2ZTHA 5FI1B 1KFJB 3RVPA 3HCNA 4GMKA 4UXIA 2CDCA 2XDWA 5DTJA 2E4WA 5G4KB 4RANA 4H0NA 4QTXA 3AESA 2BLNA 1OMOA 2VDNB 1SA0A 1Q0UA 4N3CA 4FOSA 3OI7A 3D4OA 1QKJA 4QD3A 5IUJC 2WRZA 3KB2A 3JYOA 3STXA 1B41A 1ZD1A 2EP7A 2P1DA 3G1WA 3KKEA 1LI5A 2HFJA 4M1SA 1LLFA 1MO3A 2HJRA 2BGGA 4ZV7A 4JDPA 3K9GA 3L6CA 2JBAA 1MQAA 3KPYA 2PS0A 1U5AA 4O4HF 4B3GA 1P5ZB 4MO9A 1R12A 4CW7A 1E9FA 3Q1KA 1WZ2A 4HUQB 1EVEA 3ZDYB 4FFVA 5KTMA 3A8TA 1CY2A 1CBUA 2QE7D 2VATA 2Q1UA 4CQMD 3U6BA 2IC5A 1JVSA 2I2AA 2J32A 1SXHA 3S2ZA 2Q07A 5CVUA 1CIVA 3MB8A 2O48X 2AG1A 1W36D 2DVMA 1DJPA 4KV9A 3MYYA 4NCJA 5LQMA 3QJYA 4RENA 3DWEX 4FILA 4BMVA 3HA2A 3E3LA 4FCCA 3K1ZA 1UBCA 3GU3A 1Q7TA 2WZCA 4H15A 5REQA 1YOVB 3AEQB 3EUWA 2QUKA 5KOIA 3ZR4B 2V55B 2XQFA 2Z2XA 4P7GA 4UBLA 2PRJA 6AT1A 3NXSA 4D8WA 2B2CA 2UVDA 5TEVA 3I52A 2O54A 1UDAA 1MOPA 1Z62A 2CLKB 5DIFA 2Q4RA 5B53A 1QHYA 3TB4A 4AWAA 4F3TA 3UWMA 2PGXA 4HR7A 4LPSA 1Z74A 3UZUA 3ICOA 2GI4A 3L1JA 4HNGA 1NR1A 2R1TB 4DDKA 3MRXA 2DOKA 2W9XA 1L7OA 1MAVA 2G5TA 2WNHA 1EJ2A 1K98A 4IFEA 4L08A 5F4BA 1TK3A 3O8NA 4LRYA 4P4GA 4XIFA 3WLAA 5B3LA 3GX1A 5CDFE 1YQWA 3MJCA 1ZCFA 2M98A 1JE0A 2VHEA 3DMGA 4IUDS 4RDXA 2C2BA 1QJ4A 1GPLA 3D6FA 2C5EA 1O4WA 2NYUA 2OAQ1 1WTAA 1UKAA 3DTTA 3ZD9A 1WNFA 2DM6A 3GFRA 1F17A 1SIBE 4QDKA 4U8HA 2O5CA 3BC1A 2WUGA 4W9NC 2JIQA 3DVAB 4LTNA 4O2BA 1COZA 4NLLA 1ZD8A 1DP4A 4YB8A 4LV5B 5AUQA 1Y3AA 1RI2A 2Q2OA 2QM0A 3GPCA 3HCDA 3K1YA 3O8QB 1A5ZA 2TSYB 3HJTA 4JC0A 2FPGA 3B89A 2RK6A 3TFWA 1JFRA 3EUFA 2R751 3PYLA 4KQ2A 1OBVA 2GNAA 1GUZA 3KK0A 1VHJA 4B3XA 3E53A 1KFCB 1LEHA 1MTOA 4X20B 1ATIA 1JDBC 5IKPA 1WMFA 5JJ5A 1NJSA 2O1XA 3WIOA 3ZEIA 1E6CA 4MKHA 1T4DA 1WXFA 1UJ4A 1HQDA 1Z6GA 2IYUA 3QTTA 3BDVA 4NECA 4G5OA 2WD7B 4BXOB 3DE5X 1KL7A 1RQRA 5HE8A 1TPYA 4Y8VA 3DLBA 1XTPA 2Q4EA 4FN5A 1T2AA 4MWBA 1X2EA 3KKZA 4NBVA 5ECWA 5C3UA 4CV3A 3PNYA 1WBDA 1R37A 1U0EA 2QP4A 4KXFB 4LI3X 4WZAE 3DAYA 1H2RS 1QONA 1X1EA 5G0WA 3W90A 4E2XA 1USIA 4B4DA 5KJ6A 3C98A 2CL0X 2MMCA 2QUAA 3ED5A 3ZJTA 3QXJA 3EHEA 1X74A 2XYPA 5G41A 1H69A 1LFDB 3JQEA 2I99A 1FVFA 3E5MA 4IAOA 4E1AA 1ABFA 2HKIA 2PCJA 1X7GA 3GGDA 4JU9A 2IYYA 5DCLA 3SSMA 1VLJA 2RE8A 1ZGCA 3PSAA 4MW4A 3NGMA 3ZWAA 3RYTC 4DCNA 8ABPA 1ADJA 1BEUB 1B6SA 2PXAA 3F3KA 3EXFB 3F90A 4DJDC 1G0OA 3KWFA 4I1YA 2FW0A 3W3AH 5JVDF 1I2MA 1PZEA 1AU9A 1TUGA 4P7KA 1WW2A 4KHPB 3OHSX 1T36A 1N7HA 4E7PA 4Q3BA 3OT1B 4V0RA 3HB0A 1E66A 2ZREA 4OUKX 3RIHA 3WAGA 4NH0A 1XEXB 3QKSA 2XTNA 5H9VA 1O77A 1V25A 1O97C 3KVNA 4N9QA 3UAOA 2H65A 3LXMA 1G5TA 2ZSFA 2JA1A 1JHZA 3MUNA 4L7QA 2HDOA 1Z5GA 4M8IA 4RELA 2YVQA 1UBMS 4JJ8A 2DF8A 1Y8QA 3C74A 5T8KC 3JQFC 3FLEA 3HSYA 3LDAA 4MYTA 4OEHA 2CWDA 3PGXA 1LPMA 3EMKA 3G2IA 5ENVA 3SYMA 2E87A 4G9BA 4YAWA 1CZNA 3B7PA 4RDCA 4URXR 1ZM2A 5NULA 2I4LA 2VT6A 3GPIA 3E7FA 4A4DA 3O8OB 2ZUBA 3D8SA 5DE3A 2Y67A 3JAWB 5CLFA 5IDQA 4F4UA 1H2EA 1CS0A 2IE8A 3A6DA 2PD4A 3I0MA 3DULA 3MF4A 3DDWA 1PS0A 3A6LA 1ZMRA 2WDPA 5DSXA 1HLFA 2O3SA 4B8ZA 4RC9A 3U6KA 5ALJA 5IF3A 3QXCA 1HV8A 3H1PA 2ZI9A 4L0CA 1YJQA 1RYYA 3AHDA 4B79A 5IAEA 1TZJA 3D4NA 3KD3A 4MJ7A 4MDEA 2J4FA 1K7CA 1N2SA 4Y1FA 1S7CA 1V47A 2JJ8A 5HIAA 2C1ZA 4Q12A 4G1MB 1M6NA 1RJGA 3ANLA 1JU4A 1P9OA 3EEQA 1PS9A 1H6AA 1NQUA 1X1QA 2AN9A 2Y9MB 2OBMA 3AUUA 4NDZA 2P4HX 1RXUA 4B48A 4KYVA 1ZI9A 3ABOB 4PLFA 5K0GA 3BT7A 5JHGB 5J4LA 3E7WA 3PD1A 5BRJA 3E0XA 3LYAA 2WWGA 5ESWA 2FWNA 1C9KA 1NJGA 3QVKA 2Q4BA 4H7EA 4WOPA 4Y3UA 4OHBA 5TS3A 3RVBA 4YUAA 1XROA 2E4VA 2P8JA 3OD5A 5C8ZA 2XGOA 4BNNA 1N3YA 1L4UA 3GT3A 4IX1A 1H6DA 5LYJF 4MX8A 1PWXA 4GX2A 1SQSA 4C0JA 2FUG1 2Q2VA 1P75A 2ZJAA 1E1CB 1X1RA 2QS9A 4R98A 1U1IA 4KWEA 4TS4A 4A6XA 3GC6A 3K6SA 1Z7YA 1YS7A 1GVNB 3WLJA 4A5OA 1U3DA 4CCYB 2N0SA 4U4AA 2G25A 2ZETA 3FYCA 3WOHA 4BRZA 2XVYA 2BTQA 2QT9A 4MW7A 1GV0A 2HU8A 1ZPDA 1RPNA 2OCXA 3F5FA 2HGSA 3GLHE 1MOSA 3N2GA 3TZQA 2FSHA 5AW7A 2G4CA 3OBBA 4UTNA 1GTVA 3IQGX 3M34A 4CDGA 1DOHA 1CWUA 2GJSA 1MABA 1J7KA 3P26A 3P4YA 1MKYA 4QFCA 5LPNA 3WLQA 4K87A 4LRTB 4LY3A 4NENA 4KZPA 2XMCA 2TMKA 5KHAA 5JSZB 4KX3A 1JDSA 2R7LA 3RW9A 3RYCB 2REBA 3OLWA 1G55A 4X65B 5AI0A 3RUPA 2GRJA 5I8PA 2EATA 3CEHA 1Z2EA 2HA0A 3JSAA 4TV9B 1BH6A 1PRYA 2AJLI 4ZOLB 4B32A 4ARIA 1IZ8A 4ZMRA 2XE8A 3T7AA 3L07A 4R51A 4K9OA 4D0NA 3PUKA 4HNHA 4X84A 2G71A 4EZIA 4YV7A 5HJ5A 4GWGA 1NSYA 4MQFA 4C7OA 3RYIA 1FMTA 3E3NA 1EDBA 1U9ZA 2BFFA 1H3FA 3ETEA 4L0MA 4DCMA 4FSHA 1ZESA 3ROXA 2YJGA 4LSMA 2C2WA 2LBPA 3G2OA 4FI3F 4OQYA 1NZFA 5BP7A 2WKRA 3PA8A 2EX0A 3JZFA 4HV4A 3I6YA 1KHTA 4OIFA 2C9CA 4TSKA 3VJMA 2OG2A 3IAHA 3I9FA 4K6MA 4NBWA 1NF8A 3LGAA 3R4VA 4HX5A 4KE6A 4RJJA 4HH0A 3WWPA 4B7XA 2CYAA 4WNCA 2HDNB 1W52X 5DTMA 2VDUE 4XI9A 2OQ2A 2ZTMA 3UXYA 1DC6A 2YN0A 4Y1RB 2VNAA 2ZIUB 5IEBA 4P4LA 4QRHA 2BFCA 4OHYA 5B1HA 1ZHHA 4AJJA 1SG9A 4JLWA 4GMDA 4XCQA 4X97A 1D0IA 1BDBA 3VPDA 3IP6A 2YJ3A 3GG9A 4D99A 4D5GA 2WIAA 3D7SA 3EA4A 3FNIA 4YRDA 3AFGA 1AQYA 2ETXA 4IVRA 1S8NA 3P8ZA 4PPFA 4D8UA 4NNOA 3C5EA 5IYZF 2FPOA 4RTRA 4W5QA 3QX3A 2FJPA 5IAJA 1Z7EA 1VZ3A 4HDSB 5C1PA 4OB8A 5DT9A 3ENNA 5IC5A 2MSCB 4YRMA 3OX3A 3AHFA 4C0KA 5ALZA 2L2QA 1CUFA 2VBIA 1HMPA 2CXOA 4A2CA 1C4WA 1K86A 3DJYA 3M70A 2PGJA 3OIFA 4WCDA 3P32A 5T3UA 2E7ZA 4YXWD 5KSOA 2NZWA 1T10A 1VL5A 1ZH8A 4M36A 1PCXA 1JQDA 2FQ1A 3CB4A 1TYEB 5CFMA 4RS3A 3TRFA 2NTVA 4PQRA 1EWKA 3CIOA 1IJKA 1C3OB 1GPWB 2AI2A 2JGIA 2O14A 2Z95A 2GLUA 4ZRNA 3CN9A 4KR0A 4X93A 5FTWA 4QVKA 5DWQA 5AXDA 2OCKA 1QE3A 3L7IA 1OREA 5CM2Z 3V48A 3OAAA 4YAUA 5HM6A 1A9OA 1MAHA 1NOKA 1UJ5A 2DUWA 2ZRNA 4V2UA 5A3RA 2DFPA 1K7EB 1ZQ1A 5J2TF 2AXEA 2BE7A 3N2ZB 3DLCA 3THXB 5IZ4A 1RMYA 2VJLA 3A70A 2J9YB 1WDKA 4QDTA 5EN4A 5LMCA 1XLUA 4IYRA 3SJBA 2IXBA 3OOEA 3TRHA 1TDJA 4HDCA 2P1RA 1HT1E 3ANNA 1KQOA 1KVSA 2EF1A 3D0OA 3RTBA 3W4JA 3TGLA 4KQGA 1O94D 2LCFA 4MRVA 1MZPA 2AG5A 2FZWA 3V4ZA 2BM8A 1QG0A 2P9EA 2IHYA 3FVTA 3VO9A 1MX9A 1HETA 1SOUA 2D0DA 3DZFA 3STVA 1GPNA 1SG6A 2GYUA 2OLEA 2WYIA 3CUVA 3MS4A 1QU3A 5ERGB 2FMXA 2OWEA 4ZIRA 3MUOA 1H2XA 5I51A 2OV3A 3RD5A 4C2UA 3GLTA 4XWKA 1USKA 1UMCB 1HYBA 3H8WA 2HBYA 4FOLA 4IQ4A 4Y2VA 4ZDIA 3EXHC 9GPBA 2OUIA 1O1YA 3RIGA 2YUTA 1UPAA 3HXTA 5AOCA 1R16A 3CLTD 3TN7A 3B8HA 1HC7A 1QRDA 1HG0A 3QFRA 4WERA 3DONA 5J9FA 4BV3A 3PXDA 5FWDA 3DXYA 3I5AA 3VDQA 3A9SA 1YB7A 3DDZX 4JC5A 3D31A 1BCSB 3CUKA 3ZU6A 4YCSA 5A0TA 1QR2A 2EJVA 4FDAA 2OVBA 3D5QA 3V97A 1JQBA 4UOZA 1CFZA 2FK8A 2DZDA 2RGNA 4Y0VA 3LKZA 5HIIA 2YVLA 3CNNA 3O1JC 1QO0A 4RA9B 4L0QA 2ZU6A 3ET5A 5IW8A 1M8PA 4LS3A 2D1QA 1YA6A 3GNQA 3I4FA 4YP5A 3RKSA 1MX3A 1UXOA 3ROKA 5EJ8A 3EISA 4BYMA 4BO4A 5JANA 3X1JA 3TE7A 2HLHA 4AJPA 2WYWA 3ZIUA 2LIVA 4P7FA 4DMMA 3RADC 2BV3A 1CQIB 4UNIA 4E5MA 4WFKA 2HCBA 3JRWA 3SLRA 3HEAA 1HH4A 4IIDA 5T4FA 6CHYA 3UMFA 3RSOA 2VYVA 3E61A 3I3SR 3UMRA 4JVSB 6NULA 5KQGA 1XGKA 4NOMA 3KKKA 4E0BA 4PYRA 4KO4S 4MYDA 5D84A 5JCXA 3SXJA 3Q10A 2ZEJA 3FPJA 1A82A 4A7PA 1V3UA 2XOKA 5F33A 5J5VA 4S35A 1E3DA 4FE4A 4NS4A 4XYGA 5DTRA 4F4IA 4D8XA 3Q9UA 2IUYA 3MT9A 4ZOQI 4R5MA 4B6JA 3QVVA 1PUIA 1CS4C 1XHFA 3EG5A 1FTSA 3T38A 3PNOA 5CB4A 2EG9A 3B6JA 3KE8A 3HO1A 1HDRA 3ZNNA 2EG5A 3QPUA 4HN4B 5DW3A 4ITUA 3DL0A 1VE9A 1TEHA 2ZB4A 1DPFA 4QQKA 3IPAA 4QQRA 3WHIA 3U48A 4DT1A 1MJGM 4E11A 2WNSA 1ZBQA 3REFA 2J33A 3KKLA 4CTOA 1WG8A 1XMVA 4KTTE 4CF5A 4F9GA 1G8PA 4MB2A 4WDRA 1YOBA 4QVGA 3RC3A 3VU9A 1BCRA 1IQUA 3L8FA 4KN9S 3GG2A 3S55A 5JC1A 1QHXA 1EDDA 1FYEA 4C3VA 1YL5A 5KOJB 4KAAA 3WDKA 5BNFA 4HUJA 4YRGA 1PJBA 1PE0A 2H3HA 1H22A 2YHUA 3DLPX 1GRVA 1NXSA 4O59O 1QR6A 4DSNA 1TU0A 2ZBRA 2PMKA 3D6MA 2BFDB 3GJ8A 3GZTB 4Q4JB 1RYZA 1JFFB 3IP1A 3QY0A 4O1IA 1E6UA 1P3JA 2Y0CA 4ID9A 4NY1A 2DUJA 1NTRA 2RHGB 4QAJA 5F21A 2GDZA 4CEHA 3DBHA 1M2OA 1L4LA 4CIYA 2BJWA 2ZSJA 2J45A 4AUEA 5EHXA 4B3IA 1D2EA 1XXHA 1M76A 2FSVA 2PL3A 2YVAA 2YICA 3GN2A 4MUHA 3UC9A 3DS8A 3VR6H 3EJWA 5K0SA 3DM5A 2YOHA 5BR8B 4REQA 2I7TA 5CAEB 1TEXA 2VJAA 1P2FA 4LOKA 5K3EA 2F8MA 3EUAA 3JQ9A 3RIYA 4TKUA 3VDRA 1MP0A 3D6JA 3DDHA 4JJ4A 3UG6A 2PH5A 3U3KA 5IAAA 2FZVA 3OQ1A 2JGAA 2FTKE 2X5KO 2XNJA 2ZQ5A 4CM8A 2OHXA 3W5JA 1WHTA 1ITZA 2HIGA 1N2ZA 2PL9A 4RKYA 5AK5A 1VJ0A 2EOAA 5A5EA 2CXHA 3LGSA 2X0NA 5EUQB 1WP4A 3MAJA 3H19A 2OFXA 3SQLA 5IZCA 2F3QA 2GZMA 1MB0A 3ZXUB 1OBOA 5CA1A 3DLAA 1L7PA 2GTIA 4P93A 4B7AA 1XVLA 1TZ2A 3Q1LA 3RTEA 1DDGA 3TB6A 4TOIA 1ORTA 3O4JA 3S40A 1YZTA 3LY9A 2P7HA 3AR7A 2A67A 2Y1OA 1FSFA 3CZ9A 1WX1A 3OQVA 4OGFA 1IBSA 5IJXA 1K97A 1PFYA 2IGTA 2G36A 4FDVA 2ZDGA 4MR9B 1MX5A 1FDVA 3DQPA 1WU7A 1KAMA 3TXAA 2LWIA 1NZJA 2L69A 1X87A 1JDZA 1ZVKA 2D5LA 4QXPA 3E4CA 3GH1A 2QV7A 4LQDA 1RBYA 3OH8A 3P19A 3IA2A 2HWUA 1SG0A 2F17A 2ZJ3A 3MSCA 3HDYA 5HS6A 3Q6IA 3VR2A 3LE8A 3VTAA 1O89A 5CTAA 3ITDA 3KEFA 5LQKA 4UATA 1FFEA 1U02A 1CUWA 1Q0QA 3OOSA 4TM8A 2BM0A 4GPAA 4G0UA 1U3VA 1P8JA 1I3CA 2JASA 4LSZA 2Y1WA 4LTMA 3J81k 3RV4A 1UIMA 1CR1A 3ORSA 2BEVB 3NNDA 3CEAA 3UPTA 1YD7A 5AKEA 2BF4A 5L3VA 1LC0A 2D62A 2MINA 4KXVA 1YFJA 1K8XB 5BVGA 1DAHA 1BYIA 1GTG1 4JEMA 1HDGO 1W19A 3ANMA 4GR4A 4L51A 1EM8B 4QOHA 3SU8A 3GMTA 4WLOA 3UOGA 1Y8RA 4FHZA 4YRPA 3E2IA 1XFAA 5FUWA 3TXYA 1Z38A 1MJNA 1P4HA 3LC2O 3EWNA 4HWRA 5EFOA 4CE6A 4DKJA 3DFMA 3C3XA 3DT6A 4TMKA 3ZH2A 3OEED 2AFIA 2NO5A 3OOWA 4I1UA 2JZNA 2ZUVA 3I1JA 1E2EA 1S96A 1NI4A 1SXJA 3WL7A 3FCSB 3I30X 2P4EA 3SWWA 3FTFA 3WA6A 4D81A 1FFHA 1TMYA 1C9MA 3L9XA 4JR0A 4EJMA 3FUCA 3OP4A 4NI5A 1XKTA 3E3MA 5ALNA 4Z1OA 1XVVA 1E1QD 2LUOA 3B12A 1RRPA 3N7AA 4K26A 4JB2A 2VK1A 3PFKA 1X9HA 2AKAB 3DV2A 4C2AA 4OPMA 3IDOA 1Z4LA 2PKEA 1KF0A 4YMWA 3VI3B 1FVXA 3W5DA 2LP4Y 4YCCA 3OX1A 3DBIA 4UNNA 3VAYA 5JPDA 4R1TA 4OYYA 1DWPA 2QVCA 3CZPA 3IL2A 2CVPA 2XZPA 4Z4HA 3T7CA 1TT5A 2HK8A 3CM0A 2BD0A 2VCEA 4UEQA 3QYJA 5EZ6B 3SMQA 2PKQP 1VG9B 4MQEA 4PFKA 2R6GA 3ZBQA 2H2FA 2X9VA 4XYBA 3G23A 2PNFA 2YHSA 1HKUA 3CR3C 4J75A 5K0LA 1T0HB 4U2DA 3OPYA 4DBVO 2GFIA 3QKRB 2GBGA 4BFUA 5LZ4A 3SM9A 3KIPA 5G0TA 4HDKB 4Z1MD 5ALDA 4G25A 3ZWVA 4LMRA 1IN6A 2ZXUA 4DR5B 4IY1A 1CD5A 1JPJA 1TGVA 4AIIA 2WOJA 1H9BA 1CHNA 3UXHA 3BXEA 5K09A 3GLGA 3L0OA 4YMSA 2O52A 5EWLA 4JBGA 3GQBA 4POOA 1I0LA 1K5DA 2QD5A 2R6ZA 9LDBA 4W63A 4KODA 3K6JA 1XAIA 1UPUA 3PJGA 2QBYA 1L7EA 4YP9A 3ANSA 1NL3A 3MK31 2H8KA 1Q50A 4TQAA 2PE5A 3DV0A 3GUVA 4ZYYA 2GVZC 1KJYA 3C6ZA 4PS0A 1Y4UA 3TLKA 2J6BA 4OA5A 5KU1A 4IGKA 5B58C 2CV2A 5J5CA 2XD4A 5BXQC 4Y67A 2RH5A 4CUJA 1XXLA 2NUPA 3T3PB 2FPPA 1CE8A 5FYDA 5B2EA 4LBYA 2WJ3A 2P35A 5FT9A 4NOJA 4IJMA 3AVTA 2V65A 1W5FA 4XAQA 2YWBA 3ZIAA 1TTTA 1GPBA 1Q3HA 3I92A 3QG5A 4MJXA 5CU7A 3DA8A 5T5QA 4UNRA 1TU3A 3CNQS 2HK9A 3LPMA 4FX2A 1W88A 1XSEA 4KQXA 5SV2A