4CMAA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
250
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 94
structure length 250
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmaA00
4QT0A 4XZ3A 2HMSA 2TMGA 3V5NA 3VVBA 4A7PA 3NUGA 4TRMA 2HSDA 3HADA 5BR7A 2J5KA 2QIOA 1WXDA 3DBRA 1PGJA 4I5EA 3WSWA 3HN2A 1GY8A 2NLOA 1XWFA 1ZUD1 3L9XA 4XB2A 3E48A 3R0IA 3S2IA 4W7HA 3V1UA 3DQPA 1Z6ZA 3RJ9A 1GFSA 4ND3A 2X9VA 3A4VA 3FSRA 1H6CA 4P4NA 1K2WA 4AJIA 2NVBA 5JAZA 2AE2A 1QP8A 3LDHA 5KVSA 5ICSA 1K5HA 1NR7A 2WYUA 4GKBA 4KTTE 3TF5A 1UAGA 3FBGA 4DVJA 3AOEC 4B4VA 1J49A 2LDBA 3QV1A 4AJ4A 3E6AA 3ZW9A 5L4NA 4RQUA 4Y98A 2YDXA 4IDDA 4R9RA 4UEKA 4IBOA 3VZRA 2IXBA 2D1YA 1E1LA 3W8DA 4AJOA 4CQLB 3KSZO 3PIDA 4DLLA 3R6DA 1ID1A 3QWIA 3UXYA 3U49A 2Z1MA 4WECA 4NI5A 4EBFA 3EMKA 3I9LA 1S6YA 1I3MA 1KETA 3G1TA 1CERA 4KMSA 5BNTA 1NASA 2A35A 3ZU2A 4EEZA 3IDSA 3LQFA 3PRJA 4ZN6A 4Z3DA 4YJGB 4CR7A 4N54A 4DTIA 1PS9A 1O95A 1CQJA 2CNBA 1ENPA 3MOIA 4O0LA 4MVJA 4AJLA 4JIGA 3STHA 1GEEA 5DOVA 1E1MA 2A4KA 3WGYA 4DUPA 3JD3A 1ZO8A 5JY1A 1R0LA 3PJEA 4KWIA 1I5RA 3AU9A 3VH3A 1DHTA 3L6EA 4TZKA 1ULSA 2Y1GA 1G0OA 2NU9A 5L4SA 3PYMA 3BIOA 1OC2A 2X1HA 1GV0A 3I83A 3ETEA 1EZ4A 4BNFA 4BS9A 5JYEA 4YVFA 3F1LA 3Q6IA 2Q3EA 3IKVA 2PKQP 2VZ8A 1HYEA 3E9MA 1XU7A 1E3LA 3I6IA 4RF5A 1SOVA 4IQ8A 5BSHA 3RI3A 3G1UA 1BMDA 3RSHA 2EW2A 4ZGWA 5LDHA 2WDZA 5A9TA 2V6BA 1ZMTA 3H5RA 1LDGA 2EXXA 2QQ5A 4J3FA 4L75A 2XXBA 4KDEA 3NRCA 3ONDA 6ADHA 3KYDA 1NBOA 2OFPA 4AJ2A 1Q1NA 2FPPA 4PG4A 3KOUA 1YB5A 3DHNA 3ICPA 3ZWMA 4DYVA 1ISFA 4BNVA 4I9HA 1H6AA 4JN6B 2G76A 3WGGA 1R0SA 3GG2A 4I9UA 1R4NB 5COAA 2C7VA 4HV4A 5I7FA 4AJHA 4R1NA 1TT5B 2P9CA 3ZV5A 3WB9A 3JQAA 3PQEA 1H2HA 4IJVA 1R16A 3DHYA 4OHUA 4F6CA 5G0TA 5IXYA 4CLOB 2BMAA 1Z7BA 4BKQA 4K28A 3ZU4A 2NTVA 1DFIA 2HK7A 1X15A 1KOLA 1QG6A 3DBHB 4J49A 3VVCA 1E7MA 1I8TA 2EP5A 2PD6A 3I5MA 4XR9A 4GVLA 3Q2KA 1NVMB 3V1YA 2JL1A 3ENNA 1ZSNA 4Q3NA 4FFMA 1RM4A 3LC1O 4URFA 4J2OA 2IDZA 5MDHA 3OA2A 1L1FA 2YV1A 4WLNA 3K8ZA 3HWRA 2F00A 3S2EA 3PJFA 5TC4A 4CLRA 4PLCA 3ZWYA 4BV9A 1UP6A 5GZ1A 4G5HA 3UVEA 5IG2A 1EBUA 3F9IA 1R37A 3P19A 4HX5A 4ID9A 8ADHA 2GASA 1VRWA 3QSGA 4Z0TA 4B79A 4PRLA 3V1TC 2ZYGA 4BGUA 2X0RA 2YW9A 4QFCA 4AJ1A 1GPJA 1JWAB 1I30A 3HDQA 1QYDA 3ZHXA 1C1DA 4UUOA 4BNGA 1M2WA 2O4CA 3JQ7A 4CR6A 1DIRA 1M75A 1V9LA 4HBGA 1QYCA 1H6BA 3U5TA 4H7PA 4AJNA 1B7GO 4RF3A 3U4DA 2VWPA 2E82A 4A27A 4WNIA 2O23A 3TOZA 4D46A 3FI9A 1VJ0A 3MJTA 3QE3A 4DMLA 3DAGA 3BHMA 5AYVA 4MJLA 1UZLA 3KLPX 3Q11A 4NBWA 1VPDA 2H9IA 4M55A 1EVYA 4CMGA 4AG3A 4EUEA 4HKTA 3NAQA 4DQXA 3C1OA 1SAYA 5ICMA 3UAGA 1MB4A 3IUPA 2Z95A 3RBZA 3ZZNA 3WLFA 4FD3A 2EGGA 4FBGA 2NUAA 3DFZA 2FR8A 1V8BA 2AW5A 2JD2A 1MV8A 4A5OA 5A03A 1E3IA 3TL2A 5A06A 3DO5A 5JNLA 3S2FA 3L0DA 4R5MA 5I8ZA 1HZJA 2TMDA 4WLOA 1ADFA 4B8ZA 3UCFA 1GYRA 1B14A 4FGSA 4BO8A 5IZ4A 2CVQA 4II3A 2DBVO 2VWGA 1O9BA 4NG5A 4WCDA 5KVQA 3JYNA 1ZK0A 5K9ZA 3FBTA 2B0JA 2X86A 4LVCA 1XEAA 1BSVA 1BVRA 4J0FA 4UVGA 3VPSA 1P44A 3GEDA 1JVSA 3MWEB 5KWEA 1N92A 2PKRA 3GZNB 5A02A 4RLSA 4GX5A 1OFGA 4M87A 3V2GA 2Q2WA 3ZU5A 4J1SA 1Q2XA 4YPOA 3NGXA 4R9SA 3OETA 4CM9A 3PJGA 3QA9A 2BGLA 3BMOB 1KEUA 4B3HA 5JAMA 5KVVA 4K9DA 1WVGA 1XIVA 3PQDA 3BTVA 4W7IA 3WGIA 3O26A 2AQIA 2POQX 1NM5A 3GMSA 1PQPA 3FTPA 4PCVA 4LCEA 2X0IA 1E3WB 1D1SA 1SPXA 1P74A 4FCCA 3U4CA 1LDYA 2AE1A 4UVIA 1PSDA 3GVCA 4A03A 2CMDA 4BVAA 3N7UA 2B36A 2W2LA 3K2BA 1ISGA 4FN4A 2UYYA 3UUWA 2CY0A 4J9VA 1EVZA 3K30A 3R3SA 4GWGA 4GX1A 1N9GA 2BFOA 2Y99A 1FDVA 4BMNA 3KEQA 2ZQYA 1JKJA 4OMUA 1ZK4A 4IIUA 4PRKA 1DOHA 3L77A 1CWUA 2JD1A 4NJMB 2V7PA 1N1EA 1DPGA 2EF1A 1LLDA 4CLDA 4BNLA 3QHAA 1WDLA 2G17A 1LXCA 5COQA 1EEHA 3NDIA 5B4VA 2E49A 4YAKA 4CR8A 4F3YA 4H16A 5KJ1A 4TRJA 3ZHYA 1LDNA 5H81A 4OJNA 5IJZA 3NDJA 3S2GA 2EJVA 1V3VA 2BELA 3ITDA 4PLWA 5BNIA 5CG1A 4I8XA 3B20A 3FNGA 1YBAA 4OKIA 3W1VA 4EZBA 4YQZA 4FFRA 2PNFA 3GMDA 5A3VA 3D4OA 4ZA2A 4I5GA 1EUCA 5A9RA 3DOJA 3L9WA 1E3EA 3GT0A 2AQHA 4IUYA 3GDFA 1VL0A 4ROSA 1TI7A 4Y6PA 5EPOA 1O6ZA 3H9UA 2VN8A 2VZ0A 3LSYA 5CPBA 3L6DA 5L95A 3K96A 4MP6A 1DHRA 1HDXA 3PDUA 1KVQA 1T4BA 1XU9A 1BG6A 4A0SA 2FWMX 2G82A 4YJFA 4FQ8A 4CLOA 2FPGA 1AUPA 4EJ6A 1XHLA 2ZB8A 3GRKA 3O4RA 5JW6A 4EDFA 2CFCA 2VTDA 3U4IA 2CVOA 2EERA 4XGKA 2JKVA 2DUUA 1I3KA 3AJRA 5IDYA 2VRCA 2CD9A 3HE3A 4PZDA 4E2ZA 2GR9A 4PN3A 1AN9A 4NBVA 4OGWA 4UUMA 3ST7A 1E6UA 4IM7A 1IPFA 1DAOA 1RM5A 1SEVA 1HLPA 4XDYA 4ZRMA 1NPTO 3ANLA 2AG5A 3I9KA 1SMKA 1B8VA 4I1IA 1GCUA 1LTHR 2Y0DA 3MJCA 3ONFA 4OSPA 4MO2A 1U1IA 1SCUA 5FF9A 3OQ1A 2ZJ0A 4DBZA 4KTVE 2Y1OA 1P1HA 3ZWBA 1P0CA 4PVCA 5A5FA 1DIAA 1BDBA 3F3SA 2VYVA 4NU5A 4YQYA 9LDTA 4ZICA 5IN5A 1OAAA 4ZRNA 5JBIA 2Z5LA 3EYWA 4J16A 4E2YA 5G0SA 2R6JA 3JQBA 3DZBA 3ITKA 3VHRA 4DBVO 1WMAA 4M49A 2VYNA 3GRPA 2QG4A 3F5SA 2DPGA 1HE5A 2BRUA 5U4QA 5HBRA 1YL6A 2FP4A 3GUCA 5C5IA 4FOSA 1DC4A 1KYQA 4W9NC 1B26A 2C5EA 2FR1A 2OZPA 1MX3A 5AXCA 3GVPA 2RHCA 1ADGA 1XDWA 3AUTA 3A28A 4YRDA 4BO6A 3E82A 4BO0A 3JV7A 3OJOA 1BW9B 1PS0A 5G4LA 2W4QA 3H2ZA 1LDEA 4B3IA 1K6IA 1WP4A 4CMJA 2UAGA 2EKLA 4BNJA 4NBUA 1NP3A 2VNAA 1IYZA 3R3JA 4BMSA 4WLFA 1X0XA 1JTVA 3HUDA 3PGXA 1FDWA 2P68A 3DOOA 3FNEA 3GGGA 4GL4A 1C0IA 1PQUA 4P22A 2ZK7A 5B4TA 2OHXA 1UDCA 4ZU3A 3QWBA 2DUWA 1BXKA 1ISIA 3JQDA 4RPKA 4OQYA 1Y8QB 1FJHA 3G17A 2C2XA 4CMEA 1UXKA 3DMTA 1DO8A 2VRCD 3L4BC 4CL3A 4YACA 4RPHA 1OZAA 3Q0EA 4MVJM 3OM9A 3NTRA 3AI1A 2DTEA 3K31A 3MTGA 1IE3A 3BTSA 2PA3A 1R6DA 1M76A 2ET6A 2VQ3A 2JCVA 4U8GA 2P2SA 3H3JA 3NDRA 3D3WB 4FR5A 3B1FA 3WIDA 4YJHB 5K0ZA 2BFPA 2O7SA 4QTZA 1PJ4A 1YH3A 1E92A 3MJEA 2V6MA 1A9YA 2XAAA 5I9MA 1T2AA 4ZD6A 1NNUA 1ZJZA 3NJ4A 3RFXA 2FZWA 2EV9A 4Z9FA 5JDIA 1X1EA 1XCBA 3VDQA 4G81A 2OL4A 2W90A 5BQFA 4YJHA 3PHHA 2IZ1A 5CPFA 4MP3A 3M1AA 3V2HA 4BNMA 2CUKA 2HMVA 5ITWA 4JLWA 2C07A 3RUDA 4CMAA 3EGOA 1P0FA 3NKLA 1YO6A 3AI3A 1PS8A 1IY8A 1PWZA 1PJLA 4IDAA 1PU2A 1YVEI 1Q7BA 4TRNA 1NYTA 1GL3A 2Y05A 3QWFA 3QJ5A 4BKUA 3TFQA 1SNYA 1DSSG 1E7WA 2WJPA 4IIVA 4Z3KA 5T8KA 1ZMOA 3ZNOA 5JCJD 4NFYA 2RH4A 4GLLA 3ULKA 3SJ7A 1ZSVA 2JHGA 5DBIA 4WCFB 1Q7CA 1ZFNA 5T5QA 2ZTMA 5I7EA 3NTOA 3D5QA 1J0XO 2DTXA 4GPD1 3T7EA 4RVUA 3BXXA 5KIAA 4CMIA 3ANNA 4R1UA 1GPDG 3AW9A 1LNQA 1DLJA 3GK3A 3KLMX 1KVUA 4EEXA 3VZQA 1DRWA 1TB4A 2CSUA 4XQGA 1X1TA 4ALKA 1PJSA 3JQEA 4D7AA 4ITUA 5FWNA 4RLHA 5ITVA 2DBRA 4MKXA 4FFOA 3WSVA 4QO8A 1U8XX 3CH6A 3BHIA 3AM4A 2DKNA 4MPDA 3DZFA 1B16A 2C59A 1Q0QA 1R15A 3E1KA 1LQUA 2O3SA 4HFNA 1LUAA 1GQQA 1PJ3A 1DDOA 3K73O 4ND1A 1WAMA 2HDHA 3JD4A 1ONNA 3RBVA 1XQ1A 1C1XA 3BZUA 1SB9A 4P4LA 1NQOA 5F1PA 3G3EA 4O59O 1A4IA 3SEFA 3V2UA 1HZZA 4MVJI 1AHHA 1AXGA 3WLEA 3PLNA 4IPTA 1O94A 5A05A 1XKQA 1JA9A 1CEQA 4UREA 1LEHA 4WPGA 1IUKA 4PGFA 4IJWA 5A9SB 1LQTA 1XQ6A 3AUUA 4E32A 4WLUA 1H9BA 4ALJA 4YT8A 4GMGA 3ZH2A 4QFDA 4OXNA 5IDQA 3SLKA 3CZMA 4CM9D 1IPEA 4R1SA 4BGEA 4IZHA 1J6UA 3A1NA 4IQ0A 4MKZA 5IFLA 3AM5A 1EFKA 2GD1O 4JROA 4DQVA 3WBFA 3HHPA 2XF8A 2BLLA 2EKQA 3WGTA 1YJ8A 2J3HA 1ZBQA 1U7HA 3GC6A 5IZCC 3W8EA 2WEKA 3PWSA 3GAZA 5EN4A 2UDPA 2H63A 3GUYA 1NAIA 3R1IA 4YB8A 2RHRA 4GGOA 3RUCA 1D7OA 1RJWA 1GD1O 3OQBA 5FI3A 5KJ6A 3AU8A 3VKUA 3GHYA 2AMFA 1Q7GA 1HL3A 3SLGA 1KEPA 1H94A 1NFRA 3GR6A 1NVTA 3DEYX 4OIMA 1DJQA 3TNLA 2O3TA 4IDCA 1VSUA 3EZLA 1V3UA 3RAJA 4E0BA 4U7WA 1E7SA 4IDEA 1GUFA 4PZEA 4Q3BA 1J5PA 2X9NA 3RIHA 4CMBA 5HWSA 1RWBA 1TEHA 2HK8A 3WOHA 3X2EA 1HKUA 3QP9A 3TZCA 2C29D 3LZ6A 3CUKA 3H2SA 1B3RA 2BHLA 1O89A 4JK3A 1ENZA 4IJKA 3TSCA 3JQAB 3TL3A 2VUSA 1TT5A 3ZWCA 3O38A 1PJQA 3K2EA 3PHGA 4YR9A 4UUNA 3ETGA 5C7LO 2A92A 3VDRA 4GBJA 2GGSA 4E5PA 2BH9A 3JQ7B 4J4BA 1GTMA 3SC4A 3KVOA 3WGZA 3OJ0A 5DBFA 1E7QA 2VOJA 5L9AA 3HB4X 3I9NA 2UV8A 4M8SA 5EMHA 5TNXA 2GNAA 5H83A 4CV0A 3DAFA 3GOHA 3WWYA 4BNUA 4YT4A 3BA1A 3LF2A 5FEUA 4GKVA 3RBXA 5DCUA 2JAPA 1XA0A 1O5IA 4E13A 3DTYA 5ENVA 5JO0A 4J1NA 2GUGA 1P1RA 5HA5A 4RPGA 4CMKA 4DYDA 1F12A 1I2BA 3CTMA 3QLJA 5KTKA 1I33A 1SC6A 4OKNA 2QHXA 5JMPA 4CLHA 3BMNB 4DIOA 1HF3A 5IF3A 1SO8A 5G4KB 4FDAA 1DB3A 4ND4A 5JS6A 2VWQA 1ISMA 2YFHA 3B1KA 2PR2A 1G0NA 1HDOA 1DC5A 4FB5A 1U4SA 1YRLA 5ER9A 4PFJA 4QECA 4YJGA 2E4AA 1YOVA 2JFHA 3O9ZA 1Z74A 4FJ1A 5CDTA 4FC6A 1IOLA 1LJ8A 4BNYA 1HSZA 2PGLA 3EDMA 1QYVA 1UP7A 4BKOA 3M2TA 1HDRA 3OJLA 3Q9UA 4YDRA 2B4QA 5B1YA 4DPLA 4ZQFA 2QW8A 3G0OA 1ZXBA 4PIVA 3AI2A 3ZWWA 1DXYA 3P2OA 1C0LA 1QMGA 5A4DA 3DDNA 3OSUA 3GAFA 2YHIA 1LC3A 2QX7A 3INTA 3WNQA 3MOGA 2DLDA 2H5LA 2G5CA 1MGOA 2VUUA 4MVJD 1C14A 1GAEO 4RDHA 3TZ6A 4GSLA 4HNHA 4BKPA 4CLEA 4XIYA 4OYRA 5JYDA 3M2PA 4RV9A 3WGQA 1IHYA 3DZKA 1WDMA 2EHDA 4BNXA 3FNFA 1KC1A 1Y1PA 3DFUA 3JQ9C 3U0BA 3ZV6A 4XA8A 1DAPA 3NT5A 4A2CA 4OM8A 2GN6A 1WNTA 4PLFA 2FMUA 2HMUA 3NT2A 3HZZA 3DXFA 1EVJA 2CDAA 2WSBA 1XYGA 4R51A 2EEZA 2W2KA 3SXPA 2E37A 4DGSA 5JO9A 3MCVA 3AK4A 4R01A 2WD7B 3QWHA 1C1DB 4WUVA 3D3WA 3IKTA 4CUJA 1LRKA 3RWBA 2WE8A 2D4AA 3C24A 1GQ2A 1GZ6A 1HRDA 1ZZEA 3CSDA 4PG6A 5CHEA 4CM4A 2Z1NA 4J7XA 1LI4A 3HJAA 4EUFA 4PVDA 4KUEA 4Y67A 5T57A 1JW9B 1UXGA 4MVJE 4NFSA 5JDCC 2DFDA 2C20A 3DB2A 5DDIP 4J0EA 3KO8A 3WQRA 3IL2A 4N5LA 1JVBA 2RCYA 4CM5A 3PHLA 2BF7A 4UVEA 1IL0A 1YL5A 3BAZA 1AXEA 2AXQA 2FRDA 3DAPA 3L4BA 4GLOA 1ISJA 1BXGB 2OO5A 3CE6A 3GQVA 3VTFA 1I3LA 2X8LA 2I6TA 2SCUA 1E0DA 3DONA 3KZVA 4LSWA 2PKQO 4MVJH 4K26A 3KV3O 3MTJA 2EKPA 3DBHA 3NTQA 2IYOA 1VKNA 3ICCA 1LU9A 2WD8A 5T67A 4RQTA 3W4KA 1YQGA 1YL7A 2AQKA 3IOYA 4RL6A 1GQYA 3QVXA 4KUGA 2JCXA 2X58A 1B0AA 2O48X 1N7GA 5EQDA 5BSGA 2D3TA 4PG7A 1ZCJA 4BO5A 4BO1A 3JTMA 4YXFA 1UZNA 4PLGA 4XB1A 4XGNA 3I4FA 1F14A 4N5NA 1E5QA 4KQWA 4R54A 5KCZA 3C8MA 1ENOA 1I0ZA 1ZNQO 3K5PA 5JAQA 1EE2A 1YOVB 3H9JA 4CMIB 4RCVA 3QRWA 4INAA 4E5KA 5FFFA 5G4KA 3PWZA 1X0VA 4RZHA 4U0KA 4XR4A 3F47A 3AOGA 2D8AA 4JP2A 2CZCA 1FDTA 2JD0A 2EP7A 5CFZA 1C1XB 1U7TA 4YRAA 3OJEA 1RM0A 5A5EA 1F0YA 4LN1A 1ADCA 4D41A 5EIOA 1U5AA 1R4MB 5HRUA 2NSDA 1HETA 4L76A 3A14A 3DMYA 1E77A 1NPYA 1WDKA 3BMOA 3ZN2A 4DMMA 2Q1SA 3WQQA 2JFFA 1TT7A 3GLQA 2YQ4A 1W8DA 4NK4A 4BGVA 2HKIA 1NWCA 3LT0A 3PI7A 3KEOA 2PGJA 4H15A 3L6OO 3JQ8A 4NHEA 2BI7A 3W8FA 4A73A 2PLAA 1P1JA 1ZIDA 2GYYA 3F4BA 5F1KA 1YXMA 1L7DA 3AY7A 3AUAA 2B5WA 3KSDO 3PWKA 3RVDA 3WYCA 5THQA 1PL8A 3PEFA 2B69A 2J5QA 2B4TO 3CKYA 1JAXA 4FS3A 1EK5A 4NDNE 2VHZA 3KYCA 4DA9A 3S55A 2BGKA 1AGNA 1Y81A 2I3AA 2JFGA 3ADOA 2PK3A 3OF2A 1CJCA 4L4RA 1ENYA 2H1SA 1B2LA 2O4UX 2YV3A 3B1JA 1QORA 3ZWNA 2A94A 2I76A 4R41A 1ZH8A 3JQGA 3UHAA 3GH3A 2FSVA 1D3AA 4YCAA 5T8KC 1LDMA 5DCYA 3WQSB 2G1UA 3EUWA 1ARZA 1WWKA 4O1MA 4S1VA 5J23A 1RM3A 4M86A 4YWJA 3KRTA 1LBEA 3JQGB 3JYQA 1ZKMA 2PY6A 1KS9A 5JE8A 1OMOA 3ABIA 3PP8A 5AVOA 3DOCA 3IAHA 5TQVA 3HSKA 3GEMA 4ND5A 1EDOA 4M89A 4UULA 4GMFA 3TRIA 5KJCA 5DT9A 1A27A 1HTBA 4ALMA 1WMBA 3AM3A 4GGPA 2WMDA 4WKGA 5JC1A 2GZ2A 2Q1UA 1B15A 3B70A 1YBVA 4UVDA 4JP3A 4B3JA 1DIGA 1U3TA 2DBZA 4WE3A 4B8WA 4BO7A 3QIVA 3PJDA 9LDBA 4CM8A 4XJSA 4CUKA 4W4TA 4J7CA 1KVTA 1FDSA 4W82A 2J5RA 2O3QA 2V6FA 1GUYA 4CUZA 2ZB4A 4FOOA 3P5SA 1BWSA 2X0JA 3KTDA 4TVOA 2WYWA 4EW6A 4X54A 1DRVA 3ZNQA 4DC1A 3E5MA 1P33A 1UH5A 5KKCA 1E3WA 1MG5A 3EW7A 4OO3A 4LMRA 1AE1A 4J6FA 4DQUA 2HMWA 3DHEA 3H3FA 1WZIA 2NQTA 3WX0A 1YDEA 1XR3A 1R0KA 1A7KA 1N2SA 4A10A 1LA2A 4TKMA 1KBZA 1LLUA 3I6QA 4DLAA 2Q1WA 2Q99A 2O50A 4K6FA 1YDWA 2BI8A 4F6LA 4HFMA 1DBVO 4AICA 4NPCA 5L4LA 1D8AA 1GDHA 3GDOA 4L0QA 4LSMA 4UUPA 1KVSA 1UZMA 3I3OA 1A7AA 3I9OA 4W9NA 4NQZA 4BNKA 1T2EA 2V6GA 3D4NA 3F4LA 4E30A 4EJ0A 4PLVA 4QX6A 2PTGA 2WTBA 2VHXA 2OOSA 2Y66A 1EQ2A 5A1TA 1CDOA 1Y6JA 3A06A 4J4TA 2Y1CA 3CMCO 4E4YA 1L7EA 4OXYA 4QO7A 4J91A 5EINA 5CEFA 3U09A 1EE9A 3PLRA 2IZZA 4HWKA 3ZWOA 2FR0A 5LC1A 3TZKA 3UFXA 2QZ9A 3S1LA 1QLJA 4NIMA 1DC3A 3O8QB 3AUSA 2EGHA 4M1QA 1QXSA 3IC5A 1H5QA 1G1AA 4JJFA 3AOEA 3FN4A 4DXHA 2HK9A 4XEHA 2IE0A 2DQ4A 3QWAA 1GYQA 1D1TA 1PJBA 4MOWA 1NHWA 3ROQA 1CIVA 2I3GA 4PLHA 1HXHA 4YT2A 3UOGA 5CDYA 1MC4A 3PZBA 5TJHA 4GH5A 2CF5A 1YJQA 3W4JA 5A3JA 4BGIA 1P31A 2CDBA 2W2KB 2DU8A 3H9EO 4ND2A 3FR8A 1YONA 1F8FA 3UGKA 5DOZA 3VH4A 1KC3A 4E12A 2GPTA 4BNHA 1H93A 5TF4A 1UDBA 3O8QA 3JQ8B 1A5ZA 4E33A 4BNWA 1HE4A 4TWRA 1K6XA 2Y0EA 1PL7A 4J1QA 4AJJA 2BFAA 1YS4A 3FTNA 4RO0A 4ZQEA 1QSGA 4N5MA 1FDUA 2GN8A 5DNAA 4WK6A 4XKJA 3GN2A 4J90A 1K89A 4MIYA 1MFPA 4L8VA 1NHGA 3JQ9A 4GVXA 1SBYA 4UEJA 3C85A 4JBHA 3RJ5A 4P8RA 2NU6A 4DC0A 2HJRA 3TDKA 1EVIA 2V65A 3JQAD 4IXWA 1GZ3A 4U6SA 4BNNA 3N58A 5C3MA 1ZW1A 3EVNA 2X6TA 1NPDA 4E21A 4YAJA 2PZLA 4WCFC 3JYPA 3RUHA 3TWOA 1YWGO 2DBQA 4O5OA 1N7HA 2W8ZA 3RASA 3DBVO 5U9CA 3FPCA 4IQGA 3ZGYA 4KQXA 4KDFA 3JD2A 5DP1A 2D59A 1VL8A 1CQIA 1E1KA 1WW8A 3QY9A 5AOVA 2HO5A 2OXIA 4OL9A 3S8MA 3TZHA 1N9GB 1I01A 4Q9NA 4QQRA 1PWXA 2I66A 3UCEA 5F21A 4Z0HO 2QRKA 4R3NA 5CDSA 3FWZA 1JQBA 3I9MA 3OP4A 3RCBA 3BTUA 3W4IA 5CG2A 4Y8VA 5L7TA 2PZMA 4BB6A 1XGKA 1KIFA 5IXSA 5CDGA 3GG9A 2UVDA 1VSVA 2D5CA 5HS6A 4R69A 1ADBA 4ZQBA 2YDYA 3TJRA 4BIIA 3HDHA 4C4OA 2X5OA 1PR9A 1T2FA 3K92A 3OHSX 4NNJA 1PZGA 3PFFA 1PR3A 3OJFA 2O3UA 4OOFA 4E5YA 1UP4A 1VE9A 1Y9EA 3KETA 1QLHA 5F5NA 4D79A 1E7RA 1Z45A 4E31A 4IMRA 3I52A 1W4ZA 4PLPA 4Q3AA 3VZPA 2GZ1A 1LLCA 4OXKA 4NZ9A 5L53A 4KWHA 1HYGA 3GNTA 4N18A 3ETDA 3JD0A 4XD2A 2PD3A 3ZWVA 1EBFA 8LDHA 4GQAA 2O3JA 3PK0A 2B5VA 4E3ZA 3H5AA 1PGOA 2VHYA 4MKRA 5L40A 1BTOA 4QUKA 1P3DA 2ZB3A 5H82A 3ZI0A 1GUZA 4CQMA 1UXJA 2WYVA 5G0WA 1XSEA 3LU1A 1DLIA 3PVZA 4IINA 4L74A 4ZVVA 4AJEA 3ONEA 4YRBA 1WPQA 4IGEA 5EL0A 2Q4BA 3OFSA 2WD7A 1Y5MA 3CINA 3D5TA 3JD1A 4GWKA 2GLXA 3LLVA 5JFOA 1X14A 3W6ZA 5GZ6A 4OSOA 1DJNA 4YJFB 4RDIA 5CEEA 1YBMA 3Q3CA 2C82A 1Y7TA 3OEYA 5CEJA 3WFJA 3IP1A 2BFMA 3WTCA 2GCGA 4KUHA 4HUJA 4I08A 5C7IO 2X7HA 4D0SA 2NACA 2C7GA 3IS3A 4AFNA 2O2SA 3FNHA 1DEHA 1FMCA 4CQMD 1LSSA 1Y8RA 5G0UA 7ADHA 4XCVA 4EJMA 4L73A 1E3JA 1R4MA 4EITA 1P77A 2VT2A 2GZ3A 2YYYA 2FPIA 4XJTA 2Y93A 1O0SA 1O8CA 1LRJA 2QYSA 4U0JA 5CAEA 4MDHA 3WG9A 3A9WA 4CODB 1W6UA 4RF2A 3EHEA 2Y1FA 4YYZA 4RJTA 2UUOA 4B7XA 3QVOA 1PZHA 3QVTA 2YZ7A 5L7YA 1VJ1A 5IDWA 1C0PA 4QEDA 1ULUA 1I2ZA 3JCZA 3P7MA 2I9PA 4WOJA 4PZCA 3DBLB 4ONEA 3I4CA 3IJRA 4CMCA 3GVIA 4ALNA 1MXHA 1LLQA 2Q49A 1H9AA 3ZCXA 3LC2O 2I99A 4B4WA 4BO9A 1MXFA 4J9UE 3PYXA 4YAIA 3GGPA 1E6EA 1X7HA 5DZSA 1UJMA 2B83A 3KUXA 1DC6A 4Q39A 4YBZA 3ZWPA 3LF1A 4EI2A 2X0NA 4U6QA 1E5LA 3IUSA 4C7JA 2PFGA 2FY8A 2NU8A 2WE7A 2F1KA 2XXJA 2J3IA 2VYND 2Y1DA 4MIOA 3RUIA 2QRJA 1ISHA 1I2CA 1PJ2A 2G0TA 4MIEA 4IZIA 4JJIA 3H65A 1ZK2A 1GEGA 5JCXA 4G2NA 4KOAA 1W0CA 3GA0A 3MJSA 1HDZA 5ES3A 3V8BA 1UAYA 3VAZA 3GFGA 5L51A 4RGBA 3WR5A 4YT5A 1GCOA 5I7SA 2X4GA 3GHHA 4D3FA 5K6AA 2D0IA 5BSEA 4FPXA 3CZRA 4BNIA 2JAHA 3WJAA 3ASVA 4K1LA 4RVDA 5DP2A 1T25A 3H7AA 3L4SO 1QYWA 2AA3A 2Y0CA 4TKLA 2X22A 4D0RA 4AL4A 1U5CA 4NR0A 3LYLA 2Q4EA 4TSKA 4DWVA 1HE2A 3GZNA 4CM1A 1PJTA 1JDJA 3OIFA 2ZIZA 2VCYA 5COBA 3WDSA 4WGGA 1ZK3A 1R4NA 1DIBA 3D1LA 1MUUA 3HN7A 5TT0A 3NEPX 3RROA 1KEWA 1J4AA 3INRA 3PTZA 3D3EA 1CETA 2DVMA 1MLDA 4BOYA 4BO2A 1FK8A 4Y6SA 4PLTA 2R00A 1GR0A 4PG5A 4J43A 3INGA 4O6VA 3EC7A 3H9QA 2NVUB 2HMTA 1PEDA 1E7YA 4XDZA 4Z0PA 1GV1A 2IEDA 3HDYA 4FIZA 4RPLA 4CQLA 1M66A 1JKIA 4BNTA 4RVFA 3ZNPA 5C37A 1F8GA 1BXGA 1U28A 4JBIA 4U5QA 2NWQA 5BT9A 5AXBA 1IZ9A 3ROMA 4B7UA 2ZCUA 3TN7A 1DIHA 1N8KA 4ZQGA 2JHFA 3GDGA 3VH1A 1B8PA 2HUNA 5JDIC 4DPMA 4DREA 5B37A 4GSKA 5TS3A 2OBNA 4ZJUA 4OH1A 2VT3A 1R12A 2DAPA 1NFFA 3RC2A 2VHWA 3E9NA 4N7RA 2QZZA 1N1GA 1NXQA 3DZIA 3M1LA 1A71A 1PJCA 4G65A 3SJUA 2C54A 1LSOA 3E03A 3WBBA 4AVYA 1ONOA 2GERA 2X5KO 4EYEA 1H0KA 1Z73A 3ZV3A 4LK3A 3GVHA 3LT2A 3T4XA 2RIRA 4R4JA 1UXHA 1VKOA 1ZSYA 4PG8A 4LVUA 3RC7A 4NMHA 2ZYAA 3ZW8A 1LC0A 1JLLA 3PXXA 3GF4A 1T26A 4NK5A 3WGHA 3UH1A 5I7VA 2IRWA 3IJPA 1GZ4A 2FZEA 1NQAO 1Z7EA 2J8ZA 4E6PA 4PLYA 4CL8A 4CLRB 2VOEA 4J2HA 4JQCA 5DF1A 5G2OA 1ZXLA 4JBGA 2R00C 4FJ0A 1U4OA 3ASUA 4YTEA 3QQPA 3ZU3A 4E5MA 3KHUA 3DMTC 4FFLA 3LVFO 2ZTUA 2VYVD 5IZCA 2C5AA 2PGDA 1I10A 1ZVMA 4I5DA 5THKA 5B4UA 2EW8A 5KOIA 2NTNA 2AG8A 5JMWA 1DRUA 5JCJA 4NBTA 2NQ8A 3UICA 5B12A 2NVWA 4IXTA 1D4FA 1M6WA 1NFQA 3PPIA 3OA0A 3LLSA 4D3DA 1TLTA 4QXMA 3F1KA 1BW9A 1X13A 1QYXA 1P1IA 4Z9YA 4J7UA 3ZWXA 4UAGA 2HRBA 5JLAA 3VZSA 4M54A 4RVSA 1MC5A 1XELA 5TRTA 4HFJA 1HDGO 4NU6A 3C1TA 5BNFA 2Q50A 4IS2A 3F46A 3JQBC 4S3MA 3RFTA 5KKAA 4L4XA 3KBOA 4TROA 4UVHA 2IYPA 1QRRA 2X9GA 5L3ZA 2EG9A 4JGBA 4YEDA 4XRGA 2A9FA 1KERA 3E5RA 2VTEA 4LCJA 1EK6A 4JX8A 1UR5A 3PQFA 1RPNA 3QVSA 3ZWAA 1KY4A 5T64A 3WYBA 1XG5A 3ZHZA 2Y68A 2FSSA 1AHIA 1QKIA 3AWDA 4TZTA 3BMQB 4PLZA 1I36A 2OP0A 4Q3CA 3AY6A 1G6KA 4B7CA 1Y5RA 4CM7A 1HEUA 3Q1LA 3RC1A 1YQDA 5TJ9A 1WLYA 3H4VA 3D7LA 2YV2A 4XX0A 4ALLA 2C0CA 3NGLA 1YGYA 2ZTLA 3HDJA 2YJZA 3IP3A 2AHRA 3AFNA 1LX6A 4W99A 3VPFA 4BKRA 3KB6A 4BMVA 3RFVA 4R5HA 1W73A 5ENDA 3KYBA 4R3WA 4FFPA 1Y9AA 3PHIA 1H6DA 4JCOA 1TXGA 4MVJP 3RKRA 4F45A 4ZQHA 5GZ3A 3NJ8A 2R2GA 4XYBA 2IZ0A 3ANMA 5L7WA 2W2LD 2DT5A 4TMFA 2FN7A 2X5JO 1JN0A 4XGIA 4D3SA 4FJ2A 4L4SA 4FC7A 3CXRA 3VPGA 2FHSA 3GY0A 2PZKA 1SEPA 2E48A 2IODA 5DCWA 4IDGA 3SVTA 4EGFA 4IMPA 5TSDA 1PZFA 5JPIA 2ZB7A 3MJVA 4C7KA 2RBEA 3DR3A 1NR1A 4OAQA 2NM0A 3C7AA 5HS4A 4P38A 4JXKA 2ILTA 3F5QA 5F3RA 3U62A 1GU7A 3HB5X 3OIGA 4GAEA 3K6JA 4TVBA 5FYDA 5KNLA 1HLDA 1E3SA 1HDYA 2GN9A 2HQ1A 2ZCVA 4YAEA 5TT1A 4CPDA 2B4RO 2GRAA 4OOEA 5JSFA 1E6WA 3W6UA 1NQTA 2H6EA 3WYEA 4GX2A 3RUEA 1JU9A 3WS7A 1FF9A 1V3TA 2Q1TA 1IB6A 2YUTA 5TLSA 1ML3A 1OC4A 4HADA 5TIIA 2HAEA 2P5YA 1YQXA 3HG7A 3RQSA 3UW3A 4DIBA 3DZJA 3IQDB 1U8FO 5ILGA 4WJZA 1ZEJA 1ORRA 4R16A 4B4UA 3OMLA 1VC2A 4K6CA 3WICA 5EESA 3EZYA 3QW2A 4AJKA 2ZTVA 2FOIA 2P9EA 3TQHA 3FCOA 1BHSA 4CM6A 1JAYA 2JJYA 4HNGA 4MVJG 4D43A 3KYDB 4HY3A 1TVEA 1V0JA 3U4HA 1HE3A 4FGWA 2P4QA 1LRLA 1ZEMA 1ZK1A 2GSDA 3SC6A 1IZ0A 2OORA 2GO1A 2P5UA 3GEGA 1T2DA 3ROPA 2AEJA 4II2A 5GMOA 5U1PA 1P1KA 1U3WA 3VH2A 1F17A 3ZHBA 4D45A 1BGVA 1YB1A 3O03A 2J6IA 2Y1EA 3KXDA 5CP8A 3COSA 4A26A 4DLBA 2EIHA 2BKAA 3NT4A 1PZEA 3BTOA 4NJOA 1NWHA 1YE3A 3BMCA 1B3BA 3HFGA 5JC8A 1UDAA 1EUDA 4ALIA 3WTBA 2VHVA 4LISA 3ROKA 1IHXA 3QVWA 2ZATA 5JY6A 4J1TA 3EY4A 3DZHA 3K9QO 3E18A 1EQUA 3SBOA 5AXDA 3VOSA 3MEQA 2RAFA 3DTTA 4CM8B 4Y6RA 3GFBA 2YHUA 3LT4A 3WWZA 3ZDFA 3U3XA 1E1NA 2EJWA 1N5DA 1PX0A 3T4EA 3DBLA 3WMXA 4RVHA 1I24A 4YA6A 4BQRA 5KJEA 4QSMA 4BB5A 1PQWA 5TX7A 2D5AA 3D0OA 1T4DA 1RYDA 5F1OA 4W6ZA 4BQPA 5IN4A 2P4HX 3BYZA 4TRRA 4DL9A 2X23A 4FSHA 4NH4A 4Z9XA 7MDHA 1Q0LA 3NX4A 3FF4A 1HSOA 2B37A 2ZYDA 2W98A 4BL5A 2NU7A 4Q3EA 4F46A 1JKFA 1I3NA 3RU7A 1GADO 5KJFA 3CPSA 1QV7A 3ZV4A 1KEVA 1DFHA 2O7QA 1X7GA 2ZKLA 2GF2A 4WASA 2OGUA 4XQEA 1CRWG 5ADHA 1NX6A 3UF0A 4CV3A 3GN1A 1PIWA 3OQ6A 4DIFA 1HT0A 2Q2VA 3RUAA 3RC9A 3KYCB 3BHJA 4IS3A 1K3TA 4XWYA 5F5LA 1T24A 2P9GA 3UKOA 3RU9A 5I8WA 2O2YA 2YQ5A 3ZNNA 5ILOA 2DM6A 4CV2A 3VPHA 2OMEA 3OH8A 3T7CA 3RKUA 4E2XA 4H3VA 3UCXA 3ENKA 3WFIA 1BRMA 3RUFA 1MG0A 4Z6KA 3BMQA 5AXAA 3MWDB 5A04A 3H9GA 5DULA 4I5FA 3TZQA 1EDZA 4J4HA 3EK2A 3NV9A 2PH5A 5BSFA 2NV6A 3PGJA 3G79A 2HCTA 4BO3A 3DC2A 3OICA 5C7OO 1R66A 1XLTA 3JSAA 1A4UA 1NTOA 3WGOA 3IIEA 3VC7A 3F6YA 1V35A 4HP8A 4CMEC 4CV1A 3FPLA 4RORA 3D4PA 4KZPA 1CYDA 1U3VA 1UUFA 1X7DA 1T1RA 3OECA 1A72A 3DWFA 3I1JA 4CM3A 2PZJA 4JJGA 4YAGA 1RYEA 1PTJA 1S7CA 1JWBB 2BD0A 3WMWA 4GI2A 1MP0A 1SZJG 3NYWA 5EJ2A 2AEFA 5EERA 5I9LA 3CIFA 1HDCA 2Q2QA 1F06A 2ZJ1A 3ON5A 4R68A 3SX2A 4LW8A 5AQ1A 3E8XA 3P2YA 3GNSA 3GGOA 3C7DB 3KSUA 1NVGA 3JYOA 2VWHA 1PL6A 4RPJA 1CF2O 2D2IA 3WXBA 2DFVA 3I9JA 5IAAA 3GNQA 3JQ6A 4HXYA 3L07A 4ILKA 1Z82A 5DBGA 4Q3DA 4UEOA 4I9NA 1H2BA 5HM8A 2OUIA 1Q0HA 4WOKA 2PH3A 1KVRA 2UUPA 2VRBA 4XYEA 4WLVA 2C2YA 2CDCA 5MGBA 3E9QA 2YY7A 3HNPA 3PZRA 1T2CA 4XYMA 4BNZA 1A9ZA 3JYLA 2DPHA 1V6AA 1IULA 2QRLA 2IXAA 4MINA 5HTOA 3BMNA 4FW8A 4GX0A 1P1FA 1LSUA 1YKFA 2CVZA 1Z75A 3OBBA 2WWRA 1K0UA 4D44A 1T1SA 2OP1A 5JDCA 2PWZA 3U9LA 2PV7A 1YB4A 2J3JA 4XYLA 1DFGA 1RKXA 2JCYA 5L45A 4Y9DA 5DN9A 4OQZA 1ONPA 1SOWA 2J3KA 1MFZA 3Q2IA 4BV8A 4B4OA 4AJPA 3JQCA 3N74A 4L9RA 3ADPA 1OOEA 2OBYA 3M6IA 4IJUA 4NBRA 5ER6A 3MZ0A 2HJSA 2HLPA 2XOXA 1HYHA 5EQFA 2GN4A 3C1AA 3UN1A 3PFWO 1BVUA 3KM0A 2I65A 1ZJYA 4LRSB 1VM6A 4LMPA 2LDXA 3I23A 4IGFA 3FR7A 4IDFA 1NQ5A 5LCXA 2DC1A 2E6UX 2XPCA 4NJMA 3WNVA 4EUHA 1KY5A 1BXZA 1SB8A 3PIIA 4KP7A 4XQCA 2GDZA 1HWYA 4LGVA 3HFSA 2HRZA 3TPCA 4RF4A 1GYPA 1OBFO 2VZ9A 1PGPA 3D64A 2NNLD 3VPXA 3H6KA 4CQMB 2Y67A 3GZ4A 3G49A 2PD4A 3FHLA 4DRYA 5KVCA 3GVXA 5TGDA 5JAIA 3IMFA 1M67A 3LT1A 3FWNA 3TFOA 1U3UA 1Y8RB 1C3VA 4WEOA 2B35A 3VKVA 1PGQA 4ZHSA 2QYTA 1WZEA 4MP8A 1EMDA 1VI2A 2EWMA 1QV6A 2IEBA 3OIDA 2NVUA 3ORFA 1Y8QA 2AEMA 3GPIA 4WNCA 1B8UA 2YHIB 1U9JA 4CLXA 3CEAA 3PDJA 2P91A 2HU2A 3PYLA 1MA0A 4XRRA 5I9NA 4RZIA 3DZGA 2DTDA 4BHTA 4R1TA 4MVJF 1M6HA 4RVGA 4IDBA 4LRTB 1EFLA 3OEWA 4FFNA 4HFRA 1I32A 1VL6A 5G0VA 2RH8A 1QR6A 4P4GA 2VUTA 3C7CB 1PGNA 1VJTA 2WM3A 2NTJA 2Q46A 3AY3A 1LDBA 3DBRB 3DL2A 1TA4A 1EUZA 3RD5A 4DPKA 3WIEA 3H5NA 4TQGA 4WLEA 2VNSA 3EVTA 2I5PO 5A9SA 4NFHA 5IDXA 2O3RA 4CMHA 3HQ4O 3FD8A 1NAHA 1OI7A 2AQ8A 3LK7A 4D42A 1K6JA 2YFQA 2I67A 4WCFA 5FI5A 2CF6A 4XQ9A 3WJ7A 4O63O 5JXWA 4ESOA 1LSJA 4CJXA 2Q45A 1P45A 4XIJA 4YJDA 3X2FA 5GY7A 5K6AC 5LDGA 1U2DA 4IY1A 1BDMA 3JQFA 1FXSA 3LC7O 1P9LA 3CMMA 4E5NA 3AFMA 1U2GA 3Q9NA 4XYGA 3BMCB 1VLLA 3B6ZA 4BO4A 3GPDG 4JNKA 3MJ4A 4BUCA 4CM4B 3TOXA 6LDHA 2ZQZA 1UXIA 5T6BA 2BGMA 5CDUA 1C0KA 2NADA 3EAGA 3H8VA 3VTZA 3JQFC 4E2WA 3PHJA 4WEQA 3C3XA 3FRJA
chains in the Genus database with same CATH superfamily
3IIMA 1XLTC 2GZRA 1FUYB 1CDDA 3M1YA 3V55A 4YJ2F 2TMGA 4YMGA 5B58T 1BU8A 2J5KA 1BS2A 3WSWA 3AHHA 2NLOA 3SJZA 4RTNA 3EOZA 4W9RA 1HYBA 1PDOA 1U9ZA 1FQKA 4LHSA 8OHMA 3S2IA 1FU8A 2CLOB 3EVBA 4W7HA 3E2IA 3RV4A 1RE1A 4V0QA 3TLCA 2WMYA 2XOKA 4KPYA 3CZ5A 3WYFA 3K5WA 2F17A 3I6ZA 3L82B 2NVBA 1A04A 4PNPA 5JAZA 5LQJA 3LDHA 2I33A 4LNUA 4J0HA 5EE5B 5KC8A 2A9JA 3IMEA 4KTTE 1YA8A 1K66A 1Q15A 3AOEC 4IHAA 3JZFA 3NWJA 3PDIB 1VLVA 2WAYA 1J49A 2HF8A 2LDBA 2VSFA 3AEXA 3QV1A 4JFAA 3P2IA 4O4LB 4P0QB 2WYOA 4RQUA 2NOAA 4AQ7A 2ZIFA 1VSQA 4QU9A 1EFRA 3RT7A 3DTVA 2IHYA 1KXJA 3DZDA 4US2R 3E81A 1ND6A 1JWLA 4CQLB 4B3FX 2WOJA 4DLLA 4EW3A 1ID1A 1P7CA 3EQ2A 3FCEA 3UAWA 3KUCA 3W9SA 2C9BA 2Z1MA 3R6GA 4KPGA 5C0OE 1DKQA 4J0QA 2RDMA 3VNBA 2WJYA 2VHJA 1HT1E 5KC9A 1KETA 2JIPA 1AH2A 3G1TA 4QEKA 1JLMA 1FS6A 1LPAB 4PPQA 4K3UA 3N2GA 2PA0A 3KVRA 1NXWA 3H0KA 4KRGA 4CR7A 3D8TA 4BJ5A 2FQ1A 2R5FA 3FOCA 1PS9A 2ZYSA 5A3RA 3WKBA 1JG1A 2SHKA 1PNTA 3A6FA 3IP7A 2QUZA 4Y2SA 9ATCA 2NO1A 4MVJA 3FOWA 4DV4B 3EGDB 3RLFA 3STHA 3IBGA 4QVGA 1GEEA 4D57A 4QM6A 1P60A 3LLUA 1ZXXA 1DL5A 1ZO8A 4QZVA 5I01A 3EVEA 2G1JA 2P27A 3NEYA 4HZUA 3OCXA 3LA6A 4TZKA 3GLIB 4JSTA 1QCZA 3PYMA 2BSXA 3K8QA 3BIOA 1OC2A 2KLHA 2X1HA 1GG8A 4UOQA 1FFAA 5HYVA 1RRPA 2ETVA 1CQWA 4FP9A 1EUYA 2J46A 3I83A 1R5JA 2V5VA 3H5IA 1NKVA 4G1BA 4IZOA 3M6UA 3AINA 4HCJA 1IH8A 1P7VA 4WXRA 3F1LA 3CKKA 3H1FA 2FJPA 3OQIB 1H3NA 1NUUA 5C4GB 1JBEA 5INTA 4RF5A 4KDCA 5CLLA 4N49A 3T8YA 3IODA 3RI3A 4QTUB 2A1TS 1ZD2P 2DWQA 2AMYA 2FB9A 3M6WA 1FSFA 2OFXA 5LSAA 2V6BA 3C3JA 2BMJA 4J3FA 4H1HA 3C0KA 4O5AA 4R2KA 4KDEA 3NRCA 1S2NA 1Q92A 5IABA 2GJSA 4N5DA 3OC0A 2OFPA 3DCYA 4X3PA 2FPPA 3CGWA 3FRIA 3ZWMA 1TCVA 2LNDA 3ICPA 4XCQA 5HJ5A 4BNVA 1W0JD 1WETA 1JAHA 2PX3A 4E14A 5FUQA 1H6AA 3SHQA 4V0ME 1WQ3A 2ZUDA 1W5SA 3GG2A 3R4VA 2QRZA 3ELDA 2CE2X 3W3AH 2H00A 1IZ8A 3E5HA 3NIBA 3C4VA 1VKHA 4YK7A 2GK6A 1ZN8A 1P0IA 1SG0A 3LXXA 3CRW1 3OESA 3K3PA 4D0LB 5LJLA 3DLHA 5K0EA 4OMCA 3B82A 1H66A 1PFYA 3DHYA 3BRSA 4TV9A 4XXHA 2XUQA 3CY6A 1L5KA 4WXEA 3F3YA 1AHNA 2NTEA 3W3AD 1I7QB 1KU6A 4ZQCB 1ORHA 4C0QC 1UIRA 1S4QA 4PR3A 3VPAA 5LWQA 1VRVA 3D2BA 3R5SA 4EKEA 4HQFA 5AUNB 3FMVA 1ZVJA 3WWPA 3DBHB 1QBGA 1NW6A 1UBNA 2QTCA 3IMCA 3VJRA 1Z2DA 1ZD5A 3D1VA 2D1SA 4N6NA 5C8XA 3TW4A 4RY8A 3TI9A 5SZKB 3NIWA 5FORA 3SZMA 3HM9A 3L43A 2GF0A 1C2TA 4Q3NA 1D0IA 2MR5A 1NDHA 1UFKA 3MUFA 4FNAA 4WHMA 2ZIVB 1KI6A 3E8SA 3I5AA 4B6EA 1ZG3A 4TWBA 4XLTA 4DN6A 4DNXA 3OOHA 5JBQA 5JUWA 2ECKA 5CTJA 4EI9A 3L93A 2HCJB 3K8ZA 4A6EA 4S1TA 3UIEA 4CLRA 1S5PA 3ZWYA 4BV9A 3GP5A 3BD8A 2ZP1A 2XGSA 5GZ1A 2X2EA 3UVEA 1EBUA 2IITA 4MWBA 1YR3A 3H1PA 4OV6B 2LD4A 5IAGA 1PBTA 5KNBH 4ID9A 5LQMA 1U2SA 3H6GA 1NBWB 4N39A 4L9WA 1JX6A 1THZA 2Q5HA 1JDPA 2B20A 1YCGA 1H2AS 2A5FA 3HZHA 1EXMA 1USGA 2AK2A 3NHKA 3PQ7A 4GO1A 4H9GA 1RXVA 2YW9A 1QQ6A 1YBHA 1CP3A 1JWAB 3T7AA 1I30A 2CC2A 1QYDA 4WV3A 1MBZA 4ZVOA 1EVLA 1ZGZA 4IFTA 1DJMA 4XVRA 1DIRA 1NRXA 1RWKA 5KS2A 1M75A 1XVAA 2QTHA 1WW3A 3CF4G 5BUCA 1QYCA 2C04A 1J8VA 3GEHA 3LVBA 4DAOA 2RONA 2Q27A 4ZAXA 2PHZA 1OTHA 4X6YA 4JJKA 3ISTA 2DFPA 3K5HA 1K8RA 2QLTA 4TV8B 3STUA 3WO0A 4FE7A 3U4DA 3Q7TA 2E82A 4KREA 4WNIA 1XCOA 2WINI 2C57A 2B92A 1RQ2A 1K9VF 1NW9B 3DV0B 4QAJA 2IP2A 2ZSBA 4Q1BA 3FI9A 4D46A 2V0GA 3QE3A 4C3VA 4DMLA 4YMIA 3K32A 1QFSA 4JJZA 4KL8S 5F76A 4TKUB 3X1KA 2ZTHA 1VPDA 4EATA 3H0CA 1DJPA 1DRJA 1EVYA 3NPMA 4CMGA 1I4WA 3NAQA 1VG8A 3AJAA 4GZ6A 4KWEA 5ICMA 3UAGA 1YK0A 3RUPA 3Q7IA 3RBZA 1Y6ZA 2I22A 1P3Y1 1U9CA 4FBGA 4FD3A 3R6LA 2FR8A 4URUR 1V8BA 4HGQA 2WNIA 1PI3A 2WNSA 2JD2A 3GX1A 5IAKA 5ITZB 4I4IA 5K05A 1MB3A 1Z4LA 4D56A 3IIIA 1E3IA 1YZTA 1YZNA 2C0PA 3LQQA 2VZLA 3B3FA 4I6EA 3ETCA 1KJQA 2IQ5A 4GYKA 1JQAA 5C7YA 3S2FA 3KWMA 1P5RA 2V4MA 1SVLA 1UM9A 3CWZA 3EDCA 4R5MA 5DX0A 2IBTA 3PEWA 2ZRIA 3GU3A 4WLOA 1ADFA 2A5YB 2R7NA 5JXJA 2JASA 1GYRA 3IUJA 4AZ0A 5LU8A 5IZ4A 2CVQA 2AIRA 3KQQA 4PYLA 2DBVO 3RK0A 3UNXA 2O0KA 4DA0A 1O9BA 1VDMA 4BUJA 3SMQA 8MHTA 4UD6A 2R84A 1DWQA 3FBTA 1FFHA 1BSVA 1W5AA 4F7WA 2HF7A 5HQ3B 4UVGA 1I7LA 2CLDX 1WHSB 2QJFA 2OCAA 4TKZA 4ZT4A 2PX0A 4KVAA 1A4RA 2WP8J 3LX6A 1CZOA 5B7NA 5KWEA 4C9BA 3RYIB 3GQBA 1N3LA 2AW3A 1KQNA 1ZONA 1OFGA 3A9CA 4EYGA 3L8FA 1V5EA 4M87A 2FCAA 3MAJA 2IOYA 4V03A 1LW6E 1YQ9A 1Q2XA 1RQLA 3I0MA 2GEFA 1KSHA 3O2SB 1RPAA 2AOTA 2FPRA 3MLBA 3OETA 4R9SA 4CM9A 2P9TA 2P2NA 3ACBA 3ZH9B 3T3IA 4HMQA 3CLRC 3BMOB 1KEUA 4B3HA 2HHHB 1W2HA 2DH6A 3IURA 1ZD3A 3LUGA 3BTVA 3GJXC 1AK9A 1NVVR 4HX9A 4K9DA 2DY1A 3GMSA 1IIBA 3FTPA 4ZYZA 1KYZA 2RD2A 1E3WB 4JOCA 1MO5A 5KYGA 1AGXA 2GBIA 1KE1A 3L7IA 1LDYA 1T43A 3TQSA 4OSEA 3S2YA 4O2AB 1JDBB 4A03A 2ATXA 1NXXA 3S8YA 1E2QA 3EH2A 3N7UA 4K5QA 3WV5A 1ISGA 1Z56C 1E2MA 2VH1A 4LYDA 4MYTA 1AV6A 3ZD7A 3TSYA 2W6ZA 2UXDB 3S7TA 5ER9A 1AS3A 1N9GA 1XOIA 2B8EA 3HY4A 3LT5A 4BMXA 4C0BA 5HVNA 3C8HA 2MYNA 2XQJA 2FWRA 1N34B 4Q9AA 3T7JA 3HKEB 1CC1S 1E61A 4LZPA 3EGDA 3WADA 4P3PA 5AHOA 4YP7A 1CWUA 4I5IA 1AO3A 1QQ7A 1WY5A 3H13A 3KFVA 1OTXA 2ENWA 4F72A 3NCTA 3DE5X 1KZ9A 1LLDA 1PVDA 2P3SA 1M34A 3EVZA 2FUG1 1QANA 3ORYA 5EZYB 2FZ5A 2G17A 1K08A 2VT7A 2P2YA 3SX0A 2YFKA 1WUJS 3DE2X 3UAOA 3D5EA 5F4ZA 1WD7A 4CR8A 4EKYA 5FPPA 2XUGA 5JRZA 1NN0A 2WC1A 3H11A 5H81A 1EPUA 1KGDA 1SBTA 4DV6B 1A3CA 3NDJA 4X1IA 2IGTA 4R1OA 5C8ZA 3PQ5A 4LECA 4I8XA 1RKBA 4Q93A 4EPYA 1YBAA 4ML3A 3DTVB 1AK2A 4URXR 3QE4A 3TUZC 1P7WA 3D59A 1HQDA 4MS1B 4TZ0A 4I5GA 1IZYA 3ONWA 2OBFA 2ZI7A 1K86A 3L9WA 2GPAA 2AQHA 2Y1WA 2AD5A 3NNNA 4M98A 1JMVA 1VL0A 2XUIA 4KPUA 1Z2OX 2FVYA 4ZU1X 1MGPA 2J9RA 2PANA 3RSGA 2ZGVA 2VN8A 1QO9A 2BZ0A 3L6DA 4OU5A 1J2TA 5L95A 4LVNA 3L4EA 1HDXA 4JSRA 1BKYA 2ZAIA 3M70A 5EJIA 2V1UA 3DYBA 1QVAA 1W5TA 3GWGA 1QIIA 4LJ6A 4YJFA 3SVZA 3TW8A 1XHLA 2HDNB 1A95A 3BILA 1YUNA 3KSAC 4BP8A 1HDIA 2CVOA 2EERA 2LKDA 4RETA 5E4FA 1TVKA 1PEKE 4F4HA 4M46A 1M2GA 1EFVA 1CJMA 3CUSA 4QJ4A 4YRCA 1AN9A 1T35A 1NF3A 1JALA 2HFKA 4A6XA 1DAOA 4KC0A 1RM5A 4N40A 5CDFA 5WRFA 2BSQA 4PGGA 4XDYA 3ANLA 3LUJA 2AG5A 3UPTA 1KY3A 4G0WA 1LTHR 2Y0DA 3MJCA 5LN1A 1TO2E 2ZIGA 3HYLA 4G26A 4IVRA 1C3LA 1RLUA 3JU3A 2BFEA 2HPHA 3RB8A 5BW4A 3OQ1A 2ZJ0A 1OYYA 2XRYA 4NU5A 2OKGA 1IN8A 4GXQA 4D9IA 1J9GA 5LLDA 3LV8A 1Y37A 4FINA 3EYWA 5JBIA 4YDSA 2JB9A 1N6KA 2ZSUA 3JZDA 3CWCA 2XKBA 3NWBA 2AK3A 3T9BA 4C5AA 4U2CA 4B2LA 5EJ7A 3CH7A 3LBNA 1EBBA 2V97A 2QG4A 4L3OA 2ZW9A 1OI2A 4GYWA 3BOSA 3OPMA 1RXSA 3QPWA 1HE5A 5CVUA 4BBPA 1CJVC 3V4LA 3C3EA 4P7BA 1YL6A 2C9CA 5C5IA 2WJ3A 4PO9A 4MQMA 2R62A 2KW5A 2QTZA 4RHXA 1BEEA 1XMIA 1AKQA 1DS6A 1MX3A 2OZPA 4KQCA 3ETNA 2FSIA 4MWOA 2RHCA 3NTUA 5DHUA 4AUKA 1XDWA 4F4IA 3AUTA 2XXAA 3FWHA 4YRDA 2WWIA 1FUKA 1NN5A 1PDWA 3OJOA 3CRMA 4PSDA 3QYPA 3O4FA 3LOPA 3P5BA 5CVCA 3UHOA 4RA9A 4UQPA 1H5UA 1WP4A 2BEVA 2R86A 2FQXA 4NU8X 3U4QA 1O97C 4TV9B 3N2GB 1MQ9A 3ZY2A 4DMRA 2FPPB 1R5OA 3MJRA 4BNJA 4E15A 2WTXA 1YUBA 1Q19A 4L51A 1CULC 1UANA 3HUDA 1CQIB 2YWCA 3SC3A 4EYKA 1GLVA 2ZR8A 1U0NA 3DOOA 1RKQA 3IDOA 3V4SA 2NP7A 3FNEA 1KK1A 2FEWB 3GGGA 4GL4A 1AZSC 2QEQA 2ZK7A 4XEUA 3TKAA 5B4TA 4P0PB 4PC1A 4ZU3A 3QWBA 5FAKA 3Q5DA 1BXKA 5CYFA 1GCIA 4WX2B 2RI6A 5FJIA 1G7TA 1JXMA 2OCYC 3NP9A 3KLOA 2IWHA 1OA1A 1ZZGA 2AI3A 2ZBVA 3EUAA 3VTKA 4B48A 3ZJ4A 2AOUA 3A1CA 3SIXA 4Y1RA 3K1YA 1F48A 3OUZA 4M6WB 4YACA 2NZJA 4B4DA 1Q7EA 3LRPA 1K68A 3OM9A 4XVUA 3ABQB 1ABBA 3NH9A 2JJ1A 3BTSA 3HYSA 4C06A 2BJVA 4ZCLA 4BLTA 4EJ2A 2VQ3A 3PC8A 4LS3A 1IEVA 1ZN7A 3OLZA 2OQ2A 2BGTA 4UBJA 4PNEA 1RAFA 3KQYA 2H1VA 3O2NA 1P8AA 3SNKA 2B7BA 2QAJA 3DW3X 3DYVA 3MWDA 5K8VA 1MRSA 1T8SA 3TK1A 2BFPA 2O7SA 4MV4A 4QTZA 5AQEA 5J5VA 1Z7WA 5K0ZA 3TG8A 1KL7A 1J99A 2V6MA 4Q7MB 5I9MA 3UWDA 3NJ4A 1ZJZA 3MXTA 2OSVA 1E3TA 5FR1A 3CZPA 3BFKA 1SVWA 1S8FA 4Z9FA 3IHLA 1X1EA 5I9IA 2UZIR 3BHNA 1EDDA 5LP6A 4M7PA 2FG7C 2W90A 3T3GA 1DEKA 3S2UA 3PHHA 2IZ1A 5CFQA 5AIBA 1L7VC 1YDMA 3ZJYA 4JI2B 2HMVA 1NJ1A 2ZSJA 3FGPA 4H17A 4KAXA 3RUDA 2HMAA 3EGOA 1P0FA 3UMJA 1OF1A 1YO6A 1H2WA 1T5BA 3HRKA 4YJ3F 1D5WA 2C2GA 5AM3A 5JHHB 2O7NA 3FZYA 5CB4F 4YFYA 2BT4A 1LY1A 1ATZA 1K7YA 2VJQA 1F38A 1YVEI 2HF9A 3QBDA 3IRVA 2G07A 4IDAA 4WUTA 1GL3A 3SZGA 1NF8A 3LXMA 2IHJA 3TFQA 4HNRA 4PYNA 1FFBA 4HGRA 4YCNA 1E7WA 2AXEA 3VMMA 3E53A 2MTBA 4FWTA 3ZNOA 1TU3A 5JCJD 4M1TA 1H3FA 5EUBA 4NMMA 3EQ8A 4TS1A 3T7RA 3IUQA 2ISQA 3UM9A 3HO6A 3IAM6 3A11A 4GLLA 4AQYB 3VOAA 3SJ7A 4JCCA 2W6JA 4GS5A 5GJVC 1ZSVA 1I1NA 4RTQA 3E58A 4WCFB 3UMYA 1MAUA 4Q7JB 3VR4A 4EI7A 3CEJA 5I7EA 1KZGB 4UHFA 2DTXA 1CY1A 1EB9A 2OCIA 2L17A 2Y1LA 3BJEA 4TYMA 1EXVA 5DNCA 1YC5A 2BEUB 2A3RA 4MYHA 1BXRA 4CMIA 2X9QA 4R1UA 4FFBB 1LNQA 3K1ZA 3F3MA 3TXXA 4EOGA 4EEXA 4TVKA 4O2AF 4XQGA 3MJFA 5FRDA 3JQEA 3Q3HA 3LX5A 4D7AA 5FWNA 4RLHA 4MH0R 1CUZA 4KFUA 3TNFA 5HKKA 4B3MB 1KS2A 2XITA 2DKNA 4X24A 4CXMA 1SU6A 3VBCA 4F56A 1Q0QA 1FVXA 3CQ9A 3B53X 1LUAA 3L0BA 2XADA 2ZXFA 2RGDA 4OHWA 4MPRA 5H8WA 1T9CA 3UAZA 2XMZA 1T5HX 1Z18A 3AEZA 3JD4A 4QXPA 4XH9B 2D1RA 2JFYA 1RT9A 4O2BF 1UWKA 5FLYA 2PS1A 1G5RA 1AHHA 3HP4A 3WLEA 1K0FA 4MROA 2P41A 4RSGA 1U0TA 3HU5A 4OQPA 4N47A 4GR9A 3VJLA 1CEQA 2D5LA 4NE9A 3VISA 3VU8A 2FDRA 3KBBA 4BNDB 3PR3A 4YRMA 3T99A 1QNLA 1II8A 2BKUA 3AP1A 5A9SB 4FT2A 1LQTA 2ZE7A 3AUUA 1Y4SA 4ALJA 1H9BA 3NVAA 4E32A 2DR2A 1FNBA 1VCIA 1YS6A 3ZH2A 5IDQA 4CM9D 2O8EB 1Z6AA 1IPEA 4IZHA 2QYOA 1V5FA 5IFLA 1A9OA 3AM5A 3AB8A 3ESXA 1U2EA 1RP1A 4FFLA 3KKZA 3QPAA 2XIJA 4DQVA 2QM0A 3HHPA 5CHYA 3WBFA 1SUWA 2XF8A 2EKQA 2ZRMA 3C97A 3PNBA 4RADA 3HFJA 5ALDA 3WGTA 4AF7A 4CW7A 5KTPA 4NCHA 3PWSA 3GAZA 3HB0A 2OBMA 5EN4A 1IVNA 3PE6A 3DEHA 3UMCA 4N5HX 1NAIA 2FR8C 3BUSA 1E3QA 1ESEA 3O3MB 4YB8A 1SOMA 2EVWX 3MLEA 2H1OA 3OUUA 5CW1A 1OLUA 1XCMA 4BZXA 1KEEB 5KSWB 1D7OA 3V8RA 1U0RA 1XTBA 5LXTA 1GD1O 1ZH6A 5HE8A 3AU8A 1P61B 3HKBB 2AMFA 5KHAA 1HL3A 5BN1A 3BICA 4OIMA 1L5OA 1NSYA 2YL2A 1L7XA 1XN4A 5DBHX 2QJOA 5K0LA 3ZDEA 4IDCA 2YVQA 1UK9A 2VDMB 3LL4A 2QX6A 5EI5A 2BPOA 1GUFA 4JLMA 4PZEA 4RD3A 2X9NA 5BQ5A 3RIHA 3PFHA 1RWBA 2XNSA 1NW5A 2HK8A 4MUMA 4XB6B 4JJ4A 3WOHA 2AYYA 2UUAB 4LZOA 1LF5A 3LZ6A 1EDBA 2QAGB 1V16B 3GB9A 3C41J 3CUKA 1QU3A 4KFRA 5CFMA 1GNRA 2BHLA 2J08A 1O89A 4G07A 2GI4A 4JK3A 5GWXA 4KV7A 3EC2A 4IJKA 4TMTA 2J48A 1TYBE 3Q88A 4G4IA 4K8RB 4TN5A 3TL3A 3TSCA 4P7FA 5DHRA 3VHQA 2IUTA 1HURA 2R25B 1PJQA 3K2EA 4X3OA 1H8ED 1NZJA 2P5SA 3WMRA 2MU1A 3IQWA 3LRXA 4I3FA 4YR9A 821PA 3ETGA 3L8DA 2PRKA 3BFVA 3TJZA 3EHDA 5C7LO 1A9PA 1W47A 2QP4A 4GBJA 2C3OA 3QOYA 5E8JA 1IBRA 2EJUA 3JQRA 2O2IA 3D3NA 1AO0A 1A2BA 3JQ7B 5E0OA 4WNAA 3KZKA 4OI1A 5DU2A 4JD5A 3OJ0A 4A3SA 3L7BA 1VJGA 2VOJA 3IP8A 4EY3A 5L9AA 4CCWA 3G85A 2UV8A 5JNTA 5LBTA 4WJLA 1C50A 3BSFA 1B6TA 2RHHA 4MJ7A 2BFCB 4QOJA 1NJSA 2O2HA 4U00A 1SQSA 2XUDA 3AERB 4YT4A 3QELA 1YZLA 2DFLA 3MMXA 4PTYA 3D6JA 4GKVA 3RBXA 3P9XA 3LWZA 1E58A 4YX9A 1NZFA 1XAGA 1ZD8A 2PL9A 1MOQA 2JF0A 2RARA 3B6JA 3O83A 3OIYA 4RANA 5ENVA 4BNDA 5JEEA 5JO0A 4J1NA 2GUGA 4WXMA 1ST2A 1P1RA 2GOYA 5BUQA 5DJ5A 3TH5A 4CMKA 4DLNA 4DYDA 3HO8A 1TLLA 1I2BA 1XMPA 1AG9A 1SHTX 2II6A 2UZ1B 2R6CA 4G1VA 1Y1SA 4W6QA 4DR2B 1JLLB 4RPIA 4LF8B 3RVSA 3I1FA 4DIOA 3A6GA 1Y7HA 1UEJA 2NQ2C 5TPWA 2ZOSA 4QHTA 5IF3A 5IHPA 1SO8A 5DXJA 1EE1A 1P81A 5G4KB 3Q8LA 1A9XB 2XTNA 2GLTA 4X6UA 3VBEA 4UBOA 2WILA 1VG1A 2DR0A 1FLDA 4MYCA 2PR2A 2ZJZA 4N0DA 1IOWA 4R2JA 4YCJA 3D4BA 4V1CA 4YDQA 2ENUA 3KZOA 1Q0UA 3CX3A 2R8PA 4FMDB 4KYUA 4MWGA 4PFJA 1YZKA 1YOVA 2E4AA 2P40A 3K15A 3O9ZA 5DB4A 3FJOA 5KU1A 3CCFA 3CIOA 4ZZ0A 4WRRA 4FLMA 5DMXA 1UKBA 4BNYA 1W5EA 5DN6D 3SF8B 4KOEC 5K8CA 1GAQA 2PQ6A 2PGLA 3EDMA 1CZKA 5HIJA 4WXPA 5LMZA 1OD6A 1FP1D 1UP7A 1D04A 1HDRA 2Y4NA 4FOTA 2BCEA 3VR6A 4YDRA 2B4QA 4ZQFA 4M22A 4Q15A 4YAUA 1HPLA 4D98A 1LV8A 1RJ9B 5FPQA 3RABA 1G8YA 3QXCA 2EZ8A 4D6XA 2F3TA 3AI2A 1ZGCA 2ZVPX 5JR3A 1YZFA 3TBFA 4JASB 4MV5A 3FDXA 3OSUA 4HH1A 2LPMA 4UTXA 2QX7A 3ITNA 4JVLA 3WNQA 3EQ7A 4TTTS 2PG3A 1Z7YA 4LOJA 3K8YA 4QDKA 3CISA 6PFKA 3IPXA 3LBIA 1V9CA 4PINA 4GVPA 4MDYA 3AGPA 3ECSA 1VQ1A 3K0FA 3EGVA 2AKAB 1QH1B 4BKPA 1HMYA 1WV0A 2VPXA 1N2JA 2W0SA 4MV6A 2VP5A 4ZVPA 4C7JA 4XRGA 5BW5A 1VI5A 2CDRA 4HWTA 4KAJA 2Q7OE 5JYDA 3DFFA 3TVDA 4KK3A 1WDMA 1DARA 4GECA 1PT6A 3IHWA 4JLDA 4CWAA 1FTWA 1DAEA 1Q3KA 2HXGA 3AIMA 3EXG1 1BROA 3BWXA 2BN4A 2F3PA 3ZY4A 1YVUA 4EUKA 4C5BA 1P2VA 1Z4QA 2X77A 1J56A 2ASVA 3DXFA 2D74A 5JJLA 2OY0A 1XJ0A 2WSBA 2I8CA 2XGGA 4P3XA 2NT4A 5JO9A 5TR9A 2PUBA 1F51E 2E1RA 3PU6A 3ELUA 1N6RA 3F5DA 4ZZ2A 4HTAA 2RKOA 4XVCA 4DCUA 1L7BA 1H0RA 2G5PA 3FNQA 4MA4A 4ZAYA 5AJUA 3ZDXB 2CL0X 3LIIA 1GZ6A 1HRDA 1T1JA 5B3KA 4V1CI 1SA0A 4CIAA 2ZBDA 3HJAA 1ZA2A 4A8TA 3ZIDA 2O8EA 4YMTA 1U94A 1RQNA 2PFSA 4Y67A 5T57A 3UYKA 1JW9B 3WNZA 1PP4A 4XJVA 4DT1A 1GDDA 4IHJB 4M0PA 2NUTB 2AOUB 1JLHA 2WFAA 2YHAA 4XM1A 2JJ2A 2IY9A 2A2ZA 5DDIP 4ZJPA 2WU4A 2IYXA 3O47A 1CUDA 4N5LA 1QJ4A 1VXRA 4ZCPA 4CM5A 1DKUA 4AUEA 3DAPA 3L4BA 2FRDA 3CW9A 1X9IA 1QHFA 1ISJA 2BKEA 1BXGB 2Q5OA 3DUFB 1KP2A 1BJKA 1CR4A 1O7JA 3ESAA 1SCKA 4ZYWA 4L28A 3ZD6A 2XZTA 2I6TA 2OHVA 1U6KA 1O58A 1KDRA 5KAPA 4CETA 3RRMA 4ED9A 1Z6TA 1A96A 2QMEA 3AEUA 3EG9A 4NS4A 3QJYA 3KV3O 3MTJA 2EKPA 1IXRC 1EGMB 4QBGB 4W5QA 1Q7TA 2FN4A 2IYOA 3LGXA 3QEAZ 2CL7X 5TQ2A 4IV0A 1LU9A 2EDCA 1GR1A 2XYRA 2GHIA 2IXGA 1IBLB 4RDXA 5HHTA 2WNHA 3BVPA 2BLNA 3UJPA 3QVXA 5HEKA 2QD4A 1TGYA 2X58A 2GYUA 1B0AA 3GLRA 1CR6A 5EEGA 4ZYYA 3A6PC 1W1UA 5EQDA 3WA7A 1AM4D 2UZAA 1TAQA 3DR5A 4PG7A 5CNJA 3S5UA 1M74A 4IICA 4BO5A 3ILVA 1QMPA 4YUZA 3EVAA 4ZO6A 4RA6B 2G4CA 4YXFA 3HCRA 4JB8A 3UJ7A 4DMGA 4RMGA 3I4FA 4OF4A 5F33A 2Z2IA 4DIEA 2O1SA 4N5NA 5K20A 1VBFA 3MCUA 4KQWA 1KIAA 4EGQA 1IQPA 3T9AA 1U11A 2FWAA 1DEXA 3HXKA 3JWJA 2GWHA 3PT5A 4QODA 3V3TA 3PEYA 2LIPA 3FTQA 1EGHA 3P8ZA 2PZAA 2O07A 3U1VA 1BXRB 4CMIB 2W42A 1QGZA 7AT1A 1E8MA 2OENG 1LD3A 1RWPA 5AIAA 2H16A 1LNZA 4F4UA 1X0VA 3NBZC 4YV7A 5E2BA 2R1VB 1HFKA 1QWOA 1O94C 2HJ9A 2Z58A 2Q6TA 2HSEA 4JGGA 1FDTA 5DWDA 2JD0A 4ZEOA 2P8JA 4KQMA 2YASA 3B2EA 4UAUA 3OQIA 2CFSA 2W2MA 3O2QB 4N0QA 1R4MB 2CHUA 1JA1A 4RHUA 1HETA 4B0OA 4L5AA 4L76A 2QSJA 1SCUB 2QU7A 3TB6A 5FFMA 4ZYVA 1WDKA 3IKLA 2O59A 3T4UA 3B78A 3NYQA 2EZUA 3KYIB 2Q1SA 1LFAA 2I7TA 1K27A 1J7KA 4LYJA 3GLQA 5SY9A 2UYOA 2GEVA 1SD2A 2KX7A 4NK4A 1JNYA 4V0OA 2NU9B 3HVKA 3NUQA 4JELA 3QELB 1YIAA 2C03A 5E6RA 1NWCA 2FHPA 2UVQA 1NRWA 2PGJA 4GXRA 3L6OO 2V4ZA 3JQ8A 2DKOA 4A73A 1ZIDA 3RV3A 2GVDC 1QCCA 2XMCA 3HCCA 3LY8A 2F1RA 5LZ9A 3KKKA 1VG9B 3KSDO 1WF6A 4I46A 4JFRA 3RVDA 3MWJA 5THQA 3FETA 3HK2A 1DDIA 1OXVA 2B69A 1V1MA 4JX9A 1COZA 1JAXA 1Z5WA 4C0LA 3GD7A 4JVNA 5B2FA 5C5CA 2IOHA 1UADA 3MM4A 4AKTA 3KYCA 3I34X 2E55A 1JEYB 3RAFC 1F2TB 1Y81A 1TQHA 2R4TA 1MB2A 3ADOA 3L8ZA 1CJCA 4H7IA 4YCMA 5MHTA 4L4RA 1KMHB 4RZUA 4A0GA 1E8NA 3P2KA 2CSXA 3OX4A 4KXLA 3KJHA 3BGVA 1B2LA 3B1JA 3T9CA 1A8HA 5E8RA 5EJ8A 4LWZA 4HJXA 4R41A 3DAOA 2GB4A 2C8LA 4HDSA 4PV7A 2OPHA 5ALEA 5DIFA 5EFZA 3VC3A 1M8GA 3UWKA 4BJHB 1Z26A 1LPNA 3OOSA 2G1UA 3BL8A 4N1AA 4LRUA 1WWKA 1R74A 5J23A 3ANYB 1O96A 1RM3A 3GLIE 4ECAA 4YWJA 1OZ0A 4RIHA 4KSCA 1C3XA 4DNPA 3QVMA 3JYQA 1JEJA 2CKMA 4MAMA 2IU0A 4JI8B 4QTTB 5H80A 5HDBB 4NBKA 2QM7A 2H48A 2C61A 4XAQA 2ZWVA 2RHGB 3HSKA 3ONVA 4DA4A 3BFXA 4A2QA 1IC6A 4M89A 5CYPA 2CCKA 4ZCSA 5IK2A 1N2EA 1RCTE 3C3DA 3DMDA 3LKBA 3SHOA 1B76A 3U9SA 4JOSA 3SU8A 3IJ5A 1R64A 1X39A 3CRZA 5BSUA 3ZXXA 1M1ZA 1H2YA 4WKGA 5F7ZA 2BTEA 4HDMB 2Q1UA 2IVZA 1L4MA 1T5TA 4UVDA 1JKXA 1PR5A 1XVTA 4JY7A 5CA1B 2ZAMA 1U3TA 3Q72A 2ZE5A 3IQEA 3W1EA 5CU7A 3DVQX 1WKCA 2GK7A 2JEYA 4RMHA 3RSZA 9LDBA 4CM8A 3O82A 5AVJA 2NAFA 2YC2C 2XWSA 4MSUA 2O1WA 4TVSA 3NJRA 4PONA 2HK6A 2YWHA 1FTSA 4EUNA 3B13B 2P11A 1FDSA 1CB7A 3R3WA 1QAOA 3SSNA 5IT4A 1K92A 4CUZA 3O3OB 4W8GA 2NO4A 3P0FA 4O4JA 2X3UA 2H5IA 4O3MA 3RK1A 3OM8A 2WYWA 5JOQA 1K98A 1TCBA 1ZS9A 3BKXA 3MMPA 4OB8A 5HRAA 2P3OA 2WIGA 3WQBA 1GTZA 1Q95A 3O1JC 3QFSA 4K46A 3MELA 1PG2A 3WGUA 3O74A 3DHEA 3H3FA 4RFSA 3A4YA 3LPAA 4R8MA 3PCRB 1QVWA 5HCUA 3SNHA 4KO3S 3G9TA 5AK4A 1N7JA 2P9JA 2XMSA 2A9PA 2LKCA 1V37A 1JXAA 1LLUA 4DCMA 2AZDA 1JMKC 2XTMA 1YZQA 1NV8A 3QFCA 4BQSA 2IYUA 1AJEA 4UTNA 3CE9A 4K6FA 1KAHA 1EAMA 5DHSA 3U3OA 2X4LA 2IYAA 3NRBA 4L0QA 4KO1S 4UBKA 1N36B 2ZS7A 4HT3B 1Z25A 3AC0A 3EISA 3NHZA 4PZUA 1UZMA 3I9OA 3FHJA 1L3BA 2ZIAA 5E2IA 1LWNA 2XB9A 2V6GA 3F4LA 5KYYB 2ZYRA 4EJ0A 3AFOA 4PLVA 2WDPA 4FYYA 4QX6A 1REQA 3WZ2A 2OOSA 3SEQA 2VJLA 4CDRA 2R3SA 4Q03A 2BHRA 2ZRFA 2GX6A 3STYA 1Q44A 1PR1A 2A7XA 3K0CC 3KS9A 3STWA 4OXYA 5KQGA 2Y8EA 5TB5A 2F3SA 2HHCA 1G8SA 1C0EA 4R7GA 2P6RA 4XDGA 1Y42X 2G71A 3U09A 1TIKA 1EE9A 2WHEA 1U0BB 3P2JA 2I4NA 2IZZA 3FGNA 1MHPA 4TKUA 4WN9A 5LC1A 4DFDA 2BY4A 3UFXA 2JLUA 2QZ9A 3WLJA 3Q98A 3N6RA 1DC3A 3BIXA 5HQ3A 1KI2A 1E2PA 3GMIA 2W0MA 5JWRA 3ESZA 3GBPA 1H5QA 3UJHA 4HH3C 4ZI7A 1MRZA 3IGFA 4LZZA 4RWEA 5CCDA 1OAOA 4HSEA 2DQ4A 2LP4Y 3M9WA 4G5FA 4ZEXA 1TAGA 2X0KA 2YNMD 4AP6A 3D4LA 1FW8A 1H1LB 1HDEA 3B9PA 1UBJS 2AJ8A 1C9YA 2JLBA 4Y2RA 2KB0A 2V9PA 3SI7A 5H1YA 1SUIA 1SK9A 2I3GA 4KFSA 4WVLA 1GCAA 4QPJC 3ZKWB 4ANFA 1NBAA 5J59A 1ORWA 4POAA 2EFGA 2Q9CA 4W9MC 4LOHA 2CF5A 4QVIA 2IUYA 1G5QA 1P31A 3WK8A 2DU8A 5KQPA 3SWWA 2JAOA 4ND2A 4N65A 3FR8A 3PRHA 2KJQA 3DKRA 5A6SB 4AG6A 4J0JA 2G40A 4J29A 4PQGA 1G8FA 3UGKA 4QBTA 4ND6A 5F5XA 1UBGA 4E12A 5J58A 4WFQA 4N6GA 2G0AA 3DKIA 4RIGA 2DPMA 5TF4A 1UDBA 3VOBA 1J0BA 3HRIA 1DUSA 1QH9A 5J43A 1KZHA 6ABPA 1T36A 3JQ8B 1A5ZA 1UCFA 5C1PA 5JI3E 2YQZA 3O8OB 3MFYA 2Q8PA 4UTVA 2OM2A 4J1QA 2BFAA 3FTNA 2FXIA 4QJ5A 1FDUA 1P4RA 4NONA 1Z5UA 1K89A 2FEXA 4MIYA 4L8VA 4UHBA 1W1WA 3JQ9A 5CT4A 1G8AA 4O4HA 1GL9B 5EWLB 4U7TB 3O5AA 4BBZA 4ZCTA 4RYLA 1T5OA 4WA7A 4UEJA 5CA0B 2VDUE 4C01A 1AKWA 3ABRB 4DWJA 3X0DA 2NU6A 1SCJA 3TVYA 3ZLJA 5T4HA 1F8XA 1MRNA 2J9GA 4U6SA 3DCIA 1SVOA 4BNNA 3N58A 4EG7A 4F8YA 1R4ZA 1ZW1A 3AR6A 2RIPA 3JWIA 1RRCA 4C2TA 4AJ9A 2PZLA 4M0MA 4WCFC 3RU3A 3RUHA 4O5OA 4BVEA 4HVLA 1N7HA 4Q3KA 5C52B 1R9NA 3AJEA 4BFVA 3DBVO 4OPMA 1EH5A 5DYGA 3JD2A 3NBAA 3ZLUA 3H0EA 5GAJA 4Z1MD 5JU6A 1VL8A 5AOVA 1E1KA 3HU3A 4IV8A 5MF6A 3RC3A 2OXIA 3MMNA 4CIVA 3FWPA 1Y1RA 5DKFA 2OWEA 1OFUX 2Q4RA 3UGTA 1B23P 4U4AA 4J7AA 1KO1A 3D2AA 2I66A 3DV9A 5K09A 4AKIA 3MB8A 3G2KA 4MW6A 3FWZA 3GD5A 3A26A 1JQBA 3C8DA 2I4OA 3OP4A 4TQAA 2WZDA 3W4IA 2AT1A 2O57A 2UVPB 4NX2A 1JTFA 2O54A 5TPWB 1O6FA 4D8WA 5L7TA 1UKEA 2PZMA 1XGKA 3KZ1E 4QLBA 2IH4A 3QEOA 1U8TA 5JG7A 5IXSA 5CDGA 4EA7A 1K88A 2CMGA 1Z8DA 1CUVA 2ZYTX 5HS6A 3OQNA 2JBWA 4WESB 3V7FA 3V80A 4ZQBA 3TJRA 2XRZA 4JUBA 3WNDA 1V7CA 2X5OA 3A6JA 3K92A 2YH2A 4HGZA 4MARA 3OM1A 4MCJA 2DEUA 1PR3A 1O96B 3FVVA 2V5UA 5GTDA 2HTEA 1QLHA 2EWWA 4INOA 5F5NA 2WJGA 5F9MA 4ZV4A 4E31A 4FEAA 4KMMA 3I52A 1CKEA 2HFJA 1UIMA 2J0UB 4Q3AA 4TTVA 3VZPA 3MSCA 2XNHA 1NU6A 3O8RA 2GM3A 3RYTC 1L7QA 5JJIA 3GNTA 1U3CA 1JH9A 3V7UA 1VKZA 3UZUA 2PD3A 2QVZX 3ZBPA 3R0QA 1JIXA 4COOA 1I6KA 5EIBC 3E23A 3PQ2A 3HBFA 2ORWA 3BGIA 2Z98A 3F5FA 3GJ0A 2VHYA 3H5AA 4GLBA 5L40A 3FPFA 1MVNA 4ZOLB 1I4OA 1BTOA 4HDMA 3O03A 5EJAA 1KEKA 4CEJA 1JR3E 2V7XA 1GUZA 4FDVA 2XUKA 1V1MB 4EJSC 1XSEA 4Q9LA 3D6HA 5E3HA 4L74A 1KPHA 1DKLA 4Q4JA 2XT6A 3T61A 5CB4B 1FFDA 3FMOB 4RA6A 4AUMA 2WD7A 3D5TA 1D7AA 1XXLA 1Y80A 1T0PA 2GLXA 1VCOA 2XYHA 3CINA 3JD1A 3O8LA 4ZOCA 5E4YA 1P4AA 1YASA 1DJNA 1ZR2A 1W30A 1YBMA 2AOXA 1AK1A 2PXAA 4TMKA 2FFRA 1Y7TA 3OEYA 1XK7A 1OAOC 1QPGA 2BFMA 5IWCA 1AGRA 1Z47A 3F6RA 4KUHA 3TLKA 5JCOC 1PFGA 4TYQA 2ZRLA 4P53A 1TC1A 1E5XA 1UEIA 1JG4A 2O2GA 3QKUA 3ESCA 4F2DA 4ZOLF 1FMCA 5AK3A 3Q3JB 4YIKA 4CQMD 2G80A 3DCNA 1Y8RA 1CRPA 3JWHA 5SZHB 1H2FA 1R4MA 4EITA 2WUGA 2WF9A 2GZ3A 4KRYA 2ICAA 4XJTA 1TA0A 1QDEA 2QYSA 3G82C 3DEAA 3EXEB 3NHPA 2ZM6B <