4CMAA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
250
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 94
structure length 250
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmaA00
3LF1A 1KY4A 1B16A 3T4EA 3ANMA 4E6PA 1UP7A 4PVCA 3PDJA 2HMSA 1HSOA 4KP7A 2Y66A 4I9NA 3HDHA 3HN2A 5JLAA 5G4KA 1LRKA 3FNEA 3WGQA 2V6MA 3ZWMA 5C5IA 4XGKA 4NMHA 2E82A 4E30A 3CMCO 3IAHA 3IOYA 4MP8A 3RBZA 5U1PA 4UUNA 4J90A 3GDOA 5AYVA 4YPOA 3BA1A 3Q3CA 4J1NA 4FFLA 3F1KA 1LX6A 2P9GA 3JD2A 1ZEMA 2WEKA 3STHA 1O94A 3WQQA 4EW6A 3OJOA 3Q2KA 2WDZA 3BMCA 4ZQEA 3S2IA 5BSGA 3H5AA 3OHSX 3F4BA 4C7KA 2Y1CA 4P22A 4TWRA 3DQPA 4R4JA 1DFHA 3NDRA 4ZHSA 3A1NA 3QA9A 4PLZA 3OF2A 2CSUA 2OO5A 2VNAA 4OM8A 4Q3EA 4CM5A 5KJ6A 4YAKA 1W73A 5DULA 5A9TA 1F0YA 5CDUA 2RCYA 5KIAA 4HFNA 1ZZEA 2HLPA 2PGDA 5JPIA 4RVUA 1LRLA 1B2LA 1QG6A 2NU7A 2OFPA 3R0IA 5A05A 1MV8A 3LLVA 3GH3A 3MJ4A 3ROKA 2FR8A 3AI3A 5MGBA 3DZKA 3GRKA 2R6JA 4IJVA 1PJBA 2PKRA 5L51A 4LGVA 5JYEA 2X8LA 1NVGA 1FMCA 3KVOA 2X58A 3QVXA 1TI7A 1UXKA 2WJPA 2UDPA 3GHYA 3GMSA 3M2PA 4PZCA 4YCAA 5B1YA 4BV8A 4CM9D 5JW6A 1O0SA 1E5QA 3ZU2A 3MJTA 3ADOA 1SO8A 1NNUA 1DHRA 1JVSA 2FSSA 1J4AA 4HXYA 2GLXA 3AFMA 1E3JA 4WEQA 4DIBA 4BO0A 1O5IA 1PJ2A 4BGIA 4GPD1 2HMWA 1YBAA 1EUDA 1R4NA 1PJTA 3DBVO 2Q2VA 3FR8A 3D64A 3ZHBA 3ZWWA 4ALLA 1LLDA 4Z3KA 4WOKA 3C85A 4DQVA 3P2OA 3H9GA 2C54A 2YFQA 4NJMA 4B7XA 3GVCA 4XR9A 2OZPA 3SEFA 3GFBA 3D3WA 4A26A 3OJEA 3JQGB 4ZN6A 3K8ZA 3JD1A 4WLUA 3KBOA 1C0KA 3AJRA 2IXAA 4ROSA 3ZV4A 3QE3A 4UUPA 4GKBA 4RLSA 1IULA 2QRJA 1ENPA 1O89A 1WZIA 3JQAA 3HE3A 1LC0A 3WBFA 1RM0A 3KSZO 4E13A 5A9SA 1GPJA 1Z7BA 3GG2A 1K0UA 7ADHA 1ZH8A 4P4LA 2C0CA 5TNXA 5ICSA 3RFTA 1BGVA 4O59O 3N7UA 1A7KA 2BGMA 1IPFA 2LDXA 2VT2A 1SC6A 2HMTA 4A5OA 1I2CA 4MVJA 3RI3A 2PFGA 4NG5A 1PL6A 5EPOA 9LDBA 3E5MA 1D1SA 4Y67A 5JO9A 2ZTLA 1ZXBA 4IDDA 1GEGA 1NQOA 4AJ4A 3R3SA 3RROA 1ZK2A 1ZSYA 3DZFA 1FJHA 3GUYA 4U0JA 3ZNPA 3OMLA 5U9CA 1ISMA 1N5DA 4PZEA 2EERA 3DONA 4HNHA 1SNYA 1E7SA 1LLUA 5IDWA 3TZKA 2AE1A 4DL9A 1I36A 1DO8A 1ZSNA 3JYNA 4IZHA 2NVWA 4EUFA 1DJNA 1M66A 1FXSA 5JAZA 4HFMA 4OOFA 3LT0A 3U5TA 3EYWA 3I6QA 1QYVA 2VNSA 2O4CA 3KXDA 1YGYA 3ZV6A 4XYEA 5HA5A 1KOLA 5MDHA 2AEMA 3AI1A 4ALNA 1YVEI 1C14A 3NJ8A 5ADHA 3PLRA 4NDNE 1OMOA 4CV1A 2VTEA 2YUTA 1OOEA 3FBGA 4TZTA 4RPKA 3I9JA 4J43A 5BSHA 5JY1A 2VZ8A 3U3XA 1WLYA 3JQ6A 2VHZA 2A4KA 4G2NA 5I7FA 4BNXA 4OXNA 1FK8A 1WPQA 5DCUA 1F12A 3QWBA 4CV0A 3NEPX 5FEUA 1BW9A 3JV7A 1AN9A 3QQPA 2HRZA 3NTQA 1V3UA 5EINA 1ADFA 1W8DA 4FBGA 5CPBA 2P9CA 2JL1A 2VWQA 2YW9A 3HFSA 3K5PA 3KYCB 1DC5A 1TVEA 1NP3A 3HQ4O 4E2YA 2O7SA 1ZIDA 2D2IA 3VZQA 1LSSA 3UUWA 4RZHA 1LJ8A 3MEQA 3WG9A 2QZZA 2VHWA 1DIAA 1E3WA 1ISIA 3K2BA 5KTKA 1HKUA 1GCUA 2J6IA 1S6YA 2WM3A 2BH9A 4FS3A 2WTBA 1GZ3A 1KBZA 1GYQA 3PJFA 5BQFA 2QRKA 4WCDA 1H9BA 5DDIP 1KERA 2DLDA 5L53A 3UKOA 2W2KB 1BXGB 2Q4BA 4G5HA 1HYEA 1JKJA 2DKNA 2SCUA 1P77A 1I3KA 3F6YA 1JVBA 3HSKA 2EGHA 2Y05A 3NGXA 3G1UA 4R9RA 3I3OA 4AJKA 2OGUA 1NBOA 1LUAA 3ZV3A 4GQAA 1OFGA 3D4PA 1X0XA 1LI4A 3AUAA 2HK9A 3L4BA 3NV9A 4EJMA 3G0OA 1IY8A 4I5EA 5HRUA 1JKFA 5I9LA 3RUHA 3LVFO 4TMFA 2VHYA 4W7HA 1DC4A 3AOEC 1NR1A 3AM4A 2EJVA 2JCXA 2GUGA 3EZLA 3FD8A 3H2ZA 4L9RA 1HETA 3JQGA 5EL0A 2B0JA 2PGJA 1NPYA 4BQRA 4DC1A 3BMNA 4FB5A 5C7LO 3O8QB 3PYLA 2C29D 3KV3O 2EKLA 2JAPA 1JTVA 2HSDA 3KSUA 3OM9A 3HZZA 3ONEA 8LDHA 1UAYA 1EDZA 3ZW9A 1LXCA 5ILOA 2EJWA 3D4NA 3RU7A 3WIDA 3ZDFA 5TRTA 4BGVA 4EEZA 2I65A 3PXXA 3GNQA 4GAEA 3IP1A 1V35A 4PGFA 3JQEA 4XD2A 3UOGA 1PJSA 4UREA 1F17A 1PS9A 2Q2QA 4AJHA 3EHEA 1AHHA 2Q3EA 3RC9A 2O3SA 2BLLA 5IXYA 4OHUA 4DPLA 1RYDA 2CUKA 1XR3A 2NVUB 3C7DB 5L40A 3RUAA 4YEDA 1ENZA 1L7DA 1UXJA 4BGEA 2NV6A 3N58A 1XWFA 4XZ3A 2Q50A 4HFRA 5JMWA 4DRYA 3VTFA 3W8DA 1H2BA 1NXQA 4BKRA 2NACA 5KWEA 1IL0A 4IZIA 2YV2A 1HTBA 1JU9A 4DA9A 4RV9A 5L7WA 4AJ2A 4XB1A 5B4UA 5K6AC 1LSOA 4TRMA 4PRLA 1D7OA 3I4CA 1Z45A 5C7OO 1M75A 1XQ1A 1PL8A 1C1DB 3NAQA 3GPIA 5K6AA 5F1KA 3Q1LA 4YT4A 5JCXA 3A28A 3CPSA 2CVQA 5CFZA 3D3WB 4B8WA 2BHLA 1M67A 1PQUA 3IKVA 4N7RA 4YJFB 4YR9A 3RC7A 3A14A 4N54A 3PGXA 2WWRA 4J7CA 2BI8A 2D3TA 2UYYA 2Q4EA 2D5CA 2FR1A 2UUPA 4EEXA 2I67A 5KVCA 3VAZA 4BMNA 3WBBA 1E5LA 2G76A 4B3JA 1H5QA 4JIGA 1UUFA 2CF5A 1T1SA 5TF4A 4OQYA 5DOVA 5A03A 1I0ZA 4YJHA 1XG5A 1YB5A 3NDJA 3C7CB 2PV7A 1NM5A 3GDGA 4E32A 1PQPA 4IS2A 2B35A 1ZUD1 3QRWA 4J1TA 4NFYA 4OL9A 4F46A 5A06A 2NTJA 5A3JA 1YS4A 2ZYDA 4J7UA 3H5NA 2AG5A 4AJPA 3WXBA 4BO9A 4RZIA 4XA8A 2Q45A 4Q3DA 5DF1A 3RBVA 3AU9A 3V2GA 1ISFA 4D44A 1D8AA 1KEUA 2ZCVA 1QLJA 2VYNA 1U4SA 3E8XA 1SOWA 3QSGA 3QWHA 3IUSA 4NU6A 4OYRA 3FHLA 3U49A 1KVSA 3FNHA 3H6KA 2HJSA 4MKRA 1DOHA 2ZB7A 3NKLA 2X22A 3WSVA 4FFNA 1B7GO 3KYDA 4OIMA 3RASA 1R15A 4OSOA 1DSSG 1F8FA 1X1EA 3HHPA 3U09A 1FDWA 1E3WB 4FGSA 3HJAA 1Q2XA 2GERA 4D43A 2Q46A 3ZH2A 2AEFA 2FMUA 2I3GA 1NHGA 2GZ3A 3MTJA 3U4HA 1K3TA 1ZFNA 3BMCB 1K6JA 1ZK1A 5F5LA 2PH3A 2WYUA 4NBTA 3IUPA 3DOOA 1QLHA 1VE9A 2VWGA 2W90A 2EW2A 1H6DA 4JROA 3I4FA 5THKA 5CEFA 2VUUA 1E1KA 3DMTC 1ZCJA 4PG7A 4YAGA 4XQ9A 4DPMA 4PVDA 5ICMA 1EVJA 3OEWA 3NUGA 4CM8B 3L9XA 2YV3A 1JLLA 2NNLD 1N1EA 3I5MA 3PQDA 3U4CA 3RQSA 3JQDA 1P1HA 3ZWVA 4RLHA 1UAGA 1DBVO 2HRBA 3AM5A 1U5CA 2W2LA 3RFXA 1OAAA 3AM3A 1GV0A 4GX1A 1CIVA 1NWCA 2I5PO 3KLPX 2I6TA 2B83A 4MVJD 3FN4A 5IN5A 4CJXA 2QRLA 1ORRA 2BFMA 3H2SA 2FZWA 5AQ1A 1PZFA 2X9GA 4XDZA 1PGQA 1Y8RA 4GWKA 4RF3A 3WGZA 4LCJA 2IYOA 4Q3NA 3C7AA 3VH2A 4M8SA 3ROMA 2TMDA 2X0JA 4D45A 4IBOA 2ZIZA 4Q3AA 1ZMTA 2Y0CA 4QSMA 3D3EA 2PKQO 4GVXA 2DM6A 4Z9YA 1HE4A 4BIIA 4DPKA 5L7YA 1WWKA 1X0VA 1TXGA 2O3UA 1RWBA 4NBVA 1P0CA 4S3MA 1HDXA 3AFNA 2EXXA 3GEMA 1IB6A 3GHHA 3SBOA 2GN4A 1YJQA 2GN6A 3KEQA 4ZICA 3GNTA 3V2UA 3LSYA 4LMRA 2YV1A 2PD4A 1Z6ZA 5IJZA 3DBLA 4MVJM 2DQ4A 3H7AA 3G79A 4QO8A 1PJLA 3CXRA 4FOOA 4HY3A 4ALMA 3NRCA 1QSGA 3OIGA 3EAGA 4Z0TA 1W6UA 1B8PA 2O7QA 2VHVA 1B26A 1LLCA 3ZWAA 4E2XA 3PLNA 1I3NA 1Y8QA 3FI9A 4F45A 1EFKA 4IDEA 1KEPA 1GAEO 1CETA 2H6EA 1E7MA 1PSDA 2G5CA 9LDTA 3VPSA 2H5LA 1EVIA 2Y1DA 4U6QA 4E31A 5F1OA 2ZQYA 1LC3A 1DRWA 1U5AA 4XX0A 5BR7A 1B3RA 1UDAA 3OA2A 2RHRA 4JBIA 4RF2A 2NQ8A 1QYXA 3JD0A 1KEVA 4J7XA 3VDQA 1HLDA 4DIFA 2R2GA 4BNWA 5A4DA 4W6ZA 3SX2A 2JCVA 4KMSA 4QO7A 1LDNA 1X13A 3HUDA 4DTIA 4XYLA 3RCBA 3WJAA 2OP1A 2OHXA 2ZKLA 5I8ZA 2NU9A 4QUKA 2AQKA 4L74A 1PIWA 5TSDA 2PTGA 4EGFA 5A5FA 1JAYA 1YOVA 4QECA 1T4DA 4CLOA 4CMGA 3JQFA 3D0OA 3VPHA 1LA2A 4PLPA 2CD9A 5EN4A 3G3EA 3GVPA 1EVYA 1XQ6A 1YWGO 4EDFA 5TJ9A 3UICA 3LC2O 4KDFA 4GI2A 4J0FA 2AEJA 2W2KA 1DFIA 2FN7A 2X5KO 3PRJA 5JS6A 4R1NA 3S55A 5LCXA 1A71A 4HADA 4R5MA 3WGYA 4ITUA 4BB6A 4AJEA 3PHGA 4OKIA 4P8RA 3TL3A 3ZHZA 3WGIA 1E6UA 3PWKA 5G0UA 4K6FA 1S7CA 4C7JA 5I8WA 3DOJA 4A7PA 5L45A 1T4BA 2AQ8A 1C1DA 4E2ZA 1BRMA 4CLEA 3PFFA 3ZU3A 2X9NA 4BNIA 3FRJA 3NJ4A 3ONDA 2BELA 1MX3A 2YJZA 3K31A 3VPGA 2NWQA 2BD0A 3L0DA 4AJOA 4FC7A 2WMDA 3GGOA 4IUYA 5L4NA 4QT0A 4Y9DA 5JO0A 2BI7A 1UP4A 2QZ9A 2FSVA 1JN0A 4ILKA 2HCTA 5BSFA 5EQFA 2FPIA 1ZVMA 4CPDA 4K6CA 5KVVA 3B1FA 3W4JA 3RC2A 4D0RA 3X2FA 3GK3A 2JD2A 5JE8A 5JDIA 5AXDA 2IDZA 2J3HA 3I1JA 4CMIB 1VL6A 1H94A 2JCYA 4D3SA 1G1AA 1CJCA 2B5WA 1SAYA 4ZQFA 5TIIA 2E6UX 2IE0A 1NPTO 2ZB4A 2O3QA 4B7UA 5HM8A 2AA3A 1X14A 3IJRA 4PLTA 2EWMA 3PVZA 3LC1O 5AOVA 1SB9A 4YBZA 3B6ZA 3DXFA 4FCCA 3BMNB 3RUFA 1PL7A 1B8VA 5TT1A 4E5PA 2G17A 3TZ6A 4WLNA 2JHGA 4UEOA 1O9BA 5HWSA 1NVTA 1HLPA 1UP6A 4IGEA 5COAA 2HKIA 4K28A 3UGKA 1YBMA 4CMBA 1G6KA 1P45A 2OORA 1EFLA 2Y0DA 2VUSA 3NTOA 1U2DA 5DN9A 3LDHA 1MB4A 4E21A 2AXQA 3D4OA 4LMPA 4PRKA 1H2HA 1PQWA 3OSUA 1ZKMA 3EUWA 1LDEA 4IJWA 1P0FA 2XOXA 4ALJA 2DFVA 3KSDO 3I9KA 2V6FA 3F47A 4JK3A 1BWSA 4WE3A 1VPDA 3K73O 4PLCA 3RKUA 4AJNA 1EEHA 2R00A 2OL4A 5FI3A 3P19A 1U2GA 3TDKA 1F8GA 2C20A 5BT9A 5B4VA 5ITVA 3VPFA 4DGSA 4PLWA 1C0PA 1JWAB 4QTZA 1UDBA 1ZNQO 2VCYA 4L75A 3IQDB 4LCEA 4IMRA 4KQXA 2Z5LA 3WTCA 5L4LA 1P1RA 1VRWA 3WYBA 2CVZA 4J16A 4R1SA 3ROPA 4MIOA 4CLOB 2DTDA 1LQTA 4PZDA 4CM4A 3PTZA 2QG4A 4IDGA 4XKJA 4OXKA 3H9QA 4ZGWA 3H5RA 2BRUA 5HS6A 3GN2A 5IXSA 1U4OA 4DQUA 4LRSB 2J5KA 1HZJA 2VYVA 4JP2A 4XJTA 2GSDA 4YT8A 3HDJA 1C0LA 4GX0A 4D3FA 4DLAA 4YRAA 4J4HA 1C1XA 1CQIA 1CF2O 1IYZA 2IZ0A 4AL4A 2XAAA 5IZ4A 5CEJA 3MJEA 2VWPA 3OJ0A 4IIVA 2PZKA 4ZVVA 2RH4A 1SEPA 4BQPA 4YQZA 1SBYA 3ZNNA 4Q3BA 1HE2A 4EUEA 5A1TA 1TEHA 2Y1GA 5DOZA 2H9IA 1SEVA 3NT4A 1EZ4A 3TJRA 2YFHA 3O38A 3BAZA 3GPDG 4TROA 1Z7EA 2IZ1A 5KJ1A 2CVOA 5TQVA 3CUKA 2HMVA 4BNYA 3ITDA 4FFMA 1DB3A 5THQA 3ZCXA 3JYQA 3E03A 3IKTA 1N92A 4J4BA 1N7HA 4RVDA 3K6JA 3W6UA 5K0ZA 2DTXA 1U7HA 4HFJA 4R41A 3DWFA 4YWJA 5JDCC 4PN3A 3INTA 3BZUA 3E6AA 3ENNA 5A5EA 1EBFA 3UF0A 4PG5A 4MP3A 4MVJI 5C3MA 5DNAA 3W6ZA 3GVHA 5FWNA 3H3JA 3DAPA 2Q1TA 3BMOB 4Y98A 3FNGA 1JWBB 1QYWA 5DBFA 2BFAA 2PD3A 2QHXA 3RVDA 3NTRA 1R4MA 1UXHA 4JCOA 3ANLA 3CE6A 1GEEA 4L4SA 3NX4A 5G4KB 1XHLA 5DZSA 3JQ9C 2J5RA 3WMXA 3QIVA 2RIRA 1T25A 4DYDA 2E4AA 2FRDA 2E49A 4UEKA 4I5FA 4K9DA 4WLOA 5I7EA 5IZCC 1H6BA 3DHEA 5JBIA 1Y1PA 2C07A 2ILTA 1R6DA 3JCZA 1UDCA 3QVWA 2WD8A 1DRVA 2OUIA 2Y0EA 3UN1A 4AJIA 1CEQA 3ON5A 4ZRMA 1LDGA 1OBFO 1ZMOA 2JAHA 3S2EA 4R16A 2HK8A 1DC6A 1P1IA 3LC7O 2Y67A 3ZGYA 2BMAA 3VKUA 2VHXA 1C1XB 3OA0A 2PGLA 4NFHA 4OXYA 3DZGA 1NQAO 4BOYA 1E3IA 4NR0A 3VH1A 1HE3A 4XQEA 4HWKA 4OGWA 4NBWA 1H0KA 2C2YA 1QR6A 4YJHB 3VZRA 1PJ3A 3RIHA 3GMDA 2B69A 3AUUA 4NHEA 3NDIA 2FPGA 1NR7A 3RUCA 1EQ2A 3WFJA 3GVIA 1X7HA 2F1KA 3OBBA 1NFFA 4Y6SA 4D42A 2Q1WA 4IM7A 3C8MA 3L4BC 4B4VA 1J6UA 5B4TA 3GT0A 1R4MB 3DOCA 1E92A 2B37A 3C24A 4XIYA 4CMAA 4CR8A 5CP8A 3QW2A 4R68A 5LC1A 1MLDA 1V8BA 2X5OA 1PZHA 4FFPA 1BXGA 2UVDA 3CTMA 4YVFA 2CMDA 3PJDA 1GUFA 1DXYA 5A9RA 2VWHA 2PH5A 3HDQA 4IIUA 4WLFA 2E48A 5DCWA 4FD3A 4U0KA 5KVSA 4BO8A 4NZ9A 4PLGA 2AMFA 5TT0A 4GVLA 4MVJH 3DHNA 1TT5A 2Y68A 2YZ7A 1P74A 5JC1A 5IDYA 5JNLA 1K5HA 5BNFA 4EI2A 5JAMA 5L4SA 4D41A 2I66A 3VH3A 2H1SA 3PK0A 4EYEA 4XQCA 3OQBA 3SLGA 1P9LA 3CH6A 3OH8A 3QWAA 4TKMA 1T2AA 2IODA 4AJJA 1YH3A 2FOIA 3IMFA 4GLLA 3ZU5A 5C7IO 2J3KA 2JFGA 4WEOA 1M6WA 4CQLB 1V3TA 1P1FA 5JMPA 3JYLA 4E3ZA 3VZPA 4BHTA 3QV1A 3F3SA 3TFQA 2VZ9A 1GTMA 4URFA 4ZRNA 2D5AA 1PU2A 1R66A 3CIFA 2I3AA 2C7GA 3GY0A 1I01A 5DBIA 3K96A 4RPHA 3U62A 1QYCA 4BNJA 3SJUA 5ES3A 4L4RA 4GX5A 1NX6A 1YQXA 5T6BA 3BTUA 4BL5A 5C37A 1ISJA 1YXMA 4CMJA 4MINA 4MIYA 1MG0A 4IQGA 3QVTA 3PI7A 2EV9A 3AU8A 3GDFA 3DBRA 4MO2A 5KJCA 2X0RA 3DC2A 1SOVA 3PYXA 3RU9A 3DFZA 3DMYA 3VDRA 2P4QA 1K6IA 1DIGA 4KUHA 3P5SA 4WOJA 2PA3A 1D1TA 2YQ4A 3JSAA 2UUOA 3NT5A 3WS7A 1WNTA 1O6ZA 3VVBA 4NNJA 4D3DA 1SPXA 2O3JA 3EC7A 3ZWPA 3BHIA 2HO5A 3LZ6A 5H83A 4WJZA 4YRBA 1R0KA 1GD1O 1JDJA 1U28A 4R54A 3BMQB 4QFCA 1I8TA 2O3RA 2VUTA 1GL3A 3Q0EA 3LQFA 1YJ8A 1K6XA 4D7AA 5DCYA 3WLFA 4DREA 3C1TA 3QVOA 3AW9A 4KUEA 4YACA 3MOIA 2BGKA 3EDMA 3FR7A 1H9AA 3DBLB 2QIOA 2F00A 1I2BA 3DL2A 3M6IA 4ZQBA 1Q0QA 4BKUA 3ICCA 3GNSA 2DT5A 2EG9A 2PZLA 4W9NC 4LRTB 2X86A 1X15A 1WAMA 1JAXA 1BXKA 3B70A 1UZLA 1TLTA 1GZ4A 4W9NA 4YB8A 2C5EA 4J1QA 3GGGA 3U4DA 1Z73A 1CDOA 4FPXA 3PZRA 1I3LA 5L7TA 3GAZA 4PG6A 3G17A 4E4YA 3Q9NA 1MFZA 5F3RA 1HWYA 1UXGA 2B36A 4R3NA 4ZQGA 1MFPA 3AUTA 4QXMA 1U3WA 4CM3A 3WWZA 3VVCA 2D1YA 3S1LA 1SCUA 4FIZA 1B3BA 1R4NB 1T26A 1NWHA 1YKFA 2ZK7A 3UXYA 1KETA 1A9YA 4NI5A 1AHIA 2ET6A 3QLJA 5TC4A 4ZQHA 1I30A 1YL6A 3A4VA 4NIMA 1PS8A 3SLKA 1EUCA 2GR9A 4IINA 5DBGA 5IAAA 1A72A 4N5MA 3WNVA 1HDYA 1H6CA 2POQX 2Q1SA 3IIEA 2QX7A 2JD0A 1VJTA 3DFUA 5EIOA 2AQIA 3UCXA 5AVOA 4E5MA 3TL2A 4JLWA 5HS4A 1ID1A 3KB6A 5IN4A 3ZWCA 2WE8A 4BO2A 1LSJA 1I2ZA 2HQ1A 2ZB3A 2IXBA 3ENKA 1GQQA 3WLEA 1J5PA 4I5DA 1MC4A 2W98A 1CQJA 3VHRA 2GN9A 3PWZA 3CZRA 4HX5A 4I1IA 1Q7BA 4QFDA 4TVOA 4N5LA 2DPGA 3AY6A 3DAFA 4ND5A 2B5VA 1D4FA 2UV8A 1P31A 4DIOA 3W1VA 1AE1A 2P2SA 1ULSA 3GAFA 4OQZA 3JQ7A 2HDHA 4Z0PA 3WOHA 1I5RA 3NT2A 4TRRA 4YJGA 4PLHA 3UW3A 4BKQA 3ZI0A 4EJ0A 3PQFA 1WMBA 5KCZA 4WPGA 3JTMA 1LLQA 4C4OA 1HYHA 1NTOA 4DMMA 3O9ZA 4GSLA 1F06A 4B4WA 3TN7A 5DP1A 3FTNA 3OFSA 1EBUA 1PJCA 2I76A 1NFQA 3WGOA 3E5RA 4IXWA 4CMEA 2A94A 1PZGA 3WB9A 1LEHA 1ZJYA 1V0JA 3B1KA 4XYBA 5JCJA 4FGWA 2HU2A 5A02A 2FR0A 4Y6PA 2V6GA 1V9LA 3TF5A 1WMAA 4PFJA 2IRWA 3DTYA 4MDHA 1BTOA 4Z9XA 4BO1A 1E7YA 1VLLA 3PIIA 4WLEA 1T1RA 3WJ7A 3HWRA 5BNTA 3PEFA 1IE3A 3DR3A 4KTVE 1DIBA 4BNNA 1DHTA 1Z82A 4GGPA 2W2LD 1ML3A 1PJ4A 3H65A 4RJTA 4KZPA 1WDLA 2Q99A 4I9HA 1VL0A 1LBEA 2VTDA 3RUEA 4NQZA 1BMDA 3ZWOA 5FYDA 3NYWA 2NM0A 2Q1UA 2I9PA 1AXEA 1HT0A 2DFDA 2XPCA 1WW8A 4I8XA 5GZ6A 1HXHA 1YB4A 1IZ9A 3BHMA 3ZHYA 1I10A 1E6EA 2GDZA 1Q0HA 1YO6A 2BFOA 2Y1FA 4HV4A 3V1UA 1DJQA 2GRAA 3COSA 4J4TA 3F4LA 3MJVA 3PHJA 4CM8A 3L9WA 1U8FO 3D5TA 5IDQA 4W82A 3D5QA 3MCVA 2EGGA 4LW8A 1QV6A 1B8UA 4CUJA 3RD5A 4UEJA 3MZ0A 4BV9A 1DIRA 4UVHA 1EDOA 3P7MA 1PGPA 3JD4A 1N2SA 4NPCA 2GF2A 3V8BA 4YT2A 1ONPA 3ONFA 4JBHA 1LDBA 4K26A 2PZJA 4DLBA 3QWIA 4NK5A 2CY0A 2NVUA 2BGLA 1KS9A 3L4SO 2GN8A 4J3FA 1EE9A 4BO3A 1VM6A 3TSCA 4E5KA 1N9GA 5ENVA 1R0SA 3P2YA 3E48A 4N18A 3W4KA 2OMEA 3T4XA 4CR7A 7MDHA 4FN4A 2YHUA 5IFLA 3DB2A 2Z95A 4CV3A 2CDCA 4BO4A 3KZVA 3BIOA 4M54A 1KC3A 4J1SA 3S2GA 3FTPA 2GZ2A 3R1IA 2FZEA 4BNGA 3SXPA 4TSKA 3CEAA 2GD1O 3V5NA 2GPTA 4JNKA 1GV1A 1HDOA 5B12A 2OXIA 5JDCA 3DBHB 4X54A 4RVSA 4PIVA 3W8EA 1PR3A 1BXZA 1ISHA 2X0IA 3F46A 4YDRA 1Y9AA 3VOSA 4CODB 2DU8A 4OJNA 4RL6A 1F14A 4LISA 4MJLA 4DVJA 1DDOA 1VKNA 2DUWA 3CZMA 2P4HX 4KTTE 3JQ8B 3QY9A 3OICA 2X7HA 4HKTA 2X23A 1N9GB 3TZHA 1EMDA 4MOWA 1UH5A 1XLTA 1ZO8A 2QW8A 2V6BA 4HUJA 6ADHA 3EW7A 3UH1A 3WQRA 2GCGA 4XB2A 4R1UA 3VH4A 1PGNA 2TMGA 4WASA 3KO8A 3TPCA 3DZHA 1FDTA 2VRCA 3KYBA 3E9MA 1Y9EA 2GO1A 4JBGA 1DRUA 3GZNB 3PDUA 5JDIC 4BUCA 1KVRA 3IL2A 1JA9A 4R51A 3JQCA 4XDYA 3ASVA 4U8GA 5AXCA 4EJ6A 4BNHA 5JY6A 2EP7A 1SZJG 3PQEA 1H6AA 2D8AA 2IYPA 2O50A 2VQ3A 4OKNA 1I32A 4L76A 3HB5X 4WCFA 3LK7A 1XCBA 4RF5A 1KY5A 1IZ0A 3ETGA 4KWIA 3KOUA 4YA6A 2NU8A 1R16A 1ULUA 1B0AA 1I24A 1M6HA 1EQUA 4BKOA 4CUZA 5G0VA 3ORFA 1E7RA 1ZBQA 4L8VA 2Y1OA 3CMMA 4KUGA 4ZD6A 1BG6A 3QJ5A 1YDWA 2ZTUA 3VZSA 4E0BA 1XA0A 1E7QA 1ZW1A 1UZMA 2FPPA 3PJGA 3RUIA 1DLJA 1U1IA 1Z74A 1T2DA 4D79A 3D1LA 3GZNA 4ZA2A 4RGBA 1XSEA 1EUZA 4ZJUA 4IS3A 1ONOA 3L6DA 3LT2A 3BXXA 4XEHA 3R3JA 4OH1A 3AY7A 5AXAA 4BVAA 1B14A 1YQGA 1Q7CA 4ESOA 3JQ9A 1I33A 5I7SA 3GZ4A 4CLXA 2X9VA 3ITKA 2V7PA 3LYLA 1DAPA 4IDAA 3T7EA 4NH4A 3DTTA 3Q6IA 1MP0A 2D4AA 2G1UA 4LK3A 3UCFA 2GGSA 2FWMX 4BMVA 1UJMA 1JQBA 3ZHXA 3FNFA 4M86A 5CDSA 1A4IA 4NU5A 4CL3A 1VI2A 1G0OA 3BTSA 4QQRA 1XELA 1VSUA 2OBNA 1H93A 1MXHA 2D59A 3KTDA 4E5YA 3W4IA 3MWDB 3QHAA 1WDMA 3DZBA 3GVXA 2HMUA 4WECA 2BFPA 1KIFA 3PFWO 3Q2IA 3UFXA 5CDYA 1XIVA 3AOGA 1B15A 2IEBA 2VOEA 4KQWA 4Q3CA 2RAFA 4XYMA 1ZEJA 1NVMB 4FC6A 2PKQP 4A27A 3PHHA 3F1LA 4ND2A 3BMOA 5KNLA 3GEGA 4UVIA 4RPLA 3I9NA 4R01A 5FI5A 1ZK3A 4RVHA 3EVNA 4AICA 3ST7A 3AY3A 4XGIA 2Q49A 2OOSA 3ZW8A 1PWXA 1OZAA 1Q0LA 4UAGA 3SJ7A 4J91A 4YRDA 4E12A 4GMGA 3TQHA 3V1YA 4WUVA 2XXJA 3WQSB 3S8MA 4FQ8A 5CDGA 3DBRB 1W4ZA 1OI7A 2WE7A 3H4VA 1X7GA 5T57A 4NBRA 3K30A 2PD6A 2VOJA 3FWZA 3K9QO 3U4IA 3UCEA 4Y6RA 1ENOA 1HEUA 3ASUA 4EBFA 1WZEA 3DZJA 4ALKA 2X5JO 4XR4A 3EMKA 4Z0HO 1QV7A 2QQ5A 4E5NA 3MJCA 2QYTA 3TZQA 2FY8A 1WP4A 2C2XA 5JAQA 1T2CA 1HRDA 1SMKA 2AQHA 3MJSA 5KKAA 1ZSVA 2Y93A 2WYWA 2DPHA 1QXSA 1EK6A 4BNZA 3GR6A 4CQLA 4B8ZA 4MIEA 4UUOA 1E3LA 1NQ5A 1RKXA 1NASA 2VYVD 4D0SA 4DXHA 4IY1A 4CM7A 3UVEA 3I6IA 3WGGA 3ZWBA 1MXFA 1L1FA 4R3WA 1MC5A 3KLMX 4GBJA 1GU7A 1BVUA 5G0SA 1NYTA 3E9QA 1ONNA 2ZQZA 3QP9A 4A2CA 2YDXA 3PYMA 3E9NA 3LT1A 4G65A 1ZK4A 4M49A 5JC8A 4U5QA 3QWFA 1LDYA 1DIHA 3B20A 1GYRA 3DZIA 4JGBA 2NSDA 4OAQA 3GUCA 2JFHA 2JFFA 1GPDG 4H15A 3RSHA 2OP0A 3LT4A 1TT7A 2DC1A 1QKIA 4BKPA 2NADA 4F6LA 4BB5A 3A9WA 3HFGA 4IDFA 1ENYA 1HDZA 2BKAA 3JYPA 1YRLA 5TLSA 4NK4A 1Y5RA 1R12A 1KYQA 4JN6B 1P44A 4ND1A 1RM3A 3M2TA 4RDHA 2EIHA 4HBGA 3V1TC 3C1OA 5BSEA 4FOSA 1DAOA 3L6EA 4O6VA 4JP3A 4B3IA 2JJYA 4RQUA 3JQ7B 3H3FA 3WFIA 1GZ6A 2JKVA 4GLOA 3DO5A 1U3VA 1U3UA 3E18A 4II3A 4TRNA 4BGUA 3K2EA 4J49A 3I9OA 2H63A 4RORA 2NTVA 1CERA 4IXTA 3RWBA 3DDNA 5A04A 1GDHA 4B3HA 2DVMA 2YY7A 4RVFA 4BNTA 5G0WA 2AHRA 1CRWG 4CMHA 3OEYA 4YXFA 2FP4A 1TA4A 2CZCA 1LNQA 5J23A 5IDXA 4OMUA 1MGOA 1X1TA 1HZZA 1Y8RB 3EK2A 4L73A 4R1TA 5DP2A 3CINA 5IZCA 3HADA 4O63O 2JHFA 1Q7GA 3M1AA 2FHSA 3TOZA 1K2WA 1C0IA 4XJSA 1RM4A 1HDRA 2DAPA 2VT3A 4W4TA 3PWSA 5CG1A 3DBHA 3PZBA 1GY8A 2PY6A 1HL3A 3KM0A 1E7WA 4JJFA 6LDHA 1YL5A 1GYPA 4YJFA 2B4TO 3RBXA 3WDSA 1JKIA 2AW5A 2DBVO 1Q1NA 3RJ5A 3KUXA 4LVUA 4FDAA 3BHJA 5CPFA 3L6OO 4YAEA 3WIEA 2EEZA 4HNGA 1IPEA 1EK5A 3S2FA 3PHIA 3WGHA 3Q11A 2PNFA 3NGLA 1YB1A 3JQBA 4BNLA 2XXBA 4FW8A 4WLVA 2NVBA 2ZB8A 4FSHA 4G81A 3V2HA 5JAIA 1PR9A 3OQ1A 3G1TA 4XRGA 4CLRB 4CLRA 2CF6A 4CM9A 2VRCD 5F21A 3RAJA 1O95A 5U4QA 2CDAA 4WK6A 1BVRA 4ND4A 4YYZA 5CAEA 4XWYA 5CG2A 4XRRA 3VKVA 4PCVA 1HE5A 2X0NA 3GA0A 3F5QA 2EKQA 1U7TA 1KC1A 1D3AA 4P38A 4FR5A 2PK3A 3ABIA 5KOIA 1LRJA 1R37A 2G82A 2PZMA 2EW8A 5G0TA 4CQMD 1G0NA 1CWUA 1ZK0A 3H9UA 4NFSA 3AK4A 3MTGA 1LU9A 3ZNQA 3EY4A 3U9LA 3ZNOA 2ZJ1A 2CNBA 2YHIB 2G0TA 2O4UX 2P9EA 5F1PA 4BNKA 4RPGA 4AJLA 3KYCA 5T64A 3CSDA 4J0EA 4XCVA 4CQMB 1PTJA 5FF9A 4A73A 1NAHA 4W7IA 4O0LA 1U8XX 1ADGA 4JJIA 2EP5A 4Y8VA 5IG2A 3WGTA 4R69A 1BSVA 2ZTMA 4ONEA 1E1NA 4Q9NA 4IPTA 3RJ9A 2ZYGA 3WICA 4P4NA 3CKYA 1VJ0A 1YOVB 2QYSA 1PS0A 3JQAD 4H7PA 4XIJA 4UVGA 4INAA 4OSPA 1E1LA 5JCJD 4TKLA 2NU6A 2X6TA 4DQXA 1BDBA 3TNLA 2D0IA 1AGNA 3JQBC 2IEDA 4J9UE 3HN7A 3OP4A 1PZEA 1QRRA 2DBZA 4JJGA 1Y5MA 4RO0A 1QMGA 4MKXA 5CDTA 3FBTA 2HUNA 2CDBA 4CL8A 4E2WA 5T8KA 2P5UA 2NTNA 3SC6A 3JQFC 3I23A 4AJ1A 4GL4A 4ZU3A 3AOEA 1T24A 1XKQA 4CM6A 4B7CA 1YONA 4L4XA 4L0QA 5JYDA 5COQA 4CR6A 3Q9UA 4CMKA 3E1KA 4LN1A 1MG5A 4WKGA 3KYDB 3HB4X 3JD3A 4IJUA 2A9FA 5G4LA 1AXGA 3I83A 1A5ZA 1C3VA 4ALIA 5JFOA 1LTHR 3HDYA 4BNUA 3KETA 1XU7A 2VN8A 2WYVA 3C3XA 4J9VA 4PLYA 3EVTA 1GQYA 4R5HA 5EESA 1IUKA 5AXBA 1ZJZA 1U9JA 4DC0A 1WDKA 5ER6A 4M89A 4II2A 5GMOA 3TWOA 4PG4A 1MA0A 2PR2A 3TZCA 1BDMA 1TT5B 2AG8A 3F9IA 3INGA 1NHWA 3U0BA 3EGOA 1YE3A 3KRTA 1FF9A 3LF2A 4RF4A 4PLFA 3OIFA 3KEOA 4IQ0A 3PGJA 8ADHA 4UUMA 5H82A 1J0XO 3LLSA 3AI2A 4CMEC 5I7VA 3RC1A 1WVGA 1L7EA 3WR5A 3SC4A 3AUSA 3PIDA 1VC2A 3A06A 3I9LA 4R9SA 4F3YA 1LQUA 3GRPA 4ID9A 1P33A 3DAGA 4MVJF 2YQ5A 3INRA 1GR0A 4A10A 2PWZA 3OECA 3VPXA 4MVJE 5JSFA 5ITWA 2Y1EA 4IDCA 1QYDA 3BTVA 2YHIA 1J49A 1IHXA 1ADCA 2P5YA 4NJMB 4TZKA 3O8QA 1ISGA 4I08A 2P68A 2YDYA 3PHLA 4OO3A 3PPIA 1KVQA 1W0CA 3WSWA 4QX6A 4WCFC 4GH5A 4JQCA 2X1HA 3ZWXA 5GZ1A 5EQDA 3IP3A 1XGKA 4CLDA 4EITA 4AVYA 3L77A 3IC5A 5G2OA 5L9AA 3VC7A 4B4OA 2AE2A 1E0DA 4M1QA 4DYVA 4MVJG 4IGFA 4U7WA 1PWZA 5IF3A 5A3VA 1LSUA 3WTBA 2UAGA 4FJ1A 4CUKA 3DEYX 1VL8A 4WCFB 5GY7A 3GF4A 2X4GA 4I5GA 2NQTA 2W8ZA 1E6WA 2RBEA 2B4RO 4GGOA 4MP6A 1DLIA 5KJFA 2Q2WA 3R6DA 5KKCA 4BNFA 4KDEA 1HF3A 4BMSA 2O23A 3SVTA 1Y8QB 1XYGA 5L95A 4A0SA 1PX0A 4NBUA 4XQGA 3TOXA 4FJ0A 1E77A 2LDBA 1QP8A 4B79A 1HDCA 3ZV5A 3OJFA 1XU9A 4UULA 3OIDA 4GX2A 1EVZA 4YTEA 1GUYA 4LSWA 3IJPA 4W99A 3BMQA 2C5AA 2J3JA 5ILGA 1LDMA 2BF7A 2DBQA 3FCOA 1K89A 1OC2A 3ADPA 3ANNA 1HYGA 4P4GA 3OJLA 4BNMA 1M2WA 4UVEA 5ER9A 2Z1MA 3PP8A 4IJKA 4CM1A 2CFCA 1PGOA 4XYGA 4TRJA 1HSZA 1Y6JA 3QVSA 4RDIA 1VKOA 2A92A 4RCVA 5B37A 1PEDA 5T5QA 4DBZA 1I3MA 1T2FA 5LDHA 2NUAA 3I9MA 4N5NA 3WYEA 3IDSA 4M55A 3O03A 1XEAA 2DTEA 1E1MA 1M76A 3ICPA 3FWNA 1PGJA 2EHDA 3HNPA 4Z6KA 3E82A 2RHCA 1CYDA 2J5QA 4Z9FA 1QORA 2VRBA 5EMHA 4RPJA 4IQ8A 3PJEA 3WYCA 4DUPA 2EF1A 5L3ZA 4CV2A 1BW9B 4IMPA 5BNIA 1GQ2A 2GYYA 3I52A 3M1LA 1NAIA 4BO5A 3L07A 1UZNA 4Q39A 1GCOA 2ZCUA 4GSKA 4ND3A 4LSMA 2Z1NA 5T8KC 1SB8A 2HAEA 3OETA 4H3VA 5FFFA 4BO6A 2W4QA 4FFRA 1KVUA 3T7CA 3H9EO 3WNQA 1DFGA 4YAIA 1RPNA 2EKPA 3GC6A 4YJGB 3DHYA 5TGDA 4FJ2A 3IS3A 3UAGA 4BNVA 4MPDA 5TX7A 5I9MA 1JW9B 4JXKA 3B1JA 1FDUA 3HG7A 1KVTA 2A35A 3ROQA 2O2SA 3D7LA 1N7GA 2ZYAA 3F5SA 2YYYA 1O8CA 2VYND 3C1AA 4DWVA 1PJQA 2V65A 5GZ3A 1P1KA 4YJDA 5TS3A 2C59A 4D46A 3FPLA 3GN1A 3MOGA 1V3VA 1NQTA 3MWEB 2WSBA 1P3DA 5DT9A 1VJ1A 3ETDA 4A03A 5K9ZA 3H9JA 5I9NA 3ZWNA 1RJWA 3DMTA 5A9SB 3VTZA 5EERA 1N1GA 1BHSA 1KEWA 4TQGA 5TJHA 1V6AA 1IOLA 3ZN2A 1XDWA 4S1VA 2DUUA 5CEEA 1Z75A 2P91A 3BTOA 4DMLA 4IDBA 3BYZA 2O48X 4GKVA 1RYEA 1N8KA 1Y7TA 4LVCA 3ETEA 3RFVA 4EZBA 3X2EA 1FDSA 4AG3A 3JQAB 4MVJP 4K1LA 3GG9A 3FSRA 2DBRA 3ZZNA 1YDEA 2R00C 4OOEA 1A7AA 1T2EA 1NPDA 4WGGA 5EJ2A 4QEDA 2ZJ0A 1A27A 3LU1A 4CQMA 4DBVO 2HK7A 1NFRA 5KVQA 1AUPA 2VZ0A 4MKZA 5COBA 5ENDA 5HBRA 3ZU4A 5JXWA 2PLAA 2J3IA 5F5NA 4KWHA 3W8FA 4U6SA 4TVBA 3GQVA 1E3EA 4GWGA 3EZYA 3GGPA 5CHEA 3RUDA 4XGNA 4I9UA 3RKRA 1DC3A 2Y99A 3K92A 5KJEA 4AFNA 4O5OA 4RVGA 4WNCA 4J6FA 4CM4B 3OQ6A 3AWDA 1DEHA 3TRIA 3JYOA 4FFOA 1YBVA 2IZZA 4EUHA 4RQTA 1R0LA 2GNAA 1WXDA 4HP8A 3G49A 1UXIA 4DLLA 1YL7A 3FPCA 2XF8A 2O2YA 2RH8A 4WNIA 4CMCA 1GUZA 4UVDA 4NJOA 2B4QA 3GOHA 1X7DA 4J2HA 4PG8A 4Z3DA 5HTOA 1UR5A 2WD7A 2NLOA 2WD7B 3ULKA 3O26A 1U3TA 4BS9A 1FDVA 4BO7A 4CMIA 4M87A 1Y81A 1ZXLA 4J2OA 2GZ1A 3GEDA 3WMWA 3ZWYA 2J8ZA 3O4RA 2E37A 4PLVA 3WWYA 2GASA 2OBYA 1GADO 1YQDA 1P1JA 4KOAA 3WX0A 4B4UA 1ADBA 1GFSA 3GLQA 2C7VA 4H16A 3GFGA 1VSVA 5T67A 4YQYA 5LDGA 2I99A 1A9ZA 1DPGA 2JD1A 2ZTVA 1MUUA 2HJRA 3KHUA 4GMFA 4F6CA 3UHAA 4YAJA 1IHYA 2C82A 3FF4A 4O1MA 4E33A 4YT5A 3H8VA 1OC4A 1EE2A 2O3TA 3N74A 1A4UA 3TFOA 1E3SA 1RM5A 1ARZA 5H81A 4CLHA 2ZATA 4JX8A 1HDGO 1TB4A 3JQ8A
chains in the Genus database with same CATH superfamily
3Q7EA 1AMNA 1YK0A 2GBIA 1B16A 5ETJA 2H92A 2IY8A 5DMXA 3H1FA 4HQOA 3ZOKA 2H4XA 4X44A 1G9XA 3SYTA 3ZDEA 1DTWB 1HNWB 3QU5A 2Q07A 1QG0A 2YASA 1AGXA 1E1QA 2Y66A 4X90A 2JJ2A 3R7NA 4DILA 3EY9A 1GU0A 2CLHB 1B42A 3WGQA 1JEEA 1K97A 4X1KA 4XGKA 5FFNA 3GWZA 1XRQA 3A1WA 4NMHA 1NVVR 2E82A 3ZS9A 5DX1A 3FPJA 2RAUA 4G9GA 5ADVA 2C8JA 4RK4A 3DT9A 3GDOA 3SM9A 1L8OA 1XEXB 4YPOA 5ECGC 3U1BA 3BA1A 5YASA 4JB0A 1LX6A 2VK4A 2P9GA 4MEJA 2J87A 4TUYB 3WNDA 2JLXA 1PO7A 5L8VA 4MQFB 3V32A 4ZT2A 4MPRA 4G1CA 4P2BA 5J2UF 1E89A 4EW6A 3BREA 3BL6A 4NG4A 4ARAA 1QK3A 2WDZA 1SOMA 4ZQEA 5BSGA 5I45A 1K8ZB 3OHSX 4K9PA 2VDWB 3NOXA 1FSZA 2YH2A 3F4BA 4NBKA 2Y1CA 3KL4A 2B1GA 1CY8A 2Y1LA 3GEBA 3K71B 1Q14A 3WDKA 4TWRA 1R5JA 2IF2A 3EGIA 1DFHA 3NDRA 5B58C 1JVNA 4OM8A 2OO5A 2VNAA 4TOIA 4YAKA 3U7GA 4M8NE 5A9TA 1CUSA 3LCCA 3PVSA 4FINA 2JAUA 5KIAA 4RULA 2HF2A 4A8JA 4G26A 1LLFA 6AT1A 2AJLI 1QG6A 4ODIA 5A05A 3K0EA 5KUTA 4YV1A 1IBRA 2X8AA 2Z57A 2FR8A 3AI3A 3ROKA 3KOZA 2NXNA 2FZ5A 3ABZA 5HE9A 1HBJA 3QKUA 3KDAA 5FTWA 4IJVA 1PJBA 1BGWA 3TKLA 3TIVA 4LHZA 4L0CA 1Z4JA 1P7WA 1NVGA 1FMCA 1WU7A 2I34A 2X58A 3OFNA 3C1UA 1UXKA 3JWGA 3NC1C 3M2PA 4PZCA 2NPIA 2W6JD 1IAVA 2HLDA 2J30A 2RCNA 1C0EA 3ELBA 2ZYUX 3LX8A 3A9VA 3WO0A 3IILA 5DX8A 3ADOA 3R3VA 5DGCA 1P2VA 1NNUA 1ZGZA 4A8PA 4EPXA 1JVSA 1KMQA 2JGDB 3PDHA 4HB0A 5A2QA 4JAVC 4HXYA 4JLSA 2NSLA 4DLNA 4BO0A 3ZZ1A 5GIOE 1CZKA 2EX4A 1A8SA 2J7PD 2B7BA 2P2ZA 1LFDB 3SY8A 5DBHX 2XA1A 2P2LA 5TMDA 1CB7A 3PQ3A 1YJAA 2NO5A 3D64A 2CL6X 3FR8A 4IV5A 1TYEB 3ZHBA 1TIKA 3C85A 4AP9A 1GTL1 1R0RE 2QMZA 3CH7A 1J07A 4EG6A 1K8RA 3NS7A 2RH5A 4B7XA 2YVQA 4RK7A 4U9IS 4WV3A 4XR9A 2OZPA 1CF4A 1RNLA 2DPMA 2Q7OE 1W34A 5K0JA 4IYJA 3KX2A 3QOFA 3PUZA 2CXHA 4A26A 5TXGA 1KK1A 1SVOA 1JQ5A 3LBHA 4GECA 2Q8QA 3SFTA 4U2EA 3ZV4A 4BJ3A 4ACAA 2WWHA 1QRUA 4X85A 1UJNA 3OCWA 4ASUA 1G2QA 1MRSA 1LZKA 3TSZA 2FZLA 2PPLA 1QGYA 2RJ3A 1WZIA 3LQRA 4NU0A 1QZ3A 2FMTA 3SR0A 3FYCA 4DCOA 3HDGA 3H1TA 1GPJA 1N36B 2BR5A 3UT5B 1DGQA 1W94A 2WAXA 1GNLA 2NYUA 3GJ6A 3H5LA 3IPAA 4HQ6A 3I1YA 4P4LA 5CD9A 2H3HA 2NV0A 3RTAA 1J0CA 1X1CA 1TUIA 4HI0E 2XEDA 1ZD8A 1HM5A 1SKUA 1L6RA 1BGVA 1TAHA 2F43A 1P0MA 2IC5A 2V0NA 3IT1A 4ND7A 1DEAA 3N7UA 5I5GA 4OHYA 5JADA 3TM5A 3AH8A 4L6AA 1G8AA 3AJ9A 2LV8A 3ZYZA 1J42A 1SC6A 1YMQA 1XZHA 3CLSD 2H18A 3WL6A 3J81k 2PFGA 3DDUA 4NG5A 5EI5A 3WWCA 3C98A 3E5MA 1D1SA 5A7FA 1N32B 2CBZA 1EFTA 2DG2A 2QNBA 1C9MA 2FWNA 4GZ6A 5D7BA 3AKCA 1GZHB 1NQOA 3WGLA 4Z51A 1HO3A 4HVLA 2HJHA 3BWDD 4HNVA 5CCXA 1QYRA 3HVKA 3Q3VA 3W5IA 4B6SA 1TJ5A 1EFHA 3H5OA 4HNHA 5E4YA 3TVYA 1EJ0A 1CP3A 1SNYA 3OPYA 3R0ZA 4RVOA 4UTVA 1WD7A 1LLUA 1R8XA 2FLWA 2RGWA 3P4XA 4BMOB 2AE1A 3ZVRA 1FP4B 2IU3A 3H86A 4Y2PA 5AJWA 2NVWA 5DK6A 4CU5A 4DLTA 4ETIA 4YLYA 1E1DA 1M66A 3DKRA 1FXSA 5ELLA 4BXOB 1DQNA 3OZDA 1G3IA 5ED4A 2AN4A 2JGDA 4N1AA 1N75A 5D3MA 3A1CA 3KXDA 4I4CA 3D3JA 3ES9A 3IO3A 1WB4A 1YVEI 3CWQA 3PLRA 5GIPE 5E9QA 4CV1A 2YUTA 4DNFA 1OOEA 4DJ5X 3R44A 1CFZA 2MYNA 3R6GA 4J43A 4UDXX 1KE2A 5BSHA 2VZ8A 3MXTA 5DGHA 1WLYA 1X8XA 3HS3A 3Q7IA 4G2NA 3VTAA 3WGVA 4DKXA 5K0TA 4LHEA 2AEEA 2W8BB 1N1DA 3V7WA 2JEZA 3OIVA 1AN9A 3N07A 4RSRA 3L4JA 2IU0A 2ORWA 421PA 2P6RA 1V3UA 4PGGA 3U4AA 1AKUA 5FTKA 4G56A 5CK5A 5CPBA 1SH7A 2HJ9A 1G9SA 1TYCA 4HMPA 4LGMA 5AHWA 4HGRA 3K5PA 4LGCA 1DC5A 3ZDYB 3HQ4O 3Q5EA 2P7IA 4E2YA 1NMYA 1FS5A 1IFXA 2I6UA 4BFZA 1IMOA 1IJFA 1KZHA 3SBEA 4MPPA 4BFCA 1FRNA 2WKRA 3NHAA 4RZHA 3A6FA 4R6XA 4M7OA 3H97A 3MEQA 4ZT3A 4IH9A 3WG9A 1K7YA 2QZZA 1M2KA 1E3WA 2VHWA 3JSXA 1Q17A 3L05A 3NIGB 4PQRA 2CC2A 3W9SA 3G2KA 4ARIA 1P0IA 4Q9KA 4M0PA 4HG2A 3UK7A 1OIWA 2WM3A 1Q7RA 3FSJX 1H5NA 1KMIY 1W52X 1YS9A 1YR2A 1GZ3A 1E1RA 3C3CA 3K9BA 4OTZA 4DV1B 5D6NA 2HC9A 3ZY4A 2FFRA 1FVHA 2VBGA 2FQQA 2FEWB 4X60A 1H9BA 1M1NA 3P9PA 4JUCA 4BRSA 5L53A 4ZYXA 2BEUB 2QTVB 2W2KB 3MT0A 1BXGB 1WRBA 4K9QA 2YL2A 1JKJA 4JSYA 1AKRA 2DKNA 1I3KA 3G0BA 3BCUA 1RQXA 2LNDA 4R9RA 5BYJA 4KMRA 1E2NA 1CDDA 2R1VA 3N6RA 1NBOA 2WHYA 1BKDR 1BN7A 1XD9A 4J0JA 5E2AA 2EL9A 5JH7A 2ZRGA 1X0XA 3GEHA 2HK9A 1T9GR 2E0IA 3IRVA 4ND6A 1P4JA 3F8WA 1RI3A 4AZ3A 1UIMA 1VI5A 3ZCSA 5AI4A 5BP7A 3LHKA 2GAIA 1OIVA 3RUHA 3H16A 2GCIA 4F93B 5LM3A 3LVFO 3EFBA 3QEKA 3EF1A 3GT4A 1XAGA 3VQTA 1C7ZA 3AOEC 3P96A 5CXUA 1Q19A 2JCXA 2GUGA 5EIFA 3H2ZA 1J90A 4GI5A 3VRHA 4NDAA 2J0UA 3FGZA 3L8CA 4G3XA 4NJEB 3O8QB 1J39A 3K9FC 3ORRA 1L1QA 5AI5A 3SJAA 1FFYA 5HIJA 3WRXC 4KIWA 1L5OA 3HZZA 4AW9A 2IBSA 5JVDB 3MTQA 3LW8A 4OLHA 1EDZA 3QYFA 1QE0A 1MAHA 1WUKS 5IJXA 1RE1A 4DB2A 1IC6A 1JECA 2BFWA 4GAEA 3I9V6 1QK5A 2IY7A 3SNHA 1HYBA 1Z8NA 2IEYA 3IP1A 4KPEC 4OI0A 2YJ5A 2XTMA 3KT6A 3VNSA 4UREA 1FNCA 1QHEA 1F4LA 2QX9A 3IQGX 3QBEA 3FPBA 3RC9A 3TJZA 1LF5A 1XNJA 3O75A 3ONNA 3U40A 2Z2XA 3L4EA 4OHUA 3VR1A 2I4TA 3S2YA 4D8TA 4ZDKA 1RYDA 2B8NA 3QELB 2NUPA 1TD9A 3C7DB 4Y0NA 3K6SB 1UBNA 3RUAA 4EKDA 3N86A 4I1RA 4OQLA 4RHFA 1XPJA 4Z1MD 3KPWA 1XWFA 4Q34A 3CKLA 1QGUA 5LLSA 2ON6A 4BQOA 5JMWA 3TJMA 3EZGA 1FP6A 5KCMA 2HQRA 3W8DA 2DQYA 1H2BA 4FYWA 1NXQA 1CQPA 1Q15A 2NACA 4LMAA 1I94B 1SHTX 4IO0A 3TLCA 1JU9A 2AGVA 2DCMA 3SEQA 4XVHA 1PBNA 5BT8A 2TS1A 3D6HA 3JRXA 1KDZA 1O8BA 3A4MA 3OQIB 2ZSDA 1LSOA 2QTFA 3H6GA 1D7OA 2FI1A 4PRLA 5DI3B 3TLYA 3WI7A 1M75A 5C7OO 4D9CA 1HOXA 2QIPA 4U9UA 4JB3A 1C1DB 1XBTA 2Q41A 3FH0A 1DMRA 4FCTA 2WMOB 4TUYA 2E4YA 3Q1LA 4YP7A 3RSGA 2QLFA 4HLCA 4KE7A 4X8OA 2AOUB 1RRGA 5EWLB 5SY4A 4KO2S 1KJ9A 1IY1A 1KI1A 2CVQA 3O91A 3V8QA 3PNLA 1AKVA 1X7ZA 4WZ6A 5J58A 4L16A 3IKVA 4QFBA 3ZW7A 4YJFB 3T9FA 4EY7A 2W4MA 4DCSA 3TOVA 1TZJA 2CUZA 1AIPA 4ETWA 1CT9A 4J3NA 1BS9A 5JBNA 3EODA 5HKOA 1X1RA 2G9ZA 2Q4EA 1D0SA 1N0UA 2D5CA 3LY7A 4GC9A 1TO1E 4A2WA 4EG5A 3VAZA 1UBFA 3WBBA 1N6OA 4UAUA 4V1CB 2G76A 4IXMA 4U9HS 3AF2A 3DA8A 4P7GA 3ZHUA 1LVGA 3RSCA 5JSZB 1UUFA 1T1SA 1RPJA 4XM1A 5DOVA 4BIMA 3QNMA 4YJHA 3UPUA 1DBPA 4QM6A 1XMSA 1NP6A 3HYLA 1KK3A 4L8LA 5KTOA 5TARA 1N6LA 2PV7A 4EEKA 1P2DA 2O5RA 1PQPA 4IS2A 4BC1A 1ZUD1 5ALUA 4OP1A 1RQLA 5BRAA 1XDUA 1KH1A 2B6NA 1FJ2A 1TVKA 4J7UA 4DPKA 2FOLA 1G41A 3H5NA 4AJPA 4RZIA 4UZEA 1KJNA 2Q45A 3ZJ4A 4ZTZB 2C9DA 4OQNA 4AS3A 1H2XA 3HB0A 5HKKA 1QLJA 2V7WA 4N3GA 3IA2A 3QSGA 3MPUA 4PZPA 3IUSA 3ER8A 4NU6A 3H5TA 3GRYA 4QT4A 1FRFS 4OYRA 3U49A 4GSYA 2HJSA 5CXQA 2IOHA 5E6UB 3DXZA 3KHTA 3T1NA 2X22A 5HF5A 2NQ2C 1B7GO 4LJ6A 2D00A 1KAQA 4W1PA 1L4YA 3CRVA 4RY2A 1NRJB 1FDWA 5B3KA 5LU8A 2MSEB 3IUMA 4TQ9A 4TLMB 4NYIQ 1EZZA 5EA2A 2A0FA 4I6JA 3TIFA 2HRQA 5H7XA 3TMYA 1LVUA 2JGMA 2Q46A 3CLHA 2B34A 1YACA 3ZH2A 3CJQA 2A5LA 2GLTA 1P61B 1KE1A 1K3TA 4EDHA 5MFZA 5F5LA 2WYUA 4ZCMA 1X94A 4PNEA 1JBEA 3DFFA 3IUPA 1A77A 2WTNA 1ZGCA 4IL5A 2RGXA 1H6DA 3PA8A 4PAMA 4ZO6A 3S1AB 1NRIA 3RS5A 3K5HA 5E7QA 5BQPA 5THKA 3WP0A 5CEFA 3WHKA 2CK3A 3VMFA 1CW2B 5AP9A 4DQLA 2O1EA 4UM9D 1GXSA 2EKZA 4CKEB 2DT8A 4PVDA 5ICMA 1P4GA 2FPOA 2VNKA 3OEWA 3ZXSA 5F7XA 2XGJA 3DEKA 2OR3A 3L9XA 4EMBA 3VZDA 4HAOA 5BSMA 1JLLA 3A3OA 3KQSA 2VF4X 3O3NB 3I92A 3DMRA 1ECLA 2G0AA 2X9LA 4WESB 4HBZA 4KRGA 1KU0A 4EMUA 5EZYB 4P3XA 4L0DA 3TG8A 1ZCFA 4MEAA 2W2LA 5DNYB 3ZTTA 5FAKA 3AKDA 3NBKA 1NWCA 2ZIAA 4QQFA 3R6WA 3C3AA 1T0UA 4I36A 4HB2A 4TLEA 5IN5A 2QRLA 3LM8A 3BFJA 3TB6A 8AT1A 1QR2A 1MJGM 1PZFA 3N8NA 4BX3A 2QUBA 3HCWA 3QOXA 4PHGA 4XDZA 1Q7TA 1PGQA 1Y8RA 3CSSA 5DV9A 1SZDA 3ZE2B 3CX4A 2PJRA 2FPXA 4ZFNA 1JF8A 3WGZA 2ECFA 3L40A 4YMGA 4Q3NA 1JTFA 3ROMA 1KZ1A 1M3SA 2X0JA 3D3NA 4IBOA 2VBIA 4Y7DA 1T9HA 3I2YX 2OFOA 2PKQO 4GVXA 2DM6A 1VBKA 5CLQA 1THGA 1JEQB 1WWKA 2RKWA 3FOCA 4RJKA 1P2SA 2D5IA 4RWEA 3ASYA 4S3MA 1MAVA 1QAQA 4W8GA 4B46A 1N2IA 1WR8A 1SN7A 2ZJZA 1IB6A 3GEMA 5F9HA 1XJ0A 7MHTA 3NM5A 3LPNA 1VFNA 2GN6A 4AY4A 4DLWA 3RRMA 4UW9A 2A9QA 3NBAA 2OLJA 3EGXB 1QBKC 4LMRA 3KSBC 3DJYA 5A3SA 1EWQA 2YMLA 3GCZA 4HZGA 3L6CA 3SKYA 1YZNA 4BAZA 3BRWA 4I3GA 4Q00A 1SU6A 3OIYA 4ALMA 3SSMA 4HY3A 4C9BA 5FL7D 4DDUA 3KQUA 1EI9A 2HBYA 5HKKD 4GICA 4WXRA 2Z2JA 4EVRA 1V8FA 4EHBA 3GB9A 1NONA 3C39A 4K2HA 4RAOA 1RZUA 2PE5A 1W6UA 2VHVA 4E2XA 2YV4A 2YY6A 4IJ5A 2X5NA 3PLNA 4QUJA 2I3ZA 1IXYA 1J8QA 3QMVA 4ON9A 2QE7D 1MIHA 3FI9A 2C5BA 4G0PA 1TM2A 2BAGA 3LBFA 1F4VA 3OFND 3KOMA 2EFYA 2W83A 5AUOB 5CBPB 1GAEO 3WSTA 1CETA 1F2TB 2M98A 3HSYA 4QOSA 3NGMA 3R4CA 4TL6A 1SCJA 1FXWA 1UM9A 2XGGA 4NCNA 4ZZ0A 3SIXA 9LDTA 4RXUA 3LKDA 2Y1DA 5JBQA 2R9VA 1ZCZA 2QJWA 2ZETA 1RADA 2VQDA 4ZYYA 2DFTA 4N6OA 1LC3A 2WOOA 1ULZA 3DDWA 3E9DA 1U5AA 4RA6A 3AESA 1E3MA 3HABA 2NIPA 2RHRA 4JBIA 1QYXA 3JD0A 4ZT7A 1KEVA 4LDRA 5AICA 3KKZA 2R2GA 4MV6A 2QOEA 4RTNA 3VOAA 5IWCA 1E4EB 3PPWA 1OW3B 4ZMSA 1R5OA 2Q6TA 4S24A 4UNNA 2E4WA 2FMHA 3I2HA 2JCVA 2GPYA 1CY2A 3SX2A 4WW0A 2I4LA 5ALZA 2WAAA 1C5KA 1CY1A 3QY0A 4NCKA 1WXWA 2AN5A 2ZVDA 1PW5A 2F90A 4BVKA 5FULA 3H5VA 3EGVA 3RCBA 4XYLA 4Q9DA 1EK1A 2OP1A 2CDRA 4D8YA 2NU9A 5J4YA 4AT1A 4IFBA 1OY1A 3PCRB 3MM4A 2Y3IA 5A5FA 4F1WA 5JZOA 2PS1A 1T4DA 1BE8A 3VPHA 1LA2A 3WQBA 3Q8LA 5DM4A 4KN8A 2CD9A 2YOGA 3WV5A 5CNJA 4M7WA 4HJXA 2YW2A 3AP3A 2QWXA 1EVYA 2RI6A 1UK7A 5HCNA 3IB3A 2BGJA 5TJ9A 5IYZA 1XXLA 2AUNA 3NOOA 5C1OA 1P4RA 1Y7HA 2WOJA 3EIXA 4BDSA 1K2VN 3NEAA 2W2KA 4IIFA 5KI6A 2DBYA 2FN7A 1IIRA 4YECA 1NX9A 1JQEA 4JSTA 2FW6A 1SM4A 4R1NA 3WGYA 2F8MA 4P8RA 4RDCA 3TL3A 5GM1A 3WIOA 3ZR4B 1S3GA 3PWKA 3RQIA 2EDCA 2FKAA 2W2TA 5IAGA 5TEWA 2EYUA 5L45A 3C3PA 3MS4A 2O8CA 4EFLA 3LXXA 3QFTA 4YUVA 4BJ1A 5CH3A 3C6KA 3ETNA 3HXLA 3ONDA 3TW8B 1QVWA 4QWMA 2V59A 2G1KA 4YAFA 5IJ0B 4YR7A 3DTNA 2J9ZB 1NYRA 3N5KA 2NWQA 4I81A 1ZIPA 2BD0A 2C42A 3A6ZA 3G6KA 3L0DA 4KPYA 3L8FA 5JO0A 1UP4A 3UAWA 1GSHA 5C5EA 2V9PA 4ZOLB 5LP6A 5C52B 3THWA 1V5GA 4PC6A 4RKYA 3EUFA 3G85A 4E08A 5EQFA 3OCUA 2GWRA 3NC0C 4S2EA 4WKNA 1AF4A 2J3DA 3W4JA 4AP5A 4D0RA 3PRKE 4N0PA 1Z4LA 3PGVA 1J8FA 2VUIB 4B40A 2VUHB 3MBOA 3OFKA 3IR7A 2J3HA 4CMIB 2ZPAA 4E4RA 2OV3A 1X1DA 4ZCPA 4NTZA 4D3SA 1C7RA 3FW1A 5AKEA 3HJTA 2BVNA 3L7NA 4E88A 1GGFA 4G41A 5TIIA 2E6UX 5F35A 1W581 2IXTA 2O3QA 2P69A 3FSEA 1QVVA 3IOEA 1VYUA 3KUCA 4QDZA 5AVKA 4B7UA 2PT9A 4NECA 4U8HA 2VLIA 5DNEA 5LMUB 4A36A 3UJNA 4NEHB 3W05A 1XXHB 3HRHA 3DXFA 3P0IA 4UBMA 1M83A 2GPJA 5TT1A 4E5PA 4LJRA 4OUKX 4DV2B 2WDPA 1IDOA 3TNFA 4WLNA 4V1CA 3SR4A 1E79D 1KZ4A 5H4HA 1JG1A 4UEOA 3T15A 5HWSA 1FDOA 4AF7A 4JA0A 5D1HA 2OO7A 3UC5A 4QTTB 3V42A 3RYCB 2PS0A 3GLTA 4ZO9A 1H05A 1UP6A 1PTJC 5K01A 2HKIA 4U63A 4DMFA 1P3Y1 2PMCA 1G6KA 1P45A 4DLRA 4KQGA 1DJMA 4MR9B 2H54A 3RIXA 3VOTA 1WBBA 2XQJA 5CIYA 3ZD6A 4MYRA 1GL7A 5HIAA 1VKJA 1Z83A 1QU2A 1W44A 4S0ZA 1H2HA 3P9IA 4M0FA 3U31A 2GH1A 5B7QA 4WOBA 3DLTA 3MC1A 2P2YA 1N5KA 5EWMB 4EY6A 1P0FA 2XOXA 2OD2A 2AC2A 4I46A 4IDOA 3IE2A 2XZTA 1PBTA 3NAMA 2C9BA 5T3UA 3O47A 3HP1A 2WU3A 3GRFA 1AS2A 2YIJA 3F47A 3I9KA 4RUKA 1RBQA 3QVVA 1VPDA 1UPTA 3DBOB 3IH5A 3IP9A 3K73O 3PDWA 1LGYA 2OAQ1 5EEGA 4WY2A 1C7JA 2R00A 1FYVA 2OL4A 3IAUA 1U2GA 3DE3X 1F8GA 2C20A 3MGKA 2KS6A 3TTXA 3EA4A 5B57C 2N42A 1C0PA 3A10A 2B99A 1JWAB 1TPYA 4MMYB 2F7SA 2WFZA 3ETLA 1ZNQO 4QTZA 6ABPA 4CETA 1ZA2A 4ZCLA 4MRMA 1EBBA 1KK2A 1OXBB 1L4BA 1PQ4A 1HT1E 4JENA 3WTCA 2PO7A 3EEIA 3EFHA 3R7AA 3WYBA 3HKCA 2K4MA 3UC9A 4XWOA 4MIOA 2FX2A 3BXFA 4UNQA 1KDPA 1NF9A 1W5FA 2EX1A 3CUEF 2BRUA 2WPNA 2XMBA 1RWKA 2AZDA 3HBAA 5JWRA 1U4OA 4OBBA 4LRSB 2J5KA 2BR4A 4BMCA 5CFMA 4ALKA 2ZLBA 4Y9TA 4DFDA 2VYVA 4F72A 2H2AA 4G01B 2QVCA 1YR1A 1YT5A 4EHHA 4YT8A 1ZUNA 2VL7A 1MX9A 3A1VA 1C0LA 3EISA 3HDJA 1QIIA 3CU5A 4G4IA 4GNRA 4GX0A 4M3NA 1NJ2A 1UBOS 4MITA 4YRJA 3ZLTA 4YRAA 1CQIA 2FSVC 4A1FA 3EN0A 4PZ0A 1WF3A 1XDSA 3NHLA 2JLZA 2XAAA 4ND8A 5CEJA 2IT1A 1M8JA 1OLXA 2OGZA 2VWPA 3DL4A 5ED0A 1ZD2P 3AUYA 1XQ9A 3BRSA 1SEPA 2PGAA 4QUDA 3N8GA 3SIPA 1DBSA 4YQZA 5JHGB 1SBYA 2CBGA 3ZNNA 2H4JA 2O1WA 3HYTA 2IOYA 2WICA 1V11A 3P9QA 5AKYA 5FADA 1NQUA 1QGOA 5FUQA 1TEHA 2Y1GA 1SHJA 2H9IA 4LJLA 5DYTA 1C81A 2A0YA 3WZ2A 1KOGA 4IFTA 1HNNA 4IHKA 1Z7EA 4D0LB 2I6QA 2IZ1A 3HCOA 3OT4A 2CVOA 3SOZA 5TQVA 5EIXA 1WZCA 5EAIA 1XVLA 2QTHA 4KO8A 2R6HA 4FFMA 2ZEJA 4OHXA 2YMQA 1KZ9A 3Q7RA 3NETA 4JZYA 3ZCXA 2EDAA 1UT5A 2I2XB 4P5EA 3QGMA 1IXZA 1LPAB 1TVCA 3KEMA 1N92A 3ENZA 4MDYA 5EYPA 4WXEA 1JAHA 1SBHA 2WILA 3K6JA 5HX7A 3CKKA 3E9YA 3HKEB 5K0ZA 5IRCD 1U7HA 4MW9A 4P6VF 1YS7A 3DWFA 4CF4A 4ZCTA 3KVVA 4YWHA 2A3NA 4FHDA 1CQJB 3R7DA 3TCXB 1ZY2A 2QSYA 1ZM7A 1U2PA 3GXBA 1EBFA 2PU7A 1UFRA 4MP3A 5C3MA 4WTOA 2PXXA 2P9FA 4Y6GB 5D51S 3GVHA 1GQFA 4IXNA 2OPHA 1JYFA 2QSZA 1C9EA 1PT9A 3G2JA 3GGDA 4O08A 5TPWA 2BFAA 4DE5A 2PD3A 4OPMA 1Q22A 5CURA 1G55A 1ST2A 3NTRA 5DTQA 1UXHA 2FW9A 3ANLA 3CE6A 4L4SA 2X2FA 16PKA 1XHLA 1EJ2A 2C77A 3NTUA 3QXXA 2CD7A 2J5RA 3PC7A 3QIVA 1Q3HA 2AJCA 4X97A 1CUIA 4KR3A 2J9RA 3KPJA 4D74A 4CGYA 2E4AA 1XN4A 1QFSA 4UEKA 3ABRB 1LPOA 4B31A 3AR3A 4DIMA 1XLUA 2SKEA 1OF1A 2G4LA 4EKNB 5IZCC 5JTUA 4FYPA 1BE1A 5EVCA 4G5YA 1JGTA 3TIGA 5LQNA 2ILTA 1R6DA 4H6VA 4NFLA 4CTOA 2PRIA 5HJ2A 3TW4A 4KHPB 3A8TA 4TTPA 5FL7A 6YASA 4ZRMA 2ZE5A 3GRAA 1LDGA 1CUZA 4CCWA 2J6HA 1AOXA 5A7HA 5IU6A 1RAGA 4KE6A 1RVDA 4BFSA 4JOCA 1CSEE 3J81A 1N78A 2HK8A 3O9MA 3RFCA 1BA2A 1DC6A 1P1IA 4RADA 5FWAA 3PX7A 2HRRA 1JEYA 1JEYB 2ZVQX 3HA2A 5DTJA 4KLRA 2V96A 4NFHA 4LDNA 3R3UA 1EG7A 1US8B 4NR0A 4OGWA 4OXIA 5FLYA 5FOUA 2A84A 5B3JA 1BH6A 1PJ3A 1MABB 3HGQA 2J9FB 5EWJB 4TTAA 3NDIA 4H35A 3GRVA 1NR7A 3OJCA 4JT4A 3RUCA 1RPTA 2Q8PA 3HO6A 4ZARA 3I58A 4DF3A 2F1KA 3C6BA 3ISVA 3N0XA 2A7QA 1ZIOA 1T1IA 3P9ZA 2B8TA 4DT1B 3L4BC 3R75A 4B4VA 4JJAA 5B58T 4C4YA 3O2NA 3RLFA 2OMKA 3C24A 4CMAA 4CTNA 1Q0SA 4TSFD 1E2EA 4PSDA 4S1TA 3E81A 1MLDA 1QS0A 3I6YA 2X5OA 3MWGA 4HGPA 3RS2A 3FOFC 2Q9BA 3IIKA 5JJIA 4FFPA 4K6MA 1BCSB 2ADOA 3C3KA 4UTOA 2JHPA 2OTCA 3IMKA 1Z37A 3CTMA 3JAWB 4N82A 4YVFA 1ZYUA 3ZHOA 1V41E 1GUFA 3PJDA 4FW9A 3ZCUA 2IGBA 2HHHB 2FGJA 4B5KA 1YZTA 3MAGA 4MQUA 3G5MA 3L1JA 4WLFA 2YWRA 4NZ9A 2AMFA 4TTRA 3H19A 4G0UA 4GVLA 3EEQA 4TV9A 1NBWB 1SHUX 2ZBFA 5E1DA 4KNYA 1DUVG 4PU0A 4YAOA 2FUG6 2ZIUB 3DR5A 5JC1A 5IDYA 4EOGA 3NWBA 4M9XA 5JAMA 4OXRA 5L4SA 2G9NA 2CYAA 4LS3A 3OQBA 4YP0A 4MV3A 3SLGA 1P9LA 9MHTA 3OH8A 1BEZA 3QWAA 4KSYA 3VSAA 4B3XA 4YMIA 1OB2A 4ER0A 2EOAA 4EO4A 5AOCA 1YH3A 3IMFA 1GZUA 3ZU5A 3F97A 2J3KA 4WEOA 3NTXA 1WVMA 4TMXA 1H9CA 1P1FA 1QGDA 4NYIR 1TO6A 4E3ZA 4KMOA 3E3OA 4TTJA 5B53A 4BHTA 1FPQA 3F3SA 3PFBA 3F6RA 4Q9HA 2VZ9A 1GTMA 3PXEA 1NBIA 1H4TA 3TFQA 2W4IA 1DL5A 2D5LA 2I3AA 3UJCA 4GKKB 2HMYB 4JC5A 1P4SA 3OJXA 1SUIA 3PCXA 5AWFC 5LA6F 5SY6A 1L1RA 3RVJA 3T7IA 1XPOA 1SKYE 1OWPA 1DTSA 3K96A 5ULLA 2V7EA 4PINA 4PHFA 4BNJA 2H17A 3QI7A 3DPSA 1PKEA 4FMDB 5C80A 1G3RA 3BKWA 4M2LA 3H2BA 1SZPA 3PNYA 5GWXA 4BL5A 4EHDA 4JUAA 1ISJA 1MJGA 2Q3DA 3HEMA 1SD2A 4OSEA 1KTVA 4MINA 1MG0A 3U3KA 1SBIA 2RHOA 4JUIA 1WUIS 5K0NA 3R5FA 3AU8A 2NT4A 1FC0A 4X20A 5KJCA 3FWPA 1RWQA 1PK7A 2X0RA 4CDGA 3Q88A 4MS4B 2P2DA 3RU9A 3STWA 3VDRA 2P4QA 2YWGA 1U9IA 2BUAA 5BWOA 4WOJA 4HNAA 5D2CA 5CB4B 5IT0A 1WNTA 2OBXA 4XWTA 1P5ZB 1ZNZA 4EUSA 4I55B 4N8DA 1SPXA 2OZLA 3EC7A 4XM0A 1KSGA 2XF2A 3ZWPA 1U7DA 1XTPA 2FUKA 1C2TA 3WL7A 1T8RA 2RBGA 1CR2A 4KQHA 1W4BA 2QTZA 5MN5A 3KZNA 4HQFA 1GD1O 3UMCA 3JAWA 3FWYA 3OZCA 4ROTA 4B6EA 2WVHA 3OLWA 3LCUA 1I8TA 3I2KA 3KTFA 4NV0A 1NOJA 5GTDA 4TYYA 1ONSA 1Z0JA 2O3RA 4PR0A 1AQLA 3WYAA 3W3ZB 1F1JA 1I13A 1K6XA 4TSRA 5DCYA 3E8MA 5BV2P 4DREA 1APBA 3QVOA 3O31A 4RJIA 4C0HA 4QUBA 4C7MA 4EECA 5FOQA 3FR7A 5JHHB 2XDQA 3GJYA 2QJTA 1N2CA 2IYWA 1N2CB 1S5PA 2RK4A 3GFPA 4Q1FA 1ZBDA 4TTSA 3GGCA 5EMLA 4ZVKA 4CKWB 5AM2A 1JHOA 4ZQBA 1KNXA 1Q0QA 3HL4A 5JQWA 4F97A 1IWBB 2PZLA 4W9NC 5AW1A 1U7WA 5LXTA 4FFDA 4X93A 1WAMA 2R62A 3ZCPA 1SK8A 1KYVA 2HF8A 3Q9SA 2XQFA 2AOTA 1RHKA 4W7SA 4W9NA 1D2NA 1H3FA 3L0IB 4RD2A 4YB8A 2ZIEA 2C5EA 3C8HA 3WK9A 3B8HA 4J1QA 4C0KA 4Z4IA 4JOBA 1JR3E 1XA4A 4LVOA 4B85A 4HWTA 5L7TA 1J8YF 4LY0A 4QVGA 3OOJA 1C3LA 1QUFA 1NY5A 3O0TA 4TL9A 5AIAA 1SUSA 5EJMA 3VU9B 4E4YA 4TM8A 4QM7A 1V25A 2QXTA 4Q7EA 2B36A 1JDVA 1Q11A 3GMTA 5CM9C 3NU1A 5ERGB 1F2UB 1VL5A 3SYLA 5BOSB 5EKUA 2VEOA 2IJGX 4CM3A 3WWZA 4XTRA 3K0AA 4UHKA 2O05A 3MERA 4C0BA 1L4UA 1NWHA 3QNWA 1PT6A 2Z98A 5IAKA 2I29A 3JALB 2FUNB 4JLDA 4NIMA 5A3RA 3DE1X 1ZM3A 2GR9A 4LJYA 4IINA 2ZI9A 3LXRA 1KBOA 1JB1A 3H2YA 4CEHA 3TLEA 1L5RA 1HDYA 2GEUA 3IIEA 3UCXA 2G0NA 4D5GA 3C3YA 1KRWA 5BN1A 3EXIA 4JLWA 1D6NA 1RMQA 3F3YA 1N3BA 4QREA 1ID1A 3BE6A 4XDGA 1D2EA 4CWAA 4D57A 2GK6A 5FB3A 4ZEVA 4GXTA 4G63A 1BO6A 5FWYA 1C9DB 1FFXA 1QJCA 3PICA 5EUCA 4TUYF 2NTEA 5D3QA 3VU8A 2H0RA 3T8YA 3IV7A 3VNRA 4JC4A 5J2UB 4EG3A 3N2ZB 2DECA 3KQPA 2V7VA 1RS0A 2ZRIA 1YR9A 4K5QA 5B55A 4TVOA 1PYGA 4N5LA 2DPGA 3DAFA 2QTWB 2UUAB 2B5VA 4IWXA 1QVRA 1V1MB 2PZ8A 4FZ5A 5HIKA 2WF6A 1RQ7A 2JK1A 3JQ7A 1FPMA 1I5RA 1QNLA 2EFHB 2G28A 2FU5C 4GBED 4BKQA 1J23A 2DFKB 1N5JA 2F9FA 5C1IA 3I0MA 1JDZA 1FLAA 1T4CB 3KQVA 4TS4A 3N1UA 3O9ZA 2F17A 4KNVA 1U0RA 3H13A 2JLBA 2P35A 1VOTA 3IAFA 4LBWA 1DADA 2JKZA 4GOLD 1OJLA 2IKSA 2JFNA 4MQ4A 3RS3A 4OUDB 3SPXA 3NRBA 2WJ3A 2AC7A 3TNJA 3UPDA 4MVXA 4EB6A 2VPQA 3L5OA 2MR6A 4P5PA 1QV9A 1PJCA 2I76A 4CKYA 5AI0A 3E5RA 4IXWA 2A94A 5KYNA 8MHTA 3H2JA 2FCRA 4N12A 2PXCA 2JVIA 2WHPA 2ANBA 2H06A 1F0PA 2Z0MA 2ZR7A 3T5MA 3TRDA 5I4KA 3G8DA 1V9LA 5FRDA 5DLQC 5DVZA 1M0TA 2H31A 4PFJA 4HQLA 4Z9XA 1CIJA 1UT6A 2NPFA 1CUVA 1E7YA 1ZN9A 3GBSA 3RIYA 4C3VA 4WLEA 5K4HA 1X2EA 4MJ3A 4XLLA 4D82A 5AM0A 1K98A 3O8OB 4JU9A 3HWRA 5FTNA 1MT3A 1IE3A 1XZAA 2C1XA 2G08A 1A9TA 2HGZA 3G0DA 4GGPA 3L1HA 3H65A 4RJTA 2XSZD 4EJ2A 4KZPA 1YU9A 3PF8A 1ZITA 3QFSA 1SVWA 2VDLB 3TBHA 3OMXA 1LPNA 1VL0A 3WC4A 4DEVA 1RD4A 2Q5FA 4OAOA 5E6RB 4YUZA 3RAFC 3A05A 5AK0A 2YUIA 2O0MA 4NQZA 5EJ7A 2B20A 3WL4A 4U2BA 4DMGA 2I9PA 2VH2A 1HT0A 2DFDA 1CR0A 2PJDA 2XPCA 4LZNA 4P0TA 4WVFA 3ZDCA 1YB4A 4N76A 3RRXA 2KMLA 2CNNA 1DKMA 2Y1FA 2C4TA 1XKTA 2OM6A 1EGHA 3CNQS 1RXSA 3EDOA 4H6WA 1YB2A 3L9WA 1YE5A 1JQKA 1C7QA 1MAUA 2FSIA 3GJXC 1OAOA 3KT3A 5E7MA 1MO5A 4PC2A 4I19A 5LJLA 1V47A 4IDHA 1S3SA 1UEJA 4MV5A 2ZYHA 3AFGA 4AS1A 3FLEA 4LW8A 3RT1A 4B5LA 3RD5A 4PXYA 4UNIA 2Y1KA 1MVNA 6PFKA 1EDOA 1SC3A 1PGPA 2UZ1A 2FEPA 3JD4A 4NKRA 4MGHA 1PG2A 4ZAVA 1ONPA 1CJUC 5C4IA 1UC9A 2PZJA 5G3YA 1T9DA 4EHNA 4FQ7A 3PNBA 5FOTA 5E2IA 3BKXA 3BX1A 3QVGA 1XWIA 1EE9A 1Y4AE 1R3DA 4GR5A 1VM6A 1E2LA 2AXEA 3K72B 5CT6A 4E07A 1PQYA 4HB4A 4E6EA 4M9ZA 4PQGA 5BYBA 3VU1A 5TVGA 4CR7A 2XKAA 7MDHA 1MKYA 3N2KA 4FN4A 4HVTA 5IFLA 1UK9A 2IP1A 8ABPA 1Z5GA 2WZQA 2XQVA 5JD4A 1OH7A 2Z95A 5F23A 4CV3A 3QX3A 1WCIB 2JJ8A 4M54A 3BIOA 3VR3A 5KWIA 1K5PA 3S2GA 1H2RS 2V8BA 5CH8A 2IVFA 1YK1A 1RI4A 1HDOA 2YWCA 3DW3X 4XWAA 2LRHA 3VU3A 4X54A 4D9BA 1IY2A 5IC6A 4XGQA 2QN3A 3W8EA 1BXZA 4TKVA 1ISHA 2APJA 4YDRA 4MLZA 3QPBA 2C94A 1I2AA 2V7BA 4FE7A 2D1FA 2DU8A 2GYWA 1NBAA 3O4IA 1F14A 4LISA 4RL6A 4A23A 4D9GA 1MW8X 3AHJA 4GGMX 3CZMA 4H08A 4C0QC 4KTTE 1QFJA 3JQ8B 3WO1A 3JAMA 2XMZA 5KNBH 1CPYA 2IYQA 2X7HA 2GHTA 5GJVC 621PA 2RD2A 1H2AS 2XHEA 5WRFA 4X63A 3RSFA 2V5VA 1N9GB 2ODAA 1WBDA 1VPWA 1EMDA 2C9MA 2RH9B 1XLTA 2ZXFA 1YA6A 1POXA 2ATIA 3WB2A 1J8VA 2MSDB 2OBFA 3CW2A 1IBMB 2XUGA 1QTRA 3EW7A 4CIWA 1E0KA 4IRUB 1TKRA 1PGNA 3O3OB 2YTZA 3VKFA 3M6AA 3RWOA 3TPCA 3VYRB 5GVRA 2YJTD 2F3TA 2VRCA 5AK3A 4IKPA 2CEAA 3E9MA 3GAMA 3EWNA 4JT9A 4KE8A 2FUEA 3GZNB 3KAJA 1RMTA 5JDIC 1KVRA 1KSHA 1C3XA 3DOIA 2O2JA 3GJ5A 3W6PA 1W4LA 4IGKA 1RRVA 3BWBA 4XARA 1JA9A 4OP2A 4TV8F 3TLGA 4CL2A 2J09A 1VA4A 3AETB 4U8GA 3RR2A 2CXQA 4TS9A 1BWQA 3OTOB 3PQEA 1ESZA 2ZRLA 3TGPA 2D8AA 1O87A 1XI2A 4L76A 3HB5X 3ZX5A 1P1CA 2QD3A 1XCBA 3RRYA 3G88A 3FCAA 1MJFA 1R0CA 1WCV1 3DHWC 1RBYA 1E9BA 1B8OA 5ALTA 3QVLA 2ZSBA 4OHWA 4AMUA 3NBUA 4HDRA 3R7SA 4BKOA 1HYQA 4D9JA 1CQIB 4HEA6 3T5CA 1QYIA 4UD6A 1EX6A 4AUMA 3AX6A <