4CMEC

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 91
structure length 249
sequence length 267
chains with identical sequence D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmeC00
1YE3A 1HE5A 1QYVA 3S2FA 2Z1MA 1HE3A 2CF6A 3BMNB 4Z9XA 1BVRA 1KVRA 5IDQA 1YL6A 3Q0EA 4NBUA 3Q9UA 4RPLA 5KJCA 4Y8VA 4YJFB 1IPFA 4D43A 4YRBA 3DQPA 3PHIA 5KJ1A 2TMGA 5KOIA 1LC0A 4W7HA 2D0IA 1RYDA 3OEYA 4KUHA 3FHLA 3RC9A 4ND5A 4YJHB 3U4HA 3MCVA 2PY6A 1ISHA 1ZK0A 3VH1A 3W4KA 1WMBA 3EGOA 1P1FA 2EP5A 2Z5LA 3DAGA 4ESOA 1W4ZA 3FI9A 4PN3A 3PDUA 3GVIA 1PQWA 4I5EA 1EVZA 4DLLA 2UUPA 3EDMA 1U7TA 3DHYA 1RM5A 3FNFA 4EDFA 3TQHA 1PTJA 1PIWA 1LX6A 1KY4A 2AQIA 1U9JA 5A04A 1DB3A 2BGMA 2JL1A 1HRDA 4BNHA 3PYLA 3H65A 3WGIA 1M76A 3KZVA 2AE2A 4RCVA 5GZ1A 4U7WA 2BLLA 2I67A 1MGOA 4I9UA 3V1TC 4XQ9A 4JBGA 1GEGA 4CM9D 3GF4A 5DBIA 3TNLA 1HDRA 3VH4A 3C8MA 3ZWMA 4CQMD 3LC1O 1GEEA 3G79A 3NTRA 4AVYA 3AUUA 4TZTA 3P2OA 4NU6A 2E6UX 2OBNA 2OP0A 1I2CA 2PH3A 4R1UA 3ZU3A 4E32A 4LRTB 4QSMA 4J2OA 1T2EA 1LDNA 1BSVA 6ADHA 3DC2A 4XR4A 3U5TA 2J3JA 3ON5A 4E13A 5H83A 2EV9A 3E5RA 1JLLA 4YACA 2G76A 2PV7A 4QT0A 4XR9A 3OQ6A 1EVIA 4YQYA 5BNIA 1HSOA 2PZKA 3GN1A 3VH2A 2JHFA 1DIAA 4GX0A 4OKNA 4YAKA 5HTOA 1W0CA 2BHLA 1HYEA 1SCUA 2I66A 3LDHA 4M1QA 3FNHA 4Z9YA 4N18A 1MXFA 1K6XA 1PZFA 1Y8RA 1Z45A 3OFSA 4GQAA 4R68A 1F06A 1PJSA 2IYPA 2PD6A 1TT7A 4QX6A 2BI8A 1P45A 2VRBA 2CDCA 2J5RA 1EDOA 3FNGA 3I6IA 3I3OA 1Q1NA 3D0OA 3MTGA 4UVDA 3SX2A 4NBWA 4CM5A 5KVCA 3OIGA 5ICSA 2ZB3A 3OJ0A 2P5YA 1NFRA 3KYDA 2JCYA 2RHCA 1XSEA 3RI3A 3RCBA 4AICA 1Z82A 4HFRA 1N5DA 2C7GA 2X9GA 3W4JA 2OP1A 2WYVA 1ID1A 3CH6A 2P4QA 3QHAA 1DFHA 5C5IA 4OIMA 3WTCA 2NWQA 3U0BA 1LEHA 4M55A 1UP7A 3U3XA 1GAEO 5KKCA 4I9HA 1IPEA 5ADHA 3L4SO 3N7UA 4YJGB 1ZVMA 1C1DB 1Y6JA 2V6GA 5TF4A 4YAIA 2VHZA 4G5HA 2EP7A 5A5EA 5MDHA 4OXKA 3VDRA 3D3WB 2QW8A 3QV1A 4Y6RA 1VLLA 1IZ0A 2O2SA 1P44A 1Y5MA 1XHLA 2OBYA 2VYVD 2ZYDA 2P5UA 1GUYA 3JD0A 2XOXA 3VAZA 4PLFA 2VWGA 1PJTA 1EUZA 3S2EA 1E3WA 1R4NB 3ANMA 1H5QA 4ND1A 1ML3A 4XGKA 4IJVA 1E7QA 3HWRA 4FPXA 3KSDO 3BIOA 3O9ZA 1L1FA 1PZEA 1FF9A 1HZJA 1OFGA 2Q1UA 2FWMX 1U28A 3D1LA 4GMFA 4CR8A 4A0SA 4IMPA 1PQUA 3A1NA 4BO8A 4L4SA 5F21A 1VSVA 1Q7CA 3JYQA 3O26A 1E7YA 4PLTA 5KNLA 1F8FA 4DMLA 1JKFA 3M1AA 5EINA 3WLFA 2O7SA 1M6HA 1ZH8A 2YDXA 3DDNA 1ZFNA 3WDSA 1X15A 3UFXA 3GMDA 3GHHA 5AVOA 4R16A 3PXXA 1EE2A 1P3DA 4II3A 3WBFA 4PG6A 3ZHXA 3CE6A 1ISJA 4ALJA 4Z3KA 3E48A 3Q2KA 3PTZA 2W2LD 1MG5A 3UF0A 1PGQA 1PR9A 2VWHA 4J3FA 3X2EA 5LDHA 5EPOA 1TXGA 5L4LA 1EE9A 1VJTA 5TNXA 4RORA 3TOXA 3VZQA 4A03A 2QIOA 4GSLA 3MWEB 3TWOA 4BNIA 3RUCA 3GAZA 5JXWA 4GWKA 1BHSA 2D59A 3B70A 3LVFO 1YL7A 2O3SA 3H5RA 2PGDA 3HNPA 3I83A 1KOLA 1O6ZA 4WLEA 3GHYA 4EBFA 1LRJA 3PFFA 4DREA 2JFFA 5DCYA 2AG8A 2WD8A 3G1UA 9LDTA 5B4VA 3FPCA 3ETGA 3K30A 1EFLA 5BT9A 3WGYA 1NVGA 2ZYGA 5TJ9A 3GEGA 1ZK3A 4CM3A 2O4CA 2I3GA 2FMUA 2WYUA 3RFTA 1E6UA 4IZHA 3IKTA 4L8VA 4DQVA 3G0OA 2QRKA 1PS8A 3IQDB 5H82A 2OXIA 5HM8A 1TT5B 4G2NA 1UAYA 3F5QA 3TFQA 3OICA 4LRSB 4PGFA 5AXBA 4I5DA 4L4XA 1VJ0A 3HDJA 1ZSYA 3VPXA 1NQTA 1O0SA 1V3TA 2P9EA 2X86A 3GGOA 1AN9A 1I3KA 3H5NA 5GZ3A 2QYSA 1ONNA 1N9GA 3F1KA 3S2GA 4C7KA 5L51A 3KEOA 3ZWVA 5A9TA 1A4UA 4EZBA 5CFZA 3NAQA 5ENDA 3WOHA 4AJPA 2YFQA 1DIRA 3MOIA 4C4OA 4LK3A 1OOEA 4DYVA 1D4FA 1EUCA 2DAPA 3U09A 4B3JA 1V3VA 1XDWA 4CMGA 3ITDA 4YR9A 5U4QA 4GGPA 2B69A 1LSJA 2PZJA 3GGGA 3BTOA 4QFDA 3VZSA 4EJMA 2AEJA 1VL6A 1V8BA 3B6ZA 3QLJA 1GL3A 4ND2A 1X0XA 2Q2VA 1LNQA 3HN2A 1E7MA 5T57A 3RU7A 5JBIA 4A5OA 3QVWA 4KTVE 4M49A 1JWBB 4J6FA 2EHDA 1YQDA 1CYDA 3QRWA 3KV3O 4ALKA 4AJKA 5DDIP 3I52A 1H93A 4KMSA 1QMGA 3CIFA 5JLAA 2J6IA 2LDBA 4YRDA 3GDFA 4CLOB 4J7CA 2Q2WA 1LXCA 1IHXA 3GRKA 4IGEA 3SEFA 2YQ5A 4JXKA 2BELA 4DMMA 4NJOA 4QXMA 3PLNA 3WSVA 3WYBA 3RVDA 4CLHA 1U2GA 4IGFA 2GZ2A 3HFSA 3JQAB 5JCJA 4JK3A 3O8QA 1ADFA 2O50A 1MFZA 4KDFA 4R51A 3Q11A 1DOHA 4D41A 3VHRA 1PJLA 4NH4A 5JAMA 2NU7A 1HT0A 3F3SA 3KOUA 1HKUA 3ZWAA 1T24A 2YYYA 4UULA 1R0LA 4XJTA 1PU2A 2Y1FA 4FD3A 4IDCA 1IZ9A 4UREA 1BW9A 4INAA 4Q3BA 4W9NC 1MLDA 3OIFA 2Q1TA 3N74A 4MVJM 4UVHA 4N7RA 1RWBA 1N2SA 2PKQO 1U3UA 3DBRB 5HA5A 1P31A 1B8VA 5F3RA 1MP0A 4NMHA 5F5NA 5B4UA 1A9ZA 4Z6KA 4ZHSA 3QP9A 4MVJP 5BSEA 1R15A 2HAEA 2HRZA 3DMTC 2PZMA 2VN8A 4GI2A 4GX1A 3GN2A 4PRLA 1UR5A 3KETA 4IS2A 2BGKA 1U8FO 4IS3A 4K1LA 4B8WA 5JFOA 4CR7A 1LTHR 4QUKA 2FPIA 1HZZA 2BFAA 4MP3A 3IL2A 4XJSA 5IAAA 3BMCB 1CQJA 5GMOA 2OOSA 1CJCA 4D46A 4YVFA 8LDHA 1HSZA 3NX4A 1QRRA 4BO4A 4NHEA 1NPTO 5IF3A 3KYCA 2UAGA 4CJXA 3TPCA 1I5RA 4TRRA 4L9RA 4WCFC 3ZNPA 2HKIA 1KBZA 1U3TA 4AJLA 4M8SA 2HMTA 5EESA 4PG5A 1BXGB 4O59O 4D0SA 4MKXA 1JW9B 4U5QA 3WLEA 2C07A 1PZHA 4ZU3A 1ULUA 2Y68A 4PZDA 3LU1A 5G4KA 3ONDA 4DPMA 3RAJA 4BUCA 1J6UA 3LC2O 2YV3A 3ORFA 4HNHA 2C29D 3PHHA 1ZSNA 5IN4A 4CV0A 2NVWA 1FK8A 3WIDA 1SB9A 2BF7A 3CUKA 3UHAA 2GZ1A 3OM9A 1TB4A 4Z0PA 4Q3DA 1Y8QA 4XGNA 3S55A 3SXPA 4ALLA 3JQ8A 1GY8A 4E2WA 2HRBA 3BMOA 4DC1A 3ETEA 3IAHA 5L4NA 2YHIB 3HQ4O 1Y5RA 3ZGYA 4R5MA 4BGVA 4FR5A 5KWEA 4YTEA 2DUWA 3BYZA 5EMHA 4J7XA 4EGFA 5JO0A 4LISA 3ABIA 1X7DA 1NFFA 3LSYA 2SCUA 5CPFA 2W2KB 2DTDA 3M2PA 4J1NA 3UICA 1ENOA 1FDTA 4GGOA 1ZK2A 1YONA 5G0UA 3VTFA 1P1RA 1YBVA 2RBEA 3GY0A 5KKAA 3OHSX 1E1NA 4PVCA 3C7AA 3ZNOA 2DT5A 2NTVA 2FY8A 3RD5A 3ZHZA 3TF5A 1YRLA 2WWRA 4XCVA 5U1PA 2OL4A 1DBVO 3KTDA 3NDIA 2YHUA 1YOVA 3F47A 4IIVA 5EERA 5IXYA 7MDHA 4ALIA 1HDZA 3EYWA 4I9NA 2CVZA 3E5MA 4B3HA 1R16A 3F6YA 3ZWBA 4ZICA 1UDBA 1N1EA 3VPHA 3GG2A 1IE3A 2V6BA 2P2SA 1T4DA 2NVBA 1LQTA 3EAGA 4DWVA 3MJCA 3R3JA 5DF1A 3UH1A 4TSKA 2CMDA 4FFMA 2DPHA 1FDVA 1Q0HA 4BNYA 4PG8A 2HJSA 2JD1A 2P9GA 3L6EA 3RUDA 3O4RA 2QZZA 4LN1A 1XA0A 1Y7TA 2ILTA 4L74A 4PLZA 1HDGO 3PVZA 2HK8A 3QQPA 2A35A 1U5AA 5G0SA 3UCFA 3DZBA 1U4SA 1ISIA 1UDAA 4R3NA 1YB5A 2CVQA 3WGTA 4BVAA 3KUXA 5F5LA 3FR7A 4Z9FA 1H9BA 1R4MA 3UN1A 2QRJA 2YFHA 4CLEA 1SOWA 1UJMA 1HDXA 3ROPA 1CQIA 1O9BA 1R37A 5I8WA 3RKRA 1Z73A 1NR1A 2E49A 3K31A 4HP8A 5JC1A 3VPFA 4F6CA 5J23A 4XYMA 5IZCA 1FMCA 4O0LA 3TOZA 4CODB 4IPTA 4FFPA 2R2GA 1XG5A 3CSDA 3ZWWA 3AU8A 3CTMA 4WNIA 5C7LO 2WJPA 2VRCD 2D8AA 5LC1A 3B1KA 3KVOA 4E5PA 1T1RA 3QSGA 1P74A 1DRWA 1LBEA 3ICPA 5CEJA 1G0OA 3DMTA 2EERA 3I9JA 2O3TA 1ZMTA 2PWZA 3WJ7A 5F1OA 3ZCXA 1A71A 1OI7A 3I5MA 4YBZA 4DIOA 1W8DA 3RBXA 4NI5A 2HLPA 3O38A 1GYRA 4FBGA 3S1LA 2IZZA 2GR9A 4Y9DA 1UUFA 4K9DA 5KCZA 1AXGA 4K6CA 3K2EA 3MJSA 2PD4A 3V2GA 1ADBA 5U9CA 4BO2A 1LJ8A 2ZJ0A 3SLKA 4Q3EA 4CV1A 4RQTA 1Z74A 2UYYA 1SAYA 4JJGA 2A9FA 2J3KA 4N5NA 1HF3A 1B3BA 3HSKA 4TRNA 1YXMA 2GZ3A 3GEDA 2FR8A 2YUTA 3AFNA 4WCFA 1QKIA 3OMLA 2VQ3A 1YQXA 3NGLA 5A9SB 3OJLA 2WE8A 4K6FA 3ZI0A 3UXYA 4MKZA 3BHMA 4AJJA 1ZEMA 4URFA 2X9NA 1IY8A 4FDAA 3PYMA 1E7SA 3ZU4A 1B7GO 4B4OA 4FS3A 3JQEA 3DO5A 1PL8A 5THQA 5EQDA 3FF4A 3QWHA 1CETA 1YS4A 2J5KA 2OGUA 4F45A 4BO5A 3STHA 5K0ZA 3UUWA 3RFVA 1ZKMA 4CM1A 1I2ZA 3IIEA 1GCUA 3FBGA 2IYOA 3BXXA 3I1JA 4BO9A 4KUEA 2VUTA 4Y98A 1SC6A 4J91A 2BH9A 5I9LA 2JHGA 3WNVA 2TMDA 4DQXA 5JCJD 2WTBA 1U5CA 2X6TA 3NGXA 1DLIA 1QV6A 5TLSA 4MP8A 5AQ1A 3H2SA 2CSUA 4BKQA 5DBFA 3Q2IA 1GDHA 4RF4A 1E1KA 3W6UA 1DXYA 3AUAA 1SOVA 3PHGA 3ROMA 1QLJA 1YB1A 1LLUA 4PRKA 3WICA 5C37A 4R1TA 1UZLA 1XU9A 1WDMA 3PI7A 3WQSB 3GVXA 4CM8B 3L07A 1G0NA 1PJBA 3QWBA 4DBZA 1T4BA 3DB2A 4I1IA 4UUPA 3KSUA 3MJTA 3AY7A 2WSBA 2C54A 2J3HA 4JIGA 4CMBA 2E4AA 4J16A 5JPIA 4IDAA 4LW8A 4KUGA 1H9AA 1YBAA 2IDZA 5T67A 4QECA 1NAHA 2JAPA 1E3IA 2X4GA 4BNUA 1YWGO 1IYZA 4IQGA 1MB4A 4CLDA 1SZJG 4PCVA 4IJUA 3RIHA 1YB4A 4FFRA 1LRLA 1NQOA 1PJ3A 4CQLB 1AHIA 3ZWNA 2FR1A 3INTA 2JCVA 2JKVA 3NJ4A 3MOGA 5TIIA 3O03A 2GN8A 4QEDA 4CUKA 1GYPA 4B7XA 3UAGA 2O3JA 4KTTE 4IZIA 2VUSA 3VKVA 5JDIA 3B20A 1GQYA 2D5AA 4YCAA 2EIHA 1KETA 4NBTA 3PDJA 5TQVA 1T26A 3FRJA 3JQGB 2WEKA 4O5OA 2X23A 3F4LA 4XRRA 3BMNA 5JY6A 4UUMA 2OFPA 3I6QA 4U0JA 3H9UA 4GH5A 4A26A 4HFJA 2J5QA 3I9NA 4YJFA 1V6AA 3G17A 1I01A 3U4CA 1FDWA 2E48A 2ZIZA 3P19A 2IXAA 4EI2A 3JQDA 3DXFA 5JMWA 2F1KA 5BR7A 4MVJE 4I5FA 2X0NA 4DIBA 1Z6ZA 4YJHA 4E30A 5IXSA 2Q50A 1S6YA 2ZQYA 2VZ8A 5AYVA 1Z75A 4IQ0A 4OH1A 4OJNA 2I3AA 4P8RA 2G17A 2FPGA 2JFHA 4J1TA 2Q3EA 1ZEJA 1P1HA 3VPGA 2PNFA 4EUHA 5DNAA 3ADPA 3GC6A 3WFJA 4B7UA 3JSAA 4CV2A 1GADO 1QP8A 1I33A 5JO9A 1S7CA 2VHWA 3E1KA 5B37A 5A3VA 2WD7B 3AUTA 4GMGA 4Z0HO 4G65A 1DPGA 4IBOA 3D7LA 5I9MA 3ZWOA 4CMJA 1MUUA 3DBHB 3I4CA 1WMAA 2PA3A 4NNJA 2D5CA 1E3SA 5ITVA 2RIRA 1LSUA 1KEPA 4BQPA 1A9YA 3DZFA 3U9LA 4CMIB 2Q46A 1Q7GA 5ER6A 4BKPA 1JKJA 1DRUA 1TVEA 3E18A 3JQ7B 4TRMA 4CL3A 1NVMB 4YAGA 3PRJA 4WK6A 3ZU2A 2Z1NA 4U0KA 4ZQHA 3RQSA 4F6LA 1N7HA 4E5KA 4GVXA 4LMPA 3GGPA 1ORRA 1KY5A 4NDNE 1P0CA 3JD1A 4MOWA 3F4BA 3RKUA 2PGJA 2PTGA 1BWSA 1DRVA 1XYGA 3K96A 5FYDA 1OC2A 1X1TA 1NHWA 4BGIA 1LLDA 1E6WA 5L3ZA 3W4IA 1HL3A 2EG9A 2Q99A 1TA4A 1WW8A 3EK2A 3WR5A 4RQUA 3AFMA 4HBGA 3ONEA 4I08A 4IDEA 4J43A 3I9MA 4QO7A 5JE8A 4OAQA 3L6DA 5BSGA 1HLPA 1EVJA 3DEYX 3L4BA 1BGVA 2IRWA 1D1TA 3LT2A 5A5FA 3G49A 3SJUA 4RL6A 2GF2A 3KHUA 3E03A 1ZO8A 4BGEA 3NYWA 4ND3A 1AGNA 1YDWA 5DN9A 3BTUA 1VRWA 1NASA 2PR2A 5T64A 2FPPA 3LLVA 4TVBA 5DP1A 3GZNA 1D8AA 4XIJA 4YJGA 4LSMA 1ZMOA 4NR0A 1C1DA 4AFNA 4GKVA 4XRGA 1XLTA 4RF2A 4RO0A 1D7OA 3D3WA 1GPJA 1V9LA 4XB2A 1GQ2A 4BNLA 1I3MA 4B79A 1G6KA 2YY7A 3P2YA 1X7GA 4CM6A 2C59A 5A9RA 2YDYA 4XYEA 4D79A 1D3AA 3V8BA 4MJLA 4J7UA 3WBBA 5B4TA 4E2YA 2J8ZA 3NT2A 1PSDA 1V0JA 2XXBA 1LDBA 3CZMA 4RZIA 1AE1A 3K9QO 4ZD6A 3C1AA 1MA0A 3X2FA 1DAPA 1OBFO 1R4NA 3AJRA 4FJ2A 4CR6A 4F3YA 3H4VA 3F46A 2ZB8A 2VT3A 2BKAA 3PZRA 3EVNA 4LSWA 3WJAA 3DWFA 2QX7A 4FJ1A 4HNGA 2PK3A 3DZJA 2VYND 1ULSA 2BRUA 4UEKA 1NM5A 1YJ8A 5GY7A 3ZNQA 5H81A 3K92A 4ZQGA 3K73O 3OJFA 4LGVA 4Q3NA 3DOJA 2QG4A 4TWRA 5TX7A 4JJFA 5TGDA 3GDOA 2NV6A 2X9VA 3ZWPA 2B4TO 4YT4A 2C5EA 1Q0LA 4RPKA 1E3EA 4R69A 5ITWA 4A27A 4AJOA 3JQBA 1E7RA 4PFJA 2DQ4A 3IMFA 2R6JA 1OC4A 1F14A 1E92A 1NNUA 2PFGA 3N58A 1J5PA 1NFQA 1IL0A 3VOSA 4BNGA 1VM6A 3KBOA 4A10A 1C0IA 1YBMA 1YKFA 3P5SA 2DKNA 2ZK7A 2W8ZA 3BTSA 3COSA 1LI4A 3ZWYA 4MINA 1RM4A 4J4BA 4DLBA 4IM7A 1K0UA 4TKLA 2G1UA 3AWDA 1BDMA 2AE1A 3RUFA 4CLRB 4EEXA 3M1LA 4L73A 4R3WA 3NUGA 3WGGA 1PWXA 2IXBA 3GQVA 1E1MA 3EZLA 4E4YA 1PQPA 1E5LA 3D5TA 1LRKA 1E5QA 3IP1A 4L76A 4S3MA 5JS6A 2GGSA 2YZ7A 2VHXA 5CEEA 2Z95A 4MDHA 3QIVA 4BO0A 3OECA 3ZW9A 4AG3A 4WLUA 3Q9NA 4QO8A 1ZZEA 4YXFA 3BAZA 1TT5A 1GD1O 5FEUA 1I3LA 3D64A 3EMKA 3ZW8A 1KC1A 5BQFA 2NQ8A 2DBZA 1HE4A 2V6MA 3DAPA 4XB1A 1XR3A 2NU8A 2X0IA 3PWKA 1F0YA 3ICCA 3I9LA 1ISFA 1EK5A 4BB6A 2P68A 4BNXA 1VL8A 1CF2O 2IZ1A 2EGGA 4XQGA 5AXAA 3RUHA 2ZCUA 1EMDA 4ONEA 4YQZA 5KVVA 4PG7A 1N92A 4JP2A 3QE3A 1M66A 4DRYA 5A1TA 4R4JA 2GPTA 4OQYA 3TZCA 4M54A 3DBLB 3DHNA 4MO2A 3QA9A 5COAA 1RYEA 1GQQA 1X1EA 4IXWA 1NYTA 4ZQFA 5AOVA 4BS9A 2H6EA 3C1TA 4QTZA 4WOKA 1EZ4A 1F17A 1L7EA 3FWZA 1O5IA 4J1QA 1ZBQA 2PGLA 2Y1CA 2G5CA 3H8VA 1MV8A 3WMWA 4E21A 1YDEA 3NT4A 3MJEA 1AUPA 3AW9A 4R5HA 1M75A 3HZZA 2BD0A 3QJ5A 1T2FA 1JDJA 3DAFA 4PLYA 1V35A 4PZCA 1DAOA 2WDZA 5EIOA 3JQ6A 1O94A 4WASA 1XCBA 2EJWA 2V6FA 3VPSA 1FDUA 1I32A 1VE9A 3D4PA 3DR3A 3RUIA 3SC4A 1QXSA 5IZCC 4CLOA 1MFPA 2X0JA 3HDYA 5A4DA 2DU8A 5EJ2A 2B83A 4BL5A 4BNVA 3VKUA 4J90A 1GPDG 4JQCA 4L75A 1EK6A 1ENYA 1PEDA 2VOJA 3MWDB 3CZRA 3K6JA 3JQAA 4UEJA 2YJZA 2ZKLA 3WB9A 1IHYA 1UXHA 3ETDA 4GX2A 4P22A 4FB5A 4H3VA 1XELA 4GLOA 2C0CA 4NPCA 5TS3A 1OAAA 1PL7A 4FCCA 5AXCA 4N5LA 5C7OO 5K6AC 3OETA 1I2BA 1LDMA 2A94A 2GN6A 3A28A 4HXYA 4PLHA 4CQMB 4OXYA 3RU9A 3ZV5A 1KERA 1YL5A 2GERA 3RASA 3PWSA 5DOZA 2HMWA 1R6DA 4NG5A 1KC3A 3CKYA 2C20A 4IJKA 4E2ZA 4IMRA 1WP4A 2NTNA 1PZGA 3TJRA 3GVHA 4F46A 1UDCA 4OXNA 3DBRA 4WECA 1WXDA 3PP8A 1WLYA 4RPGA 3RROA 1Y1PA 1ZW1A 4DPKA 4NU5A 1PJ2A 4B7CA 5ENVA 5LCXA 4OM8A 2UUOA 4KWIA 1XGKA 4BO1A 2VWQA 4M86A 1T25A 4XZ3A 3JYLA 3K8ZA 3QW2A 3R3SA 3ULKA 3BMQB 2EW2A 3WMXA 1E3JA 3OJOA 2C2YA 3C24A 1Q2XA 1QLHA 2QRLA 1I3NA 5CDTA 2X0RA 4O63O 3GLQA 2JD2A 3FD8A 1LDYA 2VTEA 3BMCA 2PKRA 5JYDA 2X5JO 1ZSVA 3JCZA 4JBHA 3TZKA 4EYEA 3OSUA 1BRMA 2I6TA 4IDGA 5DCUA 4BMSA 3VVCA 5CDUA 4P4NA 1WPQA 3FN4A 3JQCA 1F12A 3I9OA 1EFKA 3LT0A 1H6DA 3QWIA 4A73A 2NU6A 3K2BA 2V65A 3RC1A 1NQ5A 1LU9A 1LA2A 4FFOA 3GPIA 4ID9A 2OZPA 5IDYA 4WLFA 1BXGA 3EVTA 3W8DA 1T2CA 2JJYA 3FR8A 2W90A 5L95A 3GVPA 1ZCJA 3HB4X 1P1JA 3L9XA 4D45A 2YV2A 4NJMB 5FI3A 5L9AA 3FPLA 2O3UA 4XYLA 2RCYA 4OOFA 1WZEA 5JNLA 1GV0A 4P4LA 1H6AA 3GUCA 1K3TA 1K5HA 1R66A 3EHEA 2WM3A 1NBOA 2NVUB 3VC7A 3DHEA 1E3LA 2FHSA 1X7HA 1WVGA 3SLGA 1C1XA 4E5NA 2I9PA 4DVJA 4FIZA 4U6SA 3IOYA 2AEFA 1FXSA 1ZNQO 2AXQA 4MPDA 4CV3A 5LDGA 3V5NA 1G1AA 1A27A 2YHIA 3GUYA 1GZ6A 4AL4A 4WLOA 4UUOA 4YWJA 2RHRA 3NRCA 1R0SA 3L77A 5L7WA 4IDFA 1DIHA 4BNJA 1HYHA 1JA9A 3PIIA 1KVQA 4HUJA 3ENKA 1ONOA 2O2YA 1CDOA 1KIFA 1JWAB 1X14A 4WE3A 1SNYA 2GASA 2J3IA 2NSDA 2W2KA 4ZA2A 3LT4A 3NTQA 2WE7A 4GWGA 5JDIC 1JU9A 3MTJA 4DA9A 4I5GA 1Y81A 4DBVO 1R0KA 3B1FA 1EQUA 5A05A 3G1TA 4CM4B 1QSGA 1QR6A 4IDBA 4BB5A 2VYVA 4RV9A 1WZIA 2C7VA 4PG4A 4BKUA 4BO3A 2HJRA 4EITA 3WXBA 1BTOA 5TT0A 1Y9AA 3EY4A 3A06A 4MVJI 1VL0A 2EKPA 2PZLA 4QQRA 4PLVA 3GEMA 5T5QA 1P1IA 4KOAA 3VDQA 4UUNA 4AJEA 3JTMA 4B8ZA 5JAIA 2BGLA 3B1JA 7ADHA 1PGNA 1UXJA 4BKRA 1DIGA 4Q39A 3IJRA 1GU7A 5TC4A 5IJZA 1NPYA 2X5KO 4HADA 3EC7A 3JQ9A 1CRWG 2HMUA 3TRIA 5I7VA 4FC6A 5CDSA 4OMUA 1GZ3A 5BNFA 4NBRA 4H7PA 4UVEA 2R00C 1A7AA 3PQFA 1B2LA 4OYRA 1PGJA 1M2WA 4LVCA 3UVEA 4BIIA 5HS4A 2Y0CA 4RVSA 3H9QA 3ITKA 3IJPA 2Q2QA 4J0EA 2NUAA 2POQX 2QYTA 3GNTA 1VPDA 1QV7A 3Q1LA 4GX5A 4IDDA 4TZKA 1JAXA 1V3UA 2D4AA 3AY6A 3L6OO 2W98A 2PH5A 3TZHA 3AM3A 4RVUA 2W2LA 2CY0A 4ZJUA 4L4RA 1EBUA 1YH3A 3FSRA 4OL9A 2AHRA 3ZZNA 1P9LA 1YVEI 4J1SA 4CPDA 4Q3CA 2DC1A 3T4EA 4L0QA 4WKGA 4BQRA 3UOGA 3F1LA 2ZJ1A 4LVUA 4E3ZA 4AJ1A 1W6UA 5BSFA 4EEZA 3EZYA 3I4FA 1I36A 4NIMA 2G82A 3CEAA 5MGBA 4MVJG 1MX3A 5B12A 1JVSA 2O4UX 3EUWA 3KO8A 3PHJA 4CMEC 3ASVA 3UKOA 1HETA 2FN7A 1ONPA 4ND4A 2ZTVA 4GLLA 3AM4A 2NACA 3H3FA 1WDLA 3NDJA 4IXTA 4YPOA 8ADHA 4ZN6A 2DTEA 1X13A 2ZB4A 4GPD1 2Y66A 2RH8A 1HDCA 4N5MA 1GR0A 1DIBA 3PHLA 4FC7A 2XXJA 4OO3A 3HG7A 4J9UE 4M89A 4AJNA 2G0TA 1IB6A 3WQQA 5I7SA 5JYEA 3QVXA 2NADA 1NP3A 3D4OA 4OHUA 3FNEA 3H9GA 3HADA 2EXXA 3T7EA 3VZPA 3VVBA 3ZWCA 3L4BC 2Q49A 3GVCA 5TRTA 3E9QA 1DFIA 1UP6A 4D3DA 4W82A 4E12A 2Y05A 5K9ZA 5ILOA 1NWCA 3PYXA 1H2HA 3IS3A 3IDSA 4WLVA 1Z7BA 5A9SA 1A7KA 2AW5A 5CDGA 2QHXA 1A5ZA 1LSOA 1P0FA 3AOEA 1HYGA 4YT8A 1QYXA 3PJEA 4WEQA 3W8EA 4ALMA 4KDEA 4E6PA 5C7IO 2ET6A 2RAFA 3GRPA 3ZWXA 1AHHA 4LCJA 5KTKA 4IJWA 3V2UA 3ADOA 4IUYA 3LC7O 4EJ0A 2PD3A 1PS9A 2P4HX 1PGOA 5IDXA 3LZ6A 4AJIA 2B36A 5G0WA 2GN9A 3GNSA 5DT9A 5ILGA 5TT1A 4CMAA 2Y1GA 1EEHA 1NQAO 4R01A 2BMAA 2NQTA 2VZ9A 1VJ1A 4ROSA 2EWMA 4HFNA 4TVOA 3TDKA 1DFGA 3V1UA 1ZXLA 2NNLD 3S8MA 3PJFA 4MP6A 3GK3A 4JP3A 4ITUA 1B8UA 2GDZA 4XDZA 1LDEA 1SBYA 4YDRA 2I76A 1LLQA 2Y1OA 1B26A 2ZB7A 4XIYA 4EUEA 4OGWA 3CINA 5COQA 4B4VA 4CM8A 2V7PA 1DO8A 1U1IA 3MEQA 2AQKA 4I8XA 3MJVA 3P7MA 4JLWA 5AXDA 3ZNNA 1H6CA 2F00A 5IFLA 2FRDA 3JQBC 1GFSA 5JDCA 2DFDA 2DPGA 3GAFA 1MC5A 1SB8A 1XU7A 1C14A 4J9VA 2C82A 4J4TA 1C3VA 1C0LA 3DFUA 3VZRA 3QWFA 2AQ8A 2UVDA 3KLPX 3QY9A 4BV8A 1CWUA 1ZUD1 5IG2A 2Q4BA 2D1YA 3E8XA 1NX6A 1DSSG 2QZ9A 3PGJA 3NJ8A 4S1VA 4BV9A 3D4NA 1JN0A 3DZHA 1Y8RB 2DLDA 4B3IA 1UXGA 2E37A 3W8FA 4WNCA 4CQLA 3QVTA 1H6BA 4PLPA 4AJ4A 1M6WA 5JC8A 1PGPA 1ZK4A 5THKA 1NPDA 2B35A 3UCXA 1LDGA 4GL4A 1SEVA 1XKQA 5T6BA 4E2XA 5JSFA 2R00A 1GCOA 3KYDB 4EW6A 1C0KA 3DZIA 3AUSA 1B15A 2H9IA 4MIYA 4BNMA 4MVJA 4DYDA 2HMVA 4W4TA 4H16A 3HHPA 4DPLA 4R9RA 1QORA 3JQGA 5L7YA 3CPSA 3ENNA 4W6ZA 4OKIA 3KXDA 4R9SA 1HDOA 5KJEA 1PJQA 4RJTA 4RVDA 4NFHA 1JAYA 4YA6A 3DFZA 4GAEA 3KYBA 4CUJA 2IE0A 1QG6A 3LK7A 3T4XA 1DC6A 5IZ4A 4QFCA 1P33A 3SVTA 3OQ1A 1DC5A 4JCOA 5DBGA 5A06A 5KJFA 1KEWA 3BTVA 5TJHA 4CMHA 1J0XO 3PZBA 1U8XX 1TLTA 2CFCA 2JCXA 3FTPA 4R41A 2BFMA 3H5AA 2C5AA 3HUDA 2A4KA 4YRAA 2O48X 2VOEA 1U3WA 4CMEA 1E3WB 2Y0DA 4MKRA 3LYLA 1N1GA 1DLJA 3TN7A 2HK9A 1KVSA 1ZK1A 3IP3A 1HXHA 5I7EA 1BDBA 3PFWO 1B3RA 4E5YA 1NR7A 1EDZA 2DUUA 1HEUA 2FOIA 3GFBA 4K26A 3IKVA 3PJDA 2WD7A 1B14A 1CIVA 3INRA 5K6AA 3RSHA 1ENPA 1GZ4A 4ZQBA 3DBHA 1UXKA 4IINA 3GZNB 1X0VA 3TL3A 1I10A 3RC2A 1XQ6A 4Y67A 2X58A 4CMIA 2FSSA 3MJ4A 2B4QA 4AJHA 2OUIA 2ZATA 4NBVA 3JQ7A 3TZQA 1E7WA 4WCDA 3WTBA 1FJHA 3WWZA 3DTTA 2VCYA 4YT5A 3A9WA 5KVSA 4JGBA 3WIEA 3M2TA 4JNKA 4FOSA 4UVGA 4BO6A 1HTBA 2AMFA 1HE2A 3NDRA 1O89A 3KSZO 1IULA 5ES3A 2VWPA 5CEFA 4U8GA 1A72A 2D3TA 3DMYA 1GUFA 3RJ5A 1B16A 2WMDA 2IEBA 2Y1DA 1U7HA 3IUSA 1EUDA 3BHIA 4LCEA 5I8ZA 1EBFA 4HFMA 4KZPA 4BOYA 4KQWA 3V2HA 2IZ0A 4FGWA 1QYWA 2DBQA 1AXEA 4M87A 3KRTA 3ANNA 1K6IA 4FFNA 4HWKA 3WGQA 5BSHA 4H15A 1Q7BA 4ZRNA 3A14A 3PEFA 5CHEA 3W1VA 3FCOA 3OJEA 1C0PA 2YQ4A 3NKLA 3NT5A 3JQFC 1UZMA 4BNWA 2FP4A 4ZGWA 1JQBA 4RF3A 5JY1A 3WQRA 2RH4A 3MZ0A 3SJ7A 1CERA 4Y6SA 3TZ6A 4FFLA 2HMSA 2X8LA 2NM0A 4WOJA 4DGSA 3RUAA 4AJ2A 3TFOA 1ARZA 3RBVA 4NFSA 4HX5A 3A4VA 1LQUA 4XYGA 5EQFA 3ZV4A 1Z7EA 3OEWA 4PLCA 2GN4A 1N9GB 3AOGA 1K6JA 1W73A 3ZH2A 4YT2A 5B1YA 4BMVA 3OQBA 4J2HA 4DLAA 3SC6A 1PR3A 5JW6A 3GOHA 3UGKA 3IUPA 1T2DA 3RBZA 2O23A 1WDKA 4OQZA 4UEOA 4TKMA 1U4OA 2UV8A 2CF5A 4RLHA 5BNTA 3AI1A 4GBJA 2FZEA 3CMMA 4XWYA 3DZKA 1BXZA 5HBRA 4XYBA 3OIDA 5L45A 2BI7A 1TEHA 4XEHA 5F1KA 4II2A 2VRCA 1GV1A 2GCGA 2H63A 4EJ6A 1BXKA 2P9CA 2B0JA 4YYZA 5T8KC 2LDXA 3GA0A 4NK4A 4BNTA 3RUEA 3ST7A 2FSVA 1O8CA 4C7JA 3GPDG 2JAHA 4CL8A 1U2DA 2HSDA 5DZSA 3AI3A 3JYNA 3QVSA 2UDPA 4DC0A 1DC4A 3LF2A 3RWBA 2NTJA 4A7PA 1CEQA 2P91A 3SBOA 4JN6B 1GYQA 2OORA 3WGOA 2CDAA 1UAGA 3AM5A 5CP8A 3O8QB 2EKLA 1T2AA 5C3MA 4ZVVA 4MIOA 3WX0A 2AA3A 4XQEA 2A92A 2OO5A 1XWFA 4TRJA 5G0VA 2Y0EA 3HFGA 1UP4A 4CLRA 4BNKA 2GUGA 4BHTA 1ENZA 1JKIA 3DOCA 3INGA 2CVOA 2Q45A 3JYOA 3JD4A 4KWHA 2JD0A 5CDYA 1BW9B 2PLAA 1I24A 3NEPX 5DULA 1PS0A 2EGHA 3L9WA 4OOEA 2I5PO 3GNQA 1SO8A 3ANLA 4CUZA 2X5OA 2I65A 3OH8A 4XA8A 1KEUA 4YAEA 1ISGA 2NU9A 3UCEA 4BKOA 4B4UA 5L40A 1RM3A 1E6EA 4RZHA 4FOOA 3OBBA 4XGIA 2ZTMA 2FR0A 1IUKA 4GVLA 5DOVA 1T1SA 1BVUA 1NWHA 3U62A 1WNTA 4MVJH 4PLGA 3WS7A 3AU9A 1FDSA 2AQHA 5FI5A 5JMPA 4RF5A 2YW9A 1BG6A 3C1OA 1ADGA 4XDYA 2Y1EA 2HO5A 2BFOA 5FF9A 5A03A 2GD1O 3JQ9C 1DJNA 3DBLA 3ZV6A 1NVTA 4O6VA 3E6AA 4IY1A 2IODA 2XF8A 2DM6A 2HDHA 3T7CA 3KYCB 4P38A 4RDIA 3ZHYA 4DUPA 5KJ6A 5ER9A 1NAIA 1RPNA 4NQZA 2B5WA 1KEVA 1WAMA 2DTXA 2O7QA 4GSKA 2HUNA 2HCTA 4RVGA 2VUUA 5JAQA 4MVJD 5I7FA 3PQEA 2WYWA 1LUAA 2EEZA 5DCWA 2W4QA 3JQFA 3PGXA 2FZWA 4RPHA 3S2IA 1VC2A 5G4KB 1J4AA 4J4HA 3PJGA 3FBTA 3PIDA 5G0TA 3HB5X 3AY3A 3FTNA 1DHTA 4O1MA 4WJZA 1KVTA 1NHGA 6LDHA 1F8GA 4W99A 5COBA 1I8TA 4GKBA 1UXIA 3QVOA 2CUKA 2O3RA 4D0RA 1HWYA 3E9NA 1RKXA 1Y8QB 2AEMA 2NLOA 2YV1A 3JQ8B 1PJCA 3BMOB 1IOLA 4WLNA 2D2IA 2X1HA 2Y99A 4HY3A 3LLSA 4BNZA 1YO6A 1P77A 4X54A 3OA2A 4JX8A 3GZ4A 1OMOA 2C2XA 3DONA 4DIFA 1YQGA 1GUZA 3GG9A 3GT0A 3Q3CA 3DL2A 1I0ZA 4PIVA 2VNSA 3PQDA 1NXQA 1EVYA 1Y9EA 2EW8A 1PX0A 1J49A 1D1SA 2E82A 3WGHA 3AI2A 1SEPA 3KLMX 4CM9A 5HRUA 1RJWA 4YAJA 2B5VA 3BZUA 4XKJA 3R1IA 4CQMA 5A3JA 1DJQA 1H94A 2GYYA 1KS9A 5HWSA 4K28A 4FN4A 3CMCO 4JJIA 4Q9NA 4B4WA 4E33A 3KM0A 4FSHA 3HE3A 2EJVA 4CLXA 2CZCA 2DBVO 4NZ9A 5ICMA 3ASUA 1VSUA 3D5QA 4N54A 3AOEC 1YOVB 3RFXA 3HDHA 4Q3AA 4R1SA 4FQ8A 1C1XB 2HK7A 1R12A 4ZQEA 5T8KA 4DL9A 4RVHA 2VT2A 3KEQA 3FWNA 3I9KA 4MIEA 3K5PA 2OMEA 3JD2A 4D44A 3BMQA 3WNQA 3VTZA 4BGUA 3U49A 4ALNA 3C85A 4D3FA 1N7GA 1UZNA 3PWZA 4JBIA 1RM0A 1MC4A 1KVUA 1M67A 5G2OA 4FGSA 1N8KA 4LMRA 1E1LA 3DTYA 4CM7A 4HV4A 2X7HA 2XPCA 4CMKA 3NV9A 3C7DB 4YB8A 3G3EA 3TSCA 1MG0A 4P4GA 4XQCA 1MXHA 4YEDA 1UH5A 2VZ0A 2QQ5A 3JYPA 3ZDFA 1GTMA 3BHJA 5L7TA 1JTVA 3HN7A 1R4MB 3WG9A 5F1PA 4IIUA 4RPJA 1K2WA 1ZIDA 5KVQA 3JV7A 3ZN2A 4PLWA 2B4RO 3VH3A 4KQXA 4MVJF 3WYEA 1L7DA 1B8PA 4HKTA 3ROQA 1VKOA 2XAAA 4NJMA 1ISMA 5G4LA 2CD9A 1SMKA 3WYCA 4E5MA 2ZTUA 3D3EA 4RGBA 1E77A 4FJ0A 1YGYA 5JDCC 4DTIA 1H0KA 1U3VA 3GH3A 5EN4A 2NVUA 2ZCVA 4D42A 1EQ2A 2GSDA 4Y6PA 1DDOA 3ONFA 2GLXA 5EL0A 3H7AA 1NTOA 2GRAA 5HS6A 5JAZA 1QYDA 3F5SA 3OP4A 1K89A 5L53A 3UW3A 1BMDA 4PVDA 5GZ6A 3DZGA 5L4SA 4OSPA 3PK0A 4TMFA 3WSWA 4ZRMA 1I30A 4EUFA 2Y67A 3QWAA 3U4IA 1E0DA 1P1KA 3H2ZA 4NFYA 5KIAA 2B37A 4W9NA 3KB6A 3OA0A 4WUVA 4TROA 3ZU5A 4WGGA 4WCFB 3DOOA 2VHVA 4RVFA 3C3XA 2VHYA 4CM4A 3OF2A 3PLRA 1SPXA 2GO1A 2H1SA 4UVIA 3GR6A 3WWYA 3EW7A 2IEDA 3DBVO 5JCXA 4RDHA 1LC3A 2VNAA 4XX0A 2ZQZA 2ZTLA 4E0BA 2CDBA 4PZEA 4A2CA 3HDQA 3ROKA 3V1YA 1LSSA 1PL6A 3CXRA 1WWKA 3F9IA 5A02A 5CG1A 1PWZA 1HDYA 1Q0QA 2VYNA 1VI2A 2AG5A 3WGZA 4BNFA 2EF1A 3H6KA 2HQ1A 1DHRA 2PKQP 3GDGA 4D7AA 3C7CB 1ADCA 4R1NA 5IDWA 2JFGA 3GMSA 4BO7A 2EKQA 5CPBA 2X22A 4JROA 1A4IA 1YJQA 2Q1SA 5FFFA 3ZHBA 4Z3DA 4DXHA 2DVMA 3IC5A 3WFIA 1VKNA 4YJDA 3H9EO 5DP2A 5IN5A 1B0AA 5FWNA 1PJ4A 2OHXA 1TI7A 3LF1A 3AK4A 2DBRA 4WEOA 3Q6IA 3L0DA 2Y93A 4BMNA 2Q4EA 4Z0TA 4NK5A 4D3SA 1O95A 2GNAA 3H3JA 2DFVA 1ZJZA 4IQ8A 1DEHA 2I99A 1KYQA 4RLSA 3NTOA 4U6QA 4WPGA 3RJ9A 2ZYAA 3PPIA 4G81A 4TQGA 3R6DA 9LDBA 1JVBA 3HJAA 4KP7A 1QYCA 3JD3A 3M6IA 4UAGA 1XQ1A 1HLDA 2H5LA 3H9JA 3R0IA 1OZAA 4DQUA 3RC7A 1LLCA 3BA1A 1ZJYA 3U4DA 1H2BA 3LT1A 1DC3A 2Q1WA 2VTDA 5I9NA 3ZV3A 4CMCA 3GFGA 3I23A 2BFPA 3LQFA 5CG2A 1ZXBA 4BNNA 1XIVA 3E82A 1XEAA 4J49A 4J0FA 4FW8A 4OSOA 5CAEA 2HU2A 3JQAD 2CNBA 2O3QA 4ILKA 5TSDA 4XD2A 4E31A 3E9MA 3TL2A 3W6ZA 4W7IA 4R54A
chains in the Genus database with same CATH superfamily
2WFMA 4ZO9A 4L02A 2QP4A 5F7JA 3BWCA 1HE5A 1QYVA 2H4HA 3E0QA 2Z1MA 2CF6A 4Z9XA 4G4JA 1KVRA 2J4DA 3D6TB 1NE7A 5BMVF 5IDQA 4G23A 4LOAA 2IYRA 4RPLA 1G21A 1H4VB 3HBLA 3QNWA 3LL4A 2L0XA 3M70A 1CE8B 4AO8A 4D43A 1XE3A 3PHIA 4YRBA 5B64A 2WKWA 4V1CA 1P2UA 5KOIA 1BYIA 3DULA 4W7HA 4JV5B 1RYDA 3OEYA 4RLQA 5EIXA 4GPAA 2QTMA 5FWYA 4ND5A 4YJHB 1Z29A 3U4HA 2AD5A 1ISHA 3B1XA 4Z2AA 1WMBA 2UYQA 1LD3A 1PHRA 1LWNA 1QHEA 1X1AA 2EP5A 2FPGB 2GAOA 2BE9A 2P65A 3CRNA 1W4ZA 1KEZA 4LGCA 2QV0A 4PN3A 4D4KA 2PMDA 2ENUA 3TH5A 3TJZA 1EVZA 4ENWA 4YUYA 4H1WA 3SQLA 4DR5B 1W581 1M6VA 3A9RA 4KYTA 1RM5A 1NYRA 5FOUA 3AUKA 4H2DA 5HILA 4P0QB 3TQHA 1T5HX 1PIWA 3WJ1A 5I7OA 1PUIA 1KY4A 2PYIA 1ISRA 1MZVA 2AQIA 1L7BA 1DB3A 1YZGA 2BGMA 1HRDA 2W6JD 2PT7A 3KEMA 4BNHA 3H65A 1HE8B 1M76A 2DUNA 2WFAA 3FZNA 4OQQA 1XKXA 2XB8A 3A6GA 2F43B 3MQ4A 4MQBA 3IPCA 3SWWA 1EFPA 1U99A 2YFKA 4RJLA 3EZ2A 3WAKA 5EJ7A 2Z58A 1XAIA 3LBIA 4MROA 4JH0A 1X87A 3GF4A 2CLIB 3TNLA 3VH4A 3ZE9A 4CM9D 2O8CB 4CQMD 1EWVA 3EN0A 3G79A 3VX4A 4KRYA 3NTRA 3H4MA 5FTNA 3AUUA 4AVYA 4GI5A 2D7JA 2A9PA 4NU6A 1IN6A 2OBNA 1RZ3A 2WAXA 2YRWA 3N6RA 5KYKA 3QX9A 2C2ZA 2FFBA 3JARB 3PENA 1V71A 4X7BA 1J21A 1RHUA 4XR4A 2J3JA 2Z3ZA 3ND6A 5ELLA 4RS3A 2WUGA 3ZY6A 4EPVA 2ZRHA 1TAGA 2XHZA 3IQHX 3IXMA 3M6AA 2XZPA 3H1GA 3NHSA 1HSOA 3B1WA 3EPJA 1JALA 2D1TA 1QVRA 2DWUA 4DLKA 4KSBA 4C4RA 2ABWA 3JAWA 2W6OA 2BHLA 1U9IC 2ZT8A 7ABPA 1YRAA 5BORA 4Z4HA 3AKZA 2XTAA 4LPKA 5BQ3A 2QTAA 5HOQA 1K6XA 3VVLA 3FSJX 1F06A 5KWIA 4M36A 1T8UA 2IYPA 1TT7A 2GJSA 4GM0A 4Y9UA 4CM5A 2FP3A 1TA0A 1VMKA 4RKFA 2FFQA 5T41A 2ZB3A 5JXIA 3NORA 4U7GA 1A1VA 2P5YA 1PEAA 4RMGA 1NFRA 4KE8A 1KF0A 2JCYA 2CHEA 1XSEA 1I4DD 4YP6A 3RCBA 3RI3A 2C7GA 1TDJA 1E0KA 1KYYA 1TUGA 2OP1A 2VDUE 2VSOA 3CH6A 2P6PA 3TEJA 3ZK7A 4DQLA 1DFHA 4F8YA 5ITSA 5F73A 3OG9A 4OIMA 5E7MA 4RK1A 4JMLA 1LEHA 2GYUA 3A3NA 1FNCA 2F9LA 4GD3Q 1R7RA 1MPTA 1SQGA 4YJGB 3LGXA 3N7UA 4ENUA 4ZYVA 3GLGA 1C1DB 1Y1TA 1SCBA 1M8JA 5DM2A 2VHZA 5B58T 4BFTA 2EP7A 3VDRA 2QY6A 1A2BA 1FYWA 3QV1A 4RQAA 2GEDA 3KQQA 1NRWA 1IZ0A 2JLRA 1Y5MA 1R10A 1JHPA 1C7QA 5EIFA 1QFMA 2VHEA 9GPBA 2P5UA 4W5WA 5CM9C 3ABSB 1GUYA 3H2KA 2XUJA 4HX9A 4X0EA 3H17A 4L4YA 4K1XA 3DV0B 1L4NA 3B2QA 5JARA 2BFCA 1ECGA 3NP9A 4PLFA 4YRJA 4F2DA 4B47A 2Q5FA 1NUAA 3L4KA 4RD6A 1ZLXA 4FPXA 4FE3A 3O9ZA 4OUDA 3QELB 1L1FA 2CVFA 1EAMA 5BN1A 1HZJA 4BTLA 1OFGA 2G08A 2Q1UA 1TCAA 2DFPA 2ZE6A 1F2UA 5FPQA 3ZY2A 2GN2A 5AESA 5IX8A 3D1LA 1FFEA 4Q6BA 1PQUA 4L4SA 1DEKA 3P96A 4PLTA 1Q7CA 3JYQA 3KSRA 4YNBA 1BA2A 5F21A 3SZRA 2V97A 4C3VA 4ZHQF 3A9UA 1JKFA 4FOLA 2EJTA 4F92B 1PR1A 2QW0X 1Q0PA 3WK8A 3O6VA 2JLXA 1UXOA 3CS3A 2CLSA 1V5WA 3IAXA 1F4VA 3GHHA 5AVOA 3ZUGA 1P5FA 1XTZA 3DPIA 3VYTB 3ADDA 2WTUA 3PXCX 4UM9D 1BJKA 3SSAA 2O1SA 3OWHA 4C20A 1P3DA 5K8IA 3ZHXA 4KGXA 5B2ZA 1ISJA 3TKYA 4Z3KA 3E48A 3Q2KA 2CDNA 4PWZA 4RZ2A 3UT5A 1G6HA 1I80A 1OH8A 4IEIA 3X2EA 1N77A 3WBJA 3R3VA 1AY0A 5EPOA 2P3SA 3CUWA 3GRCA 3OE4A 5L4LA 1R8QA 3NBKA 3O2NA 3IB3A 2JIPA 4V0SA 3KWLA 4PC2A 4M8KA 2CWDA 5ENZA 3ZWQA 3KDAA 2QIOA 1L8OA 5DWQA 1NDHA 3GLTA 4Q4CA 4WBNB 2A7QA 4GWKA 1BHSA 2A57A 5CXUA 3EZGA 3WHPA 4QDJA 1XAJA 3FSGA 2IYAA 3MCZA 1WDWB 4HQNA 3RODA 4CEHB 3H5RA 4DR4B 4K6GA 1O97C 3I2YX 3NBYC 4PSCA 3K15A 3I83A 5DLPA 2H8KA 5AIBA 3N86A 3GHYA 4D9IA 5F7OA 2JVJA 1E6LA 2XKBA 2R65A 2Q3FA 2DJ5A 3IBFA 2NNWB 5DCYA 4PIPA 2AG8A 2JC3A 2GBPA 3G1UA 3ISVA 4O2BA 3DLHA 1S4MA 3DDHA 3WL7A 3K30A 5DLEA 4MS1A 1YVUA 5CT5A 3QTLA 4ZO6A 3WGYA 2WNSA 2Q6KA 1RP7A 1U2EA 1H23A 2FFRA 3CR3C 1OLOA 5J4VA 5TJ9A 3GEGA 1ZK3A 2FXIA 1GRQA 1T1JA 2Z3WA 4O2RA 4Q4JB 1HLFA 1E6UA 4C3OB 4JI4B 4PEVA 5LMNB 4GC9A 4YP9A 1YS6A 2ZR0A 1FS5A 1KBOA 4MIKA 3TTXA 5LZ9A 4PGFA 2XYQA 1MJHA 1E1QD 4I5DA 2ZSBA 1N3IA 3QM1A 2NU8B 1VJ0A 1N32B 1KAGA 3L7IA 3VPXA 1HYBA 2X86A 1JQ5A 4GP7A 4HTAA 3R5TA 1I3KA 5LXTA 1N2GA 4Z7OB 1G8YA 5ALEA 5DYTA 2WOJA 4F9FA 1EKXA 1N9GA 3F1KA 3FXAA 5BO5A 3ZI4A 5L51A 3ZWVA 1NW3A 2Q6VA 1AD2A 2K7ZA 1J2YA 2ZTSA 4HQKA 3LQ2A 4MQ4A 3T15A 4AJPA 1DIRA 4WWHA 2XUZA 2R85A 4GNRA 3LHKA 3HUUA 1OFUX 2DAPA 4FTWA 5MN5A 4ZMBA 4NXMB 1V3VA 4ZAYA 3WGUA 3ZEIA 3VZCA 3A4YA 5CITA 5E1OA 4Y2UA 3B6ZA 5HFAA 4FX2A 4DWOA 4F5EA 1X0XA 2Q2VA 1F60A 3E81A 3FPEA 3HYCA 3KK0A 3ZJ4A 2PMCA 2RHOA 2RGGA 3HN2A 1Z62A 2X13A 1LVUA 2XWBF 1B00A 3QVWA 1GM5A 2XODA 1NXTA 5E9QA 1VG9B 3PI6A 3GJ4A 2P7IA 3SZOA 3V4SA 4AQ7A 4EGJA 1SFRA 3HB1A 4MR9A 2VBCA 4RFSA 4Y2JA 1U9ZA 5ALZA 1OX4A 1ZH2A 1D5WA 2PZGA 2FKNA 3OLCX 2G88A 2IU4A 3RSOA 3R23A 2H00A 3I52A 4CF5A 1SCQA 3CVYA 2EL9A 1QMGA 1L1RA 2WKRA 3M6VA 5JLAA 1NJGA 2ZJ6A 3CXUA 3C3PA 1KO7A 2IKQA 5B3JA 1ESZA 1LBHA 3P8ZA 2D1FA 3UAXA 1PYOA 3TXXA 4IGKA 2Q2WA 4LYAA 1LXCA 1GKIA 4IGEA 4BYMA 4TTTS 4XUDA 1K0FA 2WUFA 2PUVA 3MINB 3QVVA 2YQ5A 3QPWA 5K2MA 4PZ9A 3KD3A 4OREX 4LTMA 2PS3A 4B73A 1Y1KE 5AW1A 4DB4A 4W5OA 3HGMA 2Z4TA 3NG1A 3FOZA 2O50A 1QP7A 1MFZA 4M99A 3JZFA 2Q8PA 4PYKA 3UYLA 3HM9A 1PJLA 4NH4A 2WAOA 3QE4A 5FPKA 1E1CB 2MSNA 4FHCA 2HADA 2VH1A 3KOUA 4P93A 1HKUA 1UPUA 4OSEA 4R1PA 2YYYA 4ZOQI 1G42A 1KSHA 1KJQA 1W1UA 1W5EA 4NQRA 2PZFA 4PFSA 4TLAA 4FD3A 1AGYA 4OV6B 1AKWA 1T36B 3RVPA 4Q4AB 1E6MA 1NOKA 3T0GA 3T1HB 2W42A 4UREA 3OIVA 3WKEA 4M9CA 1F2DA 1DAIA 2P3QA 5DXFA 1DX6A 1SHJA 4MVJM 3AC0A 2PWBA 4JVLA 1RWBA 4RNDB 3MM4A 4OFBA 2BFEB 4NCHA 3KD2A 1VKZA 1U3UA 1NUQA 2GAIA 5HA5A 2C84A 1AM4D 2YWBA 1SVMA 1GL9B 3FWYA 1AK1A 3HYSA 2FWRA 4S1NA 4Z6KA 4E5SA 3FYTA 4MVJP 2QQGA 1R15A 5JVDF 3NIDB 2HRZA 2N75A 4WZBA 4MV0A 4WACA 4C89A 1KDTA 4UEQA 4WBXC 1BWPA 3UTCA 2PTHA 3DZ8A 5JJIA 3IIJA 4AY5A 2GNOA 3HP7A 4IS2A 2WSYB 4IS3A 1YTUA 4K1LA 1UBCA 5JFOA 1FUEA 2ZSFA 3II6X 2PRIA 3MERA 1OYYA 1HZZA 2BFAA 4GR5A 1UM9B 1V48A 1W30A 3NIGB 5EP1A 6CHYA 5IAAA 2EAUA 3BMCB 3L0OA 1D4ZA 1Y6QA 3F8TA 3ZE1B 2NOAA 1GQRA 1F2TB 3FFXA 1DDIA 1HSZA 1ZRSA 3DYBA 3PUWA 1N2JA 2GPJA 3CG4A 3O3OB 1QRRA 4IJMA 4G37A 4K40A 3KTAA 4P86A 4BO4A 4NHEA 1TF2A 1NU8A 2LIVA 3OP1A 3EFOA 4HDSB 5JEDA 1XNJA 5ICFA 1I5RA 2IU0A 2ZP1A 3NHZA 2WAMA 4TRRA 4BPRA 1NXPA 1V16B 2NU6B 2VTVA 3S7ZA 3U81A 3KR9A 3W5SA 3RABA 1RAEA 4MCHA 5AI0A 2HA7A 3P2KA 3H42B 1OFVA 1KXJA 1ESCA 3ESBA 5FTJA 1RLIA 3JZIA 4M8SA 4H4DA 5H70A 1JLSA 5DNWA 3CLKA 3V3KA 1VA4A 2Y27A 1BXGB 4D9FA 3ZJTA 2GILA 4MKXA 2CXOA 3HBNA 2YXDA 1CR1A 1GNPA 1GGKA 3FA2A 4M8IA 4UXJA 5EMJA 4FOTA 4B17A 3OEHD 2C07A 1PZHA 3CVWA 2Y68A 4PZDA 4DPMA 4LHYA 4OEHA 2CMGA 3BK1A 3WKBA 3WLRA 1OY1A 1XDDA 1CZHA 1VCOA 3KXIA 4HNHA 4Z8YA 2C29D 1CYEA 4EHKA 1OCEA 1ZSNA 1RBZA 3L0CA 3IJEB 2WICA 1XTUA 2DHRA 2IL1A 4RZXA 2IX3A 4LMBA 1DU4A 3CUKA 3Q3IA 2GZ1A 3OM9A 4Z0PA 4XGNA 4AZTA 2V7WA 1RPZA 2SNIE 3G2PA 2XZLA 2IUSA 1UOPA 4ZC1A 3BFVA 1HO3A 3GJZA 3D4IA 3THRA 4EGSA 2YHIB 2IZOA 4I4TB 3ZGYA 2J7PA 2AOXA 4LYDA 1QLWA 1QONA 1YA6A 4YV7A 5M2QA 3FMPB 4MS4B 5LZ2A 1VHWA 4EGFA 2X0DA 1I4EB 3NVAA 6AT1A 1XQVA 1AS3A 1X7DA 3BIXA 1LPNA 1V3QE 2P78A 1IMJA 1BKSB 2QN6A 2ZUDA 4I66A 3PNPA 5B2EA 1QF7A 2AFIB 2W2KB 3LWZA 4J1NA 4TT8A 3Q7SA 1Y89A 1UZUA 4X66B 5JBQA 4PNEA 3Q7QA 1MF7A 5G0UA 3KB1A 1YBVA 3AIKA 2RGBA 2R66A 3OHSX 4ZYYA 1TCUA 4PVCA 2G9UA 3A6FA 2DT5A 3CT6A 3ZHZA 1UKYA 4C6HA 1V47A 4JC4A 2VTKA 1KIAA 1A3CA 2O2DA 2ZRMA 3HI4A 3KTDA 1AS0A 4NAUA 4PU0A 3NDIA 2GD2A 4ZO7A 1NC1A 1L8LA 1J9EA 2IZ7A 1LBQA 2Q5HA 3F47A 2IOFA 1G64A 7MDHA 3OWOA 2QROA 1IZYA 3ZLJA 4XWWA 2A5LA 4PPNA 5DT2A 4RWZA 2HF9A 3TGPA 2YWDA 4B3HA 1SCAA 4GPEA 3FMOB 1PE0A 2VPQA 1L7VC 2VFAA 1UDBA 1N1EA 3EGXB 3LK6A 3PQ7A 4UATA 2F3UA 2O8FA 2APJA 2VKQA 2GH1A 3EAGA 4NULA 3R9IA 3VU9B 1S1MA 1DG3A 1Y8ZA 1VZ3A 3A70A 3R3JA 3QG5A 2JK1A 3LVBA 1K5DA 4MWCA 4OHKA 2DPHA 1FDVA 5DF1A 5IBQA 2PNJA 2HJSA 3KUDA 4EECA 4Z0NA 3CZAA 5C53B 3FSGD 4CCWA 1N7IA 2Y1WA 1KO5A 1HDGO 5F98A 3QQPA 3VSCA 3DLCA 1A76A 4ZCIA 3DZBA 1OWLA 1RBMA 2OC4A 3M3DA 1E2IA 4R40A 4HAXA 2NX2A 1UDAA 4HDAA 1CZKA 2NUAB 1YB5A 3A1WA 2QT1A 4NZOA 3KUXA 4BRWA 1BH2A 1R4MA 3AFGA 4F91B 2A33A 4NARA 1ZL0A 1UJMA 1HDXA 3ROPA 1XZEA 3R20A 2HWUA 1U1CA 3D7NA 2QM3A 3WWOA 1YCHA 1Y48E 1SPBS 1CJKC 1E4VA 2UU9B 1GA6A 1P4GA 3GCXA 5AKYA 5JC1A 1JFSA 4XYMA 4E15A 1VJCA 5IZCA 1SUAA 4KRXA 4US0R 3TOZA 4RH3A 1ZZGA 4AZVA 3CSDA 3AU8A 2DECA 2OE2A 4FSXA 3GAMA 2WJPA 3L0SA 1ZVJA 2D8AA 2H4FA 1O4WA 3B1KA 3VR6H 3QSGA 1LBEA 1AQUA 1I2MA 4V0KA 1N33B 3DMTA 1Y3AA 2G77B 2CNDA 1LPAB 4GOLD 1MNAA 1ZN9A 3GU3A 3I5MA 3KVVA 4HDNB 5DX1A 5F1OA 3ZCXA 4LF6B 5BYKA 1T4CA 1GVHA 4NI5A 4OK5A 3TX2A 5E0KB 4FBGA 1TKCA 2CL5A 3WLMA 2GR9A 5DNDA 3SCZA 1QPZA 2QXUA 4K9DA 1XMIA 1AXGA 3PD1A 2PD4A 3SHTA 4JXZA 3TZEA 5AUOB 3PL1A 5U9CA 1VSTA 1XRNA 2Z8YA 3SE0A 2W8BB 3ZCTA 1OLUB 2AFHA 3PIRA 4KYIB 3ZS8A 2UYYA 3CLTD 4JJGA 4JLPA 3IKLA 4QOSA 2FMHA 4BX3A 3AHEA 3HVIA 1T34A 3DCNA 4HLCA 3TLJA 3X0DA 4D9HA 4ENRA 4TRNA 2RGYA 3HM2A 3Q72A 2GZ3A 2WF6A 2O7VA 1X7YB 1ZMXA 2FR8A 4EHLA 4B0OA 1PG5A 4WCFA 4LF7B 3UBMA 4QYXA 3W6OA 1QB8A 3U0VA 3T4UA 5AM0A 1FUKA 3PQ3A 2OFFA 4WMLA 3U9SA 1J7KA 4GF5A 5BUZA 1NG1A 3F90A 3UMBA 2X9NA 1IY8A 3PYMA 4EVRA 4C4TA 2JCSA 3DVLA 1B7GO 3O2JA 4FS3A 5AJWA 4B4OA 1E94E 3MK31 4NE7A 4RENA 1VBMA 3AL2A 1TYBE 1GCAA 4PICA 1YS4A 3TW0A 1MO3A 2AJ8A 5FRDA 2J48A 5DHPA 4DM7A 4ISBA 4XTCS 4WJLA 4ISCA 5B58C 3STHA 1ZKMA 1N7JA 2PX2A 1WV0A 1I2ZA 2XB9A 1PT5A 1L5WA 2CKMA 2ZRNA 1QQAA 5CNMA 1GCUA 1NXXA 3KOZA 1G41A 4BO9A 4EI8A 1PQ4A 1SY7A 2H52A 4YCLA 3O94A 4MGEA 1KAMA 4QHYA 3B89A 4P6VF 3A7DA 3PDIA 2I22A 3D5EA 3E1SA 3MLBA 1HTTA 2QPAA 3HS3A 2WTBA 4E3WA 3NGXA 4CDNA 2ZM5A 1DLIA 1F5SA 2EX1A 5FORA 5TLSA 4QFMA 1EUQA 2CSUA 1OH6A 1M74A 1V11B 2EU8A 3ORYA 2WWXA 2VXCA 3Q2IA 3UKDA 3L7JA 5DHUA 5H16A 1MW8X 2VSFA 1Z0KA 2JI8A 3BHNA 1PDVA 3W6UA 3WLHA 10MHA 3AUAA 4E07A 1FFAA 2ZT6A 2AD1A 1QLJA 1YB1A 3GEPA 4UBKA 3WICA 3F8WA 4DAEA 5C37A 1RYYA 1UZLA 2FZ4A 2JFUA 2O52A 1XU9A 3MAJA 5LQDA 1RLUA 3WQSB 2CLLB 4N1AA 1MQSA 1TA9A 3QWBA 4O2BF 2ODWA 3KKZA 1L7AA 1NMYA 4BFVA 4I1IA 3KSUA 3MJTA 4HH3C 1HDEA 3K0CA 1G7SA 4IL5A 2JGJA 3W05A 3GW8A 4M1SA 3AJAA 4G97A 5AM3A 2QRMA 2OKGA 1KYTA 3JATA 2H1RA 3GBPA 3EQ7A 1L7XA 4MV3A 4LW8A 1OIWA 1YBAA 3HPQA 3BJIC 3EF3A 4TSFA 4IEEA 5AFSA 5BV8A 2UYOA 1BMFD 4IH4A 4XFDA 5AK3A 2JAPA 4JGGA 4R9UC 1E3IA 1P9NA 3FB4A 1TCCA 3QE2A 4IQGA 3VR1A 1SZJG 3E3AA 4I7EA 2HXYA 4IJUA 1Q19A 2A0KA 3NYIA 1SHTX 3RIHA 2WZCA 3AVWA 1JLMA 4FFRA 3GB9A 2HNAA 2QI9F 4G0VA 4Q66C 3HUFA 1AHIA 4J8PA 4OQMA 4QICA 1NP6A 2LVBA 5LXTF 5I51A 3TUIC 2X7XA 3V8MA 2V74B 2XE4A 2GN8A 2ZBUA 5AUPB 1KDZA 2PT5A 4QEDA 3K70D 4JLBA 3W6NA 4FZ5A 5F2NA 3UAGA 4KQEA 3SEQA 5MN6A 3VGPA 4G4SP 4IZIA 4JI0B 4A1OA 1BN6A 5JDIA 1Z12A 1L1QA 1GQYA 3B20A 1QHHA 4ZODA 2JLBA 3SOPA 5BN4A 4WXHA 3DP9A 2PX4A 3OTHA 1KETA 5DGTA 5L3RA 4AZSA 4K2AA 3V48A 5CBKA 2HUPA 1FB5A 3FRJA 5M3BA 1W0KA 3C7TA 2ZSAA 2AG1A 2Q0XA 5DHSA 2XCUA 2NP6A 4UUMA 2LUOA 2OFPA 2FEAA 1AKEA 1NJ1A 1KKMA 1UT8A 3FMVA 3H9UA 6ABPA 3QUAA 2D7DA 3OHMA 1L9XA 3OQVA 3AZQA 3GUZA 1Q91A 3ENVA 4YJFA 3G17A 1OZHA 4IUCS 1S2LA 4EL5A 4ZVOA 2X3FA 3P19A 2XSZA 7GPBA 2BEWB 1LW6E 1N57A 1YB2A 3GBSA 3JQDA 3EZ6A 5KTYA 3IEUA 4JXXA 2JH3A 4MVJE 3I72A 2X0NA 4I5FA 5EQJB 1S6YA 2FEOA 3I32A 5AYVA 1Z75A 4FUQA 4IQ0A 2K2WA 4LKRA 5KC9A 2I3AA 1QH1A 2XBUA 2FQQA 1HPLA 4J1TA 5D01A 4O1IA 1ZD3A 1D0VA 2GXAA 1IK6A 1AMUA 3CZPA 3Q8XB 4R8SA 2QLFA 2I2WA 1IZZA 2ODPA 5K8TA 4N5IX 1AB6A 5DNAA 1AKUA 1HI9A 1IY2A 2R5NA 3CLSC 3GC6A 3WFJA 1E58A 2V59A 4F04A 4CV2A 1RRFA 3K5IA 5JO9A 3T1OA 4C2UA 1OAOC 2ODTX 1S7CA 3FFWA 4D92A 2J7PD 3G9QA 2C57A 3QKRB 4H6XA 3AESB 4LZNA 4BRUA 4IKOA 3T3IA 1FL9A 1Z2PX 3E2IA 1R0BA 2IBSA 3A8TA 4RIEA 5I9MA 1SC4A 1AQYA 3CLUD 5CTJA 2FWJA 3I4CA 1T5TA 4OJTA 3ZD8A 3O4HA 1NULA 1WMAA 4KDRA 2FPUA 2JBAA 4MAFA 5JI2E 2RIRA 1LSUA 1KEPA 3P0JA 5JADA 1A9YA 3PX3A 2ZZMA 5KNCA 3WJ2A 4CDRA 4TLLB 2IUUA 1MVOA 3F97A 1HLGA 1J23A 2Q46A 3RRMA 3R9WA 1JKJA 1PL0A 4CCYA 1JBEA 1RD4A 4URWR 2V7QD 2YN0A 2QN2A 1NVMB 1PD0A 5CJJA 5EQTA 4ZQHA 1NIPA 3ZU2A 2NUTB 4GVXA 1A9XA 2QQ0A 2QUIA 3BRCA 4UZSA 3ZCPA 4Z4GA 1P0CA 2YVKA 1XTPA 2QUJA 2MT9A 3WHKA 4NLLA 5ALTA 3EDYA 3T8YA 1WCV1 4MW7A 2I03A 4Y2XA 3ZHCA 1DRVA 2W4IA 5FYDA 1OC2A 3B5EA 1X1TA 1NHWA 5JUWA 1ODSA 4DR2B 1LLDA 4KO1S 1NT2A 1U0EA 1SBTA 1HL3A 1K7XB 1UKVY 2FFJA 3PQ4A 5TPZA 2Q99A 1ZJJA 1U02A 4JT8A 4R7ZA 5J40A 3UMMA 3GI1A 3REGA 3FLBA 3GLRA 4RQUA 3WR5A 4FYXA 2V9PA 1EUDB 2OQVA 2KBFA 1X1QA 4LX8A 4HNUA 2A9OA 1JXQA 1W2GA 1Z38A 2GTHA 1PF7E 3CU5A 3HDGA 4J43A 1ND6A 1O08A 2P11A 5AP9A 2QPLA 4YK7A 4HQLA 3ER8A 2B1GA 1NI4A 1EVJA 1DEAA 1JPJA 3CNBA 3JSXA 3UHJA 3LT2A 3VR3A 1TVMA 5J5AA 3G49A 1KWGA 2RONA 3I6YA 1P29A 4TTAA 4X8HA 5IEBA 2D2EA 3PEEA 5HXAA 4JQSA 4TV8A 1VKHA 1ZCAA 3NIBA 2YY5A 4OXIA 5JE8A 4MHTA 3NYWA 1WCYA 1YZUA 2VNIA 2IHYA 4CWAA 4NAVA 4P54A 1C2YA 1TMOA 2Z9CA 2FP4B 1R00A 3O91A 2XCRB 4JJ7A 5DP1A 1CXZA 1D8AA 1AMNA 4LSMA 3ZLTA 1ZMOA 4JVSB 3EEQA 4GKVA 4RF2A 3H0CA 4RO0A 4QOEA 3KWMA 1VE7A 4QPZA 3D3WA 4UBLA 5BSWA 2QRUA 1T6XA 3TRFA 4CQNA 4BNLA 1I3MA 1G6KA 2YY7A 1WM1A 4H4CA 5FD8A 1Q83A 1VGRA 4LWQA 3SDBA 4D9CA 2P79A 2PX5A 5IBCA 1EWRA 3QBVA 4XYEA 1DG1G 1OGIA 1GGFA 1MTOA 1VDZA 4J7UA 4KKVA 4Q1BA 4HAOA 3ZZTA 5IKEA 2JI6A 2XVXA 2R47A 1WF3A 3K9QO 1WKCA 4DEYA 3I12A 3N75A 1WUJS 1CJSA 3X2FA 1OBFO 3EXHC 1EP1B 2XUGA 2CSXA 3NHAA 4FJ2A 4CR6A 2H2GA 1FFBA 3DLBA 1FP1D 3HCBA 3TQOA 2Z8XA 2VT3A 2BKAA 2ORWA 1XNHA 3FRHA 1RI4A 2QX7A 4LDNA 4HNGA 3VI4B 1S0UA 2PK3A 2VYND 4Q7MB 3ZLUA 3STUA 4B2PA 1DAMA 1MORA 2HLNA 5GY7A 3ZNQA 2QZSA 3SDSA 2PQMA 4ZQGA 3QKSA 2R8ZA 4R8MA 2QG4A 4TWRA 5TX7A 5CD9A 1FDRA 3GDOA 5BW5A 2XTNA 4X6YA 4RHCA 4QBKA 3N5CA 1ZWKA 5EP2A 3RVOA 5FOVA 4NMLA 2IV2X 2XBMA 4PC3A 3T95A 2HA3A 2YIMA 4IIXA 3H9BA 3A9SA 1VBNA 4R05A 2YTZA 3SKVA 4ACBA 3JQBA 1OH5A 1HUQA 1AA6A 1R6XA 1GNLA 2G8LA 2AJBA 1I0LA 2DQ4A 2ZIEA 4GMKA 1BGWA 2R6JA 3AIMA 5H59A 1RXWA 3P9SA 2XVAA 4RA9A 4JI3B 1OC4A 2O0MA 4D9GA 3ZGOA 3TBFA 4BP8A 3N2KA 1B0PA 1KAEA 3OCWA 1W36D 1MAVA 1UKZA 1NQVA 5AI8A 3NKVA 3BSFA 1J5PA 5AKGA 2QEQA 5FUVA 4YUAA 1O95D 2IOHA 2IVFA 1KI2A 1VM6A 1G3MA 3B6KA 3V4RA 2ZSKA 1SXPA 2GXSA 4LJRA 3G5AA 2DKNA 3TO5A 5CYOA 4OI2A 4QODA 4AKEA 4PYJA 4LHZA 3NBFA 3TTUA 2NVOA 3E5HA 3GQBB 4GVPA 3L5OA 3BWBA 4DL9A 2ZI6A 2PKEA 3STWA 5F2KA 3V8EA 3VRHA 1P4SA 1CULC 1W93A 1KDOA 1GHTA 1O54A 1RQ2A 3BXFA 4IVQA 4IM7A 1K0UA 1RLJA 4J4BA 4TKLA 5G53C 3K0HA 2WYOA 3RF6A 3THSA 2AE1A 3ZDCA 3MA0A 5L3VA 1XA4A 1KOFA 1ZGZA 3BMXA 5FADA 2ANBA 2JRLA 3WGMA 4BEBA 2YZNA 3NUGA 1PWXA 2IXBA 4E4YA 1A5TA 1PQPA 2X5NA 4MUYA 4M0PA 3SHVA 3SQNA 3E58A 4EB0A 2F55A 4C76A 2GGSA 3PXAA 2ZPTX 4N9QA 3P0HA 3OAAD 1ILWA 3F9CA 3MELA 3CBGA 1KAQA 2CL0X 1EJBA 3EIUA 4HH4A 3CTPA 4FWIB 4JQZA 3EC2A 2ZAMA 1EQAA 1SQFA 3QIVA 1YZKA 3R4VA 1D4AA 1RRGA 5B1DA 5HFJA 3SYMA 5I48A 4LZAA 1ZZEA 3QY0A 1U7OA 4DM4A 5CLIA 4YXFA 5C51B 1GXSA 1TT5A 3R0QA 4QASA 1KFEB 3D64A 1WU7A 4DZRA 5I9BA 1U3DA 1QGYA 2CW5A 2OLKA 1QGDA 4TWIA 1KEEA 4UNPA 5KBYA 1BIFA 3DAPA 3EUFA 4PM4A 4XB1A 5F2EA 4NCXA 4CFZA 4TSFD 1CTQA 1SVOA 3PWKA 2BSQA 4DY6A 4JLJA 5BWLA 1AUXA 5HJ7A 3Q40A 2J59A 2M6RA 2VR1A 1ZR4A 1CF2O 5AXAA 3HK2A 3DDWA 4M3NA 2ZCUA 4ONEA 4YQZA 5HTKA 4A0GA 4PG7A 3O3CA 1OI4A 1G66A 1VXRA 1P62B 3PXBA 3H5OA 3RQIA 4RTPA 1M66A 1OGYA 4S24A 5JJKA 3FOEC 3AB3A 4W5HA 5A1TA 4QXAA 2GXQA 3DG9A 5IF9A 4D9KA 2VJDA 5COAA 2Z98A 1B6SA 1GQQA 1GLGA 4ZEOA 3GJYA 1SWWA 3BWVA 3F0TA 3MF4A 1TW3A 4NPHA 2H6EA 4BATA 1N2OA 4BS9A 3QU7A 5IKOA 3SPXA 4KG7A 4DDTA 1GA1A 1L7EA 3HDVA 1O5IA 1PX2A 2HWXA 3K05A 2JZCA 4V3CA 1Z0IA 1Z6XA 1FUIA 1U1FA 4YY3B 1DQPA 2G5CA 2HN9A 3WMWA 1M1NB 2V1UA 3IV7A 3DVAB 3MJEA 4DF3A 2FPXA 2V7TA 5I9TA 3PWTA 2FF7A 3AW9A 4AU1A 3T3HA 1V4NA 2BD0A 3MXOA 1GFIA 2DGDA 2ZETA 5FBWB 4F9TA 1D2EA 1W0KD 3DAFA 3PSHA 3T7TA 2B8EA 1WHTA 4KWTA 5C4MA 1BQ3A 4OLHA 3UATA 1E5XA 1CK4A 3JQ6A 4N0EA 1C3OB 2EJWA 1P2GA 3RT9A 4RV4A 1FDUA 1JVNA 1VE9A 2WPDA 3D4PA 1QXSA 5FA6A 3RJMA 3T61A 5JAOA 2XSZD 2MSEB 2XT0A 1JR6A 2DU8A 5AOCA 2IYQA 4GPIB 4BNVA 3P4XA 1WSWA 3ND7A 4EEKA 2ZU0C 3ZYCA 5DYYA 4EYKA 3E23A 5JZOA 4TT3D 2VOJA 3MWDB 2CL6X 1RFLA 4PYQA 4UEJA 2YWGA 2VJBA 3AFHA 1PYDA 2YJZA 2ZSDA 1QS0A 2ZYUX 3DLTA 5AH0A 3OUZA 1FUUA 1TD1A 2OKCA 3S4YA 2QQEA 1UXHA 4ER0A 3O1IC 4LYFA 2P41A 4P2GA 5REQA 1NN5A 4P22A 3WP0A 4ZZ3A 4FB5A 4PYLA 3QXXA 4OFZA 1XELA 2ATCA 2Z0MA 2C0CA 4TL9A 1GN8A 5TS3A 3KXKA 2ETVA 2J0VA 2GHQA 5C7OO 5BSRA 5JAHA 3AVXA 1JHDA 1G5QA 3FCEA 3H1EA 3WRYC 1XUOA 2LPMA 1H0SA 4YMGA 2M32A 3JWIA 1I2BA 5LQKA 4PYIA 1J8MF 1JIQA 2VBGA 5SYNA 4OXYA 3SX0A 2J6HA 2I6FA 3ZV5A 4AX4A 3V8RA 3RASA 5FOQA 3DE4X 4ZAVA 3RVNA 4HGPA 2C20A 4E7OA 4DILA 4AT1A 2VDNB 1FZQA 4B5KA 4DMRA 1YR1A 3FYUB 5I9IA 2A58A 2CFTA 1JX6A 5SZHB 4H7DA 4WECA 5DTRA 3PT9A 2GFHA 3AF3A 1G4UR 4GC5A 2IJGX 1IDN1 3NH9A 1Y1PA 1ZW1A 2QMYA 2D7CA 3CWCA 1Q0SA 2AUMA 4B74A 4W9MC 2YXLA 4OYYA 2F17A 2GCOA 2UUOA 4KWIA 4MW0A 5LCXA 4KV7A 4JFRA 3KT8A 2AN3A 2G0AA 3K8ZA 3GMTA 3QW2A 1TU4A 2ID7A 1ONSA 3BMQB 4UBOA 1KU6A 3OJOA 4MDEA 2C2YA 4B1FA 2HLHA 3C24A 2FVYA 3ZVRA 1NDUA 2ID8A 4PS0A 3KPJA 4DIUA 1ZNXA 1GRRA 2JD2A 3N0TA 5IBRA 4ETNA 1LDYA 2VTEA 2PKRA 4L4ZA 1R3DA 2X5JO 5TPZD 2HFJA 3CR8A 2SCUB 1JU4A 2PL3A 3O1JC 1KMMA 3TXAA 4ZYTA 4EYEA 1JDSA 3OSUA 3PV0A 4MRVA 4RJJA 4D8TA 4CF7A 1L0BA 5AW4A 2OCDA 3IRUA 3TR6A 3B52X 2I3ZA 4UNRA 1HMPA 1XU4A 4P4NA 1DAEA 1ECCA 3JQCA 4PGMA 1P2DA 1CUHA 3C7KA 3V8NA 1TFUA 2O6LA 2X4LA 1YU6A 1U0OC 1WUYA 5HKBA 4DN6A 4A73A 3VR3D 3EY9A 5BNZA 1E2PA 1MO5A 3D6JA 5K01A 1VFNA 2IVZA 3AI7A 3TB6A 3F9RA 5FBRB 3K16A 4PANA 3ANYB 4HDQB 1T1GA 1UWKA 2R7LA 4WLFA 1R6AA 1VOTA 1Y80A 3EVTA 2WUWE 4Y6GB 3ZQJA 1T2CA 4UU0A 4YC7A 1WQ4A 1VIAA 1KAOA 4TWBA 3AFOA 1E2LA 1RLOA 3D7SA 3T7KA 4W5QA 1FMJA 3GVPA 4QXPA 3R7AA 4E14A 1QO0A 2C92A 1JRLA 1G17A 4NJMB 3WK7A 4JYZA 1YK0A 1OF1A 2QNBA 2GS9A 2WDPA 1ZRHA 2O3UA 2RCYA 3JASA 1PT9A 2B94A 3EASA 4IV8A 4P4LA 3G0IA 4L6AA 1PI3A 1REQA 4NE2A 3EHEA 1NBOA 3LRXA 2NVUB 4NYMR 4LKOA 5BOSB 2FHSA 2WM9B 4MRMA 5B5SA 4XX1A 3SLGA 3A4NA 3AG6A 1U11A 5EMKA 4INJA 4U6SA 2G7MC 4MPDA 3DV2A 4ACAA 5LDGA 1QFYA 1Z2CA 4JLAA 4LJLA 2XB6A 3A9VA 4G9EA 4DV2B 1A27A 2B3TA 3GUYA 1GZ6A 4V0MA 5DHTA 5KOHB 4EAAA 2RHRA 1R0SA 4D6XA 2BW0A 3B36A 2PKYX 3IHTA 4PHTA 5L7WA 5JHHB 4UHFA 4BRZA 1AUQA 4YRGA 1DBWA 4EJSC 1KVQA 4HUJA 3WNBA 2UXDB 1C4KA 5EJ9A 2NZXA 4EG3A 5CB0A 1GG9A 1MO6A 3ENKA 1ISSA 2O2YA 2OGTA 5K05A 1IATA 2QK4A 4URYR 1QIDA 1XK7A 3NTXA 3TRIA 2GASA 3V4LA 4D02A 1FVXA 2FUNB 2X4DA 1VCNA 3UENA 3UPDA 2WYHA 4LZPA 5ALUA 5IASA 1A2KC 2HOQA 4H1VA 5GGYA 1JEQA 1P0QA 3V00A 1FVOA 3B1FA 3EGDB 4I19A 4L07A 3H5VA 4BB5A 3A1CA 3TLKA 5BWOA 4PG4A 3SKXA 3U1BA 3EEFA 5TT0A 4XX0B 3A06A 4U7DA 3H8WA 1G3UA 1YQWA 1SXJC 2EKPA 3OX1A 4QQRA 5C5DA 3GEMA 1P0MA 1CBUA 3CKLA 3VDQA 4PGGA 4UUNA 5KMGA 3GFQA 2GKOA 1T6BY 3N8KA 4K2HA 3UUGA 4EKEA 3Q3HA 2QZ4A 1QHIA 4JENA 1U80A 3RS2A 2R96A 2XNDA 5DWVA 3LG2A 2A8YA 1PGNA 1UXJA 1BQEA 4BKRA 1DIGA 4Q39A 2Q3HA 1K7FB 1T9BA 3IJRA 4EA9A 1Y7IA 2X5KO 2G83A 1SA0A 3CUUA 3LXUX 3NYRA 3OKFA 4MUBA 3TG8A 1Z2AA 3JQ9A 1L7RA 3KELA 3C48A 4ZAXA 4ZTBA 3C5CA 3GCGA 4ZCPA 1I4OA 2VHJA 3DW1X 3UJ8A 3DYIA 1GZ3A 1P3JA 2UZ0A 4BQQA 4H7PA 1N0UA 2GWHA 2R97A 2QTCA 1RKBA 3I8SA 1A7AA 3PQFA 5THXA 4DUGD 1UAAA 4OYRA 1L7PA 3RYIB 2C2BA 1JJBA 4WK4B 1VPTA 4GLBA 3B2EA 4GT1A 4N6GA 3VISA 4B6EA 1CVRA 1V7ZA 1AKYA 4O29A 4J0EA 4PWYA 2QYTA 5K6AA 2F4NA 4GX5A 2MSDB 1JAXA 2NZYA 3AKCA 3AY6A 3NDPA 3GH1A 2PH5A 5EUBA 1KHHA 4RVUA 4RDXA 6NULA 2W2LA 2KMLA 1E32A 3ZZNA 4OHOA 1FOEB 1P9LA 2VDJA 5KKNB 1EIWA 1YVEI 2ZFUA 4N3AA 4TV8F 5EEGA 3A2NA 1BXRA 4BQRA 2OD7A 3OIUA 2ZJ1A 4E3ZA 3SZMA 4E1VA 3G68A 3A2KA 3DE6X 3NPAA 5BSFA 1QBGA 3V6LA 1NNI1 3GT7A 4K7JA 3MS4A 2G82A 2I7XA 3CEAA 4HLQB 3LPLA 1XKTA 3E7PA 4YCNA 4DOMA 4KIGA 3Q9LA 1MB3A 2J3DA 3PHJA 5FBQB 3ASVA 2NGRA 1G9TA 2DWOA 4B4DA 1ONPA 1QNLA 1XC7A 4YRPA