4CMEC

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 91
structure length 249
sequence length 267
chains with identical sequence D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmeC00
1PL8A 3DZFA 3LU1A 4OL9A 3V1UA 4CODB 2VNSA 4CLOA 4J6FA 1YKFA 1YQDA 1N92A 2GZ1A 3E9QA 3OIDA 2GCGA 3I1JA 4CL8A 1JVSA 1NTOA 2QX7A 1M2WA 1D3AA 1ZIDA 3JSAA 5F1PA 4Z0TA 5TJ9A 1QYXA 3K5PA 4RCVA 3EW7A 3OJ0A 4Q3DA 4B3JA 4JROA 3PQEA 1HYGA 1PR3A 4YJFA 5B4VA 1PZGA 1Y1PA 1IB6A 1CIVA 1NQ5A 4ZD6A 3QWIA 3F1LA 1HYHA 3STHA 2R00C 5B37A 1EE9A 2VT2A 1DOHA 1JAYA 4O5OA 4ZGWA 1ARZA 5C7OO 3Q6IA 5IZCC 5TNXA 1BXKA 4CV1A 3OF2A 2DM6A 2JCXA 1I2ZA 2VZ9A 4RVUA 1PU2A 2HUNA 1GPDG 2OORA 2UUPA 3WLFA 3QWBA 1FDSA 1GV0A 4DPKA 4Q3NA 3JYOA 5CPBA 3TFQA 1YRLA 5DZSA 2C2YA 4OAQA 4OYRA 2GERA 2B0JA 2FZEA 4DIOA 4Y67A 1QLJA 1NPTO 1HTBA 2DFDA 2JD0A 1LI4A 5EMHA 4CJXA 3ABIA 1ZZEA 3TNLA 2Z1MA 1HE5A 1N1GA 2PD4A 1GTMA 1YB4A 1C1XA 3QY9A 2W2LD 2QRLA 2JL1A 4RQTA 1LSSA 5B4UA 4YRAA 3VAZA 1GUFA 4G65A 3B6ZA 4NFHA 1JWBB 3H9QA 3KUXA 4NK4A 5TRTA 3NDIA 4ID9A 3ZN2A 1TXGA 4XYEA 3IUSA 1GYRA 3NUGA 3IUPA 3PWKA 3VPXA 1WMAA 1WDKA 2PA3A 2D59A 5DULA 5MGBA 1R0SA 5JS6A 4I5FA 5TQVA 4L76A 4PG4A 3HN2A 3O38A 1KEVA 1H5QA 3QVOA 4J4BA 1RWBA 1I01A 2HMUA 2W8ZA 2W2KA 3ZV3A 3AWDA 5ENVA 3TQHA 2OL4A 3LT1A 3PJEA 4CMEA 4E3ZA 3GRPA 1H9BA 1IUKA 1UDAA 3BMQA 5EL0A 2DPHA 4XZ3A 3V8BA 4MVJG 5CHEA 3RBXA 1PGQA 4RLSA 1HSOA 4PG5A 1UDBA 5C37A 3QIVA 2PGJA 1PGOA 4PLCA 2VWHA 1R4NA 2YHUA 2HK7A 4J7CA 3VPSA 4P8RA 1LDNA 4ILKA 3ZDFA 4URFA 3WYCA 2GSDA 8ADHA 3ICPA 1MG5A 3K9QO 3GUYA 2DTDA 4CMAA 3JQAB 3KHUA 2DBVO 3IKTA 4NBTA 2OOSA 4QSMA 1R0KA 1PTJA 4JXKA 1VE9A 1LDEA 5L3ZA 5HWSA 4IQ0A 1U8FO 1GD1O 3LC2O 4E21A 3WS7A 3JD4A 3ANNA 3HDHA 4OQYA 1DC3A 1P0CA 4R41A 2IODA 4BKRA 4XYGA 1T2FA 5GZ1A 5B12A 4ZICA 4II3A 3C1TA 8LDHA 1LTHR 4WE3A 2ZIZA 4J4TA 2Q2WA 3H5RA 3PLNA 1R6DA 3LF2A 3LQFA 5IN5A 1ONNA 2IZZA 1JQBA 3W8DA 3AUUA 4H15A 2H63A 2H9IA 1FDUA 1VKNA 1WP4A 4NG5A 4TSKA 4F45A 1PS9A 3C7CB 4TVOA 1XIVA 1H6DA 2QZ9A 1H2BA 3AUAA 3LVFO 3SJ7A 3CH6A 3MWEB 1KBZA 1CQIA 3GPIA 1YWGO 4NBUA 4YEDA 1F14A 3UXYA 1K89A 2A4KA 1BVRA 3WGOA 1SPXA 5GMOA 1YQGA 3ZH2A 3IKVA 2X1HA 2PWZA 1K6IA 4Z6KA 3I4CA 3H3JA 5IF3A 1QKIA 4BKOA 2YQ4A 5A9SA 1DFHA 4LMRA 4U5QA 3W8FA 3AI1A 2HDHA 3K2BA 3GGPA 4PLYA 1A4UA 3ZGYA 4BUCA 4IDGA 4E6PA 3ETGA 3L0DA 1PZFA 4HY3A 1OFGA 4AJJA 1UP7A 3UOGA 2PKQO 3V2HA 1ISMA 2Q4BA 2ZCUA 2Y05A 2FSVA 2P5UA 3DC2A 3DWFA 1VI2A 1Y8QB 4ZVVA 5K9ZA 4Z9FA 3GQVA 4WLVA 3OEWA 4KQXA 4BS9A 1YDWA 3CE6A 3B1FA 3MJEA 4U0JA 3JQGA 3X2FA 1XCBA 3PGJA 5F3RA 3KLMX 3WNVA 2B83A 3DEYX 4PLZA 5ILGA 2CVQA 4KWHA 2OUIA 1YJ8A 3AM5A 2O3UA 4QECA 4D3FA 1Z75A 4I5DA 1Z7BA 3BTOA 3ASVA 5KKCA 3RJ5A 3JYPA 4HV4A 1NQOA 1I33A 4L0QA 2IDZA 1AN9A 1T4DA 3JQ8B 4GLLA 3PPIA 5COQA 1O6ZA 3BTSA 3UHAA 2AMFA 2O4CA 1Y7TA 2UV8A 5CPFA 4HFMA 3WIEA 4IQ8A 1HE3A 1U28A 2XAAA 3GK3A 1M6HA 4O6VA 1JKIA 4XGIA 5G4KA 5LDGA 1U1IA 2D0IA 4K6FA 1E6EA 3U4IA 1CJCA 5BR7A 4RF2A 1GCUA 1I36A 3NGLA 5TS3A 5IDQA 2BFOA 1NHWA 4OKIA 3RKUA 4KMSA 4ROSA 1Q7CA 3Q9NA 1O0SA 1WPQA 2IRWA 2P9GA 3WQRA 1YBVA 3P19A 2BD0A 1PSDA 4Z3DA 1ZMOA 1PQUA 1B15A 3R0IA 2V6GA 3TZQA 2Y1FA 4XQCA 1IPFA 3VTFA 4E13A 3KYCB 2HLPA 3OJFA 3PHHA 3ROMA 4BB6A 2DVMA 2CVOA 2HKIA 4DLBA 1O5IA 1LLQA 5JDIC 5DF1A 3INTA 2WYWA 4MDHA 1T24A 3UF0A 3GY0A 1ULUA 4GSKA 2P9CA 2B69A 3P5SA 5DOVA 3TPCA 2BRUA 4DIFA 1IPEA 3Q11A 1KOLA 3SX2A 4DLAA 3R1IA 5TLSA 4AFNA 3UCXA 4RZHA 4HFNA 3RROA 1RYDA 4N18A 3WR5A 1JA9A 3MOGA 2FN7A 1IZ0A 1YOVB 3ZV5A 1K2WA 1LNQA 3GAFA 3EZYA 4E4YA 4A2CA 1E3IA 3WQQA 5FYDA 4R5HA 4OM8A 1B14A 1LDYA 3G0OA 4AG3A 2UYYA 4Y9DA 3RVDA 2J3KA 2GUGA 4IXTA 4R69A 3I6IA 5G0TA 3HSKA 3TOZA 3GVXA 3MTGA 4AJ4A 2Y68A 3AFMA 1R37A 2RHCA 5EERA 5L40A 2HJSA 4XA8A 3VKUA 1ZK0A 4PRLA 4ND4A 3CINA 3K96A 4MKZA 5L7TA 1VLLA 3TJRA 5T8KC 3ZWMA 1O89A 3AU8A 1DAPA 1HDYA 3I4FA 4AJKA 1SOVA 2PZJA 3UUWA 1PJ4A 3AW9A 4OJNA 1KVSA 2NU7A 1E5LA 4AJEA 1C1DA 1XU9A 4S3MA 1SB9A 5DBIA 4KWIA 3JTMA 3PTZA 3AOEC 4HFJA 4R4JA 2XXBA 4KUEA 4JIGA 3AI2A 5T67A 4NH4A 2FWMX 3TDKA 3OJLA 4IJKA 3E8XA 1IE3A 4UVEA 4BB5A 1X1EA 2ZTVA 4CR6A 3ICCA 4MKRA 3E9MA 3COSA 1U9JA 5CFZA 4UEOA 4KP7A 3PGXA 1A72A 1LQUA 1V9LA 4ZRNA 3PDJA 3M2TA 5A03A 1MV8A 2RCYA 2QYTA 2P68A 3RQSA 5F5NA 1XGKA 3H2SA 1U5AA 4IIUA 1H6CA 3FRJA 2VCYA 3I9KA 2VRBA 3GGGA 5JE8A 5JBIA 3GHYA 4MKXA 5FI3A 2X9GA 3DQPA 1R0LA 5G0WA 2GRAA 1NVMB 1BRMA 3B1JA 4IJVA 1NHGA 3IIEA 1XDWA 3FPCA 4XGKA 4D46A 4EGFA 4F46A 3NT4A 4BHTA 3MTJA 3F4LA 2E82A 3PQFA 5IDYA 1E6WA 1H6BA 2DLDA 3B20A 5JCJA 5KIAA 3PRJA 4QO7A 4NU6A 1UR5A 1I2CA 2A92A 5TIIA 4U8GA 3AI3A 1CERA 2DPGA 3D4PA 3PYXA 1DFGA 1JWAB 3F9IA 2J3HA 3OJEA 3DFUA 1LSJA 1V6AA 4MIEA 1C0PA 4DXHA 3DZHA 4N5MA 3WTBA 3T4XA 1MUUA 4A5OA 4IJWA 1ZNQO 1A9ZA 4D41A 2AXQA 4BVAA 4R5MA 1PQPA 3UCFA 4FIZA 4FQ8A 1ENPA 2B36A 1HRDA 3IJRA 4BO7A 3ZI0A 1ZUD1 2CVZA 4Q3AA 5KWEA 3OECA 2GN4A 4J4HA 2AEFA 3AJRA 3EC7A 3JYNA 4I9HA 2B35A 3ONDA 5FI5A 5K6AC 4JQCA 4L9RA 4R01A 3ZNQA 4QO8A 4AJOA 1U4OA 3IS3A 4Y6PA 1P74A 2NSDA 2C82A 1K6JA 1GCOA 1DJNA 4BKUA 2Q99A 4NI5A 1U8XX 5IN4A 2GLXA 1L1FA 2JCYA 3MEQA 1E7WA 3OHSX 2HO5A 2QYSA 4WLFA 3NTQA 3GMSA 1HSZA 5A5EA 2Q49A 3R3SA 1NP3A 2BFMA 4NJMB 4HKTA 4B3HA 3LYLA 1H93A 1A71A 1AHIA 4PLVA 1XELA 3U49A 4E2WA 2YV2A 1C3VA 3FN4A 3VZRA 1HZJA 3JCZA 4GLOA 4KTVE 4YDRA 2PV7A 4ONEA 5EQDA 4CM3A 1RM3A 3F1KA 4E0BA 3AOEA 5BNIA 4D3DA 1A7AA 3O8QB 2X0NA 2BI7A 4BNHA 6ADHA 4KQWA 4RJTA 3KYBA 4WCFC 4WGGA 5CG1A 3GNQA 2PGLA 5L53A 1O8CA 2QZZA 3T7CA 1ADBA 3A1NA 1XKQA 1AXGA 4YA6A 2BGMA 1DLIA 1WZEA 1LRJA 3A14A 3F4BA 4LN1A 1PX0A 3IAHA 3KEOA 1QXSA 1GAEO 4UEKA 1HDXA 2R00A 1P1RA 3OM9A 3VH1A 4XKJA 2Y66A 3OFSA 1UXIA 2ILTA 4IDCA 4DYVA 2X0RA 3I5MA 1R66A 2GO1A 2YY7A 5HA5A 4J1SA 3V1TC 5KJ6A 5U1PA 3U4CA 4ESOA 3H2ZA 4BNKA 1U2GA 1OZAA 1CETA 4J91A 1N9GA 4Q3EA 4MVJA 1P3DA 2PZMA 3TL3A 5C5IA 4YAIA 5IXYA 3NT2A 3F5SA 5C7IO 2O3SA 4OO3A 3ZU2A 3T4EA 4EW6A 1X15A 4KOAA 4LMPA 4BNYA 1DRUA 2GYYA 5BNFA 1Q2XA 1P1FA 3NKLA 4BO3A 5B4TA 1HDGO 1I0ZA 2Q46A 2VHVA 3H65A 4JJGA 5G0UA 2O2YA 4OQZA 1GQ2A 2UDPA 3LT4A 2FPPA 3RJ9A 1Y8RA 4IUYA 4ND3A 5BQFA 1UZMA 4OXKA 5ENDA 1HT0A 3GFBA 3JQDA 1QYDA 2FY8A 1KETA 1BDBA 2X9NA 4I5GA 1ADCA 1AGNA 1Z73A 1NQAO 3GF4A 1H6AA 3H9UA 2CSUA 4Q3BA 2NQTA 1ZVMA 4FBGA 4BNGA 2ZJ0A 3ADOA 4YXFA 3ITKA 3GNSA 4TMFA 5CDGA 5EN4A 1N2SA 2HRZA 4CLRA 2BI8A 3JQ6A 4XEHA 4YQZA 2FR1A 4DQUA 3O03A 3I9OA 3SXPA 3E03A 4GKVA 5JO9A 3VPFA 4AJNA 6LDHA 3RUFA 3WWYA 4IS3A 1OOEA 2VHZA 5ICMA 4NIMA 4J49A 2JHGA 4O63O 1D8AA 4YT5A 4BO8A 1C0IA 1ADFA 5H81A 4PLHA 4YPOA 3C85A 4GWGA 5L7WA 4AJ2A 1L7EA 4ALNA 1MFZA 2BELA 5EIOA 2XXJA 5CEJA 2EP7A 4TRJA 4WCDA 3WLEA 2CDBA 4CLXA 2GR9A 3D3EA 7MDHA 4XRRA 3FR7A 2B4QA 5EQFA 3V2UA 1UXGA 3KETA 2JFFA 2DC1A 2H5LA 3OQBA 4A03A 4WCFA 3ULKA 4DL9A 2DFVA 4TWRA 3N74A 4FFLA 4MP3A 4PG6A 4A10A 2BH9A 4RORA 2C5AA 4PLWA 4YJFB 2BHLA 3IL2A 1ZCJA 3VZSA 4A0SA 2W90A 4M8SA 5KJEA 4CM1A 1P33A 1B26A 3WFJA 1E1NA 2SCUA 3RUDA 3RAJA 3FBGA 3BZUA 2QW8A 3K8ZA 2EKQA 3VC7A 1CEQA 3S1LA 2GN8A 3WBFA 4EUEA 5HRUA 2PKRA 3LC7O 4RL6A 1GDHA 2AEMA 4WLOA 1S7CA 2WEKA 3VKVA 5L4SA 3AFNA 3I9LA 2H1SA 1HWYA 1GU7A 5IDXA 4LCEA 4TKLA 3WSVA 3BHMA 2RIRA 1C0LA 2G76A 3RD5A 3UCEA 3EVNA 2NU8A 4PLPA 1WVGA 4ZQEA 1DEHA 5G4KB 3H9GA 3MJCA 1NASA 3CXRA 2FPIA 4R3NA 5C7LO 1N7GA 4O0LA 3L9WA 3HE3A 1ONPA 1V3UA 1NVGA 4YBZA 4JLWA 4OHUA 2V65A 4PRKA 4E5NA 3JQFC 5JCXA 5L45A 1LDBA 2W4QA 4MVJE 4D44A 4WLNA 4W4TA 3NGXA 1BW9A 4RO0A 1TT5B 1I32A 3KOUA 3KZVA 3QP9A 4W9NC 5ER6A 1E3SA 4XYBA 1ISJA 1LXCA 2VT3A 3GVIA 3R6DA 4TVBA 2RH4A 4RPLA 1JVBA 3U9LA 3TFOA 5COBA 1YL6A 3SVTA 2EKLA 5JC1A 4DGSA 4WEQA 3EHEA 4HUJA 1T4BA 1EMDA 1PJCA 3UICA 3ZV6A 3ZWAA 1ZJZA 2W2KB 3JQEA 2HAEA 4CPDA 3QV1A 2Y93A 3PQDA 3WGHA 1U3TA 4B3IA 3T7EA 2NM0A 4TRNA 4D0SA 3K73O 1IZ9A 3GVHA 3DBVO 1Q1NA 3FD8A 1YBMA 3VHRA 1FDTA 1IHXA 1PJ2A 2ZTUA 3CPSA 2DBRA 3ZHYA 1QSGA 1EFKA 2G5CA 4FPXA 1ENZA 3UFXA 3E48A 4FDAA 4OXYA 3W6UA 1VL6A 5HS6A 1DXYA 3QSGA 3TZKA 2OFPA 4CLEA 3L4BC 4YAKA 2Y0DA 1IL0A 1ZO8A 3FI9A 4RZIA 5IG2A 3N7UA 3ANMA 2A35A 3BIOA 1HZZA 1BG6A 1DC6A 3MJ4A 1H2HA 3AM4A 3NDRA 1D1SA 4Y6RA 3FSRA 4J3FA 4JN6B 4IJUA 1V3VA 1KC3A 3W4KA 3IP3A 1N1EA 2B37A 3HZZA 3EDMA 1PJQA 3I3OA 3QHAA 5K6AA 4HFRA 1Y81A 1JDJA 1CDOA 2OBNA 3NX4A 2NNLD 5HS4A 4BO2A 4NQZA 1U7TA 1Y6JA 2WM3A 4BIIA 2FPGA 4QUKA 3SC6A 4CV3A 2PH3A 1UZNA 2YDYA 1KERA 1E5QA 1IHYA 2XF8A 5A1TA 2YZ7A 4M86A 3O26A 1BDMA 2HRBA 2Z95A 1X14A 2VWPA 2YUTA 4QXMA 3CUKA 4DYDA 1SB8A 1OAAA 3PEFA 4BMVA 1U4SA 3GEGA 1UP4A 3FCOA 4ZU3A 4MVJP 1HETA 2Y67A 1GEGA 3RWBA 3MWDB 2ZQZA 5I9MA 4D0RA 4Y8VA 4KTTE 3W4IA 4KUHA 4XCVA 3DAFA 4RVHA 5BNTA 3U3XA 4NFYA 1WW8A 2ZTLA 1LLCA 3QJ5A 2PK3A 4CQMD 3D7LA 2BGLA 3EVTA 1EUZA 4B7UA 1PJTA 3PFFA 2O48X 4CL3A 1EVZA 5KTKA 4MO2A 3HNPA 4BNIA 1HXHA 1LEHA 1B8PA 1RM0A 4YACA 5IFLA 1PS8A 1P45A 3F47A 1DSSG 5TT1A 1PJBA 3WOHA 3VH2A 3L4SO 4B79A 3KSZO 4RDHA 4M1QA 1Z7EA 2Z1NA 4KZPA 1HYEA 2I76A 1NQTA 3PJGA 5U4QA 3WGGA 4CR7A 3JQ7B 1ZKMA 3IP1A 2DTXA 1IYZA 1FJHA 3B70A 3OA0A 1HE2A 3TZCA 4BNTA 3PLRA 3HFSA 1A27A 3RFTA 3U0BA 2BFAA 3ZHXA 3BXXA 4FGSA 3PDUA 5LCXA 3ZW8A 2WD7B 4IDBA 4OMUA 3HJAA 3O9ZA 4CUKA 1K3TA 1VL8A 5IAAA 5JAIA 1CF2O 2X8LA 1Y5MA 1VL0A 2YFHA 1X0VA 1P9LA 4CM9D 5ICSA 2HQ1A 5G4LA 4LGVA 2OXIA 1E3EA 4Z9YA 3ZWBA 1VRWA 3L6EA 4B8WA 3GVCA 4RF3A 3OIGA 4KDEA 2I3AA 1RYEA 4JBHA 4GH5A 4JNKA 4WLEA 4E2ZA 2VYNA 4H3VA 4ZRMA 1NPDA 2VTDA 3GUCA 3G79A 3BTUA 3HN7A 2AE2A 4BNFA 2WDZA 1ZK2A 3CZMA 2I67A 3G3EA 2DAPA 3KLPX 3TSCA 4D3SA 3O8QA 4BNVA 3BMOB 1NWHA 4EEXA 1WMBA 2YV3A 1ZXBA 4NHEA 1YS4A 2GD1O 2IE0A 3MJSA 2VYND 4W7HA 3C1OA 4E5KA 5AQ1A 3RC1A 2OZPA 2V7PA 1DIAA 4GPD1 4XDZA 4O59O 3ZNOA 5JAMA 2CFCA 3DZGA 3ZZNA 3EAGA 3EK2A 4GI2A 5A3VA 4BQRA 5KJFA 4FC7A 1Z82A 5A9RA 4MP8A 3RFVA 3K30A 5CEFA 5KJ1A 1YOVA 5THKA 3ZWYA 4XYLA 3ENKA 3WX0A 1J5PA 2NVUB 5JMPA 3U62A 3KTDA 4RPKA 1CQJA 4YT8A 1YDEA 3DBRA 1PJSA 3CTMA 2NQ8A 4Q39A 3RBZA 5I9NA 3FHLA 1NFFA 4CMBA 4BNLA 3PIDA 1U3UA 3CIFA 4NBVA 4CM5A 4BO0A 4NMHA 2Y1CA 2WTBA 1Q0QA 1QV6A 2EWMA 4J7XA 4PCVA 4U6QA 2DBZA 4GMGA 4NJMA 4UUOA 4GGPA 1ZSVA 2VHWA 1MC5A 1EEHA 1W6UA 3BMQB 4ND5A 4F6LA 3D0OA 4J2OA 3BHJA 1GYPA 4KDFA 5CDUA 4P4GA 4JGBA 3VH4A 1NWCA 1QV7A 4IINA 3RIHA 3Q3CA 1XU7A 3UVEA 1R4NB 4BMSA 1MLDA 2J5KA 2YJZA 3GZNB 3IOYA 1F8FA 2UAGA 5TSDA 1R16A 4IGEA 3GT0A 4BV9A 3QLJA 2E6UX 3DMTA 4I8XA 3C3XA 1OI7A 3BHIA 3ZNNA 4CM4A 2RH8A 3C7DB 1FMCA 4K28A 1O9BA 3Q9UA 2TMGA 2EF1A 2ZB8A 5A06A 4PLGA 1X1TA 5DDIP 2VUTA 3PYLA 4IZHA 5KVVA 1Q0LA 3TL2A 3D3WB 3KSUA 2J5QA 4L4SA 2NU6A 1E7MA 3L6DA 5FF9A 5AXAA 3WXBA 1EVJA 3G1UA 1EUCA 3AY7A 3FTPA 4XB2A 3L6OO 3N58A 4UUPA 5G2OA 1D4FA 1K0UA 1GV1A 1SNYA 2X23A 3JQFA 4OSPA 3TWOA 3I52A 3WDSA 1ZJYA 2C7GA 2IZ0A 3DL2A 3M1AA 4ND1A 4EEZA 2PKQP 4CMHA 2GNAA 1E1LA 2Q4EA 3ZHZA 3SBOA 4ALLA 2X7HA 2HK9A 2O3QA 2Y1EA 4MJLA 1Y8RB 4BOYA 2JD2A 3W1VA 2VRCA 1ZSYA 4AJHA 2B4RO 5JY6A 1G0NA 2DT5A 3K2EA 1PL7A 4QT0A 5T5QA 4CQLB 2PH5A 3CSDA 4A26A 4BO4A 2NU9A 5JAZA 3WWZA 1LC3A 1I3MA 2V6FA 3C24A 4G5HA 1Z74A 4NR0A 5T57A 3S8MA 5A9SB 1PQWA 1GY8A 3TOXA 1YE3A 1I3NA 1A4IA 4RLHA 1ZEMA 2I99A 4DMLA 4GAEA 1XHLA 3ZHBA 3ZU4A 4BNZA 1NXQA 5IXSA 2GF2A 2HMVA 4WNIA 2YFQA 3RI3A 1M75A 3EZLA 2EV9A 1P1KA 4LVUA 4RPJA 1PJ3A 2NVBA 1UUFA 1D7OA 4YRBA 2ZB4A 2EKPA 3VVBA 4I9NA 1CYDA 1DC4A 1U5CA 4P4LA 1AXEA 1E7YA 1ZMTA 1E7RA 3PJFA 3JQGB 4PZDA 4NBRA 1I24A 4FFNA 3WYEA 4DQXA 4E33A 3WFIA 3ONFA 3VPHA 3DR3A 3GVPA 3QRWA 2EHDA 3GG9A 3WNQA 4H7PA 4CMGA 1GEEA 1J4AA 2XOXA 4NU5A 4B4OA 5GZ3A 2HCTA 3AOGA 3KM0A 3ETDA 2DKNA 4P4NA 3LK7A 4XIYA 4UVIA 4BO5A 1XR3A 2CDCA 1HDRA 3E6AA 4BGVA 3RUAA 1XQ6A 1KVRA 3RASA 1G1AA 2ZTMA 2WE8A 1XG5A 3DBLB 5CEEA 4J9VA 3S55A 2AHRA 2Q1UA 4BGUA 4R51A 2NWQA 4EITA 4GKBA 4Z9XA 2VOJA 5IDWA 5L95A 4FFMA 1DIGA 2GPTA 4XQGA 5JPIA 2PGDA 3FPLA 1B7GO 4YJHA 1DAOA 4FSHA 5JSFA 1T2CA 3V1YA 3G1TA 2AEJA 4IDDA 4YJGB 4CMIB 3DOJA 1I30A 1HLDA 4OOFA 3ZCXA 1Q7BA 2VYVD 4D42A 2D3TA 3H3FA 3LC1O 5L9AA 5THQA 1BXZA 1LA2A 3OICA 1X7GA 3GHHA 3VVCA 5J23A 1U2DA 2YYYA 1LBEA 3GMDA 3CMCO 2DUUA 3QVWA 1ZW1A 2AQHA 1XEAA 5JO0A 3NYWA 3JD0A 3RUEA 2POQX 2IYOA 2J3IA 3NTOA 2V6MA 3DHNA 4S1VA 1KVQA 4B4VA 4RVDA 1JN0A 2CY0A 4MPDA 4RVSA 2CUKA 1I8TA 1ZK3A 5ER9A 4OIMA 4TZKA 2D8AA 3MJVA 3Q2IA 3OEYA 2ZATA 3I9JA 2IEDA 4ZQFA 3FNGA 3QVTA 4L73A 3PFWO 1FK8A 2RBEA 4MP6A 4BNXA 5JYDA 3HDQA 1YGYA 1LDMA 1A7KA 4WASA 4GL4A 3KO8A 3MCVA 2ZK7A 1DRWA 4FN4A 4ZQGA 1MB4A 2QRKA 2WYVA 2AQIA 1GUYA 4HNGA 4GVLA 1HLPA 3PK0A 2YHIB 5JLAA 1IOLA 4A27A 4FJ2A 2OBYA 4WNCA 2NVUA 4XRGA 1DBVO 1V0JA 3AM3A 3FWNA 4M87A 2ET6A 4BKPA 3JQBC 1TT7A 1MX3A 1ZEJA 5CP8A 4XWYA 3DB2A 3S2FA 3ZU5A 2JKVA 2HJRA 3ZWWA 5AXCA 3C8MA 4GX5A 3ROKA 3OP4A 1E3WA 1NFRA 1UAGA 4NK5A 1DHTA 3RC9A 3JQ7A 2AQ8A 3WSWA 4FOOA 5JNLA 3FNHA 3PVZA 4W99A 4DBVO 2HK8A 5L7YA 1YB1A 2X9VA 1QORA 2CZCA 4E32A 1HKUA 5T8KA 4R16A 1AE1A 1GR0A 4M55A 4WUVA 1O94A 1LC0A 5TGDA 2EJVA 4WCFB 1QMGA 3GC6A 2D5AA 1QG6A 2H6EA 1XWFA 2WYUA 1HEUA 4PG7A 2EW8A 4UUNA 4WKGA 1E3LA 2VN8A 1E3JA 4RV9A 3P2YA 3TRIA 4DC1A 3TN7A 4JJFA 1EVIA 1E0DA 3EMKA 2B5WA 1DPGA 1PGPA 3VPGA 4DREA 2PR2A 4MVJM 5TC4A 4DMMA 3TZ6A 4BV8A 1K5HA 4OH1A 1M66A 1J6UA 3ZV4A 1PEDA 4INAA 4DRYA 1B3BA 1LRLA 4PN3A 1ZBQA 5F5LA 4K6CA 2EW2A 4YAEA 4LRTB 4IIVA 2Q45A 3AUTA 3K92A 3JD3A 3DZIA 4A73A 1K6XA 1GYQA 3DBLA 4IS2A 5EPOA 2Q2VA 2NLOA 1JLLA 5ITWA 5KNLA 3OH8A 3WGIA 3ZWXA 3F6YA 5JC8A 5DP1A 4BO1A 4RVFA 4N5LA 3CEAA 1E92A 4JBIA 2JHFA 2W2LA 3IDSA 4W82A 3DMTC 4MOWA 4CV0A 1BSVA 3I6QA 3KSDO 2O3TA 2QQ5A 4AJIA 4CQLA 3JQ8A 3E5RA 1UXKA 3AY6A 4IGFA 4NPCA 5A3JA 1BHSA 1DRVA 5EJ2A 2NTNA 5KVSA 3H6KA 1L7DA 2QHXA 4RVGA 4FJ1A 2FHSA 4EUHA 3WGQA 3GH3A 2VYVA 3I23A 4RGBA 2I9PA 3Q0EA 4CUJA 4CV2A 1GADO 4CMEC 4DPLA 1PWXA 2O3JA 1ADGA 3DHYA 4BMNA 1R4MB 4PZCA 3SEFA 3JV7A 4J90A 1X13A 1DLJA 3LT2A 4LRSB 1P1JA 1TI7A 1DB3A 3PJDA 3CZRA 4J43A 4HBGA 1AUPA 3TF5A 4J1TA 4DUPA 2O7SA 2G0TA 1E6UA 3B1KA 4IPTA 3DHEA 3NEPX 3OIFA 2WD7A 4JCOA 3BMNB 1WDLA 2LDXA 4WECA 3VZPA 5AYVA 3WG9A 3E1KA 1ISFA 2PLAA 4BGEA 2J3JA 3AK4A 3KYCA 1U3VA 5JAQA 1Y9AA 4UULA 1NX6A 3QVSA 4OSOA 3GN1A 3NV9A 5ADHA 1S6YA 4M89A 5F1KA 3DXFA 2OP1A 4O1MA 1X0XA 1PGNA 5BSFA 4DC0A 3U4HA 2AW5A 2Q2QA 4UREA 4W6ZA 3F5QA 5BT9A 4E30A 4L75A 3ITDA 3OJOA 3ZWNA 1YB5A 4J0EA 3GFGA 5HBRA 1LLUA 4J1NA 1I10A 3BMOA 1NBOA 3C7AA 3H8VA 3HB5X 1ZK1A 1B0AA 2BKAA 4GGOA 1P1IA 1DO8A 2DQ4A 4JBGA 3WMWA 1M6WA 3OSUA 3RC2A 2UVDA 3FBTA 1JU9A 2G82A 3I83A 3QWFA 1N5DA 2FP4A 2DBQA 3E18A 4FW8A 3U5TA 1PS0A 3FTNA 1N7HA 1LJ8A 4IM7A 3JYQA 4YCAA 4AVYA 3DBRB 5IZ4A 1EZ4A 1SAYA 2AE1A 3HQ4O 4R54A 4XQEA 4L4XA 3VZQA 5FEUA 4EJ6A 3H5NA 4UVGA 5BSEA 4FR5A 3RUHA 3JQ9A 3KVOA 4OOEA 5CDSA 3VDRA 4ALIA 4CLRB 1T1SA 3EUWA 3SLKA 3HWRA 3D4OA 4QX6A 3FNEA 1MGOA 2FMUA 2NV6A 1UAYA 2Y1GA 1KY5A 3BA1A 2P91A 1KEPA 1EUDA 3P2OA 3PHGA 1X7DA 3L9XA 1Y9EA 3RKRA 1PR9A 1WXDA 1MXHA 1QYCA 1XA0A 3LLVA 1R12A 3L4BA 5LDHA 3PHJA 5T6BA 3HB4X 2O3RA 4XYMA 4M54A 4MVJI 3BMCB 4CMJA 1BXGA 2C59A 5FFFA 2GN9A 1YJQA 4GX2A 1XQ1A 1QRRA 1QP8A 4FC6A 3UKOA 4E5YA 5JW6A 4X54A 1TA4A 3DZJA 4FD3A 1YVEI 4J0FA 2X86A 4CM4B 4IMRA 5A02A 1ISGA 4FS3A 2DU8A 2I5PO 1T1RA 2E4AA 4FFPA 3GA0A 5AVOA 3QWAA 3ST7A 3H4VA 4D45A 3GPDG 2WSBA 1B2LA 1ZH8A 5EESA 2EIHA 3KB6A 1EVYA 4GX0A 4E12A 4XJSA 4MIOA 1I5RA 2F00A 4YT4A 1TEHA 2BGKA 3PI7A 4E5PA 2Q50A 3DTTA 3S2EA 5COAA 3ROQA 4N5NA 1F06A 3F3SA 4DVJA 1EBUA 5JCJD 3PZBA 4CLOB 4BL5A 3RFXA 4GX1A 1RPNA 2Y1DA 4FGWA 5I7VA 4N7RA 1N8KA 1SCUA 2HMTA 2D1YA 2D5CA 1Q7GA 2ZYDA 5DNAA 4G2NA 4C4OA 4XD2A 3DMYA 4RDIA 3DBHB 4DWVA 3QWHA 2RAFA 4HNHA 1PL6A 2ZKLA 5IJZA 4PFJA 1U7HA 1P0FA 3GEDA 1ZFNA 4ALMA 5KVCA 3QA9A 4C7JA 2ZYAA 1HDZA 3HDYA 5ES3A 3D4NA 1NM5A 2VHYA 2ZCVA 3SC4A 1LDGA 2NADA 4ND2A 3RU9A 5L51A 3A28A 3LLSA 1LX6A 4EDFA 2OO5A 5DBGA 4B7CA 1OC4A 3NT5A 1UDCA 4E2XA 4YVFA 5A05A 1T26A 1E7SA 3RU7A 5ILOA 1JW9B 3W4JA 3BAZA 1LLDA 4XIJA 2BMAA 4GVXA 4XR4A 1BW9B 2V6BA 1OBFO 4BGIA 4HADA 3UH1A 3IC5A 2C29D 4J2HA 3PIIA 4XR9A 3DO5A 3HADA 4IY1A 2FOIA 4DPMA 4U0KA 5TX7A 3GLQA 1IY8A 1WAMA 4W7IA 3GN2A 3UGKA 5BSGA 2X0IA 2P2SA 1SEVA 3HUDA 4JP2A 4PLFA 5L4LA 4I5EA 2VQ3A 3RUCA 3NAQA 2EGGA 4IBOA 2QG4A 3ZWCA 2BFPA 1N9GB 1LUAA 4J1QA 4P22A 2NTJA 5JMWA 3AY3A 4QFDA 1NR7A 1LSUA 2HMSA 4NNJA 4CM7A 4L4RA 2WD8A 1F0YA 3KV3O 1G6KA 3NTRA 3PZRA 4DBZA 1F8GA 1MFPA 4BNMA 4W9NA 1VJ1A 4HX5A 1ZXLA 4E31A 1WZIA 2ZQYA 3I9MA 1EQ2A 1RKXA 4RF4A 1KEWA 5F21A 2OHXA 1EE2A 3OBBA 4E5MA 4YJHB 2R6JA 4YJDA 3PYMA 4YR9A 4MVJD 5EINA 3A4VA 4Z0HO 4FB5A 4LISA 4R1TA 1U3WA 4LW8A 1UXJA 3PWZA 2HSDA 1JTVA 1UXHA 4IMPA 1HE4A 4PZEA 3BTVA 1QYVA 5DBFA 4WLUA 3GZ4A 4UAGA 4ALKA 4D7AA 4FFOA 1BXGB 4J7UA 3BMNA 4QQRA 4JK3A 4YQYA 1P44A 3ETEA 2GDZA 1XYGA 2O50A 2GN6A 4PVDA 4WK6A 5KKAA 4ZN6A 2YV1A 2EERA 4UUMA 3W6ZA 1GFSA 3G49A 3NRCA 2PY6A 1KC1A 1UZLA 2E48A 3LF1A 3L07A 2VTEA 3E82A 2X4GA 1Z45A 3ZW9A 1DC5A 2A94A 3RSHA 4YAJA 1M76A 2AG5A 4UVHA 5DP2A 4L74A 3GRKA 5A04A 1HL3A 2X5KO 3VTZA 4BNJA 1TVEA 4TRMA 4AJPA 4XB1A 4CUZA 2O2SA 2Q3EA 2D4AA 2VZ8A 3ONEA 2X58A 3L77A 4K1LA 4ZA2A 3WJAA 4B4UA 3LZ6A 2G1UA 4UVDA 1QLHA 4NZ9A 4MVJF 1QYWA 4BNWA 2ZYGA 3V2GA 4XQ9A 4NJOA 4WEOA 3O4RA 5JXWA 4CLHA 4WJZA 5LC1A 1NPYA 2FSSA 1DFIA 2O4UX 1VSUA 1YH3A 3AU9A 1M67A 5G0SA 3FWZA 3X2EA 1JKFA 4C7KA 1TB4A 5GZ6A 2YHIA 4D43A 4N54A 2C2XA 2WE7A 2DTEA 2WJPA 4MVJH 1DIHA 1WLYA 2B5VA 4ZJUA 1MC4A 4B7XA 4EYEA 2EG9A 4RPGA 4DQVA 5I7EA 4HWKA 1NVTA 2JFGA 4GSLA 4IQGA 4LSMA 3G17A 1I3KA 2CD9A 4LSWA 1ID1A 1T2DA 2QIOA 3PHLA 4TKMA 1F17A 4CM8B 4IZIA 1YBAA 3H5AA 3GDOA 9LDTA 2JFHA 2G17A 1KVTA 3E9NA 3WMXA 2QRJA 1LU9A 2C20A 5TF4A 3ZU3A 3CMMA 1Y8QA 3OETA 2GASA 2I3GA 4NDNE 2GZ2A 4YB8A 7ADHA 1D1TA 1FDWA 5KOIA 1PIWA 2ZJ1A 1MP0A 1SBYA 3SJUA 1WNTA 4EJMA 5I9LA 4WPGA 2P9EA 2BLLA 3P7MA 4MIYA 4EZBA 4TRRA 4YT2A 2B4TO 5I8WA 1B8VA 3C1AA 2EP5A 2OP0A 3PWSA 1SZJG 4Z0PA 3JQ9C 3PHIA 1SMKA 4ALJA 3OQ6A 1V3TA 4IDAA 5TT0A 1ZSNA 1MXFA 3M2PA 2J8ZA 4BKQA 2NVWA 4F6CA 3H9JA 2Q1WA 3DAPA 2YQ5A 3RCBA 2C7VA 3ZWOA 2BF7A 4BNNA 2F1KA 1W0CA 2YW9A 1NFQA 4RPHA 1BVUA 3QQPA 1B8UA 2JD1A 3R3JA 1Q0HA 1TT5A 1HDCA 2GZ3A 3OQ1A 1Y5RA 3U4DA 2HU2A 2O23A 1I3LA 4Q9NA 1DHRA 2IXBA 1R15A 5JFOA 1GZ3A 5A9TA 1KEUA 2JAHA 5KJCA 3Q1LA 4CR8A 1WDMA 2FZWA 2I65A 2TMDA 1E1MA 1NAIA 1PWZA 3KYDB 1BWSA 3HHPA 4EBFA 1C14A 3ORFA 3PXXA 4I9UA 1PZHA 4B8ZA 4NFSA 2CMDA 1GPJA 1DDOA 1VC2A 5JY1A 1BTOA 4K9DA 3VH3A 4NBWA 1XLTA 1EK6A 3Q2KA 3GDFA 5KCZA 4QEDA 4J16A 1GL3A 4F3YA 3S2IA 4R1NA 2P4HX 3M1LA 4R1SA 4RF5A 2GGSA 5CDTA 4A7PA 4AJLA 3A06A 4Y98A 4OGWA 4TZTA 2AA3A 4YTEA 1H0KA 3RUIA 4ZQBA 5IZCA 4H16A 1V8BA 2E37A 4I1IA 5I8ZA 4AICA 2WMDA 2PD6A 1FF9A 1DIRA 3GOHA 3GZNA 3MZ0A 3WGZA 1GQYA 2CF6A 4D79A 1J0XO 3CKYA 1LRKA 4BO6A 2P5YA 4J9UE 3KXDA 4BNUA 4GWKA 2O7QA 3WB9A 4LVCA 1VJ0A 2AG8A 4R3WA 3NJ4A 5CG2A 1ENOA 2YDXA 1A5ZA 4YWJA 4QFCA 5GY7A 5A4DA 2CF5A 1YL7A 4KUGA 1A9YA 2X5OA 1E3WB 4MINA 3DDNA 2PZLA 2OGUA 2VUUA 2PTGA 1ENYA 1RM4A 2EXXA 4WOJA 2EEZA 3IQDB 4PIVA 3GEMA 1G0OA 3GR6A 2IXAA 2VHXA 1SC6A 1ONOA 3H7AA 1KS9A 3ENNA 2CDAA 1SEPA 5HTOA 5CDYA 4ZQHA 3JQCA 3HDJA 1T25A 3KEQA 4U7WA 4Z3KA 1VPDA 3WIDA 1JKJA 2IYPA 5DCWA 3D5TA 3KBOA 4GBJA 1IULA 3BMCA 1YONA 1PZEA 3WTCA 4CMCA 4CMKA 1CRWG 1HDOA 1GZ6A 1VSVA 1KY4A 3GGOA 4CM8A 4OKNA 3V5NA 3NDJA 1EBFA 1KVUA 3JQAA 1AHHA 3DFZA 1E7QA 2IEBA 3IJPA 4ZHSA 3HFGA 4FCCA 3BYZA 1FXSA 4R9RA 5HM8A 4CQMA 4FOSA 5I7FA 1E1KA 5TJHA 2CNBA 4GQAA 2Y0CA 4Q3CA 3UN1A 1V35A 1H9AA 5JDCC 5KVQA 4PLTA 3ZWPA 1C1XB 2JAPA 9LDBA 1PJLA 1KIFA 3DTYA 1ZK4A 5DOZA 4DIBA 2EGHA 2Q1TA 1OC2A 3JQBA 1EK5A 1KYQA 2D2IA 2R2GA 3LSYA 4LK3A 1FDVA 1NR1A 4EJ0A 1VJTA 4BQPA 3WJ7A 1E77A 3JD2A 4YYZA 1CWUA 4JP3A 4CLDA 3M6IA 1UP6A 1P77A 4CM9A 4FJ0A 2ZB3A 5FWNA 3ASUA 4K26A 3A9WA 3IMFA 1O95A 2X6TA 3OA2A 3DBHA 2I6TA 3INGA 3UAGA 2C5EA 5DCYA 1T2AA 5BSHA 4QTZA 1SO8A 3RBVA 2PZKA 1BGVA 4AJ1A 4E2YA 4IXWA 2J6IA 4IDEA 1ISHA 3DZKA 2VWGA 3EGOA 3UW3A 3U09A 3WBBA 2C54A 1X7HA 5I7SA 3WGYA 5MDHA 1R4MA 3FF4A 2DUWA 3FNFA 2UUOA 3KYDA 4DA9A 3H9EO 1PGJA 3DAGA 4HP8A 3LT0A 3WYBA 2ZB7A 2A9FA 3MJTA 2JCVA 1RM5A 4PGFA 5DN9A 3QVXA 5AXBA 1B16A 3ON5A 3W8EA 2FR8A 2Y0EA 2RHRA 3ROPA 4YRDA 3NJ8A 1SOWA 1YO6A 4R9SA 5C3MA 1J49A 3QE3A 1EDOA 4YJGA 4CMIA 4GMFA 2J5RA 1NAHA 4TROA 4PVCA 2P4QA 4YAGA 3GDGA 3I9NA 5F1OA 3ADPA 4DTIA 2E49A 2JJYA 3TZHA 2X5JO 4XGNA 1P1HA 2PD3A 5H82A 1QR6A 1YQXA 4DLLA 1ORRA 3HG7A 3RC7A 4R1UA 1LSOA 1XSEA 1C1DB 2C0CA 4WOKA 5JDIA 4G81A 2HMWA 3F46A 1VKOA 5DCUA 3WICA 4XX0A 3GG2A 1VM6A 2Z5LA 1DJQA 3K6JA 3PP8A 3D5QA 1ML3A 2FRDA 4JJIA 1EDZA 1OMOA 1UH5A 1HF3A 3VOSA 5B1YA 1W8DA 3ZNPA 1MG0A 4II2A 3VDQA 5A5FA 1W73A 2NUAA 4PG8A 1RJWA 2C07A 2W98A 3S2GA 2LDBA 3JD1A 5G0VA 4M49A 2VWQA 4ITUA 5JDCA 4IDFA 4P38A 3SLGA 2PNFA 1NNUA 3D64A 3DZBA 2X0JA 4U6SA 1ISIA 2IZ1A 5U9CA 4AL4A 2VOEA 5DT9A 2NACA 3ZWVA 4CM6A 5K0ZA 5L4NA 2NTVA 3LDHA 4OXNA 4UEJA 1JAXA 1BMDA 4EI2A 2I66A 3FR8A 2XPCA 1T2EA 2OMEA 1TLTA 2FR0A 2VZ0A 3ANLA 3EY4A 3JQAD 4FFRA 4XDYA 2EJWA 1YXMA 5AXDA 1LQTA 1YL5A 2VRCD 3OMLA 2Y1OA 4CQMB 4EUFA 3D3WA 3EYWA 2PFGA 4I08A 3E5MA 1EFLA 1Z6ZA 5AOVA 3WGTA 1H94A 4Y6SA 1DIBA 5H83A 5ITVA 5JYEA 1P31A 2Q1SA 1NYTA 4RQUA 4TQGA 4L8VA 1UJMA 1W4ZA 1GZ4A 3WQSB 4HXYA 4R68A 3MOIA 3DOOA 3QW2A 4JX8A 2WWRA 4B4WA 1GQQA 3AUSA 3KRTA 5CAEA 4BO9A 3GNTA 1GUZA 3JYLA 2VNAA 5T64A 3D1LA 1ULSA 3DOCA 3GAZA 2Y99A 2X22A 4LCJA 1WWKA 1C0KA 1I2BA 1MA0A 1EQUA 3DONA 3K31A 1B3RA 2VUSA 2AQKA 4XJTA 3INRA 1F12A
chains in the Genus database with same CATH superfamily
1PL8A 2PJRA 1Z29A 4MGYR 4JEMA 5EXDA 2W70A 1DRJA 5CBKA 2VR1A 3F6RA 5FAXA 5HF9A 4KR7A 4Y7DA 3DULA 4CMIB 2GCGA 1UMDB 4DCNA 3DEFA 2J09A 1NTOA 5ALUA 4B7ZA 1O94D 2F3UA 1SHUX 3CKMA 4ZODA 2XQJA 2Z9BA 4MYCA 1M9NA 2GKOA 2J7PA 2R4TA 4RCVA 5D00A 2Z8XA 5CB0A 1GNVA 5B6IA 1VE5A 3BRSA 1G7TA 4Q3DA 2O2XA 4WGFA 3KOWA 4XPZA 5FPYA 3RQSA 3PQEA 3V4OA 5B4VA 1Y1PA 1IB6A 4JEIA 4P54A 4IWNA 1T4GA 4QIHA 4ZVMA 4QA9A 1NQ5A 2HPZA 3LNCA 3QWIA 4JQOA 2VJQA 2Z1DA 5BWOA 4RK4A 4F91B 4OB7A 3UT6A 3K4QA 2VT2A 3MGGA 2P9JA 1JAYA 2C8VA 3P9IA 5C7OO 1HT2E 4BVGA 2AJTA 5IUKC 3OF2A 1MQ8B 1RXVA 1T2UA 3ZWKA 1I2ZA 4Y9SA 4BZXA 1G3MA 4C4PA 1P7YA 2OORA 3DCIA 4L8FA 3QWBA 4X61A 3ZQJA 4DPKA 3GWZA 2EZ8A 5SYAA 3VR3D 1DO2A 5DHAA 1ZONA 3JYOA 4YRSA 2AS0A 3BWXA 2QS9A 3AQIA 5BSMA 4ZHQB 1P75A 3DKRA 2GERA 3PITA 4OYRA 5ALHA 3R75A 3IQXA 1FIUA 3UK6A 3N8KA 1EHYA 2SKCA 2W0SA 3TLGB 2GARA 2XADA 3ILXA 3V8NA 3RH0A 2IZ6A 1M72A 2LW7A 1Q0ZA 3MBIA 1AMOA 4ND7A 3ABIA 3FVWA 3GJ7A 1W6RA 2ZQ5A 1HE5A 2XTZA 3DE4X 3KQYA 1CLEA 1JX6A 1GTMA 2VJPA 1SA0A 1RAIA 3ELDA 2I29A 1YB4A 3EG9B 4GOKA 2ZSJA 5GVRA 1A9RA 3FYTA 3RHSA 4BNDB 1I5EA 4EG7A 4MS3B 3CVXA 2JL1A 5B4UA 3K4PA 3CLHA 3J81A 4J0KA 2BM1A 3AFHA 3H1GA 5BV2P 5GTDA 1JWBB 3ESQA 4NK4A 3QEMA 2W2TA 1BJKA 2JZCA 1EDBA 3DLCA 4TQAA 3KQQA 5LUAA 2ZREA 1BAPA 3OM1A 4QREA 2BFEA 3VPXA 4PQGA 3DTVD 1JHAA 1DKQA 2CKDA 3KTOA 5MGBA 1B76A 1R0SA 4FOLA 1KAMA 5TQVA 1K63A 2VNKA 3HN2A 4L76A 4PG4A 3LQ1A 4GECA 1GL7A 4PGMA 1NU6A 5DHPA 1ZNYA 4J4BA 4HNTA 1OZGA 1C29B 1I01A 4DGQA 1GPUA 2RONA 4JJAA 2X1VA 3PPWA 4H59A 2R48A 5ENVA 3IB3A 5KYNA 3TQHA 1YRAA 2QZPA 4EW1A 2XVMA 3PJEA 5KNBH 1KJQA 3DE1X 4ZI7B 1VTKA 2FSHA 4NV0A 4YAOA 3GRPA 3PENA 1H9BA 1ECGA 2INGX 2TMYA 3OTQA 1ZESA 3V48A 3ZXSA 2PL5A 1LBQA 3F9CA 3FVRA 1QGED 1V4NA 3FUTA 4EHKA 4CN9A 4RLSA 4YV0A 3ZCTA 1UDBA 2VF8A 3QIVA 1OB5A 1O0CA 2PGJA 1PGOA 1XVLA 3ZYCA 2JLUA 2VWHA 2V9ZA 4HWSA 1H3FA 4WZAA 3WP0A 2HK7A 4ZYZA 3RF6A 3H4TA 5IEJA 4NYJR 5LQSA 3A6FA 2YV5A 2WJ6A 4D02A 2GF0A 5AKKA 4W1PA 1ZHOA 2GSDA 3ADKA 2CWWA 5IJ0B 5AIAA 3UIEA 1JBEA 8ADHA 4R7ZA 1KMIY 3DT8A 4HGNA 1EK1A 1UMCB 4P98A 3WMEA 2XDWA 4LS3A 3T6KA 1DTWA 2BISA 1XYYA 4OUDB 1VE9A 1LDEA 1E89A 2DQYA 4OP3A 4TKUA 1Z37A 3W3AD 2BEKA 4CKEB 1EXVA 1CUAA 3MGKA 3LC2O 5KDOA 3P9SA 5C2JB 1AF7A 3JD4A 2WU4A 4MVXA 3HDHA 3K6RA 4OQYA 1KI8A 1RBQA 3AHIA 4ZI2A 2VDJA 1PUXA 4IHQA 4WUTA 3OCYA 1Y80A 2PWAA 4RSGA 3EIQA 3O3NB 4U3JB 1T2FA 4ZO8A 5GZ1A 4X0EA 3WGJA 5TQ0B 1V41E 2J6BA 3RQIA 3H5RA 2Q62A 2PMBA 4X3PA 3SIRA 1O96B 2CXPA 4QOEA 1NMXA 2IZZA 3BBPA 1JQBA 3ETHA 3K1JA 3W8DA 4CG1A 3WLLA 1VL2A 1KI1A 1FDUA 1WP4A 4NG5A 2IOQA 4FZJA 4L50A 4TSKA 4AX8A 2G06A 3UJNA 1KF0A 1L5WA 1WF3A 4LZLA 1DJOA 2QZ9A 1U8AA 3OEHA 1UPXA 2MSCB 2A9PA 3Q2OA 4BX3A 3SJ7A 1LBTA 1XRLA 1Y33E 5IJXA 3EFOA 3GPIA 2Z98A 2J0SA 2R5FA 1F14A 5JXGA 3UXYA 4H4DA 4RHFA 4NYJQ 3QYJA 3ZLBA 2A4KA 1FVHA 1QVZA 2EQAA 1BVRA 3OUZA 3WWOA 4MYTA 5FPKA 1UBMS 1RHKA 1QHSA 2WYHA 4B40A 3QXGA 4XE5A 2PWZA 2R96A 1S5PA 4BKOA 3BE4A 3SYLA 1P9NA 1KI3A 1V1JA 1Z6TA 1ZM7A 3PEEA 1R2QA 4LMRA 1U9YA 3LI2A 4E22A 5J43A 1TJYA 5AKEA 1OU4A 1I3OA 3K2BA 3H83A 4QQ8A 3GGPA 3LUGA 1CZHA 1A4UA 4U9HS 3TLKA 2X76A 2O5RA 4IDGA 3ETGA 4KN6A 4EG3A 3GEEA 1FUUA 1ZRNA 2V3CC 4RULA 1ZWLA 2JA1A 1A5AB 3O4JA 3RYTC 1C81A 1GKUB 2Q4BA 3LCMA 5KWVA 1CUFA 4Q9IA 4JYZA 2P5UA 2WUEA 3U7HB 1A1VA 1Y8QB 2BONA 1WQ1R 3MFQA 2P6PA 4YMIA 3GPBA 2NXEA 4OKSA 4WLVA 4DMFA 4KQXA 4BS9A 2IKSA 3L7LA 1Y6FA 3CE6A 4F72A 4AI6A 1XZKA 5D01A 5DNDA 2XGSA 1P2UA 1YI1A 1R8SA 3PUXA 1AKYA 1R00A 3A27A 3KLMX 5F3RA 3KT8A 3WQHA 2B83A 1N8SA 5FPTA 1V48A 4KWHA 1P4AA 3LHKA 2EATA 3LBYA 3O4IA 2O3UA 4QSHA 4DADA 2ZXUA 4G5GA 3UV7A 3CONA 5DTMA 3ZQKA 5C34B 6GPBA 3ICVA 3KOMA 1CDZA 1NQOA 3BSWA 4JQYA 1FS4A 1AN9A 4L0QA 3R7DA 4R2MA 4PBRA 3PPIA 2GETA 5COQA 1Z5GA 3BTSA 4ABYA 3NEAA 2B6HA 1L1QA 2O4CA 4C7BA 3GLFA 3BF7A 2P7IA 1Z3IX 2R66A 2YHBA 1U28A 3UHJA 2XAAA 1MPXA 5FUXA 9MHTA 2D8MA 2AWOA 3TZEA 3ZJ5A 1Z2NX 1QYRA 4YP9A 2EFJA 2ONJA 3L82B 8ABPA 1SGWA 3M1IA 3U4IA 3RS7A 5D51S 1BHJA 1Y3HA 2F59A 2O1EA 1XZJA 1VB3A 1WUKS 1TTTA 2V7QA 1ZP6A 5DASA 3K53A 3LT5A 4KMRA 3U16A 5IDQA 3F97A 1NHWA 3UB4A 4EHAA 5ARBA 2XSZD 4CT5A 4D56A 1UM9B 2XOKA 5IJ9A 2P9GA 3WQRA 4LMBA 1XDSA 3R20A 2WI8A 3NHUA 1CQWA 3DTVB 3GRZA 4UM8B 5FNVB 3TI9A 4BCBA 1ZMOA 5E7IA 3HA3A 2Y1FA 3ASYA 1IPFA 1EXNA 1QGUA 1Z6AA 2R62A 4KE8A 4QGFA 4EGCB 3GJQA 1IM2A 4DV2B 1D2NA 1ETUA 3I09A 1SK9A 1VBNA 2DVMA 4YV2A 1DNPA 1LWNA 3NBFA 5FUQA 1QZTA 1ULBA 2JHCA 2LUOA 3BDAA 3RAFC 4QXQA 2BFCA 4QHYA 3GY0A 3OQIA 3RYIB 3P5SA 4ZANA 2BRUA 2W58A 1K3UB 1IPEA 3EDCA 5JT1A 4R1PA 5TLSA 3R1IA 4RKWA 1INLA 1SIUA 1BWQA 1T9AA 3AR5A 3E8MA 1TYEB 3CW2A 3LQ2A 1Y37A 2AJ8A 3DVAB 3RROA 1WBJB 2ZI5A 3MOGA 1I2MA 4UXJA 3K1ZA 2R87A 4RS3A 2H31A 1WKBA 2IZ5A 3PNVA 1N1DA 4I1OA 5FLYA 4A2CA 1WB9A 4F06A 1DAHA 1ORTA 1Q0PA 2WOJA 3BAFA 4J0JA 3MIIA 3UFXB 3G0OA 2FDRA 4FFDA 1PG2A 1U9ZA 1V47A 3RVDA 2B4AA 4HAVA 3IIJA 4BBZA 2IT1A 1XCJA 3HSKA 3T35A 4G09A 1KEKA 3IPAA 4KIJA 3TOZA 1A3CA 1UBCA 5B1DA 4BUJA 4OXXA 3Q8WA 2HJSA 3VKUA 3HGTA 1OKKD 3V9AA 1GRNA 5EIHA 1TIPA 5DX8A 2P4EA 3TM5A 3ZJYA 2DFTA 5LBIA 5TVGA 3WMFA 3ASZA 3TJRA 2BTOA 1KR5A 1VGVA 1O89A 3EVFA 3ZY5A 2C5SA 2F43A 4PHFA 2FFHA 5DTRA 1FPQA 2WIDA 3G0IA 4GE0A 2PX0A 3ESZA 4NAUA 3HVIA 4AJKA 1S8OA 2D1TA 1SOVA 3NU1A 4L5JA 4PBTA 2OBBA 1PR0A 4R8KA 2OD7A 4KXYA 4Z3OA 5AJUA 1WPRA 2HM7A 4MRMB 3EZ7A 5K0CA 2XBMA 3CLKA 4RC9A 5C18A 3PG5A 5GOZA 2B1GA 3F78A 2OENG 4R84A 4H08A 3X3HA 5G40A 4JCCA 1FL9A 3HA5A 2RGNC 3AI2A 4U2FA 4EG1A 3TDKA 4NV3A 5BRJA 4IJKA 1IE3A 1QPBA 4CR6A 1TTPB 2RG7A 2VZEA 2FVXA 3COSA 1U9JA 3E9MA 4MKRA 3TIVA 3KYJB 4GI1A 2VYQA 3FPSA 3RRMA 4KWEA 4R2XA 5EQJB 1LQUA 1DTEA 6PFKA 4FNAA 1V9LA 4P3OA 1UKBA 1Z0AA 2BLNA 4QM7A 1P2BA 3H99A 3PDJA 5F2KA 5LOVA 2L18A 2LRHA 1Q84A 3CRQA 1MV8A 4MGKR 1MENA 1S4MA 2IU4A 3CXUA 3T3MB 3W9UA 4ZALA 5A4AA 1IHPA 1Z4IA 4I5IA 3ZXXA 3JAMA 5JBIA 4IMJB 4MI1A 2X9GA 3PNSA 2I9KA 4B3FX 3GLTA 1L5OA 3D6JA 5G0WA 2GRAA 4EB3A 2JEYA 3ODGA 1NHGA 3D0QA 4JBYA 5LP6F 1POXA 5B58T 4XGKA 4F46A 4D46A 1KZ6A 1QIJA 3CF6R 3N0TA 3P94A 1EJ6A 2JGDB 1ZS9A 2WOOA 3H2JA 4IDOA 4IJMA 4CIWA 1ODLA 2PYZA 3PQFA 3W6PA 2XWBF 1H6BA 3G2JA 1JHXA 2B61A 5I6DA 5JVDA 2ERCA 2KQUA 2DLDA 1WVMA 5EHQA 3V8QA 2IP1A 3IHKA 1E32A 4QO7A 5JJIA 1N4DA 1VZ3A 2A92A 4MRPA 3HCPA 3MMNA 3PGMA 1JR3D 4HEA1 1SWVA 3QVUA 5JJ5A 5B7QA 3U19A 2H7VA 3OJEA 1XQVA 4JVOA 4Y2GA 3KOZA 1EXMA 4IMIB 4MIEA 1AQUA 3DZHA 3M49A 4OFXA 4G0VA 3P97A 4A5OA 4LSGA 1S9DA 1R0XA 3BQNB 3JASA 5C1OA 2YR0A 1CHDA 4WY5A 2OSBA 3IMKA 3U9SA 2IEGA 4NYIR 4PNPA 4BO7A 4CI0B 3ZI0A 5IULC 1MABA 2G63A 5KWEA 1E2MA 1KYXA 4AXBA 4MUBA 2OV3A 2L2QA 3AJRA 3QBVA 4I9HA 4L28A 1FDIA 3R7FA 1R9MA 2XF2A 4LXYA 5FI5A 5K6AC 4OJMX 2PZFA 4OK3A 2FUKA 1S1MA 3AR2A 1NXVA 2Y1KA 4FFVA 4C2BA 4DCGA 4DIMA 4AJOA 2BBTA 1RXYA 5LVAA 4Y6PA 1D8TA 1HA3A 1AC5A 4GICA 3WKAA 1HTWA 2Q8PA 2G40A 3FG9A 1EX1A 2DBYA 1DJNA 1N5LA 1IOZA 2WD9A 3FLEA 4V2IA 5EKUA 3UJ9A 4BKUA 5JEDA 3RW9A 1E5DA 1QU3A 3DFFA 1SHJA 1KPGA 1SCBA 3VKFA 2GLXA 1TJPB 4CZ2A 2JCYA 5FP0A 1IZZA 3TLGA 2EWVA 5LMZA 1CB7A 3MUEA 4IIXA 4HDMB 3PQ7A 4MSUA 3L0IB 1LJLA 1UKYA 3CEPB 2H57A 3KZCA 1XEXA 4EELA 1EWYA 4JLSA 5JV5A 1NP3A 2WNIA 4HKTA 3LWZA 4M1SA 1DX6A 1AHIA 3U49A 4UCFA 4JI5B 1C3VA 1W36C 4YDRA 2VF2A 2WUVA 1QCDA 4NICA 1RM3A 3F1KA 4E0BA 3AOEA 5KMGA 1CUZA 2G77B 2X0NA 3PNYA 5LIRA 4OL0A 4BNHA 4KI0A 6ADHA 1JEYA 3ANYB 3KZXA 4NYIQ 5CG1A 2KB0A 3AH8A 3GNQA 1NRXA 3EOBI 1O8CA 3S68A 1PCXA 2A5DA 2V5AA 5AHRA 1XKQA 3LP6A 3D31A 3KHKA 2BGMA 1WZEA 1LRJA 3A14A 1NDQA 4DM3A 1N32B 1PX0A 1TM7E 3KEOA 4M83A 3FKSD 2VDUE 4G3XA 3UGQA 4LOAA 5IAGA 3FKQA 1IXYA 3VH1A 1OLSB 3WSTA 1CQJB 1EUYA 4XKJA 4D9IA 4QPCA 2FK8A 4HGRA 5ES4B 2X0RA 3HMQA 3F6EX 3GH1A 3I5MA 1R66A 2GO1A 2ZJ3A 2KE5A 4ZOLA 1QVVA 2OFOA 3RYFB 4DCMA 4EY6A 3RYHB 1OTXA 4ZAGA 2BVNA 1CETA 3L0OA 4WDRA 1K3FA 4FBMA 4OLHA 1F4LA 4CQJA 2W4IA 4MVJA 2AHOA 1P3DA 1DXHA 2PCJA 4MQ6A 4U3JA 2BKLA 2J0EA 2ZRPA 2QR2A 2CUZA 3E2IA 2ZBFA 3F5SA 2O3SA 3R5TA 4BN4A 5IXYA 3T4EA 3MWFA 1RIIA 4P35A 4RD1A 1ZQ9A 1X15A 2FPUA 3Q40A 1UKVY 4LMPA 4O3FA 4A3SA 5BNFA 5A62A 5HUHA 5K7SA 1QB7A 3NKLA 5C0OE 3BD8A 4UHHA 1EUQA 2XLBA 5AW1A 3RJ9A 3NEYA 1KA9H 3HSYA 1UM9A 5BQFA 4QYXA 4OXKA 4YMHA 5K3AA 3GFBA 4TSFA 3AP2A 3QITA 2Y3IA 2ZIFA 4KE7A 1WUHS 2FYTA 4B4KA 2CLDX 2NSJA 4DHEA 5B7PA 3VUFA 4BATA 1DCKA 2BGGA 4I5GA 1ADCA 1AGNA 2IOYA 1EGMB 1YZGA 3BGSA 3E5HA 3OE7D 3WY9A 2QMQA 2BGTA 1HPLA 2JAUA 4I4NA 4PC6A 2VA9A 4TLEA 1KEZA 5DM4A 4UU7A 2GHTA 3KJZA 2ZJ0A 3QVGA 4AZ3B 2OCLA 1TK9A 2ECPA 2QRMA 3ZHQA 3QXXA 1RAHA 1ANKA 2HRZA 2VHQA 2N47A 3JQ6A 1XTBA 2FR1A 3G9QA 3K8QA 2HEIA 1O0BA 4JYAB 2VO1A 2QUAA 2MIIA 1FJXA 3KJEA 5GWXA 2WWIA 3W78A 5ICMA 4NIMA 4MW6A 4QAJA 4YMLA 3ZG6A 1D8AA 1E2KA 2V5UA 4XWOA 1MCZA 1WETA 1C0IA 4Y9RA 2H92A 1ADFA 1E1CA 1Q95A 2PS9A 3C5VA 4KJZA 4DA4A 5D87A 4HNUA 2X4LA 5DNWA 4PLHA 3HRKA 3LA8A 3DZCA 5JSKA 3SI7A 1EX6A 3SZGA 2C1ZA 3C85A 3GT3A 1P5RA 3G2HA 4FWBA 4RESA 1WO8A 2BELA 1MX5A 1WEKA 3FF1A 4QBKA 4RH3A 5CEJA 1T43A 1IN5A 1GGVA 3NZEA 2O7VA 1H8HA 3QUQA 1N3BA 1Y98A 2D00A 2Q07A 2CDBA 1ACMA 4OXRA 3SF0A 2GFHA 1HDEA 1K7XB 3G8DA 5B3LA 4O4HA 1JSRA 3I05A 3D59A 5K09A 7MDHA 3OT4A 2EX1A 1JHQA 2Q3MA 3N2NA 4YMTA 3SR3A 3EQ8A 1BJRE 4OJQA 5C4IA 1IM5A 4F2HA 2GPYA 2AB0A 2PS1A 2H5LA 3OQBA 1RZRD 2BOVA 2ZE7A 4WCFA 4YAWA 4K9MA 2OYCA 4DL9A 4TWRA 5BNZA 4PG6A 4MP3A 4A10A 4IVRA 4DBZA 1E79A 2W6ID 1G20E 1D5WA 4PLWA 2BKXA 2YRWA 1YRWA 4N65A 3R41A 4X45A 1E94E 3ZS8A 3KSBC 2AOUA 2ZRJA 4ZOBA 5KYYB 4JB0A 4RSHA 1W0KD 4P3NA 1E4EA 2W90A 3KDPA 1V7PC 4IHJB 3R5HA 1B26A 3A32A 1VPWA 2SCUA 1QQ5A 1J9GA 3RIYA 3C5HA 3IA2A 4B4DA 3MVEA 5HG0A 3ZW7A 4B2LA 5KNBD 1ZL0A 3OCCA 4AWXA 3K8ZA 2EKQA 1GXSA 4HWRA 2ZPTX 3P9ZA 3OCWA 3UEOA 1M34B 2UZ4A 1GDHA 1N6IA 2LVBA 2FZLA 1UJ4A 5EJIA 1ZD8A 1S2GA 3R2JA 2QZSA 1AKQA 2BSXA 2WM2A 4UZEA 4QRIA 3DVQX 2JJQA 2ZT7A 3I9LA 5BN5B 1HWYA 3WIOA 1F8YA 1GU7A 1H3NA 2F3SA 4R0VA 4HLDA 4TKLA 1QQAA 2QE7A 1C0LA 2E2WA 3FCCA 5I4CA 1NVVR 2SKDA 4HMPA 3WRYA 3UCEA 3WRXC 2I3DA 1PLLA 4UNRA 2O54A 4GS5A 4FFWA 5IWCA 4Z53A 2NU8A 3HN6A 1DAGA 4UUQA 2KHZA 3C6KA 2O14A 5K6RA 2CXTA 1SRQA 3HJBA 3KEMA 1N2CA 3SSAA 4AP9A 1Y5IA 3CXRA 1GAWA 4R3NA 3SKVA 2BBOA 4MAAA 4Q82A 1NBWB 3L9WA 3HE3A 2B4YA 1CY0A 1OILA 2VBGA 2NZYA 3EXHC 4OHUA 2V65A 2XECA 3F5DA 5JCXA 1LDBA 3J7TA 2FGJA 2OGZA 5CFLA 5CCEA 4CKCB 1MEJA 1ZPDA 4M37A 1XXLA 1IN4A 3H1EA 1BW9A 4IQ4A 1TT5B 4KGDA 5D85A 3KZVA 1OX4B 2O8FB 4Y0AA 1CU1A 4F6RA 1RT9A 1NJSA 4DQ0A 3ML1A 2R1TA 3GVIA 1S8AA 1XD2B 4FHCA 4UKDA 1V5FA 1VSQA 3TFOA 3HYRA 3JASB 3H16A 5IF9A 3UV3A 2QMEA 3ZHCA 3LCUA 2XJ4A 2QLFA 2QJWA 1T4BA 2FV8A 1ZI9A 4HUJA 1UMBB 4A16A 4AK9A 4ANFA 5CXUA 2W2KB 4CDGA 2HAEA 5AK0A 5IVKA 1FP4B 2Y93A 5IJWA 1RCFA 5EUBA 1O4WA 1U3TA 3TOCA 1O58A 5LD2C 2NM0A 2DPXA 4DQLA 6REQA 3TAXA 5M3BA 3A0RB 1O08A 4DLPA 2ZT8A 4D9EA 1EFDN 2ZTUA 3CPSA 4LJAA 1FDOA 2QORA 2QENA 3DEHA 3X1DA 5HK9A 2VK4A 4BBAA 4MQMA 5IRCD 2JBAA 4B47A 2WZCA 4OXYA 5FTWA 3NWPA 3JZFA 3OJWA 2OFPA 3R24A 4CLEA 4N6OA 3T15A 2FI1A 4RZIA 2Z2YA 4TT3D 2RHTA 3ANMA 1Z83A 4DV1B 1HZZA 1YDFA 3DEIA 2GK7A 4UASA 4F85A 4DMCA 2GH1A 3OC0A 2P6OA 4EA7A 1GNQA 2CGEA 4K40A 1JIUA 4J3FA 3NHWA 4PYMA 1RWQA 2J31A 2QQ0A 4IJUA 5E0KB 2H1OA 1DP4A 5JD3A 1TO2E 3LXXA 4QXAA 2B37A 3LCJA 4UW9A 4C3OB 3NKFA 1DG1G 1LVHA 1VYHA 1WMEA 3N6VA 5BWLA 3GRVA 4O0MA 1OAOC 3C3CA 3KLOA 1TJ4A 1JMVA 4FEGA 1F9EA 1N9KA 1TVMA 1Y81A 4HFRA 4O02B 4QRHA 1L4FA 2BM0A 2EW1A 4RPCA 4US0R 2FMIA 3LP8A 1PLKA 4Z1MD 4P3PA 1QF6A 2LIPA 4LAFA 2FXVA 1U7TA 4MPTA 2D54A 4NQZA 1RE0A 1JDBC 4YASA 4BIIA 2FPGA 5LQMA 1Y42X 3HWSA 3ED1A 4G9EA 1CEEA 4CV3A 4QGGA 2PH3A 3I5YA 1UZNA 2YDYA 1VMDA 1IHYA 4S1WA 5A1TA 1OJ7A 2IPLA 1RAFA 2E4YA 3KKPA 3O26A 4PANA 1BDMA 1OLSA 5CDFE 1X14A 2ZGVA 1FFBA 2WWGA 4DYDA 3BL6A 3QNMA 3ZZUA 4EG4A 1WSBA 3PEFA 4BMVA 4F7WA 1U4SA 3GEGA 1UP4A 4MVJP 4KR2A 4K2HA 3SYMA 3G0DA 4Z4QA 2AR7A 5I9MA 3NHKA 4D0RA 4F2WA 5I48A 5JZSA 4Y8VA 6YASA 3D54D 1VL5A 5LQNA 4XCVA 4IFTA 5AWFC 4REMA 4FN5A 1A7JA 2Q5FA 3ZHUA 4FQ7A 3T38A 1OU0A 2HCRA 3D6VA 4Q48A 2ZIUB 2PX5A 4W8GA 2J0UB 2ZTLA 1QK5A 5JH7A 1PJAA 4QZVA 1LW7A 1JEAA 4YMGA 4X1YB 5ALEA 2FEXA 4RM2A 4S35A 2AI1A 2IHVA 3SE0A 3PFFA 2O48X 1H4VB 2V7EA 2VK1A 3ESRA 3EQ6A 4CL3A 4F3KA 1EVZA 1DJPA 2YCLA 1JSZA 3NI2A 3P20A 5KTKA 1ZINA 2UYGA 1UBTS 3RM3A 2QDXA 3ENVA 3WV4A 3DMPA 1HXHA 1XKLA 5IVPA 3W3ZB 1RM0A 1KZ4A 2PDAA 3U13A 1E2LA 2L42A 2AG0A 3AUXA 1V26A 4PY2A 1U11A 3ZTYA 4BVKA 4NZYA 2BGNA 3F47A 1PDWA 3UJHA 3O5AA 2G1KA 3K09A 4URYR 3GLIB 1XCLA 2C92A 3WOHA 4PPYA 3LXUX 1W4BA 4B6QA 4H1WA 3BB1A 2QUZA 3I12A 4M1QA 4RDHA 2QRVA 5KHAA 1IDN1 4KU4A 3UPTA 1AKUA 4A0HA 3OO0A 2BFWA 3ZGNA 3SHVA 1NQTA 3FFXA 5IS2A 1PJRA 1N3LA 2C4KA 5E4FA 5JFGA 3NC4A 1IYZA 2HRCA 1E2IA 4OQXA 4W5WA 5LKRA 2WWYA 1E98A 2HTFA 4RW0A 2RARA 1QO0D 2VJOA 4BRZA 4JLBA 2G5GX 3FTEA 1KAHA 1BFDA 1Y48E 2BFAA 1BROA 2EJTA 3BXXA 2OAQ1 3A10A 4FGSA 2ZSEA 1MAWA 3MINA 5LCXA 3TLCA 1FLDA 4V0OA 1QK4A 3KTAB 3HJAA 4EMUA 5K8UA 1VL8A 5FPQA 1X92A 2X8LA 1NXOA 2B25A 1X0VA 2BEUB 4ESEA 2JJ2A 5ICSA 3PDHA 4C30A 1J5XA 4N03A 4F9GA 5IEBA 3K1TA 5H68A 1SXJD 3A36A 4G4GA 4ZZ0A 4Z9YA 2R44A 2K6GA 3L6EA 4D9NA 3WNBA 4LOKA 4D4MA 3QZUA 3HLYA 4HH1A 4JODA 3SEAA 3LUPA 4H7EA 5JQGB 1O87A 2Q5OA 4JNKA 4IIDA 5IAKA 3NH6A 1OH7A 1GQFA 2EFGA 1D6JA 2WAXA 1QQ7A 3AT1A 1BH2A 1YR7A 3UUEA 4JJEA 1SD2A 2AE2A 3E3LA 1ZMXA 2WDZA 2XNCA 2CNKA 1ZK2A 2J59A 3NIFB 3HRIA 3NH9A 3QLEA 4MI6A 1XTZA 3WWDA 4D3SA 2ACWA 3BRWA 4DAEA 5KMGB 2X13A 3ZGZA 2NN3C 4BNVA 1LVGA 3L18A 4C22A 3QOWA 5DX1A 3FPBA 1ZXBA 2ZJBA 1WCIB 3K8OE 2SCUB 3EH1A 4X6UA 1H4TA 4WOCA 1B41A 2GKSA 2JPDA 5AQ1A 5I3CA 4YJ2A 2IPNA 2C04A 2ZUDA 3M8KA 2OZPA 3OG9A 4GPD1 4NAHA 4O59O 4P31A 5CCXA 2CFCA 3HK2A 3EK2A 3SSMA 1QS0A 2PX6A 1A8PA 2CVFA 1SCIA 1VMKA 4ID3A 3RJMA 4MP8A 3IR5A 5DNVA 4YONB 2HQBA 3RFVA 5CEFA 4EB0A 1G8JA 1FFHA 1YOVA 1ZIYA 2WFLA 2WQZA 3AF1A 3ZWYA 4B46A 4K9PA 3RS5A 4DXAA 1JQ5A 2NVUB 4RPKA 4LYGA 3SXJA 3MQ4A 4MV6A 3K9LA 5IH7A 1MZPA 1PJSA 5FA8A 4CCAA 2BGIA 5J1TB 4KXLA 1OTYA 1NXWA 3RBZA 1NFFA 3GJ3A 1VMIA 2M98A 4I6JA 3RVSA 4EJFA 4ZOLB 4M38A 5GONF 3PIDA 4NBVA 4BN0A 1SKBA 1RQXA 5K1ZA 4NMHA 4Y2XA 2Y1CA 2WTBA 1Q0QA 1QV6A 2EWMA 1ZM9A 3HEBA 3H5IA 3GZJA 4GMGA 4NJMA 5AI9A 3PA8A 4UUOA 3UMGA 4GGPA 3ZBPA 4AZSA 3D6MA 2E5FA 1EEHA 2VHWA 3BS4A 5AI4A 2LR0A 4MR9A 1JQLB 3C3JA 3RSLA 2VAXA 1VHLA 3GLSA 2Q6KA 4KSBA 2QOEA 2P2NA 4KDFA 4B74A 3H0CA 4P4GA 1E1CB 1QV7A 5IT9A 2CLHB 3N28A 2AUMA 3UVEA 221PA 3HKCA 2AX3A 2XEDA 1XRRA 3MMPA 2GCOB 3DXXA 1PBTA 2YJZA 3IOYA 1F8FA 3LWBA 4DLSA 4KHPB 1H1DA 1R16A 2HWKA 2PXHA 4N6NA 5IJ0A 2EOAA 2C4UA 1OHHA 1QANA 3P4XA 3QLJA 1EINA 3DLBA 1E2QA 1HNWB 2ZRCA 3C3XA 2QD4A 2SICE 2RH8A 1WOMA 4WACA 5H3HA 1G7RA 3HY3A 4IRMA 2FUG6 2NPIA 5CLGA 5KAPA 5A06A 3OHMA 3IT3A 4NS4A 4XM0A 4YCDA 4CT0A 1FE8A 5KC9A 4QHTA 2ENUA 4QU0A 2VUTA 4L4UA 5DWDA 3II6X 4FXPA 4AN4A 5KVVA 1E9VA 1Q0LA 2ZT5A 1NNLA 3KSUA 1TMYA 1E7MA 2LIVA 3DOEA 3QLTA 3ZCVA 3KQVA 1J25A 1V6SA 1OD6A 4MAFA 1EUCA 3AY7A 4RV4A 5DYWA 1XMQB 3R3XA 2EEPA 1P7VA 3M89A 5G2OA 3UG7A 3G5MA 1RCUA 4CKXA 2GYWA 1YA6A 2GVNA 2X23A 3JQFA 5TDHA 1FU7A 3VSBA 4BFTA 3I52A 1R0RE 1TQDA 3L06A 2FPLA 4EEZA 2Y0BA 4C4RA 4R0NA 5TQJA 2D0DA 1FVOA 1VBMA 3LGAA 2HD4A 3SZMA 3V9PA 3ZHZA 3SBOA 4IYRA 1YHYA 3UWOA 4LJSA 2HK9A 2QUKA 2C98A 2JD2A 1E0AA 3W1VA 1P7ZA 1THMA 3BG5A 2ZOSA 1ZSYA 2P2DA 3DMRA 4RK6A 5C5EA 2YYSA 1HQYE 2JGRA 1XTSA 5TMDA 1W85B 2BCGY 2X8JA 1XXHA 4QT0A 4F86A 2OHGA 2WJIA 2X1MA 1GCAA 5AKXA 3ZCRA 5IKMA 3G82C 3AFOA 4CQLB 4BO4A 3CSDA 3E7DA 4BO2A 5HJEA 3NHRA 1UT5A 4HQKA 5JAZA 3WWZA 5ABPA 2IS6A 3B7GA 4U2KA 5DW3A 1LC3A 4D4IA 4NR0A 4F12A 2XE4A 3UJ7A 2QV0A 4ZCRA 1O95D 4LRWA 2GBGA 3FAKA 2XA1A 2ZROA 1ZEMA 2B92A 2I99A 3BF8A 4A0GA 4EF6A 4S05A 4UPVA 3R6TA 1MQAA 3UMJA 3WHPA 1T29A 1XRMA 2B2XA 1FTQA 1OIVA 4HTAA 5EWJA 5KAMA 4WNIA 2YFQA 5IM4A 3GPLA 3BT7A 2ATIA 3C3EA 3T7AA 1QWOA 2JJ2D 5TY0A 1X8KA 1EUDB 3IP8A 2R47A 1Y5LA 3VO1A 1D7OA 1EB9A 1F5NA 1O4VA 2FUNB 3ZS9A 4NCJA 4FFBB 3PGVA 3TI7A 3QY0A 4M1WA 1R64A 4P4LA 4G85A 1E7YA 1L7XA 3PJFA 3QHPA 1SXPA 5CA1F 1KYWA 1W4AA 2G71A 4FFNA 1SQSA 1M5RA 2B99A 3K70D 1V7ZA 1YZFA 2D62A 2AZTA 3TQTA 1NF2A 5AM2A 1BXRB 1ONSA 3IP5A 3LQ4A 4LRQA 3QFSA 2QL5A 3D4LA 3VPHA 3ZDYB 3DR3A 3GVPA 4MJXA 3K0CA 4UMFA 5HUJA 1QUFA 3E0XA 3W8NA 4EIWA 3AOGA 1JH8A 3ETDA 1V7QA 3LK7A 3EUAA 3PKIA 2HREA 5KSPA 2P2ZA 3CEMA 4NEGA 4EI7A 2ID9A 1VP9A 3HL0A 4XVHA 1E2HA 1UEIA 4WY2A 2WWVD 4F21A 1V95A 6REQB 3FY4A 1X7YB 2FDXA 2Q5EA 1XQ6A 3RUAA 2I6UA 2PZEA 2ZTMA 2R8RA 5CEEA 4Q9HA 1NW3A 1SN7A 3IAXA 1X7ZB 3E58A 1BGWA 5LXTA 1NUHA 4Z9XA 4NULA 2FPMA 3G2PA 2YXNA 3THRA 2XYVA 1Z4MA 1UPCA 5JNUA 3OU2A 5IDWA 1ECFA 4FFMA 5K6TA 1N6OA 4AN1A 4BEJA 3FWPA 4G07A 2R6DA 1ISSA 4J0DA 2YWCA 3SK0A 1L3IA 2W6QA 4FSHA 3VHXB 4F1WA 2FSIA 1DCTA 3DL4A 4XD7A 4BNDA 2G7MC 1TRKA 3GJZA 2AGVA 4N8DA 1FZQA 2A1UB 3GYBA 3UKDA 1Z5VA 2VKQA 4O1HA 5KZMB 1ZC3A 2B4KA 3L7NA 3G9UA 4HN9A 1NJGA 5B6JA 4D42A 2D3TA 3H3FA 3ZHRA 3HVHA 1BXZA 1G8SA 3OICA 1REQA 1N2GA 3ZEAA 4UPDA 5J23A 3U4GA 3DKKA 3OBIA 1U2DA 4N3BA 2F8TA 1RRCA 1LBEA 4NE7A 3GMDA 4N0EA 4MRAA 5HOQA 2UYHA 3R3ZA 5AJVB 3UMMA 1IEVA 2DUUA 1T4CA 2PLNA 3VMMA 2A7QA 2AQHA 3CVJA 3GLIE 1RRGA 1RYBA 4J94A 4O2BF 4GOLD 2NTYC 3P5BA 4DT1B 2Q5CA 3ESCA 4AQDA 3N8DA 4X1IA 1NQUA 1KVQA 3JAWA 4GMXA 4S1VA 5JQGA 4RVDA 3DBIA 2UUBB 1WSAA 2VQSA 1VYVA 4G0ZA 5CYOA 5FOVA 2XY4A 4DCVA 1VOTA 2VSFA 3R74A 3ZJ4A 2D8AA 3PCTA 3MJVA 1R1DA 4S1OA 1OR8A 2PR7A 4FGUA 2BCJQ 4IHAA 1W7AA 1WU7A 2NO0A 1B8OA 1T35A 4OHCA 3PFWO 5ECDA 3FOBA 1FK8A 2AW3A 4MP6A 3R9KA 4BNXA 1LDMA 1HQCA 3BH6A 4WASA 2PVCA 5HFNA 2D2XA 1I13A 2ODTX 5JR3A 5LOVB 1DRWA 1ML4A 5E1BA 4BZWA 2QRKA 2WYVA 1KI6B 3DVLA 2Z58A 1NRJB 2MYTA 1QH8B 2QM3A 4RNDB 4MQBA 3HU2A 2HXGA 4K9QA 3ZDEA 1BDHA 4BEWA 1VLJA 2XZTA 5TPWB 2OBYA 3TSAA 2NVUA 3LTNC 2WINI 2R68A 1DBVO 3EZGA 1UK7A 3AM3A 3FWNA 3IVCA 4M87A 3JQBC 1CRZA 1MX3A 4QVGA 1ZOSA 4YMVA 5BQXA 4ZAXA 3OOSA 4FR2A 4LXHA 1CZLA 1T9KA 1GKYA 3CU5A 2PEZA 2QP4A 4R3UC 3COYA 1UAGA 1SUDA 1TCUA 3K1YA 3B3GA 5AVTA 4JGIA 2VPYA 5EFZA 1C4WA 2ATCA 4NK5A 3CEHA 4ETIA 1YF3A 4PXSA 5JOQA 3JQ7A 2AQ8A 3RR2A 1P8AA 4LTDA 3FNHA 4DG9A 1NW7A 2PL3A 1UDXA 3L79A 5L7YA 1O96A 2CZCA 5T8KA 4EYGA 4M0LA 4R16A 3WYFA 1T9ZA 1TF2A 2AC2A 1NXTA 2HMAA 4PPNA 5EFOA 1QMGA 3GC6A 4YUWA 3HJTA 1BS1A 5DHQA 2P4UA 4L8WB 2JFBA 2WYUA 3TRJA 1HEUA 2V59A 4CG2A 3D0RA 4WCVA 5DRTA 2QBYA 4NNOA 4WKGA 1E3LA 4DC1A 3SYNA 1U0JA 3P2YA 3TECE 3JS5A 1U0NA 1G66A 3EFBA 1E0DA 3EMKA 1RYFA 3UC5A 3FOZA 1SOUA 4RZUA 2JFUA 2XVZA 4LF9B 4MMYB 4ENRA 3ZV4A 3VU9B 1SVNA 4LJKA 4L7QA 4INAA 4K46A 1JIJA 4HDKA 4R71A 4WINA 4Q9KA 5HIKA 3HBLA 1A9XA 4N47A 4MNTA 2OQVA 3K6SA 2O57A 5IJAA 3QTTA 4FSDA 1KE1A 1VHQA 1OFTA 1KRHA 4PN3A 2NYVA 4LJYA 4BFYA 3SWWA 4DR4B 2B1IA 2PXAA 1PFQA 1B23P 2H08A 4LRTB 1XU4A 4NPAA 4CEIB 2FFRA 3K92A 4C7OA 2ZUCA 3DZIA 2AR9A 1RWWA 3CZCA 1JZQA 2MT9A 1FNNA 3AR6A 1GYQA 3EIHA 1RXUA 3LA6A 2VSXA 3FSGA 5EHIA 2X0FA 3TOVA 1BX1A 2BGUA 3H2KA 4DSUA 3USZA 2XCLA 1H2XA 2GK3A 5ADVA 5KNLA 5BN1A 2CXOA 4B33A 4ZC8A 5H02A 1PZNA 1J24A 3IH5A 1KBOA 2R6GA 5HRAA 3RYCA 2GM9A 2OPHA 1M73E 4N5LA 5BUQA 3DWGA 5TXGA 3WDLA 4B45A 1E92A 2RGWA 5K2OA 5FADA 9ABPA 3KEFA 5SZHB 3BQMB 4MUAA 3HB9A 1Q1QA 3EEBA 1C9JA 3DMTC 1GZSA 4OB6A 5U4XA 2RDMA 1D6SA 3CN9A 5EVCA 4LECA 2XYPA 4PCUA 1GLVA 1BSVA 3I6QA 4WESA 2O3TA 1U3GA 3A6HA 1DELA 1TQ2A 1AH2A 2DWOA 1FVFA 1XLWA 1UXKA 2R84A 4IGFA 1THZA 1RKVA 4X63A 5EJ2A 2HA0A 1HFWA 1OXKB 1TVKB 3INNA 4KLNA 4JH0A 4UHCA 4D9HA 2HX1A 2QHXA 1NVXQ 2VT6A 3AX6A 4RA6B 5D1HA 1U8CB 5EZYB 3GH3A 3OLVA 4J6EA 3WGQA 4G