4CMIA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 94
structure length 249
sequence length 267
chains with identical sequence D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmiA00
1H93A 1Y8QA 4Y6SA 5I8WA 4ONEA 5AXCA 1SCUA 4DVJA 4NJMB 4CLHA 1AGNA 3TDKA 1ZFNA 5TS3A 1YH3A 1VSVA 4D7AA 5F21A 1TLTA 5CDTA 1XU7A 2Y05A 4IDBA 5AXDA 3GN2A 4Z9YA 1C3VA 3MJSA 3RUEA 3NX4A 2NU8A 3DFUA 3HN7A 4FFOA 3QW2A 5LDGA 1LDEA 3D3WA 1ZEMA 4MIYA 4U0JA 5CDYA 5IDXA 2FWMX 4CM7A 1UJMA 1TXGA 3DBHB 3B1FA 1LRLA 1NFQA 4BNMA 4E12A 4GH5A 5A03A 4BB5A 2ZATA 4W9NC 3ANMA 3CUKA 4N54A 3HSKA 4FW8A 4MVJD 1X0XA 5B1YA 3UXYA 2O7SA 3WOHA 1ISGA 5A4DA 2RIRA 4R01A 1ADFA 3QP9A 4YXFA 4WUVA 3EZLA 3MTJA 5MGBA 3Q0EA 4I1IA 3Q9NA 2HMUA 1W4ZA 1WLYA 2EEZA 2C07A 4LVUA 1RKXA 3JQFA 3VC7A 3GDOA 2FP4A 4NG5A 4DPMA 2B5VA 2ZTUA 3TOXA 1ZW1A 1QYDA 2QX7A 4GQAA 3JQGB 1PGQA 2EJVA 2GO1A 4RVUA 4GVLA 1C0IA 1IY8A 2PLAA 3G17A 1GU7A 3KYDA 1SB8A 1WP4A 2Q1WA 4IY1A 4BS9A 1ENZA 4ILKA 4XJTA 3L9XA 3W6ZA 3GH3A 3B6ZA 3F47A 1VL8A 1LC0A 3ETDA 4ZGWA 4J91A 4CUJA 3GMSA 4WKGA 4YA6A 4IQGA 4JX8A 5FEUA 4OXYA 3QIVA 3DBRB 1ZSNA 1C1XA 4I8XA 4DLAA 4YJFB 1UDAA 2J8ZA 4J7CA 1LDBA 1Y9EA 4BO6A 1NQOA 2IZ1A 5ICSA 1DAPA 3U09A 3RFXA 4R1NA 1ENOA 2J6IA 4AFNA 4IDFA 2RH8A 3AUSA 3NDIA 5T57A 4MVJG 2C7GA 4FGSA 4XR4A 2WM3A 3DOOA 3GEDA 4MP8A 5G0UA 4B3HA 1A7KA 1PJBA 3CPSA 3GGOA 4YAJA 1KS9A 4FCCA 1VLLA 4IS3A 1HDCA 3VVCA 4M86A 2B36A 3C85A 4J4HA 1ZVMA 5HA5A 4Y98A 2JCYA 3JQDA 1YDEA 2VZ9A 1ZCJA 1PJTA 3WGGA 2FPIA 4WNCA 2NU6A 1N7GA 1PGJA 4NMHA 2G82A 3BMCB 4BO3A 1K6XA 1NBOA 3DAPA 3ZN2A 3A06A 5CEJA 3TF5A 4EEZA 5HRUA 4NBUA 4A26A 2O2YA 3QVTA 4AJEA 2W2LD 3RCBA 3RWBA 2PR2A 4CM4A 3MTGA 3GNTA 1LRJA 3OSUA 3JSAA 3DL2A 2QHXA 3CZMA 2TMGA 1GV0A 4RVGA 4BNLA 1Y8QB 1EDZA 2Y1DA 2G1UA 3FR8A 3N74A 4F45A 3B20A 1KEPA 1PS8A 2V65A 4K28A 4M89A 4NJMA 1HDRA 1UP7A 2B69A 1XR3A 3ONDA 5L51A 4GWGA 3F3SA 4H3VA 1W73A 4J9VA 3GPIA 1DIAA 4M55A 5EINA 4CM8A 2BGMA 1NP3A 5KVSA 1ZZEA 2YUTA 3S1LA 1LLQA 2DPHA 3W8DA 2VZ0A 3WMWA 2ET6A 4FC7A 4MVJM 2FR8A 4CR7A 3OEWA 4RVDA 5JDIC 1BWSA 2VHWA 3DBHA 3ZWBA 3SXPA 2XF8A 1G1AA 3AW9A 3GEGA 4LGVA 1YOVA 3P19A 4R5HA 4I5FA 5COQA 4MKRA 1F14A 3QSGA 4GKBA 3EYWA 4L74A 1QLHA 1GPJA 1KY4A 2VNAA 4CV1A 3BTUA 3BXXA 1UAYA 1WXDA 4E5PA 3O4RA 4WASA 4RF2A 5DZSA 4YWJA 2Y1OA 2GR9A 1NAHA 1E3IA 4XQGA 3I9NA 1QYVA 1YQGA 2J3HA 4WGGA 2NM0A 2V7PA 2VCYA 3KYDB 4B4UA 5BR7A 1G0NA 1VJ0A 3U4IA 1LI4A 1MC5A 5B4TA 4FB5A 3O03A 3EW7A 1KBZA 1SO8A 4R41A 3PVZA 1FMCA 2QYTA 2HLPA 4R1SA 3FR7A 2JD0A 3NTRA 4IMPA 5A05A 3FI9A 2X9GA 4ZA2A 3AY7A 4I9NA 1K89A 3U0BA 2PD6A 2OBNA 2OUIA 1J0XO 5EERA 1EFLA 4YAIA 4BO2A 2EGHA 2Q45A 3L6EA 2YZ7A 1WPQA 4BNXA 4CQLA 5BSEA 3O8QB 2I6TA 3KBOA 3WNVA 2NQ8A 1MP0A 2VWQA 2FSVA 1SNYA 1GYQA 2BGKA 4IMRA 4UEJA 1B3BA 4B79A 3U49A 1ZJYA 4E0BA 1I5RA 4BGIA 1K0UA 2BMAA 5JCXA 4QECA 4PGFA 2EW8A 3K73O 1KIFA 4PZDA 5KOIA 3NDRA 3KB6A 3OEYA 1BVRA 4G5HA 3X2FA 3ANNA 3GC6A 3IJPA 1PU2A 3INGA 4JP2A 1KVQA 1GCOA 3AK4A 1Q0QA 2FHSA 1B26A 4PVCA 1ZK0A 2EV9A 2OO5A 1NVGA 1NQ5A 4JBGA 4L75A 1GQ2A 4Y6PA 3EDMA 2P9EA 5TT0A 2AQIA 3GMDA 2BLLA 4XDZA 3GY0A 3PEFA 4WEOA 3CZRA 4KDEA 1DO8A 3ZW8A 4Q39A 5KVVA 4J7XA 4WOKA 4YJDA 5H81A 1JW9B 5JYDA 1ID1A 1LDMA 1XGKA 4QXMA 2P5UA 3FWNA 3VZSA 3GAZA 4EI2A 1B2LA 5AYVA 4CR8A 1ML3A 1HL3A 3VVBA 4TRJA 2YV1A 3RU9A 1B8UA 1ZXBA 1E5LA 2VRCD 1YVEI 1E6WA 1DPGA 3OJFA 5DOZA 1J49A 1JAYA 1E5QA 2B4TO 2DBRA 2HK8A 4JROA 4AG3A 4WLNA 3CMCO 3I83A 4BNVA 1GY8A 4ZQHA 2TMDA 2Y1EA 3ENNA 3Q6IA 5U1PA 3DHYA 3ZH2A 4N5LA 3IP3A 4CODB 2XPCA 5L4NA 3RKRA 3U3XA 4WPGA 3ZV3A 3QWAA 4NBWA 3RKUA 1H6DA 4JIGA 2VN8A 1DEHA 2DBZA 2I5PO 1HRDA 2JCXA 2EF1A 4B7UA 4DREA 2AEJA 3I3OA 3C1AA 3ABIA 3IL2A 2DKNA 3C7CB 2JCVA 1FDSA 4F6CA 3WDSA 4L4XA 2C54A 5GMOA 3GVHA 3UH1A 1JN0A 3JD2A 4ALIA 1TEHA 1Y9AA 4OKIA 4F46A 1ENPA 4FOSA 1DHTA 1HE5A 2FSSA 4RPGA 4XIYA 5G4LA 3VH4A 4OIMA 2GN6A 2J3JA 4AJOA 3GHHA 4PIVA 3WYBA 4ND4A 3NAQA 4TVOA 1R0LA 3JQ9A 3E8XA 2ZIZA 2C82A 2YW9A 5KKCA 2IRWA 1C0LA 1HDGO 5TGDA 3FPLA 1DC5A 4QSMA 1V3TA 3IP1A 4BV8A 5L45A 1LTHR 4HNGA 1LLUA 1OOEA 1PGNA 1O89A 1EUDA 4P38A 4Z0HO 4EJ0A 3GRKA 3EVTA 1TA4A 2NNLD 1IULA 2PZJA 5KVQA 3H2SA 4DUPA 4E6PA 3VZRA 1CERA 5F1PA 3LT1A 1EZ4A 2P5YA 2CVZA 3BMNA 4A2CA 1A5ZA 1H5QA 4CQLB 3KV3O 4OO3A 2DUWA 1LBEA 2PKQP 4BKRA 4TZTA 3EY4A 2DVMA 3Q9UA 3RC9A 1H2BA 4FIZA 4O5OA 5DBFA 4K26A 4NI5A 1PJ4A 3K30A 3PFWO 3UICA 3S2GA 4TRNA 4DYVA 1YBAA 3DMTA 3C7AA 5I9NA 2D0IA 1PEDA 3AI3A 2VUTA 4ND1A 3HZZA 3ADOA 4ZRNA 3RIHA 4BNUA 1W0CA 4BNGA 2HK7A 3R3JA 2GERA 1U4SA 4PLVA 5IDQA 3TJRA 1H94A 1GEEA 3ULKA 3UVEA 3HFSA 4GGOA 4B7CA 4ZN6A 1JVSA 3UCEA 3HNPA 3PK0A 4PRLA 3KLPX 5JS6A 2HRBA 2G17A 2Y0DA 4E13A 3PHHA 5JW6A 3HB4X 3FBTA 4OQZA 3PIDA 3WQRA 1JKIA 2AQHA 3GGPA 1KYQA 4YJHB 4J0FA 1VPDA 4YBZA 5EJ2A 2Q50A 1DSSG 4YTEA 3RAJA 1PR3A 1KVRA 5A9SA 3K2EA 1M6WA 1U8XX 2CVOA 4L9RA 5CDSA 5K6AA 3RASA 1DDOA 2I65A 2O48X 1BXGB 2EW2A 2X86A 3UFXA 3EZYA 4L4SA 1S6YA 4LVCA 4U6QA 4CMBA 1E7YA 1H9AA 4TROA 5ADHA 4B4OA 2W2LA 1DOHA 4M87A 1B0AA 1R12A 2IEDA 1D7OA 4J2HA 4YRBA 1EVIA 1Y8RA 5FYDA 2W90A 3H9JA 2JAPA 3R0IA 2GDZA 3KETA 2HDHA 5A3VA 1OMOA 5ITWA 3ZHBA 4XR9A 4HP8A 1Z75A 2BHLA 4EJMA 2VHZA 1LX6A 2V6MA 4QUKA 3D64A 1R4NB 1OC2A 1CJCA 3E9QA 2P9GA 1BDMA 4GL4A 1LNQA 1XYGA 3IS3A 3ZWXA 3WGYA 4B4VA 1MFPA 2W2KB 1FDTA 4RVSA 4WLEA 2YV2A 4PG5A 4XYGA 2BFMA 1X7GA 3ZHXA 2ZQYA 2PKQO 4BKPA 1GR0A 1UP4A 3HE3A 3KO8A 3WGZA 1KEUA 1O95A 1WDMA 5G0WA 5T6BA 1F17A 1QR6A 2AQKA 3F1LA 4CM6A 5CFZA 4NZ9A 8ADHA 3KZVA 2WD7A 1XWFA 3NT4A 3PHJA 3PIIA 3Q2IA 2WE7A 2YHIB 3AM4A 3MOGA 1I3LA 5G4KB 4PG6A 1EEHA 4LCEA 4CUKA 1E77A 1F0YA 3DHEA 2FRDA 1NPDA 1X1EA 2YJZA 4E3ZA 1X1TA 5KIAA 2HQ1A 2NVBA 1JKJA 4Q3NA 1ULSA 5CG2A 3JQBA 2RCYA 3C7DB 1P9LA 4RQUA 3TSCA 2VZ8A 3A14A 4YB8A 3AY3A 3ZCXA 1IYZA 2D3TA 2EERA 2IE0A 3JQAD 1EFKA 2QZ9A 3LT4A 1IHXA 5TT1A 3B1JA 3WSWA 3PQFA 4FS3A 5TX7A 3FN4A 4FC6A 4WLFA 3M6IA 5BNFA 3T4EA 3W8FA 5JFOA 4K6CA 4K6FA 4S1VA 3BAZA 4GX2A 3PYLA 1NR1A 1ZKMA 2EKQA 4KUHA 3OIDA 2G76A 4CLRA 4W7IA 5KJ6A 4JGBA 4NU6A 4OL9A 4NNJA 4B4WA 4BNYA 4NFYA 4NH4A 5IDWA 2PZMA 1UZNA 5I9LA 2DTDA 2DC1A 3D4OA 2LDXA 3ZHZA 2JFFA 3CH6A 5JY1A 3ITKA 4YJHA 3RUAA 1XIVA 1CWUA 2JHGA 3UW3A 3E5RA 3P2YA 2NUAA 2FZWA 1XQ6A 5A9SB 2C5AA 1T2CA 3UAGA 1R0SA 1A4IA 1T2FA 4X54A 1GQQA 5JDCC 4YR9A 4P22A 3C1TA 4YT2A 1I3KA 3KOUA 3K31A 4DL9A 2H1SA 3WLEA 2DM6A 2BRUA 4H15A 4EDFA 2UAGA 2C20A 2NQTA 4FGWA 4R3WA 5F5NA 2AEMA 1JQBA 5JMPA 1NWCA 1HLDA 3HWRA 3ZGYA 1E0DA 4HY3A 1ORRA 2GGSA 1GV1A 1BGVA 3RSHA 3E18A 1Y8RB 4I9HA 3JYQA 4LMPA 1P3DA 1FF9A 3I5MA 1GADO 4YAGA 5KTKA 1EVJA 4FBGA 2PZKA 4URFA 4E31A 1I2ZA 3ZW9A 1NFRA 2I3GA 1Q7BA 4UUPA 1ZMTA 1CQIA 5HS6A 3H5NA 1U2GA 2BD0A 3QVWA 2CD9A 3OP4A 1F06A 4LN1A 3R3SA 3A28A 1T2DA 1VE9A 3OHSX 4LMRA 4IUYA 4A5OA 2IZZA 3DTYA 3NT5A 3OIGA 4H7PA 3G1TA 1PL6A 5FI5A 3NGXA 2NVUB 3A4VA 4I5DA 4ZICA 5L7WA 3OQ6A 4OJNA 5BNTA 1UZLA 1TB4A 1ZNQO 2O4UX 2RH4A 2NV6A 4WLOA 3DZKA 1YKFA 1LU9A 1HYGA 2YHIA 1DRVA 1NNUA 3AU8A 3AFMA 5U4QA 5G4KA 4BL5A 5CDGA 4F3YA 1T26A 1P0CA 4FDAA 5KJ1A 7MDHA 3OQ1A 3GVIA 3PI7A 4HX5A 2HKIA 1E1MA 1UXJA 3KYCB 3DAGA 3GNSA 3LK7A 3LVFO 3ANLA 3KEQA 4CMIA 2XAAA 4MKXA 2J5KA 4XGNA 3CTMA 3L0DA 1M75A 3L9WA 4CM5A 3B1KA 3K9QO 3I52A 4TVBA 3TOZA 2YQ5A 2BFPA 5L4SA 1DFIA 3L4BC 2NADA 3PJFA 1X7DA 2R00C 1PZFA 3GVPA 3ZDFA 4J16A 4XKJA 3OMLA 4G81A 2Q2QA 4IXWA 5ES3A 5JLAA 5FF9A 1K6JA 1D8AA 3DHNA 2ZB7A 2F00A 1HKUA 1H9BA 4G65A 3RBVA 1RPNA 4XRRA 1L1FA 1NVTA 3TZHA 4WOJA 4L73A 1SAYA 5L95A 4YAEA 4JN6B 3TRIA 2NLOA 4UVDA 1YB1A 1B16A 1DC3A 1GYRA 1PIWA 3H2ZA 4FFNA 4IQ0A 3ROPA 3ZNQA 3VPFA 2Q4BA 2EHDA 2VHVA 2YDYA 5COAA 2AEFA 3TWOA 5JYEA 4IZHA 4UUMA 1MLDA 3GDGA 3L77A 3PWZA 1NHWA 1E7QA 5J23A 4J49A 5A04A 3E03A 3FRJA 3DC2A 3KSUA 2PTGA 3F6YA 4QEDA 3WXBA 3IUSA 1A27A 4N5NA 3M2PA 3SLKA 5EQDA 1EBUA 2G5CA 1M76A 3P2OA 3RVDA 3I1JA 2O23A 3DBRA 2CUKA 3BZUA 1YBVA 4IXTA 2E48A 4YJFA 3ZWPA 3D1LA 4KMSA 1KC1A 1N9GB 2QIOA 3VAZA 4LRTB 4AJ2A 1E3SA 3PYXA 1Q0LA 1Q1NA 3LT2A 5FFFA 4IZIA 2FPPA 4AL4A 4O0LA 2HUNA 3PGXA 3GZ4A 4DWVA 1NWHA 1LLDA 1PJ3A 3ITDA 3M1LA 4ND2A 3ZWMA 3DBLA 3VHRA 3W4KA 4BGEA 3G79A 2DPGA 2O3SA 4DLLA 4Y8VA 1E3JA 1U2DA 1PS9A 5TIIA 1SC6A 4XZ3A 3TZKA 3H9GA 3BMCA 1I24A 2WWRA 3HFGA 1WZIA 2WEKA 4AJ4A 3I9JA 1GZ4A 1VL0A 4TSKA 2I67A 2GRAA 4UUNA 3NTOA 1MFZA 3GGGA 4FR5A 4ZQEA 4EITA 1N5DA 3WMXA 1B3RA 1HTBA 4ALMA 1ULUA 1OAAA 2C7VA 4ND3A 1VKNA 1T1RA 4D45A 1K3TA 3UHAA 1RYEA 1E92A 2DAPA 5IDYA 3JQ8B 1V0JA 3QVXA 3RQSA 3KYCA 2GLXA 5AQ1A 4CMIB 4GAEA 5LDHA 4R9RA 2NTJA 3R1IA 1DC4A 4BIIA 5IZCA 5F1KA 4CM8B 2VUSA 1YGYA 5JXWA 3G3EA 4ROSA 4XQEA 3WS7A 1T1SA 4YT4A 3FCOA 3GRPA 3SJUA 2PGLA 3WYCA 2B83A 1U3VA 4U0KA 2WYVA 4GSLA 2PH3A 4PN3A 2QQ5A 2YQ4A 4IGFA 4QO7A 1MG0A 3AM5A 4S3MA 2A35A 3PGJA 2P4HX 1N92A 1P0FA 3IMFA 1A9ZA 1NXQA 2I99A 2ZK7A 2X58A 3BIOA 3EUWA 3DAFA 3ICPA 3ZV4A 3GAFA 4MP3A 5B4UA 2E6UX 3QJ5A 2GCGA 1PZHA 4CJXA 4D3FA 2R6JA 3VKUA 1WDKA 3ZU4A 5EPOA 4DIBA 2PWZA 1ISFA 1HT0A 4HFMA 3EK2A 4TZKA 4BHTA 2VTEA 2ZB8A 3QWBA 1YBMA 3JQAA 3ZWNA 1C1DB 3GDFA 3WX0A 3RBZA 4BMNA 4IDDA 4R1UA 3WGHA 1HE2A 1BMDA 4ZD6A 1YJQA 1GL3A 3SBOA 1P77A 2RHCA 1H0KA 3ROQA 4FFMA 3KUXA 4RPLA 2GN9A 1WWKA 2AMFA 3QWFA 4J43A 4MDHA 2OORA 3HQ4O 4M8SA 4PLHA 3W4JA 2Z1NA 3GA0A 1J4AA 2HJRA 4BO8A 3OFSA 3JCZA 4CQMB 1VSUA 4ZVVA 3M2TA 1PGOA 6ADHA 5JAZA 4GX0A 2GSDA 2X9NA 3CSDA 5MDHA 1QP8A 2CDBA 3JQEA 4OKNA 1GCUA 2PK3A 3DWFA 1U8FO 4DBVO 3T7CA 3DXFA 1QMGA 5ER6A 1LUAA 4JP3A 4INAA 1NR7A 2DQ4A 2VYNA 4DQVA 3DQPA 3F4BA 4O59O 3NDJA 4IJWA 4XQCA 5EESA 1I01A 3ONEA 2D1YA 4II3A 4OHUA 4Z3DA 1EE9A 1E7SA 4JJIA 5DT9A 1HF3A 3AFNA 3DBLB 1P1FA 5KJCA 2HCTA 2YFQA 4W7HA 1QYXA 2F1KA 2B4RO 4CMEA 1BVUA 1ONOA 5C5IA 3GLQA 2ZTVA 3RUDA 3I9LA 2NACA 2HJSA 3KM0A 5TJHA 5JO0A 2WDZA 1I3NA 2XXJA 4Z9XA 1U7HA 2Y93A 2GZ2A 4PZEA 4Q3EA 5IAAA 5IZ4A 5JAIA 2VT2A 1ZK2A 1U3TA 1QORA 1VL6A 2QRKA 3DZIA 4U6SA 4L8VA 1E1NA 2YV3A 1HETA 3ADPA 4WE3A 3C1OA 1H6CA 5B37A 1U28A 3BYZA 5DBIA 3ZU5A 1BW9B 4AJ1A 8LDHA 2P2SA 3OJLA 4RPJA 1FXSA 4HADA 1A4UA 2DT5A 3H65A 5BT9A 1KVSA 3FTPA 3KHUA 1V3VA 3GVCA 3IIEA 4UUOA 2EP7A 3MOIA 1NAIA 2BFOA 1X13A 3L6OO 3CE6A 4YEDA 4JCOA 3JQ7A 3WFIA 1LQTA 1EK5A 3WBFA 5HS4A 1VI2A 2O4CA 4CMAA 4MVJA 2YDXA 5L40A 1O8CA 1ENYA 1QRRA 1AN9A 2GN8A 2VYVD 3FTNA 3ORFA 1OI7A 1T2AA 4Z0TA 1PR9A 2H63A 3BA1A 1EE2A 3U62A 4IINA 3JQAB 3PWSA 3VZPA 1CETA 2EXXA 4O63O 4WECA 1EVYA 4C7KA 4DRYA 5TLSA 4WNIA 1SZJG 3DZBA 3LZ6A 3M1AA 1YB4A 2ZYGA 1Y6JA 1F8FA 4KOAA 2A92A 3JQ9C 3OF2A 4BO0A 2HRZA 2VUUA 4PCVA 4A7PA 5AXAA 1AHHA 2X5KO 1YL7A 1VC2A 3NKLA 3V5NA 4XYEA 4P4NA 1DRWA 1P74A 3EHEA 4FN4A 4CQMA 2B4QA 3BTOA 1JDJA 1PJQA 1RJWA 5A9TA 1N7HA 2HK9A 2X0IA 4Q3DA 3ZHYA 4RQTA 5I8ZA 5C37A 5A06A 4YDRA 5K9ZA 4Z6KA 3ETEA 2PNFA 4OH1A 1NYTA 2DBVO 4W82A 3BMNB 1NQTA 4KWIA 4RF4A 4CR6A 1MC4A 1MV8A 3VDRA 2PH5A 2X6TA 1T4BA 3MEQA 5GY7A 3JD3A 3MJ4A 5EIOA 3EC7A 1UR5A 2J3KA 3AOEA 3RFTA 4AVYA 4BMSA 4MO2A 4NU5A 5BSFA 1KETA 3JD4A 3L4SO 4CMHA 3OICA 3WTBA 3LSYA 4JBIA 1Z7EA 5GZ6A 3PPIA 4GVXA 3MJVA 5DF1A 4BNHA 2DUUA 2AW5A 3VH1A 3OA2A 1W8DA 2VHYA 1EBFA 4N18A 3STHA 2V6GA 3HHPA 1PWZA 1N1EA 3IC5A 3W6UA 4E4YA 1YL6A 2EKPA 1UXHA 2V6FA 3H5AA 5IF3A 1GUYA 1IPFA 4R9SA 4E2YA 1MGOA 1SBYA 4IS2A 2D5CA 1YDWA 1HE4A 3KTDA 3N58A 4Z3KA 1UXIA 4DQUA 4C4OA 3BMOA 1QYWA 3GR6A 1MG5A 3AOGA 2O3RA 4KWHA 5CAEA 4NK5A 3H9UA 5A9RA 4IBOA 3Q3CA 1BXGA 1NASA 3QRWA 1V9LA 2B0JA 3H3JA 5COBA 1KVUA 2G0TA 3U5TA 2JFGA 1FDVA 2IXAA 4D43A 3JQFC 1E7WA 4MVJH 3NEPX 4J1QA 1R0KA 4RDHA 1LSSA 3K5PA 5IJZA 1G6KA 2BH9A 2UDPA 4PG8A 1BXKA 4C7JA 3G49A 1XA0A 2ZQZA 1IE3A 2VQ3A 3C24A 1KC3A 3ON5A 3PQDA 1RM4A 2AA3A 2WJPA 4P8RA 4WCFA 4GBJA 4WK6A 1WDLA 2AHRA 4RF5A 4JBHA 1R4NA 4RO0A 3NJ8A 2VWGA 2ZCUA 2AG8A 4R68A 3RI3A 3VDQA 3OA0A 4AJLA 2W2KA 4M54A 1ZJZA 1HWYA 3RUHA 3RJ5A 4PLPA 5B12A 2GASA 1XLTA 1RM5A 4WCFC 1ONPA 3ROMA 2ZJ0A 2CNBA 1L7EA 3S2FA 1I8TA 4B7XA 5L7TA 1JWBB 1P31A 1WVGA 2VYVA 2Q99A 4AJNA 1QSGA 4J9UE 2VWPA 4YT5A 5DBGA 1ADBA 3UF0A 3UOGA 4GX1A 4GKVA 4Q3CA 4MPDA 2WSBA 4UEOA 3NJ4A 5BSHA 3E5MA 1ZK1A 1XHLA 3QWIA 4NBVA 1ZSYA 4YCAA 3SC4A 3U4HA 1BG6A 1H6AA 4UVIA 2GYYA 4BB6A 3TZQA 3QA9A 4B3JA 2VRBA 4DMLA 3RU7A 3IKVA 1OFGA 3H7AA 2NTNA 2A4KA 2DBQA 4R4JA 4RL6A 4L4RA 4BGUA 5B4VA 2AG5A 1E3LA 1B14A 3CKYA 2POQX 3GUCA 2X7HA 5H82A 3SEFA 3IOYA 2C59A 4W9NA 2VWHA 4TMFA 2B5WA 2VT3A 5EQFA 5JAQA 3C3XA 3GHYA 4MJLA 1ISMA 1IL0A 2FOIA 2QZZA 4CMEC 1SB9A 1EUZA 4BNWA 3DFZA 3D0OA 5JCJA 3DDNA 3LU1A 4LISA 3DOCA 4J0EA 4TRRA 1P1KA 1WZEA 3KXDA 4KQWA 3ZWVA 3AUTA 2P91A 4RPKA 1GTMA 3WJ7A 1UUFA 4DIFA 3QQPA 4CLRB 4XB1A 4XDYA 2HMWA 2Q4EA 3FNEA 3VOSA 1QKIA 3IUPA 3VH2A 1LSJA 1Q7CA 1P1HA 4RLHA 1MXHA 4RORA 4BKOA 2GNAA 2W4QA 4JK3A 1IHYA 3I23A 3K96A 3GQVA 1DIGA 5CPFA 2RAFA 2EIHA 1DAOA 4W99A 5L7YA 5KJFA 4DGSA 3LDHA 3HDYA 9LDBA 1TVEA 3BMOB 4OAQA 5T8KA 3VPXA 5JMWA 4BNIA 1E7RA 3D4NA 3JQCA 3Q1LA 4R69A 3WG9A 2JFHA 3UKOA 4CUZA 1I30A 5L3ZA 1B7GO 4DC0A 2VRCA 1N2SA 2ZYDA 3F4LA 2OP0A 3TNLA 4XB2A 3V1UA 3IDSA 1T4DA 1LXCA 3I9OA 3W4IA 3OJEA 1CQJA 2P68A 2CSUA 1UDBA 3D7LA 2BKAA 3ZV6A 2CDCA 2GN4A 1PTJA 2Y68A 3OETA 2GD1O 1PGPA 1Z82A 1YJ8A 3OJOA 4OSPA 5JNLA 3MWDB 1VJTA 4IGEA 1H2HA 2J3IA 3B70A 1OZAA 3SJ7A 1G0OA 4BO7A 1X7HA 5G0VA 3VTFA 4XX0A 2C29D 3CEAA 2BI7A 1MA0A 4YAKA 2FR1A 3DZFA 4U7WA 2PD4A 4BNTA 5TF4A 1CEQA 4NR0A 1Z6ZA 3AM3A 1D3AA 2Y1FA 3OQBA 1KOLA 5I7FA 1Q0HA 4GX5A 4M1QA 4E33A 3INRA 3PHGA 1M66A 1HZJA 4CM3A 5ITVA 1MXFA 1EDOA 1JVBA 3DZHA 5CDUA 1YONA 3NT2A 2JD2A 4EW6A 3TZ6A 3GFGA 1U7TA 3SC6A 5ILOA 3RJ9A 2ZTMA 2DLDA 3PRJA 5I7VA 2FPGA 3K6JA 1PJ2A 2OXIA 4FFLA 4BMVA 4J3FA 2IXBA 4KTVE 4UREA 1V8BA 2WYWA 3G1UA 3OJ0A 4DXHA 4F6LA 4FJ2A 1GD1O 1A72A 2ZCVA 1ISIA 1ZEJA 3DO5A 2ZB3A 4MIOA 2X0NA 1E3WB 2AE1A 2NVWA 3H8VA 3MZ0A 4IM7A 3TFQA 3H9QA 3PZBA 4PLZA 3UCXA 1I3MA 2H6EA 4II2A 1GDHA 2DTEA 3V1YA 3GVXA 4JJGA 3FSRA 2HO5A 1P1IA 3QV1A 3F1KA 4J90A 4IPTA 5I7SA 4ZJUA 6LDHA 1EQUA 2CDAA 3MWEB 3PP8A 4FSHA 4UULA 5HM8A 4HNHA 4NJOA 2WD8A 3SLGA 4EZBA 2FMUA 1N1GA 1AHIA 1BTOA 3X2EA 2O3QA 3LC1O 1M67A 4XYLA 4ZU3A 4CQMD 4Y9DA 1K5HA 4GMGA 5TNXA 5K6AC 2B37A 1M2WA 5TC4A 5DCYA 1IZ9A 2NU9A 2Y67A 3PDUA 2B35A 5L4LA 5JE8A 2J5QA 2NSDA 2BI8A 2R2GA 1X0VA 4UVEA 1FDWA 3VKVA 5LC1A 1IPEA 4BO1A 1VKOA 2JKVA 4PLYA 1P44A 2HSDA 4NHEA 4FFRA 1E7MA 3ZZNA 4HFNA 4QFDA 1RWBA 3S2EA 4ND5A 2NWQA 1V35A 3EAGA 3FBGA 3U9LA 3DB2A 3K8ZA 4CMCA 5JPIA 3W1VA 2IDZA 1S7CA 1F12A 1YS4A 1L7DA 2Q3EA 3QE3A 4RJTA 5F3RA 4TRMA 2PV7A 1X15A 4B8ZA 2O3UA 2W8ZA 1RYDA 4N7RA 5CPBA 4JJFA 3BMQB 5DCWA 1XELA 4ITUA 5K0ZA 5LCXA 1LC3A 5DP1A 3O9ZA 4DPKA 3WWZA 4BQPA 4E5NA 1YE3A 3RC7A 4ALJA 5CEFA 4BNKA 1N9GA 4W4TA 3JYPA 5JSFA 4J6FA 1ARZA 2WMDA 3DTTA 1FDUA 4XYBA 4HV4A 2BFAA 4DIOA 3GK3A 3H3FA 3KLMX 1NM5A 3DEYX 2C2YA 3CINA 3HUDA 3HDHA 4AJPA 3S55A 4MIEA 4PLTA 5GZ3A 3WSVA 3ASUA 3V2HA 4QT0A 1KEVA 1XSEA 4JLWA 4PG4A 4ALKA 2PFGA 4NK4A 2QYSA 1YQDA 5THKA 3TL3A 4HWKA 1E1LA 1CRWG 4KUEA 4YQZA 3KVOA 4M49A 4YRDA 4AJKA 1KERA 3OM9A 4J1NA 1VM6A 3IQDB 3F9IA 1U5CA 1CYDA 4BO5A 1FK8A 4Q3BA 2BGLA 1GYPA 1DJQA 4W6ZA 4D44A 3KEOA 3DR3A 4YYZA 3INTA 3PWKA 4QTZA 3JV7A 3JQ8A 4DYDA 4NIMA 4YPOA 3V2GA 4E2ZA 3AJRA 2PGDA 3ZWWA 5DP2A 2Y1CA 4RDIA 1E3WA 2X9VA 1LRKA 5IZCC 3UCFA 4J4BA 3WBBA 1XU9A 5C7OO 3I9MA 1GZ3A 1IZ0A 2CFCA 1GFSA 2DFDA 2X4GA 3W8EA 3WGIA 1I32A 3NV9A 1GQYA 2Z5LA 3SX2A 3VPHA 2OBYA 4CMKA 2P4QA 5C3MA 5L9AA 1F8GA 5KKAA 4J4TA 4ALLA 3C8MA 5DNAA 1ZIDA 4E32A 4KZPA 4EUEA 4BNZA 2ZYAA 5JDCA 1DHRA 4I5EA 1DLIA 4PLWA 3GOHA 1HSZA 1Q7GA 2H5LA 1LDGA 2D4AA 4WCDA 2Y1GA 3WGTA 4EGFA 2ILTA 1DC6A 3KYBA 2A94A 3WQSB 4XGIA 3ASVA 2VTDA 1SEPA 4U5QA 3PJEA 2D5AA 2GF2A 4U8GA 1E1KA 1TI7A 5T8KC 4IJUA 4FD3A 1C1DA 1V6AA 3PFFA 4I9UA 4WJZA 5A5EA 3BHJA 4ZQGA 9LDTA 4OSOA 2EWMA 5JY6A 1LA2A 1HE3A 1PQPA 1T2EA 2GUGA 5JCJD 3HG7A 1QG6A 4DBZA 1NTOA 2CVQA 1PS0A 5F5LA 5TJ9A 3PXXA 3WIEA 2CMDA 4BKQA 1Y1PA 4E2WA 1EVZA 3BMQA 1EMDA 1Y7TA 3GG2A 2SCUA 3K2BA 1O6ZA 3OH8A 4OXKA 4FJ1A 4RCVA 4WLVA 4CM4B 5IXYA 1DXYA 4BNFA 3PQEA 2X5OA 1YL5A 4LSMA 2Y0CA 3PJDA 5G0TA 3RC1A 3JTMA 2EG9A 3FPCA 3D5TA 3ZNPA 3L6DA 1ZSVA 3DMTC 4L0QA 1JLLA 2JAHA 3FHLA 3I6QA 5G2OA 1XDWA 2IEBA 3AUUA 3WTCA 4AJJA 1D1SA 1YB5A 3JYNA 1EQ2A 4CL3A 2OZPA 4AJHA 4D0SA 3PHLA 3RC2A 3VTZA 4UVGA 4D79A 1JKFA 4YACA 4ALNA 4BQRA 1DJNA 3IAHA 2Q1SA 4R3NA 2Q1UA 3EMKA 4N5MA 3RBXA 2EP5A 1K6IA 2UYYA 1PQUA 4UVHA 1IUKA 1GUFA 4E21A 1SMKA 4DC1A 5GZ1A 2IODA 4XRGA 1QV7A 1DFHA 4OQYA 3WWYA 4EYEA 3BTVA 3DMYA 5JDIA 2Q1TA 1E6UA 3CIFA 5AVOA 2DTXA 1DLJA 5H83A 3O38A 5ER9A 2X0RA 1YOVB 2I76A 3GN1A 3ICCA 1Z45A 3EVNA 1X14A 5HBRA 3TQHA 4YRAA 4XD2A 2CY0A 1DB3A 4RGBA 4Z9FA 4E2XA 1KEWA 4E5MA 5EL0A 1RM0A 2Y66A 4Q3AA 4UAGA 5KWEA 4B8WA 2VYND 1UXKA 2X22A 4BNJA 3FNGA 2CZCA 1BW9A 1QYCA 2EKLA 4NBRA 5U9CA 3BTSA 1Y5RA 4LRSB 1HDYA 3WYEA 2W98A 1AXGA 3H9EO 4CM9A 2Q46A 4CLDA 1SOVA 1YRLA 3E1KA 4RVFA 2IYOA 4GWKA 4I08A 2QG4A 1BRMA 2OMEA 1E6EA 2FN7A 1PSDA 1C0KA 1HYHA 2X5JO 3PZRA 2XXBA 2P9CA 3JQ7B 3ZWCA 1NX6A 1QV6A 3TN7A 5T5QA 2VNSA 3DBVO 2FY8A 3LQFA 3V8BA 2WYUA 2OFPA 5JAMA 1NQAO 4YJGB 2HU2A 4IDAA 3WICA 1BSVA 1UZMA 2O7QA 3O26A 2QRJA 2PD3A 4AICA 5TRTA 5DULA 1A9YA 1R4MA 1EK6A 2GZ3A 1GAEO 5IN5A 2PY6A 2I9PA 3O8QA 2ZTLA 3DONA 1DBVO 1LJ8A 5CP8A 1KVTA 5A1TA 5L53A 4XQ9A 4GI2A 3QHAA 3BHIA 1UAGA 1MUUA 4BKUA 5A02A 3F5SA 1ZK4A 3TPCA 2J5RA 3Q2KA 4P4GA 3H4VA 3JYLA 3WLFA 3A9WA 1HDZA 1WW8A 5F1OA 4O1MA 1C14A 3JD1A 4TKLA 1R16A 2XOXA 5DDIP 3HB5X 4KQXA 4BVAA 4CPDA 1TT5A 4ZQBA 2Y0EA 3IJRA 4IJVA 5THQA 3ZNOA 3WGQA 4J1SA 1KY5A 2C2XA 1DFGA 4J1TA 3L4BA 4EBFA 4H16A 4TKMA 5I7EA 3PLNA 1U1IA 2UVDA 2ZB4A 3HN2A 3ETGA 3NUGA 3GF4A 1FJHA 2X1HA 4IIVA 1HYEA 3VPSA 4XIJA 2RBEA 5DCUA 4CM9D 4BOYA 5T67A 2BELA 1V3UA 2Q2WA 2LDBA 1B8VA 4K9DA 4XCVA 3VH3A 5CEEA 3E48A 4TQGA 2GZ1A 3T7EA 2DU8A 3CXRA 4JNKA 1N8KA 4NFSA 3NTQA 3WJAA 1YO6A 5A3JA 3KSDO 2D2IA 3T4XA 3PLRA 3QVSA 4OXNA 3I9KA 3WB9A 2X0JA 3OIFA 5HWSA 4R51A 1D4FA 3CMMA 1DRUA 4PRKA 4MINA 4XWYA 3ZNNA 2V6BA 3E9NA 4D46A 2D8AA 3QY9A 2IYPA 1LDNA 2ZJ1A 3LT0A 4XYMA 4I5GA 2Z95A 1IOLA 1AUPA 1OC4A 3PYMA 4G2NA 2YFHA 1ADGA 1YWGO 1J6UA 3DOJA 4ZHSA 1K2WA 4J2OA 3S8MA 3JD0A 1LEHA 1H6BA 3WNQA 3LLSA 4RLSA 3WR5A 5A5FA 1VJ1A 3FWZA 3WGOA 4XEHA 3G0OA 3ENKA 5ILGA 1O0SA 1YQXA 1CIVA 1NHGA 2O2SA 4HFRA 3GZNA 1PJCA 2AXQA 1Z73A 1B15A 3U4DA 1J5PA 4NFHA 1ZMOA 1WMAA 2AE2A 2YYYA 2UV8A 3V2UA 1I2CA 1UDCA 1PQWA 3ZI0A 3SVTA 3LYLA 4A73A 1QLJA 4K1LA 3D3EA 3PJGA 3BHMA 3DZJA 5ICMA 1XCBA 4RZIA 4BUCA 1R66A 4YJGA 3AI1A 7ADHA 4R54A 2WE8A 1LQUA 3RROA 3P7MA 2NU7A 1SPXA 2O50A 4WCFB 4PLCA 4KUGA 4D0RA 4A0SA 1R4MB 2O3JA 3HDJA 1XEAA 1ZXLA 1LSOA 5DN9A 1BDBA 4J7UA 5C7LO 5FI3A 2QRLA 1YXMA 5KVCA 2C0CA 2C5EA 4NDNE 3QVOA 5ENVA 2EJWA 1O5IA 3RUIA 4DQXA 3NYWA 1SOWA 4YQYA 4OOFA 3QLJA 1TT7A 5KCZA 4CMGA 4R5MA 4PG7A 3I6IA 3NRCA 4E30A 3PTZA 4HKTA 1Y81A 1PX0A 2Z1MA 4JQCA 1T25A 1AXEA 3NGLA 3H5RA 4IQ8A 3H6KA 2IZ0A 2OOSA 4MVJP 4RV9A 4AJIA 4E5YA 5JC8A 4CV0A 5EMHA 1Q2XA 3RFVA 3WIDA 1TT5B 3R6DA 3E6AA 2VOJA 2Q2VA 1GZ6A 2YY7A 4MP6A 1PZGA 4EJ6A 4YT8A 3A1NA 5TQVA 4LSWA 1PL7A 1PZEA 4RPHA 4A03A 4CLXA 3P5SA 2PGJA 4HBGA 4CV3A 1I0ZA 4GSKA 2PA3A 4MVJF 3JQBC 3AUAA 2OHXA 3FNHA 3K92A 2BF7A 1HZZA 1I36A 1PWXA 3AWDA 4OM8A 1A71A 3Q11A 1ZK3A 4D41A 4WLUA 3VPGA 4BV9A 5T64A 2UUOA 1O9BA 1EUCA 4TWRA 4OOEA 5G0SA 4D3DA 4D42A 4GMFA 2OP1A 1I33A 5FWNA 1WNTA 1GEGA 4XJSA 3ONFA 5I9MA 1JTVA 2E37A 2H9IA 3HJAA 3F46A 4YVFA 3UUWA 4LK3A 4Y67A 4PZCA 4P4LA 2VOEA 4EUHA 1P1JA 4GGPA 1PL8A 3E9MA 1NVMB 1ZBQA 4PLGA 1HXHA 3LC2O 5HTOA 5JBIA 2HMVA 4FJ0A 4DTIA 2Q49A 1DIRA 4UEKA 1I10A 1UH5A 3MJCA 3ZWOA 1U9JA 3MJTA 4CL8A 4MOWA 1MX3A 4NQZA 4IDCA 2JD1A 4R16A 4ZQFA 5ENDA 3VZQA 3UN1A 4QX6A 3AU9A 1ZUD1 2JJYA 3FNFA 3IKTA 1VRWA 1ZO8A 3EGOA 1HLPA 3ROKA 1QXSA 1MB4A 3RD5A 2OL4A 1WMBA 5KJEA 4CLOA 3GZNB 4JXKA 4A27A 4OYRA 3D5QA 3GEMA 3PHIA 3GNQA 4RZHA 4FPXA 1UP6A 3OBBA 5IXSA 2WD7B 3GPDG 4CLEA 5IN4A 4HUJA 1HSOA 3MJEA 2CF6A 1U4OA 1R15A 3ST7A 3HDQA 4PVDA 4HXYA 3ZWYA 1JA9A 4Q9NA 1XG5A 1R6DA 4CV2A 3I4CA 5JO9A 1IB6A 3E82A 5TSDA 3ZU2A 3RUCA 2X23A 4BO9A 3LLVA 3WQQA 1HEUA 1U3UA 4FFPA 3HADA 4DLBA 1LLCA 1RM3A 1PJSA 2NTVA 2X8LA 3FF4A 2RHRA 4Y6RA 1GUZA 3WFJA 3TFOA 1Y5MA 3D3WB 4GLLA 5C7IO 4O6VA 1ZH8A 4BNNA 1Z7BA 1ONNA 3UGKA 4IJKA 3PDJA 2FR0A 3MCVA 3AOEC 4PLFA 4B3IA 3COSA 3LF1A 4EEXA 5EN4A 3F5QA 1JAXA 1ADCA 5DOVA 1HDXA 3AY6A 1CDOA 1JU9A 4IIUA 4MVJI 1XQ1A 3N7UA 2HAEA 5IFLA 4IDEA 5BQFA 4ID9A 1T24A 3GT0A 3U4CA 3JQ6A 4DMMA 3FD8A 4FOOA 1U5AA 2CF5A 3AI2A 3JQGA 2AQ8A 2D59A 1DIBA 1W6UA 1CF2O 2DFVA 4KDFA 2R00A 4L76A 1UXGA 4GLOA 3V1TC 1BXZA 3OECA 4HFJA 1JWAB 3RUFA 4MVJE 1M6HA 1P33A 4NBTA 1P1RA 3QWHA 3ZU3A 2JL1A 2HMSA 4BGVA 4D3SA 4R1TA 1WAMA 3DZGA 3LC7O 1R37A 4DA9A 4IDGA 4ZRMA 1AE1A 4KP7A 4BO4A 3JYOA 2A9FA 1C1XB 1B8PA 3KSZO 3S2IA 5AXBA 4QFCA 3D4PA 2O3TA 4XGKA 4A10A 4OGWA 1PJLA 5CHEA 5CG1A 1DIHA 4QO8A 1GPDG 2UUPA 3GFBA 3L07A 3GUYA 4WEQA 2JHFA 1C0PA 2YHUA 4FQ8A 1LDYA 2E49A 2E4AA 1ISJA 2Y99A 4LW8A 3LF2A 4ESOA 4KTTE 4E5KA 1P45A 2E82A 4GPD1 5JC1A 4OMUA 4RVHA 2PKRA 2FZEA 1I2BA 1ISHA 4CM1A 1BHSA 2GPTA 2OGUA 5IG2A 2NVUA 5BNIA 4EUFA 4CMJA 4PFJA 1O94A 2ZKLA 5AOVA 1U3WA 2QW8A 1NPYA 3TL2A 3KRTA 4CLOB 1A7AA 3ZWAA 2HMTA 1OBFO 4RF3A 4Z0PA 3ZV5A 1XKQA 1NPTO 3TZCA 2PZLA 2EGGA 4LCJA 2I66A 2WTBA 3GG9A 4DPLA 4NPCA 4XA8A 5KNLA 5BSGA 1LSUA 4MKZA 1SEVA 4QQRA 1Z74A 2VHXA 1E3EA 1HDOA 1NFFA 2I3AA 1D1TA 3I4FA
chains in the Genus database with same CATH superfamily
3ORQA 1E2FA 1H93A 2XH8A 3QU9A 4Y6SA 4ONEA 5SY4A 2P2GA 4ZHQB 4NZMA 3T7DA 3CUTA 1IDN1 1OX4B 2DJ5A 4L50A 4OUKX 2Y9PB 3GJSA 3I64A 1P1CA 3NBAA 4I1YA 5TS3A 2PO7A 2ZYIA 4RETA 4ETWA 1VSVA 4IIFA 4G0ZA 3W78A 3F96A 3SF8B 2GTPA 3KXPA 1OIVA 3HCPA 3AHFA 3GLFA 4HO1X 3FFWA 4G5GA 3VTAA 2XZPA 5FWYA 3MJSA 3RUEA 1PDWA 1G6OA 1SPBS 2OZKA 3HN7A 4FFOA 1E5TA 1G3RA 2HWUA 2ZT6A 3D3WA 1ZEMA 1CSEE 1NATA 4MIYA 2XKKA 2X2FA 1OXTA 5KQGA 1Z5OA 2BBSA 2QSZA 3OZDA 5EP2A 3WL7A 3DBHB 2VXOA 1LRLA 1NFQA 3SNKA 1PEAA 5CCXA 4DQDA 2ZATA 3EA0A 5FA6A 3ANMA 1FUEA 1NRXA 4D4GA 1ZNXA 2C83A 3UXYA 3ZUPA 2G77B 5JNUA 1MOZA 1GFIA 3ETHA 4FYYA 1QE5A 2RIRA 1J22A 2I71A 2IU0A 1QLWA 821PA 3QA3E 1Y6FA 2IC5A 3MTJA 4LQDA 3TW8A 4I1IA 3VZBA 4W5TA 1M1YB 2AH5A 1LS6A 5DBEX 4E14A 2DWPA 3GDOA 1JIKA 1JZTA 2VP2A 3OPNA 2W6QA 3TOXA 1TO1E 3AERB 3PKIA 1KEZA 4W8OA 3TAXA 1LPAB 4BVHA 5AVQA 4P92A 2H2GA 2BJHA 1R8XA 2QW1A 1M34E 5KU7A 1JWLA 4RVUA 2BE7A 5F51A 2Z6UA 3G17A 3K70B 4HQFA 3UMBA 3K9HA 5EZ6B 4HYQA 2R9VA 4C6SA 3MUFA 4F1WA 3N0XA 1RW4A 4JHLA 2Q8NA 4MW4A 4V0SA 3FIUA 3GMSA 4WKGA 1TF5A 1C50A 2IGTA 1RTKA 2Q8PA 3N2GB 4OXYA 3IT3A 1HR0B 1W9HA 4UTVA 3DBRB 1EXMA 4JOBA 1GILA 4JC4A 4MRSA 5A5VA 3A1CA 4IUCS 5ALWA 3G9TA 4BQQA 5DM70 4YJFB 2JPDA 3HY3A 3ZUGA 5LB4A 1Y9EA 3T3PB 4M1ZA 4BO6A 5BVHB 1NQOA 1A95A 4L1KA 4BJ6A 5BW5A 3U09A 2WKQA 1KMHA 5FR1A 4AFNA 3GMTA 3IT0A 3TLKA 2WWVD 4FNGA 4Q9AA 3QXHA 4O1IA 4JVNA 5T57A 3IUYA 4MVJG 4DBLE 2JB9A 4XR4A 5DM60 2WM3A 4JI4B 4OP3A 4U2GA 4XSGA 1K0FA 2W22A 3KSMA 5T7BA 1L4EA 3CPSA 1X8JA 1L9KA 1NBWB 4Q3OA 3MRXA 3RSLA 4FCCA 1R64A 2VO1A 1ESZA 4HN2A 3VVCA 4D9GA 1YQ9A 1QTRA 4J4HA 5HA5A 4DFDA 1U9IC 3EX7C 3FZEA 5C1DA 1YDEA 2D00A 2AFRA 1N2CB 3WFZA 1RXUA 1DXQA 3KAKA 3JWJA 4MICA 4NJEA 3TF5A 1MBZA 4FYVA 1K9VF 2EBUA 3KT6A 4FGUA 4TMWA 3PNQA 1D1QA 4BDSA 4BRSA 5CEJA 2A3RA 5DGHA 5J2TA 2W2LD 3RCBA 4OQ4A 4HPXB 3T7JA 3MTGA 3TFWA 3UBMA 3GNTA 1LRJA 1CUSA 2HTFA 2QM8A 4B75A 5FTWA 2OE2A 2EJTA 3IQWA 1TVKB 2XRZA 3JSAA 2PRSA 3FPBA 3OUZA 2QRVA 1APBA 1EDZA 5HNKA 3BGVA 1IIRA 4FMDB 3WGNA 2C00A 4HAXA 1E58A 4K28A 4B32A 2OAQ1 1UP7A 1XR3A 3L04A 1IN5A 1BX3A 1WMEA 4GOJA 3L8GA 1QDUA 3B1WA 4LHYA 4B0PA 4BMZA 4CM8A 4EL5A 3U5ZB 3I1YA 4QFBA 5T3UA 1NP3A 3SF8A 4Z86A 3C6BA 1PRYA 2C2KA 4RZUA 5BSMA 2YR0A 3S1LA 1M6NA 2MSDB 3GLFB 3BCSA 4FC7A 5FWYB 3VR4D 1SWVA 4NICA 1L5SA 3STXA 3TAHA 4GI7A 2ZI4A 1OWNA 3A4IA 4CIWA 1IAQA 1N7IA 2GNPA 2VHWA 3DBHA 3SXPA 2R6AA 1Z0DA 3AW9A 1N4AA 2DE0X 5FV4A 3GEGA 5CX1B 3W3AA 3GWGA 3I8XA 1N8NA 5JG7A 4F06A 4OKSA 2NZXA 4RMNA 1RFLA 3PE4A 1XCPA 1U8YA 3LLUA 5JQGA 1EI9A 1KRHA 4GKBA 4BEWA 1H2XA 3MCWA 3HSSA 1KY4A 1QB8A 3HBNA 2PYDA 3DYIA 4X60A 2C04A 4MPRA 4QUBA 3BTUA 1Q20A 4KR7A 1MC8A 1M1YA 3DV9A 5D6OA 4YCJA 4KCGA 4PR0A 1UAYA 4LECA 4QDOA 3DE5X 4AC9A 2V45A 3WLKX 1MOSA 4UBIA 2DQKA 2QN8A 3A58B 4XX1A 1L7OA 5BVGA 2JLYA 1CHDA 3RYIA 4NDAA 1EHCA 2IHKA 2NSLA 3ELBA 4QHYA 1HORA 4UZEA 2PDAA 2XZOA 1FTYA 4UU1A 5DWDA 2XRFA 1OPXA 4BQIA 2BRUC 1ZG3A 5DTEA 1L7NA 4TV8A 3ZK7A 1SUFA 4I81A 2CUTA 2F1OA 2H07A 1R0CA 1SO8A 1XCJA 1JIXA 2VLIA 3UK2A 1RC8A 1ADJA 3TLCA 3N2GA 2QYTA 1W25A 2BSAA 2JLRA 4NENB 3PNOA 5CLJA 5G40A 3RAFC 5A05A 6REQA 4HT3B 4KO8A 4CKEA 2X9GA 1T0JB 3HEBA 3VR4A 2HPHA 2G5GX 2W6OA 1C3EA 2OBNA 1EX1A 5EEGA 5H4GA 1HGXA 4YP6A 3VYRB 3AY0A 1NN1A 4YAIA 3I6BA 4BO2A 1OI3A 5G3YA 3WYAA 1B6SA 3CBGA 4BNXA 3EISA 1VZ2A 3O8QB 3UAZA 4CKYA 2JFPA 4M0PA 2WWFA 2P9BA 3QE4A 3QFSA 2VWQA 3RVOA 5GONB 3WNVA 2BGKA 1V5GA 1B3BA 3ITNA 4MV4A 3U49A 4LRUA 2ADOA 3TM5A 4E0BA 4BGIA 4TS1A 1SQGA 1T0PA 3QBVA 4QECA 5BMOA 4C0KA 2EW8A 3CWQA 2QD4A 4IIDA 4PZDA 2WG1A 4HJRA 4HK4A 1IN6A 1JG4A 3RYCA 1N2CA 1H85A 3T3IA 2QN1A 2RC6A 2XD4A 4FXPA 2TECE 1SXQA 1GNLA 4B45A 2GCEA 2HSGA 3NW9A 3ENWA 4FE3A 1KVQA 4JP2A 5ETJA 3ZK9A 4EMTA 2BMDA 3WWDA 1IUPA 1O6FA 3AK4A 1SIUA 2FHSA 3LFTA 1FFDA 4GU5A 4DIMA 5J2TB 1NVEA 1CDDA 1RNLA 2ZBQA 2EL7A 4YRPA 1HFJA 1NQ5A 1W35A 4L75A 5HYVA 4Y6PA 3T15A 3TRFA 1TVKA 1YOBA 1U7XA 2AQIA 4XDZA 2BLLA 2C7BA 2QRVB 1JJAA 3GY0A 3PEFA 3IDQA 5BRNA 5KU1A 1WV0A 3AF5A 4KIUA 1Z29A 4W8HA 2BUBA 2ZUWA 4NOJA 1GUDA 4Q39A 3KALA 4MVYA 3ZW8A 4YJDA 1B6GA 3IVGA 4OREX 5H81A 5JYDA 1ID1A 1K8RA 3SQLA 5JS2A 5H9WA 2WU3A 4C7OB 3SR3A 1FVXA 2I22A 2ZZKA 1L8OA 4CR8A 3EZFA 1V5FA 1AKYA 3UTDA 1ORIA 1UBEA 4HX2A 2O7NA 1PT5A 2VK8A 4G4IA 5KYWB 1AF4A 1ZXBA 4IXMA 4B3FX 2XCRB 4HNTA 1YVEI 1E6WA 4C4RA 4LF5B 1E5QA 1XZMA 7AT1A 1Q6ZA 2XYQA 4BNVA 4ENTA 2XNKA 5IJ9B 3JVEA 2JK1A 5J47A 5H4HA 5IK2D 4LF9B 3NTLA 5K8CA 4GMKA 2AN4A 2XPCA 5MF6A 5A3SA 2C7OA 1GZUA 3ZV3A 3PTAA 4NBWA 3EG9A 1O6BA 4FYWA 1H6DA 2Z98A 3BFPA 3FPFA 4PSVA 2X4DA 1KQFA 1DEHA 4HMQA 1YZFA 4H6VA 2UUAB 2ZVDA 2JCXA 3VQTA 3W0LB 2J3LA 4HGPA 4B7UA 5JQGB 4GYJA 1RQXA 4CHTA 1SELA 2OCLA 4ZI7F 1SIWA 3FZYA 1B0UA 3LKDA 3C7CB 1L4LA 1FDSA 3TB6A 3KE9A 4F6CA 3ZLJA 4RY8A 3RTEA 5GMOA 1IB0A 3C8ZA 1FX0B 3FGPA 3MF4A 3UJ6A 4ALIA 3DXZA 4FCWA 1Y9AA 4F21A 3RAGA 1JVNA 4FMDF 1ZGHA 2V74B 1W85A 3GJ6A 2FSSA 3N8GA 3BL6A 4REOA 1DUVG 1S9HA 3VH4A 2I4TA 4OIMA 2ONCA 1RWMA 2J3JA 4HWTA 4WD3A 4AJOA 4QL3A 4LQ4A 4C2AA 1NUUA 1KHHA 1TCVA 4GBED 5L3RA 1NJ8A 2C82A 4JYCA 5JUWA 3T9EA 3D6HA 1C0LA 3KVNA 1ESMA 1TQ4A 4QSMA 3CGGA 1SRQA 5L45A 1LTHR 4HNGA 4TLMB 4F91B 1H4TA 1B8OA 3NNDA 4Z0HO 4NENA 5EJEA 4KFTA 3TRKA 4FX5A 2WB2A 1G5QA 6REQB 3EVTA 4I1UA 2CXSA 4J0QA 4UXHA 1P72A 4DUPA 1CCWA 2DLNA 2YOFA 3LDGA 3GMIA 3KDAA 2QN6A 1GUBA 3QU5A 3BGSA 4QREA 3LT1A 2AK2A 4WDRA 3UMRA 1E2BA 3WISA 4Z1OA 2ZJ7A 3W3AH 3KHTA 5KX5A 2WZCA 3U7QA 3OFNA 1A5ZA 5DGXA 1M1NB 1LBEA 1PE0A 1NXXA 3PGKA 4OQLA 3OG9A 2YXNA 3KT3A 4C4ZA 2ATVA 2DVMA 2V7UA 3DOFA 3RC9A 4FFVA 2PFSA 5LBIA 3T34A 2GB4A 5DBFA 3T99A 4NI5A 1RWNA 3PFWO 3UICA 2XUIA 3HI6A 3X43A 4DYVA 5L6MB 2E87A 5DNCA 2CNKA 1E6KA 2F3PA 2DY1A 2M32A 4AO8A 4F9EA 2O2GA 5L8VA 2HLHA 1QPZA 4M2LA 4KPYA 3HZZA 1OFTA 4PNZA 4V0OA 4ZRNA 1W0CA 4YO8A 4BNGA 3RGGA 2BCGY 1KJIA 1SKBA 3R3JA 2J7KA 4Y30A 3UATA 3JVDA 1GEEA 5TEWA 2CLEB 1C9KA 1LV7A 1Z5ZA 4IHQA 3G9ZA 3EBPA 4PRLA 4OHZA 4CNQA 1TF2A 2MHCA 2W2TA 4FYPA 3NI2A 3TQRA 5BSKA 2G17A 3URMA 2XHZA 3HB4X 4OBEA 3WSWA 3UA3A 2ACEA 3HB9A 1UQRA 1KYQA 4RSHA 5E9QA 4NXNB 4YBZA 1CIPA 3TQCA 4C7OA 2HJ9A 2Q3DA 3PE3A 5JV5A 3A1UA 1DSSG 2HCBA 4HAZA 3FHTA 1KVRA 4GWLA 1QM5A 3K2EA 3GBPA 1M6WA 2CVOA 3CLRC 1C9DB 3M83A 3SN6A 5CDSA 3ERCA 1J07A 4FSXA 1TYZA 2LCQA 1XXHB 4EVIA 5MN5A 2E4UA 2WU8A 3C98A 4AYTA 5ECDA 3P9QA 3QE9Y 3MAAC 3RVPA 1J1ZA 1XJ5A 3A0RB 1JEOA 3A2LA 1A0OA 1ZR2A 4U6QA 1E7YA 3OEEA 4GLBA 2I8LA 3PU6A 4GG1A 1EJ0A 1B0AA 3A11A 4YRBA 1QTQA 1AUVA 3EG9B 1U1EA 3TLGB 3DV0A 1Y8RA 5BV2P 2V7GA 1A9RA 3H9JA 2JAPA 2Z5FA 2OESA 4FHGA 5CLQA 1NN0A 3QVLA 4K0RA 1PV2A 5DBOA 4ZALA 5ITWA 3T5TA 3EBOA 3C6YA 2GAFA 4XR9A 3HCNA 1NNSA 1XMQB 2BHLA 4UNNA 5FA8A 2A86A 2BCJQ 2ZSFA 3ETNA 1RLOA 5H02A 3MGKA 1R4NB 3NDBB 2E7ZA 5GINE 3E9QA 2P9GA 2UXBB 4UNQA 1YC5A 1JIIA 3N2ZB 3ZWXA 2W2KB 3KC2A 2YV2A 1EG2A 4HL6A 4PG5A 4XYGA 5JWRA 5A0TA 1MR3F 1KS2A 2ZQYA 2PKQO 4PZUA 5JWHA 4BYMA 4E5VA 4BKPA 1GR0A 5E7IA 4KODA 1T1EA 5EIFA 3UUFA 1KEUA 3P4YA 3R41A 5G0WA 2NZJA 4PSAA 1QR6A 3MCTA 1JDVA 3CNEA 4NZ9A 4UU0A 3RRYA 4R84A 1A8SA 3LX5A 5HF6A 3VDXA 2P7IA 1T9AA 3C74A 3PHJA 2G8NA 5J5AA 2I34A 4I46A 5DYNA 1HNXB 4GPAA 3AM4A 4X90A 2GFHA 1K8YB 3GNLA 5AH0A 5G4KB 3WWOA 4PG6A 5EFOA 2E21A 2ZIVB 4MS4A 4C22A 1JDTA 1F0YA 3ILXA 1YRWA 4YUAA 5I6DA 4LDNA 4I3GA 1VP3A 3AEXA 1VQ1A 1G7SA 4HVTA 1U99A 1LH0A 3E7FA 1JKJA 4LOAA 3TLAA 4FSDA 3MAGA 1PFWA 3GU3A 4DWOA 2GBGA 3JQBA 3U7QB 3ZHRA 4EK9A 3ZZTA 3WHLA 2BEWB 2IS1A 1RLMA 2WFLB 2YWJA 4YB8A 4LF8B 1IYZA 1SUSA 2D3TA 1IHPA 1H4QA 5LSAA 5DT2A 5TX7A 1DINA 4N4AA 4JP5A 3FN4A 2HCJB 2A14A 3OCXA 3FBWA 4URHA 1M0TA 5EJ5A 1GTVA 1VHTA 5CVUA 2Z2XA 4K6FA 3N70A 1AO3A 2AN9A 3KHKA 4JB2A 2QT0A 2Q0HA 1T8UA 2HLDD 3BAZA 3Q12A 4A0RA 3PYLA 3ZDCA 2JGDB 4TN1A 4QM7A 2GPYA 3OIDA 2E4YA 2H4YA 2HNKA 5K7SA 3RADC 2BZGA 4JUFA 2G7ZA 4FZ5A 4GOLD 4EKGA 3PHCA 1JR2A 4MUJA 3UK7A 1P5JA 1SCDA 3JARB 3ROGA 1QIDA 1NC3A 2G9ZA 1Y3FE 4NNJA 1H8ED 4ETIA 1RZVA 2G88A 3B13B 4EUKA 5IDWA 4PEVA 1GZDA 4K2AA 4QZVA 1UZNA 1MT0A 2H7CA 1R0YA 4ETMA 3I34X 2QL6A 4B74A 2Z8ZA 1GVHA 3UMSA 1DAKA 3CSSA 5FLEX 3UW3A 2UZ1B 1YNSA 2FJUA 2RH9B 2X13A 3LJKA 3QTBA 3ZDYB 1XQ6A 3WBJA 4FX2A 2C5AA 1T2CA 3DEIA 3DMHA 1KU0A 2X14A 4KKXB 3ABQB 1A4IA 3ED5A 3LZCA 1GQQA 3TQQA 1W4RA 3SEAA 4JBLA 4BWFB 1GTJ1 3QBJA 3DBOB 2VPQA 3W2IA 4YT2A 4IILA 3WGKA 3KOUA 3D7NA 3B52X 4ERXA 5EZYA 2CZQA 3PR2B 2ABWA 3EFOB 5IUKC 5J2UA 2A84A 3F7MA 3NC4A 4LJYA 2FEPA 2VK4A 4MWZA 4OQEA 1ONSA 1R0WA 2CWDA 2NQTA 4FGWA 5F5NA 2V5AA 4ZT7A 5JMPA 1GAXA 1NWCA 1C3JA 1VJRA 1H0RA 1X92A 3O47A 4RFSA 2ZSBA 7ABPA 4HY3A 2R6R1 2Y0PA 1HRKA 2UZIR 3LXUX 1UT8A 5ALJA 1BGVA 3RSHA 3E18A 1Y8RB 3JYQA 1YASA 5D5PA 3I5MA 1YDMA 2XOKD 1NDUA 2JLBA 3Q2OA 1EVJA 2UZAA 2BZ1A 4FBGA 4ICIA 4KVAA 5KTKA 4D8XA 2PM8A 2ATEA 3MTIA 2WK1A 1NFRA 2GBFA 4M9ZA 2Y1KA 2NAPA 2FW6A 3H5NA 3E23A 1U2GA 2JGFA 3FYUC 5ERXA 2BFFB 2VQ6A 3MS4A 1YD7A 3R3SA 4FWTA 1VE9A 1PNVA 2FWJA 2GJSA 2PUJA 5AW1A 4FYMA 1E2MA 2IZZA 2YZMA 3DTYA 5E4YA 4MDFA 3H1BA 1E1RD 4MUHA 3NKVA 1JJ7A 2WHYA 3RJMA 4JJEA 4ZEXA 3BICA 3G8AA 2GOYA 4GM1A 2E55A 3NGXA 2NVUB 3A4VA 2IKQA 3GRZA 5FYQA 1M8PA 2CK3D 4YASA 2D1QA 2YIVX 4H7EA 4GYYA 1C1YA 1U2ZA 2JI6A 2V3WA 3OZFA 3U3OA 1LPBB 3V32A 1E3DA 4IIJB 4B2IA 1GGEA 3AFGA 3NH9A 3QVVA 4M1MA 5AJWA 4MV1A 3ZBUA 2QTBA 5LVAA 2A2ZA 3B9QA 5KYTA 3QJYA 1V39A 2B78A 1SKAA 1DRVA 3QE2A 3AU8A 2YJNA 2ZJFA 3AFMA 3PTLA 4K88A 5AJZA 3EFHA 4MS4B 5G4KA 1T26A 7GPBA 4FDAA 4G89A 1SQ6A 3OTWA 5K20A 4ZZIA 5B53A 1SVOA 4HXFB 4N47A 2R7MA 4R8LA 7MDHA 5AOAA 3QEBZ 2CV0A 3GVIA 2VZEA 2WNSA 3NBKA 3ZXXA 4HG2A 3CCBA 4KQCA 2GESA 1E66A 1R8YA 3C7TA 3GNSA 1UBMS 3E15A 4TS4A 5E6RB 3SF0A 1EFHA 1NVWQ 3MINB 3SSNA 1KTIA 4ENUA 2R86A 3KAQA 1EG7A 5FT9A 2BEWA 1M75A 3L9WA 4LI3X 3B1KA 2WFLA 3I52A 3ZGOA 2HSEA 3OVMA 3NHKA 4GDMA 4KE7A 4AO7A 1YULA 1GLVA 2IEYA 4V24A 3X3HA 1G2IA 3PJFA 4YH1A 1X7DA 3PPVA 1OGIA 3UAVA 3ZDFA 1U8EA 2HX1A 2ZIUB 5EE9A 4D6YA 4J16A 2WILA 1SOUA 2DHCA 3R3XA 1HDEA 3A6EA 3R0ZA 3OMLA 2R60A 1JH8A 3LUCA 4G81A 4MR7B 4BATA 1WDWB 3I1FA 4KXNA 5FF9A 2GM5A 4DR2B 3LIPA 1ZC4A 2J48A 1OUMA 4ZCPA 2FW7A 5KNBH 2F00A 2YMPA 3P2MA 3T3GA 4G1CA 5KUTA 1RPNA 4GC9A 3WLOA 3CVYA 2YC4C 2RGWA 1L5KA 4AY2A 1MIOA 3FYTA 1ID8A 1DOAA 3TZHA 2IHVA 1USGA 1W36D 3I30X 2GVDC 3JY6A 4WOJA 5KHOC 2FZKA 3NNSA 4PQEA 4NCNA 4YAEA 1MQ8B 3TRIA 3PFKA 1TQHA 3FPSA 2CLOB 4UVDA 2ZSHA 5LNK1 1JB1A 2BMJA 2IHUA 2BBWA 3D6MA 4FFNA 4IQ0A 3T3DA 4KPGA 2RFLA 5E6SB 1EP1B 4FW9A 1PDVA 2UZ1A 3ZNQA 1LTQA 3TNJA 4C3OB 2JLVA 1Z4MA 4AWAA 3OIYA 2HH9A 5JSZB 1VDZA 1Y7LA 4JKIA 5DIFA 4HHEA 2JLWA 4ZCSA 5JYEA 3TR0A 3QY0A 4Q9KA 5CXQA 1L5OA 5EZYB 5AJTA 1NHWA 3EFOA 5HF8A 4RTLA 5SYAA 4J49A 1NMXA 4KGDA 2AWNA 3ZTYA 3NEJA 3HY4A 3MIIA 4GMDA 2GHQA 3LE8A 3WXBA 4EHLA 3E9RA 4RFSB 5EQDA 5JIBA 1U0BB 2G5CA 1SZPA 4NV0A 4YPFA 5HUQA 1UJ5A 1DQZA 1GPUA 3IE2A 2CBXA 3WGVA 2O23A 4RA6B 3GLIE 1BAPA 4PW0A 3D1JA 3SZRA 4IXTA 4MKIA 2E48A 4EZEA 1W87A 3O1JC 2UVPB 4RPIA 4KLZA 1KC1A 3H5TA 1N9GB 2X19A 4B6PA 4LRTB 3QPBA 1T5BA 1JPJA 3OP1A 2GZAA 3NYIA 5EJIA 1U98A 2J87A 2YVUA 1I3OA 5JCOA 1SUDA 3BHNA 2BFFA 1VE5A 2FPPA 1TC2A 4LX0A 2RHMA 4MMYB 1OJLA 1UC4B 3O2QB 2EVWX 2YFKA 4FE7A 4O0LA 1GCAA 1JU4A 1NW7A 2Q21A 3PA8A 1K4MA 5AKJA 4DANA 4DQKA 2AMVA 3UWOA 6GPBA 1AHPA 3FOFC 3SIXA 4O4IB 3LQKA 3MTQA 1EBBA 2XUFA 3TM4A 4JJZA 4L22A 4EY3A 1CUYA 1PT6A 2PWPA 4FVTA 2AG0A 4M8NE 3CX8A 4BGEA 3ORHA 3K0FB 4IXNA 2DCMA 3SIPA 3QVUA 1NW5A 3GYBA 4Y8VA 4GPZA 1PS9A 1SC6A 4OHCA 4XZ3A 1N5MA 3ZWKA 2F59A 3TZKA 2WIGA 4GE0A 4YAOA 5K0LA 3BMCA 1JMKC 2XGJA 3I9JA 2I67A 3PEYA 1ZMBA 4UUNA 4PFKA 5EQTA 2I7TA 1E8DA 3NTOA 2V59A 2OD9A 1TYBE 2PNJA 3R23A 5BMVF 3I53A 3LS2A 4KYVA 3WMXA 2A0FA 2G1JA 2H7XA 2Z4TA 1NKVA 2QTHA 2GJ4A 1DAMA 1EVKA 4A0QA 4ND3A 1CUWA 3JVVA 5AUOB 3O4FA 4A8PA 1AUOA 1K5DA 1L4UA 2E2WA 1RYEA 3KJZA 1C1HA 3L8HA 3R3VA 4LZAA 2YKGA 3Q8KA 3W5IA 2F90A 1V0JA 2GLXA 1XK7A 1G19A 2INGX 3PX3A 3MINA 5K8UA 2IGBA 5AKZA 4RTQA 2NTJA 2RJ3A 3I5YA 3N7TA 1UINA 1DKOA 3PD0A 3BXHA 3I04A 2R1TA 5F1KA 1L4BA 1YGYA 3KXKA 3A3NA 3NBYC 5KSPA 5JXWA 3WS7A 1GA4A 2VJLA 1T1SA 4ARBA 4YPOA 2WHPB 1U2EA 1KI1A 1YJAA 3F49S 4HGRA 4WZAB 3GRPA 4D8TA 2PGLA 2A58A 4BMXA 1U3VA 4G63A 3DE4X 5JZOA 2QIPA 3QG5A 4PN3A 5D8DA 4QO7A 3IP8A 5JXJA 1QGAA 4LYAA 1DCFA 4D97A 2A35A 3PGJA 1JLHA 3O21A 1QHFA 2X4IA 4IQ4A 5K0CA 1EPUA 1A9ZA 1I4OA 2XXAA 5DYTA 1P2BA 1VLQA 5C8DA 5KWSA 1MIOB 2VNKA 1TGVA 4BMOB 3OZVA 3BIOA 1GFZA 3S1AB 1SC9A 4DLTA 1LTKA 2XUHA 3NUZA 4ATNA 2LWIA 2XZTA 5B4UA 1N33B 3QJ5A 4D3FA 1JMYA 1AV7A 1XX6A 3QV2A 4D1YA 2IQ5A 4PRYA 1YB7A 1WDKA 2IJGX 1NJ1A 2PPVA 3PDHA 1UBSB 1HT0A 3GGSA 4BFVA 4NMWA 4BHTA 1UC9A 1QH1B 2QRQA 2VNIA 3I28A 5D5HA 3VX3A 1ZHOA 2JA2A 3QBDA 1C1DB 3NIFB 3WX0A 3FY4A 3HCFA 3RBZA 1Z15A 3ZWNA 4W8GA 3SC3A 5JR3A 5JSZA 1ZMRA 2G70A 1BMDA 4QPJC 3OIVA 1GL3A 5HJ2A 3PUKA 2Q1XA 2WJGA 1P77A 1OKKD 1A98A 5BNZA 3BGDA 5DYWA 1X1BA 3WOVA 3NQ41 3TOVA 1RXIA 2O0HA 2Z6AA 4K9PA 2OO7A 4B7AA 4DN6A 2OORA 5I7OA 1XNJA 2Z1NA 3ETLA 3HB1A 3SICE 2IELA 1J4AA 4BO8A 1P80A 2P9HA 3T1OA 1YS1X 1M6VA 2XW6A 4CQMB 1V8FA 1VSUA 1OBCA 1NYQA 2EP8A 1E2GA 1A8IA 5JAZA 4GX0A 4RA6A 3D54D 1RAEA 1V3QE 2QRHA 2JAWA 1QJ4A 1K3FA 1Q77A 3HJCA 1NW6A 1XRRA 1CY6A 4ABYA 2NVOA 1X3LA 5C1PA 5MDHA 2VBIA 4NVRA 2CDBA 3ZZ0A 2COEA 3IURA 2C9BA 2PK3A 1YIAA 1HT3A 3OCZA 4Q6WA 1CZNA 4UCWA 1QMGA 5BUSA 5E7QA 2BY4A 1OASA 2DQ4A 2VYNA 1XZGA 5K8VA 2FPPB 3NDJA 4AUEA 3HA3A 3RS9A 5JJIA 3CPHA 2ZVQX 3DLPX 2IQIA 1UMCB 3ONEA 5DASA 2P78A 3MRTA 3T35A 4JJIA 5EWLA 3C97A 2HOQA 2EHJA 3IX7A 3TIXB 2JH8A 4QD3A 1HF3A 4OI2A 1P1FA 1O6CA 5KJCA 4BX3A 1NQVA 2YFQA 4P93A 1QYXA 1BVUA 1ONOA 4JMPA 4L72A 3KIPA 3II6X 5HDQA 2NMVA 2PUCA 3CJRA 4GIBA 4C5CA 4Q3LA 3ZX4A 1JPUA 2FUG1 4G85A 1E3MA 3CPJB 1PYGA 1TX4B 2CNDA 4I3HA 1T9KA 4RZXA 3KM0A 4KC0A 4CTJA 1KFJB 3QLVA 5JO0A 4ZO9A 3RREA 2RI1A 4Q48A 3FTEA 2XXJA 3DXYA 3RYHA 4Z9XA 1COWA 3X1WA 1EEXB 4PZEA 3O31A 2NP6A 5TARA 5IAAA 3RVBA 1XHEA 2Q6LA 5JAIA 5TE9A 4YP9A 4OL0A 1QORA 5FDFA 2QRKA 4ER0A 5EE5B 2OQ2A 4LS3A 2H4ZA 2P69A 5CCDA 1HETA 3NV7A 5AIAA 3QH4A 4I6GA 2H1VA 4X44A 3OCJA 4BVLA 1I94B 2QTTA 5LYJF 2I3ZA 5DBIA 3MRVA 2X6QA 4IIHA 5B7GA 1DDIA 4KWCA 4F7DA 2OXCA 3S7TA 2H0AA 5CAEB 2VHEA 4RPJA 4ESHA 4BYGA 3D7SA 3H65A 4I0WB 4MZXA 3Q5DA 4JI3B 1KVSA 4WZAA 1NVKA 3KHUA 4WKPA 4X7RA 5FPYA 4F9FA 5BV7A 2CV2A 1XNRB 2JHPA 5IC4A 4O4IF 1DZIA 1XZDA 2EP7A 2RJNA 3P0JA 4Q12A 2BFOA 3HEMA 1VIMA 3MSCA 3NPMA 3E05A 2QXUA 3JPYA 5D3KA 4Y2GA 4DR6B 1C8LA 2YV4A 2ZE7A 5AW7A 2EQAA 3U4AA 1VI2A 4EJFA 4BLRA 1E89A 3C8UA 4MVJA 1H8HA 3S1AA 2HF7A 4JV5B 5ALOA 3STWA 3YASA 5L40A 5LU8A 2JEYA 1UANA 1TTTA 1FJGB 1UBLS 1PF7E 3D3JA 3THOA 3DAOA 3A3KA 1E2DA 1QRRA 1AN9A 4M1YA 5FUYA 3W9YA 5ADUS 1EFPA 4JEUA 2VYVD 3P4XA 1U2GC 2D5IA 4X92A 5EKDA 3SJAA 2XCSB 1UEJA 2ZBPA 3N2IA 2D6FA 5DV9A 3ZIDA 5HKAA 4Z0TA 1A97A 3U62A 3BA1A 3UGJA 4IINA 3P0EA 1COWD 2JAQA 1NUQA 3CO5A 2BDUA 1SC1A 2V3VA 4M6WB 2HQBA 5FUXA 1EVYA 2F7SA 1EFCA 4WNIA 4EI8A 3DZBA 3AKEA 1YB4A 5F98A 1Y6JA 3D8BA 4WBNA 1YU6A 2FP3A 1V8ZA 2NYRA 1OAOA 3LLCA 2NYVA 4ZGBA 2JGNA 3PX7A 1NOJA 1AHHA 3LW8A 1KJNA 3Q3JB 5J63A 2ORVA 1VC2A 2C2MA 2BHRA 3NKLA 3V5NA 3K0EA 5IM5A 4WN9B 4PHFA 3H1AA 3SC2B 4CQMA 4FN4A 4Q1VA 2VR1A 4JGIA 2ZRNA 3UOWA 2Y6UA 3EWIA 3LHIA 1V5EA 1IEQA 1P81A 4UC0A 1RJWA 1F9EA 3W6NA 1IJBA 1ZPDA 1OHHA 4Z49A 3AGQA 1YDHA 4RQTA 2ZM6B 1MJFA 4GW3A 5JH7A 5K9ZA 3O74A 4Z6KA 2PUAA 4OJQA 1NYTA 4QUIA 3BMNB 2Y76A 2BGJA 1T4BA 2GN2A 2J0VA 1E9BA 2X6TA 1TEVA 4C6TB 1FJXA 1UMCA 5IEJA 1SIOA 3IUQA 5EIOA 2BHSA 3MFQA 4Q4JB 2G40A 4AVYA 3WIOA 4Q4LA 4UFNA 5F52A 1VE7A 5FWXA 5CLGA 3QLEA 1KETA 3IBGA 2NZVG 2BWJA 2AXPA 5E8RA 4ZWNA 1TCUA 2HIHA 5FBRB 2V7BA 4MIKA 4P98A 5EIHA 1GPYA 3PPIA 1KRXA 4RYLA 2XKAA 4P33A 1YR6A 1Z0JA 1W8DA 2A8YA 1NNLA 3VNVA 3RYHB 1N1EA 1C3XA 1U90A 2EKPA 3H5AA 3RTCA 3DJFA 4R2JA 4K05A 5C0OE 4P54A 5HOEA 2QD3A 3AL0C 1XD9A 4TYMA 4AY3A 1UWCA 5FV7A 2QJOA 1OPRA 3N58A 3TD6A 4ZDKA 5EVJA 1DAHA 4LRXA 1UXIA 2NXCA 4IDNA 4MV9A 1XNHA 1CZUA 2C99A 3EVAA 2O2HA 2FOLA 3BMOA 3WGMA 4TUYF 4B3GA 1DBWA 3ZBPA 2HSZA 4INJA 3Q10A 4QGSA 3AOGA 1AQJA 1Q95A 1NNEA 5CAEA 3BIWA 3FKJA 1K4YA 3RK0A 3VO2A 2FPSA 4DM3A 2QQ0A 4EYOA 2XIJA 3FNIA 2WSIA 2VPPA 1M2VA 3LCMA 1CJSA 2K2WA 2Z8XA 4NL4H 1ZA2A 2ZXEA 2YOHA 4PS0A 4MS1B 1N5KA 1V71A 1E7WA 3JQFC 1RQNA 1GFWA 2BEUB 4UNSA 3LO8A 4RDHA 4Z9BA 3URKA 4M0CA 3PNVA 1SU8A 2M9MA 2XA2A 2XWPA 4F4HA 3FH0A 2V4ZA 3FDJA 4Q9HA 4E6PA 4AKIA 1XYVA 2GBPA 2UDPA 3DSRA 4FTWA 2KW5A 3A31A 1FNCA 4JEHA 4U7FA 4EPWA 1Y4ZA 1XA0A 2W48A 3C24A 2CN1A 4YK7A 5TMBA 3SCZA 3ON5A 3TL6A 2GCPA 3MCAA 3IDZA 4LGCA 3U4GA 7REQA 4WK6A 1YZTA 5T4BA 2VJPA 3H4TA 1Z2OX 2GK6A 3PFHA 5DBHX 2P8SA 3B78A 3REOA 4JBHA 5GJWC 4WFQA 5IKEA 5M5BA 3PFBA 3NJ8A 2ZCUA 4M9UA 3RI3A 2V0GA 4L6IA 1T5SA 3OA0A 3DLHA 4TL8A 2H5JA 4LJ7A 4M6WA 4UJ3A 1NUPA 4BE4A 1HWYA 4BFLA 3KWFA 4HAVA 1FCJA 2H51A 1KDPA 5FUBA 5B12A 3RS7A 1FDRA 1ORVA 1XLTA 1VA4A 2I03A 3ZCUA 1ONPA 4WBNB 4YQFA 1QF9A 4F4CA 2CNBA 2XCIA 3S2FA 1XAGA 3F98A 2QRNA 4B7XA 2JJ1D 1JWBB 2IPNA 5DLEA 4GSYA 5M29A 1OLSB 4MV3A 4AJNA 1QSGA 2FHPA 2IPXA 3ZGZA 3DDWA 2FUKA 5DBGA 4J8PA 4N48A 1ADBA 4ACBA 4QJ3A 4GKVA 1P91A 3D43A 1BEZA 2WP0A 4LXYA 2TRSB 3GFQA 3QWIA 4NBVA 4EG0A 3SC4A 1BG6A 4Y2YA 2O14A 4BB6A 2Z3VA 2QVCA 1RAAA 2VRBA 1DT5A 1U0HC 2I1WA 2KPOA 2DF8A 2PWAA 1XPJA 2VF5X 2Z30A 3H7AA 4EY4A 2A4KA 3BFJA 5T4FA 1KDYA 5K0JA 3AT1A 4CCSA 3M6FA 3ZLVA 4ZCTA 3DE1X 1Y6ZA 1HH4A 3AUKA 1G17A 4LHXA 5AD1A 2DPXA 1E3LA 3Q3HA 3LBIA 2X7HA 2AB0A 2R7AA 4GC5A 5H82A 5BMVB 1G3IA 1J0CA 2C59A 2FQ1A 2WHQA 3B5JA 4W9NA 2QNBA 5EZ5A 4Y1RB 3QKRA 5IHPA 5DLYA 1Q44A 2IU3A 5EQFA 2VCEA 3SBXA 4LHEA 4ZARA 3W3ZB 3DD5A 1J0EA 3PC4A 3GHYA 1H42A 7MHTA 4KFUA 1ISMA 1YSCA 5IM4F 2YJ3A 1GCGA 1DJPA 3KXLA 3EDOA 4BNWA 3DFZA 3ZBQA 4C4PA 4CGZA 5JCJA 3DDNA 2O1XA 2R96A 4LISA 2VAMA 4IKEA 1KQPA 3KXDA 3U16A 2IH2A 2NX2A 3TW4A 1AN0A 4EGCB 3ANYB 3TKYA 2AC7A 2M2IA 4DIFA 1JR4A 3CRZA 2GYWA 2ZRIA 5FOQA 2AT1A 1D0SA 4AECA 4JLJA 3O2JA 1QKIA 2ZXFA 3K8OE 4OVKA 4XXHA 1K8ZB 5D86A 3UYKA 4MKFA 4C9BA 1MXHA 3RSSA 3ND8A 1OCEA 2Q29A 3LKBA 1JDBB 3K96A 2HF9A 3BWEA 3GA7A 4MDYA 1FLDA 3OT4A 4W99A 3V1MA 4DSNA 3FFBA 3MRSA 5CLHA 4BJ1A 3HDYA 9LDBA 3BMOB 3LPMA 1GQRA 3G2LA 3WRYC 4CIXA 2A7XA 2QUBA 1YVUA 1E1CB 1KAOA 3KVYA 4Q4HB 1JKMA 5JARA 1RKQA 1Q0UA 1II8A 3KVRA 4H3HB 1PT7A 4FNMA 3QXCA 4O4HF 2WM2A 4KN5A 1MJNA 1MVNA 1N2SA 1W94A 1K88A 4MI3A 2O8NA 2VYCA 2AHOA 1ZGZA 3IDSA 1LXCA 4MS1A 1CQJA 1JE1A 1QKKA 3VYUB 2CJWB 2CSUA 2BEUA 4D3XA 2IF0A 5IJAA 4C43A 1XZQA 1RLUA 1FPMA 1Z6PA 2BKAA 4YX9A 3PJRA 4D74A 1NMQA 2GN4A 1PTJA 2O2CA 3E27A 1V8OA 5I8PA 1Z82A 1QH8A 4BLVA 5JNLA 3MWDB 1VJTA 4U7HA 3M6MD 1LX7A 2PXCA 5DHFA 1G0OA 5ALQA 2AUMA 4I2NA 4I50F 1WF6A 3AHGA 4UXJA 1K9SA 1NIJA 1GKYA 5G0VA 5BO5A 3VTFA 3TQIA 2C29D 4D0LB 2QSYA 3PLAE 4MQ6A 2W70A 4I66A 1MA0A 3HWWA 4DJAA 4YAKA 2F64A 3F2IA 3EXEA 4GEKA 2NT4A 4UNIA 1CEQA 2BM9A 3HJBA 4LE0A 2YBDA 1L4YA 1F0KA 3GFRA 3LCRA 3NM4A 3OQBA 3PGMA 2BMEA 2P2DA 1Q0HA 1KOLA 4JUCA 4M1QA 4QDZA 5I7FA 3EXHA 1QYRA 4OPMA 3SHFA 4E33A 4R2KA 4U3JB 2FPRA 5AJXA 4OXXA 4CN8A 2VZLA 1O57A 4IWYA 1EDOA 1JVBA 1MDFA 3CNOA 3DZHA 3THYB 3LUPA 3NT2A 4O8CA 3VSBA 4ZXFA 3TZ6A 2LKDA 1U7TA 3SC6A 2JIPA 4AG6A 2UZ0A 4KGZA 2QUIA 3HYLA 3IT1A 4JUBA 3L0PA 1JIJA 1R1DA 3LXRA 2XCQA 1ND6A 3CJTA 1POWA 3JWGA 4FFLA 4JI5B 4DZRA 1SG9A 3QLUA 4PYOA 4B8YA 5GADl 2XVYA 5KDDA 4UREA 1QO7A 4Z99A 3B9RA 4TYYA 3SQNA 4R0MA 4K6KA 1S2NA 1U2SA 1TRHA 3QX3A 4WXYB 1J7KA 5EIBD 3U7FB 4ZC8A 1UPFA 1AJEA 4FZJA 1WHSA 3W2HA 3N8IA 1OBOA 5HOQA 3D2AA 2BC9A 4KIGA 4MIOA 1E3WB 3P