4CMIA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 94
structure length 249
sequence length 267
chains with identical sequence D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmiA00
1U3WA 1U5AA 1XIVA 1NWHA 2W4QA 4IDGA 3WIEA 1JU9A 1DO8A 4RQTA 2WMDA 4D3SA 3QWBA 3GA0A 5ER6A 3VPFA 3NGLA 2XXBA 3PWKA 1GDHA 2YDXA 3CSDA 2QZ9A 3I4CA 2ZTVA 4OM8A 1DSSG 1U8FO 1YQXA 2P2SA 2J8ZA 4FB5A 3OQBA 5CG1A 4LVUA 3BHJA 3HJAA 4CLOB 2Y0EA 2NTNA 5JY1A 1IPEA 1LJ8A 2PR2A 1BW9A 4CM9A 3JQAA 3MOGA 2BH9A 4CUJA 2GD1O 3M1LA 1VKOA 2JHFA 1IYZA 2SCUA 2CF6A 1A4IA 3RROA 3KBOA 2B35A 3DHYA 4Y98A 3SBOA 3G79A 1VJTA 2DLDA 2OOSA 1HZJA 2I67A 1IHXA 3BXXA 3I52A 4MVJA 2O2YA 3VZSA 1EBUA 2ZTLA 2B4TO 3H9GA 3ZWAA 3EY4A 1KETA 3PTZA 1ENYA 5L4LA 2EGHA 3WBFA 3UOGA 4HY3A 1YBAA 1H2BA 1JAYA 4HX5A 1PZFA 4ZHSA 2V65A 3LK7A 4EYEA 3GRKA 3BMQA 1L7DA 3AI2A 3KO8A 5DBGA 1F06A 2IZ1A 2Q1SA 4HXYA 1BGVA 4IZHA 4UULA 1NX6A 2I9PA 2VHXA 1K6IA 3A06A 5IF3A 1MXFA 3D3EA 3HDQA 4DA9A 2GERA 1I10A 3I9OA 2R00A 1KY4A 1TLTA 3IJRA 3ZU2A 4BNIA 1EQ2A 1UDCA 2Q50A 1Q7CA 5CDUA 2OP0A 4JBGA 3L0DA 3ONDA 3BTVA 4TRJA 4LK3A 1H6CA 5DBIA 1B2LA 5K6AC 2WD8A 3I6QA 3JYNA 4CPDA 1PS0A 2UV8A 3GVIA 5BNTA 1O6ZA 4RVDA 1GL3A 1R4MB 1S6YA 2HQ1A 1QV6A 2B69A 3C1OA 4XYGA 1XGKA 4XYLA 1JWBB 4W7HA 3D3WB 4CR8A 4Q3DA 1Z7EA 1B7GO 1E6EA 1XDWA 1IUKA 2GLXA 4J4BA 4Q9NA 1UP4A 1ZJZA 4KUEA 5EINA 3VPHA 3WNQA 4YEDA 3F5QA 1NQTA 1E1MA 3PWZA 3OH8A 3PZBA 5JMPA 4UEOA 1I2BA 3ZU5A 3BYZA 1ISHA 2CSUA 4HBGA 5THKA 3GNTA 1MV8A 3QSGA 4E33A 3ZHYA 2WYUA 5AOVA 2IYPA 5KNLA 4HNGA 3ZWBA 3TF5A 2HJRA 2W90A 1AHIA 4E0BA 3HHPA 1P0FA 2VRCD 4LMRA 5BT9A 4B4OA 2B0JA 3S2GA 3TWOA 1HLPA 1E5LA 4RLSA 4U8GA 2AMFA 2PZLA 4R5MA 4LRTB 3ROPA 3PHLA 2X86A 3OJ0A 4D3FA 4BMNA 5JC8A 4CJXA 3PPIA 3QVSA 4L74A 2EW8A 4QECA 5A03A 3IKTA 3B20A 3FD8A 1PIWA 4FQ8A 4WE3A 3RASA 1LTHR 3SX2A 3WQSB 3C1TA 2RH8A 5TC4A 1UAYA 1ONOA 2VWPA 2NM0A 2G17A 1E3EA 1QYXA 5CPBA 2ET6A 3EZYA 3JQEA 2I3GA 3TFOA 2QIOA 1I2ZA 2AQIA 2G1UA 5CDGA 5L51A 3PDJA 3WGYA 3WQRA 1Q1NA 3Q0EA 3OETA 4BKUA 1ZK4A 2RIRA 2NLOA 1JVSA 1JW9B 3PIIA 1TXGA 1KVRA 3WR5A 2EXXA 4B7UA 3DBRB 3L6DA 1YKFA 3WQQA 2V6FA 3GPIA 1RM5A 1I01A 4Z9YA 3F46A 2E48A 3DZJA 3EYWA 3HDHA 4URFA 3F47A 3JQ7A 4R3NA 2V7PA 5A9TA 4BO8A 4ZVVA 1AHHA 1R4NA 1P45A 3DZKA 1GPDG 2JJYA 1DXYA 5JXWA 3DTTA 1X7DA 4PG5A 2RHCA 1U3UA 1UDBA 5T64A 3JQCA 3K96A 2ZB4A 4CLEA 4YJHA 3KZVA 2BFOA 4ID9A 4CM4B 1ISMA 2RAFA 4XGNA 5A5EA 3W6UA 1YGYA 4RPJA 4JBIA 5I7FA 4HP8A 3T7EA 5KOIA 2AEMA 4BNFA 5TQVA 4W9NC 2WSBA 3RUDA 4BMSA 3I6IA 1JAXA 2Y67A 1NFRA 3AU8A 3R0IA 4Y6PA 5DOZA 4DC0A 5IZCC 4WCFC 1O89A 2VHZA 3OEYA 3PLRA 1XA0A 4D43A 4KQXA 2J5KA 1QYVA 4NH4A 1T2EA 3JV7A 3VDRA 4JIGA 4GX1A 3OECA 5IFLA 4XJSA 1J49A 3H9EO 3PHHA 5IDYA 3HB4X 4IQGA 2H1SA 4MIYA 1NQ5A 2G82A 2HLPA 2D4AA 4N18A 4W6ZA 3H9UA 3LSYA 5COBA 2QHXA 4XQ9A 5L7WA 4NNJA 2Q99A 1EVJA 4XYEA 1KVQA 3L4BA 5BNIA 4I1IA 5TJ9A 1Z7BA 3PRJA 2YV1A 3FBGA 1M6WA 3FWZA 3GZNB 3KHUA 4ILKA 3O9ZA 2Y1FA 1O9BA 5I8ZA 2GNAA 5EPOA 1PGQA 4NJMA 1RKXA 1M75A 2YJZA 4OSOA 5ES3A 4JX8A 1EFLA 1ML3A 2R00C 3BTUA 2UVDA 2AG8A 3QWFA 5JBIA 2HMWA 3GGOA 4CV0A 4JN6B 3WGTA 4BNUA 1NVGA 2PKRA 1YB4A 3KETA 3ITKA 3CZMA 2B37A 4R68A 4A26A 2GASA 3IAHA 5EQDA 4E5KA 1LC3A 4B3IA 1LC0A 4E5YA 2Z1MA 4XA8A 2WE8A 2F1KA 4B4WA 3GGGA 2I76A 1RM4A 4RV9A 3F5SA 1GZ6A 2QYTA 3AU9A 4Z0PA 4BGIA 1TEHA 2JD0A 3OQ6A 1ZXLA 2OO5A 1IL0A 1GYQA 4E2YA 2B36A 5J23A 4J9UE 3MOIA 4R5HA 1C0LA 3KXDA 4XGKA 1HE5A 4FDAA 4AFNA 5JE8A 3D64A 1EK6A 5F1OA 1V35A 3LVFO 3ZWOA 3W4IA 2PA3A 1Y9EA 4MP6A 4NU6A 3N74A 5BSEA 3DZHA 3P2OA 4ZQBA 2QZZA 4OXYA 4A27A 2DU8A 4DPLA 2YFQA 5JAMA 2YQ5A 2VYVA 4OKIA 1NASA 1K3TA 1W4ZA 3INTA 3E9MA 1XLTA 2HCTA 2DM6A 4M8SA 4GBJA 3GGPA 4OIMA 5LDGA 3TL2A 5T57A 2C7GA 1BXGB 4J90A 4DBZA 3RSHA 5A5FA 4JJIA 2PD3A 3D5QA 3DFZA 1EZ4A 1I36A 2PV7A 4I9UA 1LQUA 4XKJA 5KJEA 5BSHA 2X1HA 4NU5A 3K5PA 3U4HA 1HT0A 5CAEA 4MVJH 1RM0A 1C1DB 1IE3A 2P4QA 2Y05A 4J3FA 3LC2O 4GWKA 1KYQA 2ZYGA 4DPMA 1AXEA 5EMHA 4CQMD 1PTJA 2E37A 4J7XA 2HMUA 3SJUA 3EAGA 3MWEB 4HFRA 3RU9A 1JQBA 2X5OA 1U2GA 1A4UA 4NJMB 4L4XA 1KY5A 5TT1A 1H6DA 1Z6ZA 3IUPA 3DMYA 4IIUA 5K0ZA 1B15A 3CUKA 5GY7A 5THQA 4B3HA 4CL3A 2X7HA 5JY6A 1B0AA 3VC7A 4RDIA 1PZEA 4Q3EA 4MKXA 2C2YA 4RPLA 4UVIA 7MDHA 4OMUA 1OC4A 3HG7A 4UVHA 4D46A 4DLBA 3HADA 1BRMA 5CHEA 3U4CA 4QUKA 1YL6A 5CG2A 4XRGA 1E7WA 2X9NA 4L4RA 4YDRA 1GQYA 3WYBA 3RKUA 1E6UA 1CYDA 2JCYA 9LDTA 2VYVD 4L9RA 3VH3A 2JCXA 4QFDA 5FF9A 3S55A 4MO2A 1EVYA 4BKRA 5I7EA 3R3JA 3W8DA 2GR9A 1XQ6A 1F8FA 1YDWA 1SBYA 1YDEA 3H4VA 4PLTA 1UR5A 2FPGA 1FDWA 1ZSVA 3FF4A 1A7AA 3D4OA 3GDOA 1U3VA 1P1FA 1K89A 7ADHA 1E7QA 1F17A 1CJCA 3EUWA 3KSZO 1N9GB 3WGIA 3PXXA 3L4SO 3BAZA 5HA5A 4YJHB 3K8ZA 4FJ2A 2OORA 4M86A 3F1KA 1E3SA 4J4TA 3RAJA 4II3A 4CMHA 1GCUA 2FZWA 3GZNA 5B12A 3JQGA 5EESA 1C1XB 2CD9A 3O8QB 3PYMA 1OBFO 1GUFA 3H5RA 4FFPA 3GF4A 2DQ4A 4DIOA 2VT2A 2X0NA 4MVJI 5JYDA 5ER9A 4YTEA 5A3VA 1LRJA 4Z6KA 2W2KB 4BUCA 3JQGB 1NWCA 2JD1A 4JK3A 1WDLA 3PJGA 4S1VA 2RH4A 1EDZA 1UP6A 5ITWA 2EERA 1O8CA 5IDWA 1PJSA 1I3KA 4E4YA 5IDXA 3GUYA 4XZ3A 3E9QA 3ZDFA 4A10A 2DBRA 3AUAA 3GUCA 5A05A 1PJ4A 1XR3A 1UJMA 4BGVA 3L9WA 4G65A 3OJLA 4AG3A 4TRNA 2EWMA 3G17A 5A9SB 5TIIA 2X23A 4U0JA 1H93A 4BNMA 3I4FA 3F4BA 4WCFB 4FIZA 2D3TA 4M89A 2CY0A 3ASUA 2JD2A 4L75A 2BELA 2OP1A 5H83A 4WLUA 2DTEA 1T4DA 3VHRA 4D79A 1HRDA 2PH5A 4IINA 3PYXA 1HLDA 4F3YA 5AVOA 4Y8VA 4LRSB 2DFDA 5F5LA 4HFJA 1GADO 3LT4A 5IDQA 5BSGA 4PLVA 1MX3A 5JAZA 1EE9A 1QYCA 2PD4A 3O26A 1FDTA 3GR6A 1HSZA 5L7YA 3BMNA 2O4CA 4WCFA 4BOYA 3NTQA 1DAOA 5IZCA 1PR3A 4IIVA 1ZUD1 3MZ0A 2FPPA 4CMGA 4EBFA 1ZH8A 5TJHA 1N7GA 2XF8A 1MGOA 4GQAA 1BVUA 3IP3A 2TMDA 3HQ4O 1LDMA 1ZEMA 4IY1A 1CERA 2VCYA 3I5MA 5U9CA 2Y1GA 3WTBA 3FSRA 2IYOA 1DLIA 2HUNA 1SPXA 1WXDA 4I5DA 3UH1A 4GL4A 5G4LA 3VVBA 3IOYA 5FWNA 1AUPA 1DFHA 1R0KA 1TVEA 4KMSA 4AJPA 3AOGA 4P4GA 1HDZA 4BO2A 4Q3NA 3ZN2A 2WJPA 3AW9A 1X13A 3DC2A 2FR0A 4H3VA 3VOSA 3JCZA 4OAQA 2OXIA 3IS3A 4CM8A 5CDTA 3QLJA 2Q49A 4WPGA 3NT4A 3C1AA 5MGBA 3KYDA 4MINA 3DZBA 2RHRA 2UUPA 5DCUA 3NX4A 3SJ7A 4BO4A 1MG0A 2UYYA 1MC4A 4OKNA 3BMOA 3RI3A 3UW3A 4XR9A 5TSDA 1YRLA 3FN4A 4KWHA 4CR7A 4BO9A 3UF0A 1T2FA 1GAEO 2OBNA 2TMGA 1YE3A 3HN2A 4MKRA 4BQPA 3WMWA 1ADFA 3OFSA 2Z5LA 4K6FA 3QV1A 3PDUA 3FR8A 3MCVA 2EGGA 1KERA 2YQ4A 4E32A 1B26A 3JYPA 4YBZA 3NJ8A 5DZSA 2PGDA 4JQCA 4YJGA 3AUUA 2P9GA 3DFUA 4BVAA 4NK5A 3BMNB 5DT9A 2CMDA 2O2SA 1UZMA 3JQBC 4J1TA 4RVSA 1U4OA 3F1LA 1DB3A 4QQRA 1FDSA 4RVGA 4Z0HO 3T4XA 5DN9A 2VT3A 2Q1UA 2Y0CA 2O3SA 3I9NA 3BMQB 3V2UA 1NFQA 2FSSA 4PLZA 3S2EA 4UVEA 1J4AA 1AE1A 3WB9A 5DULA 3H2ZA 3OF2A 1V9LA 3LC7O 1IULA 1K6JA 4P4LA 5JC1A 2QRLA 4WGGA 4IJVA 1RPNA 4MVJF 4YPOA 2OBYA 3JSAA 2VNAA 2QYSA 1UZNA 4E30A 4B79A 1EFKA 4KTVE 3TL3A 2GO1A 2YV2A 2W2LD 1KEUA 3FHLA 4ZRMA 3WYCA 5ILOA 3UVEA 5I9LA 1TA4A 3INGA 4BQRA 3JQAB 1X1EA 5JDCC 3QWAA 2YYYA 5IXYA 3S1LA 2DBVO 4J1SA 3PFWO 4Q3AA 1UXKA 4GH5A 5FEUA 3OA2A 3WGZA 1O94A 4RGBA 1I0ZA 3WSVA 1ZEJA 2I5PO 2O48X 3I9KA 3KM0A 4FCCA 5B4TA 4HNHA 2NUAA 3LDHA 4E21A 3Q11A 3DAFA 4N7RA 3PZRA 3UCFA 3PVZA 3K6JA 4PLPA 5TT0A 3KEOA 4DQXA 1K0UA 2GZ2A 4AJEA 1BWSA 2EKQA 4LMPA 5KVVA 1ZFNA 3WYEA 2QW8A 1F14A 4M87A 2I66A 3EW7A 4CUZA 4NJOA 1LSOA 2YUTA 1EUZA 5EN4A 5DP2A 2O3UA 3L4BC 4ZQHA 2ZTUA 3DQPA 1E3WA 2NV6A 2AHRA 4XQGA 3K9QO 4BHTA 3L6EA 3O38A 1FMCA 2AQ8A 1ENZA 1T2DA 4Y9DA 1F0YA 3OJFA 4ZN6A 5CPFA 1D8AA 4C7KA 4R16A 4LN1A 1E77A 4BNLA 4O6VA 5I9NA 3UICA 1N2SA 4RORA 3ROMA 1N5DA 3WSWA 1UUFA 4L76A 4PCVA 4GVXA 2PNFA 5G0UA 3VKUA 3E9NA 1DC5A 2AQHA 3KRTA 4K6CA 1A27A 1J5PA 4O59O 5F21A 4BNZA 3V1TC 4FFRA 5TX7A 1Q2XA 2P4HX 5K9ZA 4DQUA 3NTRA 4ALJA 3SVTA 4PVCA 1DDOA 1Q0QA 2BGKA 1UZLA 4TMFA 4B4VA 3B1FA 4IXWA 1E7YA 5TF4A 1KVTA 4D42A 5I7VA 2PTGA 4I5FA 2D5AA 3E6AA 3AM4A 3ZV3A 1I8TA 3DWFA 1LDYA 1M76A 5F1KA 2Y99A 1HE2A 1QRRA 4U6QA 2FHSA 5ENDA 4I5EA 3AI3A 5FI5A 1YJQA 4IS3A 2IXAA 3L6OO 3QW2A 4IPTA 1OFGA 3H7AA 3A14A 5A06A 4FS3A 2FY8A 4XDZA 1IZ0A 1NVMB 1U2DA 3EK2A 3ICCA 1C1DA 2VWQA 3LLSA 4CM7A 4WNIA 1BVRA 1V8BA 2O3RA 4QO8A 1SB8A 3E48A 4UEKA 4CMEC 3PJEA 4J4HA 2NVUB 3U3XA 3ROKA 4XJTA 4ZD6A 1QXSA 1PU2A 1ZK0A 4CM6A 3KYBA 1YH3A 2VNSA 3EMKA 3D1LA 4JGBA 1HYHA 5JMWA 3DXFA 2FP4A 2HMTA 2ZQYA 2NTJA 4RJTA 5C5IA 4RPGA 3OM9A 3H65A 2P68A 3TSCA 1ID1A 5G4KB 5A3JA 2OUIA 5G0SA 1A71A 2OMEA 2PFGA 3H9JA 4A7PA 2GSDA 4H15A 2I99A 5HS6A 2O7QA 3JYLA 4YAKA 1DLJA 4XB1A 1LXCA 1CIVA 1DPGA 1WVGA 3FWNA 4F45A 5T5QA 4DUPA 5ENVA 1GFSA 1ZK2A 5G4KA 3BA1A 4I5GA 1Z74A 2CFCA 1LEHA 4AJIA 1IPFA 1VLLA 3ZV5A 2F00A 1Q7GA 3K92A 1ZK1A 3EZLA 4OO3A 1H94A 3S2IA 2YY7A 3DHNA 4NBWA 5AQ1A 5CEEA 3TDKA 3S2FA 1X14A 1ULUA 3DBLA 4UREA 4FGSA 1Y81A 1TT5B 1C0KA 3NTOA 4PLYA 3AFMA 4I9HA 3PJDA 4RZHA 1Q0LA 4IJKA 1Y5RA 3SEFA 4J0FA 2B83A 3CEAA 4MVJP 3VPGA 1EEHA 4Q3BA 3LT2A 1E7SA 3I1JA 4PRKA 5ICSA 4Z3KA 4RVHA 1N1EA 4D0SA 2J6IA 1P3DA 2C5AA 1CWUA 1ISGA 1U9JA 3E18A 3HB5X 3TZQA 3UFXA 4EUFA 1VKNA 3E82A 4ND2A 3KTDA 2Y1OA 2O23A 3AJRA 3NDIA 4BNHA 3OJEA 2GF2A 5C37A 3JD3A 2IZ0A 2JFHA 4HWKA 2YFHA 1H6AA 3IUSA 3L07A 4UUOA 3WFJA 3GG2A 4TVOA 4ALIA 2GUGA 4XYBA 4XX0A 3H3FA 5CFZA 2BI7A 4FJ1A 3ZNPA 3E5RA 5CEJA 2CDAA 2ZYAA 4AICA 1PGJA 4JJFA 4PN3A 3ADOA 2NNLD 4J9VA 5JNLA 1NHWA 4NG5A 3W8FA 1E0DA 3PYLA 1D3AA 4AJJA 5AYVA 1U28A 1DRVA 4CLHA 1T4BA 4DRYA 1ONPA 2G76A 3DOJA 4UUPA 1IB6A 3Q1LA 4B8ZA 1VI2A 3R3SA 3GPDG 3RU7A 3MTJA 4BKOA 4A0SA 1JVBA 3PHJA 5U4QA 4M54A 3JQBA 4JBHA 4YT8A 1RJWA 4NFYA 3GQVA 4CM4A 4YYZA 1DEHA 1CEQA 3D4PA 2GDZA 5L3ZA 1VM6A 4NR0A 4TKMA 5KCZA 2VUSA 4W9NA 3AI1A 2QX7A 1P74A 1T1RA 4CQMA 1GUYA 1H0KA 3TRIA 1NVTA 2ZCUA 3JQ7B 4IDCA 1PQUA 4CLDA 5JO0A 4BIIA 5HWSA 5JDIA 3DAPA 1KEWA 6ADHA 3ZWMA 3GNQA 2HDHA 4DVJA 2EF1A 4J91A 5EQFA 4PG8A 5KWEA 2WDZA 1BMDA 4MIOA 3WLEA 4QXMA 3QWHA 4E2ZA 2Q4BA 4CMJA 4AVYA 4D0RA 4YRAA 5GMOA 2ZYDA 1E5QA 4KUHA 2ILTA 1E3IA 5I9MA 1ADGA 3IKVA 1DHTA 3IMFA 3NDRA 4PIVA 4IUYA 5JFOA 2NVWA 4CLOA 2YHIA 4QFCA 4UVDA 1HDCA 3FPLA 5KJ6A 2HK7A 1NQAO 1Z45A 1KVSA 4E3ZA 2FMUA 4YRBA 1Y9AA 1TB4A 3ICPA 1HE3A 3ENNA 2IEDA 1E7MA 3KOUA 4FGWA 5L7TA 1JTVA 3EHEA 1A72A 1Y1PA 2EIHA 1JKJA 1YWGO 4IGFA 1UH5A 4N5LA 1LDBA 3ONFA 3V8BA 1GV1A 1LLUA 2JFFA 3DBRA 4YT2A 1PJ3A 2VOJA 3OQ1A 4W7IA 5MDHA 1ZO8A 3WG9A 1RM3A 1A9ZA 3C8MA 4PLCA 2BRUA 3ZNQA 1P0CA 2AXQA 2X22A 3DZIA 3RFVA 4ALNA 1NQOA 3GN1A 4OHUA 4TKLA 4GX5A 1YL5A 1OI7A 3H2SA 2WD7A 2EV9A 4XCVA 1KBZA 1YOVA 5U1PA 3NAQA 1QYDA 1SEVA 2FR1A 2P5YA 3GT0A 1HDRA 3RUAA 1HYGA 1GZ4A 4XYMA 1TI7A 3W8EA 3DOCA 4NBUA 3DL2A 3BMCB 3G1UA 3NRCA 4DYVA 4F46A 3OEWA 1V3UA 4RCVA 2WD7B 4YA6A 4XB2A 2HKIA 1T25A 1ZIDA 5JAIA 2VWGA 2VZ9A 3BIOA 2AEJA 1QR6A 3LYLA 5B37A 5K6AA 2W8ZA 2PZKA 5L53A 1VE9A 3G3EA 4YB8A 3TPCA 2C29D 2VYNA 1XYGA 4OQZA 4WUVA 3V1YA 4EEXA 1W73A 4GSKA 5JSFA 4UUNA 1W6UA 3CXRA 3D0OA 4BNVA 4O5OA 3ADPA 3BTOA 3CMCO 4J2HA 2IE0A 1HYEA 3GHHA 3GRPA 4K26A 4NPCA 1NR7A 3WGGA 3H5NA 3TOZA 4R1SA 4KP7A 3T7CA 2BGMA 3JTMA 4NIMA 2DC1A 4P38A 4YAEA 4UEJA 3EVNA 2GN8A 2HRBA 2DFVA 4NDNE 1JKIA 4J7UA 2GGSA 4NFSA 3ZV6A 4BO5A 5JCJD 2WYWA 4GLOA 3RC2A 2HO5A 4NMHA 2OGUA 3RUEA 3RBXA 2AA3A 4YXFA 1SO8A 3GFBA 3RWBA 3GLQA 5AXDA 3VH1A 5F3RA 2C5EA 3JQ8A 4EUEA 4H16A 5I8WA 3PEFA 4IM7A 1PL7A 2HK9A 1AGNA 2X9VA 2DKNA 1R6DA 4NBTA 4PLGA 3PP8A 4KOAA 5TGDA 3BHIA 4DYDA 3QQPA 4IZIA 3K31A 4KWIA 2QRJA 3F9IA 3U0BA 5IG2A 4BKQA 1P31A 4WCDA 4CQLA 4BNXA 4GI2A 1QMGA 5LCXA 1ISIA 4Q39A 3ZHBA 2P91A 2BFAA 3IP1A 5DDIP 3FNHA 3S8MA 1UXIA 3RC1A 4MVJM 4IJUA 3NDJA 4P22A 3WICA 4BO1A 4GX2A 3HDJA 1VSVA 3UAGA 4FFNA 3RIHA 4F6CA 1PQPA 2B4QA 3NYWA 3AY6A 3B6ZA 1DJQA 3MJ4A 4E13A 3QHAA 4GMFA 3ORFA 5BQFA 3UCXA 4G5HA 4RQUA 5JLAA 4ZICA 1LSJA 3CH6A 5HRUA 1F12A 1UAGA 4NZ9A 2VUTA 3NGXA 4W82A 2C54A 4AJ2A 4XGIA 1R16A 4R54A 5C7OO 1YVEI 5ICMA 4RO0A 2BF7A 3IQDB 3ST7A 1GQQA 4K9DA 3JYOA 4YJFA 2A9FA 3I9MA 3QE3A 1UDAA 1HETA 5A9SA 3TZCA 4FR5A 4PVDA 4DBVO 3OHSX 2D0IA 5JDCA 2AQKA 3DMTC 3GMDA 1LLQA 4ALMA 2VZ0A 3I9LA 3C7AA 2Y66A 2FRDA 1M6HA 1ZVMA 1M66A 2HAEA 3CINA 3FCOA 3KYCA 4J7CA 5LC1A 4ESOA 1Z73A 4R1NA 1DC6A 3LU1A 2O50A 4CV1A 2IDZA 2C2XA 1LQTA 2R6JA 3QP9A 3QJ5A 4AJOA 4BMVA 2JL1A 3UXYA 3BMOB 3MTGA 4BNYA 5IZ4A 1WLYA 2Q1TA 4EEZA 4P4NA 2IZZA 5TNXA 2WTBA 3GG9A 4MVJG 1YQGA 1HKUA 4LVCA 1LLCA 2LDXA 4TWRA 2XAAA 3MJSA 3OSUA 1QG6A 1FJHA 1DAPA 4XR4A 5KKCA 1HDGO 1QLJA 2UAGA 3KSDO 2CDCA 4FFLA 3WS7A 4LGVA 3X2FA 4CM8B 3JD4A 1QP8A 5A9RA 4ZQEA 1T2CA 5TRTA 5KVSA 3I9JA 4N54A 1WZIA 1LRKA 3U49A 1ZZEA 1HDYA 5KIAA 1ADCA 4OXKA 1PS8A 1VSUA 1BHSA 1N9GA 1QYWA 2EJVA 3U4DA 5I7SA 2O3JA 4Z9FA 2HJSA 1XKQA 2J5QA 3M1AA 4INAA 1MXHA 2DAPA 4UVGA 1L1FA 1ZMOA 3SXPA 1G1AA 1G0NA 4QX6A 2W2LA 2CNBA 2Q46A 4UUMA 1BXGA 5BR7A 3FRJA 1Y7TA 1J0XO 1SZJG 2VUUA 2WE7A 5FI3A 3UGKA 4NK4A 2Y93A 1WP4A 4NBRA 2YZ7A 4J1QA 1I30A 5L9AA 3K2BA 2D8AA 3MEQA 3QVWA 4U5QA 3OIGA 1V3TA 3AOEA 3QY9A 3WJAA 5C7IO 1IY8A 1YB5A 3DMTA 4ZQFA 1PEDA 4L73A 3BTSA 3ONEA 4D7AA 1GY8A 3PFFA 4GKVA 3E03A 1P44A 4IXTA 4KTTE 4BV8A 1J6UA 3G1TA 1DIBA 3HFSA 3U09A 4B7XA 3CMMA 2D59A 2DBQA 4KUGA 4G2NA 4YJGB 1QORA 3PJFA 5CDSA 4O0LA 2Y0DA 3E1KA 1W8DA 2PY6A 3ZU3A 1QV7A 1NFFA 1P1IA 2ZTMA 1P33A 1PGNA 1PJTA 2I3AA 1MA0A 1PL6A 4BL5A 3P7MA 2Y68A 2NWQA 4CL8A 1I2CA 3D5TA 3B1KA 1T1SA 3QVTA 4YJDA 2NVBA 4FC7A 4K1LA 3GOHA 4RF3A 3VKVA 2VHYA 4Z9XA 1KVUA 1EVZA 1B16A 4YVFA 4J43A 4I8XA 2WYVA 3C7DB 1VL8A 3I3OA 4J16A 3CKYA 4GAEA 5C7LO 4FOOA 3RQSA 2YDYA 2RCYA 2HSDA 3STHA 4E31A 3OJOA 3ZW8A 4GVLA 4AJ1A 2Q2QA 4J1NA 1P1KA 2BD0A 1U7TA 1HSOA 1XEAA 3KB6A 3ZGYA 1I5RA 1GPJA 3LF2A 1HF3A 3KLMX 3ETGA 1L7EA 3ZWWA 1GEEA 3AM3A 3N58A 1O0SA 2W2KA 2X9GA 4NBVA 4BNGA 3Q2KA 4R3WA 4BV9A 1MUUA 3F3SA 4FSHA 2QG4A 5B1YA 1C0IA 1CETA 1Y6JA 2H6EA 3VVCA 5L40A 1DIAA 2HU2A 4GSLA 3RUIA 1D7OA 1Q0HA 2YV3A 1VRWA 2EP7A 2EJWA 3RC7A 1I3MA 1SCUA 1FDVA 2UDPA 3KUXA 5T6BA 1LNQA 3C24A 1JKFA 1X0VA 2EG9A 3CIFA 4ND3A 1GEGA 3KYCB 1NTOA 2NU8A 5TLSA 3QRWA 4WECA 1KEPA 3GDGA 5JPIA 1RYDA 1X7HA 4RVFA 1DRUA 1Y8QA 4ND4A 5DCYA 4XWYA 4PRLA 3WGOA 3C85A 3M2PA 1P77A 3W4KA 1Y8QB 2CUKA 4IDBA 5F1PA 3DBHA 3FBTA 4I9NA 3ZWCA 2DTXA 4U7WA 4B8WA 1PJQA 4ZQGA 2PWZA 5H82A 3P5SA 2ZB8A 4O1MA 4FN4A 1RWBA 2FWMX 3GDFA 4FFOA 5BNFA 2DPGA 3P19A 2GN9A 4FFMA 4YT5A 3NEPX 1ULSA 3CTMA 3HSKA 4BO7A 1GQ2A 1ZSNA 2G0TA 4WEOA 3W4JA 3KLPX 2GPTA 1JN0A 4TRRA 4R69A 1CF2O 1PGOA 4BGEA 1N8KA 4N5NA 3HWRA 3O8QA 2PGLA 2YW9A 4GX0A 4JP2A 3V1UA 1LA2A 1ZJYA 4EJ0A 1K6XA 1P9LA 2X6TA 2FR8A 4WOJA 3FPCA 2VRBA 1R12A 1Y8RB 3DZFA 4FPXA 4MOWA 1DFIA 3PGJA 3B70A 4KDEA 3TZKA 2D2IA 3DB2A 4A2CA 3Q2IA 2VN8A 4AJLA 4NQZA 2B5VA 2WM3A 4GPD1 3HNPA 1U5CA 2C0CA 3OIDA 4DQVA 3M2TA 3GVXA 3QWIA 3H6KA 4IDEA 3ZCXA 3FR7A 2ZATA 1NXQA 1GCOA 1WMAA 1BG6A 3HE3A 2BHLA 2EKLA 4YAIA 3HZZA 3NUGA 4IDAA 1R0SA 4AL4A 4BO0A 4L8VA 4EW6A 3C3XA 4DREA 5BSFA 4R51A 1VL6A 4UAGA 3A9WA 4CMEA 4BNNA 4AJHA 2ZCVA 4PG7A 4WLFA 2DPHA 3V5NA 4BNWA 3I23A 4JJGA 4IBOA 2Q4EA 2VTDA 3CZRA 3GAZA 1GR0A 3LT1A 5JYEA 1C1XA 3DEYX 1X1TA 2X58A 4F6LA 4Z0TA 1HE4A 5TS3A 3VZQA 2P9EA 2I65A 2Y1CA 1DJNA 5FFFA 5ADHA 3LT0A 4ZA2A 2J3HA 4RPKA 4J6FA 4WLVA 3H5AA 3VTFA 1IOLA 1PJLA 1DIRA 5FYDA 2GYYA 3ITDA 1LU9A 2LDBA 4GLLA 1HEUA 4ZRNA 1R66A 3JQ9C 1PWZA 3ZHZA 1IHYA 3OIFA 1KC3A 4NHEA 3GN2A 1E1LA 3MWDB 4OYRA 4RVUA 4R41A 3JQFC 2PZMA 3ZV4A 1HDXA 4AJKA 3UHAA 4X54A 1IZ9A 1OOEA 3MJVA 3P2YA 3WLFA 4WOKA 3DR3A 1N1GA 1XG5A 4BGUA 1AN9A 3TNLA 1AXGA 4MJLA 1JLLA 2DVMA 1RYEA 3EGOA 4PZEA 4OQYA 1DC4A 5KJCA 2E4AA 4RF2A 1WAMA 4D44A 1B3BA 2P9CA 3VTZA 4BS9A 1YOVB 2HK8A 1ZMTA 3F6YA 4OH1A 1T26A 4BB6A 1GYPA 2A94A 5T8KC 3C7CB 1T2AA 1ZNQO 2GN6A 1CRWG 3PLNA 5CP8A 3VPSA 2AG5A 3GVCA 4WLEA 1PQWA 1SMKA 2X0JA 2QRKA 3I83A 1JA9A 1ZCJA 4ALLA 2W98A 3A4VA 4RPHA 3VZPA 4OOFA 4N5MA 5G0TA 3Q3CA 3QA9A 5A1TA 3ZNOA 5DP1A 3KEQA 4PG6A 1DFGA 4TZKA 3V2HA 4YAGA 2J3IA 4MDHA 2BI8A 4IDDA 3T4EA 1DC3A 1QSGA 4CLXA 2D1YA 1Q7BA 3GY0A 3ZW9A 4YR9A 4CM3A 2R2GA 4OOEA 3RKRA 2OFPA 3WXBA 3FNEA 2VQ3A 4KZPA 1U4SA 1WZEA 3VZRA 3IL2A 3KSUA 3TN7A 5DBFA 1PS9A 1WW8A 3R1IA 5HBRA 4DL9A 4DXHA 4RL6A 4Z3DA 2P5UA 1SNYA 4LCJA 4J0EA 3GC6A 3VH2A 1BW9B 1VPDA 3GVHA 3OICA 1LRLA 3SC4A 1XU9A 4LSMA 2BFMA 5LDHA 1U8XX 4CLRB 4HKTA 5GZ3A 1YBMA 3HFGA 4OGWA 1PJBA 4GWGA 4DC1A 4P8RA 4XDYA 3FNGA 1D4FA 3ZNNA 1H5QA 4WK6A 3SLGA 1CDOA 4JXKA 3GEDA 2EHDA 2PK3A 5COAA 1U1IA 1DIGA 3IC5A 3PQFA 4RZIA 4TROA 1M67A 1UXGA 4U0KA 1B8UA 2BLLA 2FPIA 4FC6A 2X8LA 4EZBA 1ENPA 3ETDA 3GEMA 3QVOA 4ND1A 5KJ1A 3Q6IA 4WEQA 2FOIA 2H63A 5L95A 2J3JA 3GK3A 1FK8A 5IN5A 1BSVA 5G2OA 3A28A 1E3LA 2WEKA 1XWFA 1PZGA 4DLLA 1NAIA 4PZCA 2BMAA 3RUFA 8ADHA 1W0CA 4QEDA 1GTMA 4PGFA 4CQLB 1YJ8A 2XPCA 2Z95A 4QT0A 1YONA 3VAZA 4DLAA 1PSDA 3QVXA 2HMSA 1I3NA 2AEFA 1SOWA 2O3QA 4M55A 4CMIB 3DBHB 1GZ3A 4MP3A 1LUAA 2A92A 1TT7A 1XELA 3TQHA 4HFNA 4IDFA 2AE2A 3DHEA 1C0PA 3PWSA 4DMLA 4CMKA 3IIEA 4BKPA 4D45A 4QSMA 1D1TA 5GZ6A 3O03A 3WDSA 3V2GA 4PG4A 1KEVA 1N7HA 2H5LA 2QQ5A 4XEHA 1KS9A 3JD0A 3ANMA 4I08A 2C07A 1WPQA 1KOLA 2X0RA 3ZWVA 4E5PA 3GEGA 3BZUA 3EC7A 4PLFA 4IS2A 2VYND 2GZ1A 3L9XA 1U7HA 3G49A 3H9QA 3U5TA 4C7JA 4EUHA 2NQTA 4YQZA 3UKOA 1MG5A 1EUCA 2NSDA 4II2A 4GGOA 4YWJA 1GV0A 1PGPA 5IXSA 5EERA 3WIDA 2Q1WA 5DCWA 3AFNA 1XCBA 1BXZA 2GCGA 2A35A 1H9BA 1PJ2A 3MJEA 3WWYA 4DTIA 1YQDA 3DAGA 4OL9A 5COQA 1ZW1A 3IJPA 5JCJA 5B4UA 3RUHA 4B3JA 1EVIA 4S3MA 1SOVA 1ZKMA 3INRA 4CMIA 3D4NA 1TT5A 4TZTA 3RBVA 6LDHA 1ARZA 4A73A 3H8VA 1B8PA 3WOHA 2HRZA 4BNKA 1Y8RA 3UN1A 5JO9A 2PKQP 3AWDA 1I24A 5EL0A 4FBGA 2Z1NA 3JQDA 3MJCA 5H81A 5KVCA 1B8VA 1JWAB 4LISA 2GN4A 1E6WA 3COSA 1WDMA 3WGQA 3U9LA 4DGSA 1H9AA 2ZB3A 1E92A 3WJ7A 1D1SA 4YCAA 1VL0A 1YBVA 3ULKA 1EUDA 3OA0A 5C3MA 1A9YA 3WTCA 1HL3A 1BXKA 2BGLA 2NU7A 3PK0A 4RLHA 5AXAA 1PX0A 1OC2A 2CVQA 2C20A 3FNFA 1FF9A 3AUSA 1JDJA 3F4LA 3G0OA 4JCOA 4CLRA 2VTEA 1UXHA 4MVJE 5G0WA 1KC1A 4ONEA 4B4UA 2PGJA 2NU6A 3JD1A 3JQAD 3WX0A 3BMCA 3K2EA 1LBEA 1BDBA 3WNVA 4JLWA 3ZWPA 1X0XA 3DBVO 1CQIA 2ZB7A 4LW8A 1R0LA 1XU7A 3RBZA 4EGFA 2DT5A 4AJ4A 1ADBA 1EDOA 3OP4A 3LZ6A 2Q45A 2ZQZA 4OSPA 2FSVA 2V6MA 4E6PA 1YL7A 1PR9A 1H6BA 2AE1A 1LSUA 4GMGA 9LDBA 5KTKA 2IODA 4L0QA 1NHGA 4RF4A 3ZH2A 3H3JA 4ZU3A 4WKGA 1E3JA 2EEZA 2BKAA 3DOOA 3KYDB 3LF1A 1UP7A 1WDKA 4FJ0A 5G0VA 3RJ5A 5KJFA 2CZCA 4WLOA 3NKLA 4E12A 2PKQO 4FW8A 1GU7A 3VPXA 2CVZA 2CDBA 3ANLA 3DDNA 1WMBA 5T67A 4IGEA 4A5OA 4IMRA 1LLDA 2ZJ1A 3N7UA 2JAPA 3CE6A 1MP0A 4MKZA 1ZK3A 3AOEC 3K30A 1VJ0A 1DBVO 2E82A 4ZGWA 5CEFA 3E8XA 3TFQA 2A4KA 2B4RO 3PIDA 3LLVA 4M1QA 1P1JA 2NADA 4ITUA 3WBBA 1NYTA 4H7PA 2YHIB 1VJ1A 3ZHXA 5A02A 1UXJA 3VH4A 1SC6A 4O63O 3NV9A 3WFIA 3KV3O 2O3TA 1HTBA 1OZAA 1XQ1A 3JD2A 3LQFA 4R4JA 4IQ0A 4PFJA 1C14A 1NBOA 4XQEA 4WNCA 4D41A 2CVOA 1MC5A 2J5RA 4R9SA 3ZU4A 2JFGA 2V6BA 4EDFA 2X5JO 3PGXA 3ZWYA 3E5MA 2NQ8A 1LDNA 3RUCA 4JP3A 4EJ6A 2IEBA 2FZEA 2NACA 5HTOA 1NPDA 2IRWA 4HV4A 3CPSA 1B14A 4E2XA 2G5CA 1V6AA 3NJ4A 3ON5A 4MPDA 4JNKA 1K2WA 4W99A 4J2OA 1H2HA 1BTOA 4JROA 4B7CA 2EW2A 1E1NA 3GFGA 3TZ6A 3M6IA 4YRDA 1PWXA 2JKVA 2ZKLA 3AY7A 2VOEA 3OBBA 3A1NA 5IJZA 5JCXA 2OHXA 1PJCA 2UUOA 1QLHA 1MB4A 1N92A 1OMOA 4PZDA 1Z82A 3AK4A 3JQFA 4D3DA 4TVBA 1DIHA 1DHRA 2O7SA 3PQEA 5L4SA 2Y1EA 1E1KA 1O5IA 2AW5A 3LC1O 2XXJA 3JQ9A 1PL8A 4M49A 4U6SA 5AXCA 4Y6RA 3AUTA 1V0JA 1YS4A 2CF5A 3Q9NA 1HDOA 1Z75A 3R6DA 2O4UX 4GGPA 3RCBA 3PHGA 4MIEA 2X4GA 2DUUA 4LCEA 3VDQA 3BHMA 4QO7A 1MLDA 3FI9A 3UUWA 5L45A 4MVJD 3NT2A 2OZPA 3ROQA 4CMCA 3ABIA 1XSEA 3JQ8B 3ANNA 1R4NB 4HADA 1LX6A 1ISJA 2PD6A 1SAYA 4EJMA 1G6KA 5JDIC 4R01A 4WJZA 3RVDA 4IJWA 1I33A 3NT5A 5ILGA 2EP5A 4ROSA 3PI7A 3O4RA 4OJNA 3WGHA 4XRRA 5ITVA 3ZZNA 3WWZA 4Y67A 1NPYA 1B3RA 1NNUA 3ETEA 4TRMA 2XOXA 4NFHA 4CV2A 1NR1A 5EIOA 2DBZA 2Y1DA 4MP8A 1SEPA 1SB9A 3GAFA 4RF5A 4E2WA 5IN4A 4XQCA 4TQGA 4AJNA 1LDEA 4EI2A 1EE2A 4ALKA 3ASVA 4PLWA 3RFXA 3IDSA 1ZSYA 4L4SA 4R1TA 1K5HA 4BO6A 2NU9A 3U62A 1FDUA 4PLHA 3TJRA 2JHGA 4CM5A 3HN7A 2VWHA 1MFZA 2OL4A 3ZWNA 4YJFB 3ZWXA 3OMLA 2BFPA 4E5MA 2NVUA 1G0OA 3TZHA 2E49A 1R37A 5CDYA 5JW6A 2Q2WA 3DBLB 3HUDA 4CV3A 4DMMA 1A7KA 1NAHA 5T8KA 1VC2A 1O95A 4RDHA 1EBFA 5B4VA 1T24A 2GZ3A 4BNTA 1I3LA 5DF1A 5KKAA 2D5CA 1C3VA 1YXMA 3GZ4A 1X15A 5AXBA 2VHVA 2ZIZA 4DWVA 2Q2VA 1YO6A 1DRWA 1WWKA 5A4DA 1F8GA 1CQJA 1P1RA 1LSSA 3WMXA 4CM1A 1A5ZA 1PZHA 4HFMA 1ONNA 3SLKA 2V6GA 4FOSA 1M2WA 2C7VA 5GZ1A 2JAHA 1EQUA 1U3TA 4XIJA 2VRCA 1QKIA 3K73O 4ND5A 1HWYA 1Y5MA 3PHIA 1V3VA 3GHYA 3RJ9A 4LSWA 3D3WA 1XHLA 2VZ8A 3GVPA 4G81A 1NP3A 1HZZA 3HDYA 3RFTA 3ZI0A 3DTYA 4WLNA 2X5KO 4XIYA 4NI5A 2YHUA 1DOHA 1NM5A 4YT4A 3W1VA 2ZJ0A 4CMAA 1YB1A 4YAJA 5KVQA 3RD5A 4KQWA 1X7GA 1GUZA 3PQDA 2POQX 4DPKA 4QTZA 8LDHA 2JCVA 1ZBQA 3L77A 4OXNA 5JS6A 3TOXA 2J3KA 1ZXBA 3EDMA 4KDFA 4ZJUA 2IXBA 2C82A 4BNJA 1R15A 2E6UX 2HMVA 2DUWA 2GRAA 4DIBA 2ZK7A 4TSKA 2B5WA 3RC9A 4K28A 4BB5A 4W4TA 1E3WB 4A03A 1LDGA 2X0IA 5DNAA 1GYRA 3FTPA 4IQ8A 1LI4A 4R9RA 3AM5A 1EK5A 1E7RA 2NTVA 2RBEA 5HM8A 2EKPA 4GKBA 4DIFA 3QIVA 3GMSA 5HS4A 3DO5A 1WNTA 3JYQA 2VHWA 2I6TA 1ENOA 2C59A 1OAAA 1ISFA 5JAQA 3SC6A 3UCEA 2FN7A 4J49A 3D7LA 1NPTO 4BO3A 4IMPA 1HXHA 4HUJA 1GD1O 5EJ2A 1S7CA 4CQMB 4E5NA 1I32A 1R4MA 1P1HA 3FTNA 5F5NA 1BDMA 4FD3A 4CUKA 4CR6A 3Q9UA 4R1UA 1EMDA 4WASA 4CM9D 4XD2A 4Q3CA 3JQ6A 2WWRA 3ENKA 3U4IA 3AY3A 3GH3A 3DONA 5IAAA 2DTDA 2Q3EA 3DZGA 1KIFA 1ORRA 3GNSA 1FXSA 4CMBA 3W6ZA 4C4OA 4YQYA 2PZJA 5L4NA 4EITA 2PH3A 3MJTA 1MFPA 2PLAA 3B1JA 4YACA 5DOVA 4CODB 3KVOA 2H9IA 4Y6SA 3X2EA 5A04A 3EVTA
chains in the Genus database with same CATH superfamily
2HA4A 4YREA 3JATB 3IFSA 4P5DA 2VSYA 3GFTA 1KWGA 1VECA 1JU9A 3KZCA 4Y2GA 3WIEA 1UBRS 2JARA 3CRZA 1NMYA 4BDSA 1VG9B 4RQTA 3WWEA 1I4DD 1LPBB 1MOQA 1WXHA 3QWBA 2Y0BA 1C7IA 4QAJA 2PS1A 4KR9A 1OB5A 2IK8A 3H8WA 2OFXA 1QQAA 3NGLA 3IGFA 1TF5A 4B87A 3PWKA 1ZC4A 2GARA 2VCEA 4B3XA 5KAPA 2JIRA 2QRPA 4RY8A 3EQ8A 2QQGA 4OM8A 2PHZA 1U8FO 4QKQA 4MUEA 2ZIGA 3CKMA 5A0TA 1SBQA 4FB5A 1XVVA 3OQBA 5KKCA 1X1AA 2VCHA 1OYYA 3PPXA 5CG1A 3JWEA 5KQRA 3BHJA 5KYWB 2GLTA 4OQPA 1ZRSA 5CD9A 2FZGA 2A9PA 2QE6A 2YNMC 1I1OA 4CM9A 2FB9A 1N4AA 3JQAA 2BH9A 5H3CA 4CUJA 5J4KA 4Z99A 5LFAA 4Y18A 5KOHA 1A4IA 1X1DA 2B35A 3DHYA 2X2EA 4QC2A 3A26A 3R5KA 4JSYA 4Y98A 2DLDA 3OZIA 2OOSA 5CH8A 5IDVA 4B5KA 3B3AA 1IHXA 2BM9A 1GU0A 2BIFA 2GEVA 3HKDB 4MVJA 2O2YA 5AKIA 3STTA 4BMZA 4KBFA 4JLPA 6YASA 2ATXA 4POAA 4ZWNA 1EA7A 2ZSIA 1Z3IX 2REBA 3EFEA 3CCCA 5A2QA 3FUVA 3PC2A 4X92A 5L4LA 4IRUB 2PUWA 4KPUA 4JGIA 4P3KA 1G8YA 1IMOA 1S8NA 3WDKA 1U2PA 3RRMA 2ABWA 1DIOB 1R0YA 2FW0A 2Q5HA 2Z30A 3GCDA 4PX9A 1G66A 2WDPA 2V65A 1CTQA 3LK7A 3CISA 4HG2A 1GQRA 4QJIA 4R8MA 3LJKA 1Z4LA 2HEIA 2XAUA 3BMQA 1L7DA 3CF4A 1WB5A 2BBWA 1F06A 2IZ1A 1K7YA 3SF0A 1BGVA 1DBSA 1TQDA 4BFYA 4MITA 2GZRA 2VHXA 2WVAA 3D3EA 3Q7RA 2REQA 2GERA 5BURA 1RE0A 4J3NA 4BZZA 4C21A 2FUG1 4S35A 3N6VA 2PMBA 1EQ2A 2APJA 4FMBB 4DSAA 4N48A 3DXXA 1AQIA 2CMHA 5ENZA 4GMHA 3RS8A 4TRJA 4LK3A 3DEZA 3A70A 1FXWA 3DFKA 1OLSA 1PS0A 2BR3A 5BNTA 4RV5A 5K0LA 1O6ZA 3GRUA 1GL3A 4CW7A 2ZWAA 4EUNA 4ZAVA 2HQ1A 3GLVA 1QH1A 1QV6A 4HWOA 2B69A 3EISA 5KYYB 2G67A 2UVPA 3RB8A 5E4TA 1NMZA 1JFTA 2OXRA 1T6NA 1VA5A 3Q8XB 4ER0A 4MPTA 4BU0A 2HF8A 1Z3CA 4HDNA 1E6EA 4Q12A 4R8RA 4QOSA 1IUKA 3AHEA 3CLUC 4M9QA 2C7QA 4Q9NA 3ORYA 1U0NA 2WT8A 4KUEA 5ECDA 4RTKA 3MUOA 1HT2E 4Q9HA 1NJ6A 3DSRA 1GILA 1JEQB 1E0SA 3DEFA 4HH3C 4F5DA 1KEKA 2O8FB 1NQTA 1F5SA 2IL1A 2OCKA 2WM8A 3I12A 1E1MA 3PWZA 4Q05A 3RU3A 1I2BA 4UM5A 4QQKA 5LLSA 3ZU5A 3C6XA 4QPJC 4YLYA 2WTEA 2GPNA 2BONA 2CSUA 3G2PA 4B7AA 1GGHA 2WSYB 3QSGA 3VZCA 1M83A 3PICA 2IYPA 3LUAA 2PUHA 1ND6A 1LZLA 4KQ9A 5DGDA 3TF5A 5CIWA 3HA5A 2HJRA 3ND5A 4JKOA 4E0BA 2YYAA 3LUBA 1P0FA 1RPJA 1Z22A 1I4TD 1Q1AA 4LMRA 4B4OA 4OTZA 1MBZA 1SUSA 1HLPA 4XSGA 1CQXA 2AMFA 4IZOA 3ZD8A 5JH7A 2AK2A 4FZVA 2RAUA 2WF7A 2X86A 3BCRA 3OJ0A 3K71B 3L0OA 4F4UA 3PC6A 5JC8A 4I2NA 3HFRA 2VPXA 2FPKA 1YVPA 4QECA 3AL3A 2ACEA 5A03A 3FD8A 5FAXA 3DHVA 1NZDA 2XITA 1AZTA 4GHWA 3II6X 4JI3B 2ZJYA 1MGPA 3MUEA 3F6EX 2VWPA 2XNDA 1VSBA 1EP3B 2OHIA 3BJEA 3SC2A 3I72A 2KQUA 1EWVA 2W71A 1QYXA 3IAS6 4FNAA 3EZYA 3LKZA 4J0CA 2FEMA 2MWMA 4UNSA 2RAVA 2I3GA 5B36A 3TFOA 2G1UA 2AQIA 4E5UA 5CDGA 5I7OA 1U0SY 4W1QA 4FUQA 1RRGA 5B64A 2N3ZA 4MSUA 3Q0EA 5ADWA 2HEGA 5CVDA 1YJCA 1BQEA 4G4SO 3ETLA 4KLCA 3PIIA 4UATA 4RK0A 1QKKA 1P6QA 1U2RA 1W2HA 2D74A 3NHJA 3Q7IA 4IWXA 4U4AA 4RESA 3WR5A 4C4PA 1NNSA 2G9RA 2ST1A 3TXXA 2R11A 4B7UA 3UT0A 4CIYA 4TXMA 2DZDA 4MQFA 3WQQA 3GPIA 3KK0A 4PAOA 3S6JA 1S4MA 1JFLA 1I0IA 4Z9YA 1ESNA 3HDHA 3AIMA 1BHJA 3EXIB 3EYWA 5C46F 3JQ7A 2V7PA 1ZD5A 5A9TA 1IONA 1E2IA 5JXHA 4Z7NB 3R7BA 3KVNA 1R4NA 3DZKA 4DCSA 3I64A 1XDSA 2J9RA 1DXYA 3M81A 4JUCA 4URHA 4F92B 1E2FA 5EIEA 1U3UA 4G23A 1N3IA 3JQCA 3J7TA 2C4NA 3EC1A 4RJLA 2J3DA 3EEQA 4YJHA 4ID9A 3EUFA 3PNYA 5A5EA 1FUYB 2JKYA 2J3EA 5I7FA 4HP8A 4FONA 3D3JA 4BMSA 4TSFD 2O5CA 1V11A 4DDWA 2H0RA 5KYKA 1SR8A 2Y67A 4IOLA 4MVWA 3SZLA 1E9VA 3N75A 1BHQ1 4FFBA 1UT8A 4LHSA 3UK0A 1O89A 2CGEA 2MINA 2VHZA 1K5PA 1XA0A 4D43A 1HX7A 4QD3A 1U8ZA 3QXSA 3SWWA 2PPVA 4DM3A 2IPMA 2WIKA 2CFOA 2XE4A 4JIGA 2MHCA 5D01A 3T34A 2HZBA 3ET4A 3STXA 4XJSA 3PHHA 3NBZC 1R8JA 3DBOB 5ED4A 1VLQA 2H1SA 4MIYA 4N39A 2F8TA 1YF3A 2YRFA 1UBFA 1HG0A 2PYIA 4PYRA 4TTIA 3P9RA 2D4AA 2I4RA 4W6ZA 2ACVA 3H9UA 4FFVA 4R0NA 3MRXA 3K9CA 4XQ9A 3ROEA 1NTRA 1EVJA 2XT9A 1EJ2A 2ZAOA 5TY0A 4X24A 4XYEA 2E4ZA 4PS1A 2D7CA 3CA8A 4I1IA 5TPWB 4P54A 1JTEA 1Z7BA 4HXGA 4Q3OA 5DX0A 1E2LA 3SF8A 2AFIA 3LOUA 2H48A 1M6WA 2FUEA 4I3HA 3W2FA 1R50A 3GZNB 4OK3A 4QELA 3KHUA 3L7BA 3QEJA 1NP6A 2Z0MA 4ILKA 1E2PA 3EB9A 4P84A 1VGVA 5I8ZA 5EPOA 3URMA 3TEFA 1I6LA 5AJYA 2OYCA 1CULC 1M75A 3IOEA 4L9WA 4AXBA 2AZ4A 3NNNA 4M98A 4ZYZA 4NVRA 4C89A 4JX8A 2FWPA 2VJOA 3MMZA 1VXOA 4S2UA 2FSHA 1Z4JA 1R6UA 4CFYA 3AFHA 1XVLA 4CV0A 4KR2A 2ATVA 1YFJA 1WVIA 4JN6B 3AFOA 3OKPA 3WGTA 1RRKA 2LIPA 3B7PA 5CA1F 3ZE8A 3U61B 2GM4A 1NVGA 3N8DA 4L16A 4UFOA 4MDFA 3CZMA 3FHJA 4WXYB 3IAHA 3SHFA 1LC3A 2C8VA 3L6BA 3M4NA 2GD2A 1XZ8A 2B9VA 1ZPDA 3DT9A 3GGGA 2I76A 4E4RA 1U8AA 2JHCA 4FS8A 4H3HB 4AKGA 4URYR 2NZYA 3AU9A 4Z0PA 4BGIA 1U1EA 1MJNA 1ZXLA 2XGGA 3GWGA 1TW2A 2ZI4A 4FYHA 4M76B 3GEPA 4XM2A 5F7ZA 5TVGA 2P0YA 2XB2A 5J23A 1M1XB 1MV5A 2HQBA 4TV8B 5D3ZA 4NX2A 5DYGA 2RE8A 4XGKA 1HE5A 3O3OB 4FDAA 3DV9A 1SC1A 2D62A 4IV8A 3ZWOA 4PXSA 2VP5A 3I9FA 2PA3A 1E20A 4NU6A 3TQQA 1KJYA 4YCCA 3MFYA 3OESA 3DZHA 4XD7D 2F7SA 2O9JA 4OXYA 2MYPA 1V5GA 2BZSA 2ROQA 2C78A 4A27A 2HB6A 5ARBA 1F2DA 5JAMA 1CNEA 4QYTA 4BCBA 2OCAA 3FETA 2C9DA 4B3SB 1PJRA 3THXB 3QI7A 4DHWA 3INTA 2A0XA 5AVKA 4OIMA 3K72B 5LMCA 5KSZA 2OBLA 3TL2A 3OPVA 1QDEA 2C7GA 5FPKA 4L07A 2QGNA 2XKBA 2F62A 1S7GA 3I34X 3P71T 3PHBE 4QXPA 4N4AA 5A5FA 3BVPA 2WVJA 5HKKA 1D2RA 5BSHA 2PV7A 1FJXA 2Z2YA 1E58A 5FUWA 1VMEA 3IIMA 3U4HA 5C8XA 1Z17A 1IE3A 3G0BA 2QBYB 2Z8YA 1UWLA 4LEIA 1J1ZA 3NW9A 1SXJB 4MB2A 1E69A 2XGOA 3DNMA 1KYQA 4CQMD 2WSSA 4GW3A 3B1XA 4J7XA 2HMUA 4KVZA 4JLOA 3EAGA 1II0A 4NE7A 3RTEA 4ZMBA 2X5OA 5K0EA 4P92A 1IXYA 4IXMA 1ATIA 3QK7A 1GSAA 5H80A 5ALYA 3K32A 1KY5A 2NU7B 3HI6A 3ZGLA 4TLEA 4HQ6A 3IODA 3F2VA 3UPTA 3HYNA 5K8VA 5GY7A 4B3HA 3DLBA 4WSOA 4ZC1A 2Q5OA 3R5SA 4M6WB 4RDIA 4OA5A 1YR8A 4BVJA 2OZLB 4U2BA 4F12A 5KX5B 4RIGA 2MYUA 1SOAA 1ZGBA 4MKXA 4NYMR 2GN2A 5CXXA 5C3UA 3VBEA 2J0UB 1SXJE 1OC4A 4BWGA 2O8NA 1VBKA 4B2IA 3HADA 1BRMA 1W8IA 5CFLA 4DDUA 5CHEA 2VQDA 1Z0IA 5MN6A 4Z1MA 2ZBGA 3O5AA 1G21A 1L7OA 3E0XA 3QQ5A 4IJQA 5EUMA 5IVDA 4IGIA 3WIOA 4K03A 4RMJA 1CYDA 4F3KA 2A86A 1QHEA 2VSNA 4O2BA 4PNEA 2YWXA 5HBGA 4MO2A 1XPOA 2YN0A 1X39A 2JAQA 1QR2A 3CRNA 1Z35A 1PV4A 1ZUIA 4QXQA 1PHRA 1FXWF 4MYSA 4BAUA 4BQEA 1F8FA 3GJ7A 5CYGA 1EVQA 4OFBA 1BEEA 3H2KA 2P2ZA 3N2IA 4NZZA 2XGJA 1TRKA 3VAAA 1RJ9B 4IH9A 2AZTA 4HNRA 4KITB 3KFVA 4L0CA 4QATA 4WT7A 3CUWA 3KWMA 4C7VA 4DMRA 3FF4A 1A7AA 1SULA 5HPYB 3T9DA 1KFBB 4G1CA 2GPSA 2HPHA 1L5OA 1P1FA 2EJUA 3FFTA 3EUWA 3G5TA 3NONA 3KSZO 4GPAA 4PXAA 1M72A 4EFMA 4EZIA 1MR3F 4BXOA 1KOFA 2B1IA 2XNDD 5ELLA 5CCXA 4CXMA 4OXIA 1WXWA 3E2PA 2YIMA 3WMFA 2OORA 1NW6A 3B85A 4NMWA 2Y9MB 3AHJA 2C61A 4II3A 4Z0NA 4HUQB 1YZYA 5B12A 3GZNA 4WI1A 4F1WA 2ZXEA 2H29A 2DRIA 3I5AA 1P2UA 2AN9A 5EESA 3LSTA 3QG5A 2CD9A 4LXUA 3PYMA 5D2CA 5GP1A 1P5RA 3H5RA 4FFPA 3CNEA 3GF4A 4UNRA 3L4JA 2JJMA 2AOTA 4E15A 2P27A 1DVRA 4WFKA 5FXMA 2O8EA 5HIMA 4YTEA 5A3VA 2FPOA 1NONA 2AS0A 2DE0X 1SC4A 2ZZKA 3X1JA 4EFLA 3I2YX 2CXUA 2W2KB 1CUUA 3OZFA 4IEIA 5IYZA 3JQGB 1NWCA 5EJ9A 1K8QA 4D25A 1YD7A 5DNYB 2RH4A 4AZVA 3ND6A 3ORQA 1UP6A 1XPUA 4OBWA 1KS2A 1R0BA 3RLIA 3V1MA 5IDWA 3P2IA 2CW5A 2QUKA 3O1HB 5IDXA 2JEOA 4XZ3A 4HGZA 1TQ6A 3W34A 2EL7A 2FUKA 3MQ2A 5H0IA 2YMQA 4F04A 2RGDA 3GAMA 4P80A 4EY4A 4GUAA 1U4NA 3E2IA 1YTUA 4F1KA 4BGVA 4DA4A 1ZM2A 3D4BA 1H93A 2XZLA 3LG2A 3CF4G 2FPGB 2YHSA 3SZUA 1OBVA 1XAHA 1OAKA 2C03A 2D3TA 2J5BA 1NE2A 3E1SA 2HHAA 4BLWA 1NA5A 5BWCA 3ASUA 4DNPA 2O8BB 5CCEA 1A9SA 1MB3A 3OTHA 2BELA 4QHSA 5KNBD 2OP1A 5H83A 4C03A 1HRDA 1CVRA 4ENUA 1JHDA 4M0DA 4NOKA 4OHMA 1RS0A 1Z8HA 2JJ2D 3PDCA 4HZGA 4AN4A 5ISMA 3EGDB 3WKCA 5IC5A 1I6WA 4DDKA 2Y2VA 3OQVA 2HBQA 4NZYA 4RJIA 4LRSB 3TTTA 4EYOA 3MF4A 2GXSA 5B53A 1K92A 3GCGA 2L19A 5BWLA 1JUDA 4EUSA 3RABA 4H1WA 1QPGA 3ANXA 4PLVA 3TB6A 3TEJA 1R5OA 1RLUA 1M0EA 1QYCA 4XVQA 1XJQA 4DRXA 5JBNA 4EM6A 3BMNA 3FI0A 1HG1A 1L3BA 3GT3A 2PGNA 4D3YA 4XDHA 4EYSA 4NEGA 1NXWA 1M6VB 2AFHA 3NBXX 1PZMA 4MV5A 4FYMA 3WLIA 1PR3A 2Z6UA 4IIVA 1ZUD1 4AN1A 2WY2D 1XJCA 3N2KB 5E7QA 1N57A 4DVGA 4CMGA 2LGJA 3IEPA 4I1UA 4QBGB 4EBFA 4AKHA 1HLGA 1JEEA 2IZ6A 5TJHA 5AKHA 1RP1A 5EQJB 1NBWB 1TM5E 2VTVA 1AN0A 2TMDA 1ZEMA 4IY1A 4WESB 5IKXA 1NVUQ 1SVNA 1LTQA 2D5BA 4RX1A 3T7JA 3ZDXB 1DS6A 2QRNA 2CNNA 5LLTA 3FSRA 2QX6A 4LDRA 2IYOA 3UMYA 4F3TA 2HUNA 1SPXA 1WXDA 3A3KA 3BFVA 3DL4A 3P0IA 1JL3A 3E3AA 4GL4A 4Y1GA 2EIXA 1AUPA 1DFHA 4EJFA 1G5IA 3VHXB 1V6CA 4AJPA 2JRLA 3AOGA 4MQEB 4HYYA 5E6RB 4C43A 3W6PA 3F98A 5GGXA 1SBHA 1SVWA 4BO2A 2G9NA 3LHIA 3ZN2A 5ALHA 4D9FA 1JQ5A 2FR0A 1DZIA 1PR0A 3QBTA 3JCZA 4OAQA 2WWYA 2OXIA 1BX3A 1IDN1 3IS3A 2NIPA 4OFXA 4L8WB 3MJRA 4YP1A 3A4TA 2J67A 4O4HA 3CZCA 4LZNA 1U8UA 3KYDA 1LB1B 3OQHA 5B1SA 4UDOA 1GSIA 1IK6A 3CC8A 5HR5A 1EWTA 1R27A 5D86A 2UUPA 3SJ7A 5KX5F 5BYBA 1GA6A 1W4LA 1MC4A 2IPNA 1RPTA 4E03A 3OT5A 4MA4A 5NULA 4KLAA 2W43A 4L78A 1CIJA 3NHZA 4OX9B 2F43A 3VHXA 1CUHA 2N75A 1DEXA 4XR9A 3WP0A 3TB4A 2Q3HA 1YRLA 3FN4A 3KKPA 4HYEA 4IEFB 1MDFA 4DJJA 4JD5A 3K0CC 3UF0A 4BLUA 5KUTA 4GOLD 1XXHB 2OBNA 1E5VA 1TJ5A 2I2FA 3HU2A 4B2PA 4MDEA 4UOZA 3OX4A 4RTJA 1M8KA 4NRDA 1E2NA 4BFSA 5KWSA 2VL7A 4QDUA 3NHMA 2SKCA 2Z5LA 1RAFA 4B1FA 4DA0A 2X3UA 2M6RA 4DLLA 3H8SA 5A6SB 2GVNA 2J0QA 4D9GA 1PR6A 1KERA 3DUWA 3VPBA 4C08A 1X7YA 1AY0A 4MARA 2B6HA 1D8TA 2BMDA 2OV3A 1XD2A 3SZMA 2GI4A 4CKYA 3NJ8A 3RC8A 2J5XA 5DZSA 4C7OB 2D1SA 1M6VA 5CRIA 3R7SA 1MJFA 1Q17A 1F1BA 4X8OA 3E27A 4Q9IA 3BMNB 4G97A 2O2SA 1K9VF 2FPMA 3JQBC 4J1TA 4Q3LA 4NBSA 1XXHE 3MTAA 3N3BC 1Z5ZA 4KO2S 4AZ0A 4QQRA 4RVGA 1WKBA 4L5YA 4Z0HO 5FQNA 2VF8A 4LJ8A 1DOZA 1CXZA 3HGQA 3I9NA 3BMQB 1E1YA 1NFQA 1RAHA 5JH7F 2C7PA 1G2PA 2G7MC 2DKFA 3BRWA 3KQYA 4BJ3A 3RRFA 4NABA 5CDHA 5IPFA 5DLQC 5FL7D 1L5VA 1J4AA 1RWOA 2P6OA 4D9IA 3FUTA 4K86A 3H2ZA 3ILHA 3U4AA 4BFCA 4C1BA 2CXQA 1I2MA 2D1TA 3EVFA 2Q4TA 3PUWA 4OP1A 4P5EA 2QRLA 1C9NA 1MIHA 2A84A 3WO0A 4YGXB 2OO5C 1CX9B 3KJHA 1RABA 3M49A 1NBIA 2BGWA 3MYYA 2YX1A 1HR0B 4Y9UA 3CONA 2B3DA 2OT3B 3QUAA 3NJRA 2MSCB 3N05A 4IG4A 5EHZA 4EHLA 2JGLA 4JB8A 9ATCA 5CCBA 4JVNA 2V4UA 4MUBA 4EA6A 1PD1A 4OK5A 2GHRA 3O8BA 3INGA 3Q3VA 4IG9A 4B44A 3UJ9A 3JQAB 1U7DA 1X1EA 3E8SA 5IKOA 2V7TA 4EF6A 2YYYA 3VAYA 1SXQA 4D97A 3V7NA 4ZANA 4NYMQ 3TVTA 3AQIA 3FKSA 4KJXA 4YDSA 2NZUG 2V03A 4QJBA 3SSAA 3UAVA 5FEUA 3EW9A 3WGZA 1ZEJA 2H9YA 4P0QB 5G53C 4HNHA 2NUAA 4RE6A 4EG4A 3LDHA 3DAFA 2FZ4A 3PZRA 2KM1A 5IYZB 5FR2A 4NONA 1XALA 1WSWA 5E0OA 5LYYA 3WJ1A 3K6KA 4JJ4A 4BJ6A 1ODTC 3HSYA 1BWSA 2CLKB 3CE9A 3USES 1ZFNA 1KDRA 4X45A 3MD9A 4DB2A 5AVJA 4BWYA 5HJ7A 3EW7A 4HQRA 2DX7A 4UEQA 4B09A 1N5RA 1SRQA 1DQNA 5REQB 4B0OA 4A4DA 1W4BA 1RIIA 2ZTUA 3H3XA 4GOKA 3UOWA 1C5KA 4ILEA 1E3WA 3HKEA 4D8WA 2O0MA 4GMKA 4PQGA 5AKXA 1Y3BE 2AHRA 1TECE 2H2IA 3VYUB 4V1CB 2O2HA 5KREA 2AD1A 2D0PB 3GRZA 3L6EA 3RNOA 2WB4A 3ASYA 2OAEA 1FMCA 1ZRHA 3TGWA 1SBNE 4Y9DA 3IV9A 2AR9A 1OA0A 1Y7PA 2IGTA 1CUZA 4LYDA 3HXQA 2AMYA 2BAGA 3FVQA 2GBPA 3S27A 2XCSB 3WJ2A 1E77A 2YRXA 5TDHA 4R8SA 5F9MA 2PT6A 2I7TA 1O1YA 3I76A 5I9NA 5I48A 2RJNA 4AG5A 3L6UA 1N2SA 3KKLA 4OU4A 2IXEA 4RORA 3WLNA 4EG8A 2YJ3A 5J5VA 1ULZA 4MGYR 4A92A 2ZYTX 4PCVA 2PL1A 2PSDA 4JLNA 3DQZA 2BBTA 2PNFA 3VC2A 3E9NA 3VKUA 2AQHA 1GZ5A 2OBFA 4K6CA 1A27A 1CR1A 3ZE7A 1G2QA 3SSOA 1E9DA 3P4YA 4FBLA 2C1EA 1RYNA 3RRNA 1EM8A 2H85A 2ORED 3AW8A 4FFRA 5JRZA 2Z43A 3TKAA 2G9VA 3ZPXA 2DUMA 2OHVA 4UBIA 3ZHVA 3HBJA 4E1VA 2NOAA 2GZMA 4ALJA 1JQLB 2VTKA 1JQAA 4BEBA 4JDPA 4DHEA 3RM3A 3FPGA 1L7QA 2VLBA 3A9VA 3MIIA 5K9ZA 2WILA 4IXWA 2QPAA 3EY9A 3LHSA 4D42A 1LPPA 2C04A 1NVWQ 5EKXA 2PTGA 5E9AA 4KB5A 3NKVA 5CA1B 1FBNA 4GXNA 2C96A 3PGKA 2AUNA 2QVCA 3AM4A 4HTFA 3ZV3A 3DWFA 3KOOA 3HYSA 3A6ZA 1ZJ4A 4MTCA 4TT8A 5F1KA 3RKSA 3UA4A 4DBLC 1M7GA 1QRRA 4U6QA 2FHSA 3A1FA 3PF8A 2D7DA 4QBHA 3EUEA 1TUEA 5FA6A 1W5AA 2PZEA 5LZ9A 2PXCA 4YRKA 3L6OO 5CYPA 4CEHB 1Z8NA 4O2AA 4IPTA 1G17A 2AOVA 3RJZA 1L5ZA 5A06A 5D5PA 4ZVNA 1AZLA 2FY8A 5J40A 1X7XA 4EB6B 1NVMB 3FVWA 4PF1A 3MCWA 4MB6A 4U7JA 3ICCA 1NU8A 1W0JA 2QBYA 1JYSA 3WBJA 3VC3A 2IIBA 3G9UA 4CM7A 1R3DA 4XWTA 1BVRA 2ISQA 1NXPA 4OQMA 1UKEA 4DQKA 3FOCA 1UPXA 3OM8A 2ZSAA 1JH8A 1WD7A 3BPSA 3PJEA 4J4HA 3MGCA 2NVUB 3ZK9A 2XA2A 1VLZA 2XE7A 6ABPA 4H1TA 1ZK0A 3OPMA 4MYHA 2FAXA 1DXOA 3KYBA 3EMKA 2VNSA 2WJ3A 1U63A 5ITZB 2YWJA 1FDOA 2AXNA 3Q3GE 1DBRA 4IOMA 4MRVA 5I3CA 3DXFA 4TKUB 4N3CA 2O8DA 1QFMA 3EXIA 4N12A 4RPGA 3OM9A 2JEYA 1G7TA 1TUGA 2YXBA 3BJZA 1ZDMA 3G0CA 1Q1GA 4G5QA 4DSUA 1K66A 1ID1A 3OZCA 4FQ7A 2OUIA 1JHUA 2FFQA 3A27A 1VE5A 1YUMA 2W0SA 2PFGA 1DUSA 1OPRA 4A8JA 2YIVX 4B6OA 2O5RA 4YCNA 4YAKA 4JT9A 2BRUC 2WLSA 2V45A 5DTEA 4O4JA 1VYTA 1CIVA 1ILWA 1M0WA 1KDTA 1FIUA 1OXVA 2OESA 3W9YA 4DG9A 1GFSA 2VFAA 2X8JB 5IF9A 2ZT6A 3WKAA 4I7EA 4I5GA 5I4KA 2O1SA 2QUZA 4RAQA 4I4LA 4IYJA 4O0MA 3ROXA 2VP3A 1ZK1A 1KU0A 3DMNA 4Y3UA 1NVXQ 3T1HB 3KJFA 3S2IA 2R0QC 2ZJBA 1IM5A 2AOWA 1RRVA 1L4UA 2FNAA 3Q41A 2DYKA 1XLUA 2AXEA 1E98A 2WF6A 3L6RA 4DR1B 3DBLA 1YDMA 4UREA 3P8ZA 1TQHA 2XADA 1FSZA 4IXDA 1SD5A 2VUHB 3AFMA 3I09A 3PJDA 1P2TA 4EUKA 1ZM3A 1I5OA 3NAGA 3F78A 4IJKA 4NCNA 3SIXA 3CEAA 1II8A 4ITVA 1EEHA 3SMVA 3DW3X 1KJJA 3KSRA 5HVNA 3HUEA 4BJHB 2VAMA 1AQLA 1E7SA 3I1JA 4PRKA 4RELA 5ICSA 4ZZ1A 3TG8A 2Z3ZA 4Z3KA 2XUFA 1OGIA 4H0NA 1AK9A 1Z47A 3G5MA 3PS9A 4D0SA 3I2KA 4J0DA 2JGMA 3HV2A 5SZHB 3RFUA 3TRHA 4EUFA 1BH2A 3A6EA 1TRHA 1JHVA 3WQBA 4B3FX 4M0CA 2ID7A 4LRYA 1JB9A 1NN0A 3DDSA 3OJEA 2GF2A 1W96A 5C37A 2WKSA 2FMKA 2ZI6A 3EXAA 4HWKA 4RGYA 4UU1A 4A15A 2YFHA 2X8AA 4IH4A 1SHTX 1NSFA 4TTPA 5DE3A 4Q34A 5FUMA 2JH8A 4X65B 4DUYB 1OGJA 2O8VA 3IRUA 3MBOA 4G2TA 1RQ2A 1LF5A 4UUOA 4UD2A 4XYBA 4ALIA 4N5IX 2F3TA 3M4XA 5CFZA 1H69A 2JI9A 2CDAA 1B2RA 3QXXA 4AICA 1PGJA 4ERNA 1FNMA 5FUXA 1JX6A 1BAPA 1BO6A 1GVNB 5SZKB 5CA0F 4QVIA 1TZ2A 1M2HA 3ADBA 1H2EA 1PEAA 2RKOA 4M1TA 1JFRA 1E0DA 2R8EA 3PYLA 3QXCA 4OEHA 4AJJA 2W6PA 1C9DB 1BJKA 1DOAA 2Q4DA 3KKQA 3PXBA 1EWYA 1U28A 1OR8A 1PFUA 1ZOLA 2O8CA 2WV9A 4J94A 1D9ZA 2XUKA 1FYDA 1ONPA 4DRYA 1VKHA 3TIFA 1Q14A 4YRQA 2RH9B 2V7QD 2G76A 3DOJA 4TTVA 4JITA 1L5GB 4EG6A 3OFNA 2VDJA 4CF6A 2CBZA 2VXBA 2CFSA 3EZXA 1O0CA 1T0HB 1ZH0A 1ZL2A 2XCIA 3MTJA 5BQOA 5GVSA 5JS7A 1A95A 1TK9A 4YO7A 4CL0A 1JHRA 1KHTA 2DLCX 4ZYTA 4BRSA 4UJ3A 1RZ3A 1IBMB 2XCRB 1DEHA 1CEQA 3WFZA 4UAVA 1TF7A 3ES9A 2VQEB 2RHHA 3RK4A 4H7JA 4UMFA 3G6KA 1OU0A 1GUYA 3L02A 3EXEA 1KPHA 2CHEA 3JQ7B 2FV8A 1PQUA 4R1OA 3M82A 5JSQA 4NCBA 4ZO8A 1VB3A 3K9WA 1WUYA 1R4ZA 2XDQB 3DAPA 4YFYA 4CGYA 3IDFA 3PRYA 4P3XA 3UMMA 1YFZA 2EF1A 4PG8A 3BD9A 5JI2E 3MMXA 4AROA 3TZBA 5BSRA 5KNDA 3K09A 4TX1A 4E2ZA 1MPXA 1HTWA 1KO7A 4O1IA 4WADA 1HQDA 3HACA 4H18A 3PU6A 2VYCA 5IRCD 5GMOA 3B3JA 2IUUA 2ILTA 3IUMA 4LS3A 2IUSA 3HR8A 5C8VA 1EXNA 1X3LA 4YI3A 3N8NA 4EENA 3KEMA 5T41A 1JPUA 3DPSA 1WP9A 2A88A 4JQYA 2GEFA 3TIXB 4PC7A 2YHIA 4LKRA 1U2ZA 3NM5A 4QFCA 4UVDA 3GA5A 4PO9A 5J4HA 1HDCA 3SKVA 5DBOA 3AR9A 1NQAO 1XCJA 1Q91A 1Z45A 4EMBA 1T8WA 3P5BA 3ICPA 1BS2A 2B78A 4QNMA 4N5HX 5BR8B 1CV2A 1T36B 3GEEA 4P08A 3LCJA 3RRZA 1QKJA 2OAQ1 2XTAA 2IDJA 3L92A 4H7IA 1ZHHA 6GPBA 1JTVA 1KXJA 1A9RA 2J9ZB 3EHEA 5L7TA 1V47A 1T3GA 3JATA 2EIHA 5BWBA 1YWGO 4TQAA 1ZQ9A 1WW2A 1UQUA 3K8OE 3OZSA 4C4TA 1NVAA 3Q1KA 4EY5A 3SDBA 1XE3A 2Q9BA 3EH1A 2HHHB 2GESA 1AK1A 1AB5A 3CS3A 4IICA 5H70A 3ZK8A 3ZXSA 1ZD3A 16PKA 4DANA 5MDHA 3CVUA 1RM3A 5KTPA 5IAJA 1TTPB 2GH1A 3ZNQA 4W5RA 2O8FA 2OR3A 5FTWA 1RQPA 1P0CA 1M9NA 4OAOA 2QTMA 2VF5X 1BE0A 4MYUA 1NQOA 2PKXA 4TKLA 4GX5A 1OI7A 1NYQA 1SVKA 1TK2A 3H2SA 5JHHB 1OH6A 2E5FA 2C5GA 4OYYA 2OBBA 1W6RA 3A05A 4XCVA 1U11A 1YOVA 3Q7SA 3DOUA 5TQJA 3RG8A 1QYDA 4CKCA 4CE6A 2C5LA 3GT0A 1LWNA 4WACA 1W0KD 3H5WA 3HCDA 1GZ4A 3N2LA 3Q7TA 4JQOA 4S04A 1N8SA 4XYMA 4Z4QA 3AKYA 3C8DA 3W8EA 4ZYUA 2FH5B 4NBUA 1NIPA 4C3OB 4C87A 5K1ZA 2IY7A 4AY6A 1V3UA 4RCVA 5FJIA 1SUEA 1IAVA 4YA6A 2JIDA 1I7SB 4RXTA 3OT4A 1ZIDA 3KR0A 1J7JA 1WCIB 1Y8CA 3C97A 4X61A 1Z18A 3ET5A 3RHFA 4C3UA 5JYBA 1KDYA 1RRCA 1US8B 5EJEA 1A77A 2ORVA 3CUVA 4YB8A 3LL4A 5J2UA 1T3HA 3FTFA 4TZ0A 3I8OA 5JANA 5AOBA 4WUVA 1TAGA 4OQZA 1YI1A 1JAHA 3UWKA 4EEXA 2BH2A 1JBEA 5KQLA 3W79A 2LTAA 2GVZC 5B3JA 3RAPR 2OPBA 4MW4A 5DTJA 2NP6A 3GNLA 4I1YA 1CJBA 5LQJA 2VDKB 3TBHA 3WGGA 3K09C 1UPCA 3FNBA 1N5IA 3H13A 1U7WA 3PGVA 3ACDA 3T4PA 4DLRA 4KP7A 1EVKA 3T7CA 3ZI4A 1VKZA 1NT4A 3EVNA 2GN8A 4IP0A 2HRBA 5FFMA 2PLNA 1CB7A 5AHXA 4BO5A 4GLOA 3QU4A 4FKZA 3T9EA 4RZ2A 4DCVA 4D82A 4Z3OA 3PRKE 3R77A 1V7QA 5DHQA 1PL0A 3HYRA 4KYVA 3QM1A 3M6WA 3R8XA 3RWBA 5IVHA 1CQZA 1C8KA 2YVLA 2HSGA 3UB3A 1JIKA 2ATIA 3OTGA 4EUEA 8AT1A 3BRCA 3NMUF 4MVCA 4Z7QB 2PVCA 3A58B 3V8EA 1A2KC 5K6RA 3N2EA 1KE2A 3UJ6A 3HJFA 5HM6A 4KOAA 3BHIA 1UC4B 2EQAA 2Z8YM 2V8BA 4KWIA 2PZGA 5A3QA 5BSMA 4WCDA 3C3WA 4BNXA 1JPNA 2QTLA 1CUEA 1F6DA 3E9EA 5LCXA 3KZXA 3ICEA 2R4QA 3R5XA 3FNHA 3S8MA 1YGPA 2YS6A 3HDJA 2P6UA 3QLTA 1YE8A 1SHUX 3G2NA 2YWBA 2QTVB 1JI0A 3NHPA 3QFTA 1PQPA 2B4QA 2O6LA 1VKRA 4MV9A 5CURA 4F6CA 4Q1VA 3B6MA 4HPXB 4Q1EA 3B6ZA 4KE8A 1M5UA 1UBCA 4Q03A 3T7SA 2PFSA 4E13A 4HEA1 1AKMA 3PFGA 3LQRA 5FHQA 5E6SA 4ZOBA 3Q5EA 5G3YA 2CFTA 2QQ0A 2FA9A 2QZJA 5DYIA 3DGFC 4KGDA 3FPFA 4O08A 5JLAA 1ZVVA 3DM5A 3IDZA 3PQ2A 3NDBB 1YR7A 4WN3A 1PG5A 2F2TA 2EJCA 2JH3A 2RJOA 2VUTA 2IJGX 2C54A 3NGXA 4W82A 3ZH9B 4R54A 7MDHA 3IQXA 1YVEI 5ICMA 1GRCA 3ST7A 1GQQA 1N33B 3DT8A 3JAWA 2FDCA 3SZGA 4YJFA 3LH5A 4TLDA 1N3LA 5E2AA 4B8YA 1XZCA 3QE3A 2JFQA 5AR1A 2Q7DA 1SIOA 3VO8A 5A9SA 3TZCA 4G1EB 3IX7A 1A2QA 4PVDA 4MWGA 4U2EA 5DEIA 5KSWB 3OHSX 3AXSA 4UBNA 1D03A 2LRHA 3R3WA 3ICQB 5B5SA 2CC2A 1LLQA 2SBTA 3CR8A 4WY2A 4Q19A 1F2TB 1J9EA 2QR5A 3FCOA 5LU8A 5IW8A 1KDVA 4KG7A 4XPIB 1PJ8A 3E5HA 2PGOA 1QAMA 3VR6A 4LJRA 1DC6A 3KWFA 4FVTA 1M2VA 3BRQA 4CV1A 1DT5A 1E9EA 1BCRA 2C2XA 3SHTA 1LQTA 3QP9A 1H1DA 4AJOA 5C1OA 4IWYA 4XFJA 3PQ6A 4IJMA 4BNYA 2ZBFA 5IZ4A 4QREA 2C0PA 1GTVA 4KHPB 5EIAA 4P4NA 4EAAA 5IVKA 4Q6WA 5TNXA 2QK4A 3GG9A 1H5NA 1YQGA 4JLKA 3UTCA 1TZJA 3EFBA 4TWRA 3D8HA 4YXWD 3MJSA 3OSUA 4LTNA 1X70A 1QG6A 5SYNA 3VOBA 4A2QA 1HI9A 1NX9A 1TKCA 2Q4RA 2ZROA 2QRMA 3GIWA 4XR4A 3ERCA 1HDGO 3WS7A 3KSDO 4LGVA 3EDRA 2XTNA 3IBYA 3JD4A 3D5EA 2D1QA 2P9FA 2FWAA 2P62A 4PS0A 4LF8B 1Z2OX 1C1YA 5I7WA 1RXWA 3U49A 5HZKA 1HDYA 5KIAA 4D0NA 1N2OA 3ODPA 2Z58A 4GQIA 3O74A 1PS8A 4FR0A 1M8GA 2FRXA 4KQCA 1N9GA 1QYWA 3AP1A 3D4IA 4HDQB 1ZHOA 2QV7A 1QCDA 4P6VF 3I4LA 2VPZA 5I7SA 1M2OA 1XKQA 4RVOA 4C14A 2J5QA 2I7VA 4INAA 5DHFA 4BZPA 2DAPA 4UVGA 1R7RA 1YRYE 4BC1A 3SXPA 5IKPA 4YV0A 3R0XA 5GM1A 3GYGA 4L6CA 2G5TA 2IYWA 5BR7A 1J0XO 1RI3A 1DRJA 4QGBA 1PEKE 2Y93A 2I1QA 4NMLA 3ZCVA 4Q9LA 2C4HA 2YZ7A 5C4GB 3EIOA 2VJNA 1QF6A 3BF7A 1JG1A 3K2BA 1UODA 1U9ZA 3LQQA 1JPJA 3MEQA 4U5QA 3QY9A 1V3TA 3REOA 3WJAA 7AT1A 1IY8A 2X4DA 4ETNA 1YB7A 3C6MA 3Q3JB 5HZGA 3KKZA 3U7IA 2RGUA 1P7VA 1H2RS 4KVGA 3SYRA 5DGIA 3OOEA 3P2JA 2Q4OA 4D7AA 1DU4A 1J2RA 2EAUA 1YCHA 2IYTA 1E9FA 3RS0A 4DJEC 4NU8X 2WVHA 3RT7A 4XLLA 4B6GA 5LYJB 2QIPA 4CEIA 2YINC 1KRWA 1U94A 4QUDA 3VR0A 4B7XA 3CMMA 2Q5EA 2X6QA 3CCBA 4KUGA 4EGSA 4L1KA 3IAS1 5ALXA 1XOIA 3T9AA 3EQZA 1T6BY 2Y0DA 3E1KA 1W8DA 1KI4A 2PY6A 2VZLA 4KYUA 1QV7A 4IXNA 1W44A 4M88A 1KQNA 3BWBA 3TE7A 2ZTMA 2VPIA 4KPYA 1P33A 1HFJA 3C7KA 1MA0A 5E38A 2B61A 3B6EA 4MXDA 1W1IA 1PV2A 2AWOA 1BCSA 2NWQA 5ERYA 5T4EA 1S2DA 3D5TA 4A5SA 1T1SA 1T8PA 4F3NA 4L3WA 5HSGA 3QMPA 1MA3A 1YRHA 4YJDA 2WIAA 4K1LA 2Q7OE 3U6KA 3GOHA 2W6QA 3SQXA 2W9XA 5EIBD 1UKZA 1KVUA 3AEQA 5K99A 1B16A 5HW0A 1THGA 2JFZA 3BWMA 3IOCA 3N0TA 2H5IA 3HU1A 2WYVA 1OTXA 1S2OA 1G4HA 3KE9A 3R8CA 3I3OA 4Q82A 4J16A 2AK3A 1NIJA 3CKYA 1H8HA 2VATA 3N07A 4GZ6A 4TL7A 3RQSA 4QFBA 4E31A 2WAMA 4WZBA 1GPLA 4GVLA 4IVPA 3PNQA 4J1NA 1P1KA 4X63A 1HSOA 4EPWA 1KQPA 1H