4CMKA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
250
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 92
structure length 250
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmkA00
3AUSA 1IB6A 2NVUA 5JS6A 4JJGA 4WLVA 4BB6A 1I3LA 1R16A 3RUEA 3GN1A 5F5NA 2WJPA 2OP1A 1H6CA 3G1UA 2Y1FA 1PJSA 4C7JA 1DC3A 5JLAA 1YONA 2O48X 3K8ZA 4GVLA 3D3WB 4MOWA 4RF4A 4M89A 6ADHA 1K6XA 3AOEA 2ZQZA 1JN0A 2BMAA 5L7YA 3QVSA 4BV9A 4PGFA 3WWZA 2JD0A 2H6EA 1P44A 5IDYA 2GO1A 2NADA 3ZWBA 2O23A 3AFNA 3AOGA 4DPMA 1ADFA 1F14A 3LDHA 3PWSA 4UEJA 3CXRA 2WEKA 1QXSA 3LC1O 4PLGA 4BNMA 4WLUA 3GUCA 4XJTA 2DUUA 2GR9A 5DT9A 1R0LA 2Q4EA 4N7RA 1FMCA 1TEHA 2YV3A 4R1UA 1HRDA 1P1IA 3KTDA 4LSWA 4PG6A 1VPDA 2O4UX 5IFLA 1MXHA 1YXMA 3UGKA 2WWRA 4J3FA 1PGOA 2DU8A 3WFIA 1K0UA 4YAGA 1G6KA 1WWKA 3WGZA 4CQLA 5B4VA 2X9GA 1U3VA 3PHHA 3PXXA 3AY6A 1ORRA 1X1TA 5CG2A 5JY6A 3BMCA 3C8MA 4XQGA 4WGGA 1ML3A 5IDWA 2VRBA 2OO5A 4R3NA 3WSVA 4BNTA 2VTEA 1CETA 1Q1NA 2IDZA 3D5QA 3ENKA 1LSSA 2P9EA 3I6IA 4LCJA 1SMKA 2H1SA 4ESOA 5KOIA 4IJWA 2DLDA 7ADHA 2DTDA 3RASA 3RUDA 1EQUA 3ITKA 5HA5A 2VUUA 3AM4A 3I9MA 1V6AA 3RQSA 4J7UA 4CUZA 3RWBA 3ULKA 5GZ6A 3CIFA 2VOJA 5FF9A 3WBFA 1EFKA 3BIOA 5A02A 1PGQA 3QWFA 1JW9B 5LDHA 3H9QA 3HE3A 5JO9A 1XYGA 3AUTA 1NASA 4E12A 3VPSA 4R1NA 3X2EA 5B4UA 1NPYA 1DC5A 1PQWA 3BHJA 4FFMA 1HE5A 1Y1PA 1ZO8A 3JQ7A 1C0IA 3JD2A 3RC2A 2GERA 3RKRA 1Q2XA 2V6FA 4LGVA 4BGVA 2YJZA 3FN4A 2OOSA 2Q1UA 2QRKA 3OFSA 4WNIA 4NFHA 3NKLA 4BKQA 2AQ8A 1K3TA 1B2LA 3H4VA 5KJEA 4CL3A 2DTXA 3OICA 1CEQA 1ZSVA 3CH6A 1AXGA 4GH5A 3SBOA 3V1YA 5JC1A 4CPDA 3H9UA 3HZZA 3DDNA 3FF4A 3TF5A 2ZTUA 3Q6IA 4D79A 4YT4A 3CTMA 3G0OA 1YKFA 5JCJA 3KYDB 2WM3A 2A94A 1RKXA 3PEFA 1Z73A 4RDIA 2Y93A 3WDSA 3SVTA 4P38A 3F3SA 3WGTA 2PKQO 1P31A 3CINA 3U5TA 2Y0DA 1A4UA 4CMKA 3WX0A 1PL8A 1E7WA 3A1NA 1W0CA 4PLVA 4GX2A 5LC1A 4ZHSA 4IGFA 5DBFA 2BELA 1RYEA 1NBOA 2BF7A 2IZZA 4IQGA 2PKQP 3D7LA 3NT5A 4XYEA 1A7KA 4I5FA 2Q2WA 4EEZA 4JNKA 1MG5A 4LCEA 4ZJUA 1R4MB 4W6ZA 4CV2A 1O6ZA 1I2ZA 3F4BA 2E49A 1EK5A 1V8BA 1UZMA 4WPGA 2BKAA 3GEMA 1U8XX 1YQDA 4KWHA 4HXYA 3BMOA 4YAIA 2Y68A 4J91A 2IZ1A 3LLSA 4YJGB 2DTEA 3HQ4O 4BUCA 3AI1A 5T8KA 3DBHB 2J3KA 3DBRB 1BXZA 1D1TA 1I24A 3I9KA 3U4CA 1CWUA 4IS2A 2Q99A 4QSMA 5H81A 3K2EA 3ROPA 2NUAA 1SB9A 3ICCA 4E21A 5K0ZA 3GZNA 2Q49A 4R4JA 4BGUA 4CR7A 4NU5A 4O5OA 5C7OO 3R1IA 2I3GA 5COAA 1LBEA 1D7OA 3WJ7A 4UVHA 2GGSA 2AE1A 1EVYA 4TWRA 4CV0A 1Y5MA 1M66A 3DAGA 5COQA 1XQ6A 2YQ4A 3RFVA 2OMEA 3X2FA 3HFSA 3INTA 1BTOA 3BTOA 1LDGA 2X1HA 2ZTMA 2ZTVA 2O7QA 1U3TA 3GHHA 2O3QA 1SO8A 1N92A 1XKQA 4R5HA 3KLMX 4ZQHA 4AFNA 4J49A 4MVJM 1IHYA 1SCUA 1A5ZA 2GN6A 3ETGA 5C7IO 5JYEA 3C1AA 4TKMA 4Z9FA 4CMJA 3ETEA 1QYWA 5JCXA 1T2AA 1GEGA 2H5LA 2Y67A 4WLFA 1J4AA 3FI9A 2DVMA 1VRWA 3I5MA 2BFMA 1T1SA 2Y1DA 2PV7A 3SX2A 4XZ3A 1BW9B 2FWMX 1MP0A 4PLHA 3H9JA 3TOXA 2PGJA 3PWKA 4IIUA 1DDOA 1EZ4A 3O03A 4AJ4A 4UUPA 3GG9A 2ZCUA 1JTVA 3ANNA 3ZH2A 1H2BA 3C7AA 4NBUA 3F1LA 2DFVA 5JAMA 3GQVA 1YB1A 3TZQA 3I4CA 4K1LA 4PIVA 1YRLA 4RLHA 2PZJA 2I65A 4OHUA 1LQTA 2NU7A 3NGLA 2NTNA 3O9ZA 5J23A 2X0IA 5L40A 1IY8A 5A3JA 1QLJA 2YHIB 2J5QA 3GPDG 4FFRA 3KM0A 4I5EA 1DJNA 1LA2A 1CIVA 4YAEA 3HN7A 4A0SA 2O3TA 3DBLB 2E82A 1HF3A 1N2SA 3OQBA 4II2A 4WLOA 3TL3A 3RC1A 3M6IA 1ISJA 3E9QA 4W7IA 3V2GA 4O0LA 1YBAA 5A9SA 2JHFA 4B3IA 3OJOA 3PQDA 3GA0A 1TB4A 3MJVA 1DFGA 1V35A 3H5AA 4NFSA 3WBBA 2QYSA 2FSSA 2B4QA 2D5AA 3JQFC 5TT1A 4A26A 1FDVA 4KQXA 4CM1A 4ZGWA 5KCZA 4WUVA 2D2IA 3DBVO 4L4XA 4I1IA 4E13A 1HDCA 1P1RA 3GFGA 1SOWA 2POQX 3H9EO 4Z0PA 2RH4A 4D42A 4GWGA 2X86A 3UICA 3C1TA 3EDMA 1GUZA 1IPFA 1U4OA 3KEQA 1DOHA 1NQOA 5DZSA 2Q46A 1QMGA 4BO1A 4MP6A 4FD3A 2ZATA 4OAQA 1UAYA 5A1TA 2B4TO 1N8KA 1PJTA 3L77A 5BNFA 4CLDA 4DMMA 1N7HA 1BDMA 3NAQA 3TJRA 2AE2A 4I8XA 4E4YA 2O3SA 3OMLA 1JVSA 3EYWA 5HTOA 3DZKA 4H15A 4I5GA 3QP9A 5DN9A 3ZV6A 1HWYA 3FWNA 5IDXA 4EJ0A 2W2KA 3QWIA 3E82A 4J6FA 2Y1GA 3SJ7A 1DIAA 2IZ0A 2Y0CA 4OO3A 5IZCA 5I9LA 5A9TA 3DOCA 1E1LA 2ZIZA 3T7EA 5GZ1A 4DIFA 1LLUA 4Y6SA 1HE2A 2EW8A 1GUFA 4IDDA 5GMOA 3JQFA 3ZV3A 2V6GA 1H6DA 2NU6A 2D59A 2PFGA 2Y0EA 1XELA 2DM6A 4QUKA 1ENOA 1BGVA 2AW5A 3GDOA 4F45A 3OJEA 2AQKA 2C07A 2PGLA 4LRSB 4RPLA 3ZWYA 4U6SA 4TRRA 4RF5A 4ITUA 3S2FA 3O38A 3RUFA 1F17A 3EC7A 3PQFA 4DA9A 5DCYA 3JSAA 3TRIA 3GUYA 3GGOA 5LDGA 3H5NA 1RM5A 4CM8B 1QORA 5AQ1A 4F6CA 5JW6A 1CF2O 3GPIA 4YEDA 3TFOA 3DONA 3LC7O 4HFRA 1ZH8A 1KVSA 3B20A 1TT5A 3AM5A 4ZQFA 4R5MA 2BFAA 4G5HA 2JD2A 1T2CA 3DZIA 5CAEA 4YJHA 3AOEC 2WYVA 2C0CA 3OBBA 5DP1A 5DNAA 3B1JA 4M1QA 4UEKA 5K6AC 5JBIA 4PLCA 4BQPA 2E37A 1CQIA 1FDWA 3WMWA 4Q9NA 5U4QA 3ONFA 3H6KA 1X0VA 1X14A 4URFA 5HM8A 1E3JA 4BO2A 2BH9A 3IOYA 3H7AA 3ITDA 4CV3A 4Q3AA 2DAPA 3IP3A 3QVXA 3DMTC 3RI3A 1BW9A 1T4BA 1NQAO 3MZ0A 1ARZA 2DC1A 1KOLA 4J1NA 4DC1A 3AU9A 2R6JA 4NIMA 3PPIA 2O2SA 1J5PA 3K92A 4CQMA 2ZK7A 1SBYA 3ETDA 3AWDA 3WTCA 4RVFA 1SZJG 1UXJA 3ADOA 1Z82A 5A3VA 7MDHA 2G5CA 2YHIA 4Q3CA 2VHYA 4W9NC 5A05A 3WLFA 2V6BA 4AJOA 2CZCA 3F47A 3IL2A 1H2HA 2HK8A 4J90A 1HEUA 4IBOA 3TSCA 3ZWXA 1XWFA 3PJGA 5JDCC 2HMSA 1PWXA 3WSWA 1E7MA 1GYQA 1QR6A 4MDHA 5G0UA 3IDSA 4DGSA 3HADA 2JL1A 5G0WA 2C29D 3IP1A 4LISA 4EDFA 4QFCA 3WFJA 1Z75A 5I9MA 4I08A 2WDZA 3AM3A 1W4ZA 4Q3EA 4PZCA 2QZ9A 1NQTA 4EZBA 4ILKA 1RM0A 4CUKA 5C3MA 2C5AA 4D43A 3EZLA 4XDZA 1PJQA 1Z45A 5KJ1A 3BMOB 3HDYA 3KOUA 2VRCA 1I10A 1DO8A 1E1KA 3G49A 4BV8A 2FHSA 1AXEA 1RWBA 2Q2VA 1C1DB 3SXPA 2I66A 4PG5A 3WGGA 2NM0A 4GX1A 3V1TC 3GAZA 4ZQBA 3SLGA 1YO6A 4N54A 1NYTA 5FFFA 5T5QA 3I9LA 3DBHA 3KETA 2PTGA 5ENDA 3DC2A 1TLTA 3D4OA 3E5MA 1KVQA 1U5AA 4L0QA 1GPDG 1GPJA 3LLVA 1LSUA 3DR3A 3VPXA 1VLLA 1JVBA 4FJ0A 5L7TA 2GCGA 1QYVA 2PK3A 1X7GA 2WD7B 2DT5A 4IDAA 1R4MA 3PLRA 3ANLA 3NT2A 4FDAA 4EJ6A 1LLQA 3BMQB 2GN9A 1BRMA 4BKPA 4L9RA 4A27A 1YQGA 3VTFA 4AJKA 3ABIA 3IC5A 4OKIA 3ZHZA 5IN4A 3QVWA 4XKJA 3JQGB 4GPD1 4JP2A 1E5LA 1U28A 1HL3A 4PRKA 1CRWG 2EP7A 2YW9A 3UXYA 3ZWOA 4NZ9A 1GV0A 3FNHA 3ZWNA 3WJAA 2GSDA 3K5PA 3NTRA 4NBWA 5BR7A 1WZIA 3EVTA 4FJ1A 3ZCXA 5JPIA 4AJIA 2RIRA 3QVTA 3RFTA 1EE2A 2XXBA 4F6LA 3DOJA 4OOEA 4OKNA 1LLCA 3IKVA 1YJQA 3EY4A 3NJ4A 1KYQA 2FPIA 3Q9UA 3H3JA 4B4UA 2J5RA 3W8FA 1MC5A 1ZK3A 2CY0A 4RDHA 1ISFA 1M6HA 5FI5A 4OL9A 3ZHYA 2CDBA 3VZPA 4BKUA 2VCYA 5IZCC 1EBFA 1DAPA 3R6DA 3PJEA 3IUSA 3UUWA 2Y66A 3ZDFA 3W4KA 3VHRA 3GZNB 2IXBA 3QIVA 4XIYA 2JCVA 1K5HA 4J2OA 5TC4A 2J8ZA 1NWCA 2ZCVA 3D1LA 3S8MA 4IQ0A 1R12A 1CERA 2YZ7A 1MXFA 3WMXA 5L3ZA 3JQGA 5JYDA 1YS4A 3DEYX 4E0BA 2P9CA 2JKVA 1JLLA 1BWSA 2OBYA 2EW2A 1WDMA 3OJLA 4NPCA 3BTSA 5TS3A 3D5TA 3OIGA 5EL0A 5ICSA 1JWBB 1HSZA 1UXHA 1PJLA 1XSEA 1ZUD1 3ONDA 4WOJA 1Q0QA 4BGEA 3O8QB 4GAEA 1ZMOA 4HP8A 3W4IA 4XGIA 3ZWWA 3T4EA 4DYDA 3HFGA 5JC8A 1S7CA 4GVXA 1MFPA 1ULUA 4BMNA 1AUPA 3BMNB 2B35A 1WW8A 3TOZA 3AI3A 1PGJA 5JO0A 3OEYA 1LNQA 1ADBA 3ASUA 3BMCB 4DLAA 5JMWA 2NWQA 2HJRA 1ZBQA 4W4TA 3VKUA 3GNSA 2C20A 4N18A 3JQ7B 4FN4A 5TJ9A 4WEQA 4BO0A 5L4LA 1MG0A 3BA1A 1PEDA 3AK4A 2EXXA 5CPBA 1E7RA 4CR6A 4CMHA 4E3ZA 3I83A 1EBUA 3LF2A 3JYLA 2FR1A 1KERA 4CQMD 4FC7A 5IG2A 3IAHA 1LJ8A 3GNTA 1OBFO 4W82A 1XU7A 1DIRA 4HNGA 3NUGA 5KNLA 4A03A 2XF8A 1GQQA 4IDBA 5TF4A 4DIOA 3JQ8B 1PQUA 2ZB7A 3Q3CA 3WR5A 5A4DA 4JCOA 3B70A 1P74A 4TRMA 1FXSA 3COSA 5JSFA 3DXFA 3QE3A 1Y9EA 3BHIA 3C7DB 3TWOA 1NR1A 1B3RA 4LMPA 3FNGA 1GZ3A 1C0LA 3KUXA 3VKVA 3F4LA 3JQAD 3K6JA 1LDYA 3R3JA 4BKRA 4CQLB 2C59A 2HMTA 5ER9A 3NX4A 3B6ZA 1L7EA 4ALKA 3B1FA 1ONOA 2B83A 1LRJA 3UHAA 4R41A 3FR8A 3S2IA 3GRKA 4KP7A 4MVJP 4PG4A 4CM9D 1UH5A 4CQMB 4K9DA 1TI7A 3E5RA 1CYDA 3KHUA 4MVJD 1J0XO 3TPCA 4ND3A 3DB2A 1N1EA 2YY7A 3M1LA 2CNBA 3NYWA 1YL7A 2JCXA 4I9NA 5JFOA 3ZU4A 1B8VA 1NNUA 1M6WA 2X4GA 4DQVA 3AFMA 1DSSG 3OP4A 2UVDA 3R0IA 3V2HA 3RIHA 3K9QO 4XA8A 4AG3A 4D46A 3QV1A 2XPCA 4Z6KA 2JD1A 3D64A 1GAEO 3I23A 2UUOA 2YV1A 4LVUA 4OIMA 2VOEA 3OECA 3P2YA 1GU7A 1FJHA 2O50A 4CLEA 4EITA 2VT2A 1V3TA 1I3NA 4LMRA 2VQ3A 3Q0EA 1Y8RB 4PZEA 3IIEA 1XA0A 1PS9A 2VZ9A 4DQXA 1S6YA 1IOLA 4EBFA 1GD1O 2TMDA 4JLWA 2ZQYA 5A9SB 5B37A 2RBEA 2JFFA 3D3WA 3F5QA 2V7PA 3RBZA 4J1SA 1XQ1A 4H16A 1LSOA 3U4DA 2GASA 4Q3DA 1NHWA 2NU9A 3WGIA 2R2GA 2O7SA 3IJPA 4BNWA 1NFRA 1EDOA 1A9YA 1Z6ZA 2G1UA 1T25A 4PZDA 1G0NA 2EWMA 4MP8A 2Q1TA 4DPKA 1ZXLA 5EN4A 4DQUA 4RVHA 2BGMA 1ZVMA 2CD9A 4NK4A 3KLPX 4F46A 1P45A 3ZI0A 2VYND 4S1VA 5DCUA 4Z9YA 4DMLA 3GK3A 3H2ZA 2JCYA 1U9JA 1JWAB 1HZZA 1OMOA 3TL2A 4EGFA 3PYLA 4P8RA 1H5QA 1YJ8A 4HWKA 5CEEA 1OAAA 3GT0A 4B7CA 1O89A 1V9LA 2F1KA 1Q7CA 3MTGA 3NRCA 2VZ0A 2VUSA 1O95A 4NDNE 4IZHA 3S1LA 5HS6A 4K28A 4MJLA 1DFHA 2EJWA 2VHWA 3GG2A 2YQ5A 5IXYA 2R00C 1C0KA 1XEAA 3DHYA 3KSUA 4WASA 1E1NA 1IUKA 1FF9A 2IRWA 5JAQA 1ZK2A 3QLJA 4XGNA 1WMAA 2I3AA 2VTDA 3KYCB 1ONNA 2PZLA 3DHNA 3PVZA 3Q11A 2PZMA 5IJZA 4NJOA 3FTPA 1QKIA 3GC6A 5JDIC 4MP3A 3CUKA 2EP5A 4JQCA 3OIFA 1PWZA 3ORFA 4QEDA 4BNYA 1Z7BA 1DRWA 2PWZA 2FR0A 3VVBA 1DIHA 3UF0A 1P1KA 5T57A 1HSOA 1QLHA 4YA6A 4EUFA 3F1KA 4DRYA 3B1KA 1XHLA 3HDHA 1F8FA 1IYZA 1KETA 1VE9A 3F6YA 3GLQA 5F1PA 4IJUA 3V1UA 5T6BA 4H3VA 3UAGA 2IE0A 1X1EA 1EDZA 4MVJF 1SC6A 1GZ6A 3JQBA 3VH3A 2SCUA 4AJ1A 5TLSA 2HRZA 2C7GA 4RPGA 3ZWCA 1NAIA 2VYVD 4KOAA 2NU8A 5CDYA 3C85A 4PLZA 4S3MA 2NQTA 4IXWA 3DQPA 5A04A 5DBGA 1MGOA 2QQ5A 4ZQGA 3ENNA 2P91A 2G0TA 3PLNA 1A27A 3RROA 2D8AA 3W4JA 3E9NA 3TDKA 1K89A 2UAGA 2WSBA 1D3AA 2HJSA 4LSMA 1NM5A 1QSGA 4KMSA 2V6MA 1GV1A 2OFPA 3PHJA 1P3DA 1M2WA 5CEJA 1MA0A 1NFFA 1E7YA 3K73O 1KS9A 5DOVA 4QO7A 3DZHA 1ZEJA 3LK7A 1L7DA 3JQAA 1VKNA 1DXYA 1LDMA 4Y67A 3FTNA 3ROKA 3QY9A 3N58A 1PS8A 1H6AA 3L4SO 2CF5A 3PYXA 1YB5A 4YRDA 2GZ2A 1NP3A 1JAXA 1LI4A 1HKUA 2XXJA 4HADA 5L4SA 1E3WA 2H63A 1LSJA 3KZVA 2Q2QA 4D3SA 3JD1A 4UVDA 1MV8A 3ST7A 1LTHR 3V2UA 4YQZA 4RORA 4IS3A 4DTIA 1KC1A 4EUHA 1H6BA 4BOYA 3VVCA 1O0SA 2O3RA 3ONEA 4II3A 5CDUA 2YDXA 2RCYA 4ROSA 3Q1LA 2A92A 3DL2A 1P0FA 1PR3A 4XWYA 1YWGO 4E32A 2HMUA 5BQFA 2WD8A 3LT2A 4XDYA 1KVUA 4FC6A 1QP8A 4CMEA 3HB4X 2AMFA 4PRLA 5ILOA 1ID1A 2CSUA 4M86A 2BFPA 1SOVA 3WWYA 4D41A 1X13A 2J3JA 4RZHA 2EIHA 2I6TA 3RCBA 2ZB4A 8ADHA 3D3EA 5F1KA 2HQ1A 2WYWA 4FPXA 3RJ5A 4YRBA 4RO0A 3TZCA 1PZFA 3SC4A 3G1TA 4DIBA 5TRTA 3PWZA 5F21A 2W2LA 3GVCA 4GX5A 3ZNPA 1Q7GA 5C7LO 4J16A 4JIGA 4J7CA 4ALJA 4BS9A 4EEXA 4UUMA 1DJQA 3FBGA 4R51A 3OA2A 1O9BA 1U1IA 3WICA 1X15A 3FPCA 1U5CA 3C1OA 5AYVA 4M87A 3VZRA 2EF1A 4BNLA 3RU7A 1NAHA 4J2HA 3VH1A 4IDFA 1GYRA 2ZJ1A 1HDXA 3C7CB 1HTBA 4PVCA 2GNAA 4AJNA 1W6UA 5JAZA 1GUYA 3WS7A 5AXCA 1DHTA 1O5IA 1SAYA 1XGKA 5A03A 5BSGA 4A10A 4FCCA 2VNAA 1ISHA 3DFZA 4J9VA 2D5CA 3KBOA 4ND5A 3RU9A 3RAJA 1HDYA 3OJFA 4U7WA 2WYUA 1OFGA 4HFMA 2JAPA 1CDOA 1LLDA 3G79A 3LT4A 3P7MA 3QWBA 3D4NA 5HBRA 4BNNA 1NHGA 1EUCA 2Z5LA 1GQYA 3GVPA 4CL8A 4QFDA 3ZWPA 2G76A 4HX5A 5B1YA 4JBIA 3ZU3A 4UULA 3N7UA 2HCTA 1PU2A 3GMDA 1C14A 4I9UA 2O4CA 1R6DA 4B7UA 1EEHA 3IQDB 4IDCA 5B12A 2ZTLA 3LVFO 1HYHA 1OC4A 3UOGA 3ASVA 5BSFA 3I52A 1HDZA 1PZHA 3RFXA 4RVDA 3VPGA 4K6CA 4DWVA 3KYDA 1KY4A 3NV9A 3VH2A 3BXXA 2VNSA 4JBHA 1P33A 4ALIA 4IM7A 3I1JA 4K26A 4CR8A 3MJ4A 4RPJA 1H9BA 4M55A 5F5LA 2B5WA 1W8DA 3I9NA 2GLXA 1ZSYA 4JJFA 4Q39A 3RJ9A 2ZYGA 1XU9A 1VM6A 2EEZA 3QVOA 2GPTA 2C82A 5DOZA 2IEBA 5KIAA 5A9RA 2GDZA 1XIVA 3KRTA 1D8AA 4KZPA 4R9RA 4IJVA 1YGYA 4YJGA 2AHRA 4TMFA 5EPOA 1ZEMA 3L4BC 3MWEB 4N5NA 4UVEA 1WAMA 1B8PA 1KVTA 3NTQA 4L8VA 1V0JA 4JXKA 1EVIA 5BNIA 4KUEA 3EMKA 1YB4A 1DPGA 4CM9A 3HN2A 2Q1WA 3H3FA 3W8DA 1LDBA 4YRAA 1AHHA 1YBVA 4IDEA 3ZZNA 4CM7A 3FSRA 1NR7A 4XGKA 4FOSA 3CEAA 2VWHA 1C1XA 3H65A 3KSDO 3JQ9C 4M8SA 2B69A 3RBXA 3HDQA 3ZWMA 4AJLA 1WMBA 2X5JO 4E5KA 5KJFA 4CODB 5EESA 3SLKA 8LDHA 3RUCA 4AJJA 1F8GA 5DCWA 3GGPA 3W6UA 3OF2A 2ZB8A 1GY8A 1YL5A 3E18A 3W6ZA 2P5UA 3JQAB 5TX7A 1FK8A 1UDBA 4ID9A 1OZAA 2IYPA 2J3HA 3MTJA 5I8ZA 3TQHA 4PLPA 4W99A 2Y1CA 5FYDA 1E92A 1BDBA 1G1AA 2QYTA 3E6AA 1FDSA 4Q3BA 4GWKA 5BNTA 1RYDA 1CJCA 5AXAA 1ONPA 3VAZA 1LC3A 1PIWA 3DFUA 2HO5A 4JBGA 4WCFA 3UCFA 4NNJA 4AJHA 5G2OA 5F1OA 1UJMA 4NJMB 5DDIP 2Z95A 4OXYA 4IIVA 4GMFA 1SB8A 3MWDB 1OOEA 2OORA 5CDTA 5JCJD 4DVJA 1PJ3A 3A14A 1M75A 1Q7BA 2HLPA 3VOSA 3M2PA 5LCXA 1ISIA 4Z0TA 1NXQA 4XB1A 1Q0HA 4BNKA 3GVXA 1QRRA 1I33A 2PD4A 2VWPA 4YT2A 3U4HA 1Y7TA 1U4SA 4NQZA 4G65A 3WQSB 2RHCA 3JQEA 1IE3A 1E1MA 1WZEA 1XDWA 4LVCA 1R4NA 1GADO 2NSDA 3VDRA 4ALLA 4DLLA 1ADCA 1B7GO 3WQRA 1PX0A 3QWHA 4LN1A 3DBLA 1DB3A 3PFWO 3WGOA 2FOIA 3WYBA 3MEQA 4CLRB 4YQYA 4OJNA 4C4OA 2P9GA 3KSZO 1VC2A 4YAJA 2J5KA 2EKQA 4RPKA 4GLOA 4J0FA 1JAYA 4PN3A 4N5LA 1YBMA 3L0DA 2PR2A 5JY1A 5JDIA 3PGJA 4JROA 4AICA 3HNPA 4WCFC 3PJFA 1PZGA 2I5PO 4WCFB 3BYZA 1Y8RA 3H2SA 1WP4A 5CDGA 1SEVA 4AJ2A 2Z1MA 3Q2IA 4DYVA 3T7CA 1ISGA 2FZEA 4BVAA 1HLPA 4R16A 4OM8A 4XYMA 4CMBA 3IKTA 2YHUA 2AQIA 1LUAA 4CLXA 4YTEA 4Z3KA 5AXDA 1I01A 3JQCA 3W1VA 2HRBA 4YR9A 4YVFA 1RM4A 3WTBA 3UVEA 3QJ5A 3NGXA 3PI7A 4D7AA 1XCBA 2UUPA 4ZVVA 3MJCA 3G3EA 1VKOA 1K2WA 1LQUA 2E48A 1A7AA 3I9OA 1GTMA 1A72A 2X9VA 5B4TA 4ZQEA 4J1QA 5FI3A 3C24A 4CLOA 3KV3O 2GF2A 1LU9A 4NI5A 4KDEA 4QTZA 4N5MA 5L95A 2PGDA 5EQDA 1AHIA 4RZIA 2VT3A 3VPFA 2Q45A 3IJRA 4E30A 1JKJA 1QYDA 3A9WA 3VC7A 2C2XA 4IDGA 2EHDA 2W98A 2ZYDA 2G17A 1EVZA 5DULA 3PFFA 4WKGA 2OL4A 3PHGA 5ADHA 5CPFA 2AG5A 4FGSA 1MB4A 4BGIA 1I3MA 2Z1NA 2CF6A 2QG4A 4UUNA 1GCUA 3K96A 4R69A 1R66A 1TXGA 2A35A 3UH1A 1Y8QB 1ZCJA 4O59O 4PLYA 1R37A 4DBZA 3FNEA 1B3BA 4IMPA 2HK7A 4MKRA 2QHXA 4NJMA 1HE3A 4CMIA 1LXCA 5JDCA 2QW8A 5G0TA 1IL0A 1T2FA 2I76A 2PNFA 3E9MA 3I6QA 3ZWAA 5KVQA 4A7PA 4FFOA 3QA9A 2EG9A 2RAFA 4TSKA 4CMEC 3AUUA 4L75A 4RPHA 1ZK0A 4IPTA 5KKAA 4YAKA 3TFQA 3WYEA 3M2TA 4BNGA 3WXBA 2QRJA 3BMNA 4XQ9A 1E3EA 1VJTA 2PY6A 1E5QA 1KBZA 4NBRA 2XAAA 5MDHA 3GR6A 1VL6A 9LDBA 1HT0A 2X7HA 4NMHA 1DAOA 4KUGA 1GDHA 1B15A 1IHXA 2VN8A 1TVEA 2RH8A 1NTOA 4D3FA 1I30A 1ISMA 4MKXA 3KVOA 1GL3A 3M1AA 1QG6A 4P4NA 2QX7A 3OA0A 1QYCA 3GAFA 3PDUA 1W73A 1BSVA 2B37A 2CVZA 4I9HA 1Y5RA 3WG9A 1E6UA 5ENVA 5G4KB 4BNFA 3WNVA 5DBIA 2X22A 4Z3DA 3CPSA 1VJ0A 4TKLA 4Y9DA 3TZKA 3JYPA 3EAGA 3PHLA 3GFBA 2VHZA 4B79A 1E7SA 1MC4A 1AN9A 3JQ8A 1HDOA 4OQYA 4E5NA 2HDHA 1HDRA 4PFJA 4E2WA 5JNLA 5KVCA 2ZJ0A 4W7HA 1ZK1A 5TQVA 4ND4A 3K30A 2PD6A 3F9IA 4PLFA 4J9UE 3A28A 3BZUA 4YWJA 4PLTA 3BAZA 5IZ4A 3U3XA 1ZXBA 2VHXA 4LW8A 3JV7A 4E6PA 4AJEA 1T24A 3PGXA 4NH4A 5A5EA 4Z9XA 3GF4A 3I3OA 3AI2A 1Y81A 3RUHA 2Q50A 2Y1OA 1BXGA 5H82A 2A4KA 2WMDA 1HE4A 1YDEA 4MVJA 5L9AA 5IF3A 4D0SA 4HKTA 1I32A 1N7GA 3U62A 4E33A 2J3IA 3HJAA 3BMQA 1T1RA 3LZ6A 3QW2A 2PKRA 4G2NA 4L4RA 4UVGA 4BO4A 5CG1A 4U8GA 3EHEA 4BO5A 3GMSA 4TZTA 2XOXA 4WECA 4Y8VA 5F3RA 3RC9A 4J4BA 2AXQA 5L51A 5HRUA 4GBJA 2J6IA 4DLBA 5BSHA 2D1YA 2TMGA 1YVEI 4FFLA 3DTYA 1B0AA 1NVTA 1N5DA 1U3UA 2H9IA 4UVIA 3MJTA 4HY3A 3PIIA 3FR7A 1NFQA 5EERA 4A2CA 5I7VA 1GYPA 1E6EA 1WDKA 3JQBC 3O8QA 4UREA 4XX0A 2FZWA 4MINA 4BKOA 4B7XA 2NTJA 4QECA 1I36A 2IODA 2GZ1A 3OQ6A 1P1HA 1HYEA 1I5RA 2WD7A 4YT5A 4LRTB 4NHEA 1JA9A 3FWZA 1V3UA 2YYYA 4R54A 5U9CA 4Q3NA 4UUOA 1YDWA 3BTVA 3OQ1A 3QWAA 4WK6A 4ZU3A 2BFOA 2EERA 3DOOA 9LDTA 1DIBA 1P0CA 3K31A 1NPDA 1DHRA 1R15A 4IXTA 4ND1A 1AE1A 1H0KA 1EK6A 1F12A 1X7DA 2ILTA 2FR8A 3ZNQA 3E03A 2IXAA 5EJ2A 1UZNA 3OEWA 1WPQA 3AY7A 3CSDA 3MJSA 4BNZA 3VPHA 3OSUA 2NACA 4P22A 3RKUA 3L07A 2O3JA 4BO6A 1ZJZA 3NTOA 2HU2A 2OGUA 4ZRMA 4BNUA 2O2YA 3GGGA 4CMIB 2QIOA 1GZ4A 3DWFA 4WCDA 3U9LA 3W8EA 4XIJA 4O6VA 1HYGA 2GN4A 2BHLA 4R01A 1D4FA 3E8XA 1E3SA 3LF1A 1Z7EA 3E48A 3JYQA 1IPEA 4QX6A 3L4BA 4U5QA 1UP4A 5FWNA 4TZKA 5K6AA 1I2BA 1NQ5A 4X54A 3T4XA 3O4RA 5T64A 2AEMA 3PRJA 2OZPA 3PJDA 3RC7A 4B4OA 1JKFA 1ZSNA 3AW9A 3JD4A 1U7HA 4R9SA 1DLJA 3DHEA 5KWEA 4KUHA 2B5VA 3UFXA 1LX6A 1L1FA 2AG8A 2ZKLA 4D3DA 4YXFA 3WGQA 4D44A 5C5IA 3DMYA 4QXMA 3NDRA 2NLOA 3RVDA 4ZICA 4PCVA 3LSYA 5AXBA 4WLNA 1N1GA 4RVGA 2X6TA 4J1TA 1IULA 2X9NA 4BNVA 4M54A 4OYRA 3PQEA 1K6IA 3GHYA 3U0BA 1PSDA 5U1PA 4GKBA 2EKPA 4RCVA 6LDHA 4RQUA 3H9GA 5IAAA 3G17A 2VYVA 3A4VA 4HBGA 5CHEA 1Y8QA 3OJ0A 3JQDA 2D3TA 1KVRA 2FPGA 1LRLA 1PJCA 2D4AA 1P77A 4FBGA 4BIIA 1BHSA 3BHMA 4ZRNA 1PJ2A 5HS4A 4YJFB 3PYMA 4JGBA 4XYGA 4I5DA 4J43A 3RUAA 4FB5A 4TRNA 1PJ4A 3GN2A 4CV1A 1BXKA 1RPNA 3AY3A 3HDJA 4P4GA 3ZW9A 1E7QA 4FJ2A 5BSEA 4XEHA 1TT7A 1KEUA 3ZV5A 3V8BA 1ZNQO 5C37A 1A9ZA 2GRAA 2JFHA 1Q0LA 4MVJE 4U6QA 3WGYA 3ZHXA 3JD3A 5T67A 5MGBA 1RM3A 3CZRA 4MVJI 3GRPA 4IJKA 2UV8A 4QO8A 4BHTA 2P5YA 4HFNA 1OI7A 5GZ3A 4BNHA 4U0JA 2PH5A 3STHA 3K2BA 4B4WA 1B16A 4QQRA 1Y9AA 4CM4A 4YPOA 3KYBA 2NV6A 3P19A 1R0SA 3AU8A 5ITWA 3INGA 4IMRA 2X58A 3P5SA 2B36A 1G0OA 3L9XA 1ZZEA 3FNFA 1ZK4A 2OUIA 2OHXA 1ZMTA 1IZ9A 2P68A 1BG6A 2BD0A 4CJXA 1O94A 4DREA 3GZ4A 4FFPA 4J7XA 5EMHA 4YBZA 3V5NA 4WE3A 1P1JA 2HKIA 1XLTA 4YJDA 4BQRA 3DZGA 2LDXA 3GDFA 3CE6A 2YFHA 2QRLA 4BMSA 4GLLA 3PHIA 3FCOA 3L6DA 2I99A 3IMFA 1K6JA 3DZFA 2C5EA 1UP6A 1PL7A 3GVHA 4GI2A 2NVWA 3NEPX 4B8ZA 4MIEA 3ICPA 4MPDA 4GKVA 4YJHB 5TNXA 1A71A 2DUWA 2BI8A 2JAHA 3HG7A 3MCVA 4Y6RA 3WNQA 2LDBA 3PZBA 4OXKA 2BGKA 4CMAA 4H7PA 3IS3A 3NDIA 3SEFA 4CM3A 4ALNA 3PDJA 2BLLA 1UP7A 1YOVA 2W2LD 4XRRA 4NG5A 4LK3A 3FBTA 5AVOA 4JP3A 1PS0A 2P4QA 5EQFA 1LEHA 4B4VA 3QSGA 5A5FA 1UXKA 1R4NB 2X23A 1UR5A 2GYYA 3DAPA 1XR3A 2WTBA 1ZW1A 4BMVA 1ZFNA 1VJ1A 1QV7A 3JQ6A 1M67A 1NVMB 3I9JA 2VWGA 1C3VA 1E3IA 3RSHA 1HLDA 5A06A 4KTTE 3F46A 2YV2A 3PP8A 3WLEA 1LRKA 4RQTA 4B3JA 3TZ6A 2DKNA 4E31A 1C1XB 2HUNA 1O8CA 1UXGA 3AUAA 4RF3A 1E6WA 4U0KA 2FRDA 4BL5A 1UUFA 3WIDA 4Y98A 3I4FA 2DBQA 3DO5A 3LC2O 4QT0A 4EUEA 3INRA 3P2OA 3ROMA 3NT4A 4ZA2A 1E3LA 1DC4A 1I8TA 2CMDA 1Z74A 4YACA 2W2KB 1BVRA 4ALMA 2FP4A 2CUKA 2D0IA 3HB5X 1SNYA 1FDTA 5COBA 1F06A 2WE8A 2GZ3A 2IYOA 2F00A 4DC0A 1EMDA 4P4LA 5JE8A 4F3YA 1E77A 5JAIA 4GGPA 1LC0A 3OH8A 4EJMA 1KIFA 4GQAA 4E5PA 1U2GA 3GH3A 4RVSA 2NQ8A 2Y05A 3PZRA 3UW3A 3VZQA 2AA3A 4RL6A 3NDJA 4PVDA 4E5MA 5G0VA 4JN6B 1BVUA 4R68A 4EI2A 5L53A 2W90A 1ZIDA 4MKZA 4MO2A 2P2SA 4WEOA 1T26A 2B4RO 3JQ9A 5DP2A 1NPTO 1DRUA 4GSLA 1DBVO 4WJZA 4BO3A 2Y1EA 5KJ6A 1WXDA 3WOHA 3HHPA 4O1MA 5IDQA 2A9FA 2AEJA 4XQCA 5KTKA 2W8ZA 1GQ2A 4FS3A 1DC6A 2JFGA 1KC3A 1T2EA 3PK0A 3GVIA 4XB2A 1ENPA 4NR0A 2NVBA 2EKLA 2OBNA 1DLIA 1N9GB 2C54A 4CM4B 3CMCO 2RHRA 3L9WA 1CQJA 3WYCA 2VHVA 1VI2A 2PD3A 4BNJA 2E4AA 1H93A 3UCXA 3IUPA 4ND2A 1MLDA 3MOIA 1YE3A 4NK5A 1C0PA 2EV9A 5I7SA 3QRWA 5I7EA 3GEGA 4BO8A 4YT8A 1HDGO 4IGEA 3ADPA 4W9NA 4D45A 2NTVA 2FN7A 2FPPA 4IUYA 3N74A 2C7VA 1U3WA 5AOVA 4IINA 2CDAA 2X8LA 1YQXA 3A06A 2CVOA 5G4LA 2DBRA 1U2DA 5TGDA 3GNQA 4RLSA 2FY8A 4FW8A 3HUDA 3DBRA 2DPHA 3OIDA 2Q1SA 3Q2KA 2X0RA 4BNXA 5EINA 4HUJA 4Z0HO 3DMTA 4M49A 3LU1A 2P4HX 3FPLA 3ROQA 3GEDA 5FEUA 3JYOA 1IZ0A 1GEEA 1PGNA 3MJEA 2Y99A 4GL4A 3EUWA 4YYZA 2DPGA 5TT0A 1X0XA 3CMMA 3ZNNA 4KQWA 1ENZA 3ZW8A 4DL9A 3DZJA 4HFJA 1UZLA 2VZ8A 4RF2A 4TVOA 1KEPA 4XQEA 3ZV4A 1SPXA 4ONEA 2HSDA 3VZSA 4JJIA 1EFLA 1F0YA 4R3WA 2GN8A 4AJPA 3VTZA 5K9ZA 3ZNOA 4DUPA 3EZYA 1DRVA 4O63O 3UKOA 5IN5A 1V3VA 4FIZA 1E0DA 4NU6A 1I2CA 4XRGA 3UN1A 2X5OA 1FDUA 2JHGA 1MUUA 1U8FO 5KVVA 4MVJG 4FOOA 3HWRA 2DBZA 3TN7A 3WB9A 2UDPA 1GR0A 1NX6A 1J49A 3O26A 4OMUA 5JMPA 2QZZA 4CLHA 4IZIA 4CMCA 1PR9A 2Q3EA 3D4PA 2BI7A 3EK2A 3R3SA 4CMGA 4RVUA 3VDQA 4KWIA 1ENYA 4L74A 1BXGB 5ITVA 1UDCA 5JXWA 4YCAA 2PA3A 1B14A 1M76A 1H94A 2UYYA 2YUTA 5THKA 4WNCA 1ZKMA 2I67A 2PZKA 3ZGYA 1VSUA 1B8UA 1T4DA 3RBVA 3KXDA 1KY5A 4B8WA 2EGHA 4AL4A 4R1SA 3UCEA 3LYLA 1HETA 4OOFA 5EIOA 3S2GA 3F5SA 3FD8A 2DQ4A 4OSOA 3U49A 1T2DA 3DTTA 4D0RA 5ES3A 3L6OO 2IEDA 1JQBA 4PG8A 4IQ8A 5ILGA 2G82A 4DBVO 1WDLA 2HMVA 2GUGA 4B3HA 1EUZA 5TIIA 4RJTA 3KEOA 4ZN6A 5BT9A 3E1KA 3H8VA 1WNTA 3S2EA 3QQPA 5G4KA 1PGPA 5CDSA 1DIGA 3LT1A 2VRCD 3MOGA 1HZJA 3Q9NA 5HWSA 4DXHA 2DBVO 2FMUA 2V65A 3KO8A 3OHSX 3WQQA 4EW6A 5GY7A 5IXSA 4XD2A 5CFZA 4WOKA 1QYXA 4EYEA 1GFSA 2Q4BA 4FGWA 5THQA 2YFQA 4PLWA 3NJ8A 1A4IA 3OETA 4PG7A 1E3WB 3DAFA 4R1TA 1N9GA 2OXIA 1X7HA 4TVBA 3GDGA 2CFCA 4A73A 3PTZA 4JX8A 4XJSA 1UXIA 3JYNA 2BRUA 4E2YA 2JJYA 2VYNA 3KYCA 4OGWA 2O3UA 1ULSA 1NWHA 1U7TA 5I9NA 1MFZA 4GX0A 1R0KA 2C2YA 1J6UA 4HNHA 4J4HA 2CVQA 2PLAA 4UAGA 1VSVA 4NFYA 5TSDA 1C1DA 1OC2A 4E5YA 3TNLA 5DF1A 3BTUA 3GOHA 3JCZA 5G0SA 1PL6A 3AJRA 4XCVA 5KJCA 1ADGA 4CUJA 3CZMA 4IY1A 1H9AA 2DFDA 1EQ2A 3KB6A 4NBVA 1JU9A 1EE9A 2EJVA 4TQGA 1D1SA 3FHLA 1P1FA 2PH3A 4BNIA 2ZB3A 1XG5A 4BO9A 2OP0A 4DPLA 3FRJA 2HK9A 3LQFA 4CM6A 1I0ZA 4MIYA 2YDYA 1EUDA 4OXNA 4OSPA 4YDRA 4MVJH 3OM9A 4HV4A 2VUTA 1B26A 2E6UX 4L73A 2BGLA 4A5OA 3D0OA 1JKIA 1RJWA 3ZU5A 2X5KO 4INAA 4L76A 1P9LA 3DZBA 5I8WA 1LDEA 4G81A 4TRJA 3L6EA 4K6FA 1UDAA 4J0EA 3HSKA 3ZN2A 2AQHA 3SC6A 3CKYA 3GY0A 4KTVE 4FR5A 5CEFA 1VL0A 2ZYAA 4TROA 4FQ8A 2X0JA 5ICMA 2NNLD 4XR4A 4YB8A 4UEOA 4CLOB 4AVYA 1PZEA 1KEWA 5I7FA 4BO7A 1AGNA 4RGBA 4KDFA 3WGHA 1MX3A 2HMWA 3QHAA 1I3KA 4XR9A 3ANMA 5L7WA 1DEHA 2WE7A 1Y6JA 3RUIA 5L45A 3JTMA 1BMDA 4YJFA 2GD1O 1PQPA 3LT0A 3ZU2A 3EVNA 1YOVB 2CDCA 2FSVA 3ON5A 4JK3A 1EVJA 2ET6A 5H83A 1LDNA 4E2ZA 1PTJA 3H5RA 5L4NA 4RV9A 1KEVA 4GMGA 5TJHA 1TA4A 3U09A 2HAEA 1YH3A 3PIDA 4C7KA 1SEPA 1UAGA 2EGGA 4FFNA 1WVGA 3WIEA 1TT5B 1GCOA 3C3XA 1VL8A 4GGOA 4CM5A 1ZJYA 4E2XA 1YL6A 2NVUB 4XYLA 5KVSA 2I9PA 5KKCA 3ZWVA 4J4TA 4GSKA 3VH4A 3EW7A 4XYBA 4CM8A 3S55A 2AEFA 4NBTA 4BB5A 1PJBA 3JD0A 4OH1A 1WLYA 4ZD6A 5ER6A 3ZHBA 4MIOA 4OQZA 4L4SA 2B0JA 4FSHA 1JDJA 2VWQA 4Y6PA 5T8KC 3SJUA 4CLRA 5CP8A 3RD5A 3TZHA 2R00A 3EGOA 2W4QA 1HXHA 3U4IA 2X0NA 1DFIA 1QV6A 4WLEA 1NVGA
chains in the Genus database with same CATH superfamily
2RHMA 1UL1X 3GFRA 1G3MA 1IB6A 1PVDA 2XOKD 5CH8A 1VMAA 5SY4A 1NA5A 4BB6A 4FFVA 1R16A 1X7XA 2LTAA 3ZTTA 3IELA 3G1UA 1OILA 1DBIA 1G20E 4HDKB 2XDQA 1DC3A 1ZC4A 3IBSA 3H16A 5IBPA 3RJTA 4IIDA 3LUBA 3T1VA 3H0KA 1YONA 2FFJA 3K8ZA 1D2HA 3EQZA 4CGYA 4RF4A 5PGMA 2WMNB 2FPUA 4FZJA 3KJQA 3AOEA 4MUGA 1TUIA 1JN0A 3GWZA 4QL3A 1XJQA 1PFUA 4WN9A 4ZI5A 2HQRA 3QVSA 4Z8YA 4BV9A 1HFWA 1YR8A 2J31A 3AONB 4IVRA 4PYNA 5ALTA 3KBBA 3WWZA 2SHKA 2PZGA 2JGLA 2QN1A 1BJRE 2NVOA 4GPEA 2ZJ6A 4TZ0A 1T35A 2CVFA 5D1NA 5HF9A 4ENSA 4Z4CA 2P3SA 1KIAA 4DPMA 5HXAA 4UEJA 4ZYTA 2WICA 3LA8A 4IGAA 4LZOA 3CXRA 3EMDA 5I3CA 1QXSA 3NHAA 4XJTA 2GR9A 2C77A 2CXTA 1QHGA 1BD3A 2XA1A 3M5WA 1W6RA 1Q2UA 2W00A 2Q5OA 2XBUA 4EPVA 3G0GA 4N7RA 1S2LA 1FMCA 1X70A 2R47A 4EY4A 1QQ5A 1XD9A 5AJUA 1BOFA 1E99A 2O4UX 4ZWNA 4KR9A 4WZAE 4C0AC 3KOWA 3UGKA 3H17A 2JEYA 2WWRA 3RGWS 4FI3F 3GELA 2X9GA 4MRMB 3HYLA 1XTIA 4MMYB 3PXXA 1N5LA 1ORRA 2HD4A 4US0R 5BUZA 1U8ZA 1N75A 5JY6A 2BZGA 3LQKA 4XQGA 3EIOA 4PHCA 4EO7A 2VRBA 1EGMB 1VECA 4F8YA 4BNTA 3PEVA 2W4IA 4V3CA 4ZOCA 4JWKA 2UZAA 2W42A 5MN4A 3S70A 5I3ZA 3L8FA 4HDMA 5IM5A 2JH9A 2CCJA 3WP0A 3U0VA 4D92A 1E9EA 3V8PA 2H1SA 2I2AA 3FVRA 4IJWA 2DLDA 4KMMA 1I2AA 4OJTA 1UJ5A 5C2JB 1H2RS 4LBZA 3ITKA 3OTHA 3VU8A 3VM6A 2WUVA 2NZXA 1WIWA 2PBZA 5JJLA 2PSEA 3GIWA 4ZVTA 1AN0A 4J7UA 3UMRA 2W5UA 5C32A 3ULKA 5GZ6A 2VAMA 3CIFA 3EZ6A 3Q41A 1XP8A 5FF9A 3WBFA 4NECA 5B36A 4U39A 1ZIPA 4IRMA 1PGQA 5LDHA 1Z2EA 5E7MA 2CLFB 3KB1A 4LYDA 4ER7A 2HU5A 5DM2A 3X2EA 1VE6A 4XVCA 2VDKB 1DC5A 2DCMA 1Y1PA 2IOHA 1ZO8A 3ORHA 5D87A 1C0IA 2PO5A 3JD2A 3KFLA 3LBAA 4IFBA 2JKZA 2RJ3A 2XUKA 1Q2XA 4LGVA 3QOFA 3S0JA 4BGVA 1DBQA 1JNYA 2V03A 5T4BA 2Y76A 3NKLA 3VHXA 1YKSA 2GA8A 4MROA 1PQYA 4CT4B 3SHTA 5CB4A 1E1RD 1KXJA 3JATB 1UWLA 3D7MA 1QJ4A 3OICA 2QL6A 4PF1A 1PN3A 4CCYA 3A4TA 3IHWA 1G55A 1UPUA 4LDQA 5JNWA 4GH5A 4CL2A 3Q98A 3V1YA 2WV7A 3C70A 1ZRSA 5DGCA 2QT1A 1QCDA 3HZZA 4CL0A 3FF4A 1ZD1A 3Q6IA 1A8SA 1IEVA 3A6LA 3CTMA 3GZTB 3RRMA 4EYSA 2YY6A 4B74A 1PYDA 4COKA 2I2CA 3RU2A 3K6SB 1Z73A 3N2KA 1KFEB 1SU7A 2Y93A 4QOSA 5EIFA 4P38A 3V4ZA 3SVTA 2JAQA 3TRFA 3RWOA 3TNYA 4CMKA 1W88A 3H2JA 3LIPA 4O02B 2ZR8A 5TQJA 3BEOA 3WX0A 4YHHB 3HCEA 4G24A 1E7WA 1U9CA 3P9NA 4DA8A 4D3YA 4GX2A 5LC1A 3HYRA 1T0IA 1E6MA 4IGFA 2KLBA 3HR4A 5DBFA 1HNZB 2X13A 5DH9A 1GA4A 1RYEA 1P4RA 3FSEA 2IZZA 2BF7A 1NVVR 3D7LA 3PFIA 4ZQCB 4NNOA 1KAMA 5CJJA 2Q2WA 3X44A 2GM3A 2V7TA 1MG5A 3NM5A 4JJ6A 4JNKA 1WDTA 4LCEA 1NJ6A 1WW3A 4W6ZA 5AI8A 5IJXA 3P0IA 3S28A 2O0LA 3ESZA 3CV3A 3PA6A 3A1UA 3D2LA 3P26A 2QP9X 3ES9A 5IASA 1EK5A 4JLNA 1VFNA 4RTOA 1U8XX 3F7OA 1CKEA 2Z04A 4HXYA 3B9QA 2Y68A 3IUQA 2P1ZA 4MYRA 4JKYA 5FEMA 3U48A 5I45A 4BUCA 5MN6A 4BAGA 5M29A 2ZSHA 4KRFA 1I24A 1XRSB 1KA9H 3I2FA 4JI2B 3H05A 3FPSA 5F3WB 5DM4A 1TRKA 3K2EA 3ROPA 3HZOA 3OJWA 3KT3A 1XRLA 1N2ZA 2ODAA 2HA3A 3L8GA 4ARSA 3N2EA 3BB1A 2Q0QA 4NU5A 2C9ZA 2FSUA 4O5OA 3NYRA 3ADDA 4P2BA 4DR4B 5ENZA 1RRPA 2QD1A 4R1LA 3RIGA 3SSMA 2HB6A 5DHQA 1OBVA 4KJZA 4X00A 3WJ7A 4TTVA 2GGSA 1EVYA 2C9DA 5ICFA 3WDKA 2MSNA 3OQJA 4LI3X 2DFNA 3I5UA 1POXA 1XZLA 2XB6A 3BL5A 4ZCMA 3E5HA 4EI9A 4EF6A 4DT1B 4EUSA 3HFSA 2BKEA 4WY2A 2Z9CA 3ZXUB 4I19A 2QX4A 3RK0A 3U3OA 1IIRA 4DLNA 2WHRA 1VMIA 1OXBB 1NRXA 2ASVA 3D9QX 4G9EA 4EJSB 2FF5A 2O7QA 1JX6A 3GHHA 1SO8A 3QPBA 1Z83A 2JNWA 3WA6A 1XKQA 4EY8A 3MG9A 4FHCA 2WQ7A 3NCHA 1HRKA 3AYZB 1IHYA 1ZQ1A 3F2VA 3QUAA 5C7IO 3EZGA 4DRZA 1SBNE 3IAXA 3ZDZB 5JYEA 4LY3A 1CVIA 2WFMA 2OXCA 3OPXA 1KHTA 5DLPA 3UYLA 1G21E 1H2FA 3ZJ4A 4DN6A 1BFDA 2OT3B 1FYFA 2R8YA 2DVMA 1WF6A 4IG9A 3JS5A 1MPTA 1VRWA 5DTRA 1XE3A 2AMJA 5AQEA 2Y1DA 4ON9A 1VJGA 2X3UA 5FPQA 4GICA 3B5JA 3SX2A 1GILA 3TOXA 4ZDJA 2Z2KA 3PWKA 2FN3A 2VYFA 5HJ7A 2C0QA 1DDOA 2QE6A 3USCS 4Q1EA 3DVRX 3O03A 4KFSA 3AF6A 3R6TA 3TX6A 1IM8A 4B44A 4D4MA 4E5VA 2G63A 4GR4A 4YMGA 5IAOA 2Y4OA 4S0ZA 1CUDA 2YYZA 3PXEA 4A36A 5C5CA 2WQ6A 3FETA 4G85A 2DFVA 1YB1A 3M3DA 3T12A 1EYZA 3UHJA 4R2WA 3IIMA 3UKJA 2WTEA 1Y8AA 4LHXA 3RW9A 2WJWA 1VLJA 1ECPA 2H16A 3MWGA 4FUTA 5K7SA 1UXOA 3GT3A 2I65A 3WP1B 4OHUA 2NU7A 3O9ZA 4ZREA 4DIMA 1Z7WA 2X0IA 4YQFA 5L40A 3D4IA 4PC1A 1X7XB 5FV7A 3RKSA 4FR2A 3LDGA 3M9XA 1RYYA 2ODPA 1GUBA 1UOPA 2WI8A 1BHJA 1L5FA 4II2A 3A4YA 2E82A 2G77B 2O2DA 3OOEA 3R6LA 5CA1A 3DFIA 3M6IA 4MV4A 2ZOSA 4TV9A 4W7IA 3QYPA 4O0LA 4L72A 3DP9A 4Z51A 2H2AA 2PQMA 1WOMA 2R2AA 4EZEA 4FBMA 3TPFA 4OJYA 4N41A 3V4FA 2FW1A 1TB4A 2WT8A 1DFGA 1Q95A 4I1VA 5FTMA 4O2BF 1FU7A 4CIYA 3PNQA 4DLSA 2FNAA 3JQFC 2E5LB 2JFYA 4A26A 5LMNB 2Z56A 4PNEA 3G5AA 5KCZA 3EDQA 2NG1A 2ZULA 3I5XA 1V4BA 1J1IA 1P4SA 1XQVA 3CX8A 1JHRA 1OQAA 2OCXA 3V42A 1HDCA 4M8LA 3D2AA 2MINB 3H9EO 4PPFA 4HDCA 2LCQA 1Y0BA 2QD5A 2VG8A 3BA6A 3G0IA 3PGVA 4Z0PA 3VR6D 4ADSG 4Z8XA 2ISQA 2HOQA 2QVCA 4QC2A 4B73A 3RSQA 4RTKA 3BG5A 3WIVA 1U6KA 1ODIA 2J3LA 2YN0A 1JYEA 3KT0A 4LV5B 1A8PA 3HMKA 2NPFA 5DZSA 5BYAA 3B6EA 3CLKA 2Q46A 4H3KB 2A9QA 3ZLVA 4BO1A 4NCNA 4YRFA 1WMFA 2Z8XA 2ZUDA 3WO0A 4JYAB 2HPHA 2HN9A 2H4JA 1SA0B 2G0AA 3RIEA 5LXTF 1KH2A 3LUHA 3HM2A 5ARDA 1N8KA 1PJTA 5ILQA 5TMDA 3IO3A 4CLDA 4V1CA 1N7HA 4E46A 5AK6A 4N6NA 3U9SA 2R68A 1IC6A 6PFKA 1TJYA 2CHQA 3DT8A 5EJMA 2PEYA 3Q8XB 3EYWA 4QYIB 5HTOA 5FBHA 4RVNA 4BMXA 3ZV6A 1HWYA 4S2EA 1OD6A 1WDWB 2OKCA 4Z0NA 5DYNA 4DSAA 1Z39A 2QE7A 2IZ0A 4JA0A 4WBXC 4FYPA 5I9LA 4H0CA 5A9TA 1F4PA 1XLTC 4FZ3A 5K3EA 1W36C 4EKIA 5IJWA 2O19A 1YCFA 1KDVA 3FZNA 4HZUA 5GZ1A 2E5FA 1LLUA 2XYHA 4YJ3F 1RZUA 2CN1A 2C92A 3U40A 1I5OA 4C0LA 1II0A 5KMGB 2J3EA 2WPDD 4QGHA 4S24A 2CB0A 5F7JA 3R6GA 3ZV3A 3NG1A 4AURA 4QYXA 4UMVA 4JR0A 1S2IA 3RRXA 4U2KA 2DM6A 3R41A 2W6JD 3AXSA 4QUKA 1XX6A 3EGEA 1G8HA 3AI7A 4EYKA 1GTSA 2AQKA 2JFWA 3T3GA 3CYFA 3H2YA 4LRSB 1XTZA 3DQZA 3VYVA 1ZM2A 4RF5A 4F3NA 3G2JA 4JLSA 4O29A 3GJSA 3RK1A 5B7GA 3AF1A 2RBGA 1H22A 1BJTA 2AXPA 4DA9A 5BURA 4C5BA 4GZLA 1F60A 1PR2A 4L8WB 3EF0A 1QZZA 1RRFA 2EIXA 4NRDA 1UDWA 3OESA 3PTLA 3GUYA 4HAXA 4Q93A 4GZMA 3T7DA 3TRIA 3GGOA 4YP0A 3T8YA 3UJ6A 5C4MA 2V3CC 3HJFA 5LDGA 1JHYA 3NEAA 3HNRA 4CM8B 5AQ1A 4F6CA 3NDPA 4ENRA 5J2UF 3HDTA 1T15A 1M8FA 2C0PA 2ONYA 2QM3A 3DONA 3HCCA 3PR1A 4GDMA 3U9TA 2A0XA 1U8AA 3B20A 4ZQFA 3BXFA 1C9DB 4R5MA 5F98A 2W6OA 3EXAA 3IQFA 2QAGB 1QJCA 2XB4A 1U1GA 2G6TA 5BSVA 3GJQA 1VKJA 8MHTA 1AB5A 2VT6A 1M5UA 1PUJA 3AOEC 1NZFA 3HXPA 4GMDA 2WKPA 1RRVA 3N2GB 1IN4A 2A0FA 4G89A 2UXBB 3KT8A 5GONF 5K6AC 1QO9A 1E9BA 2FPMA 3FUVA 2J9GA 3L1HA 3WNZA 1JHVA 3DVSX 3M4XA 5JBIA 4IWYA 2B3DA 2C88A 3O5AA 4KNVA 4Q21A 2E37A 4YRKA 2H54A 4ITVA 1FDWA 3UM9A 4URFA 3ZZUA 2JI7A 4YV1A 1TD1A 4X7RA 1RZRD 2O8FB 3KQMA 1ACLA 4FD2A 4F3CA 3VPDA 3H7AA 4X91A 5EIEA 4TMVA 1VCIA 1XV5A 2X14A 3KPJA 5B2ZA 4Q3AA 3VNAA 3AH8A 2C3YA 1RAFA 4KBGA 3RI3A 4O4LF 3FVVA 3MZ0A 3UAZA 4J1NA 4Q4JB 2W0SA 4OLFA 4W1SA 1TGYA 2QY6A 2OC9A 5AWFC 1PEAA 1EGHA 3MAGA 3PPIA 4NIMA 2Y4NA 2VP0A 3K92A 5AUOB 3EFBA 1CZLA 2ZK7A 3SE7A 5H8WA 3A2NA 4J0DA 4F3RA 1OI3A 4F93B 1DBPA 3GLKA 1Q7RA 4G86A 1SZJG 5D01A 1JQKA 1BD4A 2OG1A 4R9NA 3H4IA 2HY7A 4LJ6A 4JZKA 3WLRA 5JRDS 1EUCB 1R5BA 1BE8A 2QTTA 2P90A 3Q1KA 3MMXA 4QWWA 5DHSA 3FPEA 2HEGA 4YJ3A 3T4PA 4M9RA 3TLYA 1H2HA 3V80A 1HEUA 2XHZA 3ZWXA 2Q8QA 3ZDEA 3PJGA 5KQGA 4K0RA 4OYYA 2HMSA 4ABYA 1PWXA 4OUDB 1BEUB 1GYQA 1QR6A 2QI9C 1OGYA 3HADA 3KEMA 4NONA 5B1SA 5K4GA 4Q37A 4DR6B 1YZUA 2KE5A 1CVRA 1YZNA 2V54A 3GJ0A 4LISA 4EDFA 4UTPA 3EG9B 1E2PA 1EFDN 2IX9A 2GCEA 4I08A 5SYAA 1V48A 1MOZA 2WDZA 2QG6A 1W4ZA 1Z12A 2B0CA 5CHYA 1UBSB 5F35A 1R6UA 4PZCA 1QIHA 1NQTA 5AI5A 3ZW7A 3OSZA 1Y3FE 2BSXA 3GROA 1NUHA 3SX0A 2C5AA 1V9SA 2XT9A 2ANCA 1KOJA 1M7BA 2F2TA 2IYQA 3LO8A 4IFTA 5AT1A 3GLIB 2FMFA 4UM9D 2QUAA 3CNBA 1E1KA 2A3RA 3S2YA 3TCNA 1XZCA 1C1DB 5E3IA 3LQYA 3TE7A 3I8OA 4OQNA 1DZIA 2Q9CA 4C2BA 1EP9A 4GX1A 3MM4A 3GAZA 1JBKA 3GV0A 1G18A 4U7TB 4ZQBA 3E81A 1NYLA 1I3OA 4AKGA 2B4KA 1X1AA 4BE9A 3EQ6A 3H1AA 3KZNA 2H5IA 3L6CA 2HCRA 2REXB 4L0DA 1MO3A 2I29A 3ZDAA 2XE8A 3SGLA 1TLTA 1KVQA 2O1EA 3ZXSA 1ZITA 2QN2A 5KX5F 1GPJA 2GXUA 3LLVA 1MX1A 4Q1AA 4FJ0A 1JVBA 4UMEA 3H0EA 2GCGA 3AG6A 4QPDA 3KXIA 2ZJ8A 2JJ1D 1BU5A 3OUUA 4P83A 1R4MA 3PLRA 3ANLA 1E4OA 1UWKA 1F8YA 1WZNA 5J4YA 3UWMA 4BKPA 5CCDA 4NF2A 3VU1A 2QRVB 4Q00A 1UKVY 4IW3B 1RXIA 4NAHA 1EWKA 4A27A 3DVLA 4BP8A 3ABIA 3BFJA 2Z4TA 3DVAB 3IC5A 4HF7A 4JYBA 4UU7A 2GAFA 3AIKA 3O8OB 4RXTA 2CJFA 2RI6A 4RA9A 1U28A 3O8BA 3JASA 3TYXA 4HGNA 3A70A 1CRWG 2P9QA 4L16A 4PRKA 1XQ9A 3RSSA 1GV0A 5JCOA 3UHOA 2KBFA 4FDLA 4HN2A 3VYUB 1HTTA 2GSDA 2QENA 3K5PA 3NTRA 4EAQA 3EVTA 3KU1A 3T7KA 3ZCXA 4QXOA 4YUZA 5BR7A 5JPIA 1ABBA 3I64A 4UNIA 1T5BA 3TLBA 3ZCPA 2RIRA 2OCKA 3AVUA 5FUWA 1ZXXA 1F8UA 4P7BA 3FDZA 1HT1E 4H1TA 4N5DA 2QU7A 3AIMA 4DKJA 2CHUA 5ES4B 2MU1A 1KYQA 4RYLA 4B4UA 5C8VA 2YWRA 4RDHA 3IR5A 2EP8A 2QR3A 3B3AA 1ISFA 2ZJZA 4DQ0A 1C4OA 3HO8A 4QNNA 1N3YA 2VP3A 5FI5A 6Q21A 5KNBH 1AQLA 1OTYA 2JIMA 4BKUA 3AFHA 5PNTA 3UJ7A 1HR0B 2A9KA 3IUSA 4TLBA 2Y66A 4IJ6A 4U2CA 3UUWA 4ENWA 1RWXA 1IOVA 4RL4A 2PCJA 1NN1A 3NV7A 3ZXIA 4JHLA 5CITA 5TC4A 2FCAA 3JZDA 2H2DA 2J8ZA 4L7QA 1NWCA 5GWXA 3A3OA 4JBLA 3D1VA 1X1QA 4IQ0A 1VHJA 4L8GA 4PYMA 4XPIA 4JCCA 5GM1A 4YXWA 4C30A 3JQGA 1KH1A 3V8NA 3WMXA 5BNZA 1CE8A 4CQNA 3UNXA 2VF5X 4QLAA 5JANA 1RTKA 2JKVA 1JLLA 4H3HB 3SNKA 3LPAA 2IV3A 3CEPB 2E87A 2NYVA 3FG9A 4KIFA 1V1RB 2UZ1B 5CB4F 1JWBB 3V6LA 3X1KA 1YZLA 4KPUB 1M0TA 1P8JA 3UMSA 3GIDA 2XR1A 3KJNA 1AKWA 2PQ6A 4N5HX 2GDJA 1IOWA 1RE1A 2J30A 2Z2YA 1FUEA 1MHPA 3CEJA 3MGBA 3O8QB 4PSCA 2WU3A 3F96A 1ZMOA 3W4IA 2A9VA 1NU8A 5D00A 4DLWA 3VR1A 2VSYA 1CUYA 1B6RA 3ET4A 1LQ2A 3UANA 2K6GA 5ELMA 3RR2A 1RS0A 1S7CA 2YXEA 4U9UA 4BMNA 1AUPA 2BGIA 2W11A 3BMNB 1J25A 1GPMA 1S3GA 1JGTA 3AI3A 3M6LA 1PGJA 1YR1A 4NXMB 2CFSA 1KHHA 1P39A 4NCIA 4Q1DA 5JMWA 1L7PA 2HJRA 3H1BA 2Z58A 3LNCA 2GWHA 1V9CA 2Q4DA 4MJ3A 1WS6A 1NLMA 2C20A 3JQ7B 5AHRA 1EB9A 3TAXA 3VFDA 4DY6A 3I1YA 3KG2A 2QBYB 2V7GA 5L4LA 3O2QB 1MG0A 5B55A 4DQLA 3AK4A 4XB6B 4KYVA 2GVDC 4CMHA 4RX1A 1FRVA 2W58A 4QXRA 5KYYB 5DMHA 1BDHA 1E2NA 2OPBA 1SH7A 2Q5CA 2H52A 3LRTA 5IG2A 2XNJA 4M8NE 3WKCA 1EXMA 1KQPA 1YJAA 1LJ8A 1SC3A 3BE8A 3FIUA 4PYQA 4ZCIA 5LA6F 2EF0A 1X7WA 3KYJB 4UDNA 1AQ6A 2B9EA 1THTA 4N6OA 3AVYA 4KKVA 3HI4A 2VNHA 1T36B 3FM9A 3ABQB 3PR3A 1MDBA 2WM9B 3RHZA 4XUCA 2GF0A 1GKUB 4JYPA 3QLUA 4MPTA 3LH5A 3PUWA 1T1JA 2CGEA 4HRYA 4D6PA 6NULA 1C7JA 2BH2A 1ZH4A 4ZYWA 1RYZA 4TRMA 3COSA 5EE9A 4TWJA 5EHNA 3JALB 4S1OA 1Y9EA 4LKOA 3C7DB 3CLTC 1W5EA 1LS6A 5K0TA 1YRAA 1GO2A 4QAQA 3EE6A 1C0LA 1GSOA 2AOWA 2PX2A 1MW8X 3K6JA 3JQAD 3Q5GA 4BKRA 1RRKA 3AR5A 2C59A 4N76A 4DADA 5IU6A 5CH3A 3PRHA 4K6HA 3UPTA 3E9RA 1NXWA 3KVNA 1Q44A 4LXTA 4DSNA 4ALKA 3VTKA 5DO9A 4BVLA 3ANXA 1FNDA 1RRMA 1PVVA 3FR8A 5T4EA 2BM0A 4KP7A 2GXQA 3KLBA 3S2IA 1X7ZB 1DAMA 5DX8A 1GTL1 5SZJA 3SHFA 3W5VA 4CM9D 4ZDKA 4M1WA 2XAUA 4CQMB 1IQRA 3EB9A 4OKSA 1A3CA 1FLDA 2O54A 2QMOA 4KQ9A 4YMSA 1NDHA 4QYTA 3CRNA 4B6SA 3KDSE 1KDRA 4QM6A 1UCFA 4J1TC 1N1EA 5TEVA 4CKEB 2NXCA 2VQEB 2CNBA 2H07A 1YL7A 2Q9UA 4GRDA 2VH1A 4U7PB 3O8CA 1M8JA 3AGPA 3I8XA 1VFPA 1JMVA 4GYYA 3HEMA 1CX9B 4N3NA 5JG7A 3D2CA 4DQVA 3OP4A 2UVDA 3R0IA 4MAFA 3RIHA 3LRXA 3K9QO 3U39A 4XA8A 4TMKA 3V2HA 4D46A 5T7BA 4CFYA 2XPCA 4M37A 3FUUA 2PWYA 4Z6KA 5B3JA 1Y34E 3EQ8A 1IRIA 1QTIA 1A82A 4IVQA 2WKSA 4LVUA 1YMQA 4NE2A 4GOKA 3UQYS 4YUYA 1S2OA 4Q7EA 4IYJA 1GU7A 4MRPA 4OI2A 4WFQA 3VO8A 5DI3B 1CNEA 4CLEA 3J7AC 4KBYA 4EITA 3NNDA 1QK5A 5F3DA 1CJSA 1QU2A 4R7ZA 5IARA 1RKBA 2QTVB 1I3NA 4FVTA 4AECA 4BBZA 4BU0A 5BVGA 2WQZA 3B51X 1U94A 4CKEA 4MLCA 1HLGA 3BGVA 5H1YA 4EGQA 5LP6B 1M2GA 3B8HA 1JR3A 2GCOB 3TG2A 4PAQA 4DQXA 1S6YA 1DWUA 3CKKA 4EBFA 3GA7A 5ALRA 3PG5A 4GBMA 4JLWA 5E6RA 5A9SB 2FJPA 2P6RA 1SKYE 4IZ6A 5HG0A 4AQDA 2QZSA 3GRYA 3QE2A 4NCXA 4QDZA 4C0BA 3VVLA 1OXVA 3VOBA 2V7PA 1TJ3A 1BN6A 1C3OB 1XQ1A 4H16A 1SCQA 4Q3DA 3HCBA 4IP0A 4UDOA 3RS3A 1AHPA 2R2GA 3A6KA 5D3KA 2VP5A 1NFRA 4L28A 1E63A 4PZDA 4B6EA 3CF4G 1UBUS 1XMPA 3LUKA 5EN4A 3S5UA 3UOAB 4RVHA 2CL0X 5HRCA 1GFWA 1GNSA 1QC5B 1C9KA 4B4DA 1P45A 3ZI0A 2VYND 4S1VA 4NCBA 2G1AA 3RYCB 4GYKA 2VCEA 3FJYA 1QVRA 2GKOA 2TMYA 4FFBB 4HN9A 4OQEA 4PBSA 1ZD5A 2ENWA 4TV9F 3TL2A 4EGFA 1LI7A 2H8KA 1H5QA 3G13A 3GX1A 4FOTA 1QQBA 3GT0A 1C29B 1WUJS 1AQIA 1V9LA 3P0FA 5BQOA 3CT6A 5F9MA 2VUSA 4NDNE 3MGGA 4IZHA 3AVQA 4ZC8A 3S1LA 2NN3C 4U5XA 2YXBA 2PMDA 2I7XA 3IOBA 3I1IA 4K28A 4EKDA 4MJLA 3NBFA 1U7DA 4PXYA 4EA6A 5C8YB 7ABPA 4K40A 4QYIA 2P2DA 2YXPX 4WZAA 4CXMA 5IXYA 4KBFA 3KSUA 3DHYA 1MNQA 4L07A 1ELOA 4C2TA 1RRGA 5JAQA 2MINA 3STUA 1ZK2A 3GPBA 4EB0A 1TKCA 4CM7A 3OQVA 1Z6GA 1TKAA 1R9MA 2PS3A 1E2BA 2PZLA 3ASYA 2F67A 3PVZA 4M4SA 3TW4A 3TTTA 3Q11A 3U7GA 2XEDA 1XTJA 4LC0A 1W30A 3JARB 2LRHA 1DJPA 3IILA 1N2GA 3FOCA 4HAWA 2CLKB 1I4EB 2V7UA 3LW7A 3H42B 3GC6A 1NLUA 2CJXA 5JDIC 1U3CA 4KXUA 1CCWA 3IO5A 2JGKA 5LLDA 1F0KA 1X7ZA 4EG3A 5A4JA 5BN3B 4QEDA 3Q7QA 2DYKA 4L22A 1ITZA 3ZXYA 3ZCVA 2IGTA 3VVBA 3VJRA 4MCJA 4UMFA 3H19A 1B23P 1NVDA 1QLHA 2AUMA 2WA2A 1M2OB 3EXG1 3MIZA 4YA6A 1U3FA 3B1KA 1XHLA 4JU8A 2QYOA 2OECA 2ZYUX 1KETA 3GLQA 5F4BA 3W5SA 1QHHB 3FPAA 3UAGA 4MH0R 2UVPB 3C8UA 3HLTA 4OGFA 4X20A 5KDLA 1UC9A 3IVMA 4DMCA 3FLBA 3LP8A 5FKJA 3U7JA 1L0BA 3LBIA 3U7QB 4JD5A 4HK4A 4RPGA 2FE1A 3ZWCA 1NAIA 4DRXA 5JRJA 4S3MA 3JRNA 1KNQA 3DQPA 4IXWA 2BCEA 4LDNA 3SN6A 5HFNA 3LTNC 3PX7A 1MGOA 1SVNA 2JLRA 4LC9A 1FX1A 2ZFUA 3ENNA 4DJ5X 2V9ZA 3PLNA 1A27A 3REQA 3IP8A 2D8AA 4K2HA 4AZVA 2IUYA 1U7UA 2ODEA 2Y9MB 5GGYA 2V4MA 2WSBA 1D3AA 4J0HA 4MV7A 4LSMA 1Q83A 1NM5A 4HHEA 1QSGA 4ZK2A 5FLXA 1GV1A 1BHQ1 1CZHA 1RBZA 3BSWA 3QFSA 3WKBA 4M9QA 4AKEA 2VNJA 2HQOA 3CH5A 5CEJA 3JAKA 5KQPA 5IANA 3B2QA 1HG1A 1R8SA 2GOYA 2MOKA 4LRUA 3O2NA 3O1JC 5DOVA 1GG8A 2XJ4A 1EX7A 4L0MA 3TD2A 3BK1A 4EPTA 2N1BA 3ME5A 1OXKB 1L7DA 1YQWA 4PC3A 1VKNA 3DGFC 4Y67A 1FNCA 3FTNA 2Z8YM 1PO7A 1R10A 4RFLA 5JZSA 1VG9B 1D1PA 3PYXA 2B6HA 2PGAA 2GZ2A 3PQ5A 4EQ6A 3GFVA 5L4SA 2IK8A 1SG9A 3H5OA 5AJWA 3JWIA 5HZKA 3PBKA 2Q2QA 4QPJC 1E18A 2CKMA 3OZDA 2GCPA 3O7WA 3A1WA 4IS3A 2QR5A 1KC1A 1CUAA 3DF7A 4EUKA 3I6ZA 1KR5A 2V97A 3V4VB 1ICEA 1H1LA 1VSQA 2QBYA 1FZTA 1KOGA 2YWHA 4ZXPA 4HEA6 4RA9B 1RPZA 1E69A 5SICE 1E0JA 3K9GA 2WD8A 4EF5A 3VYWA 3HCDA 4JFAA 1PFKA 4ZO4A 1QF9A 5D86A 6CHYA 1TF5A 2ZM5A 3NTXA 3HFRA 1QHEA 3EEBA 3GRVA 4PRLA 1EGAA 4M22A 1ID1A 1X6VA 4M86A 3K72B 2X8WA 1JQJC 2P2GA 3B52X 4PYRA 3H6HA 1MC8A 3SOPA 2OV4A 1U2PA 2R8RA 4QEKA 4K88A 3UMJA 2H1CA 3CLSC 2EIHA 4QWMA 3RCBA 1A9SA 3D3EA 3LLMA 2I4OA 1FP4B 5F1KA 1XPOA 3FWPA 4B3DA 3VDNB 2HQ1A 2UKDA 4QHTA 5AVWA 1Y8CA 1D0VA 1WB5A 3TZCA 2HJHA 2ZAMA 3SC4A 5HILA 5EIAA 3UJAA 4G0QA 5C7LO 3T3HA 4ICIA 1E94E 4J16A 5TVGA 2FHPA 3PXUA 4JIGA 3PJRA 2J1LA 4AG6A 4BS9A 1D1QA 2QVGA 4UUMA 2QP3A 5KYUA 1DJQA 3RV4A 3FBGA 4ZVKA 5HUQA 3R7NA 2XUPA 4BNDA 3PVCA 2VPIA 4EOGA 4DG5A 4BJHB 5BWOA 3VR4A 4TT8A 1X15A 4M0FA 1U5CA 5AYVA 1ZR2A 3MBIA 3WL5A 1BMFD 1B6TA 2AT1A 1HEIA 1HDXA 2B92A 2J0SA 4WESB 5M5BA 1Z0FA 4IIYA 5DHFA 5BV1A 4X41A 3VJKA 5E7JA 4D25A 1WL8A 2II6A 2PJDA 4U2FA 3G0BA 1DHTA 1QIGA 2XITA 2PGNA 1XGKA 5A03A 5BSGA 1N8TA 2C94A 2I2BA 1XXHB 2O0HA 1NYRA 2IPMA 2VNAA 3QTTA 3M5CA 1J1ZA 3DFZA 3I58A 3DCYA 3WKDA 3ZCUA 3L6RA 4CEHA 1ESZA 5DSTA 2O8VA 3RU9A 4R0NA 1U81A 1WKBA 3LS2A 5AVRA 1HDYA 2J7KA 2VYCA 4GIBA 1P8AA 1KDYA 4DWJA 3M81A 3BRSA 3OT1A 5A0TA 2JAPA 4OMFG 1LLDA 1XPJA 3OZWA 3SAJA 3UJBA 1EUCA 4Q4DA 2QMZA 3GVPA 3IR6A 4GL2A 2H29A 2H7VA 2HJVA 1XRNA 1V11B 2JZNA 3IMGA 3KJEA 5IABA 4JBIA 2YYAA 1XDSA 1SVWA 5EHGA 1ZN8A 2FXIA 3MB5A 3FDFA 1U7PA 3NNSA 2HCTA 4HB4A 1TF7A 4HG2A 3OTWA 4MB2A 5KOJB 3CB2A 4B7UA 1EEHA 3D81A 3IQDB 4IDCA 3RIXA 3FPBA 3BRCA 2CLLB 2ZTLA 3A3NA 5B12A 2XF2A 3F4KA 3LVFO 2OCPA 3UOGA 3UZUA 1TA9A 1TA0A 1NW5A 4R98A 3RU3A 3A11A 2OC4A 3HA3A 4FOPA 4RVDA 4JLPA 4RH1A 3IT2A 4K1XA 5K45A 3Q8MA 3DDSA 1VBKA 3E1GA 5I01A 1JR3D 3AT1A 1ZIOA 2G71A 2MSEB 1IATA 1OASA 3VH2A 2RB4A 4JBHA 3I0NA 1DTEA 1ECJA 4GC5A 4IM7A 5C31A 5KYWB 4F8EA 3U61B 2APJA 3Q9SA 4RPJA 1H9BA 5F5LA 2IZ7A 3EISA 2GPWA 5KNDA 2L82A 3DUWA 3PUIA 2OVFA 4KDRA 4RQBA 5HQ3B 1F20A 1NSYA 4QUDA 2VBFA 3CU5A 3ADBA 1QQTA 1N2IA 1VM6A 3QVOA 1MU0A 5DOZA 2ZDHA 1HYQA 2D1QA 1K4YA 3GLGA 2YOGA 5DXAA 2DQYA 3EGCA 5KNCA 1QNLA 5DNEA 1D8AA 4G0YA 1HKHA 2P9TA 2H2HA 4ER5A 3BD6A 4MI1A 2AHRA 2R6ZA 2VJNA 2IE8A 5IHXA 1JFLA 3GZJA 1E9DA 3D59A 1VJDA 2R1TB 5LZ7A 5JFGA 2Q9AA 2HT6A 2EAUA 3K1AB 2FJ0A 2V74B 3D3NA 2GN1A 1KVTA 2IPOA 5D8DA 3ESRA 3N7TA 2VTBA 3T7RA 1DPGA 2G9ZA 4CM9A 3P32A 2CL5A 1KTIA 3FAZA 1IXYA 1X1RA 2BBOA 3IPCA 1LDBA 4D2IA 4N9QA 2RJNA 4MS3B 3C6MA 4LSGA 1C1HA 3FSRA 1ICIA 2FR8C 5JZBA 3WLHA 4P5PA 1P4GA 2ZWVA 2QMHA 2LKDA 3EZFA 3AETA 3M0EA 1NI3A 1ULZA 2BDTA 5BN3A 3KSDO 2HHCA 1BMFA 3H2KA 4ZTZB 3WADA 1JEQB 4BP3A 3AQ4A 3HDQA 3ZWMA 2A5GA 3KXPA 2WF9A 4KR2A 4FYKA 3LDFA 3HY3A 1QX4A 4XARA 2F1HA 4CODB 3K9FC 1NUAA 8LDHA 1DAIA 3OPVA 1PK8A 1OLUA 1YK0A 2CXRA 2JI6A 5A3QA 1ZH0A 3E18A 4YMHA 2Q27A 3D7RA 2P5UA 1YUNA 1Z0ZA 2V96A 5TX7A 1A9OA 4LC1A 2O2ZA 4ID9A 2L18A 3MTJA 4CCYB 4R2LA 5DYYA 4PLPA 2ZRJA 5DHTA 4CF6A 5FYDA 2OZEA 1EXWA 3LYHA 1QDLB 1BDBA 4IXMA 3VSEA 2CLCX 4CCAA 1XZMA 2O1SA 3CZ5A 2C4TA 4GWKA 1OTXA 1RYDA 1CJCA 1Z5WA 1J23A 1ONPA 1TM7E 4RAQA 3I53A 5IVKA 1LC3A 1Z4PX 4IV8A 3DFUA 2HFJA 3FPGA 3ESXA 4JLBA 3IIIA 4BDTA 2DPYA 4JBGA 3UCFA 3JAWB 1E61A 2G1JA 4FONA 4DCGA 2J33A 2Q8PA 4NJMB 1AB6A 1WHSB 2WU8A 2JDIA 2Z95A 1SHJA 2QW0X 2C95A 4LBWA 4GPAA 1V41E 4BMOB 4D0GA 1WVMA 1SB8A 3F98A 1FP2A 821PA 4DVJA 1OFHA 4NYIR 5LYJF 4IO1A 1GCGA 2EKBA 1QP7A 3S44A 3WHKA 5LCXA 2VDNB 4AZ3A 1Q0PA 4MRNA 3SCZA 4BN5A 4HUQA 4V0OA 5J9FA 1R9NA 3TR0A 2X7JA 1CUHA 4BNKA 2RHJA 2TYSB 2VWPA 1ZM3A 3GVXA 3KQVA 2WTUA 4YT2A 1P4HA 2CLIB 1JH9A 4F11A 3U4HA 3WL4A 2QGFA 1EXDA 1Y7TA 3F0TA 3B1YA 4C3OB 1XPRA 3ZDQA 3LDAA 4U7FA 1XCJA 3FWYA 1KFCB 2ZJ4A 4Q3OA 2F1OA 2OEPA 2Q5JA 4RYDA 4L4YA 3AUYA 4ED9A 1J9ZA 3TSZA 1PX0A 1OHHD 1JSXA 2WIGA 2XMPA 3EF3A 3LHDA 3QWHA 4N8EA 5DRYA 5TGZA 3SSOA 3PFWO 3F9CA 2FOIA 1ZOSA 4C5CA 3SKYA 2HTFA 2INGX 3RYFA 1DELA 2X6QA 1LD3A 1XJ0A 2PUTA 5FBQB 4JI1B 5SZIA 4YAJA 1DNPA 5KINB 5FBWB 4RPKA 1P7ZA 3AEYA 1JAYA 3K16A 1J9EA 4N3CA 5B3LA 1T0UA 3K1TA 3THWA 5CDHA 3NYQA 2ACEA 4JEIA 3GW8A 2VBIA 2HWKA 4ZARA 3TJMA 1U5BA 1F4VA 3V8QA 3C3MA 5FI1B 1G8GA 4B3MB 1BO6A 4WCFC 2VK2A 3PJFA 4WCFB 2HA6A 4MV1A 3Q8LA 5KYXB 3OZEA 1SEVA 1WXQA 4AJ2A 2ZRNA 1CUFA 2HU7A 3Q2IA 4B43A 5F7OA 1GNTA 5I7OA 1U0HC 5I7UA 1HLPA 5K3FB 4WBNA 2B25A 4KQGA 4XYMA 1SQFA 3DAOA 3B36A 2V0CA 2WF6A 1LUAA 4P0QB 5CK4A 3V6MA 5AXDA 4DTCA 4Z3KA 1JNXX 4KVAA 4XSVA 1M6NA 2PRYA 2CNWD 3I12A 2OFXA 3JQCA 4I55B 3OM1A 1I6WA 3R0QA 4XCXA 5FA5A 1KBOA 4YR9A 3PT9A 3IP5A 4IQ4A 1RM4A 1E4EB 2ZVQX 4M38A 5DLQC 3F6CA 3UVEA 4A23A 2ECKA 3DL7A 2GEFA 5DMXA 4LZNA 3PI7A 3LQQA 3QF4A 5AVQA 4FDVA 1YZFA 2GNOA 3ENZA 3F49S 1A7AA 1N7IA 3HYTA 3SS7X 1FUYB 1IBLB 1A72A 2X9VA 4J1QA 1VPWA 3C24A 3KV3O 1EP2B 3SZ3A 4PYJA 4ABTA 4JMPA 4MKFA 5BR1A 1W0KD 1Y6RA 4DLXA 1P9NA 2KJQA 4KDEA 4JJ8A 4QUJA 2JJ8A 3DWEX 2R4TA 5A5VA 3FOBA 2YUIA 4KFRA 3HNOA 1V1MB 1JKJA 3WWOA 3UFXB 1DDIA 1LFAA 1P7CA 3P4UA 5I9BA 4W1PA 2G17A 3B1XA 3T35A 5F52A 4ZVQA 2RGRA 1W85B 3K8OE 2IIQA 3W7BA 3F5DA 5AM3A 2BM8A 5DWQA 5FOUA 1FRZA 4RKQA 5TQ2B 2AS0A 1O96A 621PA 1JB1A 2Z1NA 3P71T 4QLBA 4MWEA 1XCMA 1RYBA 3LOQA 4UUNA 4ZVNA 1GFIA 1Q0UA 3IYLW 3NOXA 4CDGA 1TXGA 1IG0A 1Y8QB 1FTQA 1ZCJA 1NJFA 2UZ0A 4PLYA 1R37A 3N28A 3P0EA 2O0JA 1UOEA 1E1QD 7YASA 4DUYB 2VDJA 1RJ9A 2JK0A 4MKRA 1HE3A 3HL4A 5AESA 5JDCA 1OFUA 3AVWA 1XMIA 4P5DA 4LYFA 2BFEA 2I76A 1AZSC 2JIZD 2P79A 4QD3A 3AEZA 1ODKA 2PBFA 1J24A 2ZI5A 3LT5A 4FFOA 4A7PA 4CMEC 3AUUA 1FDRA 2QD4A 5KYTA <