4CMKA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
250
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 92
structure length 250
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmkA00
1ZEMA 5HS6A 3WOHA 4CQLB 5GZ3A 2P9EA 1K0UA 3QY9A 4I9UA 1XCBA 3IJPA 4CM5A 5A4DA 2EJVA 5LC1A 2I3AA 4KQXA 4BUCA 4TRNA 1ENYA 3RC7A 3W8EA 5K6AC 3SBOA 3FN4A 4YQZA 2YQ4A 1I30A 1T2DA 5K0ZA 5JCXA 4MVJH 5DZSA 4GSKA 2X0NA 4HY3A 1ADCA 3E5RA 4BKQA 3DOJA 4CUZA 3D3WB 3KHUA 4ZRMA 4P4GA 3VDRA 5K6AA 3WSWA 3RCBA 5C3MA 3PI7A 5TJHA 5L7YA 2FRDA 2RHRA 1DAPA 3PDJA 4J6FA 1YONA 2NVWA 4XGNA 1Y81A 2P91A 3W6ZA 4MVJD 1H2BA 1H94A 5KVVA 3ZWMA 2I67A 4M87A 3JD2A 1K3TA 4JROA 1GZ6A 1O94A 5A5EA 4BGIA 4JQCA 1JDJA 1U4SA 5DULA 4PZDA 4D3SA 5FEUA 2OMEA 2NU8A 1A9ZA 4WNIA 5CHEA 3OQBA 4IMPA 2Q2VA 3CTMA 4RVDA 2DC1A 1O89A 2GZ1A 1DFHA 3RSHA 4NJMA 3M6IA 1A4UA 3L4BA 3Q2IA 1DEHA 3FD8A 3ZWWA 2PH3A 4RF4A 4R3WA 3KSDO 3PWZA 1TT7A 4EEXA 3VVCA 1A7KA 3I4CA 3NGXA 3QWBA 3MZ0A 3VPFA 3C3XA 4YCAA 1YL5A 4J9VA 4E30A 3F4BA 4M8SA 4FS3A 5T57A 1H5QA 1BSVA 4GQAA 4IDEA 1E92A 3ZWBA 1CYDA 4ESOA 1CDOA 3QW2A 4M89A 4KMSA 1HF3A 4IY1A 2X22A 1C14A 4EITA 4AJNA 4BO4A 3VZQA 2I9PA 3C7DB 1SOVA 4CUKA 2PV7A 4UAGA 3OA2A 2P5YA 4HKTA 3GR6A 1U4OA 1VL6A 2IE0A 1ZIDA 3FPLA 3H2ZA 1B14A 3HDYA 4PIVA 4R1UA 3ST7A 4G2NA 4HBGA 2C7GA 4TSKA 1BG6A 1F8FA 3ANNA 3V2GA 5DCYA 4F46A 1HSOA 4R54A 4CMKA 4WOKA 2LDXA 4N5NA 1FDWA 3NJ4A 1ZFNA 4JP2A 1ZH8A 4UUNA 1Q0QA 2GN9A 2O3QA 2CZCA 1FF9A 4RF2A 5F5LA 1VJ1A 3UKOA 4CMIB 5KVSA 2DTXA 1EK6A 1OC4A 1XHLA 4XWYA 4WLEA 5TQVA 2R00A 1PL7A 4EYEA 2WYWA 2B83A 3ETDA 4YT5A 4AJHA 3RUFA 3I9JA 4DTIA 3R6DA 5FI3A 1ULUA 1E3WA 4B8ZA 1HKUA 1E6UA 1BXGB 1Q2XA 3KZVA 1X7GA 1YBAA 3U4IA 4ONEA 1O8CA 1U5CA 2I6TA 2QRLA 5A9RA 4CM7A 5ICMA 3NEPX 5L95A 1P1JA 1Q7CA 2HUNA 3VAZA 2GD1O 5AXBA 1Y9EA 3AM3A 4XB2A 4AFNA 4FB5A 1D1SA 3X2FA 2EEZA 4EUHA 5JC1A 3Q9UA 2WE8A 3ETEA 3DQPA 3A4VA 1LSSA 4J1QA 2NTNA 2GCGA 3AY3A 1UUFA 4BGEA 3IMFA 3L07A 4KUHA 2GUGA 2AQIA 1HYGA 3EGOA 1Z45A 5G4KA 3B1JA 4BQPA 4L9RA 1DIBA 1XDWA 3H5RA 4WECA 5CDSA 4MVJA 4RGBA 3RWBA 3PLNA 3WMWA 5BSGA 2EWMA 1ISIA 2JCVA 4MVJM 4ZRNA 3ZNNA 4BO6A 3JYOA 2E6UX 4CLXA 3Q11A 3RUAA 2WSBA 2DUUA 3AWDA 5DBIA 1QSGA 2C2XA 3KYDA 4U0JA 4CLRB 4XA8A 3KETA 1UAGA 1PS9A 2JFFA 1LRJA 3ONDA 3C85A 4NDNE 3RFVA 1PL8A 2J8ZA 2BFAA 3HDQA 3QRWA 1U5AA 4U6SA 5MGBA 1I33A 2GERA 1WVGA 1U9JA 1Y8RB 1C1XA 3O8QA 4EW6A 1MGOA 4J49A 2OXIA 4BO5A 1P31A 4ZU3A 3WJ7A 3MJSA 4YAKA 4FOOA 3L9WA 2DQ4A 4J7UA 2Q45A 1GYPA 2B36A 5JC8A 3GHYA 4FSHA 4M54A 3TL2A 2ZTVA 1JKJA 3HB4X 3DAPA 1PSDA 4L73A 4BO9A 2IZ0A 3CZMA 3G1UA 1KEVA 1ZJYA 4UVIA 3ASUA 4AJLA 3UH1A 4KQWA 3R3SA 1I10A 1UP4A 1HRDA 3VHRA 1JQBA 4BS9A 3VH1A 4BNVA 1V9LA 3LC7O 3MJTA 3OP4A 5F3RA 3DZIA 1ZJZA 4OQZA 4AJPA 1UDBA 1BDMA 3ZHYA 1JVBA 1OZAA 3DBRA 5JLAA 4BMNA 3WXBA 5KJCA 4OQYA 4RPLA 4M55A 4OYRA 4JGBA 3RJ5A 1PJ4A 2YV3A 3VTZA 2D8AA 4LSMA 3RI3A 1PTJA 4TWRA 1UXJA 4MKXA 1LRLA 5CPFA 4HNHA 2YJZA 1GV1A 1KVSA 4BB5A 3L77A 4DPKA 1Z6ZA 3GN1A 4GL4A 5G4KB 3RJ9A 5IDQA 1U3UA 5HBRA 5JY1A 5AOVA 5CDUA 3M1AA 1KY4A 2QIOA 4DMMA 1EBFA 2WEKA 5GY7A 3L9XA 1EFLA 4TVOA 3FNEA 4N18A 4XR4A 1RM0A 4NBVA 3OFSA 3K73O 3E82A 4JN6B 5HWSA 3JQAA 1ZSYA 1YQXA 4RF3A 2D59A 1A5ZA 5DOVA 1PGOA 4J4BA 4ALLA 5T5QA 4BHTA 1LNQA 3Q0EA 2Q4BA 2C7VA 3GVPA 3NTQA 4DIBA 4UVGA 4BV9A 2QYTA 3WX0A 3HDHA 3ENNA 4XX0A 2JL1A 1NQ5A 3T7EA 3R0IA 1DRWA 3BXXA 3UUWA 1MC5A 1IZ9A 4NPCA 4OHUA 3DOCA 1PJLA 4D45A 4ZN6A 4TROA 4BNJA 1HLDA 3SEFA 5A9TA 4CM9D 1LLQA 4GVXA 3D7LA 3JQ7B 4WCFA 5G4LA 1NFRA 5KKCA 1L7EA 4YDRA 2VHZA 5A3VA 3DZFA 1DHTA 1KEUA 4HP8A 3GAZA 1W73A 3KYCA 2HDHA 4JBHA 3A9WA 3F4LA 2TMGA 3JQGB 1UZMA 1UXIA 2QW8A 5CG1A 2HCTA 2C59A 2EJWA 5L4NA 3DWFA 1Z7BA 1MV8A 4RVSA 1H9BA 1ONPA 2HK8A 3PJEA 1ML3A 3KSUA 4KUEA 2NTVA 3IOYA 1CWUA 3DB2A 4E5PA 1IPEA 4W82A 3HN2A 2GLXA 1UP7A 4NU6A 4RVGA 3PFWO 4EEZA 3QWHA 3MJCA 1D8AA 3KUXA 5LDHA 4ZQEA 4CMAA 4JJFA 1W4ZA 1KERA 4CMJA 2BHLA 2VRBA 3VZSA 1HDRA 2FPGA 5KIAA 1JKFA 3WNQA 1R37A 1B7GO 3BHIA 3DBHA 2YHIA 3K9QO 4JNKA 3BAZA 1X14A 1ENZA 5TX7A 2VWGA 3GZNB 2HK9A 4LISA 2QYSA 2B69A 2CSUA 2GNAA 1T1RA 2R6JA 3I5MA 4R5MA 4TKLA 4E13A 1DFIA 4FJ0A 1LU9A 3K30A 2W2KA 4MIYA 1P1KA 5TS3A 4HFJA 4MIEA 2G82A 1Y9AA 3GVCA 3WGZA 5L45A 3RASA 1OBFO 1EDZA 2DM6A 4IJVA 2BI8A 3PK0A 4E6PA 3HQ4O 3FWZA 1QP8A 4TMFA 4W7IA 1YXMA 1QXSA 2UUPA 1QYWA 1RM5A 1T2CA 1YE3A 3JQFC 2EXXA 5IZCC 3P19A 4J1TA 3RC1A 4FN4A 3SX2A 1E7SA 3ABIA 4XZ3A 3BTOA 1LTHR 5KJEA 2FHSA 1VI2A 4ZQGA 4E32A 5COBA 4E5NA 2QG4A 3TPCA 4IQ8A 1PJ2A 1SBYA 4J91A 4W6ZA 5CPBA 3RUHA 3I9KA 3AUUA 1LQTA 1N1GA 1D1TA 2YY7A 3HADA 5EERA 1LDNA 3JTMA 4R16A 1PU2A 2C29D 2Y0DA 2OFPA 3FBTA 1QYXA 2O48X 2NADA 1HDGO 1P45A 1ENPA 1SB8A 1WP4A 4WEOA 5FWNA 5L7TA 3EAGA 1DRVA 2YHUA 4MVJE 4I9NA 4S1VA 4YJGA 5A5FA 1I3LA 1ZUD1 3VPXA 3PGJA 3ZWXA 4ND2A 4E5MA 3KRTA 3L6DA 2VOJA 2Q1UA 3O03A 2PKQP 3FNGA 3GVXA 4ND4A 4NI5A 3WB9A 5A9SA 1VE9A 1U2GA 1JTVA 2EKLA 3BYZA 2Y05A 2IYPA 2NQ8A 1MXHA 3H2SA 4XYGA 5L3ZA 1SEVA 4OXNA 1JU9A 4CQLA 3WLEA 1ZMOA 1V35A 1LUAA 3V1TC 4FD3A 4CLOA 1S6YA 2EHDA 3FR7A 3JD1A 2PTGA 3LT0A 1WXDA 1N2SA 1LLUA 3BHMA 4ZD6A 4O6VA 4F6LA 1MXFA 4YYZA 4O1MA 3N7UA 4KWHA 1LRKA 4QX6A 4YBZA 2W8ZA 1PGPA 3QIVA 3GAFA 1ZO8A 3ZZNA 5H81A 4RV9A 3OEWA 3E5MA 2UAGA 2QZZA 2J3IA 4XJTA 4BVAA 4DREA 1QYCA 3INRA 5FYDA 1XELA 4Z0HO 3GFBA 3WMXA 4E4YA 4NBTA 5KJ6A 5JYEA 1FDVA 2A92A 3ADOA 4XYEA 2YV1A 3JYQA 3V8BA 5IZ4A 1YOVB 4Q3NA 4MKZA 4R41A 5AXCA 4BKRA 4FFOA 4B7UA 1XA0A 3TNLA 4GKVA 1DSSG 3L4SO 1YBVA 1X0VA 4G81A 3CINA 3NRCA 1Y6JA 2FP4A 3EVTA 4IXTA 1R15A 4TZTA 5CEEA 1I2ZA 3OBBA 2H5LA 1PQWA 1RPNA 5H83A 2NVUB 4IZIA 4P22A 4P8RA 4R9RA 4ALJA 2VUUA 4EJ6A 4ZJUA 4UUPA 3WBBA 4EGFA 4ID9A 2A35A 4A7PA 2Q3EA 2O3RA 4RZIA 1C0PA 1K2WA 2B5VA 2DT5A 3H9JA 4JK3A 1R0KA 1ZK1A 2AE2A 4RF5A 3L6OO 4PLZA 1DPGA 2FMUA 2NSDA 3ROQA 1WMBA 1YB1A 3PTZA 3OA0A 1LC0A 1YDEA 3QWAA 1W6UA 4HFNA 5DBFA 4BO0A 5L7WA 1WWKA 2BLLA 3LSYA 1E0DA 5TC4A 2UUOA 3EMKA 1QR6A 1N9GA 2HMWA 3JSAA 2PGLA 3RVDA 2C82A 4E12A 3GHHA 2OOSA 1QLJA 4GMFA 2CF5A 1DDOA 5KNLA 2G0TA 1KEWA 4XYMA 3JQ8B 3VC7A 3QA9A 4XJSA 3ZHXA 5JYDA 1QKIA 3DZGA 2VT3A 2I76A 3TSCA 2O7QA 3I9LA 3E9NA 3UCEA 1UP6A 3W8FA 2WTBA 3BHJA 3ZW8A 4FJ1A 4PG7A 5JCJA 3DXFA 3STHA 2DTDA 3UOGA 1HLPA 2CY0A 2PH5A 3QVOA 1ZK3A 1CJCA 2WWRA 2DPHA 4HFMA 2D3TA 1ZXBA 2PY6A 3IS3A 1DXYA 3CUKA 3DTYA 3R3JA 4I08A 4DBVO 2WDZA 1RKXA 3MWEB 4ND1A 2FPPA 3E48A 5KWEA 1Y8QA 3U4HA 5JNLA 1P33A 3WTBA 3PHJA 3GMSA 1A27A 1E5LA 2BH9A 2J6IA 2CUKA 1N8KA 5L40A 1ZCJA 2OZPA 1PIWA 1QV7A 3GNTA 5MDHA 2D5CA 1GAEO 4O63O 5I7VA 1PWXA 3RUDA 1O6ZA 3AU8A 3TFQA 4CLDA 1I24A 5HA5A 4PLTA 1B3BA 5EN4A 1DRUA 3VTFA 1KVQA 1K6IA 1EMDA 1Y5RA 4E33A 3C1TA 1HE5A 1E6WA 3PFFA 4JCOA 3TOZA 3D5QA 2WYUA 3D3EA 3ONEA 3FRJA 5G0TA 2VT2A 4FFRA 4A10A 2A9FA 4Z6KA 1D3AA 4B4WA 1ISHA 1JA9A 2B4TO 3PYXA 4D3DA 1T4DA 4TRMA 3PWKA 2NM0A 3GDGA 4KOAA 2GF2A 1U2DA 1G1AA 1G0OA 1A7AA 2WD7A 4N54A 4PRLA 3KSZO 3RBXA 3WICA 3ICCA 1HDOA 2VUTA 3DZHA 4FBGA 2CFCA 3O4RA 2RBEA 3F5QA 5BSHA 5BNIA 3BTVA 3DMTA 2B4RO 5EIOA 1T1SA 4QT0A 1NQAO 1IHYA 4WLFA 2PD4A 3H9QA 3L6EA 4XIJA 1E1LA 1EVJA 2VRCD 1F12A 3OIFA 4JBGA 4ZHSA 2Y1DA 3V2HA 2NU9A 1N9GB 3T7CA 2AMFA 5LDGA 5HRUA 4FW8A 4PLPA 1E1MA 4NFYA 4OH1A 4HADA 1P1HA 1A71A 1P74A 2DFDA 3PJDA 2JD0A 2X9NA 5EL0A 2VQ3A 4Z0TA 3NKLA 4BNIA 3FTPA 4IS3A 2HAEA 2UVDA 3WTCA 3WWYA 4Z9YA 3FR8A 1DAOA 1SO8A 3AM5A 2AG8A 4LMPA 3AFNA 3F1KA 4PRKA 4A03A 1JW9B 1T25A 3B20A 3GRKA 1E7YA 4ZQHA 4RPHA 4IJUA 2ZK7A 3JCZA 2J3HA 5BR7A 1T2FA 3AM4A 3LT1A 3COSA 1UDAA 1HL3A 1W8DA 3C1OA 3HFGA 3EK2A 1HDCA 3I83A 4NIMA 2VZ9A 3TZKA 4DC1A 4NQZA 1XSEA 4BO7A 3ZU4A 5A04A 4S3MA 4BGVA 4YA6A 3DHYA 3QVTA 3AOEC 4D0SA 1D7OA 4PN3A 4E31A 1Q7GA 1EDOA 4J90A 6ADHA 2A94A 2H1SA 4BO2A 3LYLA 4PLHA 4FC7A 2C2YA 4PLVA 3U5TA 1JWAB 1D4FA 5B4TA 1ZK4A 2QZ9A 1JLLA 1BRMA 2ZTUA 3GK3A 1GTMA 3S2FA 4DA9A 3IP3A 1GY8A 2BFPA 2DBZA 3JQCA 4CM3A 4P4NA 1P44A 4H7PA 1NHGA 5T8KC 3RAJA 3ZNQA 2VCYA 1KETA 3FPCA 4EDFA 2AXQA 1PX0A 5COQA 1E5QA 4CLOB 2CDBA 4RVFA 5TF4A 3FTNA 4EBFA 4WK6A 3PGXA 2CDAA 1XQ1A 4BV8A 4D3FA 5I8ZA 3OQ6A 5CDTA 1AXEA 5A03A 1EE2A 3PIIA 4J9UE 1QMGA 3HB5X 3G49A 1EVZA 1XIVA 3D4NA 3MTJA 5A9SB 2VYVD 1UR5A 1NXQA 3LQFA 3FI9A 3CEAA 1RM3A 3TFOA 5ITWA 3U4DA 3DBVO 4C7KA 5JO0A 4WASA 1P77A 1UJMA 5C7OO 2BGLA 2WE7A 5CDYA 2DPGA 2J3KA 5BNTA 4BKPA 2O4UX 2Z5LA 4I8XA 4J0FA 5B4UA 1N92A 2O3JA 4FOSA 1OMOA 4E0BA 3WGGA 3QWFA 4ZQFA 3ZDFA 3KXDA 3S1LA 4CM8A 3TQHA 1U3VA 2DBRA 1HYEA 4LGVA 4DPLA 4DQUA 2WD8A 2Y68A 2W98A 2RAFA 3DZBA 4BGUA 4EJMA 1O0SA 1YBMA 2VWHA 4R1SA 4R1TA 1H9AA 2GRAA 2IXAA 3DMYA 3L4BC 4JX8A 4NH4A 4CMHA 3MJVA 3WGQA 5B12A 4NFSA 1FXSA 3KTDA 2B37A 5KJFA 4B3HA 4J2HA 3I1JA 4WLOA 5JAZA 1GEGA 3WSVA 3OECA 4YRAA 3QP9A 3ZW9A 4CMEA 3DDNA 2Z1MA 4F3YA 1V3TA 1KY5A 5A06A 2YV2A 2Z95A 2XOXA 4NBRA 4BNUA 1DC5A 3W8DA 1BW9B 1QG6A 4OM8A 2G5CA 1R4MB 3ZWOA 1ID1A 1VL8A 4NJOA 2DFVA 3LLSA 4BNHA 4WOJA 5IF3A 4ND3A 3DHNA 3LLVA 3MCVA 1FDTA 2CF6A 5I7SA 1X7DA 2NVUA 1GUZA 4IDFA 2IEBA 2X58A 1SOWA 5F21A 3GFGA 4UULA 4K1LA 2RH4A 3DZKA 3QQPA 1W0CA 3BMCB 4IJKA 3I6IA 4TQGA 3GZNA 3KLPX 1M67A 3ZU5A 4INAA 2GN6A 4PCVA 1JAXA 2IZZA 3C7AA 3G79A 4LRTB 5GZ6A 4ALMA 3DBLB 3BMNB 3TZHA 2AW5A 2J5QA 2BFMA 1C0IA 5IN4A 2C07A 2ZCUA 1Y5MA 4CL8A 3AW9A 1YDWA 3TF5A 3QSGA 1MX3A 2NU6A 3GEMA 3UW3A 2ZB8A 3LC1O 3K96A 3KLMX 4FQ8A 5BNFA 1QYVA 1R12A 4CV2A 3PHGA 1BWSA 1X1TA 3NDJA 3AUTA 3GGGA 3GEGA 4OGWA 3ZN2A 4RVUA 3ZV3A 1DHRA 3QJ5A 1E77A 4PG8A 3RUCA 3SXPA 1XWFA 1YL6A 2PKQO 4EI2A 4GGPA 1BVRA 2EERA 1Z74A 2GO1A 1PJBA 2X9GA 4IXWA 5CP8A 3GEDA 2Y0EA 3E18A 3UXYA 5BSEA 3PQDA 4A26A 1WW8A 2W2LD 3E8XA 2D2IA 4JIGA 1YB4A 1FMCA 2JFHA 4CV3A 1KEPA 1ISGA 3KYCB 1KC1A 3WGTA 2EW2A 5KVCA 3LU1A 1GEEA 3Q6IA 3EDMA 4BNXA 4CV0A 5DP2A 2UDPA 4WCFB 1ADFA 4FC6A 3OHSX 4CQMB 1B8VA 3CE6A 5ICSA 4NBUA 1XQ6A 2O3SA 3GNQA 1R6DA 3MJ4A 2FY8A 4YJGB 1MP0A 2H63A 4J4TA 2IYOA 2ZB3A 2ZQZA 2FR1A 1Q0LA 3OJFA 4K26A 4D79A 2NU7A 4PLCA 2O50A 4RQTA 5JAIA 1HEUA 3JD0A 3F5SA 1VSUA 3CH6A 4W9NA 4XR9A 3NDRA 5JO9A 1GD1O 3GH3A 4PG6A 1HTBA 1VPDA 2PGDA 3P2YA 4LMRA 5A1TA 2Y1FA 1WDMA 4GH5A 2NVBA 4QXMA 3TOXA 2Y1CA 3D5TA 1L1FA 5IFLA 1PS8A 2EIHA 4WPGA 3JQAB 4E2XA 1GQYA 3FF4A 1Q7BA 2YUTA 4IQ0A 2ZYGA 2IXBA 4IBOA 4BQRA 2RCYA 1DFGA 3ETGA 3H3FA 4RVHA 1UH5A 4L75A 2BELA 1E7QA 3ZWVA 2PD6A 5JPIA 1X15A 3H9EO 4K28A 1CF2O 1GCOA 2GYYA 1JVSA 3OF2A 4FGSA 1B8UA 2X6TA 1EK5A 3C8MA 1FK8A 5FI5A 2AA3A 3RU7A 3PXXA 4WJZA 1BGVA 3PEFA 4IIVA 5JE8A 2BGKA 4MPDA 1MFPA 5TLSA 1K6JA 1PWZA 4Z9FA 3HSKA 4XRRA 4MP3A 4NR0A 1YWGO 3DFZA 2BF7A 3ROMA 4BNTA 4BNZA 3ZCXA 4OKNA 2JHGA 3GRPA 4GLOA 3AU9A 1ZXLA 8ADHA 3H5NA 1NNUA 3P2OA 1HETA 3DR3A 4UVEA 4BNLA 4XQEA 4RZHA 2EKQA 1ZNQO 4YB8A 4TRJA 4KTTE 4ALNA 2DBQA 5H82A 1I0ZA 2NV6A 9LDBA 1ZW1A 5JXWA 4AJEA 3E03A 3QE3A 4HWKA 1AUPA 3C7CB 4BNMA 1T24A 4D0RA 3WYBA 3G0OA 3PIDA 5LCXA 1AHHA 2Q1WA 3ZHZA 1KYQA 1U28A 1L7DA 2V7PA 2A4KA 4CL3A 2O2SA 3Q2KA 4O0LA 5JMPA 3X2EA 1KVRA 5EPOA 1TT5A 1V3UA 5CDGA 1LDYA 3GN2A 2DUWA 1GZ3A 3VH3A 2I66A 3S2GA 1Y8RA 3GY0A 3TZ6A 5L4LA 5DCUA 3M2TA 3JQGA 4BL5A 2QQ5A 4G5HA 3WLFA 2X0JA 4ILKA 3W4JA 5DBGA 2I99A 1F06A 4CODB 3H9GA 3OH8A 4QSMA 2EP5A 4IMRA 3JQ7A 3H3JA 1GZ4A 1NYTA 1SEPA 4GWGA 2JHFA 4JJGA 3KYDB 1E3SA 4CLRA 3AJRA 1XU7A 1NFQA 5JDIC 4L0QA 3DTTA 1ONNA 3WJAA 1DBVO 1NP3A 1N5DA 4LCEA 4WLVA 3ITKA 4I9HA 3GG2A 3ON5A 3VKUA 4K6CA 3WGOA 1ONOA 2O4CA 2O3UA 4NHEA 3WDSA 1Y7TA 4NNJA 6LDHA 5JSFA 1KVUA 3AI3A 4J0EA 1CQJA 4ALIA 4BIIA 1WLYA 5IXSA 4GLLA 4DLLA 4YACA 3O9ZA 4C4OA 2EW8A 3WQSB 3H7AA 4AJKA 4YEDA 2JJYA 1PGQA 2YFQA 1AXGA 3RBVA 1GU7A 2EKPA 4RPJA 1X0XA 4PLGA 4WCFC 1FJHA 2ILTA 4J16A 4CM4B 2ZYAA 2P4HX 5U4QA 2NNLD 4RLSA 2F00A 1UXGA 3ZNOA 1E3WB 5G2OA 4XCVA 3EC7A 1SCUA 4TZKA 2AQKA 4AJ2A 3DEYX 1UXHA 4N5MA 4YJHA 2FN7A 3HN7A 1KC3A 4EUEA 4Q3DA 3RKRA 4Q9NA 3LK7A 3E6AA 1R0SA 3FHLA 1E3IA 4XKJA 2PA3A 4WE3A 2GGSA 2JCXA 3PQEA 4Z9XA 1XR3A 2D0IA 4L76A 3DBRB 1ENOA 4RPKA 2D4AA 1IY8A 3IAHA 2FSVA 4OJNA 4XIYA 4HX5A 2Q1SA 4I5FA 5A05A 2HO5A 4CR8A 1HYHA 4ZICA 1MA0A 3A14A 3ZWAA 3WG9A 4YAIA 4IDAA 3VDQA 3TZQA 5GZ1A 1TB4A 1OI7A 2Y66A 1TT5B 1QV6A 4MIOA 1X13A 1NX6A 4IDBA 1Y1PA 3GT0A 2O7SA 2IRWA 3IJRA 4NMHA 3UHAA 3ICPA 5FFFA 5ADHA 1P9LA 1GQ2A 2IEDA 4WUVA 3LDHA 1M6HA 3IC5A 3WBFA 1FDUA 5ES3A 4YT8A 1OC2A 2OBNA 2OL4A 2X5OA 2AE1A 2V6MA 3I9NA 1IB6A 1Z82A 1ZMTA 2ZJ0A 3JV7A 4LVUA 3V5NA 2Q2WA 5T67A 1KS9A 2C54A 1T2AA 2X9VA 1T26A 3EHEA 4BNNA 5BSFA 1AHIA 1C1XB 1EBUA 2FPIA 3GA0A 3O8QB 1VL0A 2G76A 5BQFA 1K89A 2E37A 2WJPA 4ZVVA 3OMLA 2Q2QA 1GYRA 3QVSA 4CR6A 2O23A 4R1NA 4GI2A 2V6FA 2B0JA 2HJRA 4RPGA 3EVNA 1DIHA 4W7HA 5KKAA 4QO7A 4J1SA 4MO2A 4IINA 3ONFA 5F5NA 3SLKA 3OM9A 1WMAA 2JAHA 4BO1A 3OJEA 2SCUA 2HSDA 4XQGA 5L53A 2RHCA 3I23A 4F45A 4NJMB 1IZ0A 5IDXA 1EZ4A 3MEQA 1NWCA 4DWVA 2Y0CA 3V2UA 3M2PA 3PQFA 3BA1A 3VZRA 2HK7A 4IM7A 4R51A 1F14A 1GYQA 4KDFA 5U1PA 1J5PA 2AEJA 1LLDA 2FWMX 3OIGA 4E5YA 2ZYDA 3JQDA 4AJ1A 4R3NA 3JQBC 1T4BA 3W6UA 2DTEA 2Y1OA 3PHLA 4Y98A 1NR1A 5IDYA 2PKRA 2JD2A 3H4VA 2HMSA 4GAEA 4UEKA 7MDHA 1U7TA 4D41A 4IIUA 1EFKA 3S2EA 3F47A 4R01A 3I52A 1GUYA 3ROPA 1IOLA 1HZJA 3GDFA 4GGOA 1NAIA 4TKMA 1UAYA 1PS0A 4CMGA 5I7EA 4MKRA 1BXGA 3O26A 4BO8A 2F1KA 5TSDA 1SNYA 3PP8A 4BKOA 3WGYA 4WGGA 1I5RA 3TWOA 4OXYA 4MINA 2CVOA 2PGJA 1C3VA 1RWBA 4J43A 1HWYA 3W4IA 3D3WA 1F0YA 4XDZA 5T8KA 2Y1GA 4XEHA 1X1EA 1H93A 4CMIA 5KJ1A 3FCOA 1NASA 2XXJA 1HT0A 1LXCA 1ZSNA 5AXAA 4AG3A 3ZU3A 4BOYA 5T64A 3E9QA 3UAGA 4YAGA 2EP7A 5ER6A 3VOSA 3ZI0A 5DP1A 3OJOA 2WM3A 4Y8VA 4BMVA 5C5IA 4YTEA 3R1IA 4KWIA 3OJ0A 5B1YA 3LC2O 5ENDA 1N1EA 2BGMA 1R4NB 2DU8A 5DCWA 5HM8A 3WR5A 1DIRA 2PK3A 4NK5A 4DBZA 3QLJA 4ALKA 3C24A 1ZKMA 2CMDA 4TVBA 2JCYA 4B4VA 3NYWA 2FSSA 1M76A 3INGA 4E5KA 1CRWG 2G1UA 3I3OA 4D43A 1ARZA 4UVHA 1PQUA 1QORA 4DIOA 1NHWA 1VC2A 3DO5A 2XAAA 9LDTA 2C0CA 3DBLA 1PEDA 3HZZA 4RLHA 3RD5A 3WWZA 1XLTA 1WPQA 2Q50A 4OO3A 2I3GA 3IL2A 2PNFA 4JP3A 4L8VA 4IGFA 4J2OA 1RYDA 2PZMA 1NR7A 4NZ9A 3ZWPA 2ET6A 4CM1A 5ITVA 1ZVMA 3BMCA 2NWQA 3WQQA 4DYVA 4J7XA 3EW7A 4II2A 4N5LA 4KUGA 4NFHA 4Z3DA 2GR9A 1O9BA 2VYND 3F6YA 4OKIA 3GDOA 4QECA 1YO6A 1IPFA 1C0LA 1LEHA 4HXYA 4GWKA 4JLWA 1P1FA 5G0SA 3B1KA 3MTGA 1BXKA 4J3FA 4PLFA 2GZ2A 4PLYA 2OP0A 4FFNA 5A3JA 3PZRA 1JAYA 3GVHA 1IHXA 3C1AA 4I5GA 4LVCA 1PQPA 1UZLA 4R68A 1NPDA 5AVOA 4DUPA 2JAPA 1LA2A 1A72A 4LCJA 5L51A 3ENKA 2JKVA 4IDCA 4PG4A 2HQ1A 4RQUA 2Z1NA 3F1LA 5ER9A 1LQUA 2IDZA 2X0IA 3DHEA 3L0DA 1MG5A 3P7MA 4M49A 5JDIA 3ZNPA 4L74A 4YWJA 1JN0A 3E1KA 4CV1A 3H5AA 4GKBA 3W1VA 1LDEA 4YAJA 1WDLA 1YH3A 1M66A 3AI1A 3E9MA 3CZRA 3B70A 1XKQA 4D44A 3UVEA 2HU2A 3JD4A 5DDIP 3K31A 4II3A 1YQDA 3HJAA 4U8GA 2YYYA 1SC6A 5ILOA 5JMWA 3I9MA 2VHWA 4CM8B 4KTVE 4DQXA 1XYGA 4FGWA 4B4UA 3DAGA 3IKVA 1M75A 3H6KA 3ASVA 1HSZA 4TRRA 2EG9A 2X5KO 2UV8A 1G6KA 3ZGYA 2GPTA 3PHHA 3ANMA 4XYBA 5T6BA 4MP6A 3KO8A 4YJHB 3PYMA 5B4VA 1PJ3A 1MUUA 3PRJA 5JDCA 5IG2A 2W90A 3KVOA 2PLAA 1PZGA 4IUYA 3K5PA 4BNWA 2J3JA 3ZU2A 3JQAD 3OICA 3PHIA 3IP1A 5AQ1A 4GSLA 4OOEA 2P4QA 3I6QA 1XEAA 4F6CA 3PJGA 1E3EA 2BI7A 2PR2A 4CM4A 1U8FO 2H6EA 1LDBA 5JDCC 1I3NA 1ZK0A 1C0KA 1LSOA 3MOGA 3WYCA 4CQMD 1B2LA 1P0FA 4AJIA 4B3IA 3OEYA 3AY7A 2R00C 1AN9A 1IYZA 4A5OA 1G0NA 4XGIA 1SPXA 3QVWA 3IUSA 3DAFA 3LVFO 4U7WA 2GN8A 5F1PA 4LRSB 3UGKA 1IUKA 3PDUA 5G0VA 1ISFA 3V1YA 4W9NC 1OFGA 4B4OA 3A06A 1CQIA 2BKAA 1ADBA 1NPTO 3Q3CA 4CM9A 1HE4A 4QO8A 3WFIA 1U3TA 2FR0A 1EEHA 2VHXA 4B7XA 2PZKA 3IIEA 1HDYA 1WNTA 3TZCA 4UUMA 4OAQA 1O5IA 1DOHA 1E6EA 1EUDA 3HE3A 3WIDA 2OHXA 4N7RA 2EF1A 3MWDB 3MJEA 2ZATA 2V65A 2J5RA 3TJRA 2YQ5A 1H0KA 1TLTA 3DZJA 4Y6RA 1C1DB 1LC3A 4MVJP 1V8BA 1N7HA 2QRKA 3CMCO 1DJNA 1R0LA 2EGGA 4L4XA 3SC4A 1LDMA 3B1FA 5G0WA 4DC0A 2WYVA 1GCUA 2CD9A 5TRTA 2FZEA 4Y6SA 5DNAA 1LX6A 3UCXA 2X1HA 1F17A 3SC6A 3OIDA 4OOFA 4XQ9A 2GDZA 4XB1A 3U49A 2C5AA 3VPHA 5ILGA 1J49A 1DLIA 4Z0PA 4YPOA 2G17A 3HNPA 1TI7A 1FDSA 3K2BA 2QX7A 1YB5A 3DC2A 3VH2A 1R66A 3RFTA 3D0OA 2TMDA 3DFUA 4BNYA 4B7CA 3NT5A 3JD3A 2E48A 1VSVA 2E82A 3KM0A 2WMDA 1Z7EA 2VNAA 5A02A 3NDIA 1VKOA 4BNKA 1B0AA 3EZLA 2P9GA 3H8VA 1P1RA 3H65A 1XU9A 1U1IA 4W99A 3RUEA 2J5KA 4URFA 4P4LA 4D42A 3FNFA 4GX5A 2WD7B 1YRLA 2XXBA 2JD1A 1P1IA 2HRZA 3JYLA 3HUDA 3ULKA 3K92A 3ZV5A 4FIZA 1AE1A 1DIGA 4GX1A 5CG2A 1OAAA 3F9IA 4X54A 3AUSA 3KB6A 1DJQA 4RORA 4U5QA 3JQ9A 2VUSA 3KYBA 5JAQA 1QLHA 3TN7A 4DL9A 2X8LA 3NT2A 2ZB7A 4OSOA 4OMUA 5DT9A 3A1NA 5JCJD 5COAA 1DC3A 1MC4A 2W4QA 2W2LA 3WGHA 2OORA 3SJUA 2DAPA 4RL6A 4PLWA 5CEFA 5I9NA 1GR0A 4PFJA 2HJSA 5CFZA 1NVGA 1V6AA 4IQGA 4QFCA 5C7LO 3ZH2A 3IDSA 3NT4A 3AUAA 3ITDA 1PZHA 5EESA 4GVLA 2Y99A 1LSUA 4Q39A 4Z3KA 3SLGA 4OXKA 4JJIA 3O38A 4DLBA 1CERA 1BMDA 3EYWA 1DC6A 2AQHA 2Q99A 3AK4A 4ITUA 1RYEA 3D1LA 3NAQA 1Y8QB 1BHSA 1TXGA 3GGPA 1PZFA 3I4FA 2Y67A 1R16A 3PJFA 5CAEA 1PZEA 4R69A 4E21A 3EUWA 4QEDA 4QQRA 4MOWA 2NLOA 2D5AA 2BMAA 1Q1NA 2Q1TA 3AY6A 3WNVA 1DC4A 4CQMA 3SVTA 5AYVA 4HUJA 1PR3A 5K9ZA 3B6ZA 3UF0A 3RROA 5C37A 2XF8A 3UICA 1CEQA 4ND5A 4A2CA 1U8XX 2AHRA 4BB6A 1SAYA 1WAMA 4DGSA 3QV1A 5TT1A 4YAEA 5U9CA 2I65A 5ENVA 1UZNA 3GUCA 2P5UA 2V6BA 1VJTA 3OETA 3GLQA 1KBZA 3TRIA 5TIIA 3ROKA 4RO0A 1UDCA 1Z73A 1HXHA 1NPYA 3S55A 1BTOA 4O5OA 3PLRA 8LDHA 2CDCA 4IPTA 4JBIA 3ZWCA 3UFXA 2VRCA 4GX2A 4GX0A 2PWZA 1UXKA 3ZHBA 5KTKA 2CNBA 1SB9A 1B15A 5G0UA 4B8WA 4FJ2A 4PZEA 5FF9A 3WQRA 1NQOA 3BTSA 4J7CA 1EVYA 3BMOA 2Y93A 3BMNA 3BMQB 3RQSA 3SJ7A 5HS4A 5IJZA 1T2EA 4J1NA 3DONA 5KVQA 3UN1A 3H9UA 3ZV6A 1IULA 3U0BA 1I36A 2DBVO 3HFSA 3NTOA 1LLCA 1H6BA 4ZGWA 2BRUA 5TJ9A 5IXYA 4YJFA 2EGHA 2VZ8A 1DIAA 3BIOA 3BMOB 1MFZA 4CLHA 3RFXA 1NM5A 3P5SA 2R2GA 1NVTA 1E7MA 1R4MA 3CKYA 1VLLA 1BW9A 4AJ4A 4E2ZA 3W4KA 1ZSVA 2HMVA 1J0XO 1NFFA 3KEOA 3ADPA 2HMUA 3N58A 3NUGA 1E3LA 4ZQBA 5TT0A 1DLJA 2UYYA 4FFLA 4AVYA 1TVEA 3Q9NA 2YW9A 3WFJA 2ZKLA 3CIFA 1I32A 2ZB4A 1RJWA 1ADGA 1BVUA 3AOEA 3U3XA 3ZV4A 2POQX 4MVJI 3GOHA 3A28A 5BT9A 2X7HA 3LF2A 5EINA 1PJTA 3RC2A 2QRJA 3F3SA 2AEFA 3JQFA 1YKFA 2IZ1A 5IZCA 5F1KA 2VNSA 3FBGA 1E1NA 3OSUA 2Y1EA 1LDGA 3N74A 1NQTA 4KP7A 3LT4A 5B37A 1IL0A 1B16A 4OIMA 4DXHA 4BMSA 3RUIA 4A27A 4JXKA 3INTA 4H3VA 1YS4A 2NQTA 4RCVA 4DLAA 5L9AA 4K9DA 2I5PO 4ZA2A 1SZJG 4CR7A 1WZEA 3AOGA 3MOIA 1MG0A 4MVJG 4R9SA 4AJJA 1Q0HA 2YFHA 4EZBA 4WLNA 3NX4A 3ZWNA 4UEJA 5KCZA 4Q3BA 2VYVA 2CVQA 2QHXA 3NGLA 3QHAA 1H6CA 1HDZA 2C5EA 3T4XA 4NU5A 3G1TA 4FR5A 5EMHA 2RIRA 1X7HA 4IGEA 5THQA 2GZ3A 4HFRA 3WYEA 5HTOA 2VHYA 4ROSA 3OQ1A 1IE3A 1M2WA 2E4AA 4I5DA 4KDEA 3IQDB 5THKA 2BD0A 2AQ8A 4XRGA 2B5WA 1K6XA 1PGNA 4P38A 4R5HA 3GG9A 3PYLA 1H6DA 4RDHA 1GPDG 1H6AA 2VZ0A 3BTUA 3D64A 3KEQA 5IAAA 2B35A 5I7FA 2ZTMA 4M1QA 4DPMA 5KOIA 4G65A 3VVBA 4FFPA 3VZPA 1QYDA 1PL6A 1VRWA 4OSPA 4LN1A 3GMDA 1XG5A 3AFMA 2YZ7A 4E2WA 3RBZA 1U7HA 2OBYA 3RIHA 1GFSA 4M86A 4W4TA 4XQCA 2PZLA 5TNXA 4FCCA 3D4OA 2HMTA 2X23A 4R4JA 4IDDA 4YJFB 4Y9DA 2W2KB 5TGDA 4AL4A 3JYNA 2BFOA 4J4HA 4YVFA 5AXDA 4WEQA 4DRYA 4IDGA 3GUYA 1PR9A 3KV3O 5DOZA 2AEMA 4CMEC 1E7WA 1HDXA 4DMLA 1I01A 2YHIB 3DBHB 4IS2A 3BMQA 1I3KA 1M6WA 1MB4A 1B26A 4PG5A 2FZWA 5JS6A 4MVJF 3WIEA 3K8ZA 2NACA 4RJTA 4IJWA 2ZCVA 4I5EA 1JWBB 2ZQYA 1GL3A 3CXRA 4NK4A 4LSWA 3PZBA 1VJ0A 2ZTLA 1QRRA 5I8WA 1ORRA 4QTZA 3U09A 4KZPA 1YVEI 1DB3A 5F1OA 3ANLA 4YRBA 1KVTA 2CVZA 2FR8A 2PFGA 3NTRA 4A73A 5JAMA 2OGUA 1GV0A 3GQVA 2X4GA 4MDHA 4BKUA 1HZZA 3S8MA 1RM4A 1BDBA 4YXFA 3LZ6A 3VPGA 1I8TA 2DKNA 5J23A 1B8PA 4CMCA 3VPSA 3KBOA 1WDKA 2Q49A 2ZJ1A 4WKGA 1A9YA 1ZZEA 2DLDA 1KOLA 4LW8A 4BNFA 3NJ8A 4RDIA 4E3ZA 3ORFA 1BXZA 4DQVA 4CM6A 1ZBQA 1CETA 5I9LA 2HRBA 4Y6PA 2X5JO 3K2EA 3T4EA 4FFMA 1PGJA 3BZUA 2VHVA 2E49A 3GGOA 4UVDA 1B3RA 4EUFA 2VOEA 1J4AA 1K5HA 1GQQA 1H2HA 3NV9A 1EUCA 4AICA 1GPJA 1YJ8A 3WGIA 5IDWA 1N7GA 4YT4A 4PGFA 4PVDA 2GSDA 1YGYA 4BO3A 3GNSA 4AJOA 2HLPA 3RU9A 5CEJA 4EJ0A 3DL2A 1EVIA 3OJLA 2P9CA 4YJDA 4YQYA 1PJSA 4U0KA 5JY6A 5DF1A 3DOOA 7ADHA 4I1IA 1J6UA 1PJCA 3F46A 3M1LA 3LT2A 2C20A 3GZ4A 4MP8A 3HG7A 1ULSA 2B4QA 2OP1A 4UEOA 2VN8A 1O95A 2NTJA 5C7IO 4WNCA 2OUIA 4QUKA 4CMBA 4CUJA 3PVZA 2Q4EA 3D4PA 3U4CA 3HHPA 1VKNA 1YL7A 1WZIA 2OO5A 3GPIA 3VH4A 4YRDA 4CLEA 5I9MA 1LBEA 1I3MA 1P0CA 3JYPA 4HNGA 4BNGA 1ISMA 3GVIA 1Z75A 2V6GA 3DMTC 1NAHA 4FDAA 3V1UA 2DVMA 3FSRA 1EQUA 1KIFA 4O59O 1U3WA 1ISJA 1V3VA 5EJ2A 4FPXA 4DVJA 1A4IA 3FNHA 2VTDA 5DN9A 2H9IA 2PZJA 3CSDA 2YDXA 1HE3A 4WCDA 1NWHA 4E2YA 4PZCA 3TL3A 4PVCA 3CMMA 3VKVA 3ZWYA 2JFGA 2O2YA 3U62A 3JQ8A 3IUPA 3JQEA 3HDJA 3GF4A 3G17A 3K6JA 1HE2A 4CPDA 1PJQA 4XD2A 5JBIA 1MLDA 1GUFA 3KOUA 1F8GA 1EQ2A 5IN5A 2ZIZA 1ZEJA 2VWQA 3RC9A 5L4SA 3LF1A 1LSJA 4Q3EA 5EQFA 1NBOA 3PWSA 1E3JA 2XPCA 3UCFA 3EY4A 3RKUA 4GPD1 4QFDA 5EQDA 2FOIA 5JW6A 1NVMB 2VYNA 4H15A 4MJLA 2YDYA 1EE9A 2RH8A 4YT2A 1E1KA 4LK3A 4D46A 3EZYA 4K6FA 4Q3CA 3IKTA 1YJQA 1TA4A 3S2IA 4XGKA 2O3TA 4C7JA 1TEHA 1SMKA 3GC6A 1LJ8A 2X0RA 4DYDA 3JQ9C 4WLUA 4IZHA 2P2SA 2LDBA 4L4RA 4NBWA 4UUOA 2P68A 1S7CA 3G3EA 1C1DA 1VM6A 1JKIA 1CIVA 3JQBA 4L4SA 4HV4A 1AGNA 1YOVA 2Q46A 5GMOA 4GMGA 4Q3AA 1I2BA 3AI2A 4CJXA 3U9LA 1XGKA 2NUAA 3CPSA 1GDHA 3QVXA 4D7AA 1EUZA 1V0JA 3I9OA 4GBJA 4U6QA 1OOEA 4DIFA 1ZK2A 2HKIA 3PPIA 2IODA 1I2CA 3HWRA 1YQGA 2GN4A 3GPDG 2AG5A 4XDYA 2D1YA 4A0SA 4XYLA 2PD3A 4NG5A 4H16A 4B3JA 4UREA 3Q1LA 3JQ6A 4OL9A 5JFOA 2VTEA 1GADO 2VWPA 2GASA 3TDKA 4Y67A 4YR9A 2X86A 1NTOA 2EV9A 1E7RA 1DO8A 1P3DA 1LI4A 3FWNA 3QWIA 3WS7A 1R4NA 4B79A
chains in the Genus database with same CATH superfamily
1ZEMA 2P6MA 4QOJA 4MUFA 2B5OA 1R5NA 2P9EA 4YV2A 2R8BA 1XCBA 1SXJC 3WMRA 4MCHA 4LXTA 4KQXA 1UWLA 1U7WA 2XYGA 2XYRA 5K6AC 1OLUB 2P2YA 2X41A 2BFEB 4LYDA 3U4QA 1Y8ZA 2O6HA 4YQZA 5FPPA 3ESXA 2AGVA 2YQ4A 5A71A 3OQHA 5IM4A 2PS1A 1YUNA 1YTUA 3I8OA 5TEWA 1XZIA 1XZMA 4QATA 1P6XA 1YGPA 1KZ6A 1W5FA 1TUEA 1XMPA 4OLHA 1ADCA 2YCLA 3EAFA 3RV4A 1U3CA 3KHUA 2PCLA 2LGJA 1CY7A 1Y6QA 2ECPA 2JLRA 2RH5A 2WU8A 3DNPA 1UIRA 4LUCA 2VNKA 5AI4A 2QLTA 5K6AA 5GINE 3RCBA 4QSMA 3EXEA 2N3ZA 3LE8A 1MB0A 5I5EA 1G8GA 1O2DA 2WB4A 4IVRA 4S35A 1CRQA 2V59A 3TD9A 3WLOA 3UBTA 4J6FA 3GYBA 4WOPA 3ANYB 2NVWA 4XGNA 2WPDD 1X94A 4OXQA 1H94A 4FYVA 4EYSA 4OPMA 1LS6A 3KQQA 4NG4A 3ZWMA 2ZYSA 3JD2A 1I6LA 1KZ1A 1TO6A 3HVUA 4OFZA 5KINB 1RWQA 4MW5A 5A5EA 2WWFA 4BGIA 3SU8A 3MQFA 4NABA 1TECE 1XJCA 3I73A 5LNK6 4QL3A 4PTLA 4QXAA 2O6LA 5DULA 5U4XA 3ESQA 4B44A 5LP6F 4D3ZA 3D6NB 4M9XA 2NU8A 1A9ZA 3L1JA 5KO2A 2EX1A 3EVFA 3I28A 1AF7A 4CTNA 2GVNA 3UA3A 4MW4A 2IV3A 3NDBB 1KRHA 2JIQA 2PS9A 3L8ZA 5BQ3A 2H1RA 2I2CA 4HWGA 2F8LA 2QV0A 1EXVA 4KB5A 4UM5A 4Y2VA 4JJAA 1VL1A 1DFHA 2V7XA 4KKVA 3WQBA 4BN0A 2IX3A 3SSNA 2P8JA 3P0JA 3L1UA 2QTBA 2Z4TA 3DVAA 3CPEA 3V8EA 4UUAA 2YYAA 4F4CA 5KSWB 4Q1AA 1QS0B 2PFKA 1BGWA 5ABPA 4MVWA 4MKIA 2RK4A 4IDQA 2TS1A 1DEHA 3FD8A 3IQFA 2PH3A 3ZWWA 3QKUA 1EFDN 1U0JA 3G2JA 3JZDA 2VAPA 4R3WA 1LNZA 1TD1A 1J22A 1UT8A 3CW2A 3MSXA 3MT8A 1P4SA 3VVCA 5IH7A 2Y3IA 4I66A 4N47A 3L7AA 3AEKB 3FFAA 3HYTA 3HFJA 1THMA 4IQ4A 4EJSA 1I4OA 3ELDA 3IILA 1BGXT 5JQGF 4I2NA 5F98A 3NGXA 4JA0A 1XZLA 5BWBA 4PYQA 5E4YA 2ADOA 3RBAA 1T9GR 5T4EA 1OYVA 3KOWA 3MZ0A 4GOND 1XTUA 1IN7A 3SOPA 1WCV1 3ESBA 5EE0A 1QZZA 2P2CA 2QNRA 3LUGA 4JI0B 3FNQA 5DW0A 2WABA 5T57A 2ORED 1QIJA 4FFBA 1P8JA 3DHVA 3SICE 4POOA 2WLTA 4QELA 4RSMA 1T3LA 1G5QA 3QBEA 2WFAA 2ZEJA 4RM3A 1YR9A 1W29A 2I4MA 1RC1A 4BMXA 1PE0A 2KLHA 1E92A 2ALJA 3IPCA 3ONVA 4KMRA 1CYDA 1OZFA 1XA4A 1ZIOA 2H65A 1JF8A 1RPTA 3QW2A 4W5HA 3WZMA 1MC1A 4UNPA 3AJEA 4BN5A 4DMFA 1DKMA 5CLQA 4X1YB 3OY2A 1FW8A 1G8YA 2FQWA 1X86B 4MUHA 4U1RA 1GTL1 3C39A 2GA8A 3HA3A 2WINI 1XZ8A 2C2ZA 5BV7A 1GUDA 4X90A 1YV9A 2GBLA 3RUPA 1KZ7B 3O6VA 2IE0A 4OMFG 3UOWA 4F56A 3FPLA 5FLEX 1PQ4A 1E6LA 2QT1A 2R5WA 4G2NA 3RSOA 2C7GA 1BG6A 1PV2A 3ANNA 3D7SA 1ZP6A 3DWIA 4NYIQ 3WVNA 4YUWA 1IDN1 4TLCA 1CRZA 1YIAA 4R54A 4AMBA 1FDWA 1Z38A 4I1VA 4LOJA 3C3EA 1JNXX 3WGVA 4DSOA 5IJAA 3OCWA 2O3QA 1F60A 4RF2A 3K70D 4RADA 1C7QA 1RRKA 4CMIB 5GIOE 2MMCA 4BFXA 4BUJA 2DTXA 1XHLA 1ECPA 3DDWA 2QP9X 3ED1A 1Q15A 3QF4A 2GMWA 2R00A 5TQVA 2W83A 2NZ2A 5EEGA 1PFWA 2BP7A 1OQAA 4DTIA 5BN1A 2VA9A 1ULUA 1A8PA 1EJ2A 1O6GA 1R8SA 4UJ3A 3O4JA 3NWBA 4LXHA 4RKYA 4B8ZA 1D9XA 3FB4A 3KZVA 5AW7A 3DHWC 4JP5A 1O8CA 4ENRA 3LPDA 3I53A 1J5XA 1U5CA 3C5WP 4LX8A 1WMDA 3SZLA 2O0JA 1CHDA 2HUNA 1WLSA 2XCUA 1Y9EA 3AM3A 2QVGA 4U7PB 4XB2A 1E2PA 1RC8A 2SKDA 3Q7TA 4UNSA 3KL2A 1S8OA 4RFSA 2YXBA 4KRGA 4JELA 2WE8A 3DQPA 5D85A 5CTJA 4R8RA 1UUFA 3LPAA 3SZGA 3NONA 2BONA 3L07A 1MT3A 5HKBA 4KUHA 2AQIA 3E7DA 2XCIA 5BUCA 1QOPB 2GARA 1ZOLA 3B1JA 3KG2A 2Q6VA 1PAUA 5SZIA 4RANA 2HW8A 1P80A 2JGKA 5LZ5A 1KPHA 1XDWA 4WECA 1A8UA 1FTSA 2FJPA 3C2QA 1OIWA 4URZR 3R6LA 4MCIA 3PLNA 4JV5B 3S5JA 3NOVA 2OKCA 3L0BA 3EGDB 5HDBB 3S2ZA 4BO6A 5JZVA 1ZRNA 4CLXA 3Q11A 2PXXA 1U1GA 3IVGA 2C2XA 1TLLA 4CLRB 2Q7DA 1C9DB 1UKBA 2WHEA 1JYEA 3HACA 3L0IB 2OD2A 3PPXA 4EELA 2UZ3A 3C85A 4HJRA 3RFVA 2J8ZA 3SGLA 3WFZA 3ZHRA 1Q1GA 1FYEA 2UKDA 3HDQA 1YZLA 3W3AH 1CJUC 1U5AA 5MF6A 4PXYA 3HJHA 1XEFA 2YN2A 3VO9A 4URYR 2GERA 1C1XA 1H1LB 1Y8RB 2NSJA 4IUDS 4BO5A 2BEVB 2FG5A 1EXWA 3LX8A 1QCCA 4ZK2A 3H0KA 2YFKA 3WJ7A 3WL6A 3HVJA 3MJSA 1P7VA 4PEVA 4RIHA 2A57A 4UJ5A 1OPXA 3L9WA 4K9RA 3S8YA 2IHUA 4JC8A 3L8HA 3PT5A 2Q45A 4FUTA 1XXHB 2C9BA 1MPXA 1VTKA 5MN5A 1UL1X 2PQ0A 4HDMB 4L73A 5E1DA 5BSWA 3GA7A 4BO9A 4JENA 1KEVA 5HZHA 4MV8A 5AVJA 3FCYA 3P9KA 5EYPB 1MR3F 1JIVA 2Z5FA 3LFHA 1MORA 3W6PA 1AZTA 1B6RA 1JXOA 3EXIA 4AJLA 3ILYA 2YMLA 4EIWA 1IXSB 5F2EA 2ZI7A 4RTMA 1DMSA 3NM5A 3TIVA 1YVUA 3I61A 3B5IA 3KJHA 5AESA 2XTJA 3EC1A 1VZ2A 3FYCA 5JCOA 3B7PA 4UBIA 1ZJZA 5DI3B 4GLBA 1S8AA 4R40A 4BKMA 4BEJA 3OMWA 2EDCA 1BDMA 1JVBA 4MV1A 3LUBA 2QX8A 3PNPA 1EBBA 4O29A 4TLMB 4WZBB 4YCDA 3UAVA 1BU5A 4Q66C 4UW9A 1C7IA 2FPUA 3NOXA 4D8UA 5JAOA 3OPQA 5F23A 1PJ4A 4YAWA 5CBKA 5LUBA 2WWVD 3ZCQA 4UD2A 2OTCA 3VTZA 3O92A 4IJ5A 1SU7A 3FFXA 1PTJA 4N7JA 4TWRA 1UXJA 2P3LA 1Z7WA 1OTYA 1LRLA 3L92A 2V7UA 4HNHA 5HQ3A 5HZKA 4BTLA 5HJ2A 1JJVA 1BRTA 1V7PC 1SVMA 4GL4A 5SYAA 5H59A 1RJ9B 3ABQB 1MTOA 2AX3A 2WFLA 3N9IA 4U00A 4V0MA 4Y7DA 4J3JA 5CGZA 1I3OA 2QGNA 1UADA 4DMMA 3A7DA 4BTEA 1C9NA 2DH6A 1XTPA 2FKNA 1EFLA 4TVOA 4WT7A 4N18A 3GI1A 2EP8A 4XR4A 3RG8A 1RM0A 3K73O 4XFJA 1P8AA 5LM3A 2V74B 4JN6B 4BBZA 5C9ZA 2HJWA 1R50A 3RFUA 3JQAA 2ZRNA 2EIXA 3RG2A 1VLMA 2D59A 5EGSA 1FRNA 2FAXA 5K1ZA 2OVBA 1A88A 5D3ZA 2PV0A 4ZKDA 4MKFA 2XADA 1WEHA 4M0FA 1LNQA 4NY1A 1T43A 4JHLA 3AW8A 2F43B 2CLKB 2Q6TA 4DIBA 1N57A 3EWIA 3GUZA 1HQCA 3OHPA 1RD4A 2GAIA 5E6UA 1LPAB 2IYUA 3K6KA 2BLNA 3CRZA 2QROA 2JL1A 4OMDA 5LQMA 2FLVA 1BROA 2ATCA 4DY4A 1L7NA 3GLFE 1YRHA 1IZ9A 1FDOA 4LOLA 4NPCA 1D5CA 1PRYA 4M99A 1TJNA 4X7BA 1WBBA 2EWWA 1A7JA 4AMYA 2GETA 4ZN6A 4TROA 2IUEA 2G88A 2MJLA 1HLDA 4NENA 4BNJA 2X8JB 4M8NE 1P1CA 4BVGA 4O4LF 1LLQA 1VKJA 2PUWA 4LFCB 3D7LA 5G4LA 1NFRA 5KKCA 1L7EA 4C0JA 5A3VA 4HGOA 5H4GA 4O2AF 5DGHA 1O96A 1KKLA 2HDHA 4WIAA 4B71A 2YVKA 4JBHA 1NVXQ 3JQGB 2JDIA 1I7SB 2WB2A 2PT9A 2CCJA 3GJ8A 4DDUA 4KMMA 5CG1A 4RIFA 4C5CA 1RYFA 3L7LA 3KXPA 1GZVA 3BBPA 3NVAA 4KX5A 3ZLTA 2HK8A 3CT4A 4UOZA 1ML3A 1K2VN 2CN1A 2B8WA 3KSUA 2HT6A 2NTVA 5I8PA 3BWBA 3TTYA 4W82A 1J06A 2OILA 2GLXA 2VJYA 2BRUC 2R11A 2A6PA 5B6PA 3QWHA 1T10A 3OLXA 4YRCA 5HMMA 3D0QA 3PQCA 3KUXA 3MD0A 3PE3A 2JFYA 5LDHA 2NU6B 3IEMA 4JJFA 4LXQA 4ZI2A 3L7CA 2IYEA 6PFKA 3U1BA 4CMJA 1MQ9A 2PZAA 3IMKA 2GFQA 3WDLA 1J39A 1ESNA 2FPGA 3NBYC 3QKTA 4X7MA 1W9MA 4U2FA 2PZFA 4R9UC 1I5EA 3DBHA 4N65A 4JNKA 2VATA 2R4TA 3UJ9A 3CNQS 1X14A 4S1NA 5J2TB 2F8MA 3D2CA 3QFRA 3X1YA 2AG6A 2X4DA 3GZNB 4LISA 2B69A 3G2PA 2GNAA 4E13A 1CB7A 2ECQA 2JIRA 4G0ZA 1DFIA 4NOJA 5IU6A 5B6JA 1LJUA 2RGEA 4MIYA 5J2UB 4YCNA 1U2PA 5TS3A 1T9HA 3PQ6A 4IVQA 2JJ8A 4AZ0B 2Q3HA 4KPUB 4QT4A 5L45A 1KTIA 3BF8A 5ICEA 1OH8A 1EDZA 3NRJA 4IJVA 3LY9A 1NBWB 5T4HA 3DLHA 3VMFA 3FWZA 3KK0A 3NW9A 5BV2P 2IXGA 4C4RA 3V4OA 2XDQB 5A4KA 1LGYA 4TMFA 3AVVA 1ZM2A 5FORA 1RABA 4DCUA 1YE3A 3G8BA 5H7XA 1XNHA 1GTJ1 2O52A 1QB8A 1Y8AA 4KIWA 4KYVA 2O2XA 1ZDMA 4J1TA 2OZKA 1UIMA 3FOFC 2BGNA 4YP1A 3SX2A 4O3MA 4LWQA 1E7SA 5LMUB 2LZ0A 1Y42X 3D6UA 1MAWA 1JR4A 4XZ3A 1LTHR 4E32A 4RSHA 3KB2A 3VZCA 5KU7A 1UBTS 5I3ZA 1YDHA 4IOMA 4G5YA 3TPCA 2GN0A 2RHTA 3TM4A 3RUHA 1NA5A 5CVDA 2PLWA 4F60A 1FYWA 4PV7A 1J56A 1PG2A 1H3FA 1G59A 3JTMA 2Q3LA 1WXGA 1ONBA 3AEXA 1JHQA 3HJRA 2Y0DA 4PHHA 2PS3A 2QP4A 1SQ0A 1C8LA 5K0GA 1HDGO 4EAQA 1VIYA 1YNOA 3EXEB 1AKUA 2ZT8A 5FWNA 3JPYA 3GLHE 2YHUA 3OLWA 5AKHA 3F7OA 3WRYA 2HRDA 4S1VA 3B38A 1WB5A 1JMYA 4ZTUB 2WYIA 3VPXA 4UARA 3C45A 3EUFA 3IBTA 3E53A 4RKRA 1V7ZA 4K6OA 2PKQP 4TLDA 4ND4A 4AX8A 5K0JA 2HPAA 5GJBA 1QGAA 1JDPA 3F71A 4P80A 3TOSA 1U2GA 4K2HA 2QEQA 2ZIGA 4F1KA 4IYRA 2LNDA 1SXJA 1KDYA 3B2NA 5JOQA 3EJ6A 4Z4GA 1OUMA 2W58A 1MEOA 4JC0A 2ZUDA 3R3HA 4BMOB 3EUEA 1PR5A 3I6BA 4HUQA 1XRLA 5WRFA 1OU0A 2AFVA 4TUYF 4RTPA 4OQDA 1X1AA 2Z09A 1S6YA 2QG6A 3F78A 3FR7A 2BCEA 2PTGA 3N53A 1WXDA 4M1WA 4Z1MA 4G09A 3UEOA 4KITB 3V8QA 4F6LA 2E4XA 4ARBA 2DJIA 1AM4D 1BVYF 1KYVA 1SKMA 3N7UA 1DTWB 4KWHA 1LRKA 1V8FA 2EQBA 3HV0A 3SQDA 2F9FA 1K8ZB 4Y2XA 2W8ZA 4C7XA 1MQAA 3AXTA 4B75A 5KX5B 3GAFA 3T9AA 4OYYA 5EZYF 4P7GA 4JASB 4ETNA 5KOJA 1RR6A 1W2GA 3E5MA 1Q0ZA 1HI9A 3ND6A 3ND9A 4GP6A 3L1VA 4Q18A 1J8QA 5FYDA 2SKCA 1NUSA 4GEGA 1ESEA 4IWNA 4OV6B 4Z7NB 4C7BA 2M6SA 5EOVA 2A92A 1FSPA 1JZQA 2YV1A 4RK4A 4XUEA 3RT7A 4K87A 1JFTA 4NXMB 3MN1A 2ZJ6A 4PZZA 3TIXB 4B7UA 4O2LA 4LRYA 2J9RA 4C87A 1K1EA 4TX1A 1YI8A 4U7JA 2XA2A 2HSEA 1C30A 5F52A 4MPRA 3CINA 4U2GA 1E9EA 2EU8A 1Z3IX 2FP4A 2YN0A 3L2OB 3TLJA 5C8VA 5JZ9A 2ZYVX 1GARA 4CIWA 5EPEA 2JLUA 2D7DA 1WOYA 3TBKA 2H5LA 2G67A 2HSZA 2PSJA 2W6JA 2XF2A 3LTEA 2ZVQX 4GW3A 3FM9A 4HLUA 4IZIA 1IG0A 1XZKA 4P8RA 1U99A 2VUUA 5HEKA 3SR4A 4ALJA 4UUPA 1T5IA 4NBKA 3C3CA 1K2WA 4I4CA 3H9JA 5AM4A 1GVNB 3L6OO 4GNKA 1DPGA 1PLKA 2XRMA 4RHXA 3FVWA 3NH6A 3O0DA 4JOSA 4CDRA 2NSDA 2EQ5A 1NSYA 3ROQA 1WMBA 3EMBA 3PTZA 4KQKA 3EGXB 3Q3VA 5DBFA 4K9KA 1WWKA 4XUCA 4Y7CA 3TUJC 4DR1B 4HSGA 2LUOA 1G55A 3D6AA 1QR6A 2EKBA 3WYFA 4RPIA 3E7PA 2C82A 3SK0A 2QUHA 1QLJA 3R3WA 2CF5A 2HWXA 2CMHA 2MOKA 4K5QA 4C21A 4QGBA 3JQ8B 4QU5A 4AP6A 1AJEA 1IM5A 4XJSA 5JYDA 1KDPA 1ZM7A 4GC9A 3EVAA 5BSVA 1UP6A 5IW8A 5JS8A 5F7OA 2QW1A 4IHQA 1H8EA 2H7XA 3JARB 3SEQA 1KGSA 3ZW8A 4FJ1A 2WUWE 3FVRA 5FP0A 3DXFA 1TVMA 4L3WA 3OTQA 5J5AA 1X1QA 1PR6A 2PJZA 4FCTA 5CIQA 1XC7A 4WNAB 1A8SA 1C41A 1S8NA 3OX4A 2FCRA 2Z30A 3MWFA 4JVOA 4MQ5A 4HFMA 3CF0A 2D3TA 1DZIA 2P5TB 5IH3A 5CAEB 3ZLUA 1X2BA 3IS3A 1J0BA 3CFYA 2D54A 1NOJA 3DTYA 1AKTA 4EX7A 2ADFA 2WDZA 4LFBB 1RKXA 5FNVB 4ND1A 2FPPA 3A6GA 3MGCA 5AKGA 1Y8QA 1AGPA 1X77A 3FJYA 4ILEA 1RPAA 3PHJA 1FPQA 1A27A 3GMSA 1N8KA 2OZPA 4H4DA 5CIWA 1UBJS 1WQ4A 2N9UA 3FAZA 1WCIA 2D5CA 1YCDA 1HBJA 3U2QA 4B76A 3KQLA 1PLJA 4I7EA 4BCDA 4CGZA 1O6ZA 3TFQA 3KFLA 1NKSA 2MHCA 1JLHA 4FD2A 2JLQA 4X00A 1SCDA 2A8YA 1R0YA 3QXXA 5BOSB 4EI8A 4K6MA 3UPTA 2O5CA 5JJCA 2A88A 2JCBA 1FFXB 2QI9C 4TS4A 4BZQA 4E33A 2WIJA 1UT5A 3F3MA 1SG9A 3PFFA 3UJ8A 2CLOB 5LJIA 3OZSA 4OHXA 2GH1A 3D3EA 4ZOLB 3V9AA 4Z4HA 4FFRA 4O4JB 5ALNA 4A10A 1WQ3A 2A9FA 3PFKA 4HMPA 4MGZR 1H0RA 3ZD9A 1BKDR 1Y6ZA 1YU6A 1ISHA 1PL0A 4U8HA 1GJRA 3DE0X 2PSFA 3DE4X 5E9QA 1PJAA 1T4DA 4D9MA 3LBHA 3N70A 4IZ6A 5MFPA 4ZCPA 4YGYA 5TPWA 5DE3A 4MGIR 3TLGA 2C8JA 3I37X 3Q5DA 3S8EA 4KVZA 2XRZA 1G0OA 1A7AA 2OWEA 2WD7A 2ZJ7A 4N54A 1L7PA 4CL2A 1G64A 2R5FA 3DV0B 2XCSB 1F9AA 5BW8A 3KSZO 1U0RA 1NJ5A 2FW1A 3WICA 3CLTC 1XQVA 3ICCA 5KPDA 4FI3F 4EVQA 1PEYA 3EDOA 4L5CA 1M6VA 3FUXA 5BSHA 4HC4A 4RLQA 4Y1EA 3IHLA 5EIOA 4R1PA 1G291 4ENPA 2RI1A 1XVLA 2QYOA 3FCEA 4HNSA 1L8QA 2PD4A 2XUPA 4G0QA 1W2WB 3HCOA 4XIJA 1EVJA 2WK1A 5CU7A 1UKYA 3TSZA 2IPXA 1MHPA 1T5SA 3MXTA 4WN9B 3TRJA 1UODA 5T4FA 3V2HA 1YS9A 1XMQB 4MNTA 3T7CA 3G88A 1N1MA 2FSVC 3TB4A 4RH3A 3WRVA 4NFYA 1EP9A 4HADA 4QJIA 1P1HA 1A71A 5J9FA 3ZY3A 1MRZA 1JQAA 1P74A 4HMOA 4I55A 4RK6A 5DYWA 3FHJA 5DHUA 3O2SB 5EL0A 5DGCA 4HDRB 4X8HA 1VYUA 2EEPA 4BNIA 5JISA 5BVGA 3S1AB 3FTPA 3P0EA 2FXVA 4S1OA 4QRHA 5JCOC 4CIAA 4P33A 1I3CA 1OSNA 5ALHA 1DAOA 2HL6A 4X45A 2K6GA 2ZRCA 3AFNA 4ZOQI 1JW9B 3TVDA 2VP0A 3SQLA 5HYVA 1FYFA 4N41A 4IL5A 4GECA 1X39A 1TRKA 3JALA 5CW1A 5BR7A 4FZ3A 4PXSA 1IZ7A 1WB4A 4QODA 3LT1A 3BH6A 3HFGA 3TM5A 4I4IA 4NIMA 4AMGA 1EI9A 4DC1A 2R8PA 3QTBA 5EHQA 3ZJTA 2YRXA 3Q8WA 1QONA 4LDJA 4YA6A 4EY7A 3QVTA 1E2UA 1OASA 3RO7A 1D7OA 1G41A 2R44A 2BM0A 1Q7GA 2F1OA 4J90A 2AN4A 1Q20A 3QNUA 4FHDA 5J1SB 5FR1A 1V16A 2CYAA 3CGWA 3COYA 2HA0A 4OB7A 3PENA 4PLVA 3U5TA 4DT1A 1ZRSA 2BDUA 2GOYA 1C4KA 4NS4A 3TI7A 5LD2B 4IIJA 5G1NA 4K7JA 3AC0A 1RRGA 4H7DA 1BVHA 4TMKA 3INYA 1ZVVA 1QIDA 1JLLA 1CFZA 1IAQA 2ZTUA 1NY5A 1ULHA 3KHKA 3GK3A 4O4JF 5H83A 5LMNB 4CDMA 1CY8A 3IP3A 4UDNA 2QVBA 3K0KA 4QSHA 3SNHA 1US8B 2AUMA 2DBZA 4P4NA 3IUJA 3QTTA 1N2OA 5KTYA 5ICCA 4MWTA 2GF0A 3CURA 2Y4NA 5DNEA 3ZNQA 1FXUA 1KETA 3PFCA 4FR0A 5COQA 2MDTA 1TM3E 4KXMA 3ZDQA 4CLOB 2XCOA 3JU3A 1CUUA 3AY0A 3BE5A 4RVFA 4WK6A 3RF7A 1UPAA 2EBFX 2CDAA 2WJVA 4HUQB 2WA1A 1LV8A 1U2RA 2FWPA 2NO9A 3AFGA 1HNWB 4E5DA 5A03A 2NUTB 3IQEA 5CLLA 5E4JA 3PIIA 4ZCQA 3OTGA 5GPBA 1QMGA 2A0XA 2PLFA 2XRFA 2Y27A 3G49A 3HB5X 5BQOA 5C1IA 5BY2A 1GXSA 2I6FA 3E9ZA 1GFIA 2I7XA 4NSNA 1KK1A 3BXFA 1N3LA 2VYVD 3MTJA 3QJGA 3T4UA 2WJGA 5A9SB 2AZXA 1NXQA 3LQFA 1CY6A 2WJZB 1TTPB 1XNJA 3CEAA 3T3MB 3IUNA 1HT2E 5K5EA 5C5CA 4XJXA 3U4DA 4C7KA 1M34E 3UAXA 3CJQA 5EJGA 3AR8A 3JATA 3E7XA 2ZT7A 2BGLA 5EJ7A 3UY4A 2J3KA 5BNTA 2Z5LA 5BT9A 5B4UA 1N92A 1P1BA 1XNRB 4FOSA 3CUSA 2ZT5A 1ZQ1A 2CZQA 1Q12A 2FE4A 2CHUA 2FN9A 3KXDA 1U3VA 4UTPA 2DBRA 2BGIA 2P9BA 4RFVA 2WD8A 1N0UA 5LXTB 3C3MA 1W36D 2FZGA 2Y68A 2H7CA 5LWHA 2W98A 3DZBA 4WX2B 4OHFA 4R1SA 1RTTA 4MZXA 4R1TA 2AG1A 4JX8A 1S1MA 4BU1A 1W4CA 1A7UA 4DLXA 5F35A 4NFSA 1FXSA 3KTDA 4F11A 1D04A 5KNBH 1XDSA 3AR3A 5KJFA 4B3HA 1XZCA 3WQHA 2IDKA 3BFVA 3VC3A 5KUTA 3QP9A 2OGTA 4R8VA 1QGED 4TWIA 4CMEA 4F3YA 4XPIB 2AOVA 2Z95A 3IT2A 4NBRA 1L5KA 4ZQIA 2BUBA 3EMDA 4EYKA 1O94C 1QG6A 3TKLA 2JFPA 2H8GA 4C0LA 3U44A 3R0VA 4XM2A 2JJ1A 4KLZA 1VL8A 2QTFA 1WRBA 3NHMA 1USGA 1OXUA 4WOJA 1SUBA 1F2TA 2PJDA 1Z08A 3DHNA 1CUDA 3LLVA 3MCVA 2PVSA 1L5HA 2CF6A 2RGGA 1WTAA 5I7SA 1X7DA 2NVUA 2VDMB 2XVXA 2VP2A 2IEBA 2D7JA 4YO8A 2VTBB 3F73A 3VNQA 1YZUA 3WLPA 2CLEB 3DZKA 4K1LA 4ZZIA 1MO6A 1C9YA 1GILA 1XZEA 2O7VA 1JJFA 4TQGA 1F0NA 5EVCA 3KLPX 1M67A 1L7XA 4YECA 1SCIA 3STWA 4FYYA 3EVGA 1Z12A 3G79A 1YTLA 1W59A 2I2DA 2NUBA 1K6MA 4LRTB 4ALMA 2Q29A 3QPCA 4JITA 3LI2A 2EL9A 3K9CA 5LR6A 1PT6A 2WG1A 2C07A 4OHCA 3S5UA 3GRYA 3NNSA 4GMDA 2FEOA 3SJAA 3TF5A 4CEJB 3HVRA 5HOEA 4CRWB 1CBUA 4K05A 3U4AA 2Q0HA 4PZYA 5KOJB 3TG2A 1CUSA 1PR4A 4QWMA 1JZSA 2W6QA 3UUEA 4HH0A 4W1RA 2Q3DA 2C03A 4QDJA 3RRYA 3P96A 2QVLA 4MCAA 2A5GA 4AY2A 3F5FA 3GJZA 1DAFA 1E2HA 2DCUA 3TPFA 1XZDA 3OFKA 4PW0A 1KDVA 3W6OA 3WP1B 2JG3A 4URXR 4LRWA 2AG0A 2IYVA 5BMVA 1PX2A 2VJDA 2W22A 3CU5A 2Q5LA 1W52X 4KN9S 2RE8A 3N6XA 4KBFA 1BVRA 4Q19A 2EERA 3ENQA 5J4YA 1Z74A 1E8DA 2GO1A 1XK6A 2UYOA 3UMRA 2ZSEA 4HUTA 1M2FA 2Y0EA 2IBSA 5BSEA 3FRIA 2H2GA 3OFND 3E8XA 2D2IA 3PC6A 4JIGA 3V5NA 1YB4A 4A26A 2JFHA 2FQQA 4CV3A 1AB6A 2BHRA 2OHVA 1KC1A 1WQ1R 2BC9A 2VAVA 3COZA 3VSBA 5IXSA 4D25A 5CYPA 1NQXA 5SZHB 3AR4A 3EDMA 3ZBTA 4DXDA 1HFWA 2UDPA 4OHZA 4OATA 1U2TA 1ADFA 3R5KA 5CK4A 3R7NA 3DUWA 3OHSX 3L7YA 1B8VA 1U8YA 1N2ZA 1F0KA 1SHTX 1YJXA 2W6ZA 5ICSA 3N0TA 2WIBA 3DEKA 2ZCJA 2KBFA 3N8DA 1D0VA 3GJRA 1AQ6A 1N2BA 1ODKA 1TU0A 2PWPA 1R6DA 2CXUA 2VDKB 2FY8A 3HA7A 4O2BA 3VSDA 4J0IA 1JG7A 2H63A 4J4TA 1JU4A 2ZB3A 2ZQZA 1Q0LA 3OWOA 4UUQA 5FJJA 4ER0A 4TVSA 5JAIA 3QIAA 3OLVA 4RQTA 2V0GA 1Z2EA 3JD0A 1VSUA 3CH6A 1M74A 3NIGB 3NDRA 3P9YA 3PGMA 4XR9A 3WY9A 3NTLA 4A0GA 2BH2A 4PG6A 5CXQA 1RYHA 2QQGA 4Z54A 5A4JA 3GQBB 3CLSC 4LMRA 2PGDA 3EXFB 3GH1A 4MKGA 3X3HA 5KHOC 2Y1FA 1MRNA 4URHA 5IT9A 2LV8A 4LQCA 3D5TA 5EXPA 3FGPA 2XDAA 3ZQUA 2EIHA 4Z3OA 1TK2A 4E2XA 2JBAB 2JH9A 3FMVA 3LH5A 1CEEA 1UKAA 2RCYA 2C5LA 1DFGA 2DUMA 2O8CB 2VHQA 4HEQA 1RXVA 1QP4A 1BH6A 4L75A 3HRIA 3UB4A 1HOXA 1X15A 2Q41A 3H9EO 4OJTA 2W2OA 4XJVA 3PC8A 1RU3A 1ZIPA 3RVPA 3OU6A 1QFYA 3W2EA 1BWPA 3OF2A 4IIFA 3TLKA 3S44A 3GLKA 3ZGXA 5AVXA 2X6TA 4O3FA 2F3PA 4MS3A 5JQGB 2AA3A 1NBIA 2G3YA 3PXXA 1BGVA 4WJZA 2BVNA 5HFNA 2VSXA 1QTNA 3B2QA 4PQRA 4UAVA 2HRCA 3HCDA 4Z9FA 3HSKA 4XRRA 1COWA 3T35A 3P97A 4H77A 3GLFA 2QPTA 4I8DA 2DGDA 2BF7A 2SCUB 1CZKA 2WJYA 4M9RA 2GB4A 2OAP1 4L9WA 1CUYA 5G40A 16PKA 3VR6H 2OM6A 3KKEA 3PUWA 1TA9A 3GRPA 1CDZA 3PXDA 4QOHA 3AU9A 4JT8A 4Q1DA 4DAOA 2YMMA 5K3SA 1NNUA 3OPVA 2FQXA 1R6AA 4C6RA 4BNLA 1N2JA 5AKEA 1IWPB 4URVR 1AH2A 3VDMA 5LXTF 2HR1A 4B1FA 4RZHA 3EZ6A 1BQEA 3HKBB 2DR2A 3F3KA 4TRJA 1TYDE 3M4ZA 2Y9MB 4Z2AA 4G6ZA 1F9EA 4KHPB 1T8RA 9LDBA 1V3QE 1TZCA 2NVUB 3FWYA 3VSCA 3WNCA 5DYTA 1J07A 4G37A 1I0LA 1O87A 3QE3A 3C7CB 1TZKA 3WLLA 5JXHA 3T5PA 3HJCA 2G40A 1RPJA 3VQTA 1QK5A 2P40A 1BN7A 1FJXA 3TDMA 1VMIA 5H5JA 2HO4A 1NLFA 2Q7OE 1AHHA 2H07A 1KARA 1M2EA 2I0FA 3AQ4A 3CKKA 3IBFA 3ZHZA 3T3NA 4CL3A 2QAIA 4MV9A 1KVRA 1Y7HA 4P31A 3J81k 1OGIA 1KK3A 4ESHA 5IHXA 4F38A 4Q6BA 1KKUA 4OXXA 4MI6A 1R6VA 3BH0A 2DUWA 3LTNC 1YKSA 2P0EA 3USCS 3VH3A 3S2GA 3NHKA 1W5BA 2X9QA 3SS8A 1TKRA 3ZG6A 2PX4A 1JB9A 3BIXA 4H3HB 5B5SA 2PBRA 2NP6A 4EVIA 1G19A 3QPBA 1WPXA 4L51A 4YV0A 4ILKA 4LEIA 3TMYA 5DBGA 3FTEA 2C77A 2I99A 1VHDA 1TQ8A 1OXTA 1F06A 1KIMA 1ZM3A 1SKQA 2XUIA 3D6MA 2EP5A 3E7WA 3H9GA 1S9HA 2QK4A 1GZ4A 1L5RA 1SEPA 3BL5A 4O08A 4YREA 1X7XA 1E3SA 1IY9A 3KYDB 4LDZA 4WJKB 2ZR8A 3TQIA 4CCSA 5IKOA 1CUXA 2O7RA 1DEOA 3HYNA 2HEGA 2GRUA 2KI5A 3DTTA 2XA1A 1ZINA 5JDIC 4ZOAA 5FBRB 4RSRA 3WJAA 2BISA 4AY4A 4XFKA 1YZNA 3NANA 2JGFA 1I1NA 1Z4NA 2YUIA 1IUNA 4WLVA 5BN4A 3CEMA 4B6EA 4YMUA 1EUDB 4N9WA 2X1LA 5HIAA 1PYGA 4P3OA 2FFRA 3KXIA 1XF9A 3ZE6A 1KEEB 2HSWA 2VDWA 3A1EA 2C3PA 5EHGA 1TADA 1DMRA 2O3UA 2GKSA 4LG1A 3PG5A 2Q9AA 4L0CA 5DPMA 3WDSA 6LDHA 5JSFA 2DLCX 4ALIA 4J0EA 1WV1A 4BIIA 2OHHA 3IUYA 1E59A 4KL8S 1RHKA 1YMVA 1XMXA 3JQPA 4IG9A 5EIFA 1QYRA 3RYHA 3TTVA 4YACA 3O9ZA 3OLYA 3KS9A 4DGQA 4F91B 4HLNA 3H2BA 4HRAA 4EB0A 3H7AA 4OHWA 4ZMSA 4LTNA 3GJQA 3A4YA 4YEDA 4DMHA 2QTZA 1FRZA 1AXGA 4JS0A 2NAPA 4MUAA 5EP3A 5CX1A 3M6WA 2P67A 3F96A 4HDAA 1SBZA 1TMGE 2YNMA 4J16A 3VNAA 4XUGB 3HCCA 2W2XA 1WCXA 1TQDA 2NNLD 4W1SA 2WFLB 1W6RA 2VJCA 2YRFA 4XWAA 5JFTA 1UXGA 1EFVA 1ZAKA 2V55B 4TZ6A 5ALYA 3V80A 4TZKA 3QOWA 3DE1X 2XKKA 4MARA 4Q1EA 4LY9A 4WQMA 4N5MA 4XSHA 4AJ2A 3HN7A 1E2EA 1KC3A 2CJXA 3HCAA 2AC7A 5JPDA 3LPCA 4M9UA 1X8KA 5AJUA 1Q19A 2AN1A 3GGSA 4XKJA 3QF7A 3CRQA 1SIBE 2FPSA 4WE3A 2DYKA 2GGSA 2DUNA 4S0ZA 3AB8A 1XR3A 4RYDA 3ZZUA 4RPKA 1JR6A 2NTYC 1SXJE 1O58A 4FMCB 1EAYA 2E89A 4G5RA 4GBMA 5DLPA 5FQNA 5I7AA 4B0OA 1CR0A 1KMCA 1J0CA 1QWSA 1ZJ4A 2YRWA 4Z7JA 5A05A 1S4QA 2E4ZA 4R8KA 3VGPA 3JAKA 2H5JA 4O2RA 1J9EA 4DEYA 4ZI5A 4NMLA 2VZLA 3BRSA 1Y37A 5DBOA 4R2XA 1EJ6A 2VBGA 2JGRA 3A14A 3BM5A 4JIMA 4OHPA 2BFFA 3ZWAA 3PDIA 4IDAA 3MS2A 4RHFA 1SR8A 2IK8A 5FUVA 4GRAA 2FQYA 1OI7A 5FA6A 5I5GA 3UTDA 4JC5A 1CEXA 4I4TF 2B8JA 4P5EA 2FE1A 3Q3IA 3IJRA 1YULA 1V48A 3GEIA 5DK6A 1FE8A 4U7TB 4A2WA 5FFFA 3ZZ1A 2HQBA 1ZNYA 2Z8ZA 4LVUA 1WTCA 3D02A 2ERXA 4WUVA 1FVXA 3IC5A 1FDUA 4WVLA 3MLEA 2AYZA 3AR7A 1Z0KA 1OC2A 2QL7A 3RBVA 3UJPA 1FSZA 3E0QA 3ZWOA 1IB6A 3C4QA 4ZEVA 2C61A 4BU0A 5K3FA 2MSNA 3EHEA 4ZEWA 4IKEA 4LJSA 3UB2A 1SFRA 4BNNA 1OHHD 1SA0A 3O8QB 4I50F 1PBNA 3GA0A 5BQFA 2G76A 3NHZA 3Q41A 3V1MA 1E4VA 1KFBB 4ZVVA 3GW8A 4QG7A 5K03A 4HWOA 2JKZA 2YKGA 2Q2QA 1GYRA 1MO4A 2A5DA 4FYXA 4KFRA 1RQXA 4IICA 4OYLA 5LMZA 1G8MA 4TT8A 2Q5FA 1N7JA 3OD1A 3ICVA 3OT5A 1IK6A 1OIXA 2ZYUX 3B60A 3URKA 1DIHA 1S96A 2ZRDA 2CFSA 2BGTA 2HPHA 5K0TA 1KXZA 1WMAA 1RCFA 3MYRA 3VDXA 1WDTA 4B7AA 2J0SA 4A4DA 1I14A 2ONZA 2PXCA 3CYFA 4JYCA 5EZ6B 3VJMA 1UKEA 4XQGA 1ZHFA 2J3EA 2ZM6B 1IZ0A 4C06A 4H4EA 3MJDA 3HBAA 1XCOA 3Q7RA 4DWVA 1Z7YA 2Y0CA 2PGAA 2Q5HA 1EGQA 3BA1A 2J87A 4HH3C 3K20A 3VZRA 2HYDA 2QY6A 4R51A 4RY8A 4C0HA 1GYQA 5G1OA 2QVXX 4UCXA 3PXGA 2D1RA 1SVLA 5CH5A 3FXAA 1Y6FA 1N0IA 1P81A 2AEJA 1P5JA 3GO4A 1D6SA 4V0RA 3RVJA 2C2GA 3FYHA 5DXFA 5ELXA 3EQ6A 1NJGA 4PZLA 4PX5A 5E2BA 3STUA 1Z4OA 3KFVA 2DPMA 2VAMA 4Y98A 1NR1A 2CLIB 2JCSA 2JBAA 2YXLA 2PKRA 4IFIA 2JD2A 5EI5A 1WSBA 3LCVB 2EZUA 3D7MA 2D8MA 2R5NA 3F8WA 3AZOA 4NBSA 3VNSA 1HRKA 2J6BA 5EMNA 3MNFA 4B9EA 1NOIA 4KQEA 1NUAA 3UT5A 1II9A 1XPUA 4PR0A 3SJZA 4EX6A 1TW3A 1IOLA 3SHTA 2RB4A 2ZAMA 1U7DA 3GDFA 2FZVA 3FPSA 4P2GA 5BXQC 5HJEA 1XHFA 5I7EA 1BXGA 4YPFA 3THWA 2VPWA 2SECE 2ZE7A 3QHPA 1UFKA 4ARZA 3K70C 4WGGA 1ECBA 2I55A 8GPBA 4OXYA 2C2KA 4NYMQ 1TCAA 2BP7B 1GZSA 1NBEA 2GEVA 2G71A 1RWBA 3C3KA 4J43A 3KD2A 2ZYTX 1F0YA 3QYJA 3W4IA 2Y1GA 3QF4B 1D1PA 4XEHA 1YF3A 2GEUA 2BHSA 5EZSA 2A0FA 5DYNA 4HVTA 3CN7A 2GS9A 3FIJA 3IHWA 5AXAA 4AG3A 1IIRA 4LCBA 5FPSA 4FHEA 3ZU3A 4EMUA 1JEQA 3K8YA 1NUUA 1XCLA 2BKEA 4F9TA 4YAGA 3THWB 2EP7A 2WD9A 5ER6A 3VOSA 5DP1A 3RWMB 4Y8VA 1RLUA 1G4UR 2QE7D 2V98A 3R1IA 3ZCSA 1XZGA 4MLDA 1K6EA 2B2CA 4GMXA 4QDKA 4RIIA 3U19A 4KZKA 4BPBA 2GD0A 4GR9A 5ESDA 5ALUA 1HEIA 1N1EA 1FTQA 4DCVA <