4CMMA

Structure of human cd47 in complex with human signal regulatory protein (sirp) alpha v1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
117
structure length
117
Chain Sequence
ELQVIQPDKSVLVAAGETATLRCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVRAKPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polymorphisms in the Human Inhibitory Signal-Regulatory Protein Alpha Do not Affect Binding to its Ligand Cd47.
pubmed doi rcsb
molecule keywords TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE SUBSTRATE 1
molecule tags Signaling protein
source organism Homo sapiens
total genus 24
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cmmA01
4O5LH 5GRJL 1NANH 3H0TB 1T4KB 3M17B 1L4IA 2QHRH 4ZAKD 1I8KA 4YO0B 4D2NA 2CLZB 5KANG 3ARBC 3L5HA 2PYFA 1MFEH 1U8NA 1VPOL 1K8DA 1U8KA 2HLAB 1R3IL 1AD9B 5F7WC 4DQOL 4QRTA 5IBUG 2YWZA 4MJ5B 2BOBA 4LIQL 4JM4H 4PJEF 2NY5H 4M3JA 3R1GL 3T2QA 5I19L 4LKXB 1JF1A 1KB9K 1M7DB 1VEPA 2XTJB 4Z18A 1IC5L 1RURL 4OZHF 4N0UA 5C0IA 1I7ZB 2PN5A 3BRFA 3UC0H 4LCUB 1P4BL 4U33A 3QIWA 2FGWL 1RZ7H 1E28B 2WP3T 2F9BT 3RIFK 3TIEA 4U0RC 1KIQA 2YSSB 3PGFH 2HFGL 4XAKE 3EYFA 2DBLL 4QCIA 5F7NC 4PJDE 4DVBA 4WFFD 1YEHL 1W72A 1C5DA 3REWB 2ZUSA 3RL2B 2JCCE 1HWHB 4M6NL 4HUUA 4Z7WF 3IFLH 4UINL 2FBJL 3TBVB 2VDKL 3FFCB 2CK0H 1MCJA 1IZKA 1AGBB 5I1DB 4RAVB 4X6CF 3W11D 5JHDE 2CRZA 3ZE0F 1FL5B 4JEGB 1T66D 3SE8L 4C54A 3WFZA 5HGHA 5DJ2B 2ZKHH 1KYOK 3ARGB 2EIZB 2AP2A 3CFJB 4QO1A 1BFTA 5GSRA 2Y5TB 3U0WH 3FO0L 5EORL 2Y6SD 2C26A 3HI5H 5CSZB 4JRYA 1FJ1B 1FL6B 2NW2B 5EO1B 4YXLH 1BD2A 5DHYB 2V17L 4F7CA 3V4UH 3L3IA 4C56E 5EBWB 3ZE1E 4NM4H 4OFYD 1DSFL 1KN2H 2NTFB 4X4YA 4M61A 1HNGA 3DETD 4HJJL 1PSKH 2NY6B 1NPUA 3QEQA 1AO7E 4WU7B 5TDOB 1LEGA 4KAQL 5ERWA 1XIWC 1Q9OA 4DKEH 4LLMB 4EZMA 4MJIA 3U30C 2HJLA 2JB6A 4LU5L 5ESQB 1E4JA 1HZHL 2R2EA 1WGOA 2ATKA 4JDTL 1Q9WA 5T3XE 5TDPB 4MA3A 1INDL 2ZUWA 4WTZG 5FO8B 3VJ6B 4YXHH 3BKCH 5C71A 3O6KL 1IQWL 1N59B 2A6IA 5EDXA 4ZOEA 4TOYH 5AG9A 4OGZA 2HN7B 5JXED 3DYMA 4TQEH 3QDAA 1JF6A 5GZOD 4KMQA 5IFJA 3B43A 1N6VA 4XMLH 4PPTA 3VFPB 1L9NA 3EO0A 1CDUA 1ZEAL 4NYLA 3VMNA 5ITFB 3G9VA 2JJTC 1I8MB 2ICEB 3GSNH 5B4MD 3F58L 1CGVA 4NNXA 3X3FH 5J12B 4XH2A 1W0WB 5IMLA 4LCWE 3ZZ1A 1AKJA 1S7UB 5D5MB 1NKRA 2PUQT 5DWUL 5FDYA 1TNMA 2J4WL 3QB7C 4FQXD 4X7DC 5DI8B 2AXFA 3KYMB 3P4NA 1TJIH 4LSSH 5MEPB 4LARL 4Y19E 2OJEB 2G60L 2PW2A 4WJ5A 5EOQL 3D2UB 4IOIA 2MQ3A 4MDJA 4MQTB 4RZCA 3U7WL 3C5ZC 3BO8B 4JR9L 3V5KB 5ANME 4WI6A 1OD9A 4L4TE 4UT6H 5C2UB 3MX0A 1CT8A 3X14A 4PJBA 4L3ED 3CSPA 3S5LB 1I1AA 1MNUH 2DQTL 1MFDH 1G7LB 2CDFA 1JPFA 3O9WA 4I5BB 4OD2B 1KACB 5EU6E 5J7CC 2YPLE 4F7MB 1S7TB 2OM5A 2VABB 1RHHA 3DXAE 2X89D 1HQRB 3A0OA 5T1KB 4LL9A 5I1GL 5J3HC 5GGRB 3BN3B 4ODWB 1XGTA 4HWNA 3S35H 2Z8VC 1G0DA 2YEZA 2DQFB 3WDJA 3ZYOA 1LO0H 3I02B 4FFZH 1WBZA 1CGYA 1J5OH 3V0AC 3VD3A 1JGDB 3P40A 4KK5C 3RWFB 2YUZA 2WWMC 4YHML 1UWXH 5E8OA 3R8BB 5C0DB 1GZPB 3RY5A 5C0FA 3HZMA 2M2DA 2BVQA 2J8OA 2PCPB 4HGWB 4JB9L 2GTWB 4L5FH 1LE5B 4ETQB 3BT2L 2VWEE 4CGTA 3LVEA 4NRXB 4G6MH 4D9QE 1MHPL 3IJHA 1F4WL 5TE4L 4AENB 1U8OB 2EEDA 2X70B 1AXTL 3HNTH 1Z2KA 3X13A 4MCZA 4BZ2L 3JSSA 1U8IB 1IRAY 2F58L 3AFLA 2APTA 3QXDB 2BRRL 2R56L 3D0VA 4ZAKB 4IMLA 1AGDA 5GGQL 1TZHB 4P2QE 4JGJA 2R29H 3CPLB 3CFKB 4LLYA 2YRZA 4K7FB 2DN7A 1Z9MA 2BVPB 5C3TA 3ARDC 3IU4H 2A83B 4PR5B 4U1IB 2ESVD 4BZ1H 1KCUL 1TETL 4HULB 4WFED 3MXVH 1P2CB 5IT2L 4X4ZA 3OWEA 2V5MA 1NL0L 1IGIL 1Z9OA 1A21A 2EDFA 2A6DB 1IQWH 1UYWL 3MGTB 4NPYB 4OZFH 4DGVH 5J8OA 3BH9A 1J7VR 4JN1L 3BMWA 1MCHA 5DYOB 3OKNA 5MENE 4OLVH 5M7QA 1HI6B 4KZDH 3MV9A 2CMRL 2VO5A 3HMXL 4XNQA 2X44D 2L4OA 4KKBC 4UU9B 1TZIA 3KXFE 5D7SH 3VXQB 3SO3C 1RV6X 1ADQA 3PGDB 1V5JA 3M8OL 4MNQA 1DTUA 3UTTA 1G9NC 3MOAL 2WWKT 3N1PC 5DHVB 4D0CB 3RX7A 4WHTB 3GSOB 3QCTH 3SDXA 3C5SA 4YPJA 2DQDH 4NCC1 1JYNA 3OZ9L 2IQAB 1IGMH 5K9QI 4K3DL 1S5HB 3AVEA 2YD4A 4NQEE 3P0GB 1TZGL 1NCCL 4TSAL 2WLYA 4JHZA 3RGVC 3KPSE 3MFFA 1QNZL 4E0RB 1CTOA 2FECI 3QPXL 4QOKE 3GK8H 3IGAB 4OGAC 1LP9E 1U42A 1WT5A 3MV7A 3WHE1 5TGBB 3JVGA 3DHJA 4YFLI 5ILTL 1G6RL 3VFGH 3TCLA 1JBJA 4GAFB 4H0IA 2I5YL 2DS4A 5D9SB 1CLOH 3CZFB 5CEYA 3FO2B 4P46A 1JZ6A 5GRZA 5CGTA 1M7IA 2UWEE 4NHUA 4ORGA 3A6CL 32C2B 4P2RE 1QUNA 2VISA 4MGXA 3GGWA 1A0QH 4MJ4A 4QTIL 2JB5L 1ETZB 1T83A 2VJXA 3ZYIA 1XEDA 2GSIA 4FN0A 3RZWA 1C5CH 2NW3A 5E9DE 1GJIA 3WS3B 4U1KB 5TE4H 1AJ7H 4UTBL 5I74C 3T2NH 4NKQB 5K9OA 1G7QA 4JPIB 4XPFL 4HEPG 1G0YR 3RTQD 4BSVB 1OGAD 4N1EA 5DRZB 1EFXA 4GS7C 1NDGB 4PRPE 1DQQB 4V1DD 1IBGH 3HRZB 2J6EL 3M1BB 4NFDA 4UB0H 3T0WA 4WHYG 2RGSA 3LY6A 1IGYA 3LMJH 3WO4C 3ULSA 2V9TA 5E8DL 3P0VL 1PJ9A 4KRLB 3WJLC 5HHVL 4Y5XA 3HB3D 3HG1A 4QWWD 4JHBA 1MAML 3DI2B 5EB9A 3DVGA 5JXAL 3VXMA 1JV5B 3TN0C 4HIJA 2XZQH 1CGSL 4ZUUB 3OV6A 5BJTB 2AK1L 3EYQC 4KMTH 1U8QA 1AP2A 3D5OF 1YC8A 1OSPL 1NCWL 5E6YA 1DQDH 5JNYA 3HE7A 4IDJH 3LRHA 3QUYD 4L3EB 3MRFA 5C08A 3HA0A 1N5AA 3DBXA 3REVB 3CK0H 1EO8H 1MCRA 3QHZL 5KSUA 1BHGA 3QG7L 5C0BB 1GOHA 2A9MH 1ZHLA 3PABA 4Y4KC 4XNZB 1IE5A 4XWGH 5HGDA 5F9JB 1TPXC 4EI5D 2E5EA 3ULUH 3P9LB 1KIPA 2HT4D 3B9KC 5EFIB 4OCNC 3PHOB 2I60H 3BVNB 3C08L 5C0RH 2B0SH 2NR6C 4UOJA 4AEHL 3VG9B 3W0WE 4ZODA 2QQKH 1AR1C 3CLFL 1IKFL 3RA7H 2V2XA 5IGXH 4WTZA 5GZND 4GLRI 2MCPL 4KGJA 1RJYB 4NQDA 3STLB 3TWCH 1N3NA 3OXRA 4NQXB 3STBA 2WIIA 2RJMA 1QRKA 1NLBL 1T03L 1I1FA 2GUOA 4Z5RA 2FX7H 3LKRB 3QQ3B 4TTGA 3ULVE 5D7JA 1RUPH 2AEIT 1G7JA 2AABL 2O5YH 4XMKL 4Y1AD 4NN6C 3QH3B 2AK4A 2CUMA 4QRUA 1JTPA 1KNOA 3S8WA 5AZEH 1UJ3C 4NGHL 2ZSVB 5DRXA 3QNZA 2UY7A 1VFAA 4MQ7A 5TQ0H 4LEXH 4EIGB 3VXSD 4OZGA 1LDSA 4PJ9C 2ESVB 1DUYA 1TMCB 3HZVA 2A6KB 2A9NH 4KI5C 4Z78B 1CF8L 1YEDA 4M1CC 1CL7I 1QFWH 4PJ7B 3ELAT 4Z7NF 5L0QC 2WINB 1NEUA 4L8CB 4OF0A 3BGMA 4HKJB 5ALBL 3MLZH 3GMLB 1KJMB 5F7DB 1S7WB 3K74B 5E2TL 5MERB 4POUB 4ZO6A 5DMKA 4NKDA 2BHYA 2PR4L 1BEYL 3H3KA 4PRBA 2AVGA 4OZ4B 2CIKA 4JO4L 2DLTA 5EBLA 1TQBC 2X4TB 3FCTA 3O8XB 2E7CA 3ORJA 4PTTB 3EYSH 3V7AE 3BKJH 1FDLH 4U1LB 5D8JL 4H8WL 1I1YA 5HTSA 3KLAA 4HPOH 4JFFA 2NXZC 1ZHBA 3FQNB 5DEFA 2F5BH 4OM1L 1FYHB 3CFEB 3WXWH 1LO4L 2Z91B 5J9PA 3ROOA 1R3HA 4C55A 1R5VA 3BEVA 3RDTC 3NIFF 4CVXA 4WWKA 1ACZA 3SJVA 1AC6A 1T89C 3C2AH 5J1TC 4YFLF 3O3UN 1FFQA 3I2CL 4JFZH 3O2VH 3ECBA 5HD8D 2C3GA 4QHLB 3QIUC 3L9RA 5BZDB 5I73B 3P4OB 1FZJA 5L7XL 3C87A 4YHZH 1OAQH 1CK0H 3B8YA 3CXDH 4JQXC 1QD0A 3W39A 5GIRB 4Z0BL 3QXTA 4XAKD 3VGAB 4HKBA 3BGFB 5E94A 2B4CC 4APQC 4HUXA 1DBML 3RVUD 5JZ7C 3MRBB 4LSPL 4POZC 1J0KA 4F2MA 1IC1A 3RWHB 4EN3C 2PYEA 1JCKA 5LVEA 4UV4L 2DMKA 5T3ZH 1NLDL 4AEHH 4NUJB 2KPNA 4Y4HB 4QNPE 3V8OA 1VEOA 3NVQA 2CKBA 4DTGH 3DX9A 4RGNE 2AAVA 4LLQB 3Q48A 1EGJA 3DX8A 4ZFFA 4U1SA 4Z7UB 4OGYH 3FOMB 3GMRB 3RHWF 3C60D 4M8VA 3Q3GA 1PKQB 4PGEB 4QXWA 1G7MB 2XKSA 4EDXA 3TBSA 1QSFA 1JI2A 5EZIH 2JF1A 4GXUM 3TBYA 2DMCA 3QXAB 4ODHL 4C56D 3GJFH 3AS3A 2DB8A 2Q76B 2NY4D 2PTTA 3VFVB 3RTQB 4LGSB 3RI5K 1OGAB 3CUPA 5EIIB 4RBPK 3ZHKA 4KDWA 3PV6B 5IFAL 2QL1A 3EDKA 4PGDB 4NOFA 5D7LA 4V1DB 1AO7D 2GTZA 4HUMB 1U95A 3O45A 4W81A 3DO7B 1MOEA 1MY5A 2EICA 3MBXL 4J3VA 4PD4J 1AGFB 2C9AA 1KV3A 3UYRL 4HCRL 3HI1A 1UM5H 3RKDD 5T3XD 3NAAH 4NIKB 1WAAA 5F1OB 5C09E 1KSRA 3RNQB 5JMRA 1BECA 1CICA 1UZ6E 4ELMF 1KJ2L 3SDYH 3BPLB 1MHCA 1FV1B 4JLRA 3QUYB 5IMMB 3P73B 4JANA 1OOAA 4FXKB 1NCDL 4HFUH 1B3JA 4MD0A 3C5ZA 3OJDB 4AL8L 2VZSA 4JFYA 3TO2A 2CKBH 3MRCA 2EDOA 4PGBB 5F8QC 3SHSA 3T3MF 4R7NA 3FZUC 4FFWD 2HTLD 2XZCH 4EI5B 1CDYA 1NJ9A 4ZSOE 3HE6C 5B39B 2FZ3B 1E6OH 5IVXB 4J3TA 2UZXB 3UAJC 1NCAL 2A74A 4PP1C 4Y19D 1A7RL 1U6AH 2J5LB 3BDBA 1NCBL 4MA8L 3F5WB 4KTDL 4X6DA 4W70A 4WGVB 4U1JB 1WZMA 1QTYT 1SYSB 4LRIA 3HLAB 1PEWA 4I4WA 4YH6A 4I3RH 2R23B 4NRZB 2Y06H 1YQ2A 4TTDC 3U9PL 2B1AH 4L4TD 4ZS6C 5J11C 3D6GA 1OM3L 3EFDH 2VLJA 2P8LB 3NOIA 4WU5A 1YZZA 1MELA 5EU6D 5DVNA 1Q94B 2YPLD 1YN7A 3KPMA 5EU7C 1TQCB 2OI9C 3U0PB 4Y1AB 3DXAD 3UBXB 4S1SH 1RIUH 3LKSB 4HS3B 4D3CL 4BQ8A 4NT6B 2AKRB 1KB9J 1GAFL 1KT2A 3UX9B 3VI3F 1AD0A 1IM3A 2CUIA 4YC2B 3GB7A 1INEH 4OFKA 5TQ2L 3VXSB 3TYFB 4LPCA 4M9OA 5FO7A 4OCYH 4UT7H 1FYTA 3R0MA 1S9YA 4JPKL 2PXYC 1LMKA 4G3YL 1ACYH 5E1AA 5IP4A 5FYLL 4MD4B 1JPSH 3KPOB 5I8EB 4F37K 1IKNC 3I9GH 4FQPA 4QRRE 2Z8WC 3ARDA 3MLXL 4Q9QH 2BY3A 3ARFA 1GGBL 1MRFH 5AEAA 1UB5A 4RDQG 4PJXB 1EHLL 5KSBA 4LPUA 4ODHH 3QDGE 1DP0A 4D9QD 1AQKH 2W07A 4PUBH 4XRCA 5EOTB 5HI3C 4H26A 3SKNB 1J8HE 4OGXH 4AM0B 4XPHL 2ARJQ 4NOBA 4X8JA 7FABL 4X9GA 1L7TL 5HPMA 1L7IL 2DYPA 1RULH 3PWPE 4IIQC 1RZKH 3WL9A 3NFSL 4BH8A 4N0CC 4ZTPH 3DV4A 3GSUB 1FGNH 4FA8A 4NJ9L 4P2QD 3L3DA 5KZCD 1FO0H 4JE4B 1GIGL 5IQ7L 2P48B 3O4OC 4LVOC 4L8BA 3D39B 4PS4H 1SY6L 3ULUE 3UO1L 4M1GH 4XP4L 3SCMD 1NEZG 1LQSR 1EPFA 5CWSB 1QHPA 3DIFA 5I1AA 4WHYH 3T77B 3VRLE 3S36H 2N56A 3VGFA 12E8L 5LAXA 4G80B 2PF6A 5EUOA 1F11A 4YXKH 3JWDC 1AR2A 2QSCL 1GH7A 3G5XB 3BD3A 1JRHI 4UIMA 1Z0MA 1NMAH 5MEND 4WW1B 3QIBC 4QXGL 4LSDA 4PJDB 2F5AL 1V7NH 2YWYA 4PYHA 4JFQB 3VCLB 3TO4D 2BDNL 5CBEB 4K9EC 4EIZC 5E2VH 4NQCA 2JCCB 3KXFD 3BKYH 3SKOB 1JHTA 5L6YH 4XBPA 3MQIA 1FL3B 3UPAA 1Z3GL 3K8MA 1MIEH 4N9OB 1LEKA 2ZJSH 3B3IB 4PBXA 4EI6A 3AREC 5JHDB 4QF1A 1T22B 3V4VH 2I9TB 35C8H 3QR2A 4PRHD 3QDJA 3L3HB 3TA3D 2DTMH 4LLWB 4NWTH 1I8LC 4C83B 1F58L 2K1MA 2AJXH 4NFCA 4PYGA 5KVEL 1RU9L 4JKPH 4NO2A 3C60B 3ME0A 1HQ4B 4NQED 3L1OH 1T20A 5D1QD 2OBGA 4X5XB 2XRAH 2JTDA 3PWJB 1NGYA 1Q9KA 1BF2A 4JFDA 5KJRL 3KPSD 3MV11 1HYSD 4C56B 4F7PB 2DD8L 2HJKB 4QOKD 5IEKB 4U6HB 1SBBA 3BESR 1QZ1A 4L1DA 2PO6D 1IAIH 3SGJC 3WFCL 4PFEA 4HZAA 3HZKA 2DTSA 3EOBB 3T2PA 1AO7B 1T5WB 2R0ZH 2H2PD 1JHLL 3MLRL 1WZ1L 2LFGA 3I50H 1JFQH 4WCYL 1IARB 3KPPB 4I0CC 1IEBB 4MA7L 4P2RD 5AWNH 5KVDL 3B9VA 1OAXH 1H3XA 1EMTL 1E4KA 1EO5A 2Z9TA 3PNWA 1UEMA 4FFYL 4JZOA 1U93A 4QKXB 4P5TD 3VGHA 4KZEL 5BOZG 3MLUH 4RMRA 4WUUE 1NAKL 4GKZB 5E9DD 3DSNA 3B5TA 1ZT7B 2FH6A 4P2YA 3TN0A 3WLBB 5F7HA 5TDNB 2BC4B 5BV7C 1KJ3H 4OLZH 2G9HB 4NC1E 4OZHA 1J11A 2BVTA 1P9MA 1FH5H 2FATL 3DUSA 4RGOH 5DJ0B 4U7MA 1KPRA 2KZ1B 2HT3C 4Q9RH 2HG5A 2EYSB 4LCWB 1ZS8A 4PRPD 2Q8BH 5FO9B 2GK0B 1Q72L 1X7QB 2NY6C 4DZBB 2DMBA 25C8H 4LEOA 1LDPL 3I6GB 4YWGH 3FN3A 4I0KA 2R0WL 3EOTH 5HHNB 3N0PB 4Y19B 4MS8C 3MA7B 4PJ5A 2GQHA 1B2WL 2GJ6A 3U46A 4OLWL 4Z7WA 4NKMB 5AZ2L 4Z95H 5HYJA 3MV01 5T3ZE 1MHEA 2P1YA 1N64L 3MRJA 1RQ5A 2VXTL 3B9KA 2F54A 1MI5A 1ONQB 3D3VA 2W60B 3WN5B 1RVFL 1SYVA 5ANMB 1SJVA 1BFVL 1N5YL 4KVCH 3NFNB 3IKCB 2RQ8A 4L4TB 3C6SA 3OTTA 1K2DB 1JNLL 3DGGB 4WTWA 3GSVA 2W9EL 3LV3A 5B8CB 2IH3A 2Z35B 1W72L 3MFGB 5EU6B 5INDA 5IJVB 4MCYB 3OHXB 3NCYP 4XI5C 3DXAB 1BQHB 2XTLA 1F3JA 2LVCA 3GHEL 1XF4A 1MHHA 5BXFA 4HJGB 4NNPL 5J12C 2V9RA 4YR6A 4RWYH 4FP8H 1PQZA 3GSWB 3VDBA 3WKML 2AV1A 3LPWA 4XP9H 4P23C 3W0WD 1X5JA 3T08A 4DAGH 1YEGL 4CL7A 2X9YA 2AI0H 4MYWB 3L5WB 3WHXA 5DA4A 5E99L 3F6LA 1DQLH 3PWVA 1EEZB 4ZDHA 4FG6D 4PJCA 3B8SA 1L0YA 4PJ9A 3IRZA 3RIAK 5FV1L 2VYRE 2L7UA 4N5ED 4TVPL 4GOSA 5EBMA 2F15A 2AJ3A 2BMKB 3OKKB 5DS8B 5EIQA 4G8GA 3W5NA 3BRGC 1BLNA 3ULVD 4LCCB 4EUPH 3GNMH 4PRDB 3DUHA 3OKMB 5H8DA 1NUFA 3AS1A 1GHFH 1JYWA 4YDKL 3GMPB 5GJSL 3U4EB 2JIXA 2A77H 1EZVX 3ETBF 4P2QB 5KZCB 43C9A 4QRPE 4YHKH 1IGCL 2NY1D 3OG4B 4RFOH 1ZA3A 3PL6D 3QDME 3VA2C 1OB1B 1E4WH 3I6KA 3NGBB 4AMKH 3FHAA 3F12A 2FR4B 2BSRB 3GKWL 1PG7H 1YYML 1N26A 1ZK9A 1A1NB 1TVBA 5C92A 5MP6L 4QRQB 3MRRA 1A2YA 5DD1H 1VERA 1MUJA 1F97A 3BAEL 1MLBB 3TLRA 5MENB 3H9HA 1RJZA 3QIUA 1D5XB 4NWUH 3QAZC 1J1PH 3G5ZB 1D9KC 3C8DA 2WUBH 1I9IH 3QO0B 3RPIB 4FZEH 4HC1H 2HP4A 2D31B 2HWZH 1CGUA 2O26U 3TO4B 2OL3B 2FWOA 1BM3H 5GS1B 3HS0B 3KXFB 4CU8A 5K9KA 4KHTL 1B0RA 5E03A 2IALA 4XPGL 4ZAKC 2E6QA 5C7XH 5JLZA 4FQ2H 4GMSH 3SDDD 4E5XA 1NCTA 1OCWH 2VH5L 3AB0B 3MREA 3T3PE 3NTCL 1P1ZB 1A3RL 3TA3B 4IMKC 4EN3A 2EDKA 3LKPA 4AH2B 5DXWA 2MOVA 3BYYA 4NQEB 5AD0B 5D1QB 4NDMB 4NP4H 3MR9A 5HGAB 2AJSH 3K46A 4LMQI 4FXGA 3KPSB 4L4JA 4NN7B 2D9CA 1CIUA 3DO3A 3MACH 4QOKB 3MNZB 2WBJA 2HRPL 5L88H 4CW1A 2Q7NA 4KWUA 5L2KA 5EU5B 2PO6B 2DICA 3QFJE 4L4VE 3AAZA 1NDMA 3DYOA 3BPOB 3P9MA 4WY7L 5H2BA 2ZCLL 4K8RH 2QQLL 3EGSB 3UJJL 1AHWC 4NKOB 1YMME 1U91A 3FB5B 3DWTA 4YPGA 3C8KB 2V7HA 2XN9E 4I13B 2UWEB 4HS8L 2ARJB 1H15A 4LCYA 5I1IL 4PY7B 3MRKB 4JZJB 4E41B 5IVXF 3DURB 4GW4B 4P2RB 1A3LH 3W11C 2XNAB 4OD1H 1FNSH 1NEZA 5DC9B 5E99H 5IG7A 3ZSTA 2V2WA 4RGND 3VRJA 5HDBE 3OJ2C 4P5TB 1I9JL 3QULB 1W8OA 1FIEA 1ZVYA 4QYOA 5E9DB 3QI9D 3QEHA 4W4NA 4YX2H 3G5VB 1R0AL 1ND0B 5DQJB 4OT1H 1AXSA 1CFQA 3VMOA 3BJ91 5IMKB 1A6ZB 2VLKE 1CTNA 4MAYD 5HHPA 3MRHB 1NGWA 3BPCA 1CGWA 4PLKC 3GM0A 1PLGL 2ZZUT 5E1HB 4YHIB 1A5FH 1UZ8A 4PRPB 4ODSH 4DK6A 1HKLH 3MODH 2FB4H 1LNUB 3BEWA 3S5LG 1IM9D 1IAIM 2ID5A 2C3VA 2B1HL 1GRWA 5TH2A 1FC1A 2ZG3A 3C9NB 4YQXL 5DK2B 4DKAA 5D96C 2VB5A 1TITA 2BOCA 1L0QA 1S5IL 5EO0A 5J13B 3HE6A 5C09D 3C09B 1LE9B 2WIMA 4IRJA 4D0BA 5LGHL 2EZ0C 4DGIH 4UNTA 1ZHNB 1I8KB 3VRIA 1HSAA 2HVJB 5DA0B 1ZSDA 1QA9A 2D9QB 3SDCD 4WEBH 4U1HB 2YPKB 3VW3L 1HIML 5ACLA 2UUDK 2CLRA 4XX1E 5FYKH 2EDWA 1ADQL 1YEIL 2ZCKL 3VFTA 1QRNE 4K3JH 4G43A 1BJ8A 1ZLWK 3T0EE 2OJZH 1V7ML 1A1OB 4RNRB 5BRZE 1MFAL 5FM5O 4WHDA 1HHJB 1L0XA 4NRYA 2L7JA 3O6LH 4N8PA 4NBYB 1WTGT 4XNYH 4Y2OA 4PJGA 3W0WB 4E9LA 2VERN 4HDIA 3FRUA 3O6FC 4Y0GA 5EU4A 4KK8D 5DSCB 4NQSA 1J18A 4JVWA 1PZUB 1KENL 5FYLE 5EZLB 2AEWA 1KULA 2OZ4A 3UEZA 5F9OH 1ZLSL 3VFRA 2VDLL 3F8UB 4E42A 2BVUA 3PHSA 5C0CE 3O2WL 5FIEA 5BVJA 5JW4Q 5DMIL 4FXLA 3LKQA 3OMZA 5I75B 4OSUL 3IVKA 5ID1B 4AEIH 2EKSA 2YD9A 3I85A 3ZMRA 1K5NA 3IB4A 5IHZA 3JBG7 4PJDF 3MZGB 4S2SA 3LB6D 1MRDL 4M6MH 3GEWB 5FECA 3FQWB 1DBBH 3GSNB 1F3DH 2O5ZH 1DBJH 3FB8B 5HDLA 3RVTD 4XNZC 3N85L 4M6OL 3D25A 5A3IC 5J57B 2IPKA 5CMAA 3NN8B 3PL6B 5DRNB 1D3CA 3DSFH 1SEBB 2VXUL 1D5IH 1SQ2N 3DVIA 4P5KB 3Q6GL 1QSVA 5E24E 4X6FA 4QRRD 3I84A 3UDWC 4NM8L 3S4SB 1I9JH 5GGTH 5DD0L 2ZUQB 4XMPH 3ZKXB 5MHSE 4ORZC 5GPRA 4ZTOL 3LS5L 3QDGD 5I71B 3CCHB 1ZLUH 3TZVD 1QFPA 4ONHA 5DTFA 4YK4C 2UZYB 1J8HD 3LDBC 1UC6A 4J12A 2XWTB 4Y5VB 1JNHA 3ZE1F 4CU7A 4GKNB 2F53E 3PWPD 2X4RB 3QCUH 5CILH 4D0DB 1T2QH 1FGVL 5D7IB 1O7SA 4IOFD 2AJUL 3QIBA 4PB0L 4Q7DA 2IBBA 1C16A 4PJEE 3Q2CA 4R7DA 1KFAH 3MOBL 3T0XA 2CH8A 3UPRB 4X0KB 5C9JA 1OGTA 1NC2A 1HK6A 1DE4B 5K9JL 4NQTA 3ULUD 3LZFH 1KCRL 4F9PC 5IHLB 3H0TA 4PJFE 4WI3A 5DJ6B 1T4KA 3M17A 4F7TB 1MJJB 4DW2L 3EYVB 2QADC 2VL5B 4J3UA 4YO0A 4D9LL 2CLZA 1MCNA 5D72L 2DLGA 5BVPL 1ORQB 3PP3K 2HLAA 4XCFL 1AD9A 2FJGB 3Q6FB 4S1QH 4ZD3H 3GMOB 4YIQB 1I8LA 1J0YA 4MJ5A 3WD5L 3GIZL 1T1ZB 1U3HD 3FN0H 4L8DB 3F7QA 3CVHH 3R06B 4DEPC 1YEJL 4LKXA 5IW3A 1M7DA 4GH7B 4GG6F 4FQCL 4HT1H 2FX8H 5IQ9B 2VZ3A 3BWAB 1H8OA 3O8XC 1I7ZA 3FHQA 2FLBT 4X6CE 4C58B 2K7QA 3LD8C 4KY1H 4LCUA 5KSAD 4BJLA 4KVNL 1E28A 1YQVL 4JKWA 3IKKA 5FOBB 2YSSA 4HBCL 1MFBL 1LK2B 1KLUB 3SGJA 2P45B 3AS0A 2AXGB 3IJSB 3P30L 2R4RL 3SDAC 4CVUA 3IAGC 1WITA 4G42B 1K4CB 3REWA 4LCIH 4N0YL 1JPTL 3RL2A 2APXA 4Z7QF 4RGNB 3T8XB 1LK3L 1S3KL 3G6JF 3TBVA 3FFCA 5FKAB 1QSEE 5JR1L 1IC7L 5I1DA 4RAVA 1CZ8H 4UV7H 2MWCA 3QI9B 1QR1B 2HH0H 4TPRL 1FL5A 5D6DC 2W65B 3JTSB 4CN1A 5IFHH 4OZFB 2HA1A 3ISWA 3VXNB 2ZCHL 1K9TA 5DJ2A 3ARGA 2EIZA 3CFJA 1R5WB 4MAYB 3FQTB 3QEGH 4LPYA 3K2UL 2Y5TA 4HV8B 2KKQA 3BGFC 4MX7B 5CSZA 5HHOE 1BJ1H 1FFPB 1FJ1A 1FL6A 3BQUD 3JWOH 3LQMA 5F6HJ 2NW2A 2J88L 2X5PA 5EO1A 1TJGH 5DHYA 1Q0YH 3R8QA 4XT1C 4B7IA 3X12B 1T0PB 5TPWL 2H2SC 5EBWA 1BQLH 3TFKC 1XGYL 1K85A 2NTFA 4TULL 5ETUB 2KDGA 3V4PH 1DVFD 1WUNT 4X9HA 2GW5A 4IRSC 4Y4HC 5CGYC 2H8PB 5C09B 3ARZA 1BQUA 3GMMB 5C6WH 4WU7A 5TDOA 3QRGL 3U36B 4N0UE 4MXQD 4WUUD 2Q8AL 1GPOH 3AXLB 4LLMA 1ZGLB 1FG9C 1M71B 3KHQA 1T0MB 4ZTOH 1OAKH 1IGFH 5DT1L 1I1RA 2R1YB 2VQ1B 5ESQA 3LOWA 3V6OA 2VZVA 4LQFH 1CE1L 3SDCB 2AJYH 3ARPA 5FDWB 2ADFL 5EZOL 5TDPA 3EW3B 3FOLB 5EOCH 5FO8A 3VJ6A 3ZL4L 1FNEB 1N59A 2OTWB 3OB0K 5E2UH 5H35B 1MF2H 3CH1B 5IK3B 3WFDL 3HCVB 3RTQC 2HN7A 2QQNL 4ZSOB 3E6FB 4OKVB 1QVOB 4MAUH 1HCFX 2SEBB 5DEGB 5CJQH 2X1WL 3VFPA 3RNKB 2NY7H 5I15H 2ITDB 5ITFA 1I8MA 2ICEA 2W0LA 1F3RB 5T3ZD 4ZS7H 4NFBA 1H5BB 4QWWC 4CMMB 1W0WA 3EHBC 4YNYB 2O61B 1S7UA 5D5MA 2XWJB 4M7KH 5SX4I 4JRYE 5FEBA 5DI8A 5IMOB 5E08L 3KYMA 4RMUA 5MEPA 2OJEA 1FE8H 4OM0L 3U4AA 3UTTB 5JQ6L 3MV8E 2YPVH 4J7RA 4YFEA 5B3NA 1XZ0A 4P49A 5DR5L 3D2UA 3SDXB 4S11A 3V5KA 3BO8A 5HDQH 4KGLA 3MZTA 1TENA 4JHWL 2CLVB 1F90H 2P46B 5C07E 3LPFA 4K3HA 3S5LA 2C1PB 5ITBH 4OD2A 4ODTL 4ZXBD 3MLSH 3QHFL 4I5BA 4X7SL 5SV4A 2Z93B 3RUGF 1F6FB 5IIEB 3QWOB 1S7TA 2VABA 4PRIE 5DD5L 1EGJL 1HQRA 2J5LC 1SBSL 3VFOB 2NX5E 3DMMD 5T1KA 3ZT5A 4QRRB 3G6AB 5GGRA 2Q86B 3BDYL 4ODWA 1ORSB 2XYCA 5GZNC 5AG8A 4JG1L 5CEYB 2DQFA 5FXCH 3VD5A 1U8HB 3I02A 3QDGB 2DQJH 4N90D 4Z7OE 4DUWA 2J1KA 3TZVB 5DJCB 1JGDA 5BZWB 3RWFA 4N1HB 2VOTA 2E9JA 2HTKD 2VDOL 3P9WB 2VISB 5C0DA 1CLCA 3LEXA 3PWPB 5C2BH 1TQCC 2PCPA 1LP9F 4HGWA 3EJYC 2MPAL 4PBWD 2GTWA 3TT3H 1EUTA 5I1CL 1LE5A 4ETQA 5FYKE 4NRXA 5M95B 3BW9B 2Q6WB 1A6WL 4QRPD 4QXUL 4WW2B 5HYSB 4XC3L 1WEJL 1U8OA 2X70A 3QDMD 1IJ9A 1IC4H 2IANE 4CVZA 1G7QB 5F6IB 1U8IA 3CVIL 1CBVH 2UWEF 5CEZL 3QXDA 4ZAKA 1CLZH 4KHXH 1Y6KR 1H0DB 1T2JA 2J8UF 1TZHA 1FVCB 1KCKA 2HLFD 3CPLA 3PDOB 3CFKA 3VFUB 2ZOKB 4K7FA 1NGZB 2EDYA 3FJTA 3QCVL 1O7VA 4YZFF 2A83A 4I0PD 4PR5A 4U1IA 2GT9A 4IMKA 3BI9X 3NH7H 4WFHE 1GC1L 3NA9L 5GGSY 1CE1H 1J05B 1U3HB 1Y6MR 3KWWB 1P2CA 1YEKL 3HC4H 2VXVL 4KDTC 3KJ4B 4Y8DC 1A9EB 2A6DA 4CBPA 1R5IB 3MGTA 4NPYA 1E27B 1NQBA 4UTAL 2X41A 2ITCB 3H3BC 2W9DL 3MLWH 2QV2A 2OMNA 5TE6L 4O51B 1EAPB 3WEXB 3IDMB 5GS2H 4X80L 5DYOA 1Z9SA 3ROLB 5C08B 3K8KA 2CSPA 4KJQC 3RWCB 1HI6A 5IJKC 2DIBA 3G9AB 5IOPB 4KK6D 4JO2H 1XR9B 2ENYA 2BSTB 5FGRA 4L9LB 4UU9A 4FFVC 4GLRH 2R69H 3VXQA 3PXHA 3QXVA 4X6EB 2C3XA 1QPPA 3PGDA 5E2WH 3EDDA 4HXBL 5DHVA 5HI4C 4D0CA 4WHTA 2XFXB 3GSOA 2VZTA 4R9HA 4AQOA 1LO3H 3QXWA 1JTTA 2NYYC 5C9KA 4P4KC 2IQAA 1W0VB 4TSBL 3LCYA 4PJ8B 1OWWA 3QFJD 4L4VD 1S5HA 4GBXC 4YHOL 1OTUC 5F7YC 5I0ZA 1HEZB 2N4IA 4XWOC 3BQUB 5DUMH 3RVUC 3SKUD 1H9VA 4DGYH 3HC0B 4HXAL 3L7FB 5EBGA 1YMMD 2YK1H 4E0RA 2OK0L 1CE6B 2XN9D 3S6CA 3O11A 4OFYA 3NA4A 3IGAA 2A0LC 4MB4A 1BJ1J 2VZ1A 5C6PB 5FM8A 1A1MB 1K6QL 2BSED 1F5WA 4WI8A 5TGBA 2EH7L 4POYA 1DVFB 1CL7H 1S8DB 1QFUL 1Q1JH 2AEPH 3CDFA 2IPTH 5BCAA 3CLEH 4QRUB 5D9SA 5A16B 5KVFL 3CZFA 2MCG1 1V3KA 3FO2A 4WUUB 4LHJB 5B39G 2YUXA 3OXSB 3RBGA 3R0NA 3C60C 1AE6L 3TVMD 1FLRL 5BOPA 2FD6L 4OKDA 1BP3B 2WK2A 3F7RA 4F57L 2VLKD 1ETZA 4P3DB 3CX5K 5CP3A 3TESA 2B2XH 4XCCH 3ULVF 1QOKA 5ADPL 2COQA 3HZYB 5JXEA 4O2CB 3WS3A 5DDHB 3RVXC 4U1KA 4NKDB 4JCLA 4JPIA 5DGRA 4JPVH 2EE3A 4A6YH 3ZE2F 1YYLL 3BX7C 3GHBL 1G9NL 4LSUL 4BSVA 3QJHB 5FYJL 3UBXG 5A2IH 1DL7H 4FQIL 5DRZA 1OTSC 1NDGA 1DQQA 4KKLD 1UM6L 3HRZA 5DMGC 5FOJA 1JZ7A 3M1BA 4M9PA 3RKDC 4JVUA 1DBKH 1ZLVK 3W5MA 3EO9H 3ROOB 5C0JA 5HYFA 2VC2L 4R2GD 2ICCA 3HKFA 4R90H 2EDJA 4LK4A 5CJXA 1EEYB 1JV5A 2VSDA 1HH6B 4P3WA 4ZUUA 5ICYB 5BJTA 1W8NA 3QWQB 4M7JL 3GJFB 3LEYH 4QGTA 5CCKL 1TTUA 4L3EA 5JDJA 5EN2B 2W91A 3T0ED 3B4NA 4Q58C 2NCMA 4F7EB 2NY3D 4NKIL 3REVA 3MA9H 5BRZD 5LWYH 2W0FB 4PJIB 3RZCD 1NFDB 1FIGL 2WM0A 5C0BA 3D1MC 4N1CA 3VG0L 2X89A 1A9BB 5KVGL 1AY1H 4HUXB 4H1LH 2I24N 4W6WB 5F9JA 5FYLD 3P9LA 5IHUH 2XA3A 1N7ML 2EE2A 5D1ZC 4JZNB 4ONGL 5EFIA 4RGMB 3WN5C 1QO3B 3PHOA 3BVNA 3FMGL 5LQBH 3PJSB 2KUTA 1C08B 4OD3L 5C0CD 2E9WA 3HMWH 3NZHH 1HH9B 4PJHE 4ZMAT 1WTLA 3QISA 2X4PB 4Z7VF 3ZKNC 4G7VH 2P5EE 5I1HH 4XVSL 1RJYA 3OAUL 3STLA 3DX9B 2EDQA 3E8UL 4NQXA 4Y5YC 2XG4A 4DOHE 1DDHB 4ALAL 4Y2DD 1JNNL 4U7KA 2OR8A 4QRPB 3SBWA 3OKEB 2Q3AA 4P2OD 4I9WE 3WDHA 3LQZB 1MCPL 2HT2D 3LKRA 3QQ3A 4Z7NE 3QDMB 1T1YB 1VGEH 3UPCA 4M48H 3QH3A 2BNRE 1KCVL 1QHOA 3VWKD 4QNPF 2ZSVA 1JPGB 2EEBA 4R26H 1WWAX 2J7LA 4G6JL 2F8OA 3B6SB 5D7LB 3ZKMD 5I1LB 5MHSD 2EKJA 2ESVA 1Z9LA 3S9DB 4OB5L 3V0WH 2A6KA 1MQKL 4Z78A 4TUKL 1FRGH 2VWEC 1ZGLP 1UWGH 4G9FE 4PJ7A 1I9RL 4PRNB 4I1NB 2WINA 4D9RE 4L8CA 5CJBA 1F4HA 3T04D 4HKJA 3RVWC 2F53D 3WS6A 2E27L 3GMLA 1KJMA 3NIFE 1S7WA 5MERA 1J1OH 4W68A 4M62L 1WSST 4YFDB 8FABB 2EYRB 5B3JE 4GRLC 4PJAE 1ITCA 3TJHD 5IROA 4OZ4A 2O5XH 1ZWIB 4K3GA 3AM8C 2APVA 4XP6H 3VH8B 4JO1H 2X4TA 4MD0B 5D70L 4LSRL 3H2WA 3MC0A 2ADJB 4PTTA 4GMTH 1V3MA 3U9UB 1JGVL 4U1LA 1E6JH 3NGBC 4ZUTB 3NIGF 1UM6H 3FQNA 1MEXH 3WIIL 3CFEA 1E0OB 2Z91A 1F6AB 1Q8MA 3ABZA 4HUWB 4GO6B 5JDSB 1BZ9B 3MLYH 1NBVL 3MYZA 2AEQL 3LH2H 2EDTA 3G6DL 1NSNL 2OXGA 3CFBB 5HGBB 4R4FH 1UFUA 4P9HC 4YUEL 3U6RB 5KW9L 1UKQA 1FVDB 5CLTA 4QHLA 3QFJB 1A4KB 4L4VB 4EDWL 2Z4QB 1OL0A 5BZDA 1KIRB 1MCDA 5F1KC 1D7FA 5DFWH 3P4OA 3GZKA 4KTYA 1KPVB 2P5WE 4NZDA 1K8IB 1YMMB 5ELIA 2VZOA 5GIRA 3EFFB 2XN9B 4K71C 3WIHL 5BO1L 3OR7B 1MPAL 4RFEB 5EZJB 1AH1A 1FO0B 1QBAA 2JELH 1EA9C 1NCUA 5IVZB 3H42H 3O0RL 2UYLB 5JOFB 3AB0C 3MRBA 1SVZA 1RUKH 3TA3C 1F4XL 3RWHA 4HF5H 3MUZ1 1QSED 1YY9C 3I75A 3P4MB 2IAMD 3D85D 4NUJA 4Y4HA 2W59A 3NCJL 3MYJB 4JJ5B 4U49A 1YA5A 1DEEA 2BXYA 4GQPH 1GGCH 2VLKB 4LLQA 4C59B 2HYMA 3OAUH 4MNGE 4Z7UA 5D1XB 3FOMA 1A7PH 3GMRA 3U48A 1PKQA 4PGEA 1G7MA 1ZHKB 3BE1H 5HHOD 4Q9CA 1DBAL 4EXPX 1UEYA 4RAUB 4NCC2 3BPOC 3QXAA 1A7OL 2X2YA 1J88A 4I77L 2XQBH 4JGMA 4GSDL 2PTUA 4M5YH 2HMID 2Q76A 5HPOA 2WP3O 3VFVA 3RTQA 2FX9L 4Y8AA 4M02A 4ELME 1BQHG 1OGAA 5EIIA 3PV6A 4PGDA 3X3GH 4V1DA 1MJ8L 2KQMA 4PGCB 3OPZH 4YHYC 3IDYC 3DO7A 2HFEB 1AGFA 1BGXL 2APWA 4NHCH 4XAWH 1R6VA 4G7YH 5J06A 4LHUD 1B0WA 1YJDH 2VDPL 3UTPD 4R2GB 2F19L 1JRHH 3RVVC 1MWAH 3T3ME 1CXHA 3Q1SL 2ERJC 1KBGH 1NMBH 5DJAB 4F80A 3RNQA 4DN4H 1UB6B 5I18L 1QRNB 1ZE3C 1FV1A 4QT5B 5HI5D 2B4CL 5ACMA 1F6LL 3QUYA 3RAJL 5GJTH 3T0EB 5IMMA 3P73A 2PYEE 4ZFOB 4FXKA 2NY3B 1KF9B 3OJDA 4MJ2A 5JIPA 1OWRM 5BRZB 1A6VL 1BBDH 4UBDC 3PHQB 3RZCB 1GZQB 4PGBA 4WW2F 2ZG2A 4FZ8L 5DFVD 1WZKA 1EVUA 5A40E 4K23H 3MNVB 2NZ9C 5J6GB 4EI5A 4HD9A 1E4XL 5J13C 3MJ9H 4JRYD 5B39A 2FZ3A 5IVXA 1RUAL 3VRLF 3RU8L 4YBQD 1LEKB 2QSQA 3IU3B 5IR1B 2I26N 3MV8D 1MLCB 3F5WA 5C0CB 4EI6B 4HAFA 5FUCE 1A7BA 4U1JA 1KEGH 4UT9L 1SYSA 1YNTB 4YHNB 3VI3E 4WFFE 5KS9F 5DMJB 5FA4B 4EDWH 2R23A 4NRZA 1OTTC 4JM2F 1VGKA 3B2UD 3VD7A 2DI7A 5C07D 3F7VB 1F8TH 1MIML 2X4QB 4M7LT 2P8LA 4P2OB 5GGRY 3E6HB 1J10A 2D0GA 1Q94A 2B5IB 4NO5B 3U0PA 4PRID 3GUTB 4Y1AA 3RIFF 3UBXA 3LKSA 2GCYB 4NT6A 5DJZB 3D87B 4LSQL 1RK1B 1UWEL 2NX5D 3FFDB 3VWKB 1T7WA 4MMZC 4XP5L 3QUKB 4RA0C 5CEZE 4H5SB 3BPNB 1WWBX 1D6VH 3VXSA 1FORL 1I3VA 3TYFA 1RAMA 3QUMH 3AU1B 1T21B 4DN3H 3MCG1 4MD4A 5DC4B 3KPOA 4XBGA 5I8EA 3GJEB 1VFMA 1P7QD 1RY7B 5I75C 4LVNB 4LNRA 1INQB 4PJXA 1CD9B 5FYKD 3N50A 2BFVH 4PJEB 3V9FA 3STZB 1ZVSB 5EOTA 1FSKC 4BK4A 4D8PB 1Q0XH 5ALCH 4NCDA 3SKNA 4AM0A 2IAND 4PJFB 3TH3T 1HHKB 3QA3B 5EUKB 1MCKA 4P59H 3GRWH 2CQVA 5DZNA 3GSUA 1NAMH 5EG6C 3WFBH 5HHXH 5IJKA 1BGXH 1G7IB 1M05B 1VENA 1EAJA 1MRCH 1A14L 5BMFH 2MFNA 4DKFL 4WFHD 2ZUQC 3ZKXC 5I1EL 4OQTA 5KOMC 1JYXA 4N5UA 1L6XA 5I71C 3TH4T 2FYYB 2XA8H 5CWSA 4Z7WB 1X6LA 1ZVHA 3T77A 2FHBA 4HUVB 5C6TH 3DGCR 3LRSB 4X6CB 4EUPB 4G80A 3VWJD 4R4NC 1UG9A 2C4FT 3AGVA 1HDMB 3HUJE 1YDPB 2BNQE 3G5XA 1K3ZA 1RIVL 2R9HC 4WW1A 4YHPB 5F71A 4WENB 1JMXA 1JF5A 4HW6A 3FB6B 4FQ1H 4PJDA 4JO3H 1X9QA 4XXCC 4ODUB 4JFQA 3VCLA 4LVHB 5CBEA 3IS0X 2JCCA 4HBQA 1IL1B 4K94H 2OZ4L 2IADB 3SKOA 2DM7A 2BY2A 2JE8A 3ZHLA 1MHHB 5TF1L 1QSEB 1FL3A 2WZPD 3GFUA 2ZOLB 2IAMB 3B3IA 2DLFL 2GY5A 2D0FA 5JHDA 2EH8H 1I3GH 1T22A 2OXHA 3O3EB 4XHJD 2I9TA 3L3HA 1J1XL 4DVRH 3KYKL 5E5MB 4NUGL 4LLWA 4XC1H 4C83A 4LOUD 3PP4L 5E70A 2ZPKL 2N7BA 4U6XB 5LCVH 2Q1EA 1AI1L 2JLLA 4OV5B 1DZBA 5IBLC 3C60A 5F3HB 1CDIA 4OAWB 1HQ4A 3EIFA 3UYPA 3H7LA 1SM3H 5HHOB 4X5XA 3PWJA 3BSZL 3QFDB 4X5LA 3E0GA 4OQTH 1YN6B 4OLUL 3VI4E 4ONFL 4S1DC 4C56A 4F7PA 2HJKA 3TYGH 3P4LA 5IEKA 1FPTL 4U6HA 3FO1B 3IXTB 5ADOH 4WUKL 1ZANL 2IFFH 2QJDA 3EOBA 1TCMA 4LASH 1AO7A 2NXYC 5E7FA 1T5WA 4CDHA 3TH2T 3S34L 3CC5B 4KQ3L 4MQXD 5HVHC 4U05A 5EUOE 1RZFH 4X8XA 3SY0B 4OFPA 2H32H 3KPPA 3O2DA 2IBZX 4LHUB 5A2FA 4R3SB 5JW5B 1IEBA 4F9LA 3VA6A 3KPNB 3QI9C 3F6IA 4YDLC 1D5MA 2AXHA 3JWDL 5E5RB 2C3HA 1MREL 2X4UB 1IMHC 1CGXA 1LHZA 4MAYC 3V52L 3QUXD 4PRAB 2FEDD 4GKZA 4TRPH 2VUYA 4GAGL 1HOCB 1P69B 1ZT7A 3QT2A 4JY6B 4K9EL 1FAIH 1MUJB 3WLBA 4YBLC 5TDNA 2BC4A 4KI1A 2G9HA 1UVQB 3B2VH 1N0XH 5DD3H 4Y16D 1MSPA 4XPBH 2EYSA 4LCWA 5JO5B 4KRPC 2FWOB 5FO9A 2GK0A 5ISZB 4MA1B 1X7QA 3KJ6H 4DZBA 3WMSA 6FABH 3I6GA 4LSTH 4KKAD 5HHNA 4MXWH 3BN9C 1TLKA 3HTLX 4FQJL 1QYGH 4Y19A 4FABL 3D9AH 3MA7A 3MV8B 4ZQKA 3VU2A 4A2LA 2GIYA 1TIUA 4NKMA 1QKZL 4M5ZL 5C8JB 1ONQA 2W60A 1I7RB 3WN5A 3NABH 5ANMA 3S4SG 3BKML 3NFNA 3IKCA 4L4TA 1HXYB 1DLFH 3O2DH 5C07B 1K2DA 3DYPA 3ZDXE 4LAJH 4LSVL 4OLXH 1OPGH 5B8CA 1OP5K 2Z35A 5EU6A 3DTXB 4NZTL 3RWIB 4OBSA 5IJVA 4PRIB 4MCYA 1YPZF 2XPGB 3DXAA 1BQHA 1KPUB 1UACL 5J1AB 3V7AG 1IZJA 2NX5B 4KV5E 3OKYA 5AYUH 3T3PF 4CUCA 4HJGA 1FBIL 4K3EL 4J4PC 2CJUL 2VXSL 4HIXH 2P43B 4OBRA 3BFOA 1AC0A 1A64A 2VUOA 3RPKA 2CRYA 3GSWA 3L3GB 1JHKL 4RISL 5KBNC 2QTEA 4PREB 4HS6A 4JFXB 3IDJB 4NJAL 5IW1B 4BH7B 3L5WA 5E8NB 4HX1B 1NEZB 4HWZB 4K7PX 1EEZA 2P5ED 4XBEL 4FQQB 1P4IH 2V2WB 1P7QB 1JUFB 1EFXD 3HR5B 1YECH 1EBPA 1OAZH 3LIZL 2BMKA 2GSGB 3OKKA 1CFBA 3ZDZE 5DS8A 4I9WD 3RJQB 4H20H 3ARTA 4LCCA 2IANB 4IRZL 1DUZB 3OKMA 2BNRD 4X98B 5I0DA 3OJVC 3WXVH 4IOSD 5C0EB 3GMPA 5E00B 3U4EA 3I3EA 3P11L 2BJMH 4P2QA 1SVCP 5IESH 4DCQB 3JVGC 1ZXQA 1CU4L 2WUCH 1CVRA 3FT3B 1NGPL 2ZNXA 4JKMA 2XOTA 1JGLH 1OB1A 3WNNA 1YEFL 3OKDB 1XF3B 4HWBL 4AIZB 2FR4A 2BSRA 1IT9L 1MREH 1YNLH 3RL1B 4D9RD 4OJFL 1A1NA 4KUZH 4QRQA 4Z6AT 2HKHL 5CINL 3HNSH 3T4AB 5SWZE 5L9DL 5SX5K 4UI2A 4MQSB 3VWJB 3HC3L 3L5XH 4KJWD 4M43L 3MUHL 1MFCL 2VXQH 1MLBA 5MENA 4OZFG 1D5XA 2PW1B 3G5ZA 1S7RB 4M93C 3QO0A 3RPIA 2D31A 3TO4A 2OL3A 2GJZB 4N0FB 5GS1A 3ULUC 1X5KA 4JKLA 3HS0A 1CIDA 3KXFA 1KTRL 3NPZB 3MNWB 1T0NB 3KPRE 2V5TA 3BP6B 1FZOB 5D2LF 2PETA 1P6AB 4KI5E 3S88H 2OR9H 5I8OH 3EJZC 4ZUVB 2IFGA 2EXYC 2AS5M 1P1ZA 4G8GE 1RUQH 4NRYB 3TA3A 4G8FB 1OT1A 5ESAB 5F7EL 4WNQB 4Z8FH 1CR9H 1U3HC 4AH2A 5FV2A 4Y5XC 5CEXB 1KCSH 1EHNA 2DIJA 4NQEA 4P9MH 5AD0A 5D1QA 4NDMA 5D71H 4O4YL 5HGAA 3L7EB 4I8DA 2P5WD 3KPSA 1U36A 3BD4A 3Q5OA 4G5ZL 1UM4L 3HE7C 3MNZA 4L3AA 4QOKA 4HWEL 1LP9A 1TJHL 2EIEA 3MCLL 5HYEA 5EU5A 2PO6A 4OCXH 1UA6H 1G1YA 4MD5B 1K5NB 3ARBD 1PG7W 4XVJH 4N9GB 3EGSA 4UNUA 5JQHC 1A7QL 4L9LC 4NKOA 1QEWB 3FB5A 4M1DL 4M4RA 4MHHI 1YEEL 3C8KA 4M8QB 1MCOL 4OZIF 2UWEA 3MRMB 3B83A 2ARJA 1OAYH 4PY7A 3MRKA 4JZJA 4KU1A 4E41A 3DURA 1BAFH 2OL3H 4GW4A 4P2RA 2IPKB 1X5AA 2XNAA 3TV3H 2Y72A 1U3JA 2CD0A 2W1NA 2QKIB 2XKNB 1N4XH 4JG0H 3LSOB 5BV7H 4P5TA 3CVHB 4S0TD 4O02H 3CMOH 3KLSA 1QP1A 3QUXB 4KTEL 3BWUC 3QULA 4KKCD 4PJ8C 4RFNB 3U79A 5E9DA 1R3JB 2IEPA 3G5VA 1ND0A 5DQJA 4I48B 1T6WA 1KC5H 4ISVB 2VKXA 3KPQB 1RZJH 2EECA 4X9BA 5IMKA 2DM2A 3MXWH 1A6ZA 5F1SA 4Q6IB 3HFMH 4HIHB 2ICWJ 4Y16B 4OCWH 4YHIA 1WJ3A 3BXNB 1IGTB 3UROR 4PRPA 1CI5A 3K81A 5ID0B 2YKLH 1LNUA 3LS4H 1CU4H 1O0VA 4X6BB 3MLTB 5I76B 3C9NA 3AY4A 1J86A 5DK2A 2X4SB 5TF0A 2AGJH 1KIUA 1H3PH 1WIUA 4RAHA 4ZO7A 3U1SH 3BYTA 1DN0B 1QG3A 1LE9A 3MJ8B 3V0VB 3IXAB 1DLHA 2HKHH 1ZHNA 3W2DL 1KEMH 5EA0H 5FGBC 5T1MB 4TNWK 1BVZA 2DJUA 4PIRF 2HVJA 2PYED 5T5NF 2A1WL 1F4YL 2DAVA 4U1HA 2YHGA 2YPKA 2DQCL 3QUZD 1B4JH 4UDUB 4X5WB 5IW6B 2LU7A 2AXJA 1XIWD 2JJVA 4XPTL 4WO4D 4PJFF 4OCRL 5KTEL 4PBVC 1WV7T 5HYIA 1D5BB 1A1OA 3GBNL 2X9WA 4L1HA 5DO2C 4UUJB 2O93L 5T1LD 4K7PY 4RNRA 1CXKA 5HYSG 4JY5H 5EC2B 1HHJA 4I18B 3S37H 3V5DB 4J1UB 4AEFA 4P3CH 4U6VH 3W0WA 4XXDB 2A2QT 1PVHA 3O6ML 4PJHB 5DSCA 1OT2A 2P5EB 4WWKC 1KG0A 4YDIH 2N1KA 3TJEH 4O9HL 5EZLA 5FUOL 2NY2B 4DOHB 3E1F1 3ZTNH 4OIIH 2C3WA 3TBTB 4KQ4L 2DQHL 3QDHA 5ID1A 5IB3B 1MJUH 1CGTA 1A6UL 4RA3A 2BNRB 4CMHB 5JMOC 4JPWH 5I6XB 2IGFH 5J1SC 4AG4L 4HAGA 1TVHB 1R3KB 4ERSL 3FQWA 3GSNA 3J7HA 5CEZD 2ZUYA 3FB8A 5HHME 5EH1A 2X7LB 3QEUB 1D5ZB 3H9SE 3S3SA 5IVNA 4YE4L 2EO9A 3NN8A 3PL6A 5DRNA 3QPQC 1CLYL 3CFCL 1Q9LB 1SEBA 3C5ZD 4V2BA 4MJ6B 4LMQE 4P5KA 3OAYK 1PYWB 4G9FB 5L8LB 1S9VA 1KOAA 3UJIH 2VAJA 3S4SA 1UJTA 2BY0A 2EE9A 1GGIL 3K4AA 4UILL 4NN5C 4PJAB 3CCHA 4FOMA 4Q2ZB 1GCFA 3HNVL 1EEQA 4NZUL 2APBA 4XNUH 4HHAB 5J3HD 2XWTA 4Y5VA 5HY9B 4GKNA 3THMH 3LN5B 5E6IB 5T1DH 3U7YL 2X4RA 3KLHC 4D0DA 3SE4C 5D7IA 1WIPA 4GAJH 5SX4H 2R2BB 2JK5B 1MH5B 3RI5F 1P5VA 4XXCA 4X0KA 3LKNB 3UPRA 3ULVH 2C5DC 4KK5D 4GG6E 1YNKH 1DE4A 5C0GB 3AMKA 4JN2B 3QO1B 3DROB 5DJ6A 4C4KO 4F7TA 5GRJH 1MJJA 5F8RC 3EYVA 4HK0B 2VL5A 5I30L 2ORBL 1ORQA 3CMGA 1NMCB 2FJGA 2P5WB 3M45A 3Q6FA 3NBNA 1VPOH 1VSCA 5GS0C 3GMOA 4YIQA 2LAAA 1R3IH 2BNQD 1CICC 4DQOH 1T1ZA 4Y89A 2FDBP 4L8DA 3PDGA 4S1RL 3SQBA 3R06A 1CFVL 4LIQH 5DRWB 4Z7QE 1JP5A 4R8WL 4U1NB 1XZ0B 3G6JE 3R1GH 5I19H 3ESVF 5IQ9A 4JFOB 2R2CA 2XY1A 3BWAA 1IC5H 5F1IB 3WUZA 1RURH 4OIBA 3ARBB 3ARRA 4U1MB 2X6MA 1GC1C 4GRWF 1HHGB 1P4BH 5FOBA 1A6TB 1RFDL 2FGWH 1LK2A 1KLUA 5TFSL 2WMPA 2AXGA 2HFGH 3IJSA 2DBLH 2FH8A 4G42A 1K4CA 5F9WB 1YEHH 2NY0D 3BGAA 3T8XA 1UXSB 2E9BA 5MI0B 3MMEB 4MNGB 5FKAA 1XAUA 4M6NH 5E4IA 3TT1L 3WFEL 4UINH 2R0KL 1H3WM 2FBJH 4H88L 2VDKH 4AZ8A 2Y1VA 4U0RB 4LRIC 3SGEH 5CHNA 5JPNB 5T33L 1DFBL 1N8ZB 1EUUA 3QI9A 1QR1A 2V5YA 2IQ9L 2W65A 3JTSA 4HMDA 4OZFA 1VFBB 3VXNA 4BM7A 4JDVB 4NZRL 2C1OB 4UIKL 1WWWX 3SE8H 1RZKC 1JZ5A 4G8IB 1R5WA 4KKBD 4MAYA 4P2CG 3FQTA 2EDNA 5E6ZA 4HV8A 4ELMB 2VDQL 3MGAA 4MX7A 1OF2B 3FO0H 1FFPA 5DLML 5EORH 3LEXB 5CP7B 4G6KL 3INUL 1RZGB 4I3SL 1FLTX 3X12A 1KELL 4M7LL 2V17H 3WKNA 2YN5A 5ETUA 1DSFH 5FHAL 1Y6NR 1A7NL 4Z7OF 4CVZB 2H8PA 1II4E 1U8LB 5KANI 4HJJH 5C09A 3GMMA 4X99B 5TE7L 5DJYB 4XVUD 3U36A 3RGVD 3HI6L 4JREC 4QY8B 3AXLA 4KAQH 5AUMB 1RI8A 1ZGLA 4F37F 1M71A 1CVSC 1T0MA 5D1XC 1OAUL 2R1YA 4OGAD 3AS2A 2VQ1A 5CJOL 3ARFC 1EO7A 2GT9B 3SDCA 3ILQC 4LU5H 4OLYL 3MO1B 5FDWA 1HZHH 3SOBL 3MTRA 3QUZB 3FOLA 1ZA6B 4JDTH 4O2FA 1AQDB 1C5BL 1FNEA 1GOFA 1I7UB 1INDH 3IDNB 3D18B 4XNMB 5FGCE 4R97C 1S78D 2G75B 2OTWA 2RCSL 1XIWB 1EJOL 4WHCA 3SGKA 5H35A 3CH1A 4WO4B 5IK3A 3HCVA 3O6KH 3A6OA 4XCNB 4KFZC 4HPYL 4ZSOA 3E6FA 4OKVA 1QVOA 5T1LB 2SEBA 5DEGA 2LU3A 1X5LA 5GISL 3RNKA 1U3YA 2ITDA 4F58L 1ZEAH 1N2RB 1HWGB 2P44B 4J4PA 3MUGB 4CMMA 1H5BA 4EQ3A 5GXBB 3F58H 4YNYA 4JQVC 3VFNA 2O61A 4HIIA 2XWJA 5DQDL 4FTVE 1PY9A 4CRPA 1VA9A 5IMOA 5DWUH 3RUGE 4RMWA 2J4WH 3VMPA 3NACL 1R3LB 4U3HA 4GRMB 4LARH 2R4SL 4EBQL 3T0EC 4PRHE 1NH6A 2G60H 5EOQH 2CGRL 3SQOL 2DWDB 4N0RA 4W4OC 3U7WH 4JR9H 2CLVA 4A6YB 3MLVL 3UTZB 3VE0B 2C1PA 4PY8J 1OP3H 2DQTH 4JGUA 1XGUB 2Z93A 4CJ0A 4I2XE 5IIEA 3VH8G 3QWOA 4XPAL 1I7TB 1ITBB 3KPLB 3O11B 3EYQD 1U2HA 3G04B 3VFOA 2CO7B 4OCSL 5DK0B 3SKJL 4QRRA 3G6AA 3QQ4B 2Q86A 2AJZB 5I1GH 3FKUS 1ORSA 2CDEB 2ZNWA 5EU3B 1X6NA 4HFWB 4LRNL 1U8HA 3QDGA 1ZV5A 3VGBA 2BX5A 3TZVA 5DJCA 5BZWA 2BVYA 3WYRA 2FJFB 4OTXL 4H25B 1ZMYA 3CU7A 4Y4KD 1J8HA 2J8UE 4HSQA 4P2OC 4ZPVB 4YHMH 3PWPA 1BVLB 1FQ9C 4LAQL 3F65A 4YZFE 5C3LD 4QHUB 5IKCB 3HMXA 4P5MB 3U4BL 4JB9H 3BW9A 2Z8RA 2Q6WA 3VWKC 4UQ2B 2NR6D 3BT2H 3SE9L 1MCWM 4WW2A 5HYSA 3BP7B 1AR1D 4H1LB 1KTDB 1MHPH 1F42A 1F4WH 2Y07L 5H37H 1AXTH 1PX3A 2I07B 1V3JA 4BZ2H 1CXFA 1KJVB 2F58H 2H1PL 1FHGA 1H0DA 2BRRH 2R56H 1FVCA 5K33A 4XCYB 3PDOA 4MZ3A 5GGQH 2ZOKA 3VFUA 1NGZA 1VADB 5SWZD 5HVFB 1E4KC 1P7HL 1MAJA 4XZUB 3TNMB 2W0PA 4FQXB 3HUJB 2BNQB 1J05A 3GMQB 5C0JB 1KCUH 1TETH 1U3HA 4CADB 3KWWA 3TJHC 5IT2H 5B38B 1C5BH 1JTOA 5FHBL 1A9EA 4OUUB 4XTRD 4ZFGL 3RY6C 1NL0H 1IGIH 2R0LL 1R5IA 1E27A 1UYWH 2ITCA 3KPRD 1P9MC 3N9GL 3GI8L 5KSAA 4EXKA 1RK0B 1PDKA 2FL5B 4O51A 1EAPA 4JN1H 2BERA 3IDMA 3WEXA 4KI5D 3ROLA 3BZEB 4M1CD 1JNJA 3S35X 2HKFL 3RWCA 3OF6D 1CG9B 2WNGA 4EJ1C 5F96L 5IOPA 4PGZA 1AFVL 3GDBA 4K7PL 4G8GD 1XR9A 3MROB 2H6PB 2BSTA 2CMRH 4L9LA 1T5XB 2NY0B 3HMXH 4QHKJ 4XP1L 4X6EA 5F88B 1QQDB 1RZ8B 2VE6B 5EWIL 1B6DA 5E8PB 4BQBA 3OGOE 5I66B 3M8OH 4RMVA 2YMXL 3MOAH 2XFXA 2Y36L 4XCEB 4EEEA 1RIHL 3PF2A 4KK9C 2VN7A 1W0VA 3KR3L 3OZ9H 2NXZD 4PJ8A 3SO3B 1MAKA 4XX1G 5HVGB 1HEZA 2J3SA 3LRGA 4K3DH 3RDTD 1P84K 3BQUA 3QZWB 4LVHC 1BJMA 1TZGH 4XNXL 3HC0A 1NCCH 3L7FA 1OQXA 4TSAH 1CE6A 1EVTC 1AXIB 2DKMA 1QNZH 3BIBX 1PBYA 2FBOJ 2J6EA 3QPXH 4M3KB 2CRMA 2MMXA 1A1MA 4JQIL 3IDGB 1DVFA 4IS6B 1VACB 1S8DA 1U41A 4AYFA 3IDXL 4UQ3B 3B9EA 5FA3B 2H3NB 5ILTH 1G6RH 3ZTJH 5A16A 2LV4A 3SE3A 5GGVL 4PJHF 2I5YH 4B53A 3RGVB 4WUUA 4MNHB 3KS0J 3OXSA 4BFIA 3ZE2E 3BP5B 3A6CH 1G6VK 4APQD 2D7QA 5JZ7D 1UCBL 3GBML 4POZD 4P3DA 3DUUB 5LGJB 4QTIH 5FGBA 2JB5H 2Q3ZA 4LIQE 5FCUL 4EN3D 4JRXE 4ZPTB 1EHXA 3HZYA 5C0AE 4O2CA 1X5IA 5DDHA 3PQYE 1ZAGA 3CIQA 1NGQL 3EUUA 2IH1B 1I3RB 4UTBH 2VZUA 4XPFH 2DQGL 3GBLA 5LXGL 3QJHA 2I27N 1WK0A 3HRPA 3N06B 2EDLA 3V6ZB 2QR0B 3ARSA 3BUTA 3WO3B 1TFHA 2XG5A 1EBAA 3UMTA 3T0DA 1F4AA 2J6EH 1X5XA 1KB5L 2CUHA 5IEHB 1HN1A 1QSZA 4LLDB 1CFSA 5E8DH 3P0VH 5F7KC 5HHVH 4DUXA 5B3JF 4PJAF 4TN9A 1B9ZA 1EEYA 1MAMH 2XXMB 3V8CA 4D94A 1ZT4B 1HH6A 5ICYA 5JXAH 4K8RC 3LAFA 4YDJB 3KHOA 1CGSH 9CGTA 5HVWA 3CX2A 3GJFA 2AK1H 2H9GB 4PP2B 2VDNL 4EQ2A 5J89A 1OSPH 1NCWH 5DFVC 3O41B 5EN2A 5I9QB 4ZXBA 1X4ZA 4F7EA 5H94B 2QSVA 4GAYB 4G6FD 4PB9L 2W0FA 4PJIA 4Z7VE 1NFDA 3BZFB 1GGYA 3DX7B 3OKLB 5LG1A 3QHZH 2FGZA 2DQIL 3LEVL 3QG7H 1TNNA 1WBYB 1A9BA 1QLEL 3QRFM 1LILA 1JGUL 3VXPB 1MWAB 5D6CB 1JZ3A 1FNFA 4JZNA 3BRDA 1QO3A 3JXAA 3PJSA 1C08A 3I75B 3B2UC 3C08H 1HINL 1N6QL 1HH9A 4GQ9L 4Y4KB 2X4PA 3CLFH 3FZUD 1IKFH 1ROWA 4OZGF 1DEEB 1TPXB 5FYJU 5I8KL 2MCPH 1HNFA 3EYUL 3EOAB 3MRNB 3UAJD 1DDHA 2WBJC 4PP1D 4G8EB 4EUPG 2PTVA 2GITB 4R0LA 2D7OA 4QRPA 3OKEA 2CR3A 1NLBH 5HHMD 1T03H 1Q38A 2IG2L 3H9SD 1IAKB 3LQZA 1ZGLM 1J0HA 4U6YB 3QDMA 5T3XL 2D7TL 1T1YA 2FIKB 3SE4A 2AABH 4XMKH 2X1XR 3A67L 1JPGA 4ZS6D 5JHLL 2FRGP 5JIIA 2NPLX 4NGHH 1P7KB 1SJEB 3B6SA 5INCB 3U0TB 5I1LA 5SWZB 4OI9A 4I0PA 5BQ7B 1Z0NA 2AJVL 4RCAA 3FQRB 1GYAA 5FUZL 3EBAA 2W38A 4KXZI 4NN6B 5HYQA 4JAMB 1WCQA 2Q87A 2P24B 4BFGA 4GXUN 5C0NC 4IJ3B 3NIGE 1CF8H 4PRNA 1UJ3B 5C0BE 4GW1B 3DLQR 5D93B 4X4ME 3FQXB 5ALBH 4HQQL 2VKWA 1MCLA 3K0WA 1QBML 5EULV 3KPRB 4FQLL 4WWID 8FABA 2EYRA 5E2TH 4TSCL 2CDGB 1ZWIA 2PR4H 1BEYH 2PXYD 3VH8A 3VXOB 4JO4H 2ADJA 3H7BB 4HZLB 3U9UA 4RWHA 3QUMB 1NFIB 4WDIB 4ZUTA 5D8JH 4H8WH 3IFNL 2B39A 3ZDYF 1F6AA 4HUWA 4OM1H 5JDSA 1S7SB 1WCBA 1BZ9A 3RQ3A 15C8L 1LO4H 3VFSB 4KPHL 2J2ZA 3H3PL 4LHUG 4IRJC 3MRDB 3CFBA 5HGBA 3U6RA 1FVDA 2M1KA 3I2CH 4JFPB 2HFTA 2NXZB 4N0CD 5E95B 3QFJA 1A4KA 3GSQB 4L4VA 2Z4QA 1KIRA 3LHPL 3HPJB 2YBRB 2B7DT 3HAEH 3RDTB 1B88A 2DQUL 1B4RA 1VGKB 1KPVA 5DUBB 1K8IA 4X7CC 3DVFA 1YMMA 4ZUSB 5L7XH 4Z76B 43CAB 3EFFA 2XN9A 3OR7A 4RFEA 5EZJA 4Z0BH 1FO0A 1NAMB 5JIKA 5IVZA 5B22A 2UYLA 5JOFA 3PV7A 3JV4B 4KUCD 1DBMH 4LSPH 2J12B 1UH3A 3QG6B 5GGSB 3GI9L 2XWBB 3P4MA 2D03L 3D69B 3QIBD 3TVMA 3WNOA 4UV4H 4C4KT 1PFCA 2OQJB 3PGCB 3VGGA 4YHLL 3MYJA 1NLDH 4JJ5A 4K2UL 3S3PA 2VLKA 4LLAA 2V2TB 4GT7A 5JW3L 5D1XA 4XBGB 2BP3A 5K93A 1ZHKA 3ARED 4LNRB 4RAUA 4KJYB 5T5FL 1UWXK 1T1XB 3VXUE 1WAAF 5JUEL 4PV8B 1IFHL 4CU6A 4N8CL 4R96B 4WV1B 1RUML 4FQHB 1OARL 4FNLL 1I85C 2OX5A 2UZIL 2D7TH 5DUPL 3H6JA 2ED7A 3LQAL 2A73B 1T1WB 2R8SL 3CDGB 5I1JL 1C1EL 1KYOJ 4EVNB 4JHAL 3BD5A 4PGCA 1ZTXL 5IFAH 2VDRL 4P9HL 2HFEA 4LLUB 5HDOA 5FAAA 3MBXH 5DEZA 4H0HB 5JW4M 5F89B 2IPUG 4UOW0 1T7YA 4JQVA 2YZ8A 2Y25A 3QNYB 3UYRH 4HCRH 3MRGB 6CGTA 1DQJB 4J6RL 1U58B 4OFIA 2ENSA 1LO2L 1NCNA 5DJAA 1HKFA 3DNKA 2K7PA 2KBGA 1UB6A 1QRNA 4Q6IC 4ODVL 4PG2C 4QT5A 1KJ2H 2DQEL 4Y16C 2DWEA 3T0EA 4LGRB 4ZFOA 4ZOCA 1QFWM 2DI9A 1BMGA 4G6FB 4LVEA 1KLFA 5BRZA 1NCDH 3T0AA 4W4OA 4AL8H 3PHQA 3RZCA 1GZQA 5KS9E 4KKAC 5E2JA 1RMFL 2NLJB 1G0XA 2H32B 4NC0B 3CSYB 3MNVA 1KGCE 1KN4L 4KMLB 5J6GA 1GVIA 2DLEA 4FTVD 3L5JA 1U8MB 1WICA 1BWMA 5GRUL 4WI7A 4L29B 1NCAH 3IU3A 5IR1A 4UZGA 5JOEA 1G9EA 1MLCA 5C0CA 1A7RH 1NCBH 3WV0A 4MA8H 4KTDH 4MDIB 2ICWB 3GIVB 5DD6B 1YNTA 3HUJF 1EV2E 4YHNA 1ES0B 1SEQL 1Z6JT 4O5LL 3RP1A 3JWOC 5FA4A 1AGEB 4A2MA 3MBED 2BK8A 5FF6B 2NY6D 1T80A 2QHRL 4P99A 3IETB 2IBGA 2XI9A 3U9PH 3F7VA 2XTJC 4MS8D 2VLRE 2X4QA 3C2SA 3DARA 1MFEL 3WFHB 5DGQA 3DV6B 4P2OA 5HHMB 1OM3H 3E6HA 3H9SB 4NO5A 3FAWA 3GUTA 4JM4L 2NY5L 5KSBF 1X44A 2EIBA 4G6AC 2GCYA 5DJZA 3VGDA 2NY4B 1RK1A 3FFDA 3VWKA 4D3CH 5J11B 3MGOB 3QUKA 1GAFH 5HJ3A 4H5SA 2E6JA 1JVKA 3FONB 3UC0L 3RJDA 3QQ9C 2NY2C 5TQ2H 1IAOB 4UMGA 2OI9B 1RZ7L 4QEGA 3AU1A 1T21A 4XI5D 5HXMA 3PGFL 3VI4F 5JORB 4JPKH 4QXTB 4G3YH 3AMLA 5FYLH 3GJEA 3KVQA 1D5MB 3BP4B 3QHTC 4ELKB 3MLXH 2VR9A 1GGBH 3ARGC 4O2EB 1INQA 3IFLL 2CK0L 3IT8D 4PJEA 1EHLH 3STZA 4P23D 1ZVSA 2PXYB 4MVBC 4D8PA 1PKOA 3RY6A 4GG6B 3L95B 4O00A 5EUOF 2VIRB 4PJFA 4HKXB 1HHKA 2ZKHL 3QA3A 4XPHH 2R15A 3BHBB 5EUKA 7FABH 3C6LD 3DJ9A 4HKZA 1L7TH 3V95A 1OD7A 1L7IH 1HSBB 3U0WL 3NFSH 1REIA 3HI5L 5F3BB 4PD4K 4U2YA 4NJ9H 1HXMB 1G7IA 1M05A 1GIGH 2YD6A 5IQ7H 1A6AB 4YXLL 5KVMC 1H3VA 3J8F7 2FEEI 3VFWB 3V4UL 3FQUB 1SY6H 2Y9RT 3UO1H 4IIQB 1FNGB 4NM4L 4PG9B 4ZQKB 1F00I 1KN2L 2FYYA 4XP4H 4GUPB 2RAMA 3G6JB 5LGKA 3UTSE 4U7SA 1S7VB 5IB1B 1OVZA 1PSKL 3V6OC 4HUVA 3NMEA 5T1KD 3LRSA 4X6CA 4EUPA 3O4OB 4UAOB 4LVOB 5E6IC 1DR9A 12E8H 2Z31D 3E3QE 4O58L 1JN6B 1HDMA 4TUJB 1YDPA 4KH2A 4DKEL 5CIPH 4YHPA 1NBQA 2QSCH 4HUKB 3FB6A 4QXGH 4ODUA 2YPLB 3I3BA 2ZG1A 2F5AH 2XZAL 1KCLA 5JA8B 4JFEE 3IDIA 1IL1A 1M4KA 2BDNH 4QTHB 4RX4D 1FFRA 3OKOA 2IADA 1XH3B 4YXHL 3BKCL 5I2IB 1QSEA 1I4FB 4MWFB 2ZOLA 3JWNC 3RRQA 2IAMA 4TOYL 1Z3GH 3QNXB 3ZYJA 1D9KD 3O3EA 4TQEL 4W6XB 4AK1A 3SGDI 3ZDXF 1JMZA 4XMLL 5E5MA 4Z77B 1UQSB 4HS6B 3L3KB 1NKOA 4U6XA 3KLDA 1F58H 4CAGA 4OV5A 3GSNL 5F3HA 4OAWA 5KVEH 1RU9H 3X3FL 5HHOA 5CD3B 4U1GB 1QFOA 4HC1A 1E4XI 3QFDA 3AREB 1XGRB 4KJPC 1YN6A 4XB7A 4KV5F 3O3BB 1FN4B 1CWVA 5KJRH 1FFNB 1TJIL 4N90E 4LSSL 3D39E 1T6VN 2DD8H 3FB7B 3FO1A 3IXTA 4WVRA 3WFCH 5KN5B 5GRVK 2XY2A 4LBEB 2LAGB 3F7YB 5F9WC 3CC5A 3OGCA 1HYRC 2EXWC 4UT6L 3TPUB 5MI0C 1JHLH 3MLRH 1WZ1H 3SY0A 3S36X 4NQVB 1MNUL 3WLWD 4LHUA 1MFDL 2DKSA 4R3SA 5JW5A 4KKCC 4WCYH 3CD4A 3KPNA 4MA7H 5KVDH 1RJLB 2EE6A 1MCFA 3SCMB 2X4UA 4P4RB 3ZDZF 1EMTH 3IRPX 3PIQB 1U9KA 5FGCB 4FFYH 4JRXD 4KZEH 2JKXA 4PRAA 1NAKH 1WFTA 5C0AD 1HOCA 4JY6A 3PQYD 3S35L 1NBZB 1A22B 1LO0L 4FFZL 1UVQA 1J5OL 4AIOA 3OR6B 3LPGA 2FATH 3O3AB 3V5HB 3WNLA 4B0MM 4BKLB 5JO5A 1HILB 5ISZA 2VITB 4ZYKB 4FTVB 1Q72H 5ACZB 4WEUD 1BZ7B 3T1FB 4L5FL 3RUGB 5K9QG 1LDPH 2ICWI 3OL2A 5BV7B 2R0WH 2A6JB 2DL2A 1YPZE 3MV8A 1JWMB 4G6ML 5GSVB 3X17A 4PLJD 4PLKD 4Y4FD 1B2WH 3S97C 4PRHB 4OLWH 4RBPH 3HNTL 5AZ2H 1KXQE 1OLZA 5C8JA 5DVOA 1I7RA 3MBEB 1N64H 2Y23A 2VXTH 3QUZC 1RVFH 1HXYA 1N5YH 1BFVH 5C07A 1JGEB 3CNKA 4O58H 3IAPA 2R29L 1JNLH 2JJWA 2OR7A 4WO4C 1AGCB 2VLME 5CAYB 5SV3A 4PJCF 3IU4L 2W9EH 5AYQA 3DTXA 4I2XB 3RWIA 2YR3A 3RWGB 1QLFB 4BZ1L 1W72H 4PRIA 1X5YA 4KI5F 3O4LE 2XPGA 2Q7YB 1KPUA 2XZAH 3MXVL 5J1AA 5KSVB 2EZ0D 3L3JB 1LP9B 4P0DA 2NX5A 5FUCC 2V7NB 3GHEH 4RMTA 3RWDB 4NNPH 4DGVL 4F3FB 5HBBA 5KAQF 3L3GA 1ZT1B 4PREA 4JFXA 3IDJA 4GRWH 3WKMH 4BH7A 5IW1A 4OLVL 5BS0E 5E8NA 1FFOA 4KZDL 1YEGH 4LFHG 2J8UB 4HX1A 3DVNB 4HWZA 4CKVX 4FQQA 1P7QA 2VMFA 1T66C 1JUFA 4ETYA 5KOVC 5D7SL 3HR5A 4MMXC 4TVPH 3VXRE 2GSGA 2Y6SC 4P23B 1M6OB 2HRLA 2VNCA 5DHXB 2YD1A 3RY4A 3VXTB 3O6FD 3EYOB 3QCTL 2IANA 1DUZA 2DQDL 4X98A 3C6LB 3KYNB 1IGML 3GJFK 5C0EA 4Z0XB 5E00A 1F02I 4YDKH 4WFGE 5GJSH 5IB5B 5D2NE 4DCQA 3DETC 3FT3A 1P84J 1IGCH 3JV6B 3OKDA 1XF3A 4AIZA 1XR8B 3GK8L 2ADGB 5C0BD 3BISA 3RL1A 2NNAB 3GKWH 1XF5B 5D2LE 4WI2A 1YYMH 1EX0A 3VFGL 4XVTL 5MP6H 3T4AA 1DLHB 1CLOL 3VWJA 5A3ID 2Z31B 3BJLA 1CDJA 1FG2B 4J8RB 3BAEH 5IV2B 4RDQF 2FJHB 2PW1A 1S7RA 5I1KL 5JXEC 4YLQT 5GZOC 1FNLA 2GJZA 4N0FA 3OX8B 1A0QL 4YJZL 2CIIB 1T0NA 3MNWA 3BP6A 1FZOA 1TTFA 4KHTH 4XPGH 5B4MC 1C5CL 2HJFB 3CU1A 3L3OB 1J12A 4ZUVA 3QAZB 5IB4B 5GGTA 1D9KB 3GMNB 5IM7B 5SWSE 1GGTA 4BELD 2BCKB 1AJ7L 2VH5H 4G8FA 3T2NL 4FQXC 3NTCH 3QWRD 1A3RH 2R2HB 4NO0D 5ESAA 3SPVB 4WNQA 4CN6A 5CEXA 5SWQB 1KG0B 1XGQB 2CO6B 5CJXC 4OZIE 1IBGL 5KG9B 4X4XB 3L7EA 1ODAA 3MLPA 4UB0L 3LMJL 3U82B 1EK3A 5B21A 1WQVT 2D0HA 1MCEA 3FT4B 2I9LB 3ZKSD 2QADD 3RFZC 1EZVY 2HRPH 4DFIA 3ZSSA 4MD5A 2PKDA 2XZQL 4KMTL 4N9GA 5MEOA 4WY7H 1I85A 2MHAB 2ZCLH 1DQDL 1PG7X 2NY0C 1QEWA 2QQLH 3UJJH 4R6UA 4IDJL 4M8QA 3MRMA 3LN9A 5DFTA 5EIVA 2NY1B 2Y4SA 4HS8H 5I1IH 3CK0L 2QKIA 1EO8L 2XKNA 3FRPG 3O8XD 1TTGA 3TGXA 3DI3B 2A9ML 3LSOA 1S9VB 1AHWB 3CVHA 3VG9C 4NBXB 4JRXB 3QUXA 5I17B 3JV0A 3G5YB 2YA2A 4XWGL 3D48R 5C0AB 3S96B 1R3JA 3DX6A 3PQYB 3VXUD 3ULUL 3SDAD 3L6FB 4I48A 3B5GA 4ISVA 4EKXA 2I60L 3ZHDA 5C0RL 1R0AH 3KPQA 2B0SL 1XGPB 4LKCB 3BUYA 4Q6IA 2EDXA 4PG2A 2QQKL 4HIHA 4Y16A 3SBWC 3RA7L 1XCTB 5I16B 5IGXL 1PLGH 3BXNA 1IGTA 5ID0A 3TWCL 2DOCA 3WCYA 4X6BA 3MLTA 3BOVA 5I76A 2D7MA 4XVUC 1BOYA 1QLRB 4TNVK 2B1HH 2X4SA 3SDDB 4YQXH 4AQ1B 3UZVB 2EC9T 5FK9B 2MQ0A 2FO4B 4Y4FB 1U2CA 2FX7L 5GRVL 2WLZA 1LGVA 1DN0A 1RUPL 2O5YL 1S5IH 3MJ8A 3V0VA 3IXAA 4XVTH 5AZEL 4PJGF 5LGHH 1CFTB 5T1MA 2H2SD 5CUSL 2KH2B 3FO9B 3TFKD 1S78C 3ILPB 1CD1B 5D96B 5TQ0L 4LEXL 3WS6C 1NUNB 4AEEA 3S7GA 4IRSD 4Z7VB 5I1KH 4Y4HD 4E41E 5CGYD 1OP9A 2OCFD 4UDUA 2A9NL 4JM2D 4X5WA 3UCRA 3VW3H 5IW6A 1HIMH 5IROC 1QFWL 1T7ZA 1JK8B 1ADQH 1YEIH 2ZCKH 4J3XA 1VKXB 1WBXB 1KGCD 1NGXB 3FT2B 3MLZL 1D5BA 5GRXG 1X5FA 2YN3A 4UUJA 5F21B 2BHZA 1V7MH 3K80A 5EC2A 3N1GC 4H1LG 4I18A 1MCIA 3V5DA 4J1UA 5DK3A 1MFAH 5FM4A 2E7LA 3NCFB 4QGYA 4XXDA 2GHWB 4UOW1 4QRSB 4PJHA 1OY3B 1U3ZA 2ATPB 2P5EA 3EYSL 3BKJL 1FDLL 2YC1A 2ZUXA 1KENH 4LNVA 4OV6F 4HPOL 5F9DC 2F5BL 4L8SB 1PY4A 4ONOA 2VLRD 1I8IB 3WXWL 5BW7A 5CHNB 3TBTA 1JL8A 1ZLSH 2VDLH 1PGRB 5I73C 5I9QC 3O2WH 3O6FB 3C5JB 3C2AL 5DJXB 5DMIH 3TF7C 5IB3A 3EHBD 3MRLB 4OSUH 5B38G 2BNRA 3SEPA 4JFZL 2YS4A 3O2VL 3MRQB 1TVHA 3MOQA 4KUCF 1R3KA 3OG6B 3VGAC 1G7PB