4CMMA

Structure of human cd47 in complex with human signal regulatory protein (sirp) alpha v1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
117
structure length
117
Chain Sequence
ELQVIQPDKSVLVAAGETATLRCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVRAKPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE SUBSTRATE 1
publication title Polymorphisms in the Human Inhibitory Signal-Regulatory Protein Alpha Do not Affect Binding to its Ligand Cd47.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 24
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cmmA01
1UJ3B 3QUXB 3RNQA 2XKUA 2DS4A 4Y5XB 2XNAB 3THMH 4XH2A 5EZIL 3X3GL 2A6JB 4PGBA 1NDGA 3TC9A 1VEOA 1J05A 3WNMA 1LO2L 2VXVL 4F2MA 1U8LA 3O11B 1L0QA 4APQC 15C8H 4XBPA 3MPCA 1RZKH 3DETD 1IC7H 5B4MD 3N9GH 3GIVA 4ZTOH 2CH8A 3NH7L 2I9TB 2ZUVA 3BGMB 2OL3A 4NDMA 1FSKB 4JGMA 3DMMC 5DUBB 2W9DH 3ZT6A 1MCPL 5JPNB 2V17H 1HI6A 2XKNB 5I16A 1F4YL 1YYML 3UTTA 3BKCL 2HN7B 1GGBH 1R3HA 3OZ9H 2GITB 1U58B 5I1IH 3NA4A 3MYZA 2WBJB 2FBJH 2G2RA 3V95A 1SM3L 1I9RL 3H9SA 1CCZA 5C0IA 1V7NL 1OAZL 4OCYH 1F11B 3UJTL 3UPCA 1NBVH 3LAFA 4I18C 5HDOA 4KJPD 1YY8A 5IFHH 4H20H 4GRWF 1IKNC 3EOYG 4J23A 2BOBA 3ROLB 4PLOB 3UAJC 3X14B 3PHSA 3KLSA 4KKLD 4RMUA 4UMGA 4XWGH 3MRBA 1MJ7L 5H37H 4Z7VA 2Y72A 4YUEH 2Z91B 3VXQA 2BMKA 3IJHA 2Z92A 1AFVL 5C0ND 4POUB 1SBSH 2PYEB 4CU8A 3LRHA 2D7OA 5K9KA 3TH2T 5ABDE 5AUMB 4XNZB 1N64L 2NY7L 4QF1A 2OLDA 1F6AB 3WKMH 5E6IC 1UZ6E 4PP2A 3GRWL 3H0TB 4N9GA 3VMNA 2R69L 4XP9H 3U2SA 1QSEA 4LRNL 5CJOL 3ES6B 5HYEA 2IC2A 1KIPA 1FE8H 3UBXB 3SDCB 1QSFE 3REVA 3AXLB 3VXUB 2GIYA 1R0AH 4S1DC 1J9CT 2NNAB 1DEEB 4KROC 1MJ8H 4M5ZH 3VW3H 3HC0A 4J8RB 3ZDYE 4XHJC 4G6FB 1NDMA 4IIQB 4EVNB 4J3VA 2B5IB 1R3LB 2JLLA 3O2WL 4QNPF 4Y4KD 3V0WL 3C2AL 1CBVL 3RNQB 1FRGL 2HKFH 4IRJB 3L3OB 4N1EA 2VXTL 4MWFB 1DJSA 4FHBD 2E5EA 3TO4D 3QIBA 4ORGA 4HBCH 5E5RB 3ZDZF 5DMKB 1D5ZA 3TN0D 3VH8G 3SY0A 1K3ZA 2VLJD 4HJ0C 4X83A 3ARYA 2H8PB 3VFPA 4G3YL 3FO0H 3HI5H 3V6FA 1KJ3H 3VXOA 1RUPL 1T7ZA 2X70A 3WS6A 4TVPH 4F8QA 5F72S 4XVJL 5ICXA 1QHOA 1QFUH 3GRWA 4JFDB 4W6XB 4ONOA 4QGYA 1R3HB 2QQQA 4JPWL 4NQDB 3DUSB 5E4IA 5IG7B 3CFBB 4X8JB 1P4IH 3IU3A 1F6FB 3N06B 4NKMB 4RFNB 4ZODA 4HZAA 1IM9A 4N0UE 4BSVB 3ZT7A 1XGUB 3X12A 1C1EH 2VB5A 4WI6A 1VFMA 1GGCH 3QNZA 2GJJA 1EEYA 3RZCC 5JA9A 4AJ0A 3TJEL 5I18H 5D9SB 3BKYL 4TVPE 3MUY1 1WEJH 2A6DA 5EWIH 1MEXL 4I77L 1FFNB 1GSMA 4G6KH 1I9EA 2C1PB 5DD1L 1HXYB 5CLWA 1UWXH 5IW6B 1KYOK 1PQZA 3KXFE 2CLVA 3ZO0A 2XWJB 1AH1A 3MLSL 2BMKB 4FQCH 3VFNA 4ZYKB 4KMTH 1BBJB 1U93A 2F5BL 4GT7A 4KY1L 3CFEB 4TNWK 3V4VL 5D7IF 1Z9LA 1UT9A 4OLVH 4S2SB 5CCKH 3QPQD 2YD3A 2NYYC 1WZMA 3B9EA 3V4UH 5TGBB 4X6BA 3FTGA 4J4PA 3CFJA 4CNIA 4RMSA 2EXWD 2YPLD 4PJ8D 2AW2A 4MYWB 1MCRA 5EOQH 3LKQB 4GAYB 1U3HD 4A6YL 1P5VA 5I1JL 4LPTA 4ZFGH 5BMFH 3OJ2C 3V4PL 1CLZH 3PWVA 3HN3A 2C26A 5E1AA 3S3PA 3O6MH 3TWCL 3REVB 1U8QA 1JZ5A 2VQ1A 3RHWK 5C7XH 1LK3L 1AD0B 1V5JA 5F1NA 3D39B 4G5ZL 4P9HH 4S1RH 4FA8A 1D9KC 3IDIA 2X4QA 3PQYE 4BUHA 1ZV5A 2YK1H 4Q74A 5C0CE 3O9WD 4YBQD 1HHJB 2Y7QA 3ALPA 4IHOB 4OGYL 1FPTH 2F53B 3TYGL 3FKUS 4I3SH 4MNGB 5CKGA 5GRXG 2XA8H 5DD3H 1KCUH 3MRQB 4NQEE 2JJVA 1JGDA 3QIBB 3VXTB 5IJVA 4M43H 2CKNA 1A02N 1AY1L 3MJ8A 1IC5H 1FZKB 3UTQB 3E8UH 1V3KA 3MO1B 5AD0A 1LP9A 3TM6A 5E2JA 1CLYH 4EN3A 3PE9A 2JB5H 4LVHB 5DI8B 3I3EA 2X70B 4RGND 3KPQA 1AIFA 1UXSB 3B6SA 3TPKA 2Z0BA 4PV8A 4JPIA 5CKAA 1IMHC 2NPLX 3WMSA 2B4CC 1AGDA 1FO0L 3OB8A 3Q5TA 3ET9F 1R5WA 4OZHA 5IGXL 1EHNA 4A6YA 1CL7I 3ZDXF 5C70A 3E1F1 4G9FB 4HSQA 2AJUH 2ZJSH 2PXYD 3RWJB 4JKKA 3UTSE 1JF6A 2XZAH 5HHMB 2QKIA 3NN8B 4U3CA 4OAWA 1WITA 4O2CB 3O8XD 4Y19D 2GJ6B 2VZ1A 4JRXA 2ZOKB 2P8MA 3QFDA 3T8XA 4NUGH 5D8JL 1MPAH 1EGJH 4M6ML 4ALAH 2CRMA 1P69B 5BRZD 1MIML 1KTRL 4K23H 4WNQA 5J8OA 1QP1A 1IM3A 1KN2H 1FVCB 4FTVB 2C3GA 3FFDA 4AEEA 3WLBB 1QBMH 5DJXA 4KXZH 4QRUA 5E7BA 1F97A 2EECA 2O5XH 12E8L 5KAQG 1XF1A 3LB6C 2Q6WB 4JFFB 1FGNH 1T04A 4MQSB 3GBMH 5TFSL 3MXWL 1QFWM 5HJ3A 1F2QA 3DX8B 4GKSB 4X6BB 3K4DA 3UTPE 4Y2OA 1LE5A 4JQXA 2Q8AL 1FL3B 4NC1E 1KEGH 5CZVH 3GJFA 1FO0A 2H45A 5B8CC 3L5HA 2AK4A 3HS0A 4X9FA 3WXVL 3LKNA 5C0DB 3RGVC 1MHHA 3TT1H 1JI2A 5GRYA 5E2UH 1D5IL 3QFJA 1CZ8H 3AC0A 4HIEB 4C58B 1KBGH 5I17B 5F1NB 2Q76B 2R4RL 3IJSA 2MFNA 5GRVL 3QUZD 3LDBB 3NCBB 4UT9H 3RIAF 1X6LA 4PJDE 1AC6A 3JV6B 1GXEA 2Y7QB 3E6FB 3N85L 3ME0A 1A9BB 2BCKA 3CLEL 3RKDC 5D1QC 5I30L 2CO7B 5SWSE 2DMCA 5DK3A 4JRYD 4OD2B 1H9VA 3N1PC 2VL5B 3A0OA 4ODWB 4L3AA 1QQDA 3GJFK 4PJHE 5MEOB 4WHCA 1OHQA 1RK0A 4NCDA 5GGUB 3F58L 4MQ7B 1BQHB 4LCWB 1UM4L 4DCQA 1IEAB 4YGVA 3KLAA 1N26A 2EIBA 5IOPA 5C08E 2YEZA 3BEWB 4I2XA 2WAHA 1IGCH 3OG4B 5E95B 3V7AG 4ZO9A 1I9IL 4JPIB 4LLYA 2AXHA 2WZPD 3HPJA 1MF2H 2ZUXA 1KCRL 1C5BL 2VTFA 3F7YB 1ZA3A 3VFVB 3RTQC 4UT6L 5I73B 2FECI 4NUJA 5FB8B 3SGKA 3U0PB 4XMLL 1ZHNA 4Z5RB 2CGRL 3NFNA 4D0BA 3MV01 2Q87A 5C0AD 3TIEA 2Q1EA 3QEQD 3NVQA 3FB5B 1JPFA 4MXVF 4OFYA 4OAWB 3O0RL 3IDXH 3IT8D 4XBGA 5HGAB 4ZFOL 4EIGB 3UJJL 2BNRE 2OJZH 3AREC 2A73B 1PKQB 4M1DL 1CD9B 2DLHA 2I07B 3INUH 3C6LB 3TCXA 1BIHA 4PRHA 1T0MB 1OP3K 5C0BB 5KS9A 4MNQB 1G7PA 2ADJB 2QR0B 5SWZE 2UY6A 4QRUB 1ZT7B 4GS7C 3ROOA 4PJ7B 5GGRY 4MXQC 1IAIH 1IAKB 3HZKA 4WU7B 5I0ZA 5C6TH 3FFCE 4RMTA 4W81A 4X6DB 2Y5TA 3GNML 4HKJA 1OPGH 3FZUC 1VENA 1TQBC 4KUZH 1L7IL 4I48A 2ZSVA 1X4ZA 1I3RA 2LFGA 5GRVK 1FN4B 1PG7L 4YO0A 2MWCA 4MCZA 4QRSB 1K8DA 3SN6N 4NNYA 5IP4A 2R23B 5EPMA 1I85C 3ZKXC 3IETB 4F15B 2DWEB 4F57L 4PTTA 1IAOA 1MI5D 4KI5E 5T5NG 1MFAL 2BZDA 5GS2H 3HC4L 4FQHA 4OZIB 2NZIA 4G43B 5K9JL 1NSNH 4OB5L 3VG0H 4ZFOA 4D9LL 3K4AA 4X7SL 3EDFA 4C57C 4Z95L 1YNKH 1FNHA 4YHYC 3J7HA 2Y07L 3OAZK 1M71A 1FL6A 3BP5B 1BQLL 1OLZA 4JEGB 4HUMB 4AH2B 1TETH 3UO1H 1QG3A 1T1XB 4NO5A 1U2CA 3KLAB 4LLMB 2DIJA 3SDDC 3LN4A 4H0HB 5KSUB 1A6ZA 4QOKA 2E9JA 1P5UA 4CMMA 3DRTA 2X9WA 4P0DA 2AXFB 2VLME 3B83A 4BFIA 2IG2H 4N1CA 3WUWB 1ULVA 5E0QA 5D96C 1OTTC 1G1CA 4P5KA 4FQIH 4QXUL 4YHLL 1HQ4B 4DEPB 1NBZA 2Z9TA 5IBTH 2BC4A 4XC1H 3QA3A 1E4XL 4G6MH 1AHWA 4Y5YB 4WUKH 4QHNA 2WP3O 3AY4C 3GSVB 4RMRA 4I5BA 4X7TA 1E4WL 1KN4L 4DQOL 4WW2A 1QD0A 3F6LA 1S8DA 5A16A 3BZEB 4MQXC 4LASH 5GS1A 1T7YA 4F7MA 1UM6H 1OGAE 5BVPL 3G9VA 3KYMA 3NZ8B 5SWQB 4YXLH 3SCMB 4HFWA 4WHTA 1O7SA 4JDZA 4YEFA 5EU4A 3NTCH 5TDPB 3DUUB 3VFWA 3TJHD 5CZXC 4PRHB 4FFZH 3R4DA 1OB1A 3S37L 4KJWD 3FJTA 4WTWA 4ZUSA 1G7MB 2ATKA 4QTIH 2XWBB 4GAFB 3D0LB 3K8LA 3ZKMC 5C9JB 3UJIH 4IS6B 2EYTA 3P73A 3PP4H 1AO7E 3GMNA 2VABA 1MWAH 4TUKH 3QYCA 1TZIB 3WL9A 3T0EE 1DANT 1CDCA 1DN2A 4GXVL 4XAWL 5DMYA 3QUYA 5SX4I 1CLOH 4YXHH 1X4YA 2HTKD 1XR9A 3IXAA 3QJHA 4QXWA 5FYLE 3L3IA 5BV7C 3FO2B 4GXUN 4N90D 4PYGA 3WFCH 5EZOL 5T3ZL 2WUCL 1FYTD 1T2JA 3SKOB 3IFPA 5DVNA 1J8HA 5F7UA 5D1ZA 1MRCL 5B22A 5M95B 2G60H 1M1SA 4KJQD 1WJ3A 2YSSB 5CGYC 1J5OL 5C2UB 4KVCH 2W0LA 3EFFB 3EDEA 4ETYA 2DQIH 1R5IA 2W0PA 2ZUSA 2VDNL 4PS4H 5L88L 2CJUL 2HH0L 1ONQA 1MELA 1AP2B 5LXGL 1RAMA 4O5LL 1TZGL 3UZQA 4M8QA 4M7KH 5I1CL 2NX5A 3GUTB 4OSUL 1L0XA 1JI1A 4RNRA 5MEPB 5CMAA 4RGOL 2Z35B 1GC1C 2ZCKL 1LEKA 5TF1L 4P2OB 5C0RL 1RZJC 3TZVD 1MHEB 1MCQA 2J88L 2VLKE 2AXJA 5IBLC 1BGXL 4XNUH 5EZLB 3MGOA 5JO5A 1FDLH 3WUZA 3MRHB 5SX5K 3E2HB 5ILTH 1V7ML 4ZXBA 2XY1A 3CU7A 3ARQA 1U92A 1NFDF 5GGSA 3P30H 4OF5A 1YUHB 3DXAD 2E27H 1P4LA 1NC4A 2NXZC 2VZSA 4O58L 5IHZA 5I74B 3E3QC 3W9DB 4ELKA 1DBAH 1OWRM 4Q2ZA 3GKZA 2F5AH 4U6HB 3MXVH 3RDTD 5L2JB 5I1HH 4U1KA 2A6KB 4K3EL 3PWNA 3DHMA 1OAQL 3VFSA 3HB3D 1HOCA 4OLYH 4RWHA 5IB4B 3F12A 1HQRB 2DYPD 5DQJA 3IDMB 3SJVB 3ARBB 4HS3A 3TBWA 4LLWA 1A9EB 3GSNL 4V1DA 5IVXB 4LSVL 1BOGA 3DV4B 3QEHA 5DGQA 4BK5A 1V05A 3TEUA 4TPRH 2BVOA 4MJ5A 4W70A 5DDHA 1ODAA 5E2TH 3NABH 5BS0E 2B2XL 2IAMA 4Z7QF 3GMRB 5E9DE 1GZPA 2D7TH 4AIZA 1YEIH 3P73B 5CILH 4X7DC 1ACYL 3QHFL 5MI0C 3LN5B 3O45A 5CEXA 2R0WH 4ODXB 4P57A 1QEWA 3OKKB 3QUYB 4P5MA 4O02H 2X1OA 5T1LD 5J11B 4XCYA 3P9LB 4WHYG 4XCNA 3THML 5ACMA 1G9EA 43CAB 4PGJA 4K8RD 1TMCB 4P2QA 4BZYA 1AJ7H 1S7TA 1LGVA 5B39G 1J8HB 3GI8H 15C8L 4NQCE 4R96A 4Y4FD 1RZKL 3N9GL 4ZTOL 3I6GA 2JE8A 4WWID 1E4KC 4IOIB 5IEKA 3ZKND 3RWGA 1WCQA 3IFOA 2W9DL 1IGJB 4PGDA 3ZE1E 2VZ3A 3DX6A 4OKVB 1C5DA 2D9CA 2V17L 3CZFA 3GSUB 3WNPA 1TVHA 4Y16C 2XZZA 3OZ9L 5F8RC 1GGBL 4HX1B 2CDFA 4NHCH 1NCBH 2P46B 2FBJL 5H94A 1DLFH 3SEPA 1JNNH 1RQ5A 4BJLA 4JKWA 2VZTA 5CJXA 1UM5H 1JNLH 2GCYB 1B2WH 4HKZB 1NL0H 2H2SC 1RIVH 4OCYL 4TNVK 1NBVL 2V2XA 4LF3B 2LU7A 3HAEH 3DGGA 3PUCA 2J8UB 4M1CC 5IFHL 1FV1A 4H20L 2YRLA 3MJ9H 3MV11 4OCNC 5HYSA 5E94B 4Z7WE 3MLVH 3KPOB 3MRKB 4XWGL 5ALBH 5J12B 1UZ8B 4NC2B 4LPCA 4ODTH 5ESQA 3H3PH 4YUEL 4HG4J 2DL9A 2NZ9D 3VD9A 3TBYA 1SBSL 4PJIF 1T2XA 4X0KB 1YNTB 3UTZB 5LGJB 4IMKC 4GW1A 5D7LE 1J0JA 3WKML 4E41A 1INQA 1UB5A 4JM2A 2ZUUA 4JFHD 4KKCD 4QLRA 3O3AA 3WS3A 1GOHA 3LKPB 4RWYH 5INCA 5HHPA 5MEQA 5DJ8B 4GG6F 3U4AA 1FE8L 2R4SH 3L3DA 5GZOC 3HG1B 5DHYB 1LD9A 2NY4C 1R0AL 4PLKC 1A0QL 5GRJH 3ARZA 1MJ8L 2CRZA 4M5ZL 2IAMB 3GIZH 3VW3L 2R1XA 4R7NA 3QO1B 4CL7A 4Y4HA 3C60A 1G6RB 1U91B 2NY6C 4MA1C 1ORQB 1Y18B 1A2YB 4PG2A 4M6AA 3TO4B 1MLBB 1BVLA 1WFNA 4LLQB 3BZ4A 2HKFL 4DFIA 4NT6A 3KLHC 4R2GD 1R6VA 4U7SA 4P5TD 4D8PB 1JUFA 1BF8A 1Q9KA 4X98B 5EFIB 2Z8SA 4G8GA 4OT1H 1PSKH 3UXFA 1QR1B 1HILA 1QSFA 3PJSB 3FO0L 2VWEE 3HI5L 5FF6B 1KJ3L 1JZ2A 1B0GA 2Z31D 3FQXA 1Z3GH 4EN3C 1B0WA 3T2NH 5ANME 4TVPL 4M93C 4PGDB 3GMMA 1CLCA 3RL2A 3MMEB 2DOCA 1NUDA 1F90H 1OARH 2A1WH 1S5HB 1VB9A 5H8DA 3RU8H 3DVNA 1P4IL 4LFHG 3D2UB 1JZ3A 4HIHB 1ZE3C 5JPMA 1U8HB 1YEKH 2X40A 3VFTB 1SY6H 1C1EL 5B38G 2EYSA 2DF3A 4Q6IB 5HHNA 4ENEC 1GGCL 2QSTA 4WVRA 2YXFA 1EFXD 2FZ3B 2V2XB 1TVDA 3MRJA 5I18L 3U48A 5JOFA 5DYOB 4XZUA 8CGTA 4UTBL 1WEJL 5EWIL 4KKBD 5HI3D 3LSOA 2FO4B 4G6KL 1DVFA 3LS5H 3W5NA 5F1KC 1M7DB 1FG2B 3QUMB 4PJ9D 1ZT4B 5F93C 3QULA 2X4RB 5DRZA 4X9IA 5DVKA 1AQKH 3SDAB 1M6OA 1VGEL 4FQCL 3RVVD 4Z0XB 3M1BB 5HSFA 4KMTL 1CGXA 3ZE2F 2CKBH 1S7UA 5E6ZA 3HI6H 2W92A 4OLVL 5CCKL 2AQ1A 3AS3A 2Y6SD 3V4UL 1HZHH 4GW1B 4HCRH 5CIPB 2G9HA 2GI7A 2AJYH 3OJDB 3EOAB 2CIIA 4PY7B 2AGJH 2XY2A 1CE6B 4JM2B 2EC8A 5EOQL 5F7DB 3BUTA 4JN1H 2KL6A 4JQXC 4ZFGL 5MEQB 1JGEB 5BMFL 3CC5B 5JOEA 1VEMA 1CLZL 2PN5A 3BQUC 1DQJB 5L2KE 3EYFB 3KXFA 3O6ML 5CP7B 4OI8A 2CDGB 4ORZC 5C7XL 1A6TA 2R1XB 1YMHB 4FQXD 5F71A 1N6QL 4P9HL 6FABH 4HAFA 5T1DH 2VLJE 3FQNA 4JLRA 2YK1L 1DQTA 2UY7A 4OM1H 3U79A 3HHRB 4X9GA 1FPTL 3BZ4B 5E00B 4I3SL 3GSWA 5FA4A 2XA8L 5DD3L 1KCUL 2EYRA 4LIQE 3FB8A 4PGCA 2P42B 2XQYG 1I1CA 4M43L 4NN7B 4P2RD 4LHUB 1JZ4A 2P7TA 1IC5L 3BPOC 3AB0C 1HILB 3E8UL 1TJGH 2DD8H 2EIEA 2HRLA 4QY8B 3QUMH 1CLYL 1TZHB 1KB5B 3OX8B 3FQXB 2JB5L 2BOCB 3RUGF 3BW9B 2N7BA 4L4JA 4X4XA 3MRRB 5DTFA 3C8KA 3VFRB 4MCYA 4DGVH 3PQYA 5C0CA 4AM0B 3NCMA 1GGIL 4HLZH 3VWJA 2BJMH 3JWNC 3QDJB 1YEDB 1ZLVH 1ZSDA 2FJGB 1G7HA 4ONGH 4WI3A 5DT1H 1IGFH 4FFYL 5JOPE 4L3EA 3SGKC 4Y19B 4NQEA 2AJUL 2ZJSL 4NZDA 1KCLA 5DC9B 2XZAL 4L1DA 5E6YA 4NNXB 4OZFB 1WZLA 4NUGL 1TPXB 1MPAL 1EGJL 1FZMA 5IK3A 4ALAL 4WRLA 3MNWA 1CGYA 4K23L 1I8LC 4B5EA 4YDVA 3VRJA 4O2FB 4G9DB 4HKXA 3T1FB 2Q20A 1DVFB 3VXPA 5DXWA 1KN2L 3QULB 4WFFE 1HDMB 1QBML 1ZHKB 5CGMA 1JYVA 2V5TA 4TTDC 3T1WA 1EXUB 2O5XL 3O4LB 2A77H 5A2KH 2ITCA 5GJSH 4F7EA 2EICA 4NPYA 4N0UB 1AGFB 1FGNL 4MJ6A 4MAYC 5AAMA 3GBML 3QIWB 3UTSA 1MVUB 5C9KA 4XMKH 5B3JE 4Z8FH 4HPOH 1OP9A 5GGQH 2JIXB 4KUCF 3PWUA 3U9UB 3PXJA 4NN6B 1U6AH 5D7IE 3OXSB 4JANA 5IFJA 1OAKH 1KEGL 1NJ9B 3G04A 1FLTX 2Q86A 4ZUUA 2R8SH 2QADD 4EEEA 3QI9D 5CZVL 4JREC 4JRWA 4EI5C 3TF7C 4DZBB 4Y2DD 3TT1L 3KJ6H 5HVGB 4TNWF 4L8CA 5E2UL 3ARFD 2HT4D 1Y6KR 3TVMD 4PTUB 2BVQA 1KBGL 4F33A 1J1XH 4HGMA 4AT6B 4RGMB 2AK1H 2ICEB 3VXRD 5IMKA 5DRXB 1E4XI 3QIUA 5F6HJ 4QRTB 6CGTA 1B88A 1EGJA 5FYJE 4RGNE 3GSQA 2GSIB 1CICA 4GAGH 2VO5A 2ICWJ 1JF5A 3FB8B 5JNYA 2IQAA 3C8HA 5JIIA 3WFDH 2XFXA 2C3XA 1IGMH 2XI9A 2NTSP 4QYOA 4HLJA 1Z0NA 4IOSD 5C09D 1KNOB 5FOBB 3JZ7A 3LKRA 3BP4A 5FUOH 4CVWA 1EBAA 1E6OH 1K9TA 5IVZA 4K94H 2HTLC 4M03A 4AK1A 3QNXB 2OQJA 1TQCC 3G08A 4OI7A 2EC9U 1CGSH 3MRCB 1D7FA 4RZCB 5K9OA 4OV5A 2C4FU 3PQYB 3WO3B 1HKLH 4ZPVA 2F19H 2R0ZH 1MF2L 2ITDA 4O4YH 3RVXC 4PJDA 3P0VH 5JW4M 3CUPA 4JFOB 5BRZE 1WCBB 3ARGD 4P4KA 3HA0A 5SWSA 4OFPA 1K4DA 3W11C 1RUMH 1AHWC 4MA8H 2E7CA 2ARJA 1M05B 4PJHA 2W65B 1JZ6A 2OR7A 1G7JA 5CJ5A 4G80B 4KK6D 5KN5A 2DKSA 3IDXL 4N8VG 3ZDXE 4WW2C 3ILPB 1A4JB 1BQUA 1YMMB 1KOAA 5GS1C 3C08H 3VE0B 2OJZL 4NKDA 3TCLB 1J1OH 5L9DH 4YDVB 3KPTA 1ZS8B 1FC2D 2FNBA 1KELH 1HCVA 4MGXA 3S36X 3ZTJG 5A3IC 3TA3C 1NKRA 2F54B 3PL6A 5EH1A 1N5YH 5HYJB 4KRPD 2WW8A 1TVBB 1IAIL 2GSGB 2ZCLL 3LIZH 5C6TL 1TJHH 5I8EA 4QHMB 1QRNB 3LKOB 25C8H 1OPGL 3VFMB 5D7SH 1YQ2A 4KUZL 4YHIA 5DUPH 3QAZB 5IB3B 1FFQA 3D85A 5DFVC 1P84J 3BMWA 4WWKB 5DFTA 4JANB 1Q1JH 3RWEA 1ZVYA 2BNRA 4PRPD 2Q86B 4KQ4H 4KJYB 4JVPA 4ONHA 2WBKA 4OZHF 1UCTA 1EEZB 4JFPB 5BXFB 5FO7B 5HVFB 1KF9B 2XTJC 3GM8A 4QHUB 4WCYH 1H5BB 4JRYE 5SWZA 5D1ZC 3OKMA 3AM8C 2OTUA 1G0XA 1RI8A 4YLQT 1J10A 3Q0HA 4X6FB 4NO0A 5EO0B 1J0ZA 5DD6A 2Z93A 5DZOA 3FFCA 3OKNA 2HG5B 4NQSB 1L9NA 4KVNH 4D9QE 4LCCA 4HHAA 2IWGA 3GSXA 1NSNL 1QLEH 3VG0L 2AABL 4MJID 4NQXA 4CRPA 5DJZB 4X99A 1DDHA 1TETL 5C0JA 3KPMB 4BFBD 3UO1L 3BP4B 2NXYC 4LEOB 1BMGA 2V9QA 3ALXA 4YDJA 5DR5H 3S5LA 2Q3AA 4WV1B 2OQJB 5C0AE 2WQRA 1N8ZA 3VWKB 3QEQE 2DM2A 1ORSB 3P0YL 3JTTB 3L3JB 4IDLA 1BD2B 1EDQA 1JGUH 1XMWA 1UKTA 3CFDA 2IG2L 1P7QA 4K7FB 5I71B 4ZXBC 1MCNA 2GUOA 3DX9A 1XF5A 4FQIL 3T0DA 3RWFA 3V0AC 5IBTL 2FEDD 5KG9A 4JZOB 4XC1L 1A5FH 5IMOA 3VXSD 4G6ML 4YIQA 5IR1A 4WUKL 2HKHH 3BWUC 4PJHB 1MCFA 2APXA 1I7RA 1G7JB 2BNQE 2XOTA 1W0WA 3GMOB 2Y9RT 2EZ0D 5JW5A 5E99L 1UM6L 2GTWB 4GJTB 5D2NE 5C08B 4YXLL 2BSRB 4UAOC 3QDGD 5J1AA 3PGDB 3NTCL 3C6SB 3CNKA 3OKLB 5GSVA 4NO2B 4FFZL 2LE9A 1OSPH 3DTXA 5SV3A 3H8NA 4QTIL 2MPAH 3C9NA 3B2VH 3UJIL 1URLA 3PP4L 3T2PA 4U1LA 2QL1A 1C7SA 1MWAL 4TUKL 2OR9H 1KENH 5F7NC 3VXMB 4C83B 4PJCB 1Z5LA 2Q3ZA 5DJCB 4UILH 1JNHB 4P23A 1P53A 5FO9A 1MI5E 3QH3A 1CLOL 5CHNA 4YXHL 4PV9A 1AQDB 3SGJA 1OGAA 3NCYP 4J3UA 4L9LA 1T22B 3LRSB 3EJZD 5I66B 1N2RA 2FX9H 1PKOA 3JVGA 3B9AA 2YN5A 3U4BH 3WFCL 4U0QB 4WO4A 2DLIA 3Q5OA 3SQOH 2G60L 1DL7H 4LAQH 4QT5A 3VXNA 5FGRA 2ERJC 3G5YB 4S10A 1AO7A 2Z93B 2DQIL 4WJ5B 4H0IA 3T0EA 5JXAH 4PS4L 4H8WH 2DQDH 5HPMB 4HHAB 2KUTA 4PJ5E 3FCTB 3P9WB 3BPCB 5EU5B 5F9JA 5FGCE 1MAKA 2P5WD 1TCMA 5JHDD 1A7PH 1BJ1J 4MJ2A 3BRGC 1SBBA 2DKUA 4M7KL 1BFTA 3TPUA 3MLTB 1LDSA 1T89A 4RSVA 5CJXC 3VH8A 4BFEA 4WI7A 4ZDHA 1IGYB 1S7XB 4HUXB 1XAUA 2D7NA 4MX7A 5E5UB 1MHCB 3BRDA 3D25A 3DXAB 1MWAA 4RCAA 4XNUL 1N8ZB 1WWWX 2ADIB 1FDLL 2HFFB 2VDPH 3ECBB 5ILTL 1F3RB 3QCVH 3P30L 3FOMB 2UVFA 5ICZB 2V9RA 2E27L 2GK0B 1DBAL 5D1XD 2CUMA 3MXVL 1G84A 5I1HL 4WTZA 1TFHA 1JK8A 2NMSA 1OSZB 2VLLA 5D93C 2FCBA 4DOHB 3GMPB 3G6AB 4OLYL 4NM8H 3VFGH 5ICYA 4WFHD 2RFXB 3ILQC 1RZKC 1CFTA 2BFVH 5EUOB 1RURH 5HD8C 5JMRA 2VLKA 4L4VB 1XGQA 1Z2KA 2IAND 3UAJD 4MSWA 4PJGF 4JZJA 3NGBC 3BP6B 4O9HH 4LQFH 4TPRL 3EYSH 5EB9A 1CT8A 3BUYB 3E0GA 3QXDB 5E2TL 4L1HA 3NABL 1MQKH 1MJJB 2D7TL 1OM3H 5L7XH 4N90E 1YEIL 1XFPA 3BPLB 3HE7A 3OKOB 1LO3H 5CILL 3NBNA 3L5JA 1FYTE 4IBLT 4CN1A 4F37F 3V2AR 2R9HD 3HZVB 1W2KT 1X5GA 5EO1B 4Y4HC 3GMLA 5LWYH 2R0WL 2XG4A 1V3MA 2YBRB 3RX8A 1XCTB 3D3VB 4U1IA 4PG2C 1ZK9A 3QH3B 5CHNB 4O02L 2H2PC 3H3KA 1XIWD 5KOVC 4NQTA 4Y4FB 3L7EA 3QO0B 5D4QA 3PDDA 5GIRB 1AJ7L 1DFBH 2PTUA 4M7LH 1MUJA 4GAJH 1SHMA 3KYNB 5EIIB 1NQBA 3GI8L 4PRIB 3FN9A 3RQ3A 2J5LC 4JG1H 5BS0A 5D7JA 5IM7A 5E8OB 5E08H 1UJ3C 5EU6E 4M6NH 4MNHA 4R7DA 1N7MH 3SO5A 4WW2F 4OLWL 3U7WH 5F21B 1G9MH 4XRCB 1DUZB 1A1MA 4G42B 3MV9B 1U41A 2OZ4H 3OB0K 2IALA 3ZHLA 3RY4A 3MOBH 5C07B 3FT2B 1NCBL 3H2WA 4FXGA 4JQIH 1D5MA 1PEWA 4UOW0 1MLCA 1DLFL 4NNPH 1JNNL 1OQXA 4TRPH 1KTDA 1JNLL 5DURD 1B2WL 1YN7B 3VH8B 1NL0L 2H26B 4D3CH 4U1HB 4ZDHB 1RIVL 1AGCB 4NQCA 2I25N 3OKDB 3W39B 5DK0B 2WINA 2VC2H 3MJ9L 3HZMA 1U8JA 1JYWA 2HFGH 3MLVL 5D2LB 5EBMA 5ALBL 3ARDA 3CX5K 4ODTL 5DEFB 2YUWA 4HKBA 3H3PL 3I6LE 3DIFA 1C8PA 2IPKB 4QXTA 2WWMC 3MBED 1JRHH 5ISZE 1JK8B 4U1NB 3UC0H 1NFDE 2AV7A 1XR8B 4K8RH 3TGXA 3JV4A 3O6LH 3HUJF 2DICA 1PAMA 4KK9D 1U8NA 1I8MB 2ZNWA 1GHFH 4HUWB 2RR3A 3CJJA 4F9PA 1DLHA 1OY3B 3B9KD 2ATPB 4Q97A 3CCHB 4RWYL 2Z8VC 5FKPA 4AQ1B 4Z7WA 4KMLB 1ITCA 32C2A 4OF6A 3FT3B 2R4SL 5HGHB 4J7RA 3BWAB 4WW1B 1HSAA 5GRJL 3KYAA 5JQ6H 4GW5A 3GHEL 3GIZL 4LAJH 3HE7B 5I8OH 3OKEA 4DN4H 3C09C 3TFKD 5C0EA 1RVFH 5E2WH 3MGAA 2FB4H 5TE7H 4CVZB 1A3LH 2IH1B 5EOCH 1ZTXH 3EJJX 4JHAH 5D7LA 4AEHH 3HAEA 4DWHA 2VXSH 3MJ9A 3VU2A 4X5WA 4BSWB 4PJXB 3MUHL 5HVHB 4YBHA 1LO4H 2IADA 4LPUA 5IVOA 1FZJB 5TPWH 1XF4A 4AEIH 2NY1B 4OT1L 4E42B 1PSKL 3Q3GB 4KDVA 4WI2A 4YK4C 2YA0A 3C2SA 1JIBA 3SDXF 2EH8H 4WU5A 2VAAB 1G7QB 2NY2C 5D7JB 4QRRD 3U7YH 5E9DB 1KJMB 1Z3GL 1KTLA 4KXZI 3C5ZB 1V3JA 5DRNA 3MOQA 2R2BB 3W5MA 4FXKA 3QDMB 1T5XA 3VWJC 5MEND 1ZHLB 2R2EA 1Q72H 1F90L 2DI7A 5F88A 1OARL 2A1WL 3JTSB 3RU8L 4WUUB 4RFEB 3KGRA 3BN3B 2QSCH 3I75B 3IRPX 2D31A 2F15A 2J6EH 2ESVD 1GIGH 3C5JA 1YEKL 1OLLA 5DO2D 1SY6L 4LCUB 4GBXB 5I1AB 1WT5A 2F8OA 5ENWB 1UB6A 1FFOA 3LEVH 5L0QB 5KVEH 2H9GB 1OTUC 2VLRD 1OOAA 1U8JB 4ZAKC 4EIZC 5AWNH 4P9HC 1ZGLB 4H25A 5ANMA 4D9RD 3LS5L 5C0FA 2IBBA 3X11B 1DQQB 1ES0A 3FB7B 4P3DB 4N8PA 4JFHE 1MFDH 1AQKL 3ARUA 3FRPA 3BJ91 4X5LA 5D5MB 1A6AB 4QXTB 2CKBL 3HI6L 2COQA 4ONFH 1C12A 1MFCH 2C9AA 5J13C 5EORH 4PRBB 2EIZA 1Q9WB 2EE9A 4HCRL 2AJZB 3G5XA 5I0DA 2AJYL 4YDKH 2AGJL 4UIMB 2CXGA 2HT3C 2PO6B 5JIPA 5I8CA 2VDOH 4LNRA 3VFOA 5I1LA 2NLJB 3DNKA 1VFBB 4JN1L 2CRYA 3KPNA 4LSPH 4XWOD 1INDH 4OKDA 4C56E 3PABA 1KIQA 1L4IA 1IQDB 3MC0A 4LVOB 3L95B 5HDQH 1RY7B 1QPXA 5J56B 1SY6A 6FABL 5T1DL 1KC5H 1RZ8A 2BVUA 4HZLB 3W0WD 1C08A 2YRZA 3LD8B 1P6AB 4OM1L 4I0PB 3QIUC 5DA0B 3CVHH 5I6XC 4AMKH 5KOMC 1DE4B 1CICC 5HHQA 3HNSH 4MA3A 4M1GH 2YN3A 1U8PA 4K2UH 4ZSOE 4Y4KA 1BJ8A 4G6AD 5D71H 4Z76A 4PJFB 3OBAA 4Y89A 4MVBC 2PF6A 4KFZC 1N59B 3WBDA 1IEBB 3T65B 2LU4A 2CKBA 2DD8L 5D6DA 3EOBB 5BCAA 1K5NA 3S37X 3KWWB 4FMFA 3F6IA 3MRLA 3SO3B 3TN0A 4HCRA 2VLJA 1PZ5A 4DGVL 3F65A 3G5VB 1CN4A 4JFED 5LJYH 4L3CB 1IAII 2BJML 2FIKB 1T1YA 4OGXH 3PG2A 2XTLA 1U36A 2OS7A 1S7RB 3O2VH 1IGFL 3BVNA 4P4KC 1ED3B 4JO4L 4GMSH 3C5JB 3HC3H 3IDNB 4GKZB 1RUQH 1G0YR 1PX3A 1YQVH 2DMKA 3EUUA 3HI1A 2O61A 5HHXH 2FH8A 5K93A 5IB2B 4IRZH 2DWDB 1KYOJ 2M2DA 4FQQA 5CJQH 3V6BR 4MB4A 1RZFH 3H6JA 4P49A 1A7RH 3TYFA 2DM7A 1Z9SA 1SQ2N 2Z4QB 1T21B 1SVCP 3PL6C 5C92A 4IRSD 4XPTH 2P5EB 2A77L 2AXGA 5GJSL 1C16B 3BHBA 1YPZE 4JAMA 1NGQH 2L4OA 3BO8A 2FYYA 3STZB 4KAQH 3N1QC 1RZ7H 4XMKL 1UENA 4Z8FL 1QLFB 3QQ9C 4HPOL 3ZE2E 5GGQL 2HLFD 1F3JB 4JO3L 3MRIB 1BZ9A 3CVIH 1U6AL 2X4NA 1AGEA 3IYLW 3VFOB 5BZDB 1OAKL 3PWPB 2R8SL 2ZNXA 3ZKQD 3I50H 5IMLA 5FM5O 3DVIA 4YDLC 2K9UA 4YFLI 2YPLA 3PHOA 3TP4A 4PJ8A 5J6GA 2ILLA 1X6NA 4LOUC 3MZTA 1I1FB 5BVJB 1WUNT 3JWDH 4OGAD 3KJ6L 3U36B 1CFSA 3VD3A 2ADGB 3SKMB 1WK0A 4GRWB 1U3HA 1RULH 2IH3A 4WIQA 4WTXA 5H35B 4AL8H 1J1XL 2X2YA 4YC2C 4NRYB 2AK1L 3BSZH 4MD5B 2A6IB 4LHJB 5C1MB 1MREH 1RHHA 4N1HB 1FJ1B 5HHOE 2DQHH 1OTSD 3QZWA 4PG9B 2CDEA 4EI6A 4LCCC 3QUXD 5F9DC 4P48A 3RJQB 4GAGL 5D7IA 3PWLB 3SKJH 3MNZA 1KXVC 4MA3B 1TIUA 1IGML 3PNWB 5FGBA 5IQ7H 1ZLVK 1IFHH 3HLAB 4BQ8A 1H3TA 3S36H 3V5HA 5L2KB 2XN9B 1RK1A 1CXEA 5FUOL 1WBZA 4BH7B 1E6OL 3S96B 4U31A 4K94L 5GSRB 1X5XA 2EDWA 3RVWD 4JKPH 3E3QE 1CGSL 1HHHB 4KI1A 1QUNA 3J8F7 1DN0A 4F3FA 5F7WC 1HKLL 2F19L 2R0ZL 4O4YL 1DQLH 1II4E 3P0VL 2K7PA 5IF0A 5DHVH 1S9XB 1F4HA 2F74A 2DQFB 3RUGE 1A1OB 4HJJH 2DQGL 3P11H 2WBJD 5I1DA 5LAXB 3QCUH 3QPXH 4R4NC 5ERWB 3RWIB 1RUML 2EKSA 1VGKB 1ZWIA 2FATH 4MA8L 5C6WH 3H7BB 4F9LA 1NMCB 2WIIB 3NZHH 5HYQA 2OJEB 3QHZH 1SJEB 4UDUA 5ADOL 3C08L 1A7OH 3RA7H 2ZSWB 5FECB 2PXYA 3WLWC 1J1OL 4H88H 1KT2A 5L9DL 3P0GB 3W81A 3VCLA 3O8XA 4UT7H 1KELL 4YZFF 1D5XB 1CG9A 4YR6B 5F9WB 5BRZA 1A7NL 1I7TA 1F4AA 1VFUA 1XH3A 1UA6H 4MD0A 2PYED 4QRQB 4HUUB 3SGEI 3LIZL 1TJHL 1VKXA 2CUHA 3HE6B 4JAMB 3PGCB 3BZFB 3BO8B 25C8L 4GOSA 4U05A 5TE6L 3GEWB 3TBTA 2VUOA 3SE3A 5D7SL 4P23C 5DUPL 3K2UH 1I1AB 5CEYA 4Z78B 3OQ3B 3IKCB 5DJ6A 2G75A 1Q1JL 3SGJC 1SJHB 4L9LC 2C7UB 4YNYB 4KQ4L 5A2FA 1WICA 3R1GH 5KSAB 3JVGC 3KYOA 1YY9C 3SDCD 5BOZG 4GLRH 3VXUD 4Q7DA 3MRDA 4WCYL 4WO4C 3HZYB 2K1MA 1SYSA 1OGTB 1T20B 2OP4H 2ZUQC 3TIDB 4M61A 2A9NH 4M7ZB 4JDVA 2Q7YB 4G6FD 1I8IA 4M4PA 1FIEA 5E8EB 3QZWB 3F5WB 4KVNL 3T0EC 2CDEB 3QWOB 4EI6B 1QLEL 3O81A 3QBTB 4OFIA 4IRJD 5I9QB 2M1KA 4ZPTA 2EDLA 1MY7A 1PYWB 3MNZB 4LLUB 3RP1A 3MYJA 4BQ9A 1FCGA 3MV8B 4E5XB 2D9QB 3NCYS 2IGFH 1NGPH 4JRYA 4P46C 3O6FB 5DR5L 4GKOA 1MH5B 5KSVB 4RA0C 5KSBE 5MP6H 1SMAA 3I6KA 3MLYL 5HHVH 3TBVA 3TNMB 5KZCB 1JGUL 1PX4A 5ESAA 5DF0A 2R2CA 1UEMA 2NY0B 4JJHA 1A1NB 4KPHH 5DK2B 4BQ6A 3OHXA 4YPGB 4JN2B 1TITA 4NQDD 1TTUA 4WEUD 4MDJA 5DS8A 5HGDB 1A5FL 3ULVF 1KPVA 5E5MB 1J12A 1U8IA 3SPVA 5I1DB 4GRLB 2HKHL 2BXYA 1RD6A 4U1SB 1IKNA 5I2IA 4KK5D 1NUGA 3U1SH 1QVOB 1G1YA 4U0RB 4UDUB 1QRKA 1MCLA 2BHUA 3E6HA 3OV6A 4O00A 5C0AA 5IWLA 3QEQA 5DMIH 1KT2B 1CFBA 4JZJC 3D69A 5MERB 3KHQA 1MCOH 4Y5YC 1OSPL 4Z7UB 3DX7B 1I7UB 3UDWA 1CTNA 3BIKA 4PRPE 3NFPA 2C3VA 2MPAL 3PHQB 2JF1A 3KPRB 3B2VL 5C71A 3ULVD 1S5IH 3T09A 3IFNH 4XAKD 4NKOB 1B6DA 4OLXH 3RIAK 2OR9L 1KENL 4YE4H 1N3NA 4UILL 4ELMB 1I3VA 1H3GA 2BNQA 3D87B 1TTFA 3NCJH 1A3QA 3C87A 2ICWA 4X6EA 5I1KH 3PGFL 3OAYH 4H26A 5D2NA 1EMTH 3NOIA 2X89D 2FX9L 5IIEB 4JY6A 1FNAA 4OUUB 3U4BL 4I4WA 4MJIE 1VDGA 2X7LB 4ODSH 5GZNC 3SQOL 4Y0GA 3G6DH 2VRAA 1DL7L 1YDPA 4LAQL 2A9MH 3V79C 1JHKH 4LP4A 2I27N 3BIBX 4FFWD 2WWKT 3D39D 3FQTB 3IDJA 2KBGA 2P5WB 5JXAL 5I76B 2MOVA 4H8WL 3MX0A 2DQDL 1KG0B 4XXDA 1MI5A 1LEIB 5CD3B 4APQB 1KGCE 3LQZB 3UYOD 1E28A 5DJAB 4B50A 3QIBD 1FVDB 1M7IA 1RJYA 4U2YA 4PPTA 5EZJA 1XZ0A 3DMMB 4FFVD 1WGOA 5B39B 3WE6B 5HYSG 3VXSE 4E0RA 5INDB 5T1KA 2NY3C 1FL5B 3AGVA 3QCVL 3ARDC 2XYCA 2GT9B 2Y06H 5EBLA 5TDNA 1JZ7A 4PJ5A 4XGZA 3QDGE 1LMKA 4QCIA 3ULUD 1WFOA 3QRFM 4G9FD 1T6VN 1X5LA 3TH4T 2KQNA 4I18B 4PJBB 3MOAH 2UVEA 4N0FA 3VFGL 4OZ4A 3LEXA 3KPSB 2P24A 2PW2A 1OF2B 4ZS6D 4EDXB 3VA2C 2GJ6D 3DBXA 3BE1H 2BFVL 5HXMA 1JHTA 1RURL 2JJWA 2AK4E 2MHAA 4F9PC 2OI9C 5D6CB 3L5WB 1YNLH 3BKJH 4RISH 3WDJA 2HVKB 4X8XA 4KK8C 3P40A 2FSEA 3ZTNH 1QFWH 3BH9A 5DJYB 1BPVA 3VD5A 4O9HL 4LQFL 4FTVD 5KVMC 2CPCA 3EYSL 1PW3A 4AIXA 5BJTA 4M62H 3BIKB 4JM4H 4NHUA 2B4CL 1JWSB 5E6IB 1OM3L 5L7XL 4UQ2B 1VA9A 4PRNB 1LO3L 1A14H 1Q0YH 3WEXA 3OF6D 1D6EA 2QLVB 4PR5A 4J1UA 3O3DB 4OI9A 1LK2A 4JFFD 4ZQKA 3GSOB 5LWYL 2XICA 4GG8B 4CDGC 1T03H 4HS6A 4J4PD 1P84K 2XPGA 2X42A 1P6FA 3B3IA 4XI5C 5H37G 4M48L 3P9MA 3MCKB 4KROB 2GJZA 5IQ9A 7FABH 5CD5C 3UPRB 4LRIC 1DFBL 2YZ8A 4M7LL 4HBQA 4GAJL 1D9KA 1F3DH 4IM8A 1R24A 4GMTH 5JHDE 4EQ2A 3KS0H 1ETZA 3QNYB 4JG1L 5E8PB 1HYSD 2GHWB 5E08L 3CFKA 1W0VA 4HIJA 3BI9X 2PETA 4M6NL 2HVJB 1N7ML 4U1JA 1FYTA 5DSCA 7CGTA 1G9ML 4KZEH 3RVUD 4HIXH 8FABB 1HWGB 3DETC 2OZ4L 5B4MC 5A2IH 1JPSL 2XQBH 4XXDB 3RGHA 1CVSC 5DVLA 2CK0H 1X7QB 3MRMA 2PTVA 3MOBL 3X3FH 2VOTA 1YEJH 2MKLC 4JQIL 4PBXA 2PTTA 4NNPL 3Q6FA 4QHKJ 4TRPL 4EJ1C 5DEGA 2HT2D 1BZQK 5KANI 5FYKU 4LARH 4D3CL 1H0DA 3O6KH 4LCWD 1U8MB 2UZIH 1WT5C 4RMWA 3GJEA 3BPNC 3VGGA 1I7ZB 2VC2L 1FNGA 4R3SB 1NGYB 1S9YB 1WTLA 3BDYH 3MUGB 2MQCA 4NBXB 3RBGA 5EU6A 4WFHE 1L7TH 4DVRH 1YN6B 1T0NA 1VACA 4L8DA 4M6OH 4YFLF 5FYKD 3RWDB 4Y1AB 2EDJA 1H15A 3TZVA 4R90H 2JELH 3EYVA 4KJPC 5ADPH 3N50A 4PJ7F 4JVUA 3IDGA 1JRHL 3RZCB 3UC0L 4K8RL 4KKLC 5B38B 2D4FA 5I75C 5EBGA 5AZ2H 1I3UA 4U6YA 5IW1B 1GHFL 5C0NC 1S7VA 1SEBB 4PLJD 4JRXD 2MHAB 2QHRH 3W9EB 2W38A 1LDPH 1ZVSB 3SGDH 3IXTA 2DYPA 2FSEB 3BH9B 3C6LD 5CZKA 2OZ4A 3DURB 5C0BD 1OQOA 4MNQD 3K1KC 1CF8H 4HC1H 5EU7E 2H32B 4KMQA 1L6ZA 1Q38A 1A7QL 5T3XD 1XGTA 2ARJQ 5DHXB 4PJGE 4L8BB 4OM0H 1NBYA 1KIRB 5I8OL 3LV3A 4UNVA 4PR5B 4HXAH 5TE7L 1NFDA 2FB4L 4ETQB 1A3LL 2YOCA 5BOPA 4OZIF 5EOCL 4M02A 5C0GA 4L4TE 2CMRL 9CGTA 4JHAL 4AEHL 2V2WA 3QXWA 2VXSL 1R3IH 5CWSA 5TH2A 3D18B 3RGVA 4D2NA 2VZVA 3P9MB 3TBSB 1AI1H 2X9XA 2EEBA 5EUKB 2X4TA 1LO4L 2P8LA 1F42A 5TPWL 2AQ2A 3RL1A 3WO4B 4AEIL 2ICCA 4Y4KC 3FT4B 3FQWA 4LL9A 5T1LA 1QOKA 2EH8L 4JB9H 3QFJD 2V7NB 1NCDL 3U7YL 3TO4C 1QBAA 1UVQA 3O3EA 1IBGL 3EZ8A 5F96H 3P4MA 2VITB 3TN0C 5JW4Q 2D0FA 2MTPA 3X17A 4MS8D 1NGXB 4RIRB 5CBEA 1HXMA 1Q72L 1MAMH 2QSCL 5IKCA 2B0SH 3DRQA 4UQ3B 4ZNEE 1N6UA 2J6EL 1GIGL 1BVKB 3IGAB 3KAAA 1MCJA 5DEGB 3WJLA 1W72B 4TOYH 2H6PB 2GAZA 3K8MA 1XGPB 1PLGL 2X4SB 3KYKL 4ODVH 3LEVL 2FX7H 2GY7B 5IV2A 1KJVA 2VDMH 1JJUA 3B8YA 5AWNL 3MREA 5F97E 4G6JH 4KHTH 4AEFA 1J0YA 3FO1A 2B39A 3P4OB 5CJ8A 1MFDL 2X1XR 2I9LA 3P4NA 2JJSA 4XNYH 4ONFL 4BZ2L 1MFCL 5EORL 3ORJA 1EVUA 1CD1A 1H8NA 4NRXA 4NQUA 4U6VH 4YDKL 1ZHBA 2HJKB 5ITBL 2HJLA 2VDOL 2DL2A 3AROA 4PREB 1EAPA 3B9DA 2PCPA 3SCMD 4DJMA 3S88H 3HUJE 3QPQC 4RAUA 2MCG1 4LSPL 5MHSE 1JPGB 5J9PB 3DV6A 4UUJB 3NIFE 4PRHD 4WFGD 5FKAA 1HEZA 2EXWC 4F8TA 2B1AH 4PJ8C 1ROWA 1U95A 5HDQL 3ULSA 2NW2B 2EXYD 4X6CB 1CQYA 2J6EA 1S9VB 1U3HC 1BHGA 2OK0H 3LV3B 3FB6A 2BNUA 5ISZB 1AKJA 1I3GH 2AI0H 1BX2B 4P4RA 1EIBA 4Q58C 4U3HA 3V5DB 4EUPA 4JDTH 5B8CB 3PIQB 3CVHL 3K0WA 1BQSA 1SMOA 5CWSB 3DVGB 4AMKL 1W72H 4M7JH 3ARSA 3RGVB 2JB6A 5DRWB 3PDOA 2LVCA 4QTHB 2YD9A 5C8JA 1JGVH 5C86A 1Q9OA 3HNSL 4M1GL 5IFAH 1CIUA 1E27A 3O9WC 4K2UL 5MENE 4YBQC 1MCDA 3PV6B 5D71L 5LG1A 4C56A 2A74B 3AFLA 1P2CB 3GI9H 4CADA 1KCSH 1B9ZA 4N5UA 2ESVE 4P5TA 5LBSH 4JFYB 5F7EL 3S97C 4XHQA 1BFVH 1UVQB 5D1QB 2XV6B 5HBBA 3S4SA 3SDXE 5KJRH 4WFED 4OGXL 1DR9A 2VIRB 3A6CH 5GRUH 3MJ6A 5T3ZE 5E70A 1KPUB 4ZO6A 3UZEA 1FH5H 3L7FA 3O2VL 1LEGB 4HGWA 3L3GB 4Z7WF 2FWOA 4RGNC 3HCVB 2X05A 1BZ7A 2V2TB 4GMSL 2DBLH 2V7HB 2HFTA 3HC3L 2JK5B 4UU9B 4ZSOA 2CLRA 5AYQA 4V1DE 3LMJL 1RUQL 4F9LC 2OTWB 4P2OD 1RJZB 5BV7L 5HHXL 4ODUA 1N5AA 3CH1A 3EFDH 4TUJA 4NSKB 3RTQB 4M8VA 1K2DB 3MCG1 4HQQH 3P77A 5CJQL 2PXYC 3MFFB 4YBLC 1HHIB 4JO2H 3D48R 1RZFL 2MJWA 1EFXA 3O8XC 3F8UB 1A7RL 3OR6B 3QJFA 4WEMB 1G6VK 4QRPB 4XPTL 1WBYB 4ISVB 5GRZA 4XMPH 1SJXA 1MIEH 2X4UA 4PJ9A 2UYLA 1QYGH 1NGQL 2L7UA 3VRIA 3AREB 4KAQL 4XX1E 5JLZA 1RZ7L 5EOTB 3L9RB 1NC2A 4N8VB 4GUPB 1BFOA 2V5MA 3SJVD 4LKCA 3ARBD 4Q9BA 4K94C 4P2QE 4XPHH 3CVIL 5F6HI 3QXAA 3ARVA 4KGLA 2WNGA 1G7LB 1KCVH 3W0WE 2SEBA 4GS7B 5FK9A 5DMGD 3I50L 4TQEH 5GGRA 3DV6B 2PW1A 2ICWI 1IT9H 5DJDA 4HH9A 5FKAB 1RZGB 1U95B 3JWDL 3SE8H 2P8PB 3O2DH 1VEPA 4OBSA 3DYOA 1RULL 1TQBB 2MCPH 5FDWB 4AL8L 4XC3H 2K7QA 3DVFA 5CBAA 3L6FB 3FB6B 1SYVB 1AKJB 5JW4R 3MV7B 1HH9A 3BSZL 2EC9T 4NN6C 1Z6JT 3VD4A 1YPZA 1DQDH 4KV5F 4U1GB 1MREL 1KFAH 4GO6B 1T5WA 2DQHL 2C4FT 2VDKL 3QUYD 3WN5A 3GMQA 2ZG2A 4PJIB 4FQXA 3HMXA 4NOFA 3R06B 3ZKXB 4JY4B 3U82B 1J1PH 3OSKA 3RWCB 1U42A 4JFEE 3QUZC 1FNEB 3IFLH 3BH8A 5DJ0A 1E27B 1CL7H 5IQ7L 3S5LG 1VERA 3K8KA 3S36L 4ZUTB 1RUAH 1J8HD 3MNVA 5HY9A 3EYOA 2J8UF 3MA7A 1NGWB 4JKPL 4LLVA 4GG6B 4X4YB 2P49B 2DN7A 3NIDE 3K7UA 1SVZA 4GRMA 1WAAF 1S7QB 3O3BB 1PEZA 4YHYB 4MDIA 1DQLL 5HHOA 3OKYA 1U8KB 4CVXA 2YUZA 3L7FB 1I9JH 5L8KB 3FL7A 4OQTH 4LSQH 4JG0H 3BEVB 2VR5A 4HJJL 3MROB 4F7PB 4E41E 3P11L 3AAZA 3KHOA 1FVEB 1NMBH 3EO1A 2WLYA 4AY0A 3QCUL 3QPXL 4MLSA 3STLA 2FATL 1Q9LB 3SDDB 2HMID 4YFEA 2OSLA 4HJGA 2ID5A 4ZSOB 5EBWB 2F8XC 1R5VB 1IC4H 4HWUA 1BLNA 2AKRA 3NZHL 3IDUA 3W2DL 5IB5A 3QHZL 1NAMA 5D96B 2EDFA 3HR5B 1P7KB 3RA7L 4H88L 1T3FA 4QHLB 5CJBA 5IWLC 3PWJA 4UT7L 3QP3A 1LWRA 4RAVB 1BIIA 1HKFA 5J0BA 2G5BA 4NFCA 1I75A 2BSTB 5DQDH 1KJ2B 2QQNH 5F9AC 4CBPA 3DO7A 3RUGA 3UDWC 4MB5A 1UA6L 2X4UB 3CDCA 1RU9H 4O51A 2B20A 2DLFH 4H1LA 1E4JA 3KPPB 4KGJA 1OT2A 3MA9L 3V6OE 3H9HA 2HJFB 5D7KE 1FCCA 4I3GA 1BFOB 1CD0A 3K2UL 4G8GE 1JWUB 4DKAA 4HH8A 2QSQA 3QXAB 2CIKB 3VJ6B 4G8FB 4TSBH 2Q8BH 5D2NC 5TF0A 1MCWW 5CEZD 1DUYA 3MGTA 4Y5VA 3V6ZA 5GGRB 35C8H 3R1GL 1H3XA 3MUJA 1HNGA 3VA6A 4BM7A 5DHVA 3HG1D 2A0LD 2D03H 3T4AA 1KEMH 5E24E 3I02A 5FO8A 1KPRA 2IAMD 4HIIB 4LSUH 3QI9A 4DK3A 2MSPA 2A9NL 1GZQA 1PDKA 1R3JA 2VYRE 2OBGA 3Q5YA 1CDGA 1D6VH 4JE4B 1QFOA 4Y2DA 3BP7A 4XH2B 3SE9H 3ARFA 4PGBB 1NDGB 3TVMA 1GGUA 1J05B 4F2MB 1U8LB 1TCRA 3WXWL 4X80H 3VXRA 2J8HA 4XBPB 1Y6MR 3GIVB 2I60H 3H42H 4NDMB 2OL3B 4I8DA 1E4KA 2YZ1A 4GSDH 4DAGH 2VH5H 2IGFL 1NGPL 2ZOLA 1YEGH 4X7CC 4RDQG 5MP6L 4Y16A 1HI6B 1UH3A 1X5AA 5I16B 5HHVL 1KB9K 3UTTB 1KLUA 1EAJA 5C09A 4POZD 1NMAH 1ZAGA 3TLRA 1IVLA 4KPHL 1QZ1A 4WTZG 4XNMA 43C9A 3CXHK 2G2RB 3M07A 2R2HA 2E3VA 1Y0LA 3H9SB 5C0IB 5M94B 2FBOJ 3D2UD 1EERB 1UJTA 2APVA 1YY8B 1LE9A 2AKRB 2P4AB 3ARGA 1AR1D 2BOBB 3U1SL 1NAMB 1KXTB 3MRBB 4Z7VB 2NXZB 5KSBA 1IILE 2HAZA 4NYLA 5DMIL 1UWEH 1T3FB 3VXQB 3IJHB 2Z92B 5B3JF 5DC4B 1ZLWK 1X9QA 2OMBA 5FUCE 4H8WC 1C5CH 1MCOL 4FABH 3SDAD 4IMKA 2YMXH 5K9KB 2NY5H 1ND0A 4QF1B 3RUGB 2R0LH 1S5IL 3IFNL 1S78D 3NCFB 4U6XA 3TNNA 4IMLA 4PP2B 5BQ7A 4OLXL 3CDGA 3WHE0 4XTRD 4YZFE 4YE4L 4H1LB 2AJ3A 3CK0H 3EOTH 3TJHC 3VXUE 2DI9A 4H0GA 4N9GB 4DZ8A 4F7TA 2VXUL 4KJWC 3U2SB 4RFOH 1JFQH 1QSEB 3NCJL 3EDJA 5I1KL 1KIPB 4JM2D 2OL3H 2QQLH 1EMTL 3PP3K 4S1QH 3MGTB 1K3IA 3OG6B 3QCTL 4OFDA 3WHXA 4KTEH 3V7MA 3HC0B 1EH9A 4ODSL 4CW1A 5MI0B 2HTKC 5DZNA 3G6DL 1NDMB 5FO8B 3IJYA 2A9ML 3EYQD 1NFKA 4PRPA 4HUVA 4S1SH 1JHKL 1JP5A 3LPFA 2WANA 5I1GH 1R3JB 3C60D 5EDXA 4L3EE 5C3TA 4G7YH 5E2VH 4ORGB 4Y88A 4KJQC 3REWA 3T77A 4KH2A 1C7TA 2YC1A 1D5ZB 2Z8RA 4ZOCA 2EO1A 4OCRH 3SY0B 3LS4L 4JFDE 3VFPB 3S7GA 4LHUD 3U4EA 4MAUH 3V6FB 5E7FA 3VXOB 4R0LA 4NQDE 1MAJA 4MJIA 4H5SA 1QSFD 4NZUH 5KTEH 2DQEH 1X5FA 5ICXB 2O5ZH 4LPXA 3ULVH 1NLDH 1BECA 1FC1A 1LO2H 2VXVH 5E56A 1IL1A 1RJCA 5FDYA 1P7HL 3CFCH 3RPIA 5GS0D 2GY5A 3QDJD 3VFUA 5IMMA 2Y06L 1OW0C 3IU3B 1IM9B 3TZVC 3LKSA 3X12B 2GKIA 3B8SA 2AAVA 2J12B 3O41A 3QNZB 1ZLUH 3BOVA 3MOAL 1EEYB 3AUVA 1JWMA 1F4YH 1S7WA 3GB7A 2A6DB 3V5KA 2XXMB 1KULA 3BE1L 3ULVE 3ZYIA 4XAKE 4M00A 1K6QH 4XP6H 3RDTC 3VXSA 3D5OF 4RISL 1YNLL 3BKJL 1PQZB 2CLVB 4UBDD 5JR1H 1EV2E 2EDBA 3HB3C 3VFNB 2E7HA 3ZTNL 1DVFD 1G9MC 1QFWL 2DLTA 3UEZA 1U93B 4WEBH 3FHQA 3F7PC 5DLMH 4NRZA 3OAYK 4M62L 2X1PA 3QDGA 3BESR 1CU4H 4JO1H 4JM4L 3O4LD 3TV3H 4YWGH 5CP3H 3FTGB 4CNIB 3CFJB 4U6XB 2AJVH 1UQSA 3HAEG 3D1MC 2AJ3B 1B0RA 3LHPH 4DZ8B 3QIWD 1O5DT 4CN4A 4BKLA 1T03L 1NANH 3N1GC 1JTOA 4KQ3H 3F7QA 2EE6A 2JIXD 3BQUA 5ESVA 4ZFZA 2YD8A 4WY7H 3PWVB 5E1AB 5JTWA 1IGTA 2NY4B 2NQCA 1U8QB 3BD3A 7FABL 2VQ1B 1I1RA 4X9BA 5DVOA 2F53E 4FG6D 4MNGE 1HHGA 5E1HB 2NY6B 1A47A 4MA1B 4CW1B 4J3WA 5TJWK 4B7LA 2J2ZA 3GSRA 4L8SA 3IDIB 3MLZH 2X4QB 3KDMA 3LRGA 1HE7A 4LRNH 3ULUH 3QXUA 5E8NA 4NJ9H 4K8RC 4K9EH 1CDYA 1CXHA 5IJKC 4KZEL 4PJEA 4HIXL 2UUDH 2NCMA 1KLFA 1JGDB 5IJVB 2XQBL 2CK0L 2W60A 3DECA 3OPZH 3A67H 3MJ8B 3X3FL 3ZKNC 3S3JA 3JUYA 5AD0B 1LP9B 3O2WH 4EN3B 3WJLC 4LARL 1AIFB 1D5BA 3B6SB 3O6KL 3KPQB 4M93B 4X5XA 4PIRF 4PV8B 4KZDH 2UZIL 5JHDA 1MFEH 1A3RH 1AGDB 5ID1A 4WDIA 3M45A 3BDYL 4OFKA 3RWHA 4UDTA 1R5WB 5HHME 4OZHB 4OLEA 1L7TL 5DQ9A 3FRPG 4LSTH 4DVRL 1S9WA 2GJ6E 3PQYD 4M6OL 4A6YB 1S7SA 1VESA 1X5ZA 3RPIB 4KDTA 3VFUB 4R90L 2JELL 5EIVA 1RUPH 5ADPL 3KR3H 1VCAA 2JJSC 2QKIB 3ZYZA 3HKFA 5CSZA 3UP1A 4FTVE 4JRXB 2P8MB 3QFDB 3T8XB 4DVBA 4N0CD 5AZ2L 3WIFA 1I8LA 1S7WB 3T0VA 5D1XA 4DFHA 4FQPA 2NZ9C 4WNQB 1QKZH 1QO3A 1IM3B 1JMXA 1YMMD 1RIUH 4JFFE 3DYPA 3FFDB 1LDPL 2HWZH 4U1MA 1S3KH 1CXKA 5DJXB 2WSKA 2VSDA 4ZUVA 2YPKA 4FZ8H 5E4EC 3DROA 5FIEA 2VISA 3GK8H 1X5JA 4R4BA 1CF8L 4HC1L 2F54D 1I8KA 4MAYA 3TJEH 4KKCC 3WFZA 1T04B 5HYJD 2DQJH 3D6GA 4I77H 2JJTA 5DGRA 5HJ3B 4OM0L 1BM3H 2ARWA 4HXAL 1YECH 1P4BH 4R8WH 1QRND 5F7LB 1LE5B 3AU1A 3ZSSA 3OGOE 3MJ7A 5DMJB 3H7LA 1UWGH 1RMFH 4G8EA 3GJFB 4EI5A 1FO0B 4HDIA 1FIGH 1R3IL 2AK4B 3HS0B 2E9IA 4WWKD 3LKNB 1AI1L 1MHHB 3MRNA 5ALCH 1CXIA 1IKFH 3BGFC 2Y25A 3WSQH 3QFJB 4LLAA 5FYKH 3OR7A 1CFNA 4EQ3A 3IJSB 1XIWA 2EDDA 4JFXA 4JB9L 4R2GC 4PJGA 5F3BA 4P5TC 4EOWH 3BD4A 3U0TA 1GPOH 1H8OA 2BCKB 1ZT1A 5F96L 4LCWE 2FR4A 4BFGA 3FONA 5J06A 5KANG 4L4TA 1D3CA 4Q6YA 2ZUWA 1QQDB 3BPOB 4BSJA 2W60B 1RK0B 3UTPD 3AB0B 1MAML 2Z31C 4PRAA 4BQBA 3MACH 4LVNC 2C1OA 4DCQB 4YGVB 5IOPB 4OGYH 4IJ3C 4HC1A 2YEZB 4I2XB 1QLRA 4TOYL 3U30C 2IBZY 4ODVL 2BP3A 4LLYB 4BELD 5J6HA 2FX7L 5T3XH 3SKUD 1OD9A 3FQUA 4LCIH 3S98A 3HPJB 4WDIB 3VWKD 2VDML 2OXGA 1ZA3B 3HPLA 3CX5J 1AY1H 4NUJB 4KHTL 1BD2D 2WLZA 5LVEA 1YJDH 4U3XA 1ZHNB 2EEAA 2MKWA 3WNOA 3ZMRA 4U49A 4ZG1A 3NFNB 5F1IA 4D0BB 3TIEB 4XVTL 1JPFB 4HAGA 1PKQE 4XNYL 2VSCA 4JPKH 1IZKA 4KKBC 3STBA 4F37K 3FOLA 5HI3C 4ZNEA 4PJCF 4PJ9C 4XBGB 4ERSH 5IGXH 4P2YA 5T3XE 1Q94A 4G8IA 2NTFA 4U6VL 3RVVC 4PJ7E 3MBEA 4HLZG 1QO3B 4I9WE 3TA3A 5C08D 3VI4F 5KS9B 4C4KT 4X6DE 1G7PB 3S88L 1NAKH 4NFBA 1KIUA 2Y6SC 3ROOB 1XGYH 3DROB 2FJFA 3IB4A 3HZKB 1HWHB 3B9KA 2B1AL 2BRRH 1I1YA 2HFEA 2Y5TB 3GGWA 4HKJB 3EAKA 1G7IA 2E8ZA 3QZWG 4XCEA 4I48B 1E0OB 2L0DA 4CGTA 2ZSVB 1HSBA 3VXMD 1I3GL 2AI0L 1QFHA 2PYFA 2Y23A 2NR6D 3QQ3A 1I3RB 3KG5A 2LTQC 1AXIB 4G8EB 4YO0B 4JDTL 4MCZB 4JREB 4EI5B 1ZA6A 1K8DB 3WN5C 5HDLA 1W72L 4M7JL 3EO0A 4NNYB 4FQXC 5EPMB 4OZIE 1JGVL 3MRNB 3HUJA 3AM8A 5IFAL 1FFPA 1WBXA 4PTTB 1IAOB 4OGZA 2I5YH 1OP3H 3QEUA 2W0FA 3GI9L 1KCSL 4RQQA 5JORA 5EC1A 4FQHB 3OXRA 3GDBA 5LBSL 4UV7H 3KJ4C 4HWEH 1BFVL 1FNFA 4XPFH 4ZFOB 4LCYA 2FR4B 3FFCD 3K74B 4O2EA 5KJRL 4LHQB 1KTKE 5DJ2A 5GRUL 2N4IA 4QRRA 2KZWA 1FH5L 1M71B 1FL6B 2UWEA 2D0HA 2YHGA 4JVWA 2ZG1A 2DBLL 1DP0A 3L3KA 4NO5B 3GFUA 1TQCB 5MENA 2FEEL 3LN4B 1EJOH 4HD9A 2EH7H 1A6ZB 3UMTA 4QOKB 4CMMB 3JWDC 3DRTB 4BFIB 4BH8A 3EFDL 5ACZA 1K4CA 2ESVA 5T1MA 5ETUA 4GLRI 1QBLH 2D7MA 3KNBA 4P5KB 4TYUA 1HINH 1NBZB 3HPLB 3SKNA 4HQQL 4LK4A 3EHBD 4KI5D 3D0VA 4JO2L 2BC4B 3LZFH 3UROR 3QA3B 4ZFFA 3B4NA 3SDXA 3Q6GH 4GKNA 1VFAA 1AHWB 3FMGH 5F3HA 5HGBA 4HWZA 1K8IA 4QHNB 2ENSA 4QKXB 1AGBA 4I5BB 4X7TB 2GYSA 4XMPL 1I9IH 1VADA 1T7XA 4WW2B 4K7PY 1MIEL 1S8DB 5A16B 3OAZH 2AV1A 1GJIA 5IEHA 1QYGL 3MZGB 5GS1B 4MHHI 4F7MB 1ZOXA 2FLBT 3T4YA 3KYMB 3VGAC 4HFWB 4WHTB 2DTSA 4G8IB 5EULV 3IS1X 3X13A 4JDZB 5EU4B 3VFWB 4XPHL 5IBUG 4AYFA 4D0CA 1OB1B 4L4VD 1KCVL 4ZUSB 4IOFD 2ATKB 2RB8A 3WFHA 4TQEL 4F7CA 1IT9L 4Y5VC 2EYTB 1YEHH 3GMNB 2VABB 4Y7MA 1YA5A 3V0VA 2R1WA 4YPJA 3T2OA 1XF2A 3SE8L 4GQ9H 3WL9B 3UTOA 3O2DL 5BZWA 1I4FA 2MCPL 3BT2H 4XC3L 1G7IB 2QADC 4OLUH 1GVIA 3QI9C 4WGVB 4ZOEA 4M5YH 3V8CA 1XR9B 2HYMA 3U46A 1U8OA 1DQDL 3IXAB 3QJHB 1KFAL 3L3IB 5GISH 4OIIH 3ZYOA 3D3VD 4G7VH 4Y2DC 1JN6A 1HN1A 1UADC 3ARFC 2HT4C 4FMKA 4NQVA 4UOW1 3TVMC 1OGAD 3QR2A 2XTJB 3IFPB 4YHOH 1P1ZA 1J1PL 3NMEA 1NCNA 4ZS7H 4YHNA 3W0WA 3IFLL 5D1ZB 1IC7L 2YD2A 4OF0A 1CL7L 1ZKAA 2LQRA 1PY4A 1J88A 2X4PA 3T0BA 1RUAL 4PRID 3G5ZA 3IVKA 2ED8A 1R5IB 4TTGA 2H3NA 4MZ3A 4PRDA 1ONQB 1T1ZA 2NW3A 2F9BT 5D2LF 3S35H 3GSNA 3K3QA 1M4KA 4NZTH 5I1IL 4JJ5A 1WZ1H 1NUNB 3MV9D 4M8QB 1WC7A 5HI4D 1NEZA 4PFEA 2NX5B 1I9JL 1HHKA 1EHAA 4XCCH 1DSFH 3HRZA 4LSQL 4RNRB 5C07D 4JG0L 4LLDA 2NXYB 5CMAB 1LEKB 5FYLD 1X4XA 1YC8A 1NMBL 3IF1A 2P43B 4JFEA 3CD4A 3QQ4A 1QA9A 1UG9A 5HI5D 4JFQA 4HT1H 1F8TH 4MZ2A 1IC4L 2O26U 3MGOB 1EZVY 5JO5B 5F70A 4E9LA 3ARGC 4BH8B 4ZXBB 1U92B 4LEXH 5GGSB 2ZKHH 1KLGA 1P4LB 1NC4B 1T1WA 2D7QA 3SKNB 4PGEA 5IHZB 5DA4A 3QRGH 4ELKB 4PJAF 4Q2ZB 3SJVE 4KK6C 5B3NA 4U1KB 3SDXB 1CFQA 3PWNB 1HH6A 5HGBB 5IHLB 4HWZB 3T08A 1H8SA 5DQDL 3VFSB 3WCYA 5IVXE 1HOCB 1NMCC 3F12B 5DQJB 5I8KH 1RU9L 2DLFL 1XEDA 5IEHB 3PXHA 4HS3B 3TBWB 2YD4A 4UAOB 4XP9L 3I2CH 3LEYH 4LLWB 4BUGA 3MRFA 2X4OA 4V1DB 1NCUA 4IRSA 1BOGB 3QEHB 1RJLA 4UZGA 5JW3H 4KRPC 1T66D 2FD6H 3TO2A 2BVOB 4PJXF 3QUKA 4MJ5B 2Q8BL 3Q1SH 5DDHB 5SX5H 1KN4H 35C8L 4HWBH 1GZPB 1IEHA 4AIZB 4J3XA 2RJMA 3EGSA 2D03L 4M4RA 1KEML 3H9ZA 1CQKA 3O45B 2W91A 5CEXB 4RMVA 4P57B 4LSUL 4LBEA 1JF1A 3HE7D 1QEWB 4JZNA 3JV5A 4HK0A 3C8DA 4P5MB 4Y8DC 4XCYB 1D6VL 2OM5A 1PJ9A 4XCNB 2DM3A 3V6OA 2AERT 2ZPKH 4HBCL 3QSKB 3Q48A 1ZMYA 4OZGF 4P2QB 4JHBA 1S7TB 2E9WA 5ID0A 4X80L 2FECL 4KV5E 4R96B 5IT2H 5F89A 3FQRA 1IAMA 2I60L 3H42L 3I6GB 2ERJB 1UJ3A 3HR6A 3MLRH 2NY1D 4DKEH 4R0LC 4GSDL 4DAGL 3RWGB 4Y5XA 2VH5L 5IEKB 3IFOB 2XNAA 1QFWI 3MQIA 3DX6B 1QTYT 1YEGL 1C5DB 5D7JD 3CZFB 1QFUL 2A6JA 5E9DD 3B5HA 1TVHB 1TJIH 3C5ZD 3O11A 4XNXH 2CDFB 1NMAL 1H3VA 2ZUTA 3QDMD 4JJ5B 2I9TA 5H94B 2J8UE 3BGMA 1NEZB 5D5MF 2AEQH 5DUBA 4A2MA 4WUUD 4ODBD 3TESA 2DB8A 5CEZH 1WAAE 3IF1B 5J7CC 3LY6A 3CXDH 5IROA 2XKNA 3DGGB 1FV1B 3EJYD 4GBXD 5FCUH 5HYSB 2FEDC 2GITA 1U58A 5E8DH 4HK3J 2WBJA 4O5LH 1CYGA 1YPZF 4LPVA 5ESQB 1MJUH 1UWEL 2W07A 1G6RH 4ZO7A 4NCC1 3TBYB 1F11A 5D93B 1C5CL 2EZ0C 4KKAD 4XVUD 2YMXL 2NY5L 5CEZE 5KAQF 2R0LL 3ROLA 3X14A 4FRWA 4E41B 1INQB 1O0VA 1UB5B 3HG1E 4U0RC 1JNJA 5CUSH 2YPVH 3CK0L 3EOTL 1XF3A 2CXKA 3O3AB 3WS3B 3K80A 2P45B 2VJXA 2Z91A 3F7RA 5L8JB 1JFQL 5HHPB 5INCB 1WVZA 3A6OA 3WNKA 3S3SA 2PO6D 2OL3L 3L3DB 2K3TA 2QQLL 1LD9B 5AUMA 1JBJA 1F6AA 4PJFF 4KTEL 4R7NB 4K3JH 2BY1A 3H0TA 4S1RL 2EE3A 4Y4HB 3C60B 3WNLA 4L8SC 4S1SL 3ES6A 4LSVH 3EJZC 2OYPA 1BVLB 5I1GL 3UBXA 3SDCA 1UH4A 1LVEA 3AXLA 3ETBF 2QV2A 4NT6B 3VXUA 2NNAA 1DEEA 4G7YL 5E2VL 4I0PD 1JUFB 2IMMA 1Q9KB 4XBEH 4G8GB 2IPTH 4LVEA 4J8RA 2CSPA 4OCRL 1MFNA 1QSFB 3AMKA 5T33H 4UNUA 4IIQA 4EVNA 2J5LB 3FQRB 1R3LA 4MAUL 1B0GB 5JXED 3SGDI 2LAAA 4IRJA 3L3OA 4NZUL 2WV3A 5KTEL 1EPFA 4ACPA 2DQEL 4MWFA 3GMMB 2DI8A 3RL2B 2O5ZL 4BQCA 1WFUA 3ULVL 1NLDL 5DMKA 2FGZA 3DVNB 3CFCL 5CIPH 2H8PA 5F44A 4KDTC 1UWXK 3LN9A 5JPMB 2KPNA 2EYSB 4U4BA 2J4WH 3T0XA 1FORH 5D70H 5HHNB 2DMBA 2OMNA 3I3DA 4YEEA 3M17A 4JFDA 3MRJB 4ZAKA 5JOFB 4XZUB 4NQDA 3EBAA 3LSOB 3BIAX 5D1XC 2C3WA 3DUSA 5IG7A 1K6QL 4XP6L 3CFBA 2YPLE 4X8JA 1PZUB 4NKMA 2JCCF 4BSVA 5DRZB 1XGUA 3DO3A 1M6OB 3LPWA 1RZIA 2X41A 5JR1L 1S7UB 4WEBL 3WJJA 4Z77A 4K71C 4R97C 5DLML 5D9SA 1MCIA 2W0KA 1CU4L 4JO1L 2P5ED 3O4OC 1FFNA 3TV3L 2RQ8A 4YWGL 2C1PA 2G9HB 2JJTC 2AJVL 1HXYA 5IW6A 2CIIB 3WD5H 1INEH 1XF3B 3LHPL 4Q9RH 2XWJA 2W9EH 4PP1D 5FAAA 4ZYKA 4KQ3L 1BBJA 2F58H 2EDTA 4Q0XH 4WY7L 3CFEA 5LGKA 1KB5H 2PNDA 3KXFB 4S2SA 3RBSA 5E03A 3PWPD 2R9HC 5TGBA 1A6TB 1CZ8L 4FNLH 3C09B 5GS0H 4Z0BH 4QHKI 1OL0A 1BAFH 3LKQA 3BN9D 3MLZL 3FQNB 4JLRB 4GAYA 4UT9L 5EU7C 1XIWC 2X89A 4U33A 4XNQA 3ULUL 3KLDA 5T5NF 1A7BA 4NJ9L 4K9EL 3GSWB 5FA4B 1XCQA 3OJMB 1EX0A 1AD0A 1A0QH 1T7WA 2EYRB 4OZFH 4PGCB 4CMHC 1QBBA 5KSBF 3OPZL 4YK4B 2P7TB 3A67L 3D39A 1U0QA 3GZKA 3MCLH 1QR4A 2NY2B 3QDJE 4KTDH 1HHJA 2XACC 3V8OA 4IHOA 5C2BH 1GGYA 2AJSH 4D94A 2F53A 1IGCL 4MNGA 5L2KD 2XN9D 4QWWD 4KZDL 4X4XB 5DTFB 3C8KB 1MFEL 4MCYB 3MRQA 4Y19E 1X5KA 4W68A 5CP3A 5C0CB 1A3RL 3VWJB 3VXTA 4CUCA 2IBZX 4P59H 1ZLUK 1ZSDB 5GJTH 1G7HB 3DSFH 3ZE0E 4LSTL 1FZKA 3UTQA 4L3EB 5AAWA 3MO1A 4NQEB 3D9AH 4OFVA 3CSGA 1CWVA 5DI8A 1FZOA 1UXSA 3KR3L 2PKDA 3RPKA 3CX2A 4J3TA 3MRGA 1X3DA 3M17B 4B53A 4ZAKB 5IK3B 1FZMB 3QWQB 3MNWB 2QEJA 4FOMA 3O4LE 3VRJB 4HKXB 1J0IA 3INUL 4G9FA 3VXPB 1QKZL 3MBEC 1RIUL 4N5ED 2HWZL 1S3KL 3RWJA 1RZIB 3NN8A 4FZ8L 1U3JA 2FX8H 4O2CA 5GQBA 4KK9C 2GJ6A 1ZLSH 2ZOKA 4Z77B 5IESH 5J13B 3GK8L 2ITCB 4F7EB 3RAJH 4NPYB 3B9KC 4LGSB 4MJ6B 4UTBH 2DQJL 3UTSB 5HYFA 1GGTA 5JOPD 1BM3L 4RX4D 1FVCA 1YECL 4FTVA 3PWUB 4EUPG 3HE6D 4LMQI 1P4BL 4R8WL 1EO7A 1JGLH 3WLBA 5CAYB 1VGEH 5IFJB 1FNSH 1UWGL 1RMFL 3G04B 4ZUUB 2KZ1B 1JYXA 1I1AD 2FEEI 1FIGL 5JZ7D 3OF6A 3IU4H 2VDQH 2Q6WA 4YHKH 2ZZUT 4HGKC 4JFFA 1F13A 3TFKC 1OAUH 5ALCL 1IKFL 3WSQL 5KW9H 4L8CB 3DX8A 4GKSA 2UUDK 4LGPB 5FYKL 5KSAD 2BVQB 4F58H 4F33B 2YA2A 3R8BB 4WFFD 3MLXH 1AR2A 1WWAX 1FL3A 5IMKB 3S4SG 1CIDA 2JJUA 4XNQB 3QIUB 1G0DA 4EOWL 5I6XB 1GPOL 2H41A 4LSSH 3GSQB 5C0DA 1CICB 1XCQB 2VZOA 1EEUA 1YEFH 1YNKL 5JNYB 2IQAB 4MMXC 4HIEA 3K4ZA 2XFXB 4Q9QH 5I17A 3WO4C 5J3HD 4QYOB 2Q76A 4UIKH 1N6QH 5FV2A 3MACL 3CMOH 3LKRB 4YHZH 3IDYC 4OCSH 2J1KA 3WFEH 5IVZB 1DCLA 3JV6A 1KUMA 1IC1A 3E6FA 1A9BA 3MV8D 3G08B 1ZEAH 5K9OB 4OV5B 5T3XL 2VKXA 4LCIL 4OD2A 3O6FD 4ZPVB 5FYJU 5FFLA 2VL5A 2ITDB 2N1KA 4ODWA 5JW4N 1YZZA 3B2UD 5MEOA 4PJDB 3CUPB 5KZCD 1BWWA 5GGUA 1OVZA 5DO2C 3VGDA 4MQ7A 4P4KB 1BQHA 1YJDL 2Y36H 4LCWA 3RVTD 5SWSB 1IEAA 1K4DB 2NY0D 1YMME 2ED9A 4XVSH 4Z7UF 3BEWA 3BDBA 5LCVH 2ARJB 5F7KC 4LGRB 3JXAA 1FZOB 5FYJD 4JPKL 5KN5B 3MRGB 2RCSH 4K3DH 4GRLD 4LASL 1GGIH 3BDXA 2F54E 3F7YA 3AVEA 4ELMF 3VFVA 3OJVC 4K7PX 4ERSL 5HYJE 4NKDB 4TULH 1L6XA 3DLQR 4FFYH 5FB8A 3U0PA 4CN6A 4OCXH 4R4FH 4Z5RA 2XKSA 4OD3H 1QRNE 2HRPH 3FB5A 4PJEF 3PL6B 1NAKL 1DBKH 2XRAH 1U9KA 1XGYL 5GGVY 2W59A 5L6YH 1GAFH 2BRRL 5HGAA 5F7YC 5I8EB 2A73A 3KPRD 1PKQA 2I07A 3C6LA 4YHIB 4XWOC 1T0MA 4XP1H 4DUXA 4GH7B 1TLKA 5C0BA 3D85B 4MNQA 3RWEB 3RNKA 2ADJA 2QR0A 4N8CH 2BNRB 4IDJH 1ZT7A 4KDWA 4YDLB 1J0HA 4PJ7A 4ONHB 4WU7A 1IAKA 3BISA 3G6JF 2AP2A 3VG9C 4X6DA 4DGIH 4ZOBA 4OLZH 1VSCA 5SWZB 3OKMB 1PFCA 2IFFH 2OTUB 4YC2B 2I5YL 1BFSA 4NO0B 4KVCL 4U7KA 1EUUA 1CGVA 5DD6B 5JMOC 5DD0H 1FN4A 3FFCB 4UV7L 5A43C 3OKNB 4HWEL 4LCCB 4QRSA 4XPFL 3GSXB 2R23A 4G6AC 4XPAH 1OCWH 4NQXB 1WSST 3IETA 2X09A 2DWEA 1MRDH 5FA3A 3QDHA 4DN3H 4X99B 1DDHB 4GQPH 2ZCHH 1BD2E 4APQD 5A2JH 2AJXH 5C0JB 2FGWH 1FQ9C 3NA9H 4OZIA 4P46A 4PJBF 4G43A 4YDJB 3S5LB 5F6IC 3DMMD 1EJOL 1B3JA 2EH7L 3I3BA 3NPSC 1UC6A 3ESVF 1DTUA 3HFMH 1BJMA 3CFDB 1P7QB 1EZVX 2GUOB 3DX9B 1QBLL 1XF5B 2MQ3A 1HINL 3RWFB 3BP5A 2BVPA 2FLRT 5KG9B 3LZFL 4AH2A 2F5AL 2WP3T 5DUMH 5IMOB 1T1XA 3GKWH 3Q6GL 4NWUH 3FMGL 4YIQB 4LLMA 4HUKB 4D9QD 5IR1B 5KSUA 4PBWD 2H1PH 4H1LG 4JKMA 4PYHA 1I7RB 4BK4A 1W0WB 2AXFA 5ECJE 3GO1H 3WUWA 2EDOA 5JW5B 4DUVA 5LGHH 1A6WH 2GTZA 1HQ4A 4DTGH 2R15A 3KPSD 3OAUH 2XT1B 5J1AB 4IRSC 3LOWA 3WIHH 2QQKH 5EOCJ 3BRFA 4Y5YA 5GSVB 3VXME 4PJCE 3GSVA 3DTXB 4MJ4A 2YRPA 4I0KA 3C9NB 3BZEA 1YEHL 2DDQH 4U1LB 3MODH 2HLF