4CNEA

Crystal structure of e.coli trmj in complex with s-adenosyl-l- homocysteine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
Knots found
sequence length
169
structure length
169
Chain Sequence
DPALRALQNIRIVLVETSHTGNMGSVARAMKTMGLTNLWLVNPLVKPDSQAIALAAGASDVIGNAHIVDTLDEALAGCSLVVGTSARSRTLPWPMLDPRECGLKSVAEAANTPVALVFGRERVGLTNEELQKCHYHVAIAANPEYSSLNLAMAVQVIAYEVRMAWLATQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRNA (CYTIDINE/URIDINE-2'-O-)-METHYLTRANSFERASE TRMJ
publication title Characterization of Two Homologous 2'-O-Methyltransferases Showing Different Specificities for Their tRNA Substrates.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 56
structure length 169
sequence length 169
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.200: tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase.
pdb deposition date 2014-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4cneA01
1X7OA 4CNFA 1GZ0A 1P9PA 4YVJA 3BBDA 1IPAA 4YQ8A 4X3MA 1ZJRA 3GYQA 2EGVA 4H3ZA 2V3JA 3N4JA 4JALA 3KNUA 1X7PA 4YQ7A 3BBHA 2Z0YA 4YQKA 4YQAA 4YQ0A 4XBOA 4KDZA 1NXZA 1TO0A 5FAIA 4YQQA 4YPXA 4YQ2A 4YQ3A 2I6DA 3QUVA 4YQSA 4YPYA 1K3RA 3ONPA 2V3KA 1VH0A 4MCDA 5GM8A 1UAKA 3AI9X 3OIIA 1MXIA 5GMCA 4JAKA 3BBEA 4H3YA 1VHYA 4YQ6A 2EGWA 3NK6A 3DCMX 4YQ1A 3ILKA 4YQGA 4X3LA 4YQ5A 4YQOA 4YQCA 3AIAA 2O3AA 4E8BA 2QMMA 3E5YA 3KW2A 3L8UA 4YQ4A 4J3CA 4YQPA 3IC6A 4YQTA 1V2XA 1OY5A 4IG6A 5CO4A 3KTYA 4YQLA 1J85A 4RG1A 4CNGA 2QWVA 4YVGA 4MCCA 3NK7A 3IEFA 3O7BA 4KGNA 4PZKA 1V6ZA 4YQBA 4YQRA 2CX8A 4YVHA 4YQIA 1UAJA 5GMBA 4YVIA 4CNEA 5D9FA 1VHKA 2HA8A 3OIJA 1NS5A 4YQNA 4MCBA 4FAKA 1UALA 3OINA 1Z85A 4L69A 4YPWA 3KY7A 3N4KA 4YQJA 2YY8A 4YPZA 4YQDA 1UAMA 1O6DA 4CNDA 3AXZA 4YVKA 4YQ9A
chains in the Genus database with same CATH superfamily
1X7OA 4CNFA 1GZ0A 1P9PA 4YVJA 3BBDA 1IPAA 4YQ8A 4X3MA 1ZJRA 3GYQA 2EGVA 4H3ZA 2V3JA 3N4JA 4JALA 3KNUA 1X7PA 4YQ7A 3BBHA 2Z0YA 4YQKA 4YQAA 4YQ0A 4XBOA 4KDZA 1NXZA 1TO0A 4JWJA 5FAIA 4YQQA 4YPXA 4YQ2A 4YQ3A 4FMWA 2I6DA 3QUVA 4YQSA 4YPYA 4JWFA 1K3RA 3ONPA 2V3KA 1VH0A 4MCDA 5GM8A 1UAKA 3AI9X 3OIIA 1MXIA 5GMCA 4JAKA 3BBEA 4H3YA 1VHYA 4YQ6A 2EGWA 3NK6A 3DCMX 4YQ1A 3ILKA 4YQGA 4X3LA 4YQ5A 4YQOA 4YQCA 3AIAA 2O3AA 4E8BA 2QMMA 3E5YA 3KW2A 3L8UA 4YQ4A 4J3CA 4YQPA 3IC6A 4YQTA 1V2XA 1OY5A 4IG6A 5CO4A 3KTYA 4YQLA 1J85A 4RG1A 4CNGA 2QWVA 4YVGA 4JWHA 4MCCA 3NK7A 3IEFA 3O7BA 4KGNA 4PZKA 1V6ZA 4YQBA 4YQRA 2CX8A 4YVHA 4YQIA 1UAJA 5GMBA 4YVIA 4CNEA 5D9FA 1VHKA 2HA8A 3OIJA 1NS5A 4YQNA 4MCBA 4FAKA 1UALA 3OINA 1Z85A 4L69A 4YPWA 3KY7A 3N4KA 4YQJA 4JWGA 2YY8A 4YPZA 4YQDA 1UAMA 1O6DA 4CNDA 3AXZA 4YVKA 4YQ9A
chains in the Genus database with same CATH topology
1X7OA 4CNFA 1GZ0A 1P9PA 4YVJA 3BBDA 1IPAA 4YQ8A 4X3MA 1ZJRA 3GYQA 2EGVA 4H3ZA 2V3JA 3N4JA 4JALA 3KNUA 1X7PA 4YQ7A 3BBHA 2Z0YA 4YQKA 4YQAA 4YQ0A 4XBOA 4KDZA 1NXZA 1TO0A 4JWJA 5FAIA 4YQQA 4YPXA 4YQ2A 4YQ3A 4FMWA 2I6DA 3QUVA 4YQSA 4YPYA 4JWFA 1K3RA 3ONPA 2V3KA 1VH0A 4MCDA 5GM8A 1UAKA 3AI9X 3OIIA 1MXIA 5GMCA 4JAKA 3BBEA 4H3YA 1VHYA 4YQ6A 2EGWA 3NK6A 3DCMX 4YQ1A 3ILKA 4YQGA 4X3LA 4YQ5A 4YQOA 4YQCA 3AIAA 2O3AA 4E8BA 2QMMA 3E5YA 3KW2A 3L8UA 4YQ4A 4J3CA 4YQPA 3IC6A 4YQTA 1V2XA 1OY5A 4IG6A 5CO4A 3KTYA 4YQLA 1J85A 4RG1A 4CNGA 2QWVA 4YVGA 4JWHA 4MCCA 3NK7A 3IEFA 3O7BA 4KGNA 4PZKA 1V6ZA 4YQBA 4YQRA 2CX8A 4YVHA 4YQIA 1UAJA 5GMBA 4YVIA 4CNEA 5D9FA 1VHKA 2HA8A 3OIJA 1NS5A 4YQNA 4MCBA 4FAKA 1UALA 3OINA 1Z85A 4L69A 4YPWA 3KY7A 3N4KA 4YQJA 4JWGA 2YY8A 4YPZA 4YQDA 1UAMA 1O6DA 4CNDA 3AXZA 4YVKA 4YQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X7O A;  4CNF A;  1GZ0 A;  1P9P A;  4YVJ A;  3BBD A;  1IPA A;  4YQ8 A;  4X3M A;  1ZJR A;  3GYQ A;  2EGV A;  4H3Z A;  2V3J A;  3N4J A;  4JAL A;  3KNU A;  1X7P A;  4YQ7 A;  3BBH A;  2Z0Y A;  4YQK A;  4YQA A;  4YQ0 A;  4XBO A;  4KDZ A;  1NXZ A;  1TO0 A;  5FAI A;  4YQQ A;  4YPX A;  4YQ2 A;  4YQ3 A;  2I6D A;  3QUV A;  4YQS A;  4YPY A;  1K3R A;  3ONP A;  2V3K A;  1VH0 A;  4MCD A;  5GM8 A;  1UAK A;  3AI9 X;  3OII A;  1MXI A;  5GMC A;  4JAK A;  3BBE A;  4H3Y A;  1VHY A;  4YQ6 A;  2EGW A;  3NK6 A;  3DCM X;  4YQ1 A;  3ILK A;  4YQG A;  4X3L A;  4YQ5 A;  4YQO A;  4YQC A;  3AIA A;  2O3A A;  4E8B A;  2QMM A;  3E5Y A;  3KW2 A;  3L8U A;  4YQ4 A;  4J3C A;  4YQP A;  3IC6 A;  4YQT A;  1V2X A;  1OY5 A;  4IG6 A;  5CO4 A;  3KTY A;  4YQL A;  1J85 A;  4RG1 A;  4CNG A;  2QWV A;  4YVG A;  4MCC A;  3NK7 A;  3IEF A;  3O7B A;  4KGN A;  4PZK A;  1V6Z A;  4YQB A;  4YQR A;  2CX8 A;  4YVH A;  4YQI A;  1UAJ A;  5GMB A;  4YVI A;  4CNE A;  5D9F A;  1VHK A;  2HA8 A;  3OIJ A;  1NS5 A;  4YQN A;  4MCB A;  4FAK A;  1UAL A;  3OIN A;  1Z85 A;  4L69 A;  4YPW A;  3KY7 A;  3N4K A;  4YQJ A;  2YY8 A;  4YPZ A;  4YQD A;  1UAM A;  1O6D A;  4CND A;  3AXZ A;  4YVK A;  4YQ9 A; 
#chains in the Genus database with same CATH topology
 1X7O A;  4CNF A;  1GZ0 A;  1P9P A;  4YVJ A;  3BBD A;  1IPA A;  4YQ8 A;  4X3M A;  1ZJR A;  3GYQ A;  2EGV A;  4H3Z A;  2V3J A;  3N4J A;  4JAL A;  3KNU A;  1X7P A;  4YQ7 A;  3BBH A;  2Z0Y A;  4YQK A;  4YQA A;  4YQ0 A;  4XBO A;  4KDZ A;  1NXZ A;  1TO0 A;  4JWJ A;  5FAI A;  4YQQ A;  4YPX A;  4YQ2 A;  4YQ3 A;  4FMW A;  2I6D A;  3QUV A;  4YQS A;  4YPY A;  4JWF A;  1K3R A;  3ONP A;  2V3K A;  1VH0 A;  4MCD A;  5GM8 A;  1UAK A;  3AI9 X;  3OII A;  1MXI A;  5GMC A;  4JAK A;  3BBE A;  4H3Y A;  1VHY A;  4YQ6 A;  2EGW A;  3NK6 A;  3DCM X;  4YQ1 A;  3ILK A;  4YQG A;  4X3L A;  4YQ5 A;  4YQO A;  4YQC A;  3AIA A;  2O3A A;  4E8B A;  2QMM A;  3E5Y A;  3KW2 A;  3L8U A;  4YQ4 A;  4J3C A;  4YQP A;  3IC6 A;  4YQT A;  1V2X A;  1OY5 A;  4IG6 A;  5CO4 A;  3KTY A;  4YQL A;  1J85 A;  4RG1 A;  4CNG A;  2QWV A;  4YVG A;  4JWH A;  4MCC A;  3NK7 A;  3IEF A;  3O7B A;  4KGN A;  4PZK A;  1V6Z A;  4YQB A;  4YQR A;  2CX8 A;  4YVH A;  4YQI A;  1UAJ A;  5GMB A;  4YVI A;  4CNE A;  5D9F A;  1VHK A;  2HA8 A;  3OIJ A;  1NS5 A;  4YQN A;  4MCB A;  4FAK A;  1UAL A;  3OIN A;  1Z85 A;  4L69 A;  4YPW A;  3KY7 A;  3N4K A;  4YQJ A;  4JWG A;  2YY8 A;  4YPZ A;  4YQD A;  1UAM A;  1O6D A;  4CND A;  3AXZ A;  4YVK A;  4YQ9 A; 
#chains in the Genus database with same CATH homology
 1X7O A;  4CNF A;  1GZ0 A;  1P9P A;  4YVJ A;  3BBD A;  1IPA A;  4YQ8 A;  4X3M A;  1ZJR A;  3GYQ A;  2EGV A;  4H3Z A;  2V3J A;  3N4J A;  4JAL A;  3KNU A;  1X7P A;  4YQ7 A;  3BBH A;  2Z0Y A;  4YQK A;  4YQA A;  4YQ0 A;  4XBO A;  4KDZ A;  1NXZ A;  1TO0 A;  4JWJ A;  5FAI A;  4YQQ A;  4YPX A;  4YQ2 A;  4YQ3 A;  4FMW A;  2I6D A;  3QUV A;  4YQS A;  4YPY A;  4JWF A;  1K3R A;  3ONP A;  2V3K A;  1VH0 A;  4MCD A;  5GM8 A;  1UAK A;  3AI9 X;  3OII A;  1MXI A;  5GMC A;  4JAK A;  3BBE A;  4H3Y A;  1VHY A;  4YQ6 A;  2EGW A;  3NK6 A;  3DCM X;  4YQ1 A;  3ILK A;  4YQG A;  4X3L A;  4YQ5 A;  4YQO A;  4YQC A;  3AIA A;  2O3A A;  4E8B A;  2QMM A;  3E5Y A;  3KW2 A;  3L8U A;  4YQ4 A;  4J3C A;  4YQP A;  3IC6 A;  4YQT A;  1V2X A;  1OY5 A;  4IG6 A;  5CO4 A;  3KTY A;  4YQL A;  1J85 A;  4RG1 A;  4CNG A;  2QWV A;  4YVG A;  4JWH A;  4MCC A;  3NK7 A;  3IEF A;  3O7B A;  4KGN A;  4PZK A;  1V6Z A;  4YQB A;  4YQR A;  2CX8 A;  4YVH A;  4YQI A;  1UAJ A;  5GMB A;  4YVI A;  4CNE A;  5D9F A;  1VHK A;  2HA8 A;  3OIJ A;  1NS5 A;  4YQN A;  4MCB A;  4FAK A;  1UAL A;  3OIN A;  1Z85 A;  4L69 A;  4YPW A;  3KY7 A;  3N4K A;  4YQJ A;  4JWG A;  2YY8 A;  4YPZ A;  4YQD A;  1UAM A;  1O6D A;  4CND A;  3AXZ A;  4YVK A;  4YQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...