4CNEA

Crystal structure of e.coli trmj in complex with s-adenosyl-l- homocysteine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
Knots found
sequence length
169
structure length
169
Chain Sequence
b'DPALRALQNIRIVLVETSHTGNMGSVARAMKTMGLTNLWLVNPLVKPDSQAIALAAGASDVIGNAHIVDTLDEALAGCSLVVGTSARSRTLPWPMLDPRECGLKSVAEAANTPVALVFGRERVGLTNEELQKCHYHVAIAANPEYSSLNLAMAVQVIAYEVRMAWLATQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRNA (CYTIDINE/URIDINE-2'-O-)-METHYLTRANSFERASE TRMJ
publication title Characterization of Two Homologous 2'-O-Methyltransferases Showing Different Specificities for Their tRNA Substrates.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 56
structure length 169
sequence length 169
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.200: tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase.
pdb deposition date 2014-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4cneA01
1UAKA 3IC6A 3BBEA 1V6ZA 2Z0YA 4YQCA 4YQ5A 4X3MA 2V3JA 1TO0A 4XBOA 4RG1A 2QMMA 3N4KA 4YQKA 3OIIA 3KTYA 3KY7A 4YQ6A 4YVGA 5D9FA 4PZKA 4X3LA 5GMCA 4MCDA 3DCMX 4YQPA 4YVJA 1ZJRA 1V2XA 1X7PA 4JALA 4YPYA 4YQDA 5FAIA 2QWVA 1GZ0A 4YQ8A 3ONPA 4YQLA 4CNEA 4YQ7A 1P9PA 1X7OA 4MCCA 2YY8A 3KNUA 4YQGA 1VH0A 1VHYA 2O3AA 4E8BA 2I6DA 3OINA 3BBDA 4YQJA 1NXZA 3E5YA 3BBHA 4YPXA 4YQTA 3N4JA 4YQ1A 1VHKA 4YVIA 3NK6A 4L69A 1K3RA 4YQOA 2EGVA 4FAKA 4YQRA 4YQ2A 2HA8A 3IEFA 3AI9X 3QUVA 1OY5A 4YVKA 3ILKA 4JAKA 1UALA 2CX8A 1Z85A 5GM8A 4IG6A 4CNDA 3GYQA 4YQAA 3KW2A 4YQBA 1IPAA 4H3ZA 4KDZA 1NS5A 5CO4A 4YPZA 4CNGA 1UAMA 4MCBA 4CNFA 4YVHA 3AXZA 4YQIA 3NK7A 5GMBA 1J85A 4YQNA 4YQSA 4YQ3A 3OIJA 4YQQA 4KGNA 4J3CA 4YQ9A 3O7BA 1UAJA 3AIAA 2V3KA 1O6DA 4YQ4A 1MXIA 2EGWA 4H3YA 4YPWA 3L8UA 4YQ0A
chains in the Genus database with same CATH superfamily
1UAKA 3IC6A 3BBEA 1V6ZA 2Z0YA 4YQCA 4YQ5A 4X3MA 2V3JA 1TO0A 4XBOA 4RG1A 2QMMA 3N4KA 4YQKA 3OIIA 3KTYA 3KY7A 4YQ6A 4YVGA 5D9FA 4PZKA 4X3LA 5GMCA 4MCDA 3DCMX 4YQPA 4YVJA 1ZJRA 1V2XA 1X7PA 4JALA 4YPYA 4YQDA 5FAIA 2QWVA 4JWJA 1GZ0A 4YQ8A 3ONPA 4YQLA 4CNEA 4YQ7A 1P9PA 1X7OA 4MCCA 2YY8A 3KNUA 4FMWA 4JWFA 4YQGA 1VH0A 1VHYA 2O3AA 4E8BA 2I6DA 3OINA 3BBDA 4YQJA 1NXZA 4JWHA 3E5YA 3BBHA 4YPXA 4YQTA 3N4JA 4JWGA 4YQ1A 1VHKA 4YVIA 3NK6A 4L69A 1K3RA 4YQOA 2EGVA 4FAKA 4YQRA 4YQ2A 2HA8A 3IEFA 3AI9X 3QUVA 1OY5A 4YVKA 3ILKA 4JAKA 1UALA 2CX8A 1Z85A 5GM8A 4IG6A 4CNDA 3GYQA 4YQAA 3KW2A 4YQBA 1IPAA 4H3ZA 4KDZA 1NS5A 5CO4A 4YPZA 4CNGA 1UAMA 4MCBA 4CNFA 4YVHA 3AXZA 4YQIA 3NK7A 5GMBA 1J85A 4YQNA 4YQSA 4YQ3A 3OIJA 4YQQA 4KGNA 4J3CA 4YQ9A 3O7BA 1UAJA 3AIAA 2V3KA 1O6DA 4YQ4A 1MXIA 2EGWA 4H3YA 4YPWA 3L8UA 4YQ0A
chains in the Genus database with same CATH topology
1UAKA 3IC6A 3BBEA 1V6ZA 2Z0YA 4YQCA 4YQ5A 4X3MA 2V3JA 1TO0A 4XBOA 4RG1A 2QMMA 3N4KA 4YQKA 3OIIA 3KTYA 3KY7A 4YQ6A 4YVGA 5D9FA 4PZKA 4X3LA 5GMCA 4MCDA 3DCMX 4YQPA 4YVJA 1ZJRA 1V2XA 1X7PA 4JALA 4YPYA 4YQDA 5FAIA 2QWVA 4JWJA 1GZ0A 4YQ8A 3ONPA 4YQLA 4CNEA 4YQ7A 1P9PA 1X7OA 4MCCA 2YY8A 3KNUA 4FMWA 4JWFA 4YQGA 1VH0A 1VHYA 2O3AA 4E8BA 2I6DA 3OINA 3BBDA 4YQJA 1NXZA 4JWHA 3E5YA 3BBHA 4YPXA 4YQTA 3N4JA 4JWGA 4YQ1A 1VHKA 4YVIA 3NK6A 4L69A 1K3RA 4YQOA 2EGVA 4FAKA 4YQRA 4YQ2A 2HA8A 3IEFA 3AI9X 3QUVA 1OY5A 4YVKA 3ILKA 4JAKA 1UALA 2CX8A 1Z85A 5GM8A 4IG6A 4CNDA 3GYQA 4YQAA 3KW2A 4YQBA 1IPAA 4H3ZA 4KDZA 1NS5A 5CO4A 4YPZA 4CNGA 1UAMA 4MCBA 4CNFA 4YVHA 3AXZA 4YQIA 3NK7A 5GMBA 1J85A 4YQNA 4YQSA 4YQ3A 3OIJA 4YQQA 4KGNA 4J3CA 4YQ9A 3O7BA 1UAJA 3AIAA 2V3KA 1O6DA 4YQ4A 1MXIA 2EGWA 4H3YA 4YPWA 3L8UA 4YQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UAK A;  3IC6 A;  3BBE A;  1V6Z A;  2Z0Y A;  4YQC A;  4YQ5 A;  4X3M A;  2V3J A;  1TO0 A;  4XBO A;  4RG1 A;  2QMM A;  3N4K A;  4YQK A;  3OII A;  3KTY A;  3KY7 A;  4YQ6 A;  4YVG A;  5D9F A;  4PZK A;  4X3L A;  5GMC A;  4MCD A;  3DCM X;  4YQP A;  4YVJ A;  1ZJR A;  1V2X A;  1X7P A;  4JAL A;  4YPY A;  4YQD A;  5FAI A;  2QWV A;  1GZ0 A;  4YQ8 A;  3ONP A;  4YQL A;  4CNE A;  4YQ7 A;  1P9P A;  1X7O A;  4MCC A;  2YY8 A;  3KNU A;  4YQG A;  1VH0 A;  1VHY A;  2O3A A;  4E8B A;  2I6D A;  3OIN A;  3BBD A;  4YQJ A;  1NXZ A;  3E5Y A;  3BBH A;  4YPX A;  4YQT A;  3N4J A;  4YQ1 A;  1VHK A;  4YVI A;  3NK6 A;  4L69 A;  1K3R A;  4YQO A;  2EGV A;  4FAK A;  4YQR A;  4YQ2 A;  2HA8 A;  3IEF A;  3AI9 X;  3QUV A;  1OY5 A;  4YVK A;  3ILK A;  4JAK A;  1UAL A;  2CX8 A;  1Z85 A;  5GM8 A;  4IG6 A;  4CND A;  3GYQ A;  4YQA A;  3KW2 A;  4YQB A;  1IPA A;  4H3Z A;  4KDZ A;  1NS5 A;  5CO4 A;  4YPZ A;  4CNG A;  1UAM A;  4MCB A;  4CNF A;  4YVH A;  3AXZ A;  4YQI A;  3NK7 A;  5GMB A;  1J85 A;  4YQN A;  4YQS A;  4YQ3 A;  3OIJ A;  4YQQ A;  4KGN A;  4J3C A;  4YQ9 A;  3O7B A;  1UAJ A;  3AIA A;  2V3K A;  1O6D A;  4YQ4 A;  1MXI A;  2EGW A;  4H3Y A;  4YPW A;  3L8U A;  4YQ0 A; 
#chains in the Genus database with same CATH topology
 1UAK A;  3IC6 A;  3BBE A;  1V6Z A;  2Z0Y A;  4YQC A;  4YQ5 A;  4X3M A;  2V3J A;  1TO0 A;  4XBO A;  4RG1 A;  2QMM A;  3N4K A;  4YQK A;  3OII A;  3KTY A;  3KY7 A;  4YQ6 A;  4YVG A;  5D9F A;  4PZK A;  4X3L A;  5GMC A;  4MCD A;  3DCM X;  4YQP A;  4YVJ A;  1ZJR A;  1V2X A;  1X7P A;  4JAL A;  4YPY A;  4YQD A;  5FAI A;  2QWV A;  4JWJ A;  1GZ0 A;  4YQ8 A;  3ONP A;  4YQL A;  4CNE A;  4YQ7 A;  1P9P A;  1X7O A;  4MCC A;  2YY8 A;  3KNU A;  4FMW A;  4JWF A;  4YQG A;  1VH0 A;  1VHY A;  2O3A A;  4E8B A;  2I6D A;  3OIN A;  3BBD A;  4YQJ A;  1NXZ A;  4JWH A;  3E5Y A;  3BBH A;  4YPX A;  4YQT A;  3N4J A;  4JWG A;  4YQ1 A;  1VHK A;  4YVI A;  3NK6 A;  4L69 A;  1K3R A;  4YQO A;  2EGV A;  4FAK A;  4YQR A;  4YQ2 A;  2HA8 A;  3IEF A;  3AI9 X;  3QUV A;  1OY5 A;  4YVK A;  3ILK A;  4JAK A;  1UAL A;  2CX8 A;  1Z85 A;  5GM8 A;  4IG6 A;  4CND A;  3GYQ A;  4YQA A;  3KW2 A;  4YQB A;  1IPA A;  4H3Z A;  4KDZ A;  1NS5 A;  5CO4 A;  4YPZ A;  4CNG A;  1UAM A;  4MCB A;  4CNF A;  4YVH A;  3AXZ A;  4YQI A;  3NK7 A;  5GMB A;  1J85 A;  4YQN A;  4YQS A;  4YQ3 A;  3OIJ A;  4YQQ A;  4KGN A;  4J3C A;  4YQ9 A;  3O7B A;  1UAJ A;  3AIA A;  2V3K A;  1O6D A;  4YQ4 A;  1MXI A;  2EGW A;  4H3Y A;  4YPW A;  3L8U A;  4YQ0 A; 
#chains in the Genus database with same CATH homology
 1UAK A;  3IC6 A;  3BBE A;  1V6Z A;  2Z0Y A;  4YQC A;  4YQ5 A;  4X3M A;  2V3J A;  1TO0 A;  4XBO A;  4RG1 A;  2QMM A;  3N4K A;  4YQK A;  3OII A;  3KTY A;  3KY7 A;  4YQ6 A;  4YVG A;  5D9F A;  4PZK A;  4X3L A;  5GMC A;  4MCD A;  3DCM X;  4YQP A;  4YVJ A;  1ZJR A;  1V2X A;  1X7P A;  4JAL A;  4YPY A;  4YQD A;  5FAI A;  2QWV A;  4JWJ A;  1GZ0 A;  4YQ8 A;  3ONP A;  4YQL A;  4CNE A;  4YQ7 A;  1P9P A;  1X7O A;  4MCC A;  2YY8 A;  3KNU A;  4FMW A;  4JWF A;  4YQG A;  1VH0 A;  1VHY A;  2O3A A;  4E8B A;  2I6D A;  3OIN A;  3BBD A;  4YQJ A;  1NXZ A;  4JWH A;  3E5Y A;  3BBH A;  4YPX A;  4YQT A;  3N4J A;  4JWG A;  4YQ1 A;  1VHK A;  4YVI A;  3NK6 A;  4L69 A;  1K3R A;  4YQO A;  2EGV A;  4FAK A;  4YQR A;  4YQ2 A;  2HA8 A;  3IEF A;  3AI9 X;  3QUV A;  1OY5 A;  4YVK A;  3ILK A;  4JAK A;  1UAL A;  2CX8 A;  1Z85 A;  5GM8 A;  4IG6 A;  4CND A;  3GYQ A;  4YQA A;  3KW2 A;  4YQB A;  1IPA A;  4H3Z A;  4KDZ A;  1NS5 A;  5CO4 A;  4YPZ A;  4CNG A;  1UAM A;  4MCB A;  4CNF A;  4YVH A;  3AXZ A;  4YQI A;  3NK7 A;  5GMB A;  1J85 A;  4YQN A;  4YQS A;  4YQ3 A;  3OIJ A;  4YQQ A;  4KGN A;  4J3C A;  4YQ9 A;  3O7B A;  1UAJ A;  3AIA A;  2V3K A;  1O6D A;  4YQ4 A;  1MXI A;  2EGW A;  4H3Y A;  4YPW A;  3L8U A;  4YQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...