4CNOA

Structure of the salmonella typhi type i dehydroquinase inhibited by a 3-dehydroquinic acid derivative
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
251
structure length
247
Chain Sequence
KTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKPGQIAVNDLRSVLMILHNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into substrate binding and catalysis in bacterial type I dehydroquinase.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
molecule tags Lyase
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
total genus 92
structure length 247
sequence length 251
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4cnoA00
2V0TA 2ZZ6A 3A22A 1FXPA 4AH7A 1D3GA 1G6CA 4GJ1A 2ZZ5A 1OG0A 1DV7A 3VNDA 5D2XA 4UFHA 1O5XA 3NM1A 4JX4A 4JTJA 1ALDA 3UY8A 1R30A 5L9FA 5G2HA 2GQAA 3M9YA 4AF0A 2FTPA 4YCPA 3GYEA 1TPC1 4GUJA 5AYYA 4JTFA 3MI3A 3IIZA 4MLRA 4PFMA 1W5NA 3TFCA 4IMEA 1G4EA 3L5LA 5LZLA 2P10A 5T26A 3WK0A 1NF0A 4X22A 2E09A 2PURA 1BWKA 3TW7A 4JTLA 4CQ9A 1TPH1 3IVUA 3QPZA 3L5MA 5EYWA 3NOEA 1UUMA 4FNUA 3QMRA 2YYTA 3BV4A 3LXBA 4DXVA 5LSMA 2YPIA 3ABSA 3QF0A 3EWXA 5CPLA 3LGEA 1DBTA 3P82A 4FNSA 4TMCA 1T99A 4GWEA 3TC7A 2YFOA 3EX1A 1R2RA 4AF0B 3CB8A 4GXMA 4XTIA 2GVJA 3W1MA 4NQ1A 3THAA 1H7RA 3PG8A 4OGZA 1HO4A 1FWWA 4JTUA 1EB3A 1QPQA 3V1PA 2BSLA 3USBA 1KFBA 4LC6A 2ISSA 2WO5A 3F03K 4LVAA 4JTGA 4XTDA 3U8GA 1C8VA 3GX9A 4JGDA 1EIXA 3M16A 3A21A 3TXVA 4JTKA 2E6AA 1H61A 1TCDA 3SR7A 1AW1A 4WY0F 2WQPA 4O10A 3O6YX 3TE9A 4M6QA 4JX5A 3R8RA 2A7RA 4OBTA 2OX1A 2O7SA 1EP1A 4FEZA 3GLCA 3RMJA 2Q3RA 5FF0A 1X1ZA 1WBJA 2J27A 1JQXA 3I7SA 3ZS4A 4OE7A 3KVKA 3GKFA 3MW7A 4UMCA 4O15A 4XKYA 5AHMA 5EL1A 5HR6A 4NUWA 2DZUA 1RVGA 1Q6OA 4K36A 1NEYA 3W1PA 2QCDA 5FEWA 1OVDA 3GVGA 4AHPA 2I9EA 3W1LA 3C0JA 1TMHA 3PC0A 4O13A 2QUVA 4QAIA 4RK8A 1N8FA 5DN1A 1JCLA 5TIMA 3R5EA 4GE8A 3TAOA 4IX0A 1AK5A 3V75A 5HQEA 2CW6A 3P84A 4NZJA 4P61A 4IWWA 5AHLA 3U2OA 4CCDA 2FIQA 2P0OA 1C9DA 3TFXA 3M5YA 3H53A 1JULA 3BG3A 4A2SA 1I4NA 1IXNA 3HOJA 1QMLA 3MP5A 2WPBA 1JR1A 2CLIA 3PUOA 3G1SA 2Y6ZA 4CNOA 2A2IA 2KZHA 3NDOA 4QJ1A 3MHFA 1TTJA 3L0GA 3M5VA 1TV7A 1UJPA 4RLIA 3GR7A 1I2RA 3OVPA 1QCWA 3T55A 3IVSA 1LOSA 3NPXA 2QEZA 4NJKA 2Y61A 1QFEA 4ZQOA 3W7OA 3P8JA 2VKZG 5CGQA 2JKEA 5IBXC 4YL2A 4HSOA 2Z1BA 1IIHA 3WJYA 1RV8A 1KFEA 1TPEA 4Y8FA 1VYRA 1W1ZA 4M7TA 3WK1A 4LRTA 2YR1A 4QNWA 1TQJA 1K7FA 2EKCA 4Q33A 1FCQA 2GQ8A 1P1XA 1K8YA 3DFNA 2GJLA 4LT9A 4O50A 1PV8A 2E6FA 3OVRA 3NNTA 1XBZA 4MLJA 2ZRVA 3OBKA 2QCFA 1W56A 2QCLA 3KVJA 2CLMA 5U4NA 3TR2A 2G97A 5DELA 3LCXA 5D30A 4Q32A 1SO3A 2E5DA 3M43A 1KM1A 1AW2A 3KXQA 4PA8A 5D2YA 3N34A 1QAPA 2VFDA 4JY8A 5EPDA 4N4PA 3W9ZA 2V81A 3C2VA 1K03A 1XC4A 3LM7A 4UTHA 1KV8A 3QSTA 1X6UA 5J5RA 2FPTA 2QCMA 2CZ5A 3NL2A 1CW2A 3O1NA 3DFQA 1LDCA 2QCNA 3CTLA 1R2SA 3CM4A 3RLUA 1GYNA 2Y85A 3LCHA 1HUVA 1VHCA 2DZVA 4N9EA 3W1RA 1FY6A 4JTSA 4NXSA 1KFJA 1XUUA 5AHIA 1D9EA 3KHJA 2X1RA 2ZTJA 5E1QA 1LBMA 1BEUA 2DJXA 2OJPA 3CU2A 5D2VA 3TUUA 1Z41A 2ZTKA 1FWRA 4YXGA 1OFAA 3E9AA 3QSRA 3B0VC 1A5AA 1U5JA 3PM6A 2ZRUA 3CWOX 1V5XA 3W74A 3UNDA 4NJIA 2AAMA 3DENA 1I2QA 2B7PA 3DZ1A 5F1VA 1H7PA 3GAKA 3QQ0A 4GNJA 4XQ6A 4XKYB 1VPXA 3TQVA 1DOSA 1VHNA 4LU0A 1H7NA 4LS1A 2Z6IA 4E38A 2Z6JA 4FNPA 2X2GA 4UR8A 4LY8A 4X2RA 4H6KA 3LHYA 3PBUA 1PS9A 3P80A 2RKXA 3DFTA 5AC7A 1AW5A 3MYPA 3WFAA 2J9XA 3KAOA 4YMZA 3NYZA 4LVFA 5I3HA 3UYCA 4UMBA 5HWNA 3T78A 1UB3A 1J2WA 3QMTA 3EWZA 5FESA 4JDBA 3HG2A 4FXSA 4Y96A 5D38A 2H8XA 2VFFA 3TIMA 3W1QA 3EX4A 2GJNA 2C14A 1WX0A 5DXYA 4Y9AA 1LBLA 1QPNA 1P4CA 3B0PA 1IGSA 2C6QA 3NPUA 4X9SA 1VCGA 3A23A 3VI2A 4DO5A 3WJXA 3GDKA 2CLFA 5D03A 1FDYA 3RU6A 3P8IA 2Y88A 3RNDA 3KOFA 1GTEA 3EWWA 1PL9A 3O15A 1SFLA 2NUWA 3DHDA 3F1QA 5KSWA 4JS3A 2QF7A 1QO5A 4N4QA 3SFKA 3QW4B 3N9SA 4Z0SA 5BW6A 4MUZA 4N02A 4N9DA 1GZGA 3W7MA 6ALDA 3LTPA 4UUIA 3CHVA 5LNWA 5LNRA 4JX6A 4LVBA 3EB2A 3W7KA 4JICA 3C2EA 2CLLA 3SGUA 1I2PA 2YX0A 2QJIA 2C13A 3ELFA 2J6XA 1LTDA 4IX2A 1VCFA 2FB3A 3P60A 3QZEA 4LTSA 5D05A 1W3TA 3QFEA 5K9DA 2ATMA 2GOUA 3LX9A 3ANYA 3HG4A 1Z48A 1TV8A 3C8FA 3N2MA 4JEQA 2ZZ7A 3HB9A 3I6RA 4N9BA 3NGJA 4FNRA 3TH6A 3W07A 1F05A 4ZVJA 4BK9A 3S8HA 1TJRA 4PTNA 3W7NA 3IIXA 4N9CA 3VE9A 1LRQA 1XDLA 2ATSA 4FF7A 4UFJA 5EBUA 2NZLA 1YDVA 2H90A 1TQXA 3N2XA 4HHPA 3I7QA 2J24A 2VEKA 3BO9A 5TBOA 2WNZA 1OFRA 2RH9A 3F4NA 3HPXA 1LP6A 3B06A 3DFOA 3FJLA 1ZNNA 1D3HA 3D0CA 4H4IA 4W9TA 5DLCA 2PRLA 2XN1A 3NR0A 1QO2A 3TMLA 1VJIA 1BTMA 4MKNA 3UWZA 3TXZA 2RDTA 4HNNA 2F84A 5AFDA 3MJYA 4MPQA 4OT7A 5G2WA 3UY7A 4PL1A 1ML1A 2FPVA 3DI1A 1GVQA 4R7JA 5F4WA 1W54A 1YLVA 4JTTA 4JIQA 3UD6A 4BFAA 5DBTA 4MIMA 4AMAA 2E6YA 1OJXA 3TU9A 4U4MA 3PULA 4JYDA 1KFCA 5CG7A 1KTNA 3W73A 3W1NA 1IIGA 5C6MA 3NO5A 1TTPA 2WV8A 1P5BA 5DY3A 2ZDRA 3FKRA 3PB2A 3NL5A 2DORA 4S1FA 4Z0JA 3HJZA 3C56A 3O8AA 5F1UA 4DF2A 2C1HA 3IRDA 2ISVA 3NQVA 5KZMA 1SSGA 1YYAA 4ZQRA 3SECA 3W7EA 4IMGA 4MYAA 3FKKA 3TSDA 2H8ZA 3BGJA 3GZ3A 3TJXA 2QAFA 5GVJA 2Y7DA 5F4XA 3MO7A 3M47A 1W3IA 1H60A 3LXAA 2V9DA 2ZYFA 1J5TA 4M7SA 1EP3A 3N9RA 5DY2A 2OT1A 2QCCA 2YCEA 4MZ8A 2EHHA 3O06A 4O53A 4AWUA 4R34A 1W5OA 5LNVA 4JD4A 3PVFA 3VKJA 4M6VA 3MMTA 8TIMA 3ABOA 3HPZA 1OABA 1TPFA 4LV4A 2V8ZA 3G1FA 4WXYA 2RHGA 3A5FA 1W3NA 3PS7A 3CT7A 4ADSA 5C5YA 3KX6A 1YPIA 4M19A 2A7NA 1Q6LA 3BW2A 1BKSA 2NUXA 3W1TA 2VFEA 3FYOA 2VXNA 2ZZ4A 5LHEA 3MP3A 5G4WA 1I45A 4N6EA 5FI8A 5I3GA 5FF2A 2PRMA 3PUEA 4NXKA 1GT8A 5CZTA 2YSWA 5EY5A 3Q58A 1Q6QA 4LC8A 1TPB1 2C15A 4AWSA 1DJQA 1JRBA 1UASA 4A22A 2NXIA 3R13A 4XZ9A 1L9WA 3NQMA 4Y6GA 1H50A 1DKWA 2NV1A 4O1BA 4NT0A 2BWGA 2EGZA 2V2CA 5A8GA 1NAL1 3LHZA 4KKXA 5DCEA 1RD5A 4C1KA 3RF9A 2NX9A 1G7VA 2CZDA 2ZCGA 3NQ7A 1HTIA 2FFCA 1K7XA 2DZTA 2GPTA 3SGZA 3NVTA 2EF9A 1XKYA 4YLWA 3OEXA 3IGSA 1JCNA 4IOTA 3RLVA 3GKAA 3W76A 1B57A 2A21A 1DVJA 2FPYA 2C16A 2X1UA 2X16A 2HSAA 3TSMA 1VC4A 4TR9A 1KM5A 4K7VA 1H63A 3N3MA 3BW3A 1WA3A 3HF3A 3P61A 1SU5A 4L4MA 3CIXA 4ML9A 3BPWA 3M5XA 4HNVA 3G0SA 5BRBA 3LBMA 2W0UA 5C55A 1F2JA 2GVGA 3H54A 1PHWA 4UTTC 4XWUA 3G1VA 2TSYA 3NQEA 4IMCA 1H5YA 1LLWA 2NWSA 3S42A 1BWLA 1FDZA 2J9ZA 3STGA 4YWIA 3SJ3A 1LCOA 1LYXA 5F2MA 4KFOA 4O4WA 3TA6A 4K8EA 3QM3A 2H3DA 4M6PA 4O1DA 4UTWA 4GUGA 4EVZA 5HUOA 4RJEA 1KTCA 4UTWC 4N6FA 3WK3A 4WOZA 1MO0A 2JKAA 4IPJA 1IXOA 1FX6A 3L65A 4O1CA 5BNKA 4BWLC 4J9JA 2VEPA 3QMSA 2CZFA 3BW4A 5IM51 1IF2A 2JKPA 3W86A 4WY0A 3NQDA 2PC4A 4M5PA 4O16A 3DFSA 3HO8A 4POCA 4A21A 1JJKA 4UTTA 3S0CA 2FB2A 2H6RA 2Y63A 2F7FA 2CWNA 3UZ5A 1M7OA 4O19A 4NNBA 3C2RA 3G1XA 5K4ZA 1N7KA 2WNQA 1PCKA 4ICNA 4UFLA 1XBYA 3TJLA 1F6KA 3BARA 2EPHA 4I9AA 2ZRZA 5FEXA 4RX0A 1NFBA 1OX4B 2D73A 3U6WA 3QQ1A 3W71A 4E2BA 1JUBA 2BZNA 3UXDA 3LCFA 4NJGA 1V7YA 2V82A 3L66A 3OHIA 4AEOA 1GVOA 3GNDA 3LERA 1TSIA 4FX6M 4DO4A 3UWUA 4O12A 1S5WA 1QOQA 1QNVA 3UXAA 3GXNA 4FNQA 5HR7A 2ZRYA 2ALDA 4H3DA 2VELA 3G3DA 2ZRWA 1H7XA 1ZY9A 3TQKA 1PHQA 3IEBA 2LLEA 3UZJA 1AG1O 1FCVA 4LRSA 4YCOA 3LBCA 1LOLA 1TIMA 5AHFA 1I2OA 1H7OA 5D2TA 2OT0A 4JN6A 1ZENA 1VH7A 4B5NA 4PC8A 1OYCA 2C18A 2DZSA 2UV8G 5LHFA 1ZAIA 3VCRA 2WOQA 4OU1A 3NZ1A 5SWUA 1SFJA 1Z44A 3E96A 1SW0A 3M0ZA 3GDMA 3EWUA 3GDTA 2V5LA 5K2ZA 4LV9A 2NXGA 2VEIA 3C6CA 3NQAA 1WXJA 1TYGA 1SSDA 1GPWA 2I14A 4RCXA 4E0CA 1MSSA 1F7BA 5CPMA 1RZMA 5LNSA 4DEFA 2C3ZA 3JS3A 3R2GA 3TW6A 1P0NA 2QUUA 3DFPA 3F4WA 1EX5A 1PE1A 1S5VA 4L4LA 3N19B 1F76A 3L0KA 2P1FA 4GRSA 3K30A 1JRCA 4QSHA 2QKFA 1GOXA 1OFOA 3EEGA 2A5HA 1LZOA 2CZEA 5AYZA 1KA9F 5F2LA 1SZFA 5H91A 3EKZA 1KM6A 2BTMA 1IXQA 3BGGA 3T7VA 1IXPA 1OYBA 3G1DA 3IV3A 2E68A 2JK2A 2G5WA 1FWSA 3SSJA 3W2LA 3S1WA 1ZALA 3GIYA 5FF3A 3EX3A 4NJHA 5FF7A 5CZJA 3ZWTA 2OZ0A 3GAYA 3MWAA 5K7JA 2QJHA 3BK0A 5G2IA 1C29A 4LVGA 4IXXA 1F74A 2NV2A 1OF8A 1JQVA 3DKLA 4P2VA 4WZHA 4UFMA 1DQWA 3ABRA 3G8RA 4KFPA 4EOUA 1JCYA 4LS0A 1LROA 1YXYA 1SR9A 3S6DA 3LLFA 3QRHA 2A85A 5HUPA 3HQ1A 3HG5A 4IMDA 4LUIA 5CPNA 4DPPA 4I7VA 3TMQA 1AL7A 4NNCA 1VRDA 5AOUA 4EF9A 1EPXA 2ABBA 2QAPA 1JVNA 3UQNA 2DP3A 2QR6A 4PEKA 1VLIA 3W7JA 4HKPA 3NL3A 3WK2A 5HNRA 2B7QA 3W1UA 1G67A 1R46A 3LI0A 4FB7A 3HPSA 5C54A 5CPOA 1GVRA 3H55A 4UNKA 3KFTA 5KZDA 4UTUA 1DHPA 1KFLA 3CEUA 4JDYA 4FX8A 1FCBA 3N73A 3GR8A 1S3HA 1DL3A 4DO6A 3P67A 1X7FA 3S5OA 3O05A 2HS8A 3DBPA 4KFNA 3NL6A 4R53A 3P5YA 1KLZA 3W7CA 1LORA 1FWTA 1OK6A 3M41A 2B7OA 3IIOA 3G18A 3LCWA 4Y90A 1QOPA 5I3KA 1EA0A 4NX5A 5FEPA 2WSQA 4GUIA 2A1YA 3TC6A 5D09A 1OFDA 3P5ZA 4A29A 1I2NA 3LDVA 3OG3A 2IQTA 2VFHA 5A5WA 1AMKA 1SO5A 2X1SA 1EP2A 1UBSA 1W5QA 4GUFA 2WNNA 3FIGA 3LHTA 3HGRA 4DQWA 1VZWA 1YADA 4FIRA 4ZZ9A 5G1TA 2HTMA 3R89A 4HIBA 1GG0A 3GXTA 2Y7FA 1K8ZA 4DPQA 1TTQA 3KRSA 4QITA 3A5VA 3B03A 4LS2A 2E5BA 4OHQA 3OA3A 3DH7A 4QIUA 3G22A 2Y62A 3WJZA 1XI3A 2ZZ1A 4MFDA 3M7WA 2ZZ2A 3PBYA 5EMUA 5D02A 5MHBA 2YW3A 3L2IA 2QDHA 3LTYA 1VYSX 3P74A 3W6YA 5D04C 2CLOA 4MY9A 4AHOA 4DF0A 3BLFA 2A6NA 3PSWA 5AC8A 4DELA 1VCVA 4Z1CA 2HMCA 1TPWA 3S5ZA 4UMAA 3R12A 1QR7A 1U83A 4ZQPA 1XBXA 3G1HA 4O1AA 1ZCOA 4TO8A 1T96A 3LHWA 1GVSA 3W85A 1TPDA 3LOTA 1A5SA 5HMSA 3NQ6A 1GG1A 3W87A 4BI6A 1Z42A 2A4AA 5L6UA 4XBSA 3M6YA 1OFBA 1G4SA 1GWJA 2XFWA 3NQCA 3OVQA 1ZAHA 1XL9A 2VFIA 3UWWA 1XCFA 1CI1A 1W37A 4Z1BA 3FA5A 2NWRA 3W7LA 3L5AA 3I65A 1DQXA 4O14A 2R8WA 2X1TA 5K3VA 1YXCA 1ONRA 3MI2A 1KBJA 3LB0A 1FUYA 2B7NA 3IGUA 3W83A 4ZMGA 4EWND 3LHVA 1FDJA 3FYPA 5CSSA 1EWEA 1L2UA 3ATYA 2R94A 4HT3A 5HINA 2NXHA 1THFD 1FBAA 3L9CA 4JY9A 1X8FA 2G95A 5KMYA 4O28A 4Z08A 2GVLA 1KBIA 4X3ZA 4UCGA 3TAKA 5AN7A 2ZA3A 5F4SA 5F2GA 3T4CA 1MEIA 1JUKA 1VYPX 3LCLA 4NNAA 2TRSA 4TU1A 2WSRA 3DXIA 1XUZA 4O8RA 2J9YA 3C61A 3CQ0A 4NX0A 1KTBA 5HJLA 3SZ8A 3G0UA 1P0KA 3W7QA 3O6DA 1OFQA 4AB4A 3UWYA 3LCGA 1W8SA 3SIZA 1HG3A 4HN4A 4O11A 1NF7A 3HGOA 1G7UA 4OWGA 3SI9A 3W22A 1OX6A 1X1OA 2DJLA 3PR2A 5DCBA 2B0MA 1KFKA 2Y89A 2YFNA 1ZJIA 1O4UA 4RR4A 1FCUA 3TROA 1OK4A 4ZQMA 2DZWA 4G1KA 4HNTA 5F2IA 2V30A 3PY2A 5FEZA 3GK0A 2C0AA 1L6WA 4AHQA 4O54A 1T8XA 3W2UA 4MY8A 2TYSA 3HGSA 4IPIA 3BLEA 3QH2A 4MJMA 2Z0IA 1TRIA 4UFIA 3W1XA 4CNNA 3DU0A 1XFBA 2CLHA 3W2MA 4I7WA 5I3IA 3PG9A 4BF9A 3TQ0A 3W1AA 4WOQA 3FOKA 1WOBA 3LRMA 2XN0A 4CNPA 3C3NA 4PODA 3FLUA 1TV5A 3BG5A 4C1LA 4LOCA 1B4EA 3KRUA 4O57A 4RZ5A 4O52A 1SW7A 2VC6A 3VE7A 4K39A 1W5PA 3BVJA 5K9XA 3HIJA 4JXCA 1A53A 1YTDA 1WQ5A 4QISA 3NM3A 1ZHAA 4RXGA 3W7DA 4CLMA 1KW1A 2RDUA 3W88A 4PCFA 4O0ZA 5CSRA 4TIMA 3DAQA 4TMBA 3LRKA 1SZEA 5IBXA 4K37A 3MBFA 1I8JA 1PIIA 4K7YA 3RFAA 1OHLA 2JBMA 4AXKA 1WV2A 2XN2A 4JTHA 4MFEA 1TB3A 4RV8A 4S2CA 3TKFA 2HS6A 2YW4A 3UWVA 3WJSA 1GEQA 3L0NA 1M7PA 4E2DA 3LXCA 2X30A 1A50A 4K38A 3S1XA 1LRNA 1OF6A 1SZGA 1R47A 2E1DA 3ZWSA 3W2JA 3UPBA 2ISWA 1O95A 4OV9A 4EIVA 1GYLA 3MHUA 4CCEA 5LGZA 5DCDA 3UPWA 3IIPA 4MZYA 2TPSA 2JGQA 2VEMA 4JYFA 4K6AA 3VFLA 4OV4A 5BMXA 5HULA 3MYOA 4GC4A 2R14A 1FXQA 3ABQA 1XM3A 1L6YA 1TTIA 3M5ZA 4LNYA 1MEHA 3W23A 4FO4A 5G1YA 2Y7GA 5KTLA 2O7QA 4UR7A 1K7EA 5C2XA 4UTMA 5K4XA 2QUTA 3B05A 4RZ4A 1FQ0A 3L21A 5E0KA 1W31A 4PL2A 4WUIA 1ME9A 1RR2A 4S2BA 4JR5A 3PAJA 4PH6A 5AB3A 5KINA 2VENA 1TPUA 3I68A 4ZQNA 1O5KA 3B8DA 4LVDA 1LM1A 3EWBX 4O0KA 2QCGA 3IIVA 1EUNA 3FJ6A 3GB6A 2R91A 1ICSA 3GNNA 1NVMA 3DHFA 2V2HA 3B04A 5I3JA 1ADOA 2BXVA 5U7SA 4WY0B 1H7WA 2Q8ZA 1KM3A 3G1YA 1N55A 1JUEA 3Q94A 1Q45A 2Y7EA 3S1UA 1KV5A 1H1YA 4NJJA 4NVTA 4RXFA 4IQLA 3ZR4A 4R33A 2J88A 2ZZ3A 4QM1A 1WOAA 2Q3OA 1Q3NA 4FX7A 2E6DA 1EEPA 1GQNA 1H51A 4IMFA 3CC1A 4XBKA 1MXSA 3IVTA 3Q2DA 5I3FA 1SQ7A 4ADTA 4EF8A 3G24A 3GDRA 4O18A 4I7UA 3BG9A 3O16A 1MEWA 2YZRA 2NUYA 3B4UA 2QDGA 4GFSA 1TO3A 3LTSA 4DF1A 1B9BA 3JR2A 3PF3A 4JYEA 2W79A 3MHGA 1H1ZA 1OYAA 4MY1A 3FEMA 4O17A 4ZQCA 3E12A 1KM0A 1SUXA 2FLIA 2QJGA 2Z2UA 3MUXA 4MJZA 1YDOA 3INPA 4GBUA 1QWGA 3TNOA 1EWDA 5AYXA 4RZ6A 4ZL1A 3C52A 2YDAA 2CLKA 4LWWA 4U28A 4AVFA 3STEA 4MYXA 3G0XA 5ABTA 1DJNA 4OQVA 3ATZA 4IJBA 3TCEA 3W7PA 4Q4KA 3GXPA 3T40A 2E77A 4GUHA 1ME7A 1J4EA 3Q37A 3O6CA 4IXHA 3TV8A 3W2KA 3THQA 7TIMA 1F73A 4KWWA 4IUOA 2GUUA 3STCA 1ICPA 2DZXA 3NXFA 5KITA 2EAWA 2QCEA 4UC5A 3EXSA 1HL2A 2ZBTA 2A0NA 3HG3A 3L68A 1XDMA 4DBDA 3NG3A 2C19A 3KRZA 5LKYA 1KLYA 2YXGA 3YPIA 1VR6A 4UIOA 3EWYA 3LCIA 1W0MA 1F6PA 2QCDB 3W84A 3P62A 2DU2A 2Y70A 4NU7A 2FDSA 3W2NA 2FJKA 2VFGA 3RK8A 2BLEA 1K02A 2PE4A 2OCZA 3I7RA 3MBDA 1T0OA 4NZFA 5E93A 3PBWA 1SO6A 2CFFA 3JRKA 1L6SA 4XUGA 1QPRA 3B0UX 4BI5A 1A5BA 1TPVA 1A5CA 3PBVA 2ZRXA 3S9YA 4JTEA 3C4UA 3LHUA 1Y0EA 1WYIA 2DZPA 4FNTA 4AAJA 5TQLA 3C2OA 1K8XA 5LGXA 3O63A 3HMJG 2ZA2A 3EKLA 4QQ3A 2YYUA 3AJXA 3S5NA 2I1OA 5K9CA 2JGYA 1G4PA 4TX9A 2VOMA 3MI6A 4N2YA 4HSNA 1HFBA 3GDLA 3KVLA 4FHAA 3EX2A 3NAVA 3W3OA 4UFKA 3P81A 3E0IA 3W7HA 4KWVA 4AWTA 2H3BA 3NQ2A 1G69A 1UCWA 4DBEA 4MOZA 3NPWA 1LLZA 1W5MA 3P7YA 1LOQA 1SW3A 2NX3A 4UTKA 3TX9A 3FFSA 3TDFA 1CX9A 3NEVA 1F5ZA 5CZSA 1QPOA 4UTLA 1Q6RA 4HPJA 2ZFAA 5AHNA 3EX6A 3MP4A 3KVMA 4WQ6A 3W70A 3EXRA 1YTKA 3WJWA 3M44A 2Q8LA 3QC3A 5H2ZA 2BX7A 1TREA 4ORMA 1VS1A 2NX1A 1HO1A 5D2WA 1WBHA 1RPXA 3DKJA 3UWQA 1AL8A 4UTIA 4ORIA 2PCQA 5DBUA 3CLMA 3SY5A 1S5TA 1KM2A 4QNEA 6TIMA 3NQ8A 4CQAA 1GTHA 4UNLA 5CKSA 1WDWA 5J5DA 1JCJA 4JNMA 3TK7A 3TSBA 1K3UA 3LI1A 4D2JA 1E51A 1XXXA 3NPVA 2CLEA 1SO4A 3NA8A 3M1ZA 1M5WA 2G96A 3PUDA 5G5IA 2NLIA 1GVFA 3QYQA 1YDNA 2GQ9A 4JIPA 3S1VA 4Z1DA 3C2FA 1LRTA 3OIXA 1ICQA 3L67A 5EKYA 4UTJA 3W7IA 4ONVA 1DORA 1M6JA 5FF4A 4HNUA 3QW3A 1YPFA 2YGYA 3T44A 5D37A 3QEZA 3SW6A 4CQ8A 3N14A 1JCMP 2A7PA 4MZ1A 1NSJA 1SZNA 3STFA 3EXTA 3PSVA 3LV6A 3FS2A 1XBVA 2W6RA 1LBFA 1YTEA 1VGAA 2RFGA 2WKJA 2ZA1A 2RDWA 3DI0A 3E49A 5HWMA 3NZRA 1TRDA 2TMDA 1O60A 2A6LA 1PCWA 3W7RA 2ABAA 3HGJA 4O4VA 4A2RA 1B4KA 4FIQA 5DXXA 4BWLA 3CEPA 4FXRA 2FQIA 1EUAA 4LW7A 3LRLA 3DGRA 1WAUA 1VQTA 2ZQ0A 1PVNA 3QPYA 4ALDA 1QDSA 1RQEA 1OFEA 2E5CA 1KM4A 4A3UA 4HPXA 2WJZA 4WX2A 3G8EA 1RQHA 4Z1AA 2AQWA 3NQGA 3W75A 4WD0A 3W72A 1OFPA 3O07A 5D32A 5BMWA 5BOOA 4MVAA 1ME8A 2WSYA 1YXDA 4JTIA 4UXDA 4BR1A 1B3OA 4K8HA 3LLDA 3BLIA 3A24A 1G4TA 1ZAJA 3G3MA 1JCXA 2CU0A 1ZFJA 4BI7A 1FWNA 2V5BA 5HWJA 1VLWA 2OMAA 4RKAA 3W7GA 5KZEA 3IGXA 3NQFA 1OX5A 1MZHA 3HBLA 5CZ0A 5LNUA 1SPQA 1R2TA 5AHEA 3CWNA 4LUJA 5D33A 4ADUA 3ZFHA 1RQBA 5EA9A 5G4EA 5AC6A 4CCCA 1H62A 2B4GA 3CIWA 3CPRA 1OX4A 2QCHA 3E02A 3AO0A 3S5YA 3PWAA 4WXZA 2V2DA 4WJEA 3PB0A 3G1AA 4IGHA 1TJPA 1GJPA 1UUOA 3LV5A 3QJAA 2PRHA 3A9IA 2AGKA 1O94A
chains in the Genus database with same CATH superfamily
3BOXA 2V0TA 3A22A 1FXPA 4AH7A 3ENLA 2J13A 1CB7B 4ZEPA 4CQDA 4JX4A 1ALDA 3VUPA 1S39A 3W37A 1JZ7A 2O9OA 1VFLA 4GUJA 4D6GA 2D2OA 3UCDA 4AD4A 4C7DA 4P8UA 3L5LA 5T26A 3WK0A 3EB3A 4B2DD 4UZUA 2Y8UA 3H8AA 2BY1A 1TR9A 1E6QM 1Z32X 3WQOA 3H23A 4WIWA 4DXVA 4R5EA 5A6BD 2DUXA 3LGEA 1DBTA 3CH9A 6ENLA 2YFOA 3CB8A 1TZZA 2GVJA 2Z4GA 4K2SA 4JOMA 1FWWA 4JTUA 1EB3A 2QPXA 4M0XA 3ZJ6A 3GM8A 2WO5A 4FOUA 4J3VA 4XTDA 4G7EB 3LGGA 3A21A 2XVLA 2INEA 4TV6A 3DIPA 4F3HA 4FK9A 4LF1A 2W91A 4YNGA 2DSZA 4NAFB 3VMOA 2A7RA 4BEQA 3WX7A 3HFTA 2PD5A 2Q3RA 1JQXA 7TAAA 3UEQA 1RCQA 4W4QA 1GJWA 4AIOA 3GKFA 4UMCA 5ENLA 3WQVA 5HR6A 1EF2A 3KBWA 2YIHA 2DZUA 3C8NA 1V3IA 2WWDA 3OHMB 3GVGA 4NI3A 1SFSA 3AC0A 3W1LA 2HXTA 4KETA 3EOEA 1OGBA 1Z3NA 3U2EA 4RK8A 1N8FA 2ZWZA 5DN1A 2ZXAA 4L56A 3GTXA 3SN0A 1DXEA 3COTA 3RX3A 4C7GA 3V75A 5HQEA 1JCTA 3EDJA 3OP2A 1PZ2A 4IWWA 4REQA 4CCDA 1VIZA 2GK1A 3CH0A 1DWGM 3ZJKA 3AIBA 1NY1A 1XSKA 1I4NA 1IXNA 1GQIA 3MP5A 3AUOA 3G1SA 4CNOA 3NDOA 3UR2A 5CLWA 3L0GA 3W4RA 2W3ZA 1TV7A 1XIHA 2ZUSA 1GNXA 1ZPTA 3A4WA 1I2RA 3L4UA 4JFTA 1LOSA 2QEZA 2WHLA 4NG3A 4ZQOA 3W7OA 3ABXA 5CC5A 5CGQA 4NAEB 1BGGA 1IIHA 2GJPA 1KFEA 4Y8FA 3SADA 3UETA 1LWHA 1DEDA 2YR1A 3TYEA 4QNWA 3MV01 1UPPA 4GI6A 2EKCA 3CYVA 1QUMA 1K8YA 3CZKA 1JDDA 4LT9A 1XBZA 4XVEA 1W56A 2QCLA 1UHVA 1WP6A 3SCRA 5LIKX 1US2A 2ZIDA 1KM1A 1X6NA 3OGVA 5D2YA 4MKSA 2J25A 4Q4QA 5CC6A 3C2VA 1EHAA 1X6UA 5J5RA 3NL2A 5BWFA 3QY7A 3CTLA 1V0LA 4A6GA 1XRSA 4F66A 3CM4A 4YYFA 3I6EA 3RLUA 3CJPA 4GLEA 4H9MA 3LCHA 1BVWA 4N9EA 2ON3A 1XUUA 2WVUA 1GHSA 3QN3A 4W7WA 4MB3A 2E28A 3WMLA 2OJPA 2XIMA 4RL3A 1HT6A 4AVNA 4IGMA 1R0MA 1A5AA 3I4EA 1U5JA 3PM6A 3O9NA 4I8DA 4HGXA 3CWOX 3UNDA 4NJIA 1POKA 2AAMA 3WF4A 1F3EA 3DZ1A 5F1VA 2EJAA 3E0VA 3F4CA 4H9VA 3V7PA 3T0AA 4HHMA 1DE5A 2IKJA 3ZT5A 2GUYA 1H7NA 3VD3A 2Z6IA 4AW7A 1RBLA 2WW5A 2ZUTA 3AIEA 4UR8A 5DT5A 3PBUA 5AC7A 1AW5A 3WFAA 4J3ZA 4YMZA 1NP0A 3UT0A 1MYRA 4KRTA 4L6OA 1U30A 3B8IA 1KWGA 3VNYA 1V08A 3GVVA 1J2WA 4PTMA 4Q8PA 2ESCA 3FGCB 3TIMA 2HQAA 2GJNA 1HGWA 2ADAA 4G8TA 1QPNA 2BNJA 2YCLA 3P14A 3M46A 2C6QA 1O68A 2WVVA 4C5ZA 1P7TB 1E4LA 3A23A 3MSGA 2CCRA 4DO5A 3WJXA 2WCAA 1WDDA 1FDYA 2Z00A 2Y88A 2BB0A 3EWWA 2YXXA 3VKDA 3NDZA 4ZOBA 3O15A 3F1QA 3GHRA 2C0HA 4JS3A 2V68A 2QF7A 1QO5A 4HVXA 3QW4B 3P3BA 2OU4A 3TLLA 5BXRA 1NDWA 4MUZA 2EPKX 4AISA 4ICMA 4IJRA 2V67A 1GZGA 3CHVA 5LNWA 3WDPP 1OQFA 5AC4A 5IXEA 2J6XA 4IX2A 1VCFA 2FB3A 3P60A 4LTSA 3BJFA 3AYVA 2ATMA 3LX9A 3ANYA 3HG4A 1TV8A 3C8FA 3CV1A 2X0SA 3HB9A 1NH6A 4DJED 3UR7A 1A5MC 1R3RA 1T41A 4S3KA 1FWJC 4XZLX 4CD4A 1YDVA 3VNIA 1ITQA 1TQXA 3N2XA 2P5NA 2VEKA 3BO9A 5TBOA 5CPQA 3HPXA 2NVCA 1LP6A 1D3HA 4H4IA 1AFSA 3PZVA 3FJ4A 4XSMA 4RDYA 2RDTA 3ARVA 4L4OA 4HK7A 3PZUA 1Y5XA 1YNQA 2FPVA 1CNVA 1Q7QA 2HRWA 3OW1A 2ISFA 5DBTA 4MIMA 1NDZA 3F2BA 3TU9A 3H6OA 3PULA 2GJRA 4JYDA 2Z25A 3HMCA 4LX4A 1KTNA 3VD7A 3W73A 1ZBVA 4Y8EA 2YB1A 2WZTA 3RR4A 3JZUA 5DY3A 2NT0A 3FKRA 2DORA 5ABFB 3HJZA 4DF2A 2DVXA 3TJIA 1YYAA 4ZQRA 3FKKA 4D6IA 3TSDA 5A8OA 3A12A 2H8ZA 1TWZA 5GVJA 2PWVA 3MO7A 2DT1A 4DJDC 1W3IA 3H22A 1ZCCA 1DP0A 2ZYFA 3W28A 1GYMA 3N9RA 1K6WA 2OT1A 1KC7A 1E1FA 5FOOA 1YMYA 4LBUA 3PZGA 4M8UA 4O53A 2HV5A 2WYSA 4AWUA 3LYEA 3MDUA 1X96A 2WK2A 1WPCA 1A5NC 3VKJA 4M6VA 4D6EA 8TIMA 1OABA 1R3QA 1TPFA 3FHQA 3G1FA 2V69A 2GZXA 4HB7A 3ORWA 4J1OA 1QOXA 3PS7A 5HQLA 5A3HA 4ADSA 3FXYA 1YPIA 3OGRA 3EAUA 1Q6LA 1TJ0A 5PTDA 3WD3A 3W1TA 3AXXA 5FI8A 3WUFA 5FF2A 1D2KA 1Q8AA 3K4DA 1GT8A 2W9MA 3URBA 4IUGA 4AZBA 2AGTA 1GOOA 2YSWA 3NZPA 3QKZA 2JIEA 4AWSA 1FP8A 5IDZA 4A22A 3R13A 4XZ9A 3NQMA 4O1EA 2R24A 3GNPA 4IICA 4Y6GA 1H50A 2V2CA 5KZ6A 2YA0A 5A8GA 3MKKA 1RD5A 2G3IA 1F9CA 1G7VA 3B3DA 3NFUA 5HDRA 4Z2LA 2EF9A 3AZTA 1XKYA 3IPWA 5C9RA 3GKAA 7PTDA 1UR1A 2VCBA 1P0EA 2FPYA 4GOAA 3RHGA 4DZIA 3DECA 4UB9A 4I90A 1KM5A 4REQB 3KBSA 1WA3A 5GNZA 1IWPA 4W7VA 3MJMA 2VI0A 1RCXB 4HNCA 4UTTC 3SJNA 1OCQA 2DY3A 2HE5A 3NQEA 3Q4DA 2C1IA 4H8NA 2NWSA 3R0DA 3R79A 3WH5A 5HNUA 1FDZA 4YWIA 2P53A 2QIIA 1LYXA 3TA6A 1JYWA 4KERA 1E40A 4GUGA 4X63A 1KTCA 3I3EA 4V2XA 4IPJA 1IXOA 1FX6A 3L65A 5BNKA 4ZB0A 2BV9A 3L4VA 3CPUA 3VK5A 4TVDA 5IM51 1HZYA 3CL8A 5I07A 4EXAA 3W86A 5HXMA 1JL8A 3VVGA 4PUNA 4O16A 4E3VA 4Z42C 3N13A 1HKKA 1JJKA 1E9ZB 4V1YA 4A21A 4UTTA 2J62A 3WBEA 1WDPA 4CN4A 3A13A 4O19A 3ZVHA 5K4ZA 2WC4A 1N7KA 4GIEA 1PCKA 1SM9A 3QZAA 4M1RA 3TJLA 3WFZA 3WQFA 1F6KA 2ZRZA 1R7OA 4RX0A 1OX4B 3U6WA 1W91A 4E2BA 2BZNA 1XINA 3N6QA 2XVGA 3UBPC 1TSIA 4Z17A 1O1HA 1RLCL 1TUFA 3TWAA 1QOQA 1UWSA 3UXAA 1S38A 1IGWA 2ZRYA 3AYSA 3CV7A 3DHPA 4H3DA 4H8VA 3RM8A 4WCJA 2VELA 3G3DA 2ZRWA 1ZY9A 3TQKA 2VR5A 3MUIA 3IEBA 4LRSA 1JD9A 3N6JA 5AHFA 4FALA 2ZOXA 2I57A 4JIRA 4LYRA 4G5DA 1GOQA 3AUJA 4PC8A 1V3JA 4BCEA 3VCRA 2WOQA 4OU1A 1SW0A 2L5HA 4HCDA 5A8MA 1E0TA 1OC7A 2OEMA 2V5LA 5HJXA 3RPDA 2VEIA 3C6CA 4U3CA 1QK2A 1MWOA 2I14A 3HTWA 1UA3A 4HNOA 3CIVA 3V3WA 3VX1A 3WMCA 4CD7A 3AZSA 3PN8A 1LUCA 3TW6A 2FVLA 1R3YA 2BGSA 4IZGA 4IMAA 1TX0A 4MWAD 3ZQ9A 2NQHA 3K30A 2HK1A 2XVNA 1OFOA 2A5HA 1LZOA 1KA9F 2QS8A 3EKZA 4QJ3B 1E6XM 4HA1A 3VA8A 4ERIA 3IV3A 4QBXA 4UZSA 3W2LA 4PTWA 3GIYA 4B15A 5T8GA 4DO7A 1BVZA 3KZPA 4E5TA 4NJHA 5FF7A 3V16A 4H41A 2WPGA 1UKQA 2ISDA 3BK0A 3AXKA 3M07A 1C29A 4LVGA 2CEQA 1DJGA 2GL5A 2X7WA 3UF9A 1JQVA 3S2CA 3WMBA 2D22A 4DHGA 4FF5A 3WDHA 4KFPA 5AVNA 4LS0A 1WZMA 3QOKA 3S6DA 1R7AA 3AIRA 3VIJA 2PDKA 4DUOA 1F07A 1EHNA 1A4LA 4QJ4B 4BQ5A 3ONCA 4NNCA 1VRDA 5AOUA 4HMCA 4BY3A 2ABBA 3WELA 3VGFA 3UQNA 2NW0A 3CUFA 5I00A 2DP3A 4PEKA 3GH7A 5HNRA 1Z89A 2GDQA 2VP8A 4H1ZA 3ITYA 3VD9A 3LI0A 3ARUA 4XIMA 3RRXA 3L4WA 4UNKA 3KFTA 1R3TA 2PDJA 1DL3A 3QY8A 2G8ZA 4DUXA 3KRBA 3D46A 2Z1SA 3EA3A 3QZ6A 1X7FA 2DVTA 1RK6A 1XYLA 4BQ4A 1Q7MA 1Q6CA 3UGRA 2XM1A 4HPNA 4HA4A 3D3AA 3VNMA 1VKFA 3QLDA 3IV8A 4R53A 3T08A 1S2AA 1LORA 1Q6GA 3TVAA 3VCCA 4C6BA 1RA5A 3LGDA 2Y4SA 4ACZB 3HA1A 4NX5A 2OPJA 1V0KA 2WSQA 1FWEC 1R3SA 5HMEA 2FJUB 3VKCA 1OFDA 3P5ZA 1I2NA 3KHDA 3LDVA 3OG3A 2IQTA 1K8CA 3PZTA 4M1BA 1EP2A 2FZMA 3AROA 2WNNA 3AS1A 3LHTA 4H7ZA 3A4AA 3UXKA 1OT1A 3L4YA 4PBFA 3AJ7A 5REQB 5ABEA 2E9BA 2Y1HA 2EKGA 3NSMA 4FR1A 2Y7FA 1DIEA 5AVHA 4J2MA 4PMZA 4X61A 4ZB2A 1TTQA 2VC7A 3KRSA 4LS2A 3UW6A 3C5QA 1WE5A 3EPMA 3OA3A 4OHQA 2I9UA 4QIUA 2GLKA 1EYEA 1NDYA 2C1GA 3S46A 1XI3A 4FLRA 2ZZ2A 3PBYA 3EGJA 2J8GA 3LTYA 2PB1A 4NF7A 5D04C 5BZAA 2A3EA 2PLCA 5AC8A 4JKLA 1VCVA 2FHFA 1R9XA 3OLIA 3S5ZA 3WLKX 1QR7A 3ES7A 4ZQPA 4GGBA 4NRRA 1ZCOA 3LHWA 1GVSA 3W85A 1TPDA 1OY0A 3P6LA 1HJWA 3WLTA 1I9CB 4GC3A 4H9YA 4FI4A 4ATDA 3FA5A 4IIDA 2PSNA 4O14A 2I7GA 1YXCA 3Q67A 4YVXA 5LIXX 3CQHA 2B7NA 1V3MA 3WZ0E 4AIUA 4G9PA 4ZOEA 1BRLA 1UR9A 1FDJA 5EMJA 4GNVA 3E2QA 1EWEA 2CBUA 1L2UA 1C7SA 4W7UA 2NXHA 1THFD 1QHZA 1X8FA 3TN3A 2QGYA 2OO0A 4Z08A 1KBIA 4X3ZA 5A69A 1C93A 3TAKA 5F4SA 1CGUA 3PNZA 3T4CA 3VILA 2ACQA 3GG0A 1O12A 3CBWA 3G6LA 2WSRA 3DXIA 1C91A 1KRBC 1IT7A 1TX2A 4MDOA 2YA2A 5HJYA 2CBIA 3GG8A 3G0UA 3GIQA 4HZ8A 2QDEA 2HROA 1MRAA 1HG3A 3BAJA 4X9YA 1NF7A 1Q6EA 3W22A 1OX6A 4J27A 2VRQA 4FS9A 1E0WA 5DCBA 5FAGA 1UWIA 3SN1A 1JG9A 3TROA 1ZP3A 4DJEC 1B0IA 2Z28A 3WQ5A 2WVSA 4I5RA 5FJOA 3UCQA 1V3LA 1PBGA 3SCUA 3W2UA 3TYCA 1U33A 1D7KA 3WIJA 3BLEA 4A3RA 4MJMA 1TRIA 1DPMA 2OSYA 3RYSA 4BF9A 1CZ1A 3GW3A 3W1AA 3IJQA 3FOKA 1TV5A 4Q4MA 4C1LA 4LOCA 1ELSA 1B4EA 2CITA 4GIAA 3VE7A 3EBVA 1A53A 4QR6A 4ACYA 1KXVA 2I56A 3BSGA 1EF3A 3NM3A 1ISXA 4RXGA 1J93A 3D6NA 3NWRA 3KS5A 3PANA 3CWHA 3WEZA 3SRFA 4L80A 3TW9A 4O0ZA 3T6CA 1W3JA 5BU9A 3MU7A 1DJZA 3MBFA 1I8JA 3TOPA 5FJRA 1DWIM 2XN2A 1CB2A 4JTHA 4TVCA 3N1AA 4LAMA 4QAWA 4AYGA 4LUYA 3BDKA 2PFHA 1AQFA 3TKFA 5JU6A 4CGTA 3L0NA 3VIMA 4E2DA 4XSLA 2X30A 1CXIA 3L4TA 3MMDA 4UQCA 3T42A 3SM0A 4JTAA 2XGIA 1B3WA 1FHVA 3W2JA 1O95A 4OV9A 4EIVA 5A6KA 2GYIA 5DCDA 1RVKA 2TPSA 3AOFA 4E4UA 3PZMA 2Z24A 3QC0A 4BEUA 3STPA 1FHDA 5BMXA 3RM9A 4JKMA 3H2AA 3M5ZA 4RPQA 4QE1A 3W23A 3WO8A 2Y7GA 1X8CA 4DAFA 5E6ZA 5K4XA 3B05A 4GINA 5C8BB 4RZ4A 3ITLA 1ITCA 1UKTA 1REQA 1W31A 4KRZA 1RR2A 2IPJA 1QW7A 4CU8A 1JZ4A 2OFJA 4PH6A 2VENA 1WKFA 2V3GA 4AY1A 1XLIA 4CD6A 3IIVA 3GNNA 4XX6A 3FYYA 3AZRA 2V2HA 2BXVA 4WY0B 4LH8A 2J7FA 3M64A 2PWHA 4C6IA 1JUEA 1DHKA 2DW6A 2BXZA 3Q94A 1CXHA 2Y7EA 1V6XA 3QV7A 1FTXA 3VD5A 3TTOA 3DYMA 3N4FA 4RXFA 4R33A 3WLSA 3H12A 3CASA 4LAOA 1FOBA 2F2KA 1Q6FA 2E6DA 3CTTA 3K4AA 1X38A 3UZYA 1MXSA 4G7EA 5C0QA 3SCNA 3TYZA 4EF8A 2EO7A 2OWCA 3O16A 3AAMA 2ZX5A 2YZRA 3NSNA 4GFSA 1TO3A 1JDCA 3PF3A 1PYFA 1TZ7A 4GX8A 5FJIA 4YTTA 3AQUA 4PCPA 2IW0A 4MJZA 4IGNA 3IGHX 3CQKA 5H8MA 4GBUA 3K4WA 1EWDA 5A6TC 4GYKA 1BWVA 4L65A 1DIOA 4AVFA 1GJUA 4WK9A 3UVAA 3OA5A 1GVEA 4G2DA 4DZHA 4DJEA 3ATZA 4IJBA 3W7PA 3GU1A 3PPFA 3ZR6A 3OLGA 4KWWA 2FHCA 4FLSA 2D0FA 4LAZA 2PCEA 2DZXA 3RXZA 1DIDA 4A8RA 4GQ0A 3EKGA 4IQDA 1FFRA 1WCGA 1HL2A 4C91A 2A0NA 3MMWA 1ONXA 2C19A 3KRZA 3NG3A 1KLYA 1XYAA 5HOSA 3EWYA 3LCIA 1MQQA 3I3BA 2FDSA 3TZNA 1PIFA 1FKWA 4HU0A 4I9JA 4NZFA 5C9ZA 4PUMA 3C0SA 1L6SA 4XUGA 4JN7A 4HMEA 3WLRA 1BTCA 1A5CA 1XF0A 3S9YA 2D20A 5HNTA 4AD3A 4OOZA 2DZPA 1JD7A 1IT0A 1G94A 4MWAC 4Q22A 5LGXA 2PDMA 2ZUUA 5LA0A 4B4FA 3JU2A 3AJXA 3S5NA 2OQHA 2NSOA 2WLYA 2PDLA 4N2YA 4HSNA 3GDLA 1EC8A 9XIAA 1FH7A 1OB0A 1CYGA 3P81A 4XB3A 1G69A 3U57A 1UCWA 1N8WA 3IJDA 3NPWA 3W02A 1D7FA 4B5SA 4EAYA 3TX9A 1BLIA 3AIQA 2FMNA 4O0QA 3NEVA 3IJ7A 2JEQA 2A3CA 4HPJA 4NASA 1V7AA 3UXIA 4C6QA 4DI9A 4S3FA 3MP4A 2Y24A 4S3EA 3W70A 4S3BA 3V35A 1VPYA 4D1JA 5CPSA 2Q8LA 3CB3A 4PRTA 5FIPA 3CQJA 2HZGA 5H2ZA 2A3LA 4ORMA 1VS1A 1US3A 2NX1A 2WMFA 1WBHA 2VDGA 1RPXA 2WHKA 3UWQA 5DBUA 2WMKA 1O1ZA 2X41A 3SY5A 1KM2A 2J66A 3ARWA 2RGLA 3C3UA 3SUVA 1ZTVA 1VFSA 3NQ8A 3PFMA 1CPUA 4JNMA 5BROA 1LQ2A 4GIRA 3TSBA 3BAIA 3PNUA 4AIEA 3S6OA 4D2JA 2BY0A 2FKPA 1E51A 1XXXA 1F3XA 3NA8A 3M1ZA 2J78A 5G5IA 1EO7A 4KIRA 3CPGA 1GVFA 3RRAA 2ZC1A 1VP5A 4US6A 3OBEA 3S1VA 1K4GA 3TTEA 2VX6A 1PDYA 4KWOA 4IIHA 4J3WA 4CQBA 3E2SA 3T44A 4P7LA 1KR1A 1XPGA 1JCMP 3WD1A 1NSJA 3EXTA 3PSVA 3LV6A 2I16A 4UFMA 5HWMA 1VGAA 2WKJA 2A6LA 5I5RA 3W7RA 1BQCA 2VC9A 4YN5A 4BWLA 1JZ5A 3EZ4A 3RLHA 4GGHA 3LRLA 3DGRA 1TVPA 3I10A 4ERAA 5CPTA 4HPXA 2WJZA 4Q8WA 3L23A 2EG8A 1MNSA 4AG0A 3NQGA 4XK2A 3SCPA 5D32A 1IV8A 3EB4A 4JTIA 5I6SA 3SIMA 3BMXA 1T5AA 3LLDA 3WH7A 3A24A 5JH2A 1RH9A 1ZAJA 2Z26A 1SR0A 2WC7A 2WJFA 3WQWA 1EOKA 5HANA 4QRNA 5AHEA 3CWNA 4LUJA 3GXMA 5HPOA 3LA4A 3F4DA 3ZFHA 3LPOA 1UWUA 1PTAA 3T8QA 4ZTYA 3E02A 3VX0A 3MY9A 4GQQA 3FNDA 3OG2A 1TJPA 3E6EA 1UUOA 4HNLA 3ID7A 3K8LA 1R85A 3QJAA 3F4VA 5AYIA 1AZ2A 4JHZA 1O94A 3NIYA 1VFUA 2G3NA 1D3GA 1G6CA 2F38A 4PMNA 4V15A 1Q2RA 3G6MA 2BOGX 1NARA 3VNDA 5D2XA 1O5XA 3ECQA 4DBUA 3CL7A 4JTJA 1AH4A 3F5KA 1HXJA 3IS4A 4QROA 3BANA 1PX8A 4IPPA 4AF0A 1UWTA 5DMMA 4YCPA 3GYEA 1TPC1 1HP5A 1KGWA 1UD4A 2WCSA 3IIZA 3MI3A 1N2VA 4IMEA 1UD6A 5LZLA 1B5TA 2P10A 1NF0A 2E09A 2PURA 4MSSA 4DLFA 3H4WA 1P1MA 3IVUA 3UA4A 3EDKA 3NOEA 1FWGC 1XH2A 4FNUA 5LSMA 1UUQA 3ABSA 3EWXA 3KL3A 4JQ4A 3MA8A 4ZXOA 4L4PA 5CPLA 1HL9A 1R8LA 1TA3A 1NFPA 3C2YA 3GH4A 3DERA 2J7EA 4TQTA 1XD1A 2WC3A 4HPHA 2XZ9A 2Y5SA 3THAA 1HO4A 3CV2A 3ERPA 2BSLA 3USBA 1YBQA 1OG6A 4LC6A 2ISSA 2GVYA 3BAWA 2JF6A 3F03K 4WGXA 5EMKA 1CEOA 4DI8A 3GX9A 3WBWA 2V6AA 1EIXA 1J5SA 3TXVA 2YBUA 1TCDA 3KBMA 5ABHA 1AW1A 2BMBA 4WY0F 2WQPA 4AD1A 4JX5A 1G9HA 3R8RA 1SZRA 4OBTA 2OX1A 4HZ7A 2O7SA 4MJ4A 3GLCA 2G0WA 3I6TA 2YLAA 3KCOA 3I7SA 2GGJA 2P8BA 4OE7A 1RA0A 3VM7A 1EDGA 5LIUX 1JXKA 3FAXA 2XJ7A 1OVDA 1MXGA 1OINA 4IH3A 3UP8A 4AHPA 2HCVA 3GWQA 3WQ4A 4O13A 2QUVA 1NDVA 3J7HA 2E8YA 4GE8A 2FVKA 3TAOA 4IX0A 5T9BG 1KGXA 1S46A 4H6QA 1AQMA 4LQ1A 3THDA 1FWFC 4IPLA 2CW6A 4NZJA 2GJXB 4LBRA 3U2OA 2FIQA 3BMWA 1C9DA 5A6AA 4RE3A 1JULA 2PTYA 4C6LA 5FJUA 1QMLA 5H8UA 1ZBWA 1GOIA 2CLIA 2GSHA 4D8AA 3RPMA 2KZHA 2CNCA 2WB5A 3MHFA 1A3HA 4E8DA 3M5VA 2DIEA 1MI3A 3DG3A 1UJPA 2OWWA 5I03A 1QBBA 1WNOA 3IVSA 3KL5A 1PIGA 3R43A 4NJKA 1PXGA 4GPNA 4PUWA 2DH3A 2VKZG 5IBXC 3B8SA 4YL2A 4HSOA 4M56A 3ZT7A 3WY1A 1FWCC 4UQEA 5MKGB 1RV8A 1TPEA 1P0DA 3C0QA 4M7TA 8XIAA 1GZJA 4XD4A 1YNYA 1E6NA 2DV0A 2GQ8A 1XPYA 4O50A 3MVTA 2E6FA 3OVRA 3L7RA 3OBKA 2QCFA 2VR4A 3WENA 5U4NA 2G97A 2BXYA 2E5DA 3BL3A 4NZ3A 2X42A 1JPHA 3M43A 4NAEA 3KXQA 3ANUA 4JBRA 4TOQA 3N34A 3ZO9A 5M3WA 3ABZA 1E6PA 2OYLA 3W01A 4UTHA 2IS7A 2O56A 4EPKA 4Q8OA 1EJWC 1H0IA 1JIBA 3D5HA 2QCNA 4W8LA 3VGBA 4WEVX 2CHRA 4ENLA 1GYNA 2VCAA 3AMCA 2DZVA 1KKRA 1BVNP 3GU2A 4X2PA 5AHIA 3RX2A 3KHJA 2ZTJA 2NV9A 5D9OA 3II1A 4UQ9A 1Z41A 2ZTKA 3POCA 4XIAA 3DYPA 3QSRA 1OZMA 2ZC8A 4UTFA 1V5XA 2PP3A 3DENA 1I2QA 3RU8X 1H7PA 3GAKA 3QQ0A 3OO2A 1A5OC 4XQ6A 1VPXA 5GPRA 1YW1A 1DOSA 4EWJA 4E2VA 3K2GA 4HD5A 4LS1A 3NDYA 2Z6JA 4FNPA 4LYQA 1K4HA 1V0MA 2X2GA 4LY8A 2RKXA 1UA7A 3APTA 5I77A 2J9XA 2R82A 4IIGA 3KAOA 2HEJA 1AVAA 3IJ9A 3NYZA 2DT0A 3N4EA 3V4BA 1L0PA 3ZIZA 4UMBA 3AWOA 1LF1A 5HWNA 3A3HA 1UB3A 3S9ZA 1F4AA 2E3ZA 3MSDA 4YJ5A 1J2BA 3QMTA 4C6OA 1N82A 1X98A 3AXIA 2PU0A 1V6VA 1C8XA 4GI9A 4FXSA 1IEIA 4Y96A 3VIHA 2DIKA 2H8XA 3CK5A 4ACZA 1UKOA 1S2TA 1EQCA 2QVHA 3SN4A 4Y9AA 1SMDA 2OELA 3QHMA 1OC5A 6TAAA 1A0DA 3NPUA 3OODA 1VCGA 4MWAE 3VI2A 4KEVA 2CLFA 2O9RA 1OIMA 5FACA 3P8IA 3RNDA 1ADDA 1W3HA 3MZNA 2VVSA 3BAXA 1XG3A 4ML4A 4PZVA 1RP8A 2PF0A 3SFKA 3N9SA 1RJRA 1WDSA 3XINA 5FAJA 1M7XA 4DIAA 4EXBA 4Q8VA 2Q6ZA 4N02A 1HL8A 2PMQA 1XLGA 3LTPA 4UUIA 4QLKA 5LNRA 1H5VA 2C8NA 3EB2A 4LVBA 4JICA 4C5YA 1J12A 2O9TA 3LM3A 5I78A 4NYYA 4C6NA 1I2PA 4MNLA 4S23A 3ELFA 3OVGA 1S1RA 3GC2A 2W5FA 5K9DA 4Y7EA 1MQRA 1Z48A 2WSKA 2ZZ7A 4LEQA 3N17A 4WDUA 1UR2A 3NGJA 1PKLA 3CMGA 4ZVJA 1TJRA 4YIWA 3W7NA 1JZ8A 1UIPA 2H9AA 1XLDA 1UOZA 4X0VA 4RDVA 1WAWA 2H90A 4NY2A 4ROPA 1UROA 1U1JA 2J24A 3F4NA 3UG8A 4U2ZA 1ZNNA 5FL0A 2DZAA 3D0CA 5DLCA 5H1WA 1YIXA 1XLKA 1VJIA 4B2DA 1BTMA 2F84A 3PBGA 2FTYA 4UBPC 4MMWA 3UY7A 1QJWA 5F4WA 1YLVA 2HNEA 4JTTA 3I3DA 5E09A 1W1IE 4IFKA 2YL5A 1KFCA 2OODA 3PPCA 1IIGA 2ONEA 4WKFA 1QI0A 3NO5A 4QFUA 5DMNA 3PB2A 4S1FA 4Z0JA 3O3RA 3C56A 4ATWA 2R1KA 2OG9A 2VWSA 3F7JA 3TJXA 2Y7DA 4A05A 1KR0A 2CLPA 1QI5A 3HFYA 3MT1A 6A3HA 3SSZA 1KCXA 3O6AA 2PBOA 4M7SA 4KH2A 4HZMA 5DY2A 5D4YA 2PEVA 3AWNA 3MCOA 3WNNA 3PVFA 3FVMA 4I9MA 3R11A 1J6OA 1XLJA 4XZWA 3MMTA 3ABOA 1R38A 1XQLA 3OLEA 1ZS2A 4WDTA 4IL2A 3S9IA 1W3NA 2EPMX 3CT7A 1PSCA 3UERA 1JYNA 5C5YA 3KX6A 5LXEA 2A7NA 3VC5A 2PWFA 1C7TA 4NILA 2NUXA 3WBXA 3DC0A 2VXNA 3MP3A 2ASHA 1E0VA 5G4WA 1C8QA 4N6EA 4Y2WA 1PB0A 4MKVA 1XD0A 6XIMA 3PUEA 1AA1B 4L7ZA 1UZ1A 5CZTA 1OCBA 2ODOA 5EY5A 3SGGA 3Q58A 4ZE5A 1DJQA 2WSPA 2DW7A 4EANA 1TCMA 2IQ0A 4BS0A 4WGHA 3VOJA 1HJUA 3TYDA 4KKXA 1EGZA 3RF9A 4FMVA 1RY8A 4HCLA 3BLOA 3EMCA 4TX8A 2Z29A 1HTIA 1UD5A 1E5JA 2GDVA 2DZTA 3SGZA 3KOXA 1EGMA 3T09A 1WKDA 4NL1A 3OEXA 2OKTA 3P0XA 3GU9A 2RAGA 5JIPA 5CSUA 2V63A 1B57A 4RZBA 2W61A 2X1UA 3GYCA 3QV6A 1ODUA 1H3GA 2HSAA 1ISZA 3TSMA 1JZ6A 4L1GA 4K7VA 2ZX6A 1H63A 3N3MA 3BW3A 3HF3A 1SU5A 2QUNA 2D0HA 4ML9A 3BPWA 4HNVA 3G0SA 4U2YA 5CC7A 2W0UA 1W9XA 1UR4A 4HZ6A 4XWUA 3G1VA 2TSYA 4Z2KA 3RN6A 1I60A 4GH1A 2JIWA 3H7RA 4Y9NA 4D8LA 3SY1A 3ARZA 1NP2A 2HPIA 2AL2B 3G1RA 4IL0A 1BWLA 2J9ZA 4UWMA 4Q7NA 5F2MA 4KFOA 1O5RA 4JPGA 3WD4A 4K8EA 3HN3A 2AAAA 1C90A 4IIBA 2GK1B 1K9EA 4O1DA 4EVZA 1EA9C 1KD0A 4WOZA 3T81A 1XISA 1XRFA 2JKAA 1BKHA 4O1CA 4BWLC 3W25A 4J9JA 3LY0A 2OLAA 3QMSA 3U0HA 3WF1A 3QVQA 1XIBA 2CZFA 4HHLA 4GVGA 3BW4A 3QOMA 4M51A 5DRIA 3N9KA 4ZOCA 2JKPA 4WY0A 3NQDA 4M5PA 3GD6A 3ZXWA 4POCA 3P0WA 3TTYA 1L8PA 2FB2A 3W6MA 2H6RA 2DSWA 3AMKA 1FKXA 4E6MA 3EDFA 4J5NA 4XBJA 4NNBA 4DJDD 2GDUA 3G1XA 4QCEA 2OX4A 1M1BA 1K9TA 1RP9A 4AX7A 2WNQA 4EP8C 3N18A 3BARA 2EPHA 4I9AA 3BCDA 4DYJA 1NFBA 4AMCA 4C6DA 1ZP4A 1JPKA 3MCNA 5FJJA 3L66A 1OGSA 2GSEA 4GCAA 3WCZA 3OHIA 2E9LA 4AEOA 3M0HA 3NGFA 3GNDA 3LERA 4DO4A 3UWUA 1B3ZA 4QP0A 3H24A 3LSBA 4PRWA 1QNVA 3RCMA 3PZNA 3EMZA 4FNQA 3NUKA 2QJNA 3R10A 1H7XA 2XISA 3UZJA 3KCLA 3LBCA 1I2OA 2OT0A 4JN6A 1ZENA 1VH7A 2UY5A 5LHFA 1R86A 4RV3A 3CL6A 3NZ1A 3ARPA 2UWFA 5K2ZA 4LV9A 3NQAA 3P2VA 3WSUA 1SSDA 4AC7C 2V5DA 1S2WA 3LZ5A 1MSSA 1F7BA 1RZMA 1YQ2A 3TR9A 3JS3A 1W1A1 4NHVA 4GY0A 1IEVA 3VYLA 4XO7A 1HJQA 3F4WA 1BF2A 1EX5A 3MS8A 2Y8KA 1LWIA 4L4LA 1S5VA 1WO2A 3N19B 2O0TA 1L2QA 4HYRA 2P1FA 5A6SA 1GOMA 4GRSA 2VURA 4QSHA 3BAKA 4FZIA 1GOXA 1JZ2A 1KBBA 3EEGA 4F4RA 5AYZA 3WDIA 1EJXC 2FFIA 4JTCA 1SZFA 2AQVA 1KM6A 1EZWA 1VBRA 1WXYA 2RDXA 3TQPA 4DXXA 3NO3A 2YZ5A 3LENA 3A4XA 1JFXA 3QR1A 3T7VA 1IXPA 2G3MA 4LCRA 4BA0A 3SSJA 5MKGA 4ZR8A 4H2CA 1XIIA 3S1WA 3CMFA 3FX4A 1TV2A 3H7VA 3BZGA 5CZJA 3ZWTA 2OZ0A 1XIEA 3MWAA 4CNSA 1O7AA 2PDPA 2PLMA 1W32A 1OF8A 1JDFA 4P2VA 2YDRA 1CIUA 3ZZ1A 4W8AA 5FD0A 1LROA 2EPNA 3NQBA 4QEEA 4D1IA 1M65A 3UFYA 1XLEA 7A3HA 1TV3A 3NZGA 3ZMRA 4EF9A 2Y2WA 2QAPA 1JVNA 1U5HA 2C79A 2YLLA 2QR6A 3H4GA 1VLIA 3PPGA 4W84A 3W7JA 4HKPA 3NL3A 2B7QA 4WHBA 2O9PA 3CV6A 1EJTC 3HPSA 3IAQA 4C7FA 5C54A 2DT2A 3H55A 4C6PA 4FX8A 3N73A 2BBFA 3RX4A 3VDBA 1C3FA 5M03A 3P67A 4QLJA 2X0HA 3MKCA 2R1LA 4A3QA 1WXZA 3IUIA 4F9JA 2E9MA 2HS8A 4ILSA 2CHNA 2NQ9A 2FZ9A 1OK6A 2B7OA 3DEQA 3G18A 3LCWA 4Y90A 1OD0A 1SJCA 4IIEA 4RUBA 1QOPA 1EA0A 3B9AA 5FEPA 1GKRA 1I75A 2PDNA 4D6HA 5D09A 2OVLA 2XFYA 4O1FA 4KPLA 2VFHA 4B9ZA 5DMLA 3GNOA 1HKVA 2X1SA 1UBSA 1DJIA 4GUFA 1NWSA 3JZEA 1QW9A 1O66A 1VZWA 1SJAA 2XSAA 3B97A 1UWQA 2F2HA 2XZ7A 1GG0A 1K8ZA 3OQEA 5HBFA 1LUCB 4U5IA 4QITA 1GEHA 4L64A 2E5BA 1QBAA 3G22A 4ES4A 1V6UA 2CERA 3TZFA 5I0DA 5A6LA 3M7WA 5D02A 2YW3A 4PFHA 1VFTA 2BP1A 4LCQA 5J8LA 2XIQA 2GGGA 4JIHA 4MY9A 4DF0A 3T4WA 3REQB 4DELA 4ZFMA 2HMCA 4UMAA 2ANUA 2ZKMX 4EE9A 3BQ5A 4MNJA 3MV11 4TVUA 4O1AA 3OYXA 4ROQA 1NQ6A 3VIGA 3WQ8A 1G4SA 4CEUC 2XFWA 3OVQA 4D72A 3U7VA 1EC9A 1UZHA 3UWWA 1JI1A 2NWRA 5FJPA 5EMMA 5E6YA 3GR4A 3W7LA 1E43A 3I65A 4HU3A 1ZLPA 2R8WA 1UJQA 4KCTA 2J4GA 2PPGA 2XFRA 1FUYA 1XCWA 2E1WA 4A8NA 3HQOA 4GYPC 2VCCA 3MQTA 5EB8A 4GMEA 2G41A 2F9RA 4ZFCA 2D24A 5G4HC 3ATYA 4L1XA 5HINA 1QT1A 2G95A 2GVLA 1RY0A 1J11A 1OBAA 1GKPA 2OZ3A 4PCNA 2X40A 3EOSA 2QGHA 2PLKA 2GGIA 4TU1A 3VNJA 2PS2A 1SYTA 2G4FA 3C61A 2VJXA 1PUDA 1W1TA 1OFQA 1VEPA 3SIZA 4O11A 3HGOA 4AUBA 2OTDA 3NJ3A 4OWGA 3WLIA 3SI9A 1DQUA 1X1OA 2DJLA 2B0MA 1KFKA 5MF5A 3TYUA 1EFZA 1OK4A 1E9LA 1UBPC 1IHIA 4HA0A 4JL2A 1VF8A 2V30A 2ZUWA 3APYA 3R94A 1L6WA 4FOKA 2JFEX 2D0GA 2VDIA 4MY8A 4AXNA 3QH2A 3V5OA 1H41A 2X05A 4MAVA 2JALA 1BG9A 5FL1A 3GXDA 4CNNA 3DU0A 4I7WA 3PG9A 2WBKA 1VEMA 3GVWA 4Q6XA 1P43A 2XN0A 4CNPA 4PODA 3FLUA 1WUEA 3BG5A 1JGMA 2R1NA 2VQTA 3HIJA 4QGCA 1WQ5A 3UG4A 2PLJA 4GISA 5XINA 1ZHAA 1EKOA 3W7DA 1S2VA 3DAQA 4TMBA 3KL0A 2QIWA 1YEYA 1NFGA 4K37A 4MADA 1OHLA 2JBMA 4AXKA 1MDRA 1WV2A 4EXQA 3GVQA 3PJWA 4S2CA 1HGYA 2WLZA 4DJFC 2HS6A 3EDDA 4BKNA 3WJSA 1GEQA 4IP7A 3LXCA 4AD2A 2OGYA 1LRNA 1V3HA 1R47A 1E6ZA 2CYGA 1A5LC 1G5AA 2X09A 1VFHA 3BXWA 3UPBA 2ISWA 2WMIB 3M0KA 1IWAA 3MO4A 5FCZA 2BVTA 2ZX7A 3ITXA 2VEMA 4ZENA 3UU0A 2HK0A 1UH4A 3KDNA 4YPJA 4E8CA 4L9XA 4OV4A 5HULA 2WQDA 3MYOA 1OIFA 2PGEA 3ABQA 1V6TA 2BVYA 1MEHA 3HPAA 4AD0A 3UR5A 3R4IA 5G1YA 1XH1A 2O7QA 1QPKA 4P5UA 5CC3A 4UR7A 4UTMA 1T40A 1FA2A 8CGTA 2I5IA 4XVDA 3RO6A 5C9UA 4PRRA 4PL2A 4WUIA 4ZO8A 4KCWA 3S2NA 4S2BA 1M53A 5AB3A 5KINA 3FHAA 1TPUA 1O5KA 1UR0A 3TWBA 4KF1A 5HQMA 4PMOA 4EAMA 1LM1A 2GOKA 2WNWA 1EUNA 4H01A 1UW9A 5IHRA 1DYSA 3FJ6A 3GB6A 1ICSA 3T2OA 4HTBA 2KX9A 4J28A 3RITA 3B04A 3ZLGA 2OGJA 2C91A 3MZ2A 1WKEA 2GSJA 1H7WA 2Q8ZA 3DDMA 4FXFA 1Q45A 1WDRA 3S2LA 1HJXA 3JW7A 1XIMA 3ZR4A 4RDZA 4J3SA 5BWAA 2J88A 2QV4A 4QM1A 1WOAA 3TA9A 4J3XA 1E55A 3HQPA 4F0MA 4FX7A 4PEEA 1H51A 3CAVA 4DJFD 3Q2DA 1XFCA 4ADTA 1B1YA 3VM5A 1XLLA 3MDWA 2VYOA 2RJGA 4GO9A 2NUYA 3B4UA 3LTSA 1B90A 2E0PA 2PDXA 3AMLA 3JR2A 3H7UA 4N7QA 1TJ2A 3HPFA 4JYEA 4R27A 1OYAA 1ESWA 1V93A 3PZIA 4O17A 1TWDA 4ZQCA 2QJGA 2Z2UA 3L4XA 2PDQA 5E5CA 1QNQA 1W9DM 3INPA 1PAMA 3TNOA 1CBGA 4ZL1A 2YDSA 4CKQA 3C52A 4LWWA 2GGHA 3NURA 3STEA 5ABTA 1DJNA 4RW3A 1KXHA 3A47A 3S5SA 3GXPA 1PDZA 4IQEA 2A3BA 1HJSA 4JQ2A 3ITTA 3VKKA 4OTKA 3THQA 3OQ8A 1UKPA 2GUUA 2OXNA 4XZNX 2BODX 3NXFA 5KITA 1DJYA 2EAWA 2QQ6A 3VNLA 3QR3A 4PUJA 3EXSA 2D1ZA 2ZBTA 3HG3A 3L68A 1XDMA 4RE4A 2XSXA 3WQEA 3NVDA 4UIOA 4OIFA 4G7FA 2E7FA 2DU2A 1UKSA 5I06A 2FJKA 3GFYA 2BLEA 2PE4A 2Y5EA 1T0OA 3PBWA 2WXDM 2TODA 1FRBA 3JRKA 2E67A 4B3LA 3B0UX 4H6EA 1UWAA 5JBDA 2XH4A 2G4JA 4HN8A 1UC5A 1WYIA 5DEZA 3C2OA 1RCOB 3HMJG 2I1OA 2JGYA 4F40A 1QI2A 2XH7A 4TX9A 3MI6A 4R9XA 1HFBA 3KVLA 2FYMA 4LUTB 2WM0A 3EX2A 4UFKA 3W7HA 4KWVA 4GABA 4AWTA 3OZYA 5FJTA 5JBEA 2ACSA 5AKQA 2PDYA 2EBNA 3P7YA 1K6AA 4UTKA 1WZLA 3URQA 2XG9A 1HKWA 3CUZA 4Q8NA 5CZSA 2ZVRA 4UTLA 2QPUA 4LYKA 2ZFAA 4WKAA 3UGVA 1MW0A 3T2PA 2VD9A 4I5XA 1YTKA 5ABFA 3WJWA 4EKJA 3M44A 4BQ2A 3QC3A 2BX7A 3WMSA 3VIIA 4FLQA 4GYFA 2Z1XA 4QHRA 1HO1A 1W9BM 3QGAC 4YVPA 4MPKA 1AUSL 7CGTA 3MB9A 3DKJA 4GKTA 4MM1A 4UTIA 2PCQA 2XIJA 4BF5A 1Z8AA 3LMYA 1EXBA 3CLMA 1XYCA 1S5TA 3ZT6A 4Q8TA 3KTXA 4D71A 4UNLA 5CKSA 1WDWA 5J5DA 3RUBL 3TK7A 3GXFA 3QV8A 3BZJA 1K3UA 3NPVA 3C86A 5JUVA 1A3XA 5TD4A 1QNPA 1IQ8A 3MVIA 1YDNA 1Z9AA 3C2FA 2GWGA 1QNOA 1LRTA 1ICQA 4DWDA 3ZVIA 4Q7IA 1J79A 4ONVA 1M03A 5FKYA 1Z7AA 4HNUA 3QW3A 4AQLA 2DFAA 3LG3A 3QEZA 5H8PA 2VD8A 1GZ1A 4CQ8A 5DMYA 4GI8A 4GZ7A 3SY8A 4LVAA 3FS2A 3IACA 1XBVA 4PCTA 1LBFA 1YTEA 2RFGA 4ZA0A 1TRDA 4R7OA 7ENLA 2Y8VA 1ZL1A 2ABAA 2CXGA 4ZB5A 4FIQA 2FQIA 2PWEA 1EUAA 3PHAA 2EG6A 3T0BA 4GY7A 4TTUA 1VQTA 2ZQ0A 1PVNA 4ALDA 3H21A 1JF6A 4H9ZA 1KM4A 2ZX8A 3WDQA 4XO6A 4A3UA 2ZUNA 4C1NA 4MB1A 4M80A 5HNNA 4WX2A 2OEJA 2IUZA 4UOJA 3SRKA 3W75A 4GIYA 5BOOA 1J18A 1R5YA 3WNLA 3DGBA 1YXDA 3WLPA 2BHYA 4AYSA 1DXIA 1BFNA 1XQKA 4BR1A 5JMUA 3CHEA 1ZJBA 4K8HA 5T91A 1JCXA 5C7HA 1FWNA 5HWJA 1VLWA 4C6KA 4M3PA 3W7GA 4E3TA 3IRSA 3IGXA 2JF7A 5CZ0A 5LNUA 1SPQA 2J8TA 2QVNA 1R2TA 5HAOA 1RQBA 4LB3A 4AD5A 3BURA 5AC6A 1H62A 3U4AA 1OGGA 1Z6KA 3PWAA 2WVVB 4S3CA 1TKKA 4WXZA 4WJEA 1Q4WA 3G1AA 1TELA 1EO5A 4IGHA 3UCCA 4LB4A 3T8LA 2PRHA 3A9IA 3FGCA 2PGFA 3PJUA 3GTIA 3IAPA 2ZZ5A 1DV7A 9RUBA 4AEFA 4EK7A 5HK4A 1UH3A 5C9XA 5G2HA 1Q5MA 2V3FA 1XCXA 4RE0A 1D8CA 2GQAA 2BHUA 3B40A 1RHCA 1WKYA 1PPIA 4U3AA 1BG4A 1QASA 4PFMA 1O6IA 5GJPA 3PJXA 3TFCA 1SGJA 1EEXA 1PTDA 3RGTA 1GQLA 2VEGA 4A3YA 3POHA 4PR4A 2ZADA 4CQ9A 1TPH1 3LZ3A 5EYWA 3VO0A 1IZJA 5JIWA 1AZ1A 1UUMA 3QMRA 3WNOA 2YYTA 2YPIA 3ICJA 3QF0A 3FAWA 4FNSA 1T99A 4GWEA 4IHCA 4GVFA 3EX1A 1PZ3A 1TWSA 4PMXA 3CZGA 4AF0B 4GXMA 3W1MA 3Q45A 4NQ1A 3ZVHB 5HMFA 6REQB 1HN1A 3PG8A 1DE6A 1M01A 1PJ9A 1QPQA 1EPVA 3V1PA 1KFBA 4XAGA 1P6CA 3NSXA 1FH8A 2IKIA 2J7HA 4JTGA 2J77A 1E6RA 2X0YA 3U8GA 1C8VA 3S6TA 4ATLA 2IXUA 1W9UA 4JGDA 4JKKA 1OEPA 3M16A 4JTKA 4NZCA 3SR7A 4PMQA 4B5WA 1W1VA 4KS0A 4O10A 2WM1A 3O6YX 4M6QA 4KCVA 3TE9A 2F6KA 4DX3A 2QULA 3RMJA 5FF0A 1WBJA 2J27A 4NI8A 3FK4A 4JL1A 3ZS4A 4GJIA 1EC7A 2R1PA 3RPTA 4O15A 5EL1A 4NUWA 3MTWA 1RVGA 3EEZA 3KCJA 4K36A 1NEYA 1PWLA 2QCDA 5FEWA 1HF6A 4HSHA 1A0CA 2I9EA 1YE4A 3C0JA 1TMHA 1J96A 3PC0A 4CN1A 3EWCA 4QG6A 1MW2A 2AMXA 5TIMA 3CZLA 3R5EA 4HMNA 1J0JA 3PJTA 1TE1A 3BSHA 4PTDA 5XIMA 3P84A 2P0OA 3TTSA 4UQDA 3M5YA 3BG3A 3IK4A 1Y5WA 4WSJA 5A2BA 3NEHA 1JAKA 3PUOA 2XPKA 3PTKA 1IR2A 2Y6ZA 4QJ1A 4RPPA 1L6FA 3W00A 2PWGA 3ITCA 4Z2GA 4PCSA 1NELA 4RLIA 3OVPA 3NPXA 2Y61A 3LEPA 1QFEA 3WEOA 4QSFA 3U3HA 3V18A 3S1GA 5HMDA 3S3GA 4OJYA 1ITXA 2QJMA 1Y5VA 2BGNE 1EJVC 3GC4A 3V36A 3KP0A 2PZNA 3MC5A 3FDGA 1K7FA 1P1XA 3ARQA 4MNKA 3DFNA 3QPEA 4JTQA 2GJLA 4V33A 1PV8A 3NNTA 1E4IA 4I5UA 4MLJA 2ZRVA 4K3ZA 1R3VA 3H2CA 5CLTA 2CLMA 3TR2A 1M41A 4AZIA 4BJHA 3WNMA 3G2GA 3LCXA 5D30A 2XIBA 1SO3A 1Q85A 1AW2A 4PA8A 4U5KA 1GVYA 3VMPA 5JBFA 5DANA 1KRAC 4JIEA 2VFDA 3ZYZA 3WD0A 5EPDA 4N4PA 2EG7A 3W9ZA 2V81A 4TX6A 1XC4A 3WUBA 4DXKA 1W1PA 1QTWA 3QSTA 4XISA 4FPSA 2FPTA 1HVXA 1CW2A 2VUYA 3DFQA 1VRXA 1KFWA 3E3HA 4GVHA 1S2UA 5EFDA 4QX4A 3V5CA 2FH8A 1E1CA 2Y85A 3GS6A 3R7MA 4K1GA 1HUVA 3WQ6A 3FJNA 1FY6A 1KFJA 5E70A 1D9EA 2AKZA 5E1QA 1BEUA 2DJXA 3CU2A 1CLKA 1UMLA 1R9YA 2JQXA 1CECA 2R9RA 3E9AA 3HM7A 3TONA 1S5MA 3GUGA 1WB0A 7ODCA 4GKLA 3BH4A 3FDKA 2ZRUA 3R6IA 2H9AB 3VU2A 3W74A 4J4KA 1OSEA 2B7PA 4E4FA 1CT5A 4GNJA 4RNJA 1BSIA 4M6UA 4XKYB 3SCTA 3TQVA 2DDXA 4JIIX 1BXBA 4LU0A 1E9YB 1YPXA 3E0FA 4X2RA 1U2YA 4H6KA 3LHYA 4KEMA 1PS9A 4NYUA 3MYPA 1QVBA 3LBOA 3JVAA 4TUFA 4QCFA 4BF7A 4A8LA 3T78A 4B90A 1KCLA 3EWZA 4JDBA 3ME3A 1T8QA 2V38A 1U22A 1HX0A 1NJJA 3HG2A 3B0YA 4MHBA 5D38A 3TOYA 3U7BA 2VFFA 3H4XA 1S2CA 1QHOA 1WX0A 5DXYA 3VZYA 4H6RA 3AHVA 4RW5A 3B0PA 1IGSA 4X9SA 1ISYA 4W89A 1NIUA 5D03A 4XZBA 3RU6A 1GTEA 1PL9A 1FWDC 1V77A 3DHDA 5BRQA 5KSWA 2D2GA 2DT3A 2ACRA 2EPLX 2WHMA 4FR6A 2W66A 3IANA 1E73M 3VGEA 4AEEA 3FN9A 3SURA 4N4QA 1F8MA 3CLWA 4Z0SA 2OWXA 2VTFA 2VGIA 3SCVA 3TTQA 3E74A 1HKIA 2REQB 3W7MA 2CWXA 1D3CA 2PC8A 5FA5A 1JYXA 2CLLA 4PBEA 2YX0A 1LTDA 4I9TA 3LPFA 3QZEA 1W9VA 4F0LA 1W3TA 2GOUA 2VX5A 3GW0A 1EQPA 2WZIA 4JEQA 4GBDA 3DN5A 3I4KA 3I6RA 4FNRA 5A8QA 4IG2A 4KEUA 4PTNA 1B2YA 4PMYA 4GACA 4B5XA 1XDLA 3RIKA 4L9ZA 1PTGA 2NQLA 1MDLA 2ATSA 4FF7A 4LUSA 2NZLA 4O8AA 1SJBA 1MW3A 4HHPA 3I7QA 2AKMA 1OFRA 4KGLA 1KQZA 5EBAA 3B06A 3DFOA 1H11A 5A8NA 3ZLHA 4IPNB 3LLXA 1VFOA 3LMZA 3NR0A 3WNKA 3EYPA 4MKNA 2WJDA 4YVVA 3UWZA 3TXZA 4HNNA 1M9HA 5AFDA 3MJYA 2HDJA 1DTNA 2ZUMA 4PL1A 1GVQA 1XRTA 3PZQA 4PB4A 1C9WA 1JF5A 1UD3A 3O2LA 4Q4RA 4Q4OA 3UD6A 4BFAA 3GO2A 2E6YA 1OJXA 1VBGA 4GH3A 3ISIX 2A3AA 4HYVA 3U2CA 3A3XA 5C6MA 5M2FX 2WV8A 4DRSA 4B92A 4QG8A 1P5BA 4FSAA 3OLDA 3O8AA 4GX9A 5F1UA 4GQGA 5KEZA 2C1HA 2ISVA 3A6OA 5IOBA 5KZMA 1SSGA 2O92A 1OT2A 3SECA 3W7EA 3BGJA 3GZ3A 4LAKA 2BASA 3BSMA 1Q7ZA 5JXQA 5AECA 2V3EA 3LXAA 4DYKA 1J5TA 4DWSA 4P7RA 2UY4A 3N11A 4MZ8A 1DIKA 2EHHA 3QTGA 5LNVA 4C1NB 1XV8A 3HPZA 3EOOA 2FZBA 1NOWA 4LV4A 2V8ZA 1G1YA 2QMKA 2EQDA 1EGVA 2PGWA 3K1GA 4WXYA 1NWTA 3PWGA 3A5FA 3FA3A 2HXUA 4KEZA 1E15A 5AY7A 4M19A 1E3ZA 1VB9A 1BKSA 4ZO6A 3CUXA 2VFEA 2ZZ4A 5LHEA 3ZM8A 1I45A 5DT7A 4FA3A 5I3GA 4S3AA 3F5JA 4ZOAA 2PRMA 2WMIA 4NXKA 2E8ZA 1ZJAA 3VZXA 2AQOA 4OZOA 4IM4A 3IUDA 2J7DA 1TPB1 2C15A 2VZTA 1QNRA 1JRBA 1EXPA 1UASA 1K1DA 2PA6A 2NXIA 2Z1VA 1L9WA 1DKWA 2NV1A 3KW3A 1UD2A 3IJ6A 4NT0A 3T1GA 3UNTA 3AHZA 2EGZA 1P6BA 1YNPA 1NAL1 5DCEA 3LHZA 4FP1A 4OECA 3CAQA 4P8WA 1F6YA 2CZDA 1TZ9A 2FFCA 4JQAA 1FHLA 3D47A 2GPTA 5I7GA 4H9XA 3MCMA 5CQ1A 4LSBA 5BOFA 3IGSA 4S39A 4W85A 4IOTA 1MW1A 3MKVA 3W76A 3FCPA 2X16A 2BY2A 3TP4A 1EJRC 4TR9A 1BXCA 5CJNA 3N4AA 4XZIA 2FVMA 3CMJA 5C55A 2GVGA 2YL6A 3H54A 4PB3A 4L9YA 1K70A 1VBJA 5M1TA 4R85A 3B8UA 3HJEA 2IPWA 4IMCA 1FWHC 1UZ4A 3M0VA 3S42A 1GKQA 4U10A 5CBJA 4PMVA 3STGA 1M68A 4O4WA 3UPMA 2O4MA 3QM3A 3AS2A 4IISA 1CWYA 2H3DA 1FH9A 3OJGA 5HUOA 4RJEA 4UTWC 1CGTA 3WK3A 1UH2A 1ADSA 3WF3A 1UP2A 4CNUA 2WZEA 2XINA 2W63A 1IF2A 2PC4A 1JXJA 3VOHA 3RCNA 1VD6A 4LF2A 4DWSD 1XYMA 2DEPA 3ZLFA 1AJ0A 4DZAA 4HK5A 2CWNA 3UZ5A 4E8GA 3C2RA 4ZBCA 4LEFA 1PX3A 3ARSA 4M81A 5I24A 4LUSB 1ITUA 3ZSTA 2D73A 3W71A 1JUBA 1LL7A 2OR2A 2ZE0A 4C6MA 3N2OA 2V82A 1ECEA 1KRMA 4HBKA 1GVOA 2VGBA 7REQA 4PUEA 4FX6M 4B5UA 3DYOA 3LD5A 4O12A 1RK5A 3H2FA 1UR3M 1T6MA 4JCLA 4MDPA 3BTNA 3GXNA 2OB3A 5HR7A 3M6DA 1MXDA 1OADA 5CBIA 3ITVA 2LLEA 3N04A