4CNOA

Structure of the salmonella typhi type i dehydroquinase inhibited by a 3-dehydroquinic acid derivative
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
251
structure length
247
Chain Sequence
KTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKPGQIAVNDLRSVLMILHNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Insights into substrate binding and catalysis in bacterial type I dehydroquinase.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
molecule tags Lyase
total genus 92
structure length 247
sequence length 251
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4cnoA00
1I45A 4GUJA 2Y61A 1AG1O 1T99A 1K8XA 1LOSA 4LV4A 4R34A 5D37A 1H63A 1Y0EA 4GUHA 3W73A 3DI1A 4CCEA 1VQTA 2J6XA 5U4NA 1TTPA 1DV7A 3W7HA 3O15A 3I7RA 2C1HA 1FCUA 1VLIA 1P0KA 3B0VC 3LX9A 3W1RA 3MP4A 4RX0A 5KTLA 4UMBA 5FF0A 4R33A 3UXAA 5IBXC 2H90A 1LDCA 2VFGA 3EWXA 4UNLA 3TAOA 2G97A 1DOSA 1H7RA 4OHQA 1MEIA 3IGUA 1QPOA 5LNUA 1W5OA 3ABRA 4BR1A 4FNQA 3VFLA 2NUXA 3W1PA 1EP1A 1PHQA 5CPNA 2VEKA 3DFPA 3NPXA 1KM0A 1DHPA 3UNDA 2EF9A 4Z0JA 3L21A 4CCDA 4EF9A 2YSWA 3RK8A 4TMBA 2QEZA 4E2BA 1OK4A 2BXVA 5GVJA 4MZ8A 3TUUA 3MHGA 3FKRA 1A5AA 3P61A 5AHLA 1LM1A 3UZJA 3MI6A 3MHFA 3BV4A 5U7SA 5DN1A 1JQVA 4K38A 3HG3A 1DQWA 4AH7A 5K4XA 2JGYA 4Q32A 3I7SA 1FDJA 2J9YA 3GNDA 5FF2A 3BARA 3L0GA 1EP3A 2OT0A 2QCNA 1SFLA 3S1WA 4I7WA 2QCLA 5BNKA 5FEZA 2GPTA 3JR2A 4JEQA 3LOTA 4NJIA 2WOQA 2CZ5A 3W1NA 5AHNA 5K9CA 1PCKA 2R94A 1GVSA 1VCVA 2OMAA 2WPBA 3W86A 1K7FA 1OYBA 2J88A 4NVTA 5G2IA 2XN0A 1A53A 1C29A 3OVRA 1NF0A 3OEXA 4JDBA 4O53A 5EKYA 2ZZ2A 1HG3A 1JCMP 1WX0A 4JYEA 5CPMA 4KWVA 2RFGA 4H3DA 2WJZA 1VJIA 1GYNA 3LTSA 2CLHA 2CLFA 4MFDA 5CPOA 1OX5A 2GQ9A 4IMCA 3B0PA 4CQAA 5FESA 5D02A 4MZ1A 5KINA 5FF3A 1JRBA 3LI1A 3CWOX 1VCFA 3V1PA 1O5KA 3M5XA 1YPFA 1ONRA 1OK6A 3WK3A 4RJEA 1RPXA 2XFWA 2VFFA 3BLIA 2Z6IA 3NDOA 1SUXA 1GG0A 3SZ8A 5BRBA 3UWYA 4UFLA 1TSIA 4FNTA 4Z1CA 1QPRA 3FIGA 4GNJA 2VKZG 1J2WA 3QW4B 4FB7A 1OFBA 3GDKA 1DJNA 3QYQA 1H61A 2O7SA 1VLWA 3TV8A 4BK9A 3VKJA 1OYCA 4TX9A 4JTTA 5AYYA 3LGEA 4PODA 3S42A 4IGHA 4JGDA 3EX6A 1KTBA 1TPH1 3RMJA 3KVJA 2TPSA 3BPWA 3STEA 4JTHA 3BGGA 2WV8A 2PE4A 3M43A 1W3TA 4UUIA 4AWSA 1K7XA 3RLUA 4LC8A 1ALDA 3GKFA 2A5HA 2VFDA 3LCLA 1W37A 4LUIA 3SSJA 4ALDA 4AWTA 3CB8A 1XUUA 1LRQA 4RZ6A 2NX3A 3TU9A 4FNPA 2Y7GA 1YTKA 1NSJA 5CSSA 1N8FA 5AB3A 5KZEA 3SI9A 3TSMA 1YXDA 2WSRA 3TDFA 1LCOA 4ZQCA 3A9IA 1Q6RA 3T44A 1PCWA 1A5SA 1GVOA 3FFSA 4RXFA 3RFAA 4XBKA 4K7VA 3SECA 3LM7A 1L6SA 1BTMA 4NZFA 2P10A 1SO3A 3PBVA 2RDUA 1WOBA 1L6WA 3N73A 4UTJA 1S5WA 3T78A 1T96A 4MVAA 3R12A 4J9JA 3O63A 4DO6A 2ZBTA 4MUZA 2G5WA 1XXXA 1TQXA 3NQ7A 3W1AA 1GYLA 1U83A 1PV8A 3TKFA 7TIMA 3MP5A 3O16A 4JN6A 4L4MA 4FNRA 3B05A 1LP6A 5FI8A 1G6CA 5F2MA 3Q94A 3W75A 3M0ZA 4Y90A 2A85A 1QO2A 4WOZA 4M6VA 4NJJA 1Z42A 4JIQA 4UTWC 4CNOA 4X3ZA 2GJNA 3LHZA 5AYXA 3TROA 4U28A 1WQ5A 1D9EA 4KKXA 4JTLA 1UASA 1ADOA 3OVQA 2ZQ0A 5TBOA 3WK2A 3UZ5A 5K4ZA 3G0UA 1GVFA 2VEIA 1KFEA 2ISSA 1H60A 2V2HA 3IIXA 1VRDA 1Q6LA 4XKYA 1FWWA 4H6KA 3IGXA 2CLIA 3SW6A 3BG3A 3CQ0A 1EP2A 1H62A 3IIOA 1OHLA 4WY0F 5DXYA 4AMAA 2V2CA 4YWIA 2H8XA 3W7JA 3DZ1A 2W0UA 2Z2UA 3GDTA 4JTKA 2QCFA 1P1XA 3EKZA 4UTTA 2QCDA 1ZCOA 5D2YA 5K9XA 1M6JA 5CG7A 4X2RA 3LTPA 2Y70A 2DZVA 1YPIA 1YYAA 2Y63A 1TPDA 3W7GA 1OYAA 3P62A 5ABTA 1KM6A 1KFJA 1DORA 3UY8A 4JICA 2Y6ZA 5DY3A 1VC4A 1MZHA 3BW4A 4KFNA 3PBWA 3LHWA 1Q6OA 2CLKA 3IEBA 5I3IA 3STGA 2E5CA 3STFA 1GOXA 2QCCA 2J27A 5CGQA 1TJRA 1FXPA 4FIRA 4OV9A 1J4EA 4HPXA 5HWJA 4LRTA 1QFEA 3KAOA 1KFLA 1GJPA 2I9EA 3GXPA 1H1ZA 2QAFA 3W6YA 4DEFA 5CKSA 1BEUA 5DCDA 1JVNA 1NFBA 4C1KA 4NX0A 3QQ0A 5MHBA 4IMFA 5F2GA 3VE7A 3M1ZA 2GOUA 5C55A 4JTIA 1JUBA 4N2YA 2Y7EA 3DFOA 5D03A 1OF6A 3A22A 1YTEA 3L2IA 4D2JA 3R89A 3A23A 2HS8A 1SW0A 4UC5A 4HSNA 1R46A 2FIQA 1SW3A 4LC6A 3TX9A 4WJEA 2H6RA 1SSDA 4NNBA 3BW2A 3IIPA 3A5VA 2BX7A 5DCBA 1JCYA 3PC0A 3F03K 3NZ1A 3W7QA 4O11A 3NPVA 4LY8A 2QDHA 2X1RA 4ICNA 1R2RA 3LV6A 1F05A 3AO0A 4TO8A 3P5YA 5K2ZA 2QCEA 4QISA 3N19B 5H91A 3PSWA 3EKLA 2C14A 1GZGA 5HNRA 3P81A 4U4MA 3G8EA 4NJHA 4N9DA 4RZ5A 2NWSA 1YXYA 3C2RA 4C1LA 2YYTA 2WNQA 3DFSA 4OBTA 2ZTJA 3TCEA 1CX9A 3W7OA 4CQ8A 4ZMGA 2GVJA 3M9YA 5G1YA 1VS1A 4IX0A 2DJLA 3W88A 5AC8A 3N2MA 1ZNNA 2H3DA 4HNTA 1K3UA 4PC8A 3N14A 3QFEA 5LNVA 1HFBA 3TW6A 1O5XA 4K37A 4QITA 3NQAA 3G1SA 2B7PA 3G3MA 2A2IA 2DORA 4RK8A 3L67A 3B03A 2QKFA 4IJBA 3PR2A 1QAPA 1H1YA 3T7VA 3H55A 4NXKA 1MO0A 2QJGA 4O18A 3QC3A 2H3BA 4ZL1A 1Z41A 4ADUA 2J9ZA 5CPLA 1KW1A 5TQLA 4MY9A 4UTLA 4Y9AA 3IIVA 3GDMA 3O8AA 2V81A 3IGSA 3HPSA 1CW2A 5H2ZA 5LNSA 1LOLA 2YW4A 4UIOA 2PURA 4UTKA 5F1VA 3S1XA 2W79A 3LV5A 2FB3A 3EWBX 4PCFA 1AW1A 3T55A 3HIJA 3E12A 3P8JA 3EWZA 3N3MA 4O28A 3S5NA 5HR6A 3HJZA 2A21A 1RD5A 4PTNA 4UMAA 1XKYA 4MJZA 4OQVA 3C52A 2FPVA 4AHPA 2IQTA 3OIXA 1K7EA 1R47A 3BW3A 2R91A 3CLMA 2EGZA 1ICPA 1TRDA 1RQHA 3NVTA 2DZTA 4YL2A 2NX9A 1K02A 1AK5A 1PE1A 3W71A 2ATSA 3C8FA 1QMLA 3TJXA 3KOFA 3TQKA 3UPBA 2FPYA 4DPQA 5E1QA 1IXOA 3G1HA 2V2DA 4TMCA 3M41A 4Z1AA 4N02A 4MYAA 3NGJA 6ALDA 3SR7A 1W5NA 3WJYA 2QCMA 1ME9A 2X1SA 1YDOA 1FY6A 4PFMA 3U6WA 2QCGA 3TAKA 3WJXA 2ZFAA 1WYIA 3KHJA 4ONVA 3M47A 1B4EA 2DP3A 2JKAA 1KFBA 1B3OA 4DQWA 1RQBA 3PWAA 1WAUA 1QO5A 1XUZA 3B4UA 1O94A 1T0OA 3V75A 1SQ7A 5KZMA 4GFSA 1TJPA 4FIQA 3DXIA 3W7RA 1ZAIA 3L66A 3M6YA 1YADA 4E0CA 3QW3A 2YGYA 2YR1A 3WJWA 1I4NA 4BWLC 1XBYA 1RVGA 2WQPA 1G7UA 1FWRA 4HT3A 3NQCA 3MWAA 1ZENA 4NXSA 5F4SA 3P80A 4ZQMA 3S8HA 4QIUA 2YZRA 3FJ6A 4A2RA 5D32A 2OT1A 1I2NA 3LXBA 1NEYA 4FXSA 1A5BA 1VYRA 3KRZA 4EOUA 2E6DA 3TC7A 5HINA 4MFEA 4OT7A 1OX6A 4O0ZA 4M5PA 1FXQA 2WKJA 4N6FA 1X7FA 3W2LA 3W07A 2VXNA 1RZMA 4FX7A 3IIZA 2ZRVA 2V5LA 3C56A 4KWWA 5HMSA 3UWWA 4WD0A 4GRSA 4L4LA 1H7XA 4UFHA 4O19A 1W8SA 5T26A 5CZTA 1T8XA 4JR5A 4O1CA 4DF2A 4O16A 3QF0A 1C9DA 1QDSA 1Q6QA 3EX4A 4UFKA 3CTLA 5CSRA 4UTMA 5HR7A 2A7PA 5AOUA 1ICQA 2B0MA 3W1UA 2V30A 2VEMA 4HNNA 3ATYA 3WK1A 2B7NA 2AGKA 4P61A 3W1MA 1VCGA 5DELA 3QMSA 5L9FA 1JUEA 1P5BA 2ZRWA 4YCPA 5E0KA 4CNPA 3HG4A 5HUPA 1BWLA 2HS6A 4MLJA 4NJKA 3BLFA 2V5BA 3UWZA 4E2DA 3L5MA 3BG9A 4WZHA 4AWUA 2FPTA 2P1FA 3L9CA 1C8VA 4IMGA 3W3OA 4N6EA 1OJXA 3MMTA 1ME8A 1TPB1 1W56A 3NAVA 2Y89A 2QJIA 1JR1A 1GQNA 1JCXA 2TRSA 3G1AA 3W84A 1OG0A 4R7JA 3LLFA 1EEPA 3HO8A 3RU6A 5FF4A 2NXIA 3F4NA 1BKSA 4DO4A 1SW7A 1OFOA 3WK0A 2ZA3A 3L5AA 1L2UA 1UUMA 4DF0A 1KLYA 2CLEA 3L5LA 3C2VA 3FOKA 3HMJG 3O1NA 4O1DA 1HUVA 2YCEA 5I3FA 2ZRUA 2TYSA 3FEMA 4XUGA 2A4AA 4DBDA 3MJYA 3THQA 4HSOA 3JS3A 4DPPA 4IOTA 3TFCA 1MSSA 5EY5A 1SO6A 1WA3A 3NQFA 3QZEA 3ANYA 2C13A 3TFXA 1XCFA 4JY9A 3W7LA 3CPRA 2AQWA 4O14A 3G1FA 2FB2A 1JULA 1KV8A 3QPYA 4BFAA 3S6DA 2CZFA 3DFTA 4NUWA 5F2LA 2E09A 3C2OA 2WO5A 4OU1A 3W7EA 4HNUA 3K30A 1K8YA 1Q3NA 3NM1A 4MYXA 4IQLA 1AL8A 2CFFA 3GDRA 2H8ZA 1JCJA 2A7RA 3MYPA 1JCNA 1DJQA 4K6AA 3M5VA 1QWGA 4DO5A 3R13A 3W2JA 3S1UA 4AHOA 1QPQA 5KSWA 2ZZ6A 2VFIA 2VOMA 1W54A 3NR0A 5A5WA 3ABOA 3QH2A 3KVLA 4GC4A 3KVMA 2J24A 2JGQA 1RQEA 1FBAA 3QJAA 1ZHAA 4BI7A 3W2MA 1X1OA 5I3KA 2AAMA 3LRMA 3TSBA 3DGRA 6TIMA 2CWNA 5K3VA 3CC1A 4ZQOA 5C2XA 4ZQRA 1LBMA 1AW5A 2C3ZA 3PB0A 1S3HA 3E96A 1IXNA 1W3IA 3PS7A 5LSMA 2PC4A 3NPUA 3W22A 3DH7A 4FNUA 1PIIA 2YYUA 3Q58A 1N55A 5IBXA 3NQGA 5D2WA 4HKPA 3S1VA 1FDZA 3M5ZA 3N9SA 2RDWA 3SFKA 1ME7A 4ZVJA 3B0UX 4Q4KA 1IIHA 1I2RA 4NZJA 3G1DA 3LCWA 1I2OA 1RV8A 2I14A 3BG5A 3RLVA 3GVGA 5AFDA 3QMTA 1FCQA 3EXRA 4PH6A 1QPNA 4UTHA 3N2XA 4S1FA 1YXCA 1SSGA 5LZLA 1G7VA 2ISWA 1FUYA 2ZZ7A 2YDAA 2QUUA 3QMRA 4M6PA 3W1QA 4IPIA 4IMEA 3MBDA 2C15A 3LRKA 1TYGA 3W7CA 3CEUA 1K8ZA 2E6AA 4A2SA 3HG5A 3RNDA 3B8DA 3E0IA 1LOQA 3W2UA 3G22A 5AYZA 4OGZA 4FO4A 5D2VA 5E93A 2NZLA 4WQ6A 2HMCA 2QUVA 3LCHA 1NF7A 3W7NA 4BF9A 5DY2A 3U8GA 1TRIA 4JYFA 4JX6A 1M7PA 4GXMA 1KM4A 2PCQA 3MP3A 3TK7A 3PSVA 5BMWA 2W6RA 3IRDA 4GWEA 1XFBA 3OHIA 3PM6A 5FEWA 4Y6GA 3QEZA 5FEPA 3TSDA 3PULA 5DBUA 4KFOA 1I8JA 3M7WA 5EMUA 3C2FA 3CIWA 5CZSA 2V0TA 4RXGA 5HWNA 1EX5A 3SGUA 2GJLA 3VI2A 3KRUA 1Z44A 1VR6A 1QOPA 3B06A 3E02A 1ZAHA 3BO9A 3H54A 4YMZA 1CI1A 4E38A 3LTYA 1ZJIA 4UFMA 2C6QA 1SZNA 4XQ6A 1W0MA 3LLDA 4XTIA 4MKNA 2VFEA 3HBLA 1F6KA 4K8HA 1TPC1 4NU7A 2NXGA 2PRHA 1WBJA 2R14A 2Z1BA 3BK0A 4LOCA 4CNNA 1IIGA 1QCWA 1HL2A 3TR2A 1KTNA 3AJXA 1JQXA 1W5PA 2BWGA 3TMQA 4JS3A 2ZTKA 1TTIA 1KFCA 2DZUA 2CLMA 1O60A 3NQVA 2X16A 2NUYA 4N4QA 3O6CA 1V5XA 2PRLA 5DCEA 3H53A 4JTEA 1FWNA 1TQJA 4OE7A 1SFJA 2G95A 3NNTA 5AHMA 1KM2A 2NV1A 3T40A 2EPHA 3FYOA 3DI0A 5D04C 3EWWA 1AW2A 1W1ZA 1YDNA 2ALDA 1VYSX 4HHPA 4Y8FA 4QNEA 5D05A 3SY5A 4LVGA 2QF7A 1ML1A 4FF7A 2KZHA 2VFHA 1EUNA 2VEPA 1V7YA 1YDVA 3G0SA 1DQXA 4M6QA 4MLRA 2OX1A 5LNRA 1F6PA 5AHFA 2CLLA 1FCBA 3ATZA 1F73A 3SGZA 4WX2A 1G4SA 5HWMA 2A0NA 2C18A 4B5NA 4DF1A 3EX3A 3LXAA 3A5FA 4NT0A 4FHAA 4I7UA 3LCFA 2QCHA 3EB2A 4YLWA 1EA0A 3NQDA 4UCGA 3G1XA 1LZOA 2NUWA 1M7OA 1VYPX 1OX4A 4UFJA 1H7PA 3PB2A 3NEVA 3O06A 3TQVA 2X1TA 1KM5A 3U2OA 3G24A 3SIZA 5J5RA 1O4UA 1TV5A 3GNNA 3MW7A 5KMYA 4FNSA 4AEOA 1X1ZA 2QJHA 2DZPA 2Q8LA 3F4WA 5I3HA 4N9BA 1JJKA 2J9XA 4O17A 4JTJA 1YLVA 1I2QA 3GAYA 3OG3A 3LRLA 1J5TA 1FDYA 3CEPA 4Z08A 2DJXA 1X6UA 3TNOA 2ZA1A 3HPZA 1SR9A 2BSLA 3NL6A 2WNNA 2NX1A 3EXSA 3NQ2A 3D0CA 3W23A 3EX2A 1DBTA 4M7TA 4Q33A 1EWEA 4UTWA 4HIBA 4OWGA 4QAIA 1I2PA 1TPFA 1ZALA 3DFQA 2B4GA 3KRSA 3LERA 2FFCA 4M19A 4AB4A 4GUFA 4JX4A 4ADTA 5C5YA 5F4WA 5G4WA 2WSQA 4N4PA 4O4VA 1H51A 4BI6A 3QSRA 5HQEA 4PA8A 3FYPA 4PL2A 4UR7A 3E9AA 4LVBA 3W1XA 3P8IA 1OFEA 4DELA 1M5WA 2ISVA 4WUIA 5KZDA 4LVFA 2E6YA 5A8GA 5AC7A 2NXHA 4CQ9A 2B7OA 1NVMA 2GUUA 4AF0B 1RR2A 1DKWA 2O7QA 4FX6M 2VC6A 1KBJA 3ZR4A 1GT8A 3UWQA 3PG9A 2EAWA 2X2GA 1WBHA 4NJGA 3USBA 1N7KA 3QQ1A 3NQ8A 1XBZA 1AMKA 2A1YA 3NL2A 1SPQA 1SZGA 2RKXA 1THFD 1D3HA 2RDTA 2Q3OA 3C0JA 4X22A 3WJSA 3R8RA 3Q37A 4QQ3A 1KLZA 1FCVA 2ABBA 4MY8A 3GZ3A 1NAL1 2HSAA 3PVFA 1R2SA 3M5YA 5AC6A 1GWJA 1HO4A 1F76A 3R5EA 3L0NA 3DAQA 3ZWTA 1VZWA 2JKPA 2DZSA 5BOOA 1SZFA 3TXZA 1EIXA 3G3DA 2C19A 4LS1A 4PL1A 1W5QA 3E49A 3HGRA 4XBSA 2ZYFA 1XBXA 3ZS4A 4A22A 2YFOA 2XN2A 5D2XA 4IX2A 2NWRA 3NA8A 3PAJA 3P74A 4ADSA 2OJPA 1B4KA 3NM3A 4ZQNA 4EIVA 2A6NA 1JCLA 3KVKA 4ZZ9A 5BW6A 1UB3A 3TH6A 1SO5A 4IUOA 2ZZ1A 2BTMA 1KV5A 2RH9A 3NZRA 4JY8A 4LVDA 4XTDA 3W74A 4N9EA 3W83A 1OF8A 4HN4A 2Y7FA 3GIYA 4JYDA 5LGZA 3O6YX 2E6FA 3TMLA 4UTTC 4MY1A 3L65A 3RF9A 5DBTA 2WNZA 3P5ZA 4NNCA 1LYXA 1WV2A 3LBCA 3DKLA 1P0NA 1TMHA 3VE9A 4S2CA 3LB0A 2TMDA 4GE8A 1EUAA 3MYOA 4O1BA 5DLCA 1XM3A 2WSYA 3GXTA 2ZRZA 4A3UA 2V82A 4LNYA 4JTFA 2BLEA 2ZCGA 3KX6A 4WY0B 1FWTA 2D73A 3NPWA 4RCXA 3B04A 3MI3A 3WFAA 1MEHA 4IXXA 1L6YA 5LNWA 3JRKA 1R30A 2I1OA 1G69A 4MZYA 1JUKA 4Y96A 4Z0SA 1VHCA 2X1UA 3ABSA 1OX4B 1W31A 5AHIA 4K7YA 5G4EA 3EXTA 5TIMA 8TIMA 4DBEA 3EWUA 3THAA 2GVGA 3HF3A 1AL7A 1LORA 4HPJA 4O0KA 1ICSA 2CU0A 4IXHA 4ZQPA 4A21A 3DBPA 3IV3A 3P60A 1IXPA 3W7PA 4UTUA 3KFTA 1G67A 2YPIA 3M16A 3QRHA 1PVNA 2E5DA 2E77A 2Q8ZA 3NYZA 5L6UA 2EKCA 1WOAA 3DHDA 4AVFA 3EEGA 4G1KA 1TTJA 3GR8A 1OFAA 1FX6A 4QSHA 3S9YA 3W2KA 2OZ0A 3HPXA 3S5OA 5CZJA 3R2GA 4CCCA 2C16A 3LCIA 3UPWA 3N9RA 3OA3A 3G1VA 2YX0A 4JDYA 5HULA 4FXRA 3W70A 4IPJA 3W7DA 3LHYA 1W5MA 4MOZA 5I3JA 2A7NA 1VGAA 1S5VA 1UJPA 3QSTA 2Z0IA 1VH7A 3W1TA 1JRCA 2YFNA 1DVJA 3NQEA 1XDMA 1TB3A 1H50A 3ELFA 1H5YA 4AXKA 2CLOA 3UXDA 3TC6A 1WDWA 2P0OA 3DKJA 3NXFA 3CHVA 1LBFA 5G5IA 2CZEA 4JX5A 3ABQA 4K8EA 2Y88A 4R53A 3W87A 3DENA 3FJLA 1IXQA 4QNWA 5G2WA 1UBSA 3FS2A 3C61A 2FTPA 4FEZA 2YW3A 1L9WA 3DU0A 3TJLA 3GDLA 1LLZA 5F4XA 1G4PA 3GB6A 4AAJA 3UWUA 1SZEA 4LWWA 3W85A 4PEKA 1E51A 4UMCA 2DU2A 3VNDA 1BWKA 2CW6A 3OVPA 5EL1A 5SWUA 3W9ZA 2ZRXA 1F74A 3HOJA 3P67A 3TQ0A 2VENA 3G18A 3INPA 4O15A 4WXYA 1B57A 1OABA 3NOEA 2HTMA 5FF7A 2DZXA 2QDGA 3MUXA 4N9CA 3WJZA 4LVAA 5LGXA 5D30A 5C6MA 4JD4A 2ZZ5A 2EHHA 3L0KA 1FQ0A 4LRSA 4LTSA 4BWLA 3PUDA 1B9BA 5LHEA 1ZY9A 4FX8A 3FA5A 3ZFHA 1A5CA 3LCGA 1TTQA 5I3GA 4O1AA 2R8WA 4UXDA 5EBUA 3GKAA 2LLEA 1X8FA 2QAPA 4K39A 1KM3A 2Q3RA 1FWSA 2OCZA 5FEXA 2NV2A 3I7QA 1TPVA 1XC4A 3O07A 1OFDA 2ZZ4A 4DXVA 1W3NA 4YCOA 1WXJA 3STCA 4RZ4A 4RLIA 3G1YA 4KFPA 4TU1A 1F5ZA 1LRNA 3LBMA 3MO7A 2JK2A 1DL3A 4I7VA 4W9TA 3DHFA 1UUOA 4LW7A 5F2IA 1LTDA 4S2BA 1GTHA 1VPXA 1TPWA 2FDSA 3F1QA 2JBMA 5D33A 3P82A 5LKYA 3MHUA 3CT7A 4ORIA 4POCA 3IVSA 5EPDA 3S5YA 5IM51 1H7OA 4TIMA 1QR7A 2E1DA 2E68A 3GR7A 4O4WA 2GVLA 3IVUA 3NG3A 1TO3A 3G0XA 3W7MA 1TPEA 5C54A 2DZWA 3L68A 3IVTA 4OV4A 1OVDA 4HNVA 3TE9A 3W72A 3TIMA 4AHQA 1G4EA 2F84A 1SU5A 4O50A 3PBUA 4AF0A 4EWND 1ZAJA 3BGJA 2ZRYA 1A50A 1Q45A 2QR6A 3KXQA 4Z1BA 2A6LA 4JXCA 2GQAA 3PUOA 1XBVA 3HGSA 3SJ3A 1IF2A 3A24A 3QM3A 2V9DA 4ML9A 4O57A 3GLCA 4CLMA 2TSYA 2E5BA 4MPQA 3LCXA 4GUIA 3LDVA 1KFKA 3I6RA 3CIXA 1OFPA 3LI0A 1SO4A 4X9SA 5K9DA 2X30A 5LHFA 2FJKA 3UD6A 2C0AA 4QM1A 4IWWA 2Y62A 4UNKA 1LROA 3GX9A 4YXGA 1GEQA 1OFQA 3GK0A 4LU0A 1EPXA 4GJ1A 4LV9A 5AN7A 4GUGA 3OBKA 2F7FA 2FQIA 1KA9F 4EF8A 3C2EA 1R2TA 5D2TA 3VCRA 3CWNA 1GVRA 2PRMA 3C6CA 4K36A 3CM4A 1TREA 1EWDA 4UFIA 3FKKA 3HGJA 4MIMA 3S0CA 1KM1A 2XN1A 1PS9A 3W2NA 3TXVA 3UY7A 1ZFJA 3HG2A 4JIPA 4IMDA 4RR4A 4JTUA 1S5TA 1XI3A 2VELA 1LRTA 4TR9A 1K03A 4EVZA 3O05A 4I9AA 1GPWA 3NQMA 2YXGA 1IGSA 1U5JA 1UCWA 3CU2A 1QNVA 1TCDA 1VHNA 1QOQA 1GVQA 3HB9A 4LS0A 4O12A 2JKEA 3MBFA 3PF3A 4WY0A 3PG8A 3EX1A 3YPIA 2ZA2A 5D09A 3W7KA 4O13A 3UYCA 4NX5A 2V8ZA 3A21A 4BI5A 3EWYA 3I68A 3O6DA 3GYEA 4UTIA 5EYWA 5DXXA 5CZ0A 2Z6JA 3M44A 3PBYA 1H7NA 1MXSA 3P7YA 1HO1A 3LHTA 5F1UA 3GXNA 3PUEA 1TV7A 3UQNA 1YTDA 4WXZA 5AHEA 1KBIA 4O8RA 1TPUA 3HQ1A 3GAKA 2QUTA 2ZDRA 2GQ8A 1D3GA 1F2JA 3G8RA 1F7BA 3NL3A 3UWVA 3I65A 5EA9A 4XWUA 3QPZA 4NQ1A 1XDLA 1MEWA 2ATMA 2FLIA 3C3NA 5G1TA 4A29A 5BMXA 3P84A 4JTSA 3FLUA 1XL9A 4WOQA 1KTCA 1LBLA 3NQ6A 2UV8G 4M7SA 4Z1DA 1HTIA 1OFRA 4LUJA 5J5DA 4UR8A 1GTEA 4XKYB 4QJ1A 3MI2A 1EB3A 1PL9A 1LLWA 2NLIA 3LHVA 1P4CA 3W7IA 1GG1A 1TIMA 2CZDA 3Q2DA 4NNAA 1H7WA 3LXCA 3BLEA 3BVJA 1Z48A 3N34A 4MJMA 2RHGA 4ORMA 2G96A 5KITA 2QCDB 3TA6A 1G4TA 5G2HA 2Y85A 5HJLA 4LS2A 2BZNA 3NL5A 4XZ9A 4O52A 3T4CA 3LHUA 4O54A 4RV8A 3W1LA 3NO5A 3PY2A 3ZWSA 2Y7DA 4H4IA 4LT9A 3W76A 5K7JA 1TV8A 4RKAA 1PHWA 5HUOA 4JNMA 4GBUA 5D38A 3S5ZA 3DFNA 4O10A 3TW7A 4P2VA 3C4UA 1O95A 2ZZ3A 2ABAA 2B7QA 3HGOA 4JTGA
chains in the Genus database with same CATH superfamily
2YXXA 2X05A 1XH0A 2VM8A 1Y0EA 4Q8QA 4CCEA 1VQTA 3I3EA 4HOZA 1TTPA 2C1HA 3B0VC 2G3MA 3W1RA 4RX0A 3FGCB 2PEVA 3VDBA 3UXAA 5IBXC 3GNXA 3DX5A 2QMKA 3HPAA 2G97A 1DOSA 1HKVA 1H7RA 4W7WA 1QPOA 3H2OA 4JAWA 1KRAC 5LNUA 4FNQA 1JPIA 4K68A 3WDQA 1V03A 5CG0A 1KM0A 1LWJA 2VDHA 4EF9A 3ZYZA 7ENLA 3MHGA 3SGGA 3UNTA 4AYSA 3P61A 4L64A 4D6FA 5EMKA 4AD3A 1BD0A 1L6FA 1JZ5A 5E0FA 3GNDA 2UBPC 3AMCA 1EEXA 3AYSA 2J7DA 3ITCA 2OT0A 2FZDA 5FEZA 4JTCA 3JR2A 5ABEA 2XZ9A 4NJIA 4DJDC 3W1NA 3MJMA 5BZAA 1PCKA 4LY4A 2R94A 4NHVA 3GU9A 2Z4GA 4G8TA 1AQ0A 1E6QM 1OYBA 3WH7A 3WUEA 1R3QA 1C29A 4LUYA 1NF0A 3OEXA 4JDBA 1RP8A 1J93A 3S6OA 1IT0A 2XIIA 3M0JA 1DWGM 2ZZ2A 1EJXC 1NOWA 1DWAM 6ENLA 2EO7A 1E1CB 3AIUA 1JCMP 3GVQA 1KXTA 2J66A 1C7TA 4JYEA 4PUEA 3SM0A 1SMAA 2PDMA 4KWVA 1B9ZA 2RFGA 4YJ5A 1VJIA 3LTSA 2HBVA 3B0PA 4CQAA 5D02A 4MZ1A 5KINA 2X0SA 3TYEA 2PDLA 1W1VA 3CWOX 3LI1A 1REQB 4TVDA 3V1PA 4PMDA 2J4GA 1ONRA 1OK6A 1GJWA 2BVTA 2XFWA 3DGBA 3M7SA 2NVCA 4V1YA 1V6TA 2YL8A 2OG9A 3RJXA 1EBHA 2EKGA 4PUKA 4KIEA 1TSIA 3P93A 1X39A 4GNJA 4DXKA 3QW4B 2BS9A 4FB7A 1DJNA 3VKJA 1OYCA 4DAFA 3GXDA 4IGHA 1N2VA 2ZE3A 3GH7A 4FSAA 4JGDA 3M0MA 1YE4A 1U5VA 1XQKA 2WV8A 2PE4A 4GA8A 4UUIA 4AWSA 4LC8A 1UD8A 2W63A 5A8MA 3CB8A 1LRQA 1ISYA 3IJQA 2NX3A 5CGMA 3REQA 1K9TA 1YTKA 2YA1A 3ARRA 3MKKA 1CGTA 1JD7A 1ECQA 2Q6ZA 3DECA 3SI9A 3VIGA 3OGVA 1PCWA 1HVXA 1GVOA 4K1GA 3FFSA 3RFAA 1BXNA 2C1IA 3KE0A 4E4UA 4K7VA 3SECA 3LM7A 1BTMA 4NZFA 2P10A 1JFHA 1SO3A 2ASHA 1RH9A 5AC4A 1WDQA 2O9OA 3R1ZA 3UZWA 1QNRA 1K6WA 6REQA 1L6WA 2MANA 3KWSA 3OLDA 1S5WA 2I7GA 1S38A 4MWAD 3UF9A 4NI3A 5DANA 3T78A 3WLIA 4MVAA 3R12A 3EA1A 3PZTA 2V5CA 5KZ6A 3O63A 3TJIA 2OSYA 3D3FA 1T41A 1E5NA 2V69A 3K2GA 1BWVA 3MP5A 4L4MA 1LP6A 2PA6A 2IPGA 3RITA 2D23A 4IQJA 3M0ZA 1M65A 4WOZA 5TAOA 3QLLA 3SQLA 2ACUA 4MSSA 5AYXA 3GRIA 1VBGA 2KAUC 4KKXA 3OVQA 3MCMA 5M17A 4GQ0A 3UZ5A 1PDYA 2JFEX 4FMVA 2VGBA 1IR2A 1H60A 4PMUA 1G9HA 4XKYA 4H6KA 3EOOA 3SW6A 1EP2A 1QW7A 1FTXA 4IGNA 1XLGA 4AMAA 4YWIA 3W7JA 3DZ1A 4PUJA 3K1GA 4W8LA 2QCFA 3VC6A 1P1XA 2Q01A 3KOZA 1UWUA 3VD7A 5IFPA 3TONA 1BVZA 4X2RA 3F5JA 2PDHA 1D8CA 1YYAA 2W27A 8RUCA 3M6DA 3WN6A 1XC6A 3P62A 3E5BA 2DT1A 4ACZA 1DORA 2HISA 8CGTA 3HQPA 4RE2A 1VC4A 1XINA 3FSTA 4TV5A 3VOFA 3ONCA 4UZUA 4REQB 3STFA 9RUBA 5CGQA 1FXPA 1XLMA 2ZDSA 3W4RA 4M1RA 2EPOA 5DO8A 2J79A 4HPXA 4LRTA 1GJUA 4US5A 1QFEA 1QPKA 1ENUA 2I9EA 3GXPA 3TOPA 1VBJA 4CUCA 3GE7A 4DEFA 4MPKA 1JVNA 3FA3A 1OC5A 3V3WA 3OW1A 3VE7A 2GOUA 1MFVA 5C55A 4A8RA 4CEUC 2Y7EA 3WEOA 1E56A 2E1WA 3GD6A 3N2CA 1NP2A 3L2IA 3WUFA 3A23A 5A94A 1ONXA 4WRHA 4HSNA 4OOUA 2FIQA 1SW3A 1SSDA 2PDCA 1OCJA 3BQ5A 3A5VA 3WNPA 5DCBA 1JZ4A 2EG8A 3ARPA 1V0NA 4GXWA 4ICNA 2X40A 1TWDA 3KP1A 4TO8A 4CQCA 2O56A 3WDJA 3AWNA 3T81A 3EKLA 5B7YA 1GZGA 5HNRA 3P81A 4U4MA 3GHTA 3KZSA 4NJHA 5C9WA 3D5HA 3LYEA 4BS0A 2DUXA 2WNQA 2ZX5A 3DFSA 2Z2AA 3AXIA 3B4YA 3RM8A 3M9YA 3PZOA 4HOWA 4NRSA 4OUEA 1PAMA 5CJ5A 5AC8A 1T8QA 3ABZA 5H1WA 4Q8PA 1O5XA 3E6EA 4QITA 1GCYA 2Z00A 4PSPA 4J4KA 4RK8A 1HJVA 4AU0A 1DWHM 2QKFA 3PR2A 3T7VA 1R3WA 1MO0A 1OT2A 2NQZA 2QJGA 3QV6A 1SVDA 1HKKA 3KBVA 2E8ZA 2UY2A 1Z41A 3BLDA 4ADUA 1MQPA 4B3KA 4DNHA 3IIVA 1H5VA 3IGSA 1KGXA 3UCCA 5I6SA 1CW2A 2ONEA 4QE1A 4UIOA 3UERA 3GR4A 3S1XA 3NSXA 3AIQA 3Q67A 1HJWA 3OOQA 2C8NA 4G5DA 4AY7A 1E43A 3E12A 2AQOA 4C6FA 2AMGA 1UA3A 4E8CA 3N12A 2FPVA 4XZWA 3ARQA 2IQTA 1V0MA 1K7EA 4G7FA 2EGZA 1ICPA 2NX9A 3T6CA 3MUY1 5DMNA 1QMLA 2CLPA 3KBSA 1X6NA 3TJXA 3VGDA 5BU6A 4ZB5A 3FXYA 5E1QA 2J7HA 4H01A 3B8UA 4D6DA 4TMCA 3AS1A 4N02A 1SFTA 5EBAA 4GI4A 2GGHA 1V3KA 1C93A 1M3UA 5I78A 4PFMA 1HZYA 4ACZB 2RGLA 1EJTC 4ONVA 1B4EA 1BXCA 3TTEA 1KFBA 1B3OA 5HPOA 1RQBA 1H1NA 4QHRA 1XUZA 3B4UA 1J0HA 3AZRA 2X09A 1KXVA 2CETA 3W24A 4GQGA 1TJPA 4FIQA 4NF7A 1Y65A 4GO8A 3W7RA 4B4FA 3ITLA 4E0CA 3UETA 2OFJA 4V33A 4BWLC 3S2NA 1JFXA 5I07A 5DT7A 4E6MA 2WQPA 3WF0A 4AD1A 4HT3A 3WZ0E 1MFUA 3CO4A 1W3JA 4JTAA 4QIUA 3F7JA 1WUEA 3RO6A 1E6SM 2OT1A 8XIMA 2CCRA 4W7VA 3KRZA 2DVXA 3S9ZA 2BFGA 1BKHA 4DM2A 4MFEA 4O0ZA 3T42A 4IIFA 3E74A 3ZJ6A 2VXNA 4JHOA 1F8IA 1LT7A 1M68A 1X96A 1F07A 3UW6A 3UJRA 5LIUX 4WD0A 3HURA 4FZIA 1O66A 1GVYA 3TTSA 1AD1A 1W8SA 3FJNA 1OZQA 3WLSA 2PTWA 3UZYA 4DF2A 2WMHA 1QDSA 4V27A 3EX4A 3O6AA 1WKFA 3CHDA 1YNQA 2OWWA 2V30A 6XIAA 2VEMA 4HNNA 4TUFA 4Y9NA 3WK1A 4HU4A 4P61A 3QMSA 3AYRA 2YOCA 1XIBA 3E0WA 3AS2A 4C7FA 4JFVA 3HG4A 3NZQA 2HS6A 4DYKA 4MLJA 4E2DA 3BLFA 4BF7A 4CEXC 3L9CA 4IMGA 3UJEA 2D0GA 1ME8A 1TPB1 4MDOA 4HCDA 2XIQA 4BCEA 4E2VA 3AS0A 1V0LA 2DSVA 3W84A 1R3RA 3QOMA 4ES4A 1OG0A 1QW8A 1JPHA 2JQXA 2PU0A 5FF4A 1IZKA 4R85A 1CXIA 2WMKA 4A8LA 4TTUA 3VU2A 1OFOA 3WK0A 1J6OA 4HTYA 3EGJA 3GYCA 1NM9A 3SCQA 3LPPA 3TN4A 3OYXA 3QZAA 3C2VA 3HMJG 1R7OA 1FHLA 1HUVA 3B0YA 2ISFA 5I3FA 3F2BA 2TYSA 5E6ZA 3URBA 2A4AA 4DBDA 3MJYA 2QGYA 4IGSA 2D20A 3JS3A 2DIJA 2CBIA 4IOTA 3BLPX 3MMDA 4B2DA 2I9UA 2C13A 3TFXA 3HN3A 3FW6A 3W7LA 1H2JA 3VIHA 3CPRA 2AQWA 4TVUA 4H9XA 1KGWA 2WVUA 3CWHA 1JULA 3DFTA 1V3HA 5F2LA 3NDYA 1J0YA 4HNUA 3K30A 1OGBA 1CNVA 4MYXA 5IRPA 3PNUA 4PUWA 2H8ZA 4XVEA 1B3ZA 4F0LA 4K6AA 4HA4A 4DO5A 4D72A 3W2JA 4EPBC 1KKRA 1H11A 5CC5A 2PGEA 5A5WA 1S39A 3ABOA 5EB8A 4JQAA 1RQEA 2VRQA 3QJAA 1X1OA 5I3KA 1I0DA 4CNTA 4BEQA 1KRBC 3I4KA 1V6UA 2F2KA 1TV4A 1FVPA 3DYOA 1AW5A 3PB0A 2V3EA 3E96A 4PSRA 4FNUA 1PIIA 2XSAA 3Q58A 4RPPA 1N55A 1UR9A 3OZYA 2D1ZA 1XIFA 2EBNA 2X8RA 1XH1A 1UC5A 3B0UX 4W5ZA 3U0HA 4LEQA 1I2RA 5CJNA 1I2OA 2FGLA 1XLAA 1ODZA 3RLVA 5AFDA 2FTYA 2RAGA 2A3HA 3BUVA 2PD5A 1G7VA 1FFQA 1FUYA 3D46A 3WNNA 4QG9A 3BTNA 3D47A 2QUNA 3QMRA 3W1QA 3RN6A 4RE0A 5I09A 4P8XA 1BYCA 1KCZA 4MHBA 2WKGA 1TR9A 2OODA 4MUPA 3R7MA 1K4GA 2WXDM 3RNDA 4D71A 3B8DA 3TEVA 4NP7A 4B5XA 1P0BA 5A6AA 4OGZA 4FO4A 1UIPA 3QGAC 2EEXA 1MUMA 1XIDA 2XGIA 1NF7A 1P7TA 1L6GA 4JYFA 3N15A 4GXMA 3TK7A 3PSVA 3P6LA 5GQBA 2W6RA 1YQ2A 3GXIA 3A4JA 3DC0A 4KPLA 5DBUA 4KFOA 1EO7A 1JDDA 3AJ7A 2XDFA 4Z2HA 2A3BA 3H2FA 3CIWA 1XPGA 1C92A 4OFCA 4U5IA 1VR6A 3B06A 3AAMA 3E02A 3KL3A 3BO9A 1HJUA 4C6PA 3RHGA 4YMZA 3LU2A 2HV5A 4EACA 4UFMA 2C6QA 4PTWA 3LLDA 5T9BG 4U33A 1EA9C 1EXBA 3TA9A 1LQ2A 3FN9A 4KEVA 3SCNA 1HF6A 1TPC1 3BICA 1SFSA 7CGTA 2Z1BA 2R14A 3BK0A 3NSNA 1UIOA 1KTNA 3GC2A 1YBQB 1JQXA 1VBUA 3NZGA 3CL8A 3CT2A 4KESA 4YHEA 1KFCA 4HYWA 1KQZA 4N4QA 3VNLA 4LH8A 3V5FA 4HJWA 2PRLA 4GZIA 4F0RA 3VDHA 2J7BA 4S39A 1VEMA 2VZVA 2EPHA 1XLIA 4UCFA 5D04C 2XG9A 4ZA0A 1XIGA 1AW2A 4AD0A 1JZ7A 2GYIA 3DERA 1ZZMA 3PWGA 1YDNA 1R3TA 4HHPA 3SY5A 3WQWA 2W66A 4JHZA 1JYNA 2BHYA 4QLLA 1ZPTA 1EYEA 2BP1A 4MG4A 3WMLA 1EL3A 3ARXA 3R11A 4MJ2A 2OX1A 5LNRA 3SADA 1F6PA 1XSKA 4A3QA 1FCBA 3SGZA 2R82A 4JFSA 5HNNA 3UG5A 2G41A 3EX3A 1Y7VA 3LXAA 4GBDA 1LLOA 4NT0A 5IOBA 1BG4A 4YLWA 1EA0A 4UCGA 3G1XA 1LZOA 2NUWA 1M7OA 2IS7A 1UQZA 1H7PA 4QAWA 3NEVA 4HVXA 4US5D 2OELA 2ZC1A 4AEEA 4AEOA 2VD8A 4GYJA 2BASA 2DZPA 4LAKA 4S3JA 4PTDA 4WDUA 5DRIA 1PKYA 4JTJA 1YLVA 1J5TA 2D24A 3CEPA 3U7VA 4Z08A 4XAYA 1C9WA 3UXIA 3TNOA 4L80A 2JEPA 3FK4A 3W23A 3GW0A 4IIGA 4UTWA 3DFQA 3IACA 3UESA 1H0GA 1KBKA 2FFCA 2A3AA 5T91A 2X42A 1HN1A 1WKDA 5C5YA 4ZCWA 5CBJA 4NI8A 5G4WA 4RDVA 3EWCA 5H8PA 4GYKA 2JF6A 5HJXA 1M03A 4LB3A 4YTRA 1Q85A 4PL2A 4UR7A 3UYIA 4PRRA 3BXWA 4L6DA 4DELA 3VKKA 4ENLA 2E6YA 3KCJA 1TE6A 2B7OA 1LL6A 4JBRA 1FHDA 1O5QA 3UXLA 2BY0A 2O7QA 4FX6M 2VC6A 1GT8A 3PG9A 1J8VA 2WJDA 1WBHA 3QQ1A 4GKTA 4JIHA 4GQBA 4XD3A 1QI5A 1PZ2A 2VGFA 3PNZA 4QDPA 5XIAA 2RDTA 2Q3OA 3WJSA 2NV9A 3VTRA 1DQUA 2ABBA 1OT1A 5DQPA 1TVNA 3L2LA 3WMBA 4NIRA 5A6SA 4OKDA 2HNHA 3R5EA 2F8QA 4HB7A 2GUBA 3ZWTA 3ME3A 4ZOAA 2D0HA 4RW5A 4OBRA 4PL1A 1VEOA 1A3XA 1BF6A 2WMIA 2HK1A 2DH2A 1J0KA 2ZYFA 3ZS4A 4A22A 2XN2A 1ZSXA 3NA8A 3PAJA 1EF2A 1EJVC 1CXEA 2A6NA 4EIVA 1F6YA 4B5SA 4EXAA 4GCAA 3B0XA 1GK8A 5BW6A 4S3KA 3S9IA 1UB3A 1UD5A 2ZZ1A 3GU2A 2RH9A 2WW5A 4ZOEA 1QNPA 4XTDA 3W74A 4WGHA 3N18A 3OU8A 4OJYA 1DWJM 1AQFA 3A3XA 4NZCA 3PBGA 1MW3A 3TTYA 3WQ5A 4PMXA 5A2CA 2Z1WA 5DBTA 3A4XA 3LBCA 1TVLA 4XIMA 4YYFA 3ARYA 4H2HA 4QX4A 4MTVA 5GNZA 4O1BA 1XM3A 2WSYA 3N6JA 3KWXA 2J78A 2FKPA 1B30A 1QXLA 2D73A 1ZQ5A 1AZ2A 3WF2A 4HK7A 2PWHA 4Z0SA 5TD4A 2WPGA 3M0KA 2ZUTA 3ABSA 2X1UA 1W31A 3BAYA 1JGMA 8TIMA 4M56A 3KZPA 1XG3A 3U3HA 1MNZA 4DHGA 4IXHA 1P43A 3W38A 3FCPA 4IFKA 1K9EA 2INFA 3KTXA 5IHRA 1KQYA 4XZIA 4FOJA 4UWMA 3IJ6A 1J79A 1F61A 3M16A 2YCLB 1AJZA 2O55A 4AVFA 3QLDA 1OFAA 4I9JA 5FOOA 2OZ0A 1DJHA 2J47A 2JF7A 5CZJA 2C16A 3LCIA 4IJRA 1K8CA 4JNZA 1ZGDA 4FXRA 2AQVA 1EPVA 2OKTA 4IPJA 4L4OA 5CEWA 3LHYA 5I3JA 2A7NA 4ZXOA 1GYMA 1RPKA 1NP0A 3QXBA 1EO5A 3QSTA 2Z0IA 1VH7A 1DVJA 4C91A 2W67A 4S38A 1TB3A 3QC0A 1H5YA 4AXKA 2BG5A 2CLOA 4GI9A 2GZXA 1XYLA 1WDWA 1J11A 3DKJA 3NXFA 2PCEA 1E6NA 3ABQA 4K8EA 1GVIA 3W87A 1IXQA 1UBSA 3FS2A 3PTKA 4KF1A 4J28A 4L1XA 2FTPA 3VIPA 4LX4A 3MY9A 3TJLA 1WZLA 4YVXA 1LLZA 2GVEA 3ZO9A 1CXLA 1SR0A 1VKFA 3GHSA 1G0CA 3W85A 4HN8A 1E51A 4UBPC 1OBAA 2F38A 1SMDA 3W9ZA 5JQ9A 4EPEC 4GY0A 3P67A 5I23A 4WXYA 3TYAA 2HTMA 3M4HA 2QDGA 3GDBA 3LK6A 3L4TA 1XR2A 4N9CA 3VGHA 5D30A 4G7EB 1W1PA 2EPMX 3CZJA 3FA5A 1NDVA 1IQ8A 3UR5A 2PFHA 4Q8MA 3N13A 4K39A 1KM3A 2D69A 1U33A 5FEXA 3O07A 1NWRA 4JKMA 3PJUA 4RL3A 1RBOB 4YCOA 3T0CA 1LF1A 1X38A 3EZ4A 2O0TA 4RZ4A 4RLIA 3G1YA 3GY1A 4TU1A 4ZEPA 3LBMA 4C1NA 1CXKA 3WBYA 1UWTA 4Q4OA 4Q8WA 1US3A 3TTQA 4S3DA 2FDSA 3F1QA 2REQA 2ZE0A 5D33A 3SRFA 3R79A 2XH2A 5IM51 2WLYA 3IVSA 1DE5A 2E68A 1KXHA 3GR7A 1S5MA 4O4WA 4PBGA 3H70A 2PLKA 3PZ9A 2QQ6A 3NG3A 5A6TC 3G0XA 4HCLA 1EJ7L 3IV8A 1W2VA 4KETA 4HNVA 2BODX 1UZDA 5CAKA 3TIMA 4QS6A 2F84A 1ADSA 1SU5A 2OLHA 4O50A 4AF0A 4EWND 2ZRYA 2WMGA 1A50A 1EDTA 1E9ZB 4K3ZA 1IF2A 3VIIA 1C91A 3ZR5A 4PMQA 2V9DA 4ML9A 3NGFA 4PMYA 1P0DA 1Q6EA 2PP3A 3BLLA 2OLAA 3WNKA 4PRWA 3WLJA 4MPQA 4ZSTA 2DW7A 3I4EA 1TA3B 3E1F1 4C6EA 5CCZA 3DCPA 3WD0A 1A5LC 5LHFA 3UD6A 4MADA 1BVWA 4AC1X 4BHYA 1JIBA 1GEQA 4TV6A 1OFQA 4LV9A 1MVYA 1DXIA 2FQIA 1JD9A 5D2TA 4ASTA 1TX2A 1GVRA 1R3SA 5FACA 3CO8A 5D9NA 2PMQA 2MUCA 3WBWA 1EWDA 4AISA 3MCNA 2IPFA 2AMXA 3B9AA 4M3PA 3A6OA 2ZXAA 7REQA 3VNJA 1PS9A 2HWGA 3TXVA 2C71A 1TJ1A 1J10A 4Q3MA 1CLXA 1S5TA 1XDJA 3LA4A 1E4IA 1XI3A 2V3DA 1LRTA 1XYAA 4AZCB 4EVZA 9XIMA 2VZTA 4GVFA 1GPWA 4LEFA 4AMCA 4KQNA 3NQMA 1GPFA 4U2YA 1IGSA 1U5JA 1QNVA 1E6PA 2PC8A 1G01A 2NQ9A 4X60A 3EX1A 4J3UA 1HQTA 4KCVA 4R88A 4MAVA 3OIHA 3UYCA 4MMWA 2ZUSA 4HZ8A 5IHSA 3O6DA 5EGRA 4UTIA 5DXXA 3NQBA 3F2DA 4LCQA 1H7NA 4XAGA 3P7YA 1RVKA 2XHYA 1EC8A 3GXNA 4QTGA 1TV7A 5AHEA 1WDPA 4O8RA 4QCFA 3GAKA 1UWQA 2ZDRA 2VEFA 1D3GA 1ISVA 3NL3A 1QK0A 4NQ1A 1XDLA 2ATMA 5AZ1A 1XS2A 3TN3A 4A29A 1MUCA 1RXOB 5BMXA 2P88A 4JTSA 3DG3A 4Z2JA 3URNA 2XZ7A 5J5DA 4AZIA 1GTEA 4QJ1A 1W9PA 3OZMA 4F0MA 4EAMA 1POKA 4CU6A 5I5RA 2ZXBA 1P4CA 1E6ZA 4ZB0A 3ZLGA 1F3XA 2PGWA 4NNAA 1EJUC 1GORA 2R1KA 1CGXA 2VUNA 1EHAA 4EXBA 4MJMA 2RHGA 1QU4A 2G96A 3TA6A 3VM7A 1G4TA 2Y85A 4LPCA 3NL5A 4O52A 3HU7A 4O54A 4RV8A 3W1LA 1SZRA 3ZOAA 3OPSA 2Y7DA 3MTWA 2OKOA 1TV8A 1GKQA 4GVHA 4WIWA 4RKAA 1PHWA 3V0UA 5HUOA 2XVGA 4JNMA 7PTDA 1RA5A 3MKVA 1OQFA 1R7AA 3FDKA 4P2VA 4X0NA 1OG6A 2GDQA 4L6HA 3VKBA 4DJFD 1AG1O 4C6JA 5D37A 4GUHA 3ARWA 3VNZA 3CQHA 5U4NA 1R5YA 1DV7A 3W7HA 3O15A 1FCUA 4UZSA 1VLIA 3LX9A 1SJCA 3UWEA 3MP4A 2PAJA 1CXFA 2PTDA 4ZO9A 2OU4A 2GWGA 1VIWA 1BTCA 3HZ3A 1JEZA 1RD6A 4R33A 3EWXA 3AMGA 1MQRA 4OHQA 3IGUA 1W5OA 2PTZA 2Y0FA 3ABRA 1YDYA 4L9XA 1DP0A 2NUXA 5HQMA 3D3AA 1OINA 1VF8A 2VEKA 3UNDA 2EF9A 1J01A 2R9RA 1IWBA 3L21A 1FWIC 2WCSA 3IAQA 2BXVA 1I6NA 1I60A 1XJBA 1A5AA 4LGXA 5ECUA 1UD3A 3UZJA 3BV4A 5U7SA 5DN1A 4QSFA 3HG3A 2BGNE 3AIWA 1DQWA 2JGYA 2J9YA 3CGTA 1QI2A 2GGJA 2DW6A 1MQQA 2V68A 2PDGA 3RRXA 5JUVA 2GPTA 2WHKA 1KWGA 2XUCA 4JEQA 3BURA 3DYPA 1U1UA 4KCWA 3SUWA 4DWSA 2CZ5A 3ERPA 1WUFA 1GVSA 5H8MA 2PDJA 3V18A 3OVRA 2OSWA 1HG3A 3MMWA 3UVIA 5FAJA 3I10A 4BQ3A 1WX0A 4WJ8A 4GJIA 5CLTA 3GWQA 2WJZA 2AAAA 1GYNA 2CNCA 3MO4A 4PBFA 2CLHA 3AROA 3PJTA 4GC3A 4MFDA 3WYZA 5CBIA 1OX5A 4IMCA 3SIMA 1LG2A 5FESA 3HV9A 2XIMA 1JAEA 5FF3A 4NZ3A 1NWSA 1Q66A 3WY1A 4CU8A 4XVDA 1KFWA 3M5XA 5C2CA 3QQWA 1IEVA 1RPXA 3BLIA 3TVAA 3NDOA 1YE6A 2XFFA 3SZ8A 4RDYA 1DHKA 1W9XA 4UFLA 1B3WA 2XH0A 4A6GA 1OFBA 1A47A 5HNUA 1H61A 2O7SA 1VLWA 4BK9A 3MANA 4IP5A 4PODA 4Q4MA 5LIKX 3WG6A 1A49A 3K4AA 1GUVA 3EX6A 1ZTVA 5E09A 3BPWA 3STEA 4YTQA 3VILA 4JTHA 3IUIA 2WJFA 2B31A 3RLUA 5BYWA 2VWSA 3GKFA 2VFDA 5AVHA 1W37A 3LD5A 5E9XA 4AWTA 1P0EA 3FXGA 4PMOA 4RZ6A 4L9YA 3TU9A 2XVNA 4FNPA 1NSJA 4ERIA 3TN6A 2WSRA 4JHMA 3A9IA 3BCJA 3T44A 2XYLA 4DUXA 3LQGA 3NZPA 2O9TA 3E0VA 1XYZA 2G4JA 4ACYA 2XSXA 3CAKA 1GQKA 1GGOA 3NOYA 1UW9A 4UTJA 4D9PA 4D6CA 5BRQA 1SJAA 1WAWA 3V16A 2PTXA 2VX6A 2G5WA 3CV7A 4MUZA 4UOQA 1XXXA 3R0KA 3BL3A 3NQ7A 3VO0A 1GYLA 3ARZA 3VUSA 4AX6A 5ECVA 2YL6A 3GNPA 3WQDA 4I5RA 2WZIA 4FNRA 8XIAA 2XJ7A 3SSZA 5FI8A 2A79A 1G6CA 3Q94A 4Y90A 1S2TA 4M6VA 2VT0A 4NJJA 4UTWC 1RUSA 3E0FA 1VEPA 2P0IA 1WQ5A 1D9EA 1A3HA 4JTLA 2AKMA 2ZQ0A 1UQYA 4MB1A 5TBOA 1BLIA 4DWSB 4FLRA 1RBLA 2ISSA 3OQEA 2HK0A 4MDPA 3S1GA 1XLJA 2PDPA 3EDKA 1FWWA 5C2GA 3IGXA 1VFLA 4OTKA 1E0TA 3CQ0A 2E7FA 1OHLA 4WY0F 5DXYA 3F4VA 5AZ0A 1IR1A 3GVRA 2OYKA 3SQMA 2W0UA 3GDTA 3OG2A 4I9TA 1AQMA 1HKIA 1LG1A 4CD8A 1M6JA 2Y70A 2YBUA 4X2PA 3PUGA 1YPIA 4WGXA 1HP5A 2DGAA 5ABTA 1KM6A 3TYUA 1UWSA 3VDGA 2VUYA 3UY8A 4JICA 5DY3A 3AYVA 2AL1A 3H4WA 3RCYA 1X98A 5D9PA 3BW4A 2ON3A 1DXFA 2PP1A 3IS4A 3LHWA 1TZZA 2AKZA 2E5CA 3WQPA 2IQDA 2BOGX 3KAOA 3M0YA 2QAFA 3W6YA 2ALRA 3ABXA 1BEUA 4C1KA 3QQ0A 4R5EA 2IXUA 4ZE5A 4N2YA 5D03A 3AI0A 2P50A 1YTEA 3WUBA 4D2JA 1Y5VA 3UFYA 4UC5A 3VD5A 4LC6A 2PDFA 3TX9A 3E2QA 4NNBA 3BW2A 1WKEA 2AOSA 1RA0A 4R7WA 2BX7A 4JQ2A 3PC0A 3F03K 1KD0A 3NZ1A 4LY8A 2QDHA 1UMYA 3ZJ8A 2J77A 2ZUUA 2XM1A 3DHUA 3AO0A 1S2VA 1OGSA 2QCEA 2OEKA 3PSWA 2C14A 2ZADA 3G8EA 3SCVA 3T05A 1QNSA 3C2RA 2I5IA 2PBGA 1CEOA 3TCEA 3CUGA 3H2AA 3CUIA 3C0LA 2GVJA 3VA8A 3GTXA 2CEQA 1VS1A 4V15A 2CKRA 2DJLA 1ZNNA 3AHYA 1HFBA 3TW6A 2QV4A 2GUYA 3G1SA 2YL9A 4P7LA 2YB4A 3AZSA 4JQ4A 3GTFA 4IFOA 3B03A 3SRHA 4WLCA 3R8GA 3H55A 1W9UA 1EGVA 3QC3A 1PZ0A 4ZL1A 3MUCA 3QPEA 1EC9A 5TQLA 4UTLA 4Y9AA 1ZL1A 4U31A 1LOLA 2YW4A 4IQEA 3RCNA 5F1VA 3GHRA 3EWBX 2GWNA 4PCFA 1RY8A 2RJHA 1X7IA 1QBAA 3EWZA 3S5NA 3HJZA 5MKGB 4PMJA 1NFGA 5ABGA 5HDRA 1XKYA 4MJZA 2D2OA 3LZ3A 5CPQA 1OY0A 1CENA 3C52A 3KP0A 3VZYA 3OIXA 2IKGA 4IIEA 1TRDA 2I56A 3NVTA 4YL2A 3B8WA 1PE1A 2VO5A 3W71A 1XGZA 4F8XA 3R58A 4LYKA 3C8FA 2BDQA 4M0XA 1FWCC 4H1ZA 5JMUA 2ZX8A 4QG8A 4ZO6A 1HNYA 2V2DA 4DI8A 4Z1AA 4BF5A 1XIMA 4MYAA 6ALDA 2VCBA 3SR7A 1NDWA 2Y5SA 1HW6A 5HA7A 4L65A 1FY6A 3U6WA 2QCGA 3BH4A 1MW0A 3CZKA 4A3YA 1NDYA 2G3JA 3ITOA 2PWDA 2JE8A 3NYDA 4Q7BA 5I7GA 1KCKA 3N3TA 4DQWA 1FWJC 2QJMA 5D9OA 1QO5A 1YNYA 3B8VA 5I03A 3R10A 4EE9A 3V75A 1PKLA 4GFSA 5LA1A 4TQTA 1ZAIA 4HOXA 3QW3A 1YNPA 3F5KA 1GOIA 4IL0A 5J8LA 2WK2A 4ERGA 1G7UA 3AU2A 3NQCA 1ZENA 4JZ5A 4NXSA 5DFAA 3S8HA 3GM8A 3DIPA 3FJ6A 4A2RA 1C3FA 3RLGA 1I2NA 1NEYA 4FXSA 3VK5A 1ZBVA 3IJLA 4C6LA 3HQNA 4Y9MA 1MUWA 1DYSA 3TC7A 1X6LA 1XRSA 3C0QA 3WD4A 2WKJA 4N6FA 3AMLA 4GGHA 4LAOA 3C56A 3HTWA 4KWWA 1QHOA 4PMZA 1I1XA 1GKRA 1TV3A 4L4LA 3CYJA 4QQUA 1MW2A 3R0DA 4UFHA 5MF5A 5CZTA 2VHLA 4JQ1A 1C9DA 1TMQA 3IJ9A 1EH9A 1Q6QA 1N82A 2XFYA 4UTMA 3PPHA 3HA1A 5DMLA 4H2CA 1EOKA 1MDRA 2AGKA 2Z29A 1VCGA 5DELA 2R6OA 2C91A 4NAEB 3CTTA 4Q4SA 4H9MA 5L9FA 2ZRWA 4CNPA 3DHPA 2GQ3A 2FDMA 3BG9A 4D1JA 2WBKA 4LAUA 3W3OA 4Q7NA 3QTPA 3MMTA 4IL2A 4PGLA 1W56A 2Y89A 3U57A 1KR0A 3RXZA 1GQNA 3WQGA 1RLDA 1JCXA 2TRSA 2J7GA 4DZAA 3LLFA 1V3MA 2NXIA 3F4NA 2DT0A 5EFFA 1QBBA 1TX0A 3JW7A 5A6JA 3L5AA 1L2UA 3ISIX 3T1GA 1EDGA 1ISZA 3LGDA 3FOKA 4BEUA 2VVSA 3O1NA 4O1DA 2YCEA 3B40A 1N8WA 3QZ6A 3S2JA 2BHUA 1CPUA 3MDUA 3M64A 5EY5A 4B16A 3SUUA 3ARVA 1JG9A 4DWDA 1L8NA 4DJEA 1XCFA 3SY8A 1UMLA 4NSBA 4DWSD 3G1FA 1WDDA 1A5KC 1JPKA 4CN1A 2FB2A 1KV8A 1JCTA 3MSDA 3QPYA 4EP8C 2WQDA 3C2OA 1X1NA 3CAQA 4JIEA 3W7EA 1K8YA 2GK1B 4IQLA 1AL8A 3KHDA 2CFFA 4PUUA 3FJ4A 2OPJA 3S2MA 3UCQA 2PDBA 4B15A 1QWGA 3R13A 2XVPA 2IMRA 3S1UA 2ZC8A 3RX4A 1HT6A 1AUSL 2WMJA 2Y4SA 1QPQA 4AHOA 2Y8UA 4H8UA 2VFIA 4C6BA 1Z89A 4R9XA 5ABFA 3QH2A 4NZ5A 2GOKA 4GC4A 3KVMA 3UR7A 1FBAA 3QKZA 1Z8AA 1ZHAA 4BI7A 3W2MA 1KNWA 4H83A 3LRMA 3DGRA 6TIMA 4FOKA 3LN3A 3XIMA 1SM9A 4GINA 1LBMA 1R6WA 3VZZA 2HNEA 4MB3A 3WLQA 1NJJA 4ECLA 4F9DA 5CSYA 3AUJA 1A3WA 4HKPA 1UPMB 3M5ZA 2WZHA 1PUDA 4KEUA 1ME7A 4GKLA 3RPDA 3H7VA 3P0WA 4G9PA 4GGBA 1CGVA 2XGZA 3CUJA 2FGZA 4Q4KA 4H04A 2WBGA 2CBVA 1ZJBA 1IIHA 4NZJA 3BG5A 1GZ1A 2O92A 1S5NA 3UG8A 1V0KA 4XD5A 1IWAA 1FCQA 4HPHA 4C6CA 1Q7MA 3N2XA 2PPGA 1NOUA 4S1FA 3CMJA 1YXCA 2ISWA 3L4XA 1IHIA 5HNTA 2YDAA 3GG8A 1Q13A 1U30A 5LIYX 1BVNP 2XWDA 4IPIA 3CXOA 2DIEA 2C15A 3AIEA 3LPGA 1XQLA 2E6AA 4OECA 4A2SA 3ZM8A 1NY1A 4XISA 3E0IA 1LOQA 4PCSA 3G22A 1XD1A 2DUZA 3KBNA 3SEPA 2Z28A 1UG6A 3DN5A 4UQ9A 2NZLA 1M7JA 3CV6A 3EDEA 3E5PA 4WQ6A 2HMCA 1R0MA 3W7NA 4BF9A 3S4TA 2WB5A 2OLSA 1KM4A 3MP3A 3QR1A 3ZMRA 4IG2A 5BMWA 4JN7A 4H7ZA 3OHIA 5FEWA 4J7RA 4W89A 5FEPA 5JH1A 2DT2A 2E67A 5HBFA 1E6RA 4GACA 4GG9A 3T0BA 1ECEA 3VI2A 3VOHA 1Z44A 4O8AA 4F3HA 4ROPA 3TP4A 1ZAHA 3BJFA 1RHCA 3PWIA 1PKNA 1CI1A 1XIIA 1BRLA 4JIRA 1ZJIA 4XQ6A 1US2A 1UROA 4F2UA 4GNVA 1NARA 4NU7A 3BAXA 4LOCA 1F3WA 1IIGA 1QCWA 1HL2A 3WD2A 1E4MM 3A4AA 5EU9A 3AJXA 3Q45A 4D8AA 1G1YA 2BWGA 3TMQA 4JS3A 3ZXWA 2H9AA 1VFUA 3VCCA 2FHFA 2POZA 4RNHA 4LFYA 3H53A 5DCEA 1Z3NA 4HYRA 3NNTA 3AMDA 1KM2A 4XZBA 2NV1A 3GH5A 1GKPA 4GX8A 3LGGA 3EWWA 3T9PA 1XLHA 4H8VA 1KO0A 1GW9A 4M24A 1W1ZA 1PTGA 1VYSX 2QYGA 3BC9A 4QNEA 5D05A 5C71A 4DJDD 2Y8VA 2HXUA 2VFHA 4Z17A 2VEPA 4AY1A 1RAKA 2PP0A 3U9IA 2BXYA 1DQXA 4M6QA 1DXEA 2QLYA 1W3KA 1G4SA 3WEMA 2QULA 2O9RA 4A3RA 3A5FA 3DDMA 5TNVA 2WC4A 2Y8KA 4FHAA 3LCFA 2OX4A 2Q09A 4KBXA 2YCJA 3HJEA 2QPUA 4RDWA 3WH9A 1CBGA 3EMQA 1OX4A 3TQVA 2D0FA 1X97A 2E9MA 5J5RA 3IARA 3GNNA 4LUTB 4LANA 4FNSA 3F4WA 5I3HA 4C60A 4N9BA 4PZVA 1UWAA 3KM8A 3GAYA 1I2QA 3PHAA 2PDXA 2ZXDA 3N4EA 3LRLA 5ENLA 1TZ7A 3AHVA 2Y5JA 2DJXA 3TYBA 3T8QA 1X6UA 3ZJKA 1XPYA 2ZA1A 3HPZA 4K8GA 1DBTA 2WHJA 3E2SA 5A1AA 4HIBA 4OWGA 4B3ZA 4QAIA 2Z7GA 3BOXA 3VD4A 3AU6A 3LERA 1DJZA 3OGSA 4HMCA 3WQOA 4BI6A 1H51A 3UBPC 3QSRA 4PA8A 3FYPA 4Y2WA 1UR3M 3P8IA 1FKXA 3MDWA 5CPSA 3UT0A 4KGLA 2OZ3A 5KZDA 1HL8A 2W91A 4IZGA 2CHNA 3OB8A 7TAAA 2KX9A 1XH2A 4J2PA 4Z42C 1PDZA 1XW8A 2W92A 4CQDA 1L8PA 1ZB5A 1UZ4A 3UWQA 4A8NA 4HU8A 2D2HA 1GQJA 2FZMA 3NL2A 3R0UA 2PWVA 3WD3A 1GOQA 2RKXA 1AFSA 3GG0A 1THFD 5A3HA 4X22A 4XZMX 1RP9A 4QQ3A 1KLZA 1TV2A 4RPQA 1NAL1 2HSAA 2VX5A 3M5YA 1F76A 2AL2B 4C6KA 4LUSA 2CC0A 3DAQA 1VP5A 1TMLA 3O2LA 5BOOA 2AGTA 5E70A 1EIXA 2C19A 5EMLA 4LS1A 3VKCA 1W5QA 5GNXA 4AZ6A 3ECQA 1XBXA 2YFOA 1SYTA 1CLKA 4C90A 4Q8VA 3H2NA 4AUBA 4ZQNA 1JCLA 1PB0A 4YU1A 4IUOA 3ITYA 2BTMA 4JY8A 1SJDA 4L4PA 4N9EA 3D6NA 4WHBA 2E9BA 1LUCA 4HHHA 3RIKA 2XVLA 4JYDA 2FHCA 3RDKA 4CN4A 4NZ1A 5JBEA 3GIPA 3RF9A 1WV2A 2VR4A 3DKLA 3VE9A 4S2CA 3LB0A 2HEJA 3S2LA 1CXHA 2OWCA 1W91A 3S47A 3ENLA 2ZRZA 3T8LA 3KX6A 4WY0B 5XIMA 1FWTA 2HXTA 3NPWA 4RCXA 4IXXA 4UNIA 1RBAA 4IFRA 1L6YA 5LNWA 1R30A 1TWZA 1G69A 1W32A 2PWUA 1VHCA 1OX4B 4K7YA 5G4EA 4CN6A 3THAA 3UR8A 4KRUA 1AL7A 1LORA 4C6MA 4HPJA 4ZQPA 4A21A 3W7PA 1IXPA 4UTUA 3QRHA 1PVNA 1GHSA 2E5DA 3SURA 2FVKA 4S3CA 3NYZA 1TWSA 1WOAA 3DHDA 4PUDA 3GR8A 1QNQA 4QSHA 1GONA 3W2KA 3IPWA 1F4HA 3S5OA 3R2GA 4JCMA 4GIRA 2P3ZA 2FH6A 4IM4A 1XIJA 4HBKA 3LPFA 3EBVA 1J12A 3ZVHB 3WO8A 1KCLA 3F2CA 1CB2A 3NQEA 3HPFA 3EOUA 3XINA 2GJXB 3OTRA 1Q4WA 3TC6A 3FY1A 4F2TA 2WNWA 2Y5EA 1LBFA 5G5IA 2DSKA 4O1FA 1EGMA 1IEIA 4QNWA 4MGGA 1NELA 5IDZA 1PJ9A 3UPMA 1UD6A 1C7SA 1PYFA 4MWAE 4UMCA 4R27A 1UC4A 2DU2A 3MSRA 1A0CA 3P14A 4Z2IA 5SWUA 2ZRXA 3HOJA 1UR8A 3AIBA 3C3UA 3G18A 4O15A 1J5SA 1XSIA 3OA5A 2CBUA 1IEXA 3JU2A 3LMZA 1VAHA 2EHHA 3CV1A 3SY1A 1DPMA 4PB4A 2WWDA 4CD4A 2D3NA 1XYFA 5LHEA 5LA2A 4FX8A 3QGVA 3NCOA 4HZ6A 3KDOA 4AD4A 2DZAA 1OC6A 3CPUA 4TOQA 4XKMA 3AHZA 3N2BA 3KCOA 3RUBL 1YPXA 4J5NA 2WSPA 3COTA 4YN5A 2QZRA 3GIQA 4MKSA 4DLMA 1W3NA 1WXJA 1BF2A 5I79A 5AECA 4I3GA 3GBEA 1DL3A 1UUOA 4QROA 4C5YA 5F2IA 4QE5A 4QGCA 3VABA 1XLBA 1TPWA 2R1MA 5C7VA 1ZJHA 3CZEA 4IISA 5LKYA 3KBMA 5JH2A 4ORIA 5EPDA 4S3AA 3S5YA 1UKSA 1H7OA 1ZP3A 3L4YA 2E1DA 2GVLA 1O5RA 3GBDA 1CT5A 3W7MA 1TPEA 5C54A 3GFYA 1JF5A 3SN1A 2Q02A 5FKYA 4R9OA 3SN4A 4DBWA 1OVDA 4AHQA 4DO7A 4QBXA 1CIUA 3PBUA 4UQCA 1ZAJA 5AVNA 3VD3A 5LIWX 1NH6A 1Q45A 3LMYA 5A2AA 4B5UA 4IF2A 2GQAA 2YB1A 3QM3A 3DFYA 5BXRA 4KH2A 1EJWC 5C9UA 1JI1A 4CLMA 2TSYA 2E5BA 4O0QA 1JDCA 2PS2A 4ICCX 3LDVA 1D7FA 1ITXA 5HANA 5K9DA 1XG4A 1E72M 2FJKA 2WC3A 2C0AA 3A9BA 2FTWA 4IWWA 1LROA 4LBSA 1RCXB 1XCXA 3GK0A 4YWSA 1EPXA 5AN7A 4GUGA 3OBKA 4LBUA 1AH0A 1KA9F 3BDKA 4CGTA 2CYGA 4AZHA 3FV9A 5BRPA 3C6CA 4K36A 3CM4A 3UCDA 4UFIA 1IZJA 3NIYA 3M0HA 3S0CA 2XN1A 3MB9A 2X7VA 5CAHA 1GOKA 1ZFJA 3HG2A 4JIPA 1VJZA 3REQB 4IMDA 1XP3A 4AQLA 4RR4A 4JTUA 2E40A 2VELA 3O3RA 3WBXA 2QDDA 1GQIA 3IK4A 4D1IA 4I9AA 3VGGA 2YXGA 1EQCA 2WKLA 4M6UA 4PMVA 3TLQA 1UCWA 3MUAA 1S1PA 3RR4A 3V0SA 3N11A 6REQB 4M29A 3PG8A 2YDRA 4W87A 4O13A 2R1PA 2V8ZA 1P6WA 2VCAA 4H9UA 3WL0A 1CGUA 3WELA 3I6EA 1J9YA 3GYEA 4ZO7A 3VNYA 5CZ0A 2Z6JA 1W9BM 2E0PA 1MXSA 4G56A 1HO1A 3FVDA 3CUZA 5F1UA 3PUEA 2CITA 4H41A 4KWUA 3UQNA 8A3HA 5JVLA 1KBIA 5A6KA 3M0VA 1CGWA 4M8UA 4XBJA 1E0XA 1F7BA 3UWVA 1V6YA 7ODCA 1EBGA 5EA9A 3QPZA 3MT1A 5C9ZA 4B4HA 5BXSA 2WC7A 1E1FA 1FP9A 4WDTA 3P84A 5A2BA 2GSJA 1XL9A 4WOQA 1KTCA 2O9PA 2ZWZA 4M7SA 4DJEC 1HTIA 1XD0A 4LUJA 4UR8A 2W4XA 4XKYB 3QV9A 1EB3A 3T2QA 4Z1YA 2W3ZA 3S83A 3WF3A 3TQPA 1WE5A 3Q2DA 4NG3A 4UOJA 2VQTA 1H7WA 2GSHA 3UGVA 3BLEA 1EZWA 3KUMA 2ODOA 3N34A 3DESA 3WQFA 4C6IA 5DMYA 1V3JA 1TCMA 2PUZA 3EMCA 5G2HA 4LS2A 4J1OA 4GABA 2BZNA 4P8WA 3T4CA 3N4AA 3NO5A 1FWFC 7XIMA 1JAKA 1PX3A 3K13A 3VIFA 4KS0A 3TW7A 1BQGA 3C4UA 1VBHA 1O95A 2WJEA 2ZZ3A 1MI3A 1TFVA 4DI9A 4Y8EA 4B9ZA 1I45A 4GUJA 2Y61A 4WKFA 3FX4A 4LV4A 1LOSA 4R34A 1JF6A 3DI1A 3F4DA 5CPTA 3WL1A 2G4FA 1MW1A 4PTXA 2X0YA 1ADDA 3I7RA 3VAVA 2GLKA 1AD4A 3BLKA 1LWHA 1T40A 1B0IA 4X63A 2HCVA 2H90A 1W6TA 4UNLA 3TAOA 1ZCCA 3RPTA 3O0FA 3WKZA 1S2UA 2F2HA 3LLXA 3W1PA 5E6YA 5HQLA 2HE8A 3NPXA 4EX4A 1DHPA 3ALFA 4Z0JA 1XLLA 2YSWA 4JPGA 3RK8A 4TMBA 3WQ4A 5A8PA 3U2EA 1OK4A 3WCZA 3U4AA 3GU1A 4I5XA 4A4AA 1JZ6A 1WCGA 4WDXA 1LM1A 3MI6A 2QDEA 2QVNA 2YCKX 3QVQA 3SCRA 4Q32A 1VFTA 2Z1SA 2WAGA 5CZKA 5FF2A 4LCRA 4Y7EA 5FA5A 1M04A 3L2MA 3BARA 3L0GA 3ITXA 6PTDA 2HDJA 1SFLA 4I7WA 2QCLA 5BNKA 3OODA 3LOTA 5A8QA 2WOQA 4RW3A 4L6OA 5K9CA 1FP8A 2OMAA 2WPBA 3USZA 3F4CA 3W86A 3TR9A 4NVTA 5G2IA 1GNXA 2XN0A 3THUA 2Z26A 1A53A 2ISDA 3RMEA 2YDSA 3W81A 3LUTA 4O53A 5EKYA 6XIMA 2PB1A 3UR2A 3FA4A 1ZBKA 2FHBA 4IP7A 4W88A 1C8XA 5CPMA 3BAKA 1GOWA 2CLFA 3W6MA 2J74A 2GQ9A 1NQ6A 4MWAA 2C1GA 2FZ8A 3CNYA 3VUPA 4LBRA 3K46A 1YPFA 4IHCA 2PI6A 4S23A 2E9LA 3WK3A 4H6QA 2DY3A 4I6VA 2VFFA 3GFZA 4MJ4A 4AFYA 1GG0A 2DQXA 5BRBA 3E3HA 4Z1CA 1XV8A 3FIGA 5B7ZA 1VRXA 2G8ZA 2L5HA 4M81A 3CHEA 3QYQA 3EEZA 3TV8A 4JNYA 3KOWA 1TKKA 4TX9A 4JTTA 4IPPA 1HJQA 1QOXA 3CYVA 2X7WA 1KWKA 2NQJA 4QCEA 3MU7A 2FZ9A 1A5UA 1TPH1 3RMJA 3SCOA 4LJ3A 1EYWA 1EHNA 3BGGA 2VGIA 2WVVA 1S3TC 4NAFA 3M43A 4WKHA 1W3TA 3BMWA 2PZNA 1EFZA 1K7XA 1ALDA 4TXEA 2A5HA 2VGGA 5EFDA 3WLNA 3SSJA 4GD0A 4ALDA 1XUUA 4QJ3B 4FOUA 2QT3A 2Y7GA 5CSSA 1N8FA 2QV5A 3WNOA 3SRKA 4L56A 1UOKA 4MKVA 4ZQCA 4IIDA 2WVTA 1Q6RA 1V02E 1DJXA 1FOBA 4Z2GA 1GEHA 2DUAA 1NOFA 1PX4A 4UQEA 3T0AA 2PDNA 1L6SA 4C6OA 3DC8A 3WDIA 2RDUA 2A3EA 1YIXA 1QI0A 1MXGA 1WOBA 2O4MA 3N73A 3PZUA 5I24A 3PK7A 4J9JA 4OBSA 4DO6A 2ZBTA 2ZIDA 4B90A 1XYMA 1TQXA 1CDGA 4XSMA 1FRBA 1PV8A 1MYRA 3O16A 5FL1A 1E1EA 4KIRA 1GW1A 1Q7QA 3RM4A 3NFUA 2R24A 5IXEA 3OQ8A 3W75A 1Z42A 2PWGA 4JIQA 3LHZA 2YDQA 2DV0A 2XH7A 3WK2A 2VR2A 3CAVA 3G0UA 3VIOA 4A35A 1GVFA 1KFEA 2V2HA 2J7CA 5BU9A 3BG3A 4JOMA 1H62A 4PYSA 2BGSA 3S3GA 2V2CA 3SB0A 2H8XA 1QNOA 2BMBA 4F79A 2Z2UA 3BZGA 4H7VA 1OD8A 3EDFA 4Q4RA 2ZX7A 1VFMA 3PP7A 2QCDA 1W3LA 1ZCOA 2XIBA 2VR5A 4KERA 1TR1A 2Y63A 4P7RA 4U3CA 4L1GA 4W86A 3AZTA 1DWIM 2W5FA 1KFJA 5JIWA 2ESCA 2Y6ZA 1FWAC 2I57A 3MUIA 2WANA 2ANUA 1UZ1A 1MZHA 2HBXA 3PBWA 2QUMA 1I1WA 3STGA 3M46A 1GOXA 2QCCA 2J27A 3FGCA 1TJRA 2P8CA 2INEA 4OV9A 1J4EA 3EPMA 3RGTA 5HWJA 4MB4A 1KFLA 3R4IA 1H1ZA 2QIWA 5CKSA 5DCDA 1RJPA 4NX0A 3QHOA 5MHBA 6CGTA 4TVCA 3M1ZA 4JTIA 1JUBA 1V79A 4HQVA 2QS8A 2BXZA 2HS8A 1K9DA 1SW0A 4AD2A 3FNDA 3IUDA 3LS9A 2WVVB 4WJEA 1B54A 5CSUA 4M80A 1IV8A 3CLWA 4IMAA 1DJGA 4O11A 3NPVA 3GUWA 3THCA 1U22A 4NL1A 3P5YA 3F5LA 5H91A 1UKOA 2NT1A 1P48A 2YA0A 4N9DA 4RZ5A 4AZBA 2VC5A 3N2OA 1YXYA 4E8GA 4C1LA 2YYTA 2ZTJA 4JTRA 1CX9A 3W7OA 2OEMA 3B9NA 4ZMGA 4P8UA 4N0RA 3W88A 1WZMA 3SJNA 1K3UA 4PC8A 3QFEA 4CD6A 1RALA 1E1CA 2C7FA 3LNMA 2X2YA 4K37A 4JIIX 5A6BA 2JALA 2DORA 4YPJA 3OBAA 4IJBA 4Z2LA 5JBFA 2PDWA 1WDSA 1QAPA 1H1YA 3TWBA 1JNEA 4O18A 1REQA 2H3BA 2OVLA 3N17A 2J9ZA 1KW1A 3U5UA 4MY9A 3GDMA 5FIPA 5DEZA 4EWJA 5H2ZA 1ZRQA 5JU6A 3VC5A 3OBEA 5D8ZA 1AW1A 3HIJA 4QE4A 3P8JA 4O28A 5HR6A 1M9HA 4PTNA 1RD5A 3BOFA 1UR0A 4UMAA 1KCXA 4E4PA 3ZLHA 4Q8TA 4GIYA 5FD0A 4AHPA 4DN1A 5H6HA 3AXHA 1UKPA 3NWRA 3CLMA 3VIJA 1BGAA 1RQHA 2NW0A 4GYPA 1IEWA 1K02A 4W8AA 1AJ2A 1AK5A 4EAYA 3QTGA 4IT1A 4XAZA 5JIPA 3IAPA 1R9YA 4H00A 4P7NA 2J8FA 5FJIA 2FPYA 3MVTA 4JFTA 4DPQA 2WZEA 1ZBWA 1Y5WA 4B92A 1OIMA 4DBSA 3NGJA 2F6XA 1OB0A 3ANVA 1FFRA 1HIZA 3VPLA 1DTNA 1W5NA 4ML4A 3WJYA 2X1SA 1YDOA 1P7TB 4HPNA 2G3NA 3WJXA 5BROA 5FCZA 3KHJA 1GHRA 2HQAA 4H9YA 4XUYA 3VKAA 2DP3A 3DOPA 2JKAA 1EXPA 1BQCA 1JI2A 3PWAA 5CLWA 1E0UA 4DUOA 1T0OA 2VZOA 2YZ5A 4Q7IA 1SQ7A 5KZMA 1X8CA 3JVAA 1TIWA 1XLCA 3M6YA 3SN0A 2YGYA 2YR1A 3WJWA 4LQ1A 1FH9A 5CH9A 1XBYA 1RVGA 3V4BA 1P1MA 3PPCA 5F4SA 3A13A 1UH2A 4PTMA 5D32A 3K8MA 3HV8A 1C8QA 3RG6A 4EOUA 1OEPA 1XLDA 5HINA 1OX6A 4M5PA 1FXQA 3UGRA 2OQHA 1RZMA 4FX7A 4ZODA 2NVAA 3VCNA 5F7UA 3GG1A 2V5LA 2PLJA 3B9EA 4HPGA 2ZVIA 3UWWA 2CESA 3PPFA 3W25A 1H7XA 4O19A 3I3BA 5FL0A 2GSEA 4JR5A 4O16A 4UFKA 1TWWA 1QI4A 2OO0A 1ICQA 1A80A 3W1UA 1DJYA 3AXKA 2B7NA 3W1MA 1IT8A 1OCQA 1GVEA 4GQQA 1JUEA 3N9KA 1V02A 1UHVA 4W85A 2W62A 4FP1A 3H8AA 3SAZA 5HUPA 3TN5A 5FAGA 4I8DA 3UWZA 3L5MA 2HPMA 3T2PA 2FPTA 2IXVA 2YL5A 2EPLX 1C8VA 3APGA 4AIUA 1VFOA 4X61A 2VQUA 1OJXA 2XINA 3NAVA 1QJWA 2HJPA 3TYCA 1M53A 3W29A 2QNEA 1FH8A 2O4QA 3G1AA 4R7JA 3BSMA 4REQA 4HMDA 3HO8A 3RU6A 1BKSA 1UP3A 1WXYA 4DYJA 1UUMA 3APYA 2DVUA 4DF0A 3SUTA 2Z24A 1JZ2A 2ZRUA 1OD0A 4HNCA 3K5XA 4XUGA 1BSIA 2EQDA 3THQA 4HSOA 1CZ1A 2W61A 5M1TA 4DPPA 3BMXA 3TFCA 1MSSA 3BE7A 1SO6A 3NQFA 2IQ0A 4KWOA 4JY9A 4U5KA 3W53A 4AVNA 2WYSA 4O14A 3H2CA 1K1DA 3WQCA 3T4WA 3B97A 2CZFA 4NUWA 5I02A 3NM1A 3WF4A 1WZAA 3H4XA 2A7RA 1JCNA 1DJQA 3GXMA 4ZFCA 3M0XA 5KSWA 2ZZ6A 4KCTA 3R94A 5I77A 3KVLA 3RRAA 4B5WA 2J24A 4XAFA 2JGQA 1Q6GA 2PDKA 1RY0A 1TJ0A 2CWNA 1UJQA 4Z2KA 3M0LA 4ZQOA 5B80A 3LSBA 2XPKA 3B8IA 4BQ5A 1V3LA 1W3IA 3PS7A 2EG7A 2PC4A 3NPUA 1DIKA 3DH7A 3ZT7A 4QXIA 2V3GA 4W84A 2YYUA 2PGRA 3H2EA 5D2WA 3MSGA 3S1VA 2WMIB 2RDWA 1DWFM 3SFKA 4BKNA 4YIWA 1E5JA 4FAMA 3ZSTA 3FAWA</