4CNPA

Structure of the salmonella typhi type i dehydroquinase inhibited by a 3-epiquinic acid derivative
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
252
structure length
252
Chain Sequence
MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Mechanistic Insight Into the Reaction Catalyzed by Type I Dehydroquinase
rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
molecule tags Lyase
total genus 97
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4cnpA00
2H6RA 2QCCA 4UNLA 1IIGA 4R53A 3TE9A 3EWZA 5G5IA 5CZ0A 3W73A 1WOAA 3L5AA 3N9SA 4NU7A 1FBAA 3M1ZA 2A4AA 2DZUA 2Z1BA 3HMJG 1B4KA 1JQVA 2VOMA 3P81A 1MZHA 4HNTA 4DXVA 2TMDA 1QMLA 1H7PA 2JK2A 2W6RA 1OX4A 3R5EA 3F1QA 5AN7A 1A5CA 1FXQA 2D73A 3STEA 1XFBA 1KM0A 1XUZA 3QPYA 3DBPA 3SJ3A 4ZVJA 1OHLA 3PWAA 3LCWA 2NV1A 3PB2A 3PAJA 1TV7A 2VEIA 4DF2A 5D03A 4CCDA 3TMLA 1F5ZA 5DCBA 2WO5A 4MLJA 1PV8A 1IXOA 4EWND 2J9YA 1TPEA 4FNUA 4LUJA 1H51A 3T7VA 3NQ6A 5K4XA 2G95A 3I7SA 2PRMA 4MFEA 4O13A 4AF0B 2Y88A 3P5YA 1OFOA 3DFNA 4UFIA 4RZ6A 2RDUA 3EWXA 5G2IA 3T55A 3OVRA 5TBOA 2VFEA 1K8XA 2I14A 1P0NA 3I7QA 3M5XA 3R2GA 1H1ZA 4TMBA 5D09A 2CZEA 1KTNA 1KFCA 3P8JA 3THQA 3TMQA 3NPUA 1EB3A 1BWLA 3KFTA 1ZALA 4BWLA 2ZYFA 4CCCA 3C8FA 1OFEA 2YR1A 3CPRA 3LRKA 1E51A 1L6SA 5KINA 4AB4A 3F03K 3GDRA 4JD4A 1YLVA 3TW7A 2G5WA 3BW3A 3L21A 3LLFA 3R89A 5C5YA 1OYBA 2YDAA 3NO5A 1R47A 3S1VA 3OA3A 1JRBA 3HGJA 2O7QA 3HO8A 3MI6A 3STGA 1GTEA 3OVQA 1XBZA 3SECA 4NZJA 2Y62A 3DKLA 3NM1A 1SR9A 1D3GA 4A2SA 1XUUA 3DI0A 3HG5A 1I2PA 3RK8A 4GJ1A 5E0KA 1B9BA 2CU0A 5FESA 5KTLA 3JR2A 2X1TA 4NZFA 3LTPA 3FS2A 2ZRVA 1O94A 1S5WA 4HNNA 1OFAA 2ZTKA 4Z0SA 3UY8A 3M0ZA 3L0GA 3NQCA 3TFCA 2QCHA 3GIYA 3GR7A 4IX2A 4K8HA 3C4UA 1WOBA 5HJLA 3R13A 3W1UA 4Z0JA 1FX6A 1DV7A 1OG0A 4KKXA 5D02A 1QNVA 3B0UX 3W71A 3W1TA 1JCLA 1JQXA 5T26A 4IQLA 4M6PA 3JS3A 1I2RA 2ZRYA 4AVFA 3M5VA 2C3ZA 3S8HA 1KFEA 2FPYA 2QUUA 2B7OA 3LHYA 3FJLA 1SW7A 1KM3A 1QWGA 3VNDA 4RK8A 1H50A 4H6KA 3G1SA 4DQWA 3W70A 1KFJA 1TPB1 1CX9A 2V30A 3BLEA 2QCLA 2VEPA 3UNDA 3NZ1A 4NX0A 3VFLA 5BW6A 3CWOX 2VXNA 3KX6A 3LHWA 1JUEA 1DJNA 1G4PA 3VE9A 3QW3A 2CLLA 4MPQA 4XKYA 2Z6JA 1YXCA 1YTEA 2QF7A 3TC7A 1VQTA 4UTTA 5F1VA 4H3DA 1UUMA 3SGUA 3P62A 2X1UA 1XM3A 2ZA3A 5H91A 1I45A 3KRUA 4OV9A 4QIUA 4UFHA 3U6WA 1LDCA 2C18A 4Q4KA 2HTMA 3A24A 5K9DA 1KTBA 5FF3A 3E0IA 3B0PA 4JIPA 2QR6A 2QAPA 1EP3A 3GDTA 5AYXA 3UWYA 3MYPA 3QMRA 1V7YA 2NX1A 2FDSA 1W1ZA 5H2ZA 4UFJA 3RLUA 3QMSA 2XFWA 2ZZ7A 4JX6A 4WX2A 3G1FA 3F4WA 4ML9A 4GXMA 4UFMA 3NQMA 1O60A 1WDWA 4NVTA 4OBTA 4UTWA 4DEFA 2A7PA 3TIMA 3TSDA 3UWZA 3VE7A 3W7JA 1K7EA 3PUEA 3NQGA 1TTPA 3O8AA 1ZY9A 4O15A 5AHMA 4CCEA 3W2NA 3W75A 5U4NA 3ANYA 3G1DA 1LOQA 4JS3A 4O18A 4LWWA 4IMCA 4YCOA 3L67A 5K7JA 1EUNA 2J27A 4FIQA 4POCA 2ZFAA 1VRDA 3QQ0A 3G8RA 5LZLA 3JRKA 3LX9A 5CG7A 1PCKA 3LTSA 2E6DA 5LNUA 2RHGA 4LUIA 1K3UA 1G7VA 2DJLA 4Z1CA 1DQWA 1OABA 2TYSA 3SI9A 3CEPA 3W85A 3ZFHA 1Y0EA 4JICA 4ADTA 4Z1BA 3IVUA 2QJIA 4WXZA 1QOPA 3Q37A 4QJ1A 5EYWA 4IPIA 1J2WA 1DORA 4O14A 1XBXA 3KHJA 1VYRA 3LXBA 3IRDA 1BEUA 5LHFA 4CNOA 3N9RA 4N9DA 3LBCA 4NJGA 3GDMA 1SU5A 2OT1A 3BARA 4RKAA 3B8DA 3GXNA 1VGAA 3W83A 3W7KA 1PHQA 1TV5A 1G4SA 1H60A 4WY0F 2XN2A 3NVTA 4BI5A 3LHZA 1VYSX 2BLEA 3LDVA 1TYGA 1KM2A 3HPSA 4ORMA 4NQ1A 7TIMA 1DOSA 1DQXA 3LXAA 1K02A 4UR7A 1RQBA 2E5BA 4N6EA 3L5MA 5A8GA 3IIXA 3P82A 1Q6QA 2EF9A 4O12A 5D30A 2ABBA 1VCFA 4M19A 3W9ZA 2Y70A 1I2OA 4O50A 3RLVA 1AL8A 4N02A 3TQKA 3W7NA 4TO8A 1ICSA 5F4SA 3TCEA 4PEKA 1JRCA 2W0UA 4IGHA 3K30A 1F6PA 4FNSA 4MLRA 5J5DA 4KWWA 2WNQA 5KZDA 2V2HA 4UIOA 5DCEA 1LP6A 3NDOA 5HNRA 2GQ9A 3GKFA 5F4WA 4UTHA 3TQVA 4DBDA 3TR2A 3L5LA 6ALDA 3HPZA 1NFBA 3UD6A 1VR6A 4YXGA 1Q45A 4JGDA 4QSHA 2H8ZA 4JTHA 4XTIA 3IIVA 1TRIA 2EKCA 4WQ6A 3AO0A 1ICPA 3RU6A 3LXCA 4I7WA 4N9CA 3NA8A 1FCUA 4GNJA 3IIOA 3E9AA 2E6AA 3W2LA 1K03A 5AHNA 5K9CA 1JCJA 4HSOA 1EWDA 3GZ3A 4XTDA 4JTEA 1KM6A 4JDBA 2V2DA 4IMGA 3T44A 5F2GA 3S5ZA 4LVGA 4LS1A 3QMTA 3B0VC 1TPVA 4UTIA 3W88A 1DL3A 2A7RA 5HQEA 3TDFA 2ZZ6A 1L6WA 4FNPA 3C3NA 5AHIA 3STFA 4JY8A 3LERA 5EPDA 4DPPA 3HJZA 4FEZA 2CZ5A 1B57A 3HGRA 3C56A 1WXJA 2GUUA 4O52A 4RXGA 1FWNA 3IV3A 4K7VA 1I2QA 4JTKA 4ZQPA 4GBUA 2WQPA 1D9EA 1U5JA 3EXSA 4PA8A 4UTMA 2H3BA 1W5OA 3B05A 3PR2A 2J6XA 3DHFA 3NR0A 3UWUA 3W2KA 2DORA 3ELFA 1YPIA 2ZRZA 4IMDA 1L6YA 4CNNA 1RZMA 5HUPA 4LVFA 1LM1A 4DPQA 4JR5A 4NXKA 5F4XA 3UZ5A 1KLYA 1LLWA 4K6AA 3DH7A 4E38A 3G1AA 3MHFA 3Q94A 4M6QA 3Q2DA 4FB7A 1TQJA 3LLDA 3N73A 1IIHA 3P67A 5G2HA 3BGJA 1X6UA 4AMAA 1FCVA 2YZRA 1M5WA 1DJQA 1S3HA 1YPFA 4AH7A 1TJPA 1QO2A 2YX0A 4K39A 3FIGA 3TX9A 3W1PA 4RXFA 1AW2A 3NPVA 1O5KA 4UFLA 2HMCA 3PG8A 4PODA 3EWYA 5BRBA 5TIMA 3W7DA 5ABTA 5LKYA 5MHBA 3EX3A 3MP5A 2V5BA 4AAJA 4BFAA 1GWJA 2ABAA 1F74A 4P61A 4LC8A 2VFGA 3FOKA 3W7CA 1SO4A 1KBJA 5I3HA 3W7QA 3BW4A 3IIZA 1H7XA 1OK6A 4BI7A 1F76A 2VFFA 4O17A 4N2YA 2VEMA 4UTLA 1N8FA 1H63A 4UC5A 3W84A 1W5PA 3WFAA 1SO6A 2AGKA 1A50A 3TA6A 2FLIA 1DBTA 1YXYA 3SGZA 1FDJA 1W5MA 5D37A 3GAKA 1EIXA 3QJAA 3MI3A 4CLMA 1YADA 2C0AA 2GOUA 3PS7A 1XC4A 3LI0A 3LRLA 4YWIA 2HS6A 2ZBTA 3KOFA 2EAWA 1F2JA 3LTYA 4UR8A 3N19B 5TQLA 4AF0A 3LB0A 4Y90A 3TFXA 3GKAA 3M16A 4JTUA 3M43A 3NQ7A 1GTHA 5CSSA 2PRLA 3OVPA 3W7OA 5I3KA 3PULA 3W2UA 1THFD 1NSJA 2CZFA 4IJBA 1MEHA 4AHPA 1OFPA 1X1ZA 1M7OA 2FFCA 4TMCA 1OFBA 5HR6A 1K7FA 3FEMA 4GUGA 2QKFA 4FF7A 1IXPA 4MY8A 5DBUA 5AYZA 5D2TA 1SO3A 2KZHA 3W72A 5KITA 3NAVA 3GDLA 2V82A 2YPIA 5FF2A 4N4PA 2OT0A 3ATZA 5C55A 3W7GA 4QNWA 3N3MA 1GJPA 1T8XA 3NL3A 1PIIA 2VENA 3YPIA 2YCEA 4G1KA 3MHGA 8TIMA 4NT0A 4I7VA 4XUGA 3EXRA 3PSWA 1A5AA 1OX4B 2F7FA 4JTFA 4WD0A 2JGYA 1O4UA 3VKJA 4YCPA 3G1VA 2XN1A 4NUWA 3SY5A 5D2XA 3CWNA 3NGJA 2E6YA 2NX9A 5A5WA 3BW2A 4MOZA 3EWUA 2CLOA 3E96A 2WKJA 5G1YA 3I7RA 3SFKA 3TJXA 3GB6A 1JR1A 1SSGA 2X1RA 3M6YA 3P80A 3FJ6A 4UUIA 3UXDA 2CWNA 2ZTJA 3CQ0A 3UZJA 5FEPA 2QCFA 5G4EA 4UTUA 3I6RA 4CQ8A 2BX7A 4FNRA 4JYEA 3LGEA 5AC7A 3O63A 4JNMA 1UCWA 3PBVA 5HMSA 1W3IA 1YYAA 4QNEA 3TAOA 1VCGA 5DBTA 4C1KA 3MI2A 3TROA 4J9JA 3GX9A 4JTJA 3L66A 3DENA 3C61A 1MSSA 3MBDA 3CM4A 3T4CA 4K7YA 1ZENA 3W23A 2NWRA 3P7YA 1XKYA 3BV4A 4LU0A 2VFHA 1LRTA 3LBMA 1VHCA 5CKSA 3L2IA 3M5ZA 4UFKA 4R33A 1H1YA 3FKRA 2I1OA 5FF4A 4CQ9A 4JX4A 1D3HA 2Y61A 1GVQA 1PL9A 2DZTA 3T40A 2WJZA 2CLMA 4LRTA 1VZWA 1H62A 1GPWA 3L0NA 1P1XA 1TIMA 3M7WA 2FB3A 1OVDA 2Z6IA 4O10A 4Y6GA 1Q6RA 4NJIA 5AHFA 3OBKA 1XDLA 1PE1A 4E2BA 1FWTA 3E49A 1DHPA 2QJHA 2C14A 3GAYA 3NPWA 3BPWA 4Q32A 4WJEA 3VI2A 2EGZA 1EPXA 4ALDA 4TIMA 1FDYA 4R7JA 1IGSA 4S2CA 4Z1AA 4ORIA 1EX5A 3ABRA 4X2RA 1YDVA 2FPTA 1GYNA 3W7HA 3NEVA 5LGZA 2V81A 1W0MA 3MUXA 1F6KA 3UXAA 1O5XA 1G6CA 4JTTA 3G1YA 1TPWA 1G7UA 2X2GA 3BLIA 5EKYA 3TAKA 4A3UA 3HF3A 3W1XA 1P0KA 4C1LA 4YLWA 3GXPA 4DF0A 4ADUA 4MYAA 3PF3A 1ICQA 1KTCA 5LNWA 4O53A 2QCDA 2DJXA 2NXIA 4OWGA 4UNKA 3NOEA 4UMCA 3A22A 1QPRA 3BG9A 3CLMA 4M5PA 1FDZA 2G96A 2CLIA 4Z08A 3CC1A 1T99A 3QRHA 3W07A 3KVLA 3CU2A 5DY2A 4A22A 3QPZA 4Y9AA 2CZDA 3W86A 5AB3A 2ZRWA 1KW1A 3INPA 2NV2A 5FEWA 2R91A 3HBLA 4WY0B 4ZMGA 5CPMA 4WUIA 1T96A 3DU0A 1KBIA 3SW6A 4QM1A 3DXIA 4XKYB 2NX3A 1JCXA 2YGYA 2EHHA 2A85A 3GDKA 3A23A 2RH9A 4IOTA 2ZZ3A 3RMJA 3FYOA 2QCEA 3DKJA 4JDYA 3N2XA 4FO4A 3M44A 2QAFA 4M7SA 5DXXA 2PCQA 3NM3A 3W7LA 3DI1A 4M6VA 4O4WA 1Z41A 3UWQA 2B4GA 2NUXA 1AG1O 3DFPA 1B3OA 3LHUA 2JBMA 3TJLA 3BLFA 3W1RA 4GC4A 4TX9A 1QPOA 4NNCA 1FWRA 4BWLC 3EEGA 2GQ8A 1SZEA 2YFNA 4HIBA 3O05A 2ZRUA 4OT7A 4N9EA 3S5NA 3PY2A 1HL2A 1SZNA 1ADOA 1X8FA 1QOQA 4O4VA 2RDWA 1EWEA 4MVAA 3QC3A 2VEKA 1BTMA 2FPVA 3LV5A 1Q6OA 1J4EA 1G67A 5D04C 1AL7A 3DFTA 3CIWA 3MWAA 1RR2A 4O1BA 3W87A 3U8GA 5DN1A 1A53A 5L9FA 3QZEA 2Q3OA 3SR7A 2NZLA 2Q8ZA 2GJNA 4K36A 3NNTA 4PH6A 3KVKA 3UQNA 1W5QA 2NXHA 4O1CA 3M5YA 1GVRA 3W1MA 3WJYA 2X30A 1A5BA 3RF9A 3MMTA 1ALDA 1YDOA 4E2DA 3W1LA 1UB3A 2FIQA 1TPFA 4ZQCA 1L2UA 5FF7A 3W3OA 1AMKA 4PFMA 4LOCA 1VHNA 3NQVA 3B4UA 3NL2A 4IWWA 5D2YA 2BXVA 2P1FA 4O54A 1MEIA 1R2SA 2DZPA 3NQAA 2RFGA 1SZFA 1W54A 4OQVA 4AXKA 3PBWA 1IXQA 4XBSA 2FB2A 3TKFA 3CEUA 5CZTA 3N34A 3TNOA 2WPBA 2DP3A 4ICNA 4GFSA 3H53A 3GR8A 2PE4A 5GVJA 2V0TA 1DKWA 4PL1A 4RR4A 2Z2UA 2FJKA 1FQ0A 1GVOA 1GEQA 4Y96A 2E09A 5IBXA 1IXNA 3G18A 4BR1A 2Z0IA 2DZVA 2Y7DA 2CLKA 3L9CA 3ZS4A 4EOUA 3A21A 4OE7A 5FI8A 3A5VA 1C9DA 1TJRA 1AK5A 3MBFA 5KSWA 2C15A 3FFSA 5LGXA 3LRMA 3EXTA 1ZCOA 5F2LA 4EF9A 1LRNA 2YW3A 4JEQA 5K4ZA 4AEOA 4IXHA 1H7OA 3LHVA 4MZYA 2OZ0A 1QO5A 2O7SA 1W5NA 3O6DA 2DU2A 5K3VA 5D2WA 1YXDA 4D2JA 3DZ1A 3NQ8A 3V75A 2AAMA 2E5CA 4K8EA 5LNRA 1LLZA 4LVBA 2Y7EA 4Y8FA 3KVJA 2ISSA 3LCHA 4IMFA 1LROA 2JKEA 2Q8LA 5I3JA 5EY5A 2CFFA 5E93A 1OFDA 3B06A 4ZZ9A 5KMYA 3WK3A 1LYXA 4UMAA 3G3MA 4XZ9A 1I4NA 4NX5A 3G1XA 1TTQA 3M41A 4Z1DA 2GJLA 5DY3A 1XXXA 1RD5A 3O07A 4GUHA 1C8VA 3W2JA 4UTWC 2GVGA 2VFIA 1TMHA 1PVNA 1A5SA 5HWMA 2P0OA 2Y7FA 4WOQA 4X9SA 1QFEA 4FNTA 4QITA 1XDMA 3O06A 4RZ4A 1OX6A 1C29A 3CB8A 1ME9A 5CPNA 4MY9A 3LCLA 1WQ5A 2VFDA 3B04A 1KM5A 4MFDA 5K9XA 1DVJA 2ZZ5A 3M47A 2WSRA 2X1SA 5L6UA 1UASA 2G97A 3NQFA 1ME7A 3HIJA 3G1HA 3TV8A 4X22A 3MP3A 3MHUA 3PBUA 3TSBA 5LNSA 1FWWA 4OU1A 4N6FA 1OX5A 3OEXA 1RQHA 2QEZA 1GT8A 4RX0A 4WZHA 3P84A 4WOZA 4L4MA 4B5NA 4EVZA 4JTSA 4JYDA 3UY7A 1TPDA 5C54A 4NXSA 1RPXA 4UCGA 1KV5A 1KM1A 1SZGA 4ONVA 4QISA 1MXSA 3OHIA 2PURA 2NUWA 5AHEA 5LSMA 1X7FA 2CLFA 1PHWA 3HG3A 5EBUA 1MEWA 2ZZ2A 3PC0A 4FIRA 4LS2A 4RCXA 1TPH1 3S42A 1Z42A 3LM7A 4R34A 5BOOA 3GK0A 3NL5A 4DO5A 1F73A 1TPC1 3DFQA 1WX0A 3KVMA 3W1AA 2CLHA 3V1PA 3C2VA 4FNQA 4A2RA 2WNZA 2OX1A 4HSNA 3WJSA 5IM51 1ZJIA 2P10A 3EX4A 3IVTA 3P5ZA 4IMEA 1KFKA 2ZA1A 4H4IA 3G3DA 3SSJA 1EEPA 2NLIA 3QYQA 1OYCA 1GQNA 4ZQNA 1KV8A 3O16A 1UUOA 1TTIA 2RKXA 2JKAA 4RLIA 4MY1A 3G22A 1W3TA 3QQ1A 1H7NA 1OF6A 1QPNA 1WA3A 1VLIA 3C2EA 2JGQA 3PSVA 4LS0A 3G24A 1KM4A 3NQEA 5AFDA 1Q3NA 4CQAA 3G8EA 4O0KA 1VPXA 1HO4A 1GG1A 4S1FA 3H55A 3P8IA 1S5TA 1H7WA 5DXYA 1XL9A 5EMUA 1JUKA 3W74A 2CW6A 1CI1A 2YYTA 3R8RA 3MYOA 5CZJA 1NAL1 3D0CA 4O1AA 4XBKA 3NQDA 1LCOA 1LRQA 3EKZA 1M7PA 3DHDA 2LLEA 1JCNA 3UWVA 4LTSA 4NJJA 3LHTA 1RQEA 4LV4A 3S1UA 2DZWA 1LORA 2UV8G 2H3DA 4EF8A 1LBFA 1F7BA 3IIPA 1BWKA 1OFRA 3WK2A 3DAQA 4BF9A 3MO7A 1TREA 4L4LA 4RZ5A 3FYPA 2OMAA 2GQAA 1MO0A 2WV8A 2OJPA 3DFSA 3OG3A 1I2NA 3CT7A 3KAOA 5DCDA 4JXCA 1YTKA 3G0SA 4FX7A 3VCRA 1JUBA 2EPHA 4A29A 1SPQA 3ABQA 3SZ8A 1VC4A 3BO9A 1J5TA 2A6NA 2E68A 3TC6A 1VS1A 3C2RA 3UPWA 2I9EA 2R8WA 5KZEA 2HSAA 3W2MA 3NXFA 1K7XA 2ZQ0A 1V5XA 3S1XA 4U4MA 4OV4A 5FF0A 4MKNA 1GYLA 1AW1A 3EWWA 5CZSA 1WBJA 1QPQA 1G4TA 4IPJA 1HTIA 1EA0A 1SFJA 1BKSA 3S5OA 3L68A 4O11A 4NNAA 1AW5A 2Y63A 2YYUA 3NPXA 1HFBA 4IUOA 2IQTA 3FLUA 3HB9A 2C13A 1TCDA 5KZMA 1FCBA 2Y89A 4MUZA 1OYAA 3TW6A 2QJGA 3EX1A 4UTKA 4QAIA 1ZHAA 1UJPA 5F1UA 2YSWA 1ME8A 4XQ6A 5U7SA 4HNVA 1G69A 3BG5A 1ZAHA 1HO1A 3WK0A 3S6DA 4ZQRA 1TV8A 1PS9A 4N9BA 3DGRA 4A21A 3ATYA 4MJZA 1EUAA 3QSTA 1ZAIA 3PUOA 1I8JA 1GOXA 2CLEA 2OCZA 3B03A 3HG2A 4K38A 4HT3A 2R94A 4AHOA 3QEZA 2Q3RA 1KLZA 5AC8A 4FX8A 1LZOA 3L65A 1P5BA 3IEBA 1N7KA 2QUTA 2ZRXA 1F05A 2V2CA 3C2FA 4O1DA 5G1TA 2A1YA 3USBA 3MW7A 5DELA 1FWSA 3HOJA 4KFPA 5CGQA 1K8ZA 2H8XA 5AC6A 4W9TA 3M9YA 4WY0A 1W37A 3DFOA 3C6CA 5FEZA 1ZFJA 4HPJA 3LCFA 5AYYA 1H7RA 3G0XA 3UYCA 1JULA 4JYFA 2WNNA 4MYXA 1R2TA 3UWWA 2J88A 4JX5A 1GZGA 3C2OA 5I3IA 4BI6A 4PCFA 2A7NA 3CTLA 1XBYA 5HWNA 3SIZA 4JN6A 1LOSA 1EP2A 1TQXA 3N2MA 3ZWSA 3LCIA 1OJXA 3O6YX 3L0KA 3KRSA 1NEYA 4GE8A 1S5VA 3H54A 3IGUA 4O28A 4ZL1A 3TH6A 1KFBA 1WBHA 2BTMA 4HKPA 4AWSA 3HPXA 1QCWA 3O6CA 3TUUA 5FEXA 5SWUA 3W7PA 5D38A 4I7UA 1PCWA 4KFNA 2YFOA 5F2MA 4FX6M 3BG3A 1FXPA 5EL1A 2E5DA 3TXVA 3QSRA 2C19A 4PL2A 4MZ1A 4UTJA 1NVMA 3PM6A 4GUIA 4TR9A 5HULA 4GUJA 1QR7A 1JJKA 2QCGA 1SW0A 2ISWA 4AHQA 3PUDA 1KFLA 5C2XA 2B0MA 2TPSA 4JTLA 3O1NA 2J24A 2DZXA 1TO3A 3NZRA 5BNKA 3OIXA 4PC8A 4XWUA 2ZDRA 3W7MA 1XCFA 2ATMA 2QCDB 4M7TA 1YDNA 3FA5A 4UMBA 4FXRA 3EKLA 2ZCGA 2NWSA 2JKPA 2PRHA 1GVSA 2A6LA 2TRSA 4RV8A 1NF0A 2YXGA 1LOLA 4DELA 4HNUA 3BK0A 4E0CA 3THAA 2FTPA 2BZNA 4FXSA 3MJYA 4P2VA 1R2RA 2QCNA 2E77A 3IVSA 4ZQMA 4IX0A 5HINA 3LI1A 3KXQA 2NXGA 1SQ7A 3E02A 1P4CA 4JY9A 3P74A 2X16A 2V5LA 4NJHA 2ATSA 1HUVA 3ZR4A 3A5FA 2C6QA 3PBYA 4FHAA 4U28A 1N55A 2R14A 4KFOA 5AOUA 3N14A 1G4EA 4MZ8A 3TU9A 1JCYA 4O8RA 2WSQA 5DLCA 3RNDA 1TTJA 2FQIA 2BWGA 2ISVA 3HGSA 2ZZ1A 3QF0A 1ZNNA 3S9YA 4S2BA 3C52A 2WSYA 4N4QA 3TSMA 2TSYA 2Y6ZA 5EA9A 1R46A 3GNDA 1KA9F 3G0UA 4BK9A 1EP1A 3T78A 3QM3A 2GVLA 3NL6A 1TB3A 1LTDA 1ZAJA 2Y7GA 3PG9A 1FUYA 1OFQA 3W22A 4GRSA 1H61A 1SUXA 4HPXA 4TU1A 4O16A 4UTTC 1Z44A 1SFLA 2W79A 3Q58A 4LRSA 1Q6LA 1HG3A 1X1OA 3NYZA 2E1DA 5CPOA 4YMZA 5F2IA 5LHEA 4LC6A 4LVAA 1WYIA 5G4WA 3W7IA 1SO5A 3PB0A 2VKZG 2Y85A 2B7NA 4I9AA 4KWVA 2E6FA 1VCVA 3R12A 3STCA 3BVJA 2QDGA 2C1HA 5CPLA 4GUFA 1XBVA 1JVNA 2BSLA 2QDHA 2RDTA 4NJKA 4K37A 3S5YA 4PTNA 3W1NA 4LW7A 4JTIA 4OGZA 1QAPA 1FY6A 1SW3A 3PVFA 2WOQA 1W31A 2DZSA 4NNBA 1VLWA 3GLCA 3EX2A 3S0CA 3I65A 2B7PA 4DF1A 4O57A 3ABSA 2A5HA 1RVGA 3E12A 4DO4A 1XI3A 3A9IA 1NF7A 1FCQA 4UXDA 5K2ZA 5D32A 3WJXA 1H5YA 2YW4A 5D05A 5LNVA 6TIMA 4X3ZA 4DO6A 3U2OA 5D33A 3HGOA 3F4NA 3WJZA 2VELA 1VJIA 2V8ZA 4LY8A 4O0ZA 4HN4A 3WJWA 3ZWTA 2F84A 3LCXA 2AQWA 3C0JA 1IF2A 3LCGA 4WXYA 4AWUA 3W1QA 3QW4B 3LV6A 2J9XA 4MIMA 3IGSA 4DBEA 2C16A 3W6YA 2NUYA 1K8YA 2QCMA 1OF8A 3ABOA 3EB2A 3GVGA 4LNYA 2GVJA 1ONRA 4LV9A 1W3NA 2GPTA 1VYPX 3W76A 2ZZ4A 1R30A 3HQ1A 2H90A 2A2IA 4LT9A 1CW2A 5BMXA 3EWBX 1ML1A 3IGXA 1TSIA 3LOTA 5AHLA 3P60A 4MJMA 1W56A 2ALDA 1T0OA 5BMWA 1UBSA 1GVFA 3WK1A 5J5RA 3TXZA 4GWEA 3P61A 5HWJA 5C6MA 5HR7A 3TK7A 5HUOA 1LBMA 1O95A 4YL2A 1B4EA 5E1QA 4EIVA 3AJXA 3S1WA 2ZA2A 5I3FA 1LBLA 2XN0A 4IXXA 3I68A 1SSDA 2B7QA 5CSRA 3HG4A 3QH2A 4JTGA 3NQ2A 5G2WA 1JCMP 1WAUA 4OHQA 4CNPA 3W7RA 1QDSA 2PC4A 1Z48A 4O19A 3KRZA 5D2VA 3GYEA 1VH7A 1M6JA 4AWTA 1L9WA 1RV8A 2QUVA 2VC6A 5I3GA 3FKKA 4JIQA 1W8SA 4HHPA 3O15A 3GXTA 4ZQOA 3MP4A 3GNNA 1TPUA 3W7EA 1WV2A 2A21A 1U83A 4LVDA 2A0NA 1GG0A 3BGGA 3UPBA 4Q33A 3CHVA 3QFEA 3NG3A 4RJEA 2V9DA 5IBXC 4ADSA 3EX6A 1TRDA 3RFAA 1YTDA 3TQ0A 2J9ZA 3CIXA 2HS8A 1OK4A 4QQ3A
chains in the Genus database with same CATH superfamily
2QCCA 4UNLA 1IIGA 3REQB 3L5AA 3HPAA 4NU7A 3FSUA 1OCQA 2Z1BA 9XIMA 1B4KA 4OBRA 7REQA 2VOMA 4HNTA 3SUWA 4AU0A 3V35A 3MSRA 1H7PA 2VR2A 1BAGA 3BZGA 4RDVA 1A5CA 1FXQA 3S6TA 1XUZA 1E70M 3QPYA 3DBPA 3W24A 1ZU8A 1OHLA 2P5NA 3LCWA 3EPNA 3PAJA 1JYVA 2UY3A 1UA3A 2WYSA 3WL1A 3U2EA 1H11A 1F5ZA 4FMVA 3VZXA 1KQZA 3RN6A 2VCBA 2X0SA 1VAHA 4MNMA 3DFHA 4ZFMA 1BQCA 2W61A 1H51A 3CO4A 3ZLGA 3I7SA 5DO8A 4O13A 3MCNA 4I5XA 2Y88A 4RZ6A 1G94A 1KWGA 3KUMA 5G2IA 1WO2A 4IL0A 3EWCA 2VFEA 1K8XA 2I14A 4XIMA 4D6IA 2DSVA 5AZ0A 4Q8VA 5BZAA 2CZEA 2PDBA 1Q6CA 3BH4A 1YNPA 3TMQA 3VM5A 2OZ3A 1BWLA 3KFTA 1ZALA 4BWLA 4XAZA 2OLHA 1R6WA 3C8FA 1OFEA 2YR1A 4LEFA 4PTMA 1W9DM 4FI4A 4AB4A 1W9UA 1GW1A 2J62A 4JD4A 4LCSA 4V1YA 2G5WA 3PPHA 1GCYA 1KD0A 1O5QA 5DRIA 5FKYA 3E1F1 4IPPA 3HGJA 3STGA 3HO8A 1S2AA 4EX4A 1XBZA 2OGJA 4OUEA 2HK1A 3BE7A 2EKGA 1SR9A 4D9PA 5E70A 1AJ0A 3DI0A 1MMFA 1PBGA 3AHTA 3HG5A 1I2PA 3D6NA 3VILA 2CU0A 3FS2A 1PDZA 3EDKA 4KIEA 4HNNA 1XLCA 5AY7A 2Y8KA 3DEQA 1GUVA 3WQCA 3NQCA 1YEYA 5AECA 1BXCA 4Z0JA 3VGHA 1FWCC 3W1TA 1JCLA 1JQXA 3JS3A 1XHGA 1NWUA 1QWGA 3VNDA 1SR0A 3TVAA 2UY2A 4HGXA 3N11A 4DWSA 2V30A 2GSJA 5C7VA 4M6UA 4HJWA 5I6SA 3CUGA 3KX6A 2J4GA 2NT1A 2IXUA 2PF0A 1DJNA 1G4PA 4XKYA 4RE0A 4ENLA 5CH9A 2PDFA 1YXCA 3HV8A 2VZUA 1UUMA 2VM8A 4FOUA 3W82A 1EOKA 3U0HA 1IT8A 4OV9A 4QIUA 3U6WA 2C18A 1MZRA 4M1RA 4C7FA 1KTBA 1P6WA 3JU2A 3RCNA 5A6KA 3E0IA 4C6CA 1XGEA 4RUBA 2XPKA 3UWYA 3H70A 3QMRA 3MYPA 4ICCX 1C8XA 1R3YA 3QTPA 3JZEA 4E8DA 4UFJA 3QLDA 3RITA 2XHYA 5HNTA 4DWDA 1XSKA 2XFWA 1IWPA 4JX6A 1VF8A 3F4WA 1H4PA 4KWUA 4QS6A 4B91A 2CEQA 4UFMA 1Q65A 1J10A 1O60A 1WDWA 4UTWA 3TIMA 4EACA 4F79A 3PUEA 5AHMA 1V3HA 3SRFA 4IFKA 1TX0A 4CCEA 2AQVA 1B3WA 4C6BA 3W2NA 3W75A 3RLHA 3GW0A 2OEKA 2VZTA 5JVLA 1A47A 3WD4A 1CYGA 2GVEA 4LWWA 3L67A 3EDDA 1UMLA 3CYJA 4FIQA 2J7GA 4POCA 1ADDA 3CXOA 3F2BA 3LX9A 3FXGA 5FJJA 2RJGA 2REQA 3CAWA 1PCKA 2C1IA 1JEZA 2RHGA 4LUIA 2PAJA 4Z1CA 3ES7A 3HMCA 3W85A 3OLIA 3ZFHA 1Q7QA 5A6TC 4S3JA 4W93A 4QJ1A 3N25A 3FV9A 1DORA 4O14A 3KHJA 2EO7A 3AIWA 3M0YA 4K3ZA 1AH4A 4CNOA 4H9UA 1UOZA 1UKSA 1KXQA 3WD1A 3CWHA 3B8DA 4A4AA 1KBLA 4NILA 3CQKA 2J7BA 4LUTB 2XN2A 3NVTA 1YMYA 3I3BA 3UXLA 4M80A 1K02A 4UR7A 2YKKA 4HU0A 1RQBA 3LMZA 5I23A 5HATA 2E5BA 4M51A 3L5MA 3GXDA 4PCNA 5A8GA 4HK7A 1R86A 5GNXA 2IQDA 4ACZB 5ENLA 2ABBA 3RCMA 1VCFA 4N0RA 4L7ZA 2WMIB 3W9ZA 4TUFA 1I2OA 1TR9A 4O50A 3O0KA 3A64A 1AL8A 4DWSD 2YCJA 5CPQA 3T0DA 1CLVA 1KC7A 2W0UA 4IGHA 2FKPA 3EBVA 3DYMA 4MLRA 5J5DA 4KWWA 2WNQA 4JTAA 5KZDA 2YL6A 1UP2A 2ACRA 4L1GA 5H6HA 4EP8C 3K13A 3HPZA 1NFBA 1UWSA 4GGBA 2OKOA 2YBUA 2QDDA 1FFRA 1ZBVA 2WZIA 4JGDA 4S39A 4QSHA 2H8ZA 1Q6GA 1Q4NX 2VGGA 4LAZA 1TRIA 2EKCA 3AO0A 4JN7A 4D8AA 3ORWA 4WF7A 3IIOA 2BB0A 4L1WA 1RBAA 5KETA 4DUOA 3S6OA 1K03A 1D8WA 1JD9A 5K9CA 1EWDA 4JDBA 1UBPC 2V2DA 5A6BA 3ZJKA 4PYSA 4LVGA 1XG4A 3ZZ1A 1N8WA 2XYLA 3QMTA 4XIAA 4DZIA 2OGYA 4JN8A 2ZZ6A 5ABGA 3BC9A 4JY8A 3WUFA 4C7GA 1X1NA 5C9ZA 4DPPA 1V0KA 3HGRA 1WXJA 4OVXA 2WKLA 4YTTA 3OA5A 1I2QA 1A0EA 1Y8BA 1D9EA 1U5JA 4UTMA 1OCJA 3DHFA 3UWUA 3WNOA 1YPIA 1ZSXA 5JH2A 3DYPA 4CNNA 4K8GA 1LM1A 2PP1A 4JR5A 5BWFA 4NXKA 3LNMA 2HWGA 3E5PA 2HVNA 3IV8A 4AEEA 1TQJA 4ECLA 1EZ2A 1D3CA 2A3AA 3SBFA 1C3FA 1FVPA 2C8NA 4FF5A 4D6HA 5G2HA 3VUSA 1X6UA 1M5WA 2YLAA 3GZAA 4US5A 4F0RA 1DJQA 3MMDA 2NVCA 4QE4A 3FIGA 1OINA 3VNKA 3UXKA 4MNLA 3NPVA 3W38A 1O5KA 4HJFA 3KS5A 1A4MA 3HFYA 4XO7A 5ABTA 2X09A 3F7JA 4AAJA 3R25A 1GWJA 4Y9MA 4LC8A 1L2QA 2FTWA 2XIBA 1GZJA 3BAXA 1KBJA 2QV4A 3TQPA 3W7QA 3BW4A 3IIZA 3T2OA 1OK6A 4MG4A 1V79A 3UR2A 2Z7GA 2Y2WA 4UTLA 5E9AA 1H63A 3WENA 1GZ1A 1A50A 4GH1A 1DBTA 4QLJA 4BS0A 3SGZA 1AZ1A 3BICA 5D37A 1BVNP 1EIXA 3QJAA 2C0AA 4TX8A 2GOUA 1DJWA 1RA5A 2EAWA 2X8RA 2OQYA 4DJDA 2P50A 2GUYA 4GVFA 3LB0A 4Y90A 2YCLB 3EDEA 4AY7A 3FSTA 3M43A 3SY8A 3VIPA 3THDA 2Z1KA 2PRLA 3CIVA 3B8WA 3VOCA 5I3KA 3SQMA 1ZZMA 1QI4A 1NSJA 4IJBA 1DWGM 1OFBA 5HR6A 2FZNA 3LEPA 2XIQA 3MU7A 3ZSSA 4MY8A 1OG6A 5A6BD 5DBUA 2PLJA 5T9CE 5D2TA 1FWEC 1SYTA 1SO3A 2KZHA 1J9YA 4IFRA 3NAVA 3AU6A 4Q7IA 3N29A 5D9MA 3ATZA 5C55A 4KGJA 3NL3A 2VENA 4RV3A 1I9CB 1UD3A 1KCZA 1OX4B 4WD0A 3VKJA 1QWKA 3QTGA 2Y0FA 4GA8A 2PDYA 4TTGA 2WAGA 3EWUA 2CLOA 1FFQA 3I7RA 3GB6A 3WLIA 2ZTJA 1A5NC 4FXFA 2QCFA 5G4EA 4HZ7A 4UTUA 2R1NA 3M0LA 3SCSA 4JYEA 2PDUA 1DYSA 3LGEA 3O63A 4JNMA 1UCWA 4HA4A 1YYAA 4PTWA 4TX6A 4JKMA 5DBTA 2E28A 3GXFA 4US5D 4JTJA 3MBDA 2Z1SA 3WUBA 3H22A 4NZ3A 4AD3A 3H12A 2WCSA 3R8GA 3V1HA 2PBGA 1POKA 3W23A 2NWRA 1JZ7A 1LRTA 5XIMA 3SN0A 4UFKA 3FKRA 2I1OA 1SM9A 2Y61A 4GIEA 3T40A 1VZWA 2ZUVA 3BZJA 2J7HA 4O10A 4PRRA 4Y6GA 4PMXA 4E2BA 3E49A 1PKMA 2RJHA 3WLQA 2C14A 4Y9PA 4Q32A 3CUJA 1FHVA 2XFRA 1LWJA 3II1A 3V5FA 3KBJA 3WQPA 2XUCA 4E8CA 4JQ4A 3VNZA 4Z1AA 4GLEA 2P8CA 4MM1A 1BYBA 1MQQA 3NEVA 1UKQA 2V81A 1TVNA 1W0MA 3GIPA 1F6KA 3UXAA 5I7GA 3CV2A 4JTTA 1ZPTA 3E5BA 3ITGA 4H8UA 4UB9A 3RG6A 4DJDD 4GFIA 2IKIA 1TPWA 1G7UA 2VC7A 2FZBA 3BLIA 4A3UA 3GXPA 4B5UA 1ZQ5A 4MYAA 1JIBA 1BPLB 1XLEA 3PF3A 1KTCA 5LNWA 1XV8A 4O53A 4Z42C 4IH3A 3UJEA 3GG1A 3LSBA 3VIOA 2VVNA 5IRPA 1Q6DA 4CN4A 1QPRA 2WBGA 3W0KA 3BG9A 1FDZA 2G96A 4Z08A 3SIMA 4U5KA 3O0FA 4JAWA 2HISA 4XD5A 1MDLA 1GVIA 1XYAA 3WDHA 3SW6A 3RDKA 3DXIA 4XV0A 1JCXA 3HM7A 2EHHA 4Q3MA 2O9PA 2PPGA 4IOTA 3VOIA 4IIHA 2QCEA 4XK2A 3DKJA 2HQAA 1CBGA 1WDPA 2AMGA 1EQCA 4HSHA 4YS1A 2IKJA 3AS2A 3DESA 5BOFA 4GC4A 4TX9A 1QPOA 4PMOA 4BWLC 3W6MA 1UH4A 4OBSA 2PTXA 4LFYA 3C86A 1HL2A 1SZNA 3SRKA 1DWFM 3VD9A 2FPVA 5FAJA 1J4EA 4V1XA 2O92A 2DVUA 4UQBA 1QATA 3CIWA 1RR2A 1BRLB 3W87A 3U8GA 5DN1A 3QZEA 1MWOA 4UZUA 3SR7A 2NZLA 4KCUA 3C0SA 3NNTA 4PH6A 3UQNA 3C8NA 1WZAA 2W27A 1GVRA 3NURA 3WJYA 1QTWA 3BCFA 1ALDA 4E2DA 1RD6A 2FIQA 2ZE0A 3U3HA 1TPFA 4ZQCA 5FF7A 3W3OA 1XCXA 3TLQA 4B15A 2I7GA 1U1UA 2V5JA 1MEIA 1M01A 4Y9NA 2XSBA 3NQAA 1WDDA 1DIDA 1W54A 1IXQA 2PUZA 1W9VA 4RDYA 3L7RA 4IPNB 3N34A 1XGZA 2WPBA 2DP3A 2GSHA 4GFSA 5CCZA 5GVJA 4PL1A 1CCWB 2DZVA 3U9IA 2Y7DA 1R3TA 3E3HA 3QFWA 4WR3A 1HQTA 3IARA 3B0YA 3L4YA 1C9DA 1EH9A 4CD8A 1AK5A 1FWIC 4S3DA 3EXTA 1ZCOA 4ZA0A 4JEQA 5K4ZA 4JIEA 2PGEA 4ZOCA 1H7OA 1TCMA 2OZ0A 4MHBA 1W5NA 3DC8A 4NYYA 5MKGA 4A6GA 2O55A 2IPFA 4D2JA 1E6XM 3MMUA 3MWCA 3KCLA 1E4MM 3KS6A 3N1AA 2E5CA 5LNRA 4LVBA 3ARZA 1KGXA 3PTQA 3GU1A 4Y8FA 4HA0A 1LROA 5CSUA 5I3JA 5EY5A 2CBIA 3IANA 6REQB 5IDIA 3OPSA 2NW0A 2J78A 4YPJA 4V28A 4XZ9A 1UQYA 3GC4A 4Q7BA 4LEQA 3G1XA 1TTQA 3M41A 4DLMA 2OSWA 3KBVA 2VGFA 3VTRA 2PDIA 4UTWC 4IM4A 3T8LA 1B54A 2DSZA 3QN3A 2UWFA 5FJOA 1TMHA 2AL2A 1CIUA 3KOYA 4KRTA 4WOQA 3E74A 1ODZA 1HP4A 5BXSA 5CPNA 4MFDA 5K9XA 1G9HA 3LU2A 2ZZ5A 3SN4A 2ZX6A 3HFTA 3WNLA 3HIJA 3N15A 3UWEA 2E1WA 2XSXA 4D6JA 3G1HA 2QYGA 3H8AA 3G2GA 4MWAB 1OX5A 1RQHA 2RGMA 5IHSA 3V0UA 3TC3A 4J3ZA 4EVZA 4JYDA 3ZT6A 1F3WA 1GQLA 5C54A 3WH7A 2ZUSA 2NSOA 4NXSA 1Z9AA 2OWXA 1VPYA 2PDCA 4OTKA 4PBGA 1Z3NA 4UCGA 1JZ2A 4W7VA 1V02E 2WMGA 3REQA 2HK0A 3OHIA 4A35A 4L56A 1AH0A 4Q8MA 3AQUA 3MUY1 2GZXA 5LSMA 2CLFA 5CAHA 3CGTA 3AYRA 4R27A 4JOMA 2XG9A 4FIRA 4LS2A 3TTQA 2L5HA 3K8LA 1OC7A 5ABEA 4J3XA 3GK0A 3LM3A 2FVMA 3VD3A 2J6VA 3C2VA 3WIJA 5IHRA 2WNZA 4HSNA 5C9RA 3EX4A 4LBRA 2ZADA 4IMEA 3HN3A 1R3WA 1W2VA 3G3DA 3SSJA 1IT7A 1Q66A 4XVEA 3GS6A 3STPA 4PB5A 4QG6A 3QV8A 1OCBA 4CVWA 1XSJA 3M0IA 1V93A 1TTIA 3FHAA 1AQHA 2RKXA 4HP5A 4B5TA 2JKAA 3ZJ7A 3ITVA 4JQ2A 1V6UA 3WF0A 2GYIA 1H7NA 1C91A 1PO9A 2BFGA 5FSEC 1WA3A 3C2EA 1RPKA 1LT8A 3WQWA 4TVCA 3VNJA 3G24A 3BJTA 3NQEA 2VVSA 5AFDA 4CQAA 1NY1A 4FALA 3PZQA 2GWNA 4QFUA 2G50A 4Q8NA 1XL9A 3W74A 3T4WA 2VMFA 2CW6A 3R8RA 3MYOA 3D0CA 2I56A 4O1AA 2PP3A 3NQDA 3H7VA 2JEQA 3EKZA 1M7PA 3DHDA 4NL1A 2O4MA 3LGDA 4NRRA 4S3CA 4CCZA 3UWVA 4WK9A 4LTSA 3LHTA 1XYFA 1WP6A 3S1UA 1L6FA 4EF8A 4GJJA 1LBFA 4MWAE 1V6XA 2GDVA 1BWKA 2VGIA 4GG9A 1S2TA 1QNSA 4PE8A 3S2JA 4BF9A 3MO7A 1NTHA 1J01A 3WQVA 1MO0A 1LJYA 2WV8A 5HMEA 1U2YA 4JXCA 2OOGA 1PZ2A 3LY0A 3ES8A 3VCRA 4LYRA 1JUBA 4A29A 3SCTA 3ABQA 3PZVA 3CUIA 4DHGA 1GORA 4UQAA 3GM8A 2GWGA 4PSRA 3ITXA 2YDQA 3KCJA 1K7XA 4PUNA 1V5XA 3E38A 4OV4A 1I60A 4MKNA 3ZXWA 3PZNA 3UR8A 3TJ4A 1GYLA 1MUMA 3EWWA 5BU6A 2VDGA 1I1WA 3I4KA 3POCA 2HVMA 4GY0A 4Y2WA 2WQDA 1V77A 4UQDA 3R0KA 4IUOA 1TCDA 5KZMA 4MUZA 1O5RA 5FAGA 2W91A 1OC5A 2XH4A 3VDHA 2QJGA 4UTKA 2D0HA 1ZHAA 1KRCC 1UJPA 3VU2A 1BQGA 3S9IA 1XF0A 3ZR5A 3RM8A 3BG5A 4W7WA 3VDAA 4N9BA 1UZ4A 1HL9A 1V4YA 4EPKA 4ATLA 3QKEA 4NF7A 1BXBA 1Z7AA 3PUOA 1I8JA 1GOXA 3WQ6A 2OCZA 1NFPA 4AHOA 3QEZA 4DBSA 1LZOA 3L65A 3GHRA 4UR9A 1UZHA 4XISA 5I03A 5G1TA 1UD6A 3USBA 1H41A 2QVNA 5AC6A 4QLKA 1F07A 3WD2A 1TWDA 4H7CA 4J5NA 2VZVA 1MW2A 1RY8A 4F48A 7ODCA 4JYFA 1GZGA 3C2OA 3RILA 4MADA 1KB3A 2HEJA 3CTLA 1XBYA 4MDOA 1ONEA 1UP0A 4DZHA 2ASHA 3T81A 3WFLA 1NEYA 2VDHA 1S5VA 1R3QA 1I1XA 4GE8A 3H54A 3AZRA 4ZXLA 4L6DA 2BTMA 3CQIA 3HPXA 1QCWA 3U57A 1EGVA 1QASA 2W9MA 5D38A 4GCXA 5AC4A 3GU9A 3BG3A 1VBRA 4C5ZA 4TV5A 4PL2A 3EZ4A 3CZ8A 4LB4A 1NVMA 1XKJA 4GUJA 1QR7A 2WM0A 1SW0A 3K8MA 4GQGA 5LIUX 4PULA 3TN4A 3PUDA 4Q4SA 1KFLA 2D2JA 2J8TA 2WHJA 5C2XA 3OGSA 1K9EA 1T41A 2J24A 1VEPA 1CGWA 3ITLA 3POHA 3SFWA 5BNKA 4X0NA 1SGJA 4JHZA 2ZDRA 1XCFA 4M7TA 1DXFA 2VOTA 4FLRA 3N17A 5MF5A 4AIBA 4D8LA 4J35A 2PRHA 2A6LA 5C70A 2TRSA 7XIMA 6ENLA 3H24A 4LYPA 3BK0A 3THAA 2BZNA 4LPCA 3MJYA 2P3ZA 1N2VA 2VZOA 2OO6A 2E77A 3IVSA 3CAVA 3LI1A 3PPGA 4H1ZA 4GVHA 1TIWA 2NXGA 1SQ7A 1A3WA 4DYEA 5BWAA 1XW8A 1PJ9A 3K5XA 4GZEA 4S23A 4OJYA 2JQXA 1KXHA 4D6EA 2XZ7A 4LAKA 2WHLA 1E9LA 4HA3A 1DPMA 3BGAA 4HK6A 3A5FA 1TVLA 2C6QA 4LYQA 4FHAA 1E0XA 5EBAA 1N55A 1DIKA 2VX6A 1UJQA 3PZTA 3N14A 1G4EA 4MZ8A 3TU9A 4CEXC 1J18A 4O8RA 4J3TA 1JDEA 5I77A 2ISVA 2X1IA 1GJWA 1ITXA 3TLLA 1K9FA 3K1GA 3UYIA 2WSYA 3GUGA 1P0BA 3C0LA 3TSMA 1R46A 3GNDA 3G0UA 2O56A 4GO8A 5CXPA 2GVLA 2PWHA 1E43A 3NL6A 1XYZA 4GCAA 1DEDA 3PBMA 2Y7GA 1OFQA 3W22A 4GRSA 3WZ0E 1X6LA 1J0IA 3KW3A 1DWJM 1Z69A 2W79A 4DBWA 4LRSA 4R7OA 3NYZA 5F2IA 4LC6A 1WYIA 5G4WA 2VKZG 2IXVA 1VCVA 4DVOA 3WLSA 3BVJA 2QDGA 4ZEPA 4GC3A 3UJSA 4GXPA 2ICSA 4YTRA 4HU8A 5M3WA 1TWIA 2QDHA 3PNUA 2RDTA 2E9LA 3CL7A 2VGBA 2CBJA 4DLFA 3ECQA 1LL4A 1QAPA 1YKWA 3PVFA 4NNBA 1QVBA 4Q6JA 1V6WA 4MSSA 2QS8A 3PUGA 5BXPA 4DF1A 4O57A 4PBEA 3P93A 3ABSA 2A5HA 1RVGA 1GOOA 1FCQA 5K2ZA 3TR9A 2ZKMX 1NELA 5LNVA 1C92A 4DO6A 2YA2A 3U2OA 5D33A 1XDJA 3F4VA 1GEHA 1NDZA 4H8NA 1BTCA 4LY8A 1ZJBA 4Q6XA 5C9XA 1XD0A 3SJNA 3WJWA 2YA0A 1XPGA 3W6LA 4AWUA 3W1QA 1VFSA 4DJFA 3H26A 1DJYA 3GG7A 5AYIA 2FGZA 1ONRA 2ZX7A 2G3MA 2GPTA 3W76A 1TZZA 3FK4A 3HQ1A 1Z8AA 1TX2A 4WRHA 1DHKA 2RDXA 1TKKA 1Q63A 1UWQA 1JG9A 1ML1A 3ZM8A 4UOJA 3P60A 1T0OA 5BMWA 1IEVA 4GY1A 1Q8JA 5J5RA 2VQUA 5T9BG 4IGNA 5HR7A 1UH3A 1RY0A 1E6ZA 3TK7A 1BVZA 4AZCB 1AD4A 3VKBA 4AVNA 4DNHA 2PU1A 2OPJA 2ZA2A 5I3FA 3APTA 4FLQA 4IXXA 2PZ0A 3KBWA 1Q4WA 1QJWA 2NQ9A 3L4VA 3Q45A 5G4HC 2IW0A 3TN5A 4YHGA 1JCMP 1WKFA 1HVQA 3GFXA 4M56A 3FJNA 3CAQA 1Z48A 1W1IE 2QV5A 1VH7A 1US2A 4HNOA 1TA3B 1E5NA 2VRKA 3RAOA 3U7BA 2QUVA 1F3EA 3G5EA 2FZ8A 5CSYA 3G1RA 3AWNA 1CGVA 1W8SA 3R11A 5CQ1A 4PBFA 4AZ6A 4JIIX 1M41A 1XISA 2WC7A 4LVDA 2MNRA 4D6GA 5C71A 3CHVA 3QFEA 3URNA 2V9DA 2PMQA 3EX6A 1TRDA 1JI2A 3K4DA 3CIXA 3AAMA 2OSXA 1OK4A 1O1ZA 4GX8A 3DYOA 1PZ1A 1AVAA 2H6RA 4XSLA 1PXGA 3EWZA 3W73A 3RLGA 1K1DA 3N9SA 2QQ6A 3W27A 1JAEA 3M1ZA 4PMDA 2W63A 2DZUA 4DXKA 2ACQA 4UZSA 2E40A 3P81A 1MZHA 3KWXA 4PUWA 4BHYA 9CGTA 1NJJA 1J6OA 4G1NA 4GPNA 1U5VA 2W6RA 1OX4A 3F1QA 2PB1A 2D73A 2VURA 1XFBA 4GKTA 1X97A 3SJ3A 2A3HA 1M65A 4Z2GA 3MV11 1M53A 3PB2A 1AUSL 2VEIA 1UC5A 4GJIA 2OWWA 4DF2A 1SJCA 4CCDA 3K46A 3TMLA 3P0WA 1BGAA 3RYSA 4HMDA 5JUVA 2E7FA 3WMBA 4AF0B 3CPGA 3BMVA 2WK2A 1UW9A 2ON3A 3AZSA 2RDUA 4PMJA 3T55A 1A5OC 1NIUA 3OBEA 1E4IA 4DAFA 5TBOA 4B3ZA 4DJFD 4C1NA 1ZUAX 3KLKA 3R2GA 3P8JA 4CN6A 3NPUA 2EQDA 2IPJA 3ARVA 4NKCA 3ARTA 3VKKA 1F8MA 2PDGA 3W00A 1E51A 3FJ4A 2PA6A 1W1VA 4QJ5B 3UERA 1E4LA 3F03K 3UZXA 1P43A 3QV9A 1YLVA 3BW3A 2QZRA 1OYBA 3S1VA 3NO5A 1R47A 4HHHA 3WUGA 1JRBA 4GZJA 2W66A 4CN1A 3OVQA 3SECA 4NZJA 3ALGA 1D3GA 1CEOA 3ZR6A 3PTDA 3RK8A 3SAZA 4UOZA 3TYCA 5FESA 1FRBA 2POZA 3JR2A 3JVAA 3SCVA 4NZFA 4WDXA 4V33A 1S5WA 1B1YA 1OFAA 4Z0SA 3WEOA 3M0ZA 3TN6A 3LQLA 3GIYA 4NZCA 4U5IA 2FVLA 5HJLA 2JIWA 3R13A 2BODX 4WKFA 5D02A 3AYVA 3WH6A 4Z2LA 5T26A 3OGRA 4M6PA 4NAEB 1H49A 4IGSA 4AVFA 1I2RA 2C3ZA 4DYKA 2TAAA 3EDFA 1VENA 4FR1A 1SW7A 3GNRA 4RK8A 3G1SA 3W70A 4WEVX 1JPHA 2GOKA 2INEA 2G0WA 3BLEA 1GK8A 4NX0A 3MT1A 4TTUA 3CWOX 3AIUA 3ZT7A 4ZBCA 1IWAA 3H2FA 3WDIA 3QW3A 2CLLA 1L0PA 1XC6A 3GO2A 2Z6JA 4RNFA 2QF7A 3TC7A 2VI0A 4CNTA 4EPBC 1VQTA 4UTTA 2EJAA 4PMQA 3NSXA 3QXBA 3SGUA 3RXZA 4MNJA 4G6CA 1XM3A 2PWFA 1I45A 4G5DA 2GSEA 3RU8X 1LDCA 4DI9A 1RJPA 4DJEC 2CIPA 5K9DA 5D9OA 1KFWA 1YPXA 5C2GA 1LL6A 2QAPA 2VDIA 2BOEX 1EJVC 5CBJA 4HTYA 3GSMA 1V7YA 2FDSA 5HMDA 4LAMA 2AQOA 3RLUA 3AALA 1HXJA 3BUVA 4DRSA 1H5VA 4CNUA 1BRLA 4ML9A 4OBTA 4DEFA 2VRQA 3TSDA 4KWSA 2BP1A 3D3FA 3VE7A 4BF5A 3W7JA 1XICA 4O15A 2QMJA 1UYQA 1XLHA 3ANYA 4JS3A 3B3DA 3NWRA 2QGHA 2Y4SA 3N6QA 4JNZA 5K7JA 1EUNA 2J27A 1W6TA 3EA3A 3W01A 1Q85A 3NGFA 4CU8A 3LENA 2POTA 5LZLA 3O6AA 2W62A 3H4WA 2DQXA 3PP7A 5CG7A 2E6DA 4FXJA 1ZS2A 3GH5A 4DM2A 3TYZA 2WMFA 2XFFA 2TYSA 3LMYA 1Y0EA 1WXYA 4ADTA 4Z1BA 3B9AA 2QJIA 3OLDA 3CUFA 4WXZA 1QOPA 3NO3A 1TWZA 3AXKA 4GZ7A 1XBXA 5IFPA 4NASA 2WLYA 3IRDA 4PUUA 3ENLA 4Q4MA 1J11A 4N9DA 3WUEA 3GDMA 1FWGC 2HPIA 4M1BA 3TYDA 4ZE4A 1TV5A 1G4SA 2GGJA 3R7MA 4XAYA 1VYSX 3LG3A 5C9WA 3LDVA 2XINA 1KM2A 1TV4A 2VWSA 4ORMA 4GQ0A 7TIMA 2PDJA 3E2QA 2V3DA 3P2VA 2WCAA 1I6NA 1FP9A 1XIGA 1VBUA 4N6EA 3M4HA 3P82A 3PZUA 1Q6QA 3LZ5A 1XX1A 2P8BA 4E3VA 4LAOA 4AFYA 1W17A 3AXXA 1ICSA 6REQA 4F8XA 2BY1A 1IEXA 1QNRA 4W87A 4ZO9A 3VX0A 4XZNX 2WB5A 2V2HA 4WGHA 4UIOA 1EYEA 1LP6A 3NDOA 3GKFA 1QT1A 5F4WA 1JI1A 4UTHA 3GXIA 3BWWA 3PZIA 3TR2A 4HZ8A 2EPNA 3UD6A 1Q8AA 4UQ9A 4W8BA 1W1A1 3FA3A 1LG1A 4J3UA 4WQ6A 1ICPA 3M07A 4N9CA 1FCUA 2DVXA 3T6CA 4QE1A 2E3ZA 3KCOA 4EWJA 1JGMA 4FOKA 2BY3A 4HSOA 3GZ3A 1KM6A 4MWAA 2ZWZA 3M0MA 3T44A 4LS1A 1OADA 1TPVA 4G7EB 3AUJA 4ZOEA 1PIFA 4AD0A 3SUSA 2A7RA 5HQEA 3VIKA 3TDFA 1WKDA 1L6WA 2ADAA 1NP2A 3URAA 3C3NA 1GVEA 3WNNA 2V5CA 5EPDA 3HJZA 4FEZA 1BXNA 3C56A 1FWNA 2BHUA 4JTKA 4ZQPA 1PZ0A 1CDGA 4PA8A 3DHUA 2H3BA 1W5OA 3B05A 2J6XA 5H8PA 3W2KA 2DORA 1LQAA 2ZRZA 4IMDA 1JZ8A 4LVFA 4DPQA 3NIYA 1HGYA 1J5SA 4CD5A 1JYNA 4C5YA 5JIPA 2VCAA 3A4AA 2RUSA 1GONA 4J2MA 3Q94A 3Q2DA 4FB7A 1M3UA 3MUIA 4WDWA 1ONXA 4KIRA 4AD1A 3P67A 3ALFA 3GYCA 4IJCA 4WSHA 1UD4A 1S3HA 5DRCA 1K9TA 2R1PA 2YCKX 1TJPA 5C7HA 1QO2A 2Y24A 2YX0A 3FA4A 3W1PA 4IQEA 2QJNA 3NZPA 1AW2A 3QV7A 1XSIA 4UFLA 2YZ5A 2HMCA 3A4WA 5BRBA 4XZIA 3W7DA 3S46A 3R1ZA 3EX3A 4LXFA 3AIRA 2V5BA 4NZ1A 4BFAA 1PB0A 2ABAA 3R4IA 3EAUA 2VFGA 2ZICA 2DV0A 1Z32X 3GTNA 3L2LA 4BI7A 3N9KA 2JEPA 5GJMA 4N2YA 2VEMA 1N8FA 4JKLA 4UC5A 8RUCA 3COTA 1VFLA 3BLKA 3H21A 4AQLA 3M7SA 3M0XA 2XSAA 3GAKA 3CT2A 3MI3A 4CLMA 4H83A 1J2BA 3PS7A 4HCDA 3LI0A 3V3WA 1ITQA 3LRLA 1C90A 4YWIA 3HV9A 2ZBTA 1QI2A 3KOFA 1WZKA 1F2JA 1DP0A 4UR8A 1EF3A 4PUKA 4S3KA 1PDYA 3H6OA 2HDJA 3GKAA 2OLSA 4ZSUA 4JTUA 3BAWA 2GJXA 3NQ7A 3WLKX 3OVPA 3VC6A 3W7OA 2ZUTA 4U2YA 3MZ2A 1THFD 3ZJ6A 4F2UA 1S2WA 2OR2A 3KOWA 4AHPA 3IK4A 4TOQA 1M7OA 2HNEA 5ABFB 5E6ZA 4GUGA 2JALA 2QKFA 4FF7A 3N12A 4AZ5A 4C6NA 1OSEA 4R9OA 4MB1A 3W28A 3W72A 4IICA 2V82A 1Q5MA 5FF2A 2OT0A 4ERIA 3W7GA 1OCNA 1GJPA 1T8XA 1YNQA 5HPCA 5J04A 3YPIA 4O1EA 1SMAA 3VOGA 4GIRA 4AY8A 1A5AA 2F7FA 3GQYA 2XN1A 1HW6A 2ZC1A 4E5TA 4NUWA 4PMNA 2DVTA 3GTHA 4QX4A 3HU7A 3KTSA 2BASA 2I17A 2PC8A 1EJRC 3NGJA 2E6YA 3KOXA 3EMCA 2ISFA 5A5WA 4MJ2A 4K1WA 4AZBA 1JR1A 1UIOA 1TJ2A 1IR1A 3P80A 2PCEA 3G6LA 2J8FA 3BLPX 5CZKA 3E2SA 3U4FA 3WYZA 5FEPA 4GMEA 2WVVA 1W1YA 3RX2A 3R0DA 4S3GA 1RK6A 2FJUB 3FNDA 3GUWA 3PBVA 4IGMA 1VFMA 4QNEA 3TAOA 1OEPA 4C1KA 3MI2A 3TROA 2XH0A 4ZXOA 1MXGA 3DENA 1HNYA 1V6VA 4B3LA 4XX6A 3T4CA 3VYLA 2J13A 4AIEA 3CZEA 4PUJA 1WDRA 2VFHA 3LBMA 1VHCA 4W88A 4R33A 4XZLX 3T0BA 5FACA 3GDBA 3E2RA 1PL9A 2CLMA 3MS8A 1P1XA 3M7WA 2FB3A 4PEEA 5AHFA 1XDLA 1XYLA 1MI3A 3NPWA 3VI2A 5CC5A 1QW7A 2EGZA 4ALDA 1FDYA 4R7JA 3W26A 1A3HA 4ORIA 3AIBA 5LA0A 3MUCA 2OO0A 1GYNA 2WKGA 3EOUA 4F40A 2CPUA 1G6CA 3TCSA 3PPFA 1HKKA 1JFXA 1SFTA 2XVGA 2X2GA 1RLDA 3TAKA 3HF3A 3W1XA 2VD9A 1P0KA 4D8ZA 4C1LA 4DF0A 1XD1A 1ICQA 2HVOA 1XLBA 1A49A 2DJXA 4OWGA 2OLAA 4ML4A 4BQ3A 1VBHA 2PD5A 5M03A 4AX6A 2F6KA 1QK2A 2I5QA 2HE5A 4G2DA 1T40A 3EOLA 3MY9A 2CLIA 3QRHA 1T99A 3W07A 4G7FA 2NVDA 1YRRA 4JTCA 2CZDA 1C7SA 4ZB5A 1KW1A 3INPA 4C6OA 4GX9A 4WY0B 5CPMA 4WUIA 4MAZA 3DU0A 2DZAA 2FH6A 5IOBA 2QJMA 2NX3A 3P6LA 4H04A 1W32A 2A85A 2CETA 3VOJA 4JTRA 3FYOA 1FWHC 3XISA 4L61A 3N2XA 5DXXA 1GQIA 2PCQA 3W7LA 3DI1A 4M6VA 1UR3M 4GIAA 1Z41A 3UWQA 1ISZA 2JBMA 5E5CA 3W1RA 3DIPA 4QEHA 2YFNA 2ZRUA 5DMMA 1OC6A 1ISVA 4N9EA 1X8FA 3I4EA 4MTVA 1EWEA 2VEKA 2BY0A 3ID7A 1Q6OA 1MFUA 2D2HA 1G67A 2OYMA 5D04C 4L4PA 1YE4A 4O1BA 1EPVA 2EG8A 2Q8ZA 3VKDA 2I9UA 4O1CA 3M5YA 3LPPA 4GABA 3W1MA 2IPGA 4AX7A 1YDOA 5I00A 4KMQA 1WZMA 3B40A 4IUGA 1L2UA 1OZQA 4IG2B 2ZXBA 3NL2A 5D2YA 1UZDA 4QR6A 1HN1A 2P1FA 2FMNA 1CGTA 4B2DA 5I24A 4RPPA 4OQVA 3K4WA 4N42A 4GI8A 2Z7KA 3TNOA 1BGGA 1NH6A 3H53A 2V0TA 1DKWA 1HIZA 3BURA 4IIBA 1W3JA 1EHNA 2E25A 1FQ0A 1GEQA 2R82A 1S2CA 4DYJA 3RRAA 4BR1A 3G18A 1ISWA 2CLKA 3ZS4A 1EOMA 3A21A 2Y1HA 1EJWC 3N6JA 4QROA 3MSGA 3MBFA 2WMHA 3FFSA 5LGXA 4GKLA 1VFUA 3UJRA 2OYLA 2YA1A 3LHVA 4L9ZA 4MZYA 1DXIA 1QO5A 2V69A 2PLCA 1Q13A 4F4RA 3O6DA 5K3VA 4J40A 1AQ0A 3DZ1A 4DUWA 1TWSA 3IJ9A 2AAMA 1LLZA 1RBOB 8CGTA 2J75A 5FJRA 4IMFA 4JCMA 3PN8A 2GL5A 3V36A 1OFDA 2HCVA 3WNPA 4ZZ9A 5KMYA 3DDMA 4KH2A 3UPMA 1F3XA 1OT2A 3VIIA 1HKWA 4W8AA 5DY3A 3UZWA 2Y8UA 1B31A 4UNIA 4MGGA 1MNZA 4AZCA 4C6IA 4EXAA 1R9XA 1QI0A 1PVNA 1ZP3A 5HWMA 4X9SA 4EXQA 1QFEA 4FNTA 1XDMA 4KT2A 1OX6A 6XIAA 5CLWA 3H2MA 3RHGA 3CB8A 4HPHA 2VFDA 3B04A 3LCLA 1V3MA 3M47A 4HOZA 3N2CA 1AODA 1A5UA 1M03A 3GD6A 1UASA 5L6UA 1JDAA 1PUDA 3AHYA 3CL8A 3WH5A 1TA3A 4PFHA 3OZMA 3NVDA 3TV8A 1NOFA 3MP3A 3PBUA 1K6WA 1ITUA 3TTSA 1E0TA 4OU1A 1Q2SA 1NFGA 3CLWA 3PFRA 2QEZA 4GIYA 4L4MA 3FN9A 4M24A 3VVGA 4L9YA 2YBVA 4IHCA 1BSLA 1WAWA 1SZGA 2FFIA 2GUBA 3M0JA 2HE8A 2D3LA 3SCUA 5E0FA 2IQ0A 1PHWA 4QSFA 4XD3A 3AHZA 6XIMA 4G8TA 4B2DD 3PC0A 1M68A 1Y65A 4RCXA 1TPH1 4V27A 2BGSA 3VMPA 4R34A 4QEEA 1NWTA 4ZB0A 4DO5A 1TPC1 1WX0A 3KVMA 1UHVA 2BVDA 2OX1A 5IM51 2P10A 3IVTA 1FHLA 3CPUA 3L4ZA 2VRJA 4J3SA 2ZA1A 4H4IA 2NLIA 1RK5A 1OYCA 1GQNA 3N18A 1KV8A 1UUOA 5A8MA 3VKAA 4LF2A 1CGUA 2VHLA 4ATWA 2EPLX 5HPOA 5CC7A 1IR2A 1JZ5A 4HMNA 2J66A 2QMKA 1QPNA 3KZPA 4XG1A 4Y9OA 2JGQA 4O0KA 1VPXA 1HO4A 1T5AA 3D46A 5LYRA 4S1FA 4AD2A 1H7WA 3IJ6A 1S1RA 1NAL1 1XYCA 3IS4A 3VGDA 1EDTA 1LRQA 2HROA 2Z4GA 1F8IA 4NJJA 2JIEA 4MWAC 2BG5A 4LV4A 3DN5A 2DZWA 3IIPA 7REQB 4I6KA 4XZWA 4H00A 1XLMA 3DAQA 1HZYA 3IJQA 1TREA 4L4LA 2WWCA 3S5SA 3QPEA 1F9CA 2ZX8A 3OG3A 3CT7A 5CC3A 1S38A 1YTKA 4P7LA 3G0SA 4FX7A 1CNVA 3AIQA 4ROQA 2P0IA 1VC4A 1KRMA 1J5TA 3GIQA 4FPSA 2P53A 2R8WA 5KZEA 4GD0A 3A3HA 3NXFA 3S1XA 4NAEA 4U4MA 1E6RA 1WKEA 4XB3A 1FWFC 3GR4A 1AW1A 4GNKB 1EFZA 2BVTA 3Q65A 5CZSA 4J3WA 3U48A 2FGLA 1G4TA 2ZXDA 4NI3A 1SFJA 4PR4A 3KP0A 1AW5A 2ODOA 3LSCA 4BF7A 1HFBA 2YL8A 3FAWA 2EPMX 1O66A 2A3CA 4XZMX 4GACA 1FCBA 2Y89A 1OYAA 3ZOAA 1V8EA 5B7YA 2VNCA 4B4HA 4MMWA 5AVHA 5FA5A 3WLRA 1ME8A 4TV6A 5U7SA 3CS2A 4ZQRA 3TTYA 1TV8A 1PS9A 1DJIA 4US6A 4A21A 4HU4A 3AU2A 3UBPC 3ERPA 4AVOA 2I16A 3PK7A 3B03A 4GYJA 4HT3A 4YYFA 3WQGA 2DSUA 2OX4A 3UG5A 5EU9A 2PWEA 3IEBA 4LB3A 2QUTA 2PGRA 1F05A 3B4YA 2XIJA 4CVUA 1AH3A 3EPMA 3F4CA 3MQTA 3HOJA 4KFPA 5CGQA 2H9AB 1E1CB 3WMCA 3AC0A 4GINA 3B8UA 3DFOA 3UEQA 5A8PA 1QBAA 4J1OA 3IGHX 1EO7A 5AYYA 3A6OA 1JULA 4MYXA 1R2TA 4U2ZA 5I09A 4GQQA 1UH2A 1CWYA 1JF6A 5HWNA 1YQ2A 3PTMA 5C2CA 1REQB 2XIMA 1LOSA 1EP2A 1E1EA 5IDZA 5HAOA 3WQDA 3L0KA 4DWSB 3IGUA 4O28A 3KL0A 1QBBA 4DZAA 2DPEA 4JEJA 4HKPA 2YB1A 2CKSA 3O6CA 5E0CA 2GDQA 5SWUA 3EB3A 1TZ7A 4I7UA 4A8RA 3VK5A 1BVWA 4KWOA 5EL1A 2E5DA 3N2TA 3TXVA 3WY1A 2C19A 3QR1A 4MZ1A 1WUFA 4UTJA 3PM6A 4GUIA 4TR9A 5LIXX 1K70A 2ISWA 2AAAA 2QPXA 5HQLA 4GI9A 1X96A 2TPSA 3BLDA 2ZWYA 4Q4OA 2XWEA 4RW3A 4PC8A 1TV2A 4XWUA 3BQ6A 2YDRA 2QCDB 5HJYA 1YDNA 4P7NA 4CQDA 1RP9A 4U3AA 1JDCA 2F9RA 4HVXA 1LOLA 5HA7A 4DELA 4HNUA 1YHTA 5JBFA 3WF4A 1E6NA 1R2RA 4DX3A 4YIWA 3RIKA 3VZYA 4ZQMA 2R1KA 3KXQA 3FW6A 1S2VA 2R6OA 3SCOA 4E3TA 4DUVA 4KCWA 5JBEA 4FSAA 1JDDA 2OZ8A 3PBYA 4EK7A 4U28A 4I5UA 5DANA 5AOUA 3THUA 2ISDA 1C7TA 3OLGA 2FHBA 2OEJA 1MW0A 4NY2A 1XCWA 3GY1A 3H4GA 2ZZ1A 1MUCA 2DIKA 5A69A 5EA9A 2PGWA 2WZHA 4HOWA 2QUNA 3SQSA 2C91A 4JFSA 3SEPA 1FUYA 2DIJA 2WC4A 3CBWA 2OU4A 1NP0A 4HPXA 4TU1A 3LK6A 1E6PA 1Z44A 1OGSA 3RJYA 4E8GA 4G7EA 1Q6LA 5LHEA 4YMZA 3U7VA 3WF3A 2XU2A 3PB0A 1LUCB 4I9AA 2E6FA 1BYAA 4B92A 5E6YA 3TJIA 1JVNA 3DFYA 5I0DA 4NJKA 2F38A 1BD0A 3S5YA 4PTNA 2DDXA 3W1NA 2FZDA 1W1B1 3AI0A 1W3HA 5I3DA 1W3KA 2FGBA 4LW7A 1DWAM 4JCLA 1J96A 4OGZA 3WF2A 2DUZA 3BXWA 2Z25A 2DZSA 1VLWA 2W67A 3GLCA 2WMJA 2WLZA 4FA3A 3I65A 3BMXA 3E12A 4DO4A 3PWIA 2YDSA 1S39A 3LA4A 5D32A 1SVDA 3L4WA 3ISIX 1H5YA 2YW4A 2PP0A 3AS1A 4X3ZA 4BQ2A 1VFTA 3PPCA 5CJ5A 2VELA 2XVNA 1QU4A 3AMDA 4HK5A 5M5DA 2AQWA 3C0JA 3LCGA 3WD0A 5C9UA 2J9XA 1P7TA 3W6YA 1EJSC 1K8YA 3EB2A 4LNYA 4IQDA 1NQKA 5REQB 1B3XA 4ASTA 1V3JA 2QPUA 4JZ5A 1R30A 3VDCA 3WO8A 3QHNA 1V7AA 4LT9A 4GHRA 3FYYA 4F2BA 4MNKA 4YNGA 2BHYA 1UBSA 3WK1A 1ISXA 2HXTA 3TXZA 3P61A 3VD4A 5CLTA 3KL5A 5C6MA 2CHNA 3BSHA 4U33A 5HUOA 1PKNA 3WLNA 1O95A 1HGWA 3BCDA 3CH9A 1B4EA 1BFNA 2XN0A 1C8YA 2X7WA 1OM0A 2B7QA 2FH8A 3HG4A 3GFZA 3WX7A 4W8LA 3NQ2A 1WAUA 4X9YA 2YXXA 4RDZA 4O19A 3KRZA 5D2VA 4KRZA 2XGIA 4HCLA 1P6CA 1E15A 3VCCA 4WDUA 4AWTA 3B9OA 1JPIA 3BLOA 2D24A 1R3SA 4LY4A 2VC6A 3UXIA 3SURA 3CASA 3CUXA 3O15A 1WV2A 3AIVA 3F5KA 1GG0A 3BGGA 3UPBA 1G5AA 4Q33A 5A95A 1V6TA 3QC0A 3VXGA 3VNLA 4ADSA 1U22A 3VNMA 3UP8A 1EDQA 3GH4A 1E5JA 2HS8A 3D47A 5KZ6A 4J27A 2D2OA 3SM0A 2BOGX 1HJUA 4R53A 1WOAA 4DZ5A 2F6UA 1QOXA 1FBAA 4IF2A 4MKSA 3G6MA 3EPOA 2A4AA 2OQHA 2HXUA 2OYKA 5GQBA 1VD6A 4DXVA 3WH8A 5CPTA 2PGFA 5CGTA 1UWUA 3BOLA 2JK2A 1RLCL 3CV6A 3K4AA 3F2DA 3ME3A 3DC0A 1KM0A 1POJA 2VL4A 4ZVJA 1GOKA 4GGHA 4HPGA 1RCXB 1TV7A 1UD8A 4XVDA 1ZLPA 4I9TA 1UR9A 2WO5A 5EMLA 4MLJA 1IXOA 4WIWA 2PI6A 3SRHA 2Y8VA 1TPEA 1FWAC 5ECVA 4FNUA 4H9XA 3CHEA 4LUJA 3DUGA 1WUEA 3WLLA 2PRMA 4MFEA 1ZCCA 2G3FA 2AOSA 1LG2A 1OFOA 1XPYA 3DFNA 4DNMA 3RMEA 3GC2A 3OVRA 3T2PA 1UOKA 4TXEA 3I7QA 5TF0A 1H1ZA 3AXMA 4TMBA 5D09A 1KTNA 1FWDC 1KFCA 1EB3A 3KTXA 3CPRA 1O7AA 1L6SA 3H2CA 1BLIA 3GDRA 3TW7A 3R89A 3RCYA 4LGXA 4Z1YA 3GVVA 4LNCA 2O7QA 4JFWA 1GTEA 5I5RA 5CJMA 4MAVA 3DKLA 3NM1A 1F61A 4A2SA 1XUUA 3WLPA 2V38A 4GJ1A 1B9BA 4C6LA 3B9NA 2X1TA 4AZHA 3LTPA 2ZRVA 2ZTKA 3UY8A 5FJTA 4GVIA 3TFCA 3GR7A 2WVSA 3C4UA 3W1UA 2WCGA 1FX6A 1DV7A 1OZMA 4JHMA 1XIDA 5AKQA 1JYWA 4U10A 3B0UX 3TA9A 4QAWA 1JCTA 1VEOA 1XIIA 1O6IA 4IQLA 4J7RA 1OT1A 2ZRYA 3M5VA 1QHPA 1KFEA 2BGNE 2C1GA 2FPYA 1WB0A 2QUUA 4CD4A 3UCDA 3LHYA 3T0AA 3FJLA 1MW1A 3VGEA 3N4EA 4BEUA 1TPB1 1CX9A 3VMOA 3L2MA 4RNHA 1J79A 2QCLA 3M6DA 3NZ1A 3VFLA 5BW6A 2E4TA 4E2VA 1PTDA 2VXNA 4R5EA 2NQ5A 1XJBA 2CHOA 4WKAA 4NHVA 3VE9A 4MPQA 4WVXA 4LUSB 1B3YA 3HTWA 4H3DA 3FX4A 3P62A 3L4UA 5HXMA 3UU0A 4D6DA 2QW5A 4Q8PA 4KEUA 5H91A 2R1LA 4MJ4A 5ABHA 1A5LC 1QHOA 3IJLA 4Q4KA 1XLKA 1CZ1A 1LLOA 2HTMA 3A24A 1XRVA 5FF3A 1MVYA 2WVTA 3QQWA 1VJZA 2QR6A 4JIPA 4HTBA 2ALRA 1EP3A 3GDTA 5AYXA 1UPMB 2NX1A 2WHMA 4CD7A 2BDQA 1W1ZA 3WBXA 1EYWA 3QMSA 4B16A 4WX2A 7A3HA 4CQBA 1RJRA 3A12A 3VINA 3NQMA 1GKQA 2KAUC 4NVTA 3A3WA 1C93A 3UWZA 1K7EA 1TTPA 3O8AA 5DMLA 1ZY9A 1FA2A 4H9VA 2JE8A 5U4NA 3KBMA 3WQ4A 1GNXA 1JPMA 4IMCA 4RNIA 3BOFA 4Z2JA 1V3IA 3QQ0A 3G8RA 3JRKA 3F4DA 4HBKA 3ONCA 2ANUA 1M04A 3D3AA 5LNUA 1K3UA 2D22A 2DJLA 3WLOA 1IYXA 1N82A 1DQWA 4DN1A 2PDWA 1OABA 3QVQA 2W92A 4JHOA 3CEPA 3QBUA 3B0XA 3T1GA 4JICA 1TELA 1US0A 4OECA 3Q37A 4GVGA 4O0QA 4FAMA 5I07A 2O0TA 1VYRA 3ZLFA 1B0IA 4K68A 2HNHA 1ECEA 4H6EA 4B3KA 3UCCA 1V3KA 3LBCA 3GFYA 4NJGA 3BARA 4RKAA 3GXNA 1R3RA 1VGAA 3W7KA 1PHQA 4WY0F 2PBOA 3IRSA 1QRQA 3LHZA 1U1JA 1ZB5A 3CJPA 1TYGA 3OVGA 4NQ1A 1DOSA 1DQXA 3ZVIA 4AYGA 3ICJA 3IUIA 1XH0A 3IIXA 4F0LA 3SSZA 5D30A 4GI4A 2PD9A 4M19A 4HQVA 3RLVA 4XZBA 1V0MA 4TO8A 3TCEA 4PEKA 3ZO9A 1JRCA 3K30A 1CXIA 3OP2A 4Q8TA 1NDYA 5JH1A 1UPPA 4KPLA 1FH7A 5DCEA 5HNRA 3Q67A 4OKDA 1PIGA 3TQVA 4IJRA 2PWGA 1HJXA 4DBDA 3L5LA 2V67A 3ZYZA 4NSBA 3UESA 2DT2A 3VPLA 1YX1A 3CZGA 1BF2A 3RU6A 2WWDA 2GGEA 2EEXA 4I7WA 1E6QM 1UC4A 4MDPA 4NZ4A 3ZT5A 1XP3A 3E9AA 3T0CA 3ZSTA 1A5MC 4KEMA 4QJ4B 4B5VA 3IWPA 4ES4A 5AHNA 2DH2A 4LJ3A 4JTEA 3HA1A 4C7DA 5CBBA 4IMGA 2Z1XA 3FY1A 2X7VA 3S5ZA 2GQ3A 3OZOA 3B0VC 4JL1A 4UTIA 1HKMA 4H6RA 3B97A 1FH9A 2OQLA 1LQ2A 5MKGB 3SGGA 4ZB2A 1YW1A 4QHRA 1T7LA 3FGCB 1K8CA 2CZ5A 5JMUA 1VBGA 3HQNA 3GG8A 4K7VA 3S47A 3OTRA 3QGVA 4GBUA 2WQPA 3EXSA 2JF6A 3PR2A 3FVDA 4AIUA 3ELFA 1L6YA 3GXMA 3NDZA 1XGDA 1RZMA 1WNOA 3EKGA 3WQ5A 3ARQA 4F66A 1VFHA 5F4XA 3NDYA 3UZ5A 1KLYA 1LLWA 4K6AA 3TYUA 3DH7A 2WJFA 4E38A 3G1AA 1WPCA 3MHFA 2Y5SA 3H7RA 3LLDA 3V7PA 3N73A 4AMAA 1TR1A 1FCVA 2YZRA 3N4AA 4XO6A 4AH7A 2IPWA 3MDUA 3TX9A 5BROA 3EWYA 5LKYA 5A6JA 1TG7A 2PSNA 1LWIA 4P61A 1H0GA 3FOKA 3VIFA 4L65A 1JXJA 3S2LA 5I3HA 4QDMA 3RR4A 2VFFA 1V51A 2ZUNA 2PTDA 4AG0A 3RJXA 1W5PA 2ACUA 3WFAA 1TJ1A 5A6LA 4QGCA 2AGKA 4A3QA 1GOIA 1CPUA 3TA6A 2FLIA 4XUYA 1RJQA 1RUSA 3C2YA 1YADA 4QDWA 1XC4A 2VX4A 3GVRA 3LTYA 3N19B 4PTDA 5TQLA 2XVPA 4PMYA 1E73M 4Q22A 3M16A 1C8QA 4V15A 1ZBCA 1GTHA 2XH2A 5CSSA 4ZE5A 2WVUA 4ACYA 4AD5A 4PSPA 4DAIA 3VIGA 4DJEA 1MEHA 1XIEA 1OFPA 3BOXA 1XIFA 2VYOA 2DT1A 2FFCA 4FZIA 4WLCA 4XKMA 1K7FA 3S9ZA 1GKRA 4JTQA 4A8NA 4BKNA 2PEVA 1QK0A 2HV5A 5DX7A 2YPIA 2DZBA 4N4PA 1B3VA 5EMKA 4QNWA 3N3MA 4UOQA 3VDGA 4G1KA 3S4TA 3MHGA 4I7VA 4XUGA 2PFHA 4BQ5A 2BS9A 2JGYA 1O4UA 3G1VA 3UR7A 3WN6A 1XYMA 4B9YA 2Q09A 3K8KA 3CWNA 2F2HA 2NX9A 3BW2A 1X98A 3MC5A 3E96A 2WKJA 3PNZA 4XAGA 5G1YA 1UR4A 1RCQA 2WZEA 3SFKA 2BGQA 2I5GA 3ITCA 5JU6A 3QYSA 3FJ6A 1ZP4A 4UUIA 3UXDA 1B30A 3CQ0A 1RALA 5HOSA 3UZJA 3I6RA 2NVAA 1Z6KA 2PWUA 2VC5A 2EG7A 2BNJA 1W91A 1SZRA 3NQBA 5AC7A 3HURA 2XZ9A 2NLYA 3SQLA 4L80A 1W3IA 3ABZA 4JQ1A 4O1FA 2H9AA 3DOPA 3GX9A 4PRTA 1E1CA 3L66A 1EGZA 2WPGA 3NCOA 4CUCA 3CM4A 4Z2HA 4JBRA 4AXNA 4K7YA 1ZENA 1OD8A 1PAMA 3AFBA 3BV4A 2AL1A 2OELA 3PANA 1DE6A 8XIMA 1LWHA 2BV9A 1PWLA 3L2IA 5CKSA 3TTEA 5FL0A 5FF4A 2EBNA 4CQ9A 4JX4A 1D3HA 1REQA 3WLHA 3I3EA 2DZTA 5FJIA 2WJZA 4KGLA 4QE5A 1OQFA 1UR0A 1GPWA 1SJDA 1TIMA 1YNYA 3WCZA 3NTYA 4NJIA 1A5KC 3WKZA 1UA7A 1PE1A 2QJHA 1V03A 4YU1A 3GAYA 3BPWA 2X05A 3ARXA 1W8GA 4CU6A 1IE7C 2A79A 2HJPA 4HU3A 2XWDA 4HYVA 4FK9A 1IGSA 3M64A 4S2CA 3ABRA 4X2RA 4J4KA 3CQHA 1YDVA 2FPTA 3BAIA 3W7HA 2NQHA 3V4BA 1O5XA 4IP7A 4LBSA 1XH2A 1FHDA 4GZIA 3GH7A 4IFOA 4ZGYA 1RHCA 4ADUA 5B7ZA 4X61A 2ZE3A 4BJHA 4C6QA 2XIIA 2PLMA 3WLTA 2A3BA 2QCDA 2NXIA 1GYMA 2WM1A 4UNKA 3NOEA 4UMCA 4DJED 2GJPA 3CLMA 5GJPA 1W9BM 3CC1A 3KVLA 5DY2A 4A22A 3QPZA 3W86A 2AKZA 2PWDA 2FVKA