4CO1A

Structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine diphosphate
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
112
structure length
112
Chain Sequence
b'MKLVMAIIKPFKLDEVREALTSLGIQGLTVSEVKGFGRQKGQTEIYRGAEYSVSFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETNTEAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PII-LIKE PROTEIN PZ
molecule tags Signaling protein
publication title Structure and Thermodynamics of Effector Molecule Binding to the Nitrogen Signal Transduction Pii Protein Glnz from Azospirillum Brasilense.
pubmed doi rcsb
total genus 20
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4co1A00
1P1LA 4WK3A 2XBPA 1UKUA 3TA0A 2GNKA 4OZJA 4RWXA 3TA2A 4Y6IA 1V3RA 2NS1B 1NZAA 1HWUA 2E66A 1Q1KA 3O5TB 1J2VA 4USJC 4E98A 2DCLA 4C3KA 1NAQA 2XULA 3M05A 4YB7A 4YB6A 2GW8A 5D4OA 4CO0A 4USHA 1VHFA 3OPKA 3DFEA 1UL3A 3LF0A 4CO3A 5L9NA 2GX8A 5D4NA 4Y65A 1NH7A 2XZWA 5D4LA 5DRKA 3T9ZA 1UMJA 4YB5A 4CNZA 3BZQA 3O8WA 2CZ4A 4C3LA 2O66A 4OZNA 2O67A 1H3DA 4OZLA 2J9EA 4IYQA 1XK8A 1KR4A 1QY7A 4CNYA 1GNKA 4C3MA 1VFJA 1O51A 3NCRA 4WK1A 4CO4A 2V5HG 3CE8A 4ZK7M 4CO2A 1V9OA 3N5BA 3MHYA 3AHPA 2XG8A 3AH6A 5D4PA 1PILA 3L7PA 2RD5C 2J9CA 4RWWA 4CO5A 3X3UA 4D3HA 2NUUG 4AFFA 4RLEA 1V6HA 3GSDA 2J9DA 1UFLA 4CO1A 2NUHA 4R25A 2JJ4D 3NCQA 3NCPA 1O5JA 3TA1A 1OSCA 4NYOA 3AA8A 2ZOMA 3HLUA 2EG2A 1V3SA 3AA9A 2EG1A 2Z0GA 2VD3A 4USIA 5DS7A 2ZFHA 2J9DE 4NYPA 4RX6A 1NH8A 2PIIA 4D3GA
chains in the Genus database with same CATH superfamily
1RTDB 1HD0A 1YRTA 1LW2B 4KC5A 5KFEA 4KV8B 2FGOA 1FFWB 2W9BA 1F9HA 2EK6A 1JLQA 2MSTA 3RBEA 2OPQB 2BVZA 1U09A 5E3PA 2MKSA 2E5LJ 1UVMA 3HHKA 2JLGA 2B5JA 1KP6A 2WVBA 3DGPA 4HDHA 4I2QA 1A6LA 4USUA 2HQCA 4ZOSA 3W9HA 2HHVA 5HMZA 3O5TB 4Z7YA 4DL7A 1W26A 3K8VA 2KZMA 5EX0A 1R3NA 2YPYA 4FVCA 5T7LB 3J7YU 2CPXA 4IDKA 1EKRA 2F7VA 3LGHA 1MNEA 1U1LA 2HGMA 4QYZJ 2RF2B 4FS1A 3K58A 3A12A 2GW8A 3NXZA 4PG4A 3T19A 2AGOA 3DMJB 1RTDA 1HMVB 2DR7A 4I7FA 4B9LA 1S1XB 4YY3F 3JSBA 3UR0A 2HVIA 3I5AA 4PRFA 1JKHA 1NDCA 2VF3A 1REVA 1WKKA 3IG1A 4WP9A 2BQRA 4RW7B 1TKXA 3DKDA 3PKMA 1R6YA 3H5SA 4ZMMA 2XMVA 2VIHA 3R2CJ 4X4TA 5C2GA 3BBFA 3MZIA 3NGSA 3HHNB 1OY8A 3PO4A 2V2ZA 3BSAA 4NCBA 4KKOB 2ABYA 2CWXA 4LR7A 1UVLA 3V81A 1HBUB 3TZWA 4J9VA 3HPOA 2W9CB 3PJXA 2ZHAA 1KSPA 3THPA 2J7WA 4HT5A 1CBKA 4QU7A 4K7QA 1FTRA 1SC3B 3DHWC 3HVWA 4DL0C 4LIWA 4DPUA 2G4BA 2KYZA 1SC4B 1VIXA 3MR6A 5A6PA 1CQNA 5K5MA 3HKZD 4XIUA 3DLKA 4WTYA 1KTVA 1S9EA 3CWJA 3ILLA 3ILOA 3VCDA 2ZOGA 2DO4A 5J2MB 2QLXA 2KFYA 2OMOA 3DLLQ 3ENVA 2HGLA 3PVXA 4PWWA 1VJWA 4DX5A 3TANA 3ENQA 1AA1B 3ITHA 1NSKL 3GJTB 4YFUA 4A8FA 2UXCF 3LP2A 1YVFA 3NRBA 4F25A 4JI2J 3PY8A 2YKMB 4NZ6A 4CH1A 3T6BA 4A8YA 4LSLA 4KGKA 4WU2A 3I9ZA 3PRDA 4OQJA 4WFBQ 2HBRB 1S77D 1SKUB 2YBVA 1LKZA 1G4CA 1PC4A 5H9FK 1QAYA 2F1FA 1URRA 1UJ5A 3X3UA 1BWVA 2XMKA 1GTEA 2B9YA 5D78A 1KEKA 5LJ5Y 2YKPA 1CSJA 1JXVA 1WWHA 4DQPA 2R7XA 2DK2A 4L72B 4TYBA 4B9TA 1S1VA 2HQGA 3BQ1A 4O3RA 3W2WA 1WF1A 3MMAB 2OTLS 4K2JA 4EEYA 1P9YA 3A3OB 4DV5J 3SCLE 2LA6A 3LP2B 4HI1A 3GYXB 4GC7A 1SC6A 1SV5B 2HS4A 4JV0A 2KN4A 4J9OA 1S9GB 4ELVA 2IA6A 5GAGU 1RU2A 3FMWA 4YR3A 4WE1A 2HFZA 3V5RA 1FESA 3BYPA 1S4FA 4HEA9 3VALA 3HSDA 4IFYB 2K06A 4RO0A 4URQU 3SDEB 2ZOMA 2ATLA 2FUG9 2H5JB 2J7UA 2QZ8A 4IRDA 1MWYA 3M2UA 4ZVQB 4DSKA 4B3RJ 3CB4A 4WZMA 5KFLA 2D3UA 3L7OA 1VGYA 1SPBP 1NK9A 2UUBF 3KG1A 3C46A 1QLNA 4QW8A 1X4EA 1SUQA 2CJKA 1UPPA 5CXTA 2FJDB 2EFOA 2R8HA 1C0UB 3MCNA 3N6MA 3PW4A 4RBVA 3SYZA 1EETB 5IV4A 1JIHA 3VWSA 4O0IA 2M88A 2HNDA 1FJEB 1YJ9S 3Q8SB 1T9XA 4RUBA 3R1HA 2HMIA 1FRIA 4LFAJ 5KFFA 1FDDA 4CCHA 3CIMA 2DNGA 4TYAA 4DR1F 2E5HA 3U27A 3M30A 2A18A 3U1NA 2NSBA 1RAFB 4Q45A 1HNXF 3LGMA 3CDWA 4F4YA 2IMWP 5IT0A 2E1AA 2VFRA 1NM2A 4LF5F 2EEYA 2RF2A 1U0SA 3CD6S 3KLFA 2ZBRA 1WOPA 1XQIA 1UTAA 2Q6BA 3QATA 3KJFB 5IT4A 3AT1B 2KH9A 4DX8H 1BY9A 3D6MB 1PJ5A 2X51A 4N76A 5RUBA 4LQ3A 3HHDA 2CNOB 5F8LA 1O6XA 3QGPA 3ET6A 4N77A 2BACA 1UP1A 2KFNA 3VAHA 5BR8F 1FTCA 5HLFB 1DTTA 2V50A 1VQOS 5J2PA 4DL3A 2RDIA 3C3LA 3HHLB 5CABA 2VBYA 5D4NA 5IFMA 1FCAA 4M5JA 4AQYF 2VONA 5ETQA 4LQ9A 2ERRA 1VK3A 3EM1A 3PYFA 2E1CA 1S49A 4DPYA 2B8PA 1VR6A 3DU5A 2G1DA 2DEJA 4O3OA 1WF2A 2IBOA 2HNZB 3ELHA 3IBFB 1J27A 2Y3YA 2L48A 2I2YA 1T11A 2AJ1A 3D28A 1T05A 3BZQA 4A8WA 1AYEA 2BJ7A 4L74A 5A8WA 5KFNA 1VBXA 2Z2ZA 4C8LA 3MXHP 4IR1A 1S1XA 2IJNA 3MEEA 4DMZA 2BE2A 2ZDOA 2CKWA 2OFHX 4GKKJ 5DG7A 1KOOA 5M2UA 1Z4UA 5B0FA 3WHIA 2GMJA 4A8XA 5F9LA 3QAEA 2MQQA 1PJ7A 3KLHB 2W2MP 3CUNA 2J9EA 3MD1A 1NJIT 2KG1A 2UXBF 1YSJA 1LWFB 4ED4A 4NXMF 1U4BA 4C3MA 4LF7F 3CJQA 2WONB 1EP4B 1S1WB 5KG5A 2FC9A 3NCRA 1WACA 1NSAA 4DWIA 2BJEA 4NRTA 3Q8YA 2YNHA 5HJYA 1XR5A 1S1VB 3I96A 1CC7A 4P2SA 3PIOQ 1ELOA 4KGXB 3KK3B 4JI1F 1KFSA 4J91A 5EHHA 1Q5VA 2HIQA 3OTBA 4EZ6A 1FWPA 2R2RA 3C15B 2W25A 3M9MB 4JI6J 3J81U 3OUYA 2I5JA 1F9EB 2W7OA 3UE2A 2DR8A 2JSXA 2HVZA 3LQVA 5AXNA 2VBZA 1T9TA 3GWCA 4NA2A 4WE1B 3VF0B 1WC6A 3H7HB 3GV5B 4NXNJ 1EKSA 1VHIA 4DR5F 2FLNA 5CYQB 4ILLA 2BJ8A 3BQ0A 1F60B 2DKOB 1VQ5S 2BQUA 1UCNA 2AW0A 2YQ0A 4LF1A 4EFAC 4DF8A 3CC4S 4W92B 2RSQA 5GAHU 4ICLB 5JXSA 4ZJLA 1BGXT 3TVYA 2EKNA 2C3YA 5T41A 5KFDA 3R1LA 2NZCA 4P2XA 1MU2B 1YJVA 2GMLA 2ROEA 2V34A 1NB2A 3LH2S 3DCAA 3WX4A 2RKIB 5M2PA 5KFSA 1MLAA 5KFHA 4JI3J 4C4WA 3V4MA 2HFSA 4P7TA 4J37A 5J2QA 1WNEA 1RADB 4DSJA 2KZZA 5ETRA 4ED7A 1NSPA 4C7QA 2WB4A 2HNYA 3CD0A 4WKYA 3MM7A 2YX7A 3B4MA 3QT6A 5GVQA 2AWZA 3UD3P 4JV1A 4J9UE 5THWA 1HPZA 1GMUA 2Z2YB 2NPIA 3MFIA 5CA5A 2KXFA 3G6XA 4H4KC 2LA4A 2HFUA 1SH2A 3O44A 3MUMP 5E3RA 4PWDA 1K0TA 2KI2A 3DLGB 3N79A 3AODA 1X9SA 3BF4A 1G7CB 1VLYA 4LRAA 1UKUA 3ZO7A 1TKZA 1Q8BA 3IS9B 3ZTQA 2DPJA 4MK9A 2V9WA 3RRKA 3WIUA 4OYOA 2V6AA 4DS4A 2C2OB 2RS8A 2PT0A 2N7YA 2RB7A 3M8WA 4Y6IA 1KVKA 2HWTA 3ZZZA 3QZ8A 3GFZA 1XMQJ 2C2RA 4B3SJ 2PMZD 3KUEA 4PQUA 3MUVP 2GIRA 4ZN1A 4R5PB 3CJRA 3KXDA 2UVVA 2ZD1B 3HF5A 2MGZB 5GAHI 3NNCA 4C2MA 2BRLA 1T94A 3IAM9 1F5AA 5KFYA 2Z2LA 3Q8RB 1QJHA 1WEZA 3DLGA 2EW9A 4ZP9A 2ZBIA 2EFVA 4CO0A 4CLZA 2CG4A 5HMYA 4QIFA 3L3CA 1UL3A 3P8BB 2AEJA 5KFRA 3I6PA 4UQGA 4UTGA 2NR0A 2MSSA 3I5BA 1YRUA 2F40A 2R7OA 5HQ8A 3MM5A 4USKA 1NJXA 3V2UC 2KJVA 3KK2B 3Q22A 4ZCMA 5D4LA 2UXDF 1URNA 4ZVSB 2YNIB 2YPZA 1RE1B 1QVFR 2GO8A 3EDRB 3GMGA 4JYAF 4K0KJ 3TZZA 1N5YA 3M32B 1JWWA 3TEHB 1FKPB 2BKNA 4OYBA 5LMUF 3OQ2A 4ZKAA 1SH0A 2HVEA 2WVDA 3NLCA 2H4YB 3HSZA 3PJ9A 2FTRA 4CLSA 4QQBA 3BQ2A 1FJGF 1M90T 2IM2A 5A2QU 2X3DA 1NDLA 2V4JA 2VH7A 2XWXA 1RUSA 2JOQA 1CG2A 2BANA 4I0WA 4K4TA 5HI7A 3V4IB 3QJLA 4LT6A 5E3CA 3CCVS 1GNKA 4U8VA 2MZ1A 1JLEB 2LQ9A 3GQCA 2KT5A 2VV5A 3OXLA 4P2MA 4L3NA 2W4DA 2GHPA 4WFXA 5EX3A 1S57A 2G2ZA 5LM7E 5KFZA 3ZTSA 4CZCA 2FHMA 2LU2A 4ZPCA 4ZCIA 4G3IA 1UAWA 1VC0A 1B0PA 2MKHA 2VUGA 4X66F 1CJKB 1LWEB 3LGNA 3CCJS 3IRXB 3MI7X 4N8OA 3JXOA 1L3UA 4LF6J 2F3JA 4JI5J 5LOQA 1RCXB 2ZHBA 4DX6A 3CGIA 4GVLA 4LFCF 1JXEA 3EGWB 3V6JA 2LQJA 4NRUA 3LPEA 1UFLA 1RLCL 2PO4A 3N01A 1HBMA 4OJ3A 5CD4A 3KDNA 2ZUAA 5DLGA 1AROP 4KBIA 2B6AA 2ACYA 4Y2CA 2V8DA 5KT3A 4H4OA 3JSYA 2E29A 3G86A 1DTQA 1BQXA 1PG5B 2COLA 3TVZA 4X65F 4DFKA 2K8GA 3KTQA 2VOPA 2GGPB 4DU7A 1FRLA 1RBAA 5AXKA 1UJ4A 3FFIA 3L09A 4TU7A 3NWRA 2EI5A 3IAS9 5HQLA 4JI0J 2WW8A 1WTBA 4DZ6A 3FRYA 4O4GB 2QTWA 3IBCB 2ZZTA 3OSNA 2FLPA 1RCOB 4USIA 5J1EB 1L5UA 1LOUA 2XZDB 2ZFHA 1AZSA 4N5SA 3W3SA 2A0FB 2YKMA 5G4DA 4UOHA 2N3OA 2PA3A 4N56A 2W7AA 3KHHA 2ZH6A 1NH8A 4MIWA 5CAAA 1FVSA 3UVJA 2CJAA 2M70A 2MJUA 4NMXA 3PIPQ 4KB7A 3VQSA 3Q24A 5C25B 1E6VA 4JV5F 3HULA 4K4VA 5LXRA 3HVTB 3K89A 1N54B 2LQBA 1G3OA 3EICA 2YWKA 3D66A 4WFAQ 2Y0SD 3D68A 1ZYQA 3EDQB 3AOAA 3JQJA 2LQ8A 3OT9A 4J90A 3G96A 4OYZA 5B0AA 4OYPA 3MCOA 4C8KA 5C24B 1D8YA 2QG9B 2FHOB 3SMZA 4K8RA 1RT7A 4BS2A 3AB2B 2C2KB 1XNQJ 4LSZB 2JDJA 3BN4A 3IM9A 3NKYA 3L4BC 2VC0A 4OI2A 1SV5A 5HMWA 3H25A 5K8OA 2RVJA 3TVKA 5KFQA 4X62F 3DRXA 5D0EA 3WC0A 3LP1A 2BRKA 1RHJB 2CNLB 1WOOA 4OJ1A 3TZYA 3MOZA 1T9VA 1R89A 4MT1A 3UR3C 3KK2A 1VQMS 4C48A 3R7NB 5IM0B 4MK7A 1U24A 2FHJA 3GCWP 4DBQA 2F4VJ 1HNVB 1R7IA 2MLZA 3IP0A 4I68A 2AJ2A 2W4CA 4FBUA 1SKSA 3DFEA 2ROPA 1IBKF 4KJIA 2V0NA 2LEBA 3CXCR 5DZ6A 2M8HA 2ZVSA 4JI8F 5ETTA 3TUPA 2VPWB 4QYRA 3D1HA 3FKBA 3BGUA 1T3OA 4A46A 4U6PA 4YB1P 1EETA 1NH7A 2RILA 3DNCA 3P45B 4M63A 2E7WA 4OFZA 3T9ZA 5KOXA 2KRBA 4F0MA 2MGZA 4NZ7A 1M5VC 1VQ7S 1H6KX 3C6UA 4P73A 3R7BB 2VA2A 3FMBA 1U6FA 4QIEA 1LWCA 4YQWA 2HZVA 2EFNA 1GMVA 2CPHA 1PYOB 1N6QB 1S9GA 3ET6B 4NLWA 3UDLA 5A0YB 2ZJPQ 1S1TA 4OJGA 1C4AA 5HBMA 3DLHA 3S1TA 4PZVA 2CG8A 4OZLA 2DGTA 1XK8A 4KFBB 5FD1A 1QY7A 1C1CB 1S7IA 2DD8S 4ZHRA 4QBUA 1D0EA 4JV5J 4X4RA 2XCPA 3S01A 4EUVA 4ZK7M 1O0PA 1T8EA 1P6TA 1VQ4S 3EJMA 2ZVIA 1DAXA 3W5XA 1HKAA 3AH6A 1N56A 1PILA 2DH7A 2IHR1 2MLYA 3NBPA 5A8RB 1M5HA 4B02A 4RWWA 7AT1B 2Y8WA 3QNWB 1DHMA 5F8MA 4TQRA 4EU0A 3RR7A 4MKYA 2BANB 2DGXA 2EBGA 1NO8A 3MEEB 2UV8G 1IQZA 1SCJB 2C2DA 2R7QA 2BOPA 2XI3A 3M8RA 2FVQA 3HMJG 1I51B 2CQ2A 2IDLA 2QLWA 4R25A 3EZUA 1M1GA 1AFIA 4ZHRB 4X65J 4OX7A 1R43A 2HLTA 2CQBA 1HARA 2FHKA 4YR0A 1OSCA 1FDAA 2XCAA 1YKWA 4DR4F 2V63A 2R2TA 1K44A 2Q3PA 1TKTA 4OYMA 2D9OA 2QC3A 1B70B 3A8EA 4W98A 2RJZA 3OJUA 1CS4A 2FPHX 3G71S 1SJ3P 1S0OA 3I31A 2F63A 3M2VB 1WTFA 4QU6A 4HVZA 1OWXA 2B43A 5C25A 5KT6A 1SL1A 2I5JB 1RWUA 1HI0P 2R7RA 1RISA 3QLHA 1V3ZA 3RB3A 2AHOB 5LMNJ 3OVBA 3DRPB 1C4CA 5C5JA 1SQEA 2MJNA 1WORA 1TKXB 2VG7A 1Q78A 2CYYA 2R8GA 1IUJA 3DRRA 2MTLA 1LK5A 3DLBA 4UT4A 3V6KA 2OFGX 2OPPA 2QL7B 1F2HA 1ZM9A 2AYGA 2DH8A 4LFBF 3FC9A 2FHJD 1RHUB 4ZIVA 2RRBA 3PX0A 2GIQA 3J80Y 3GE9A 5JVGQ 4DL2A 3U1MA 4USWA 3E51A 4ES3A 2FJWA 2WZ1A 2HAFA 1TR0A 4NYZA 2L41A 3R3TA 3N6LA 1N8RT 1N32F 1W7WA 4FNHA 4X4VA 4MJKA 2ZH8A 3GFHA 2IM3A 4PG8A 4ES1A 1T02A 5B7WA 4RNNA 4ECVA 4ECWA 4DSLA 5GMKa 1EARA 1ZZFA 3I0RB 4ZCKA 3FUYA 4Y34A 3D0IE 4KT0C 1BE4A 3ITHB 1U6ZA 3GV8B 2YNFB 4MH8A 5BYSA 5IWAF 4QIGA 1EB0A 4DR2F 2ILZA 3LP0B 4R0JA 2MPUA 2JVRA 1NAQA 3DLKB 4WWSA 5CQGA 1EJ7L 5B0CA 2P6SA 2OPRB 3GZ7A 5D4OA 4ILMA 4HTIA 4M5KA 2YVSA 3HKWA 4B08A 4DR6F 1DQ8A 1X5SA 2CQ0A 5L38A 4KTQA 3MM7B 1FRXA 1FKOA 1E6VB 2GJ2A 1FEEA 4FKXA 1CLFA 1S6UA 2BM0A 1S59A 2KXNB 2VJUA 2XY5A 1WD6A 3N4WA 1WSVA 2XYPB 3W2WB 5DRKA 2FVCA 4ECSA 1Y0HA 1ZAWA 1ZPWX 1S0NA 1BLUA 4ITSA 4DN9A 1IBKJ 1GX5A 4PQUB 1JNRB 5DDQC 3BYRA 4QR2A 3JYTA 4DR6J 2BKOA 3N5FA 3OFEA 1RTZA 3M8QB 4I6AA 2CZ9A 5K8PA 1VMBA 5EWEA 3BDPA 4CIOA 1ZPVA 3PNIA 3OTCA 4J9RA 3DRSA 3FEZA 3H42A 4O4RA 2V8HA 5HP1A 2J5AA 3NGTA 4KSEB 1SUQB 1R27B 1P27B 2NCKL 2E1MC 3C6UB 4ETXA 4RU2A 2A3JA 2J0WA 3N0VA 1IKWA 4FYXB 1QAJA 2RU9A 4QWBA 4GKKF 5KFAA 1F6TA 3BO4A 4ECTA 2W2PP 2OPSB 2CPYA 3KHGA 3I87A 4OX6A 2XM3A 2KO1A 5HO4A 2P9CA 3D1OA 4G6VB 1HI1A 4CO5A 3NOGA 2IDEA 1MMDA 3CJ3A 2XSJA 3MEGB 4D3HA 4Q7AA 3UNYA 2R8IA 1J5OA 3TUZC 1QAIA 4IFVA 2HNZA 2HGNA 1H2TZ 4NLYA 4QIWD 4Y2IA 2PI4A 1C0TB 4CO1A 4IH7A 2IRUA 2WCXA 3KG4A 3T5HA 4PYDA 3DOMB 1FWLA 5HBMB 5LMNF 3LW5C 9ATCB 2FLLA 4PEOA 4IH5A 1VQ9S 4M5NA 5KFIA 2AJ0A 3QGGA 1W2IA 3PX6A 3BBBA 1X7VA 4F4WA 2B0GA 1NRKA 2ATCB 5KFUA 4M95A 1V5VA 1V3SA 1JLQB 1KLMB 4NLSA 4A48A 2DXFA 5DQGA 1QTMA 4DUYF 2UP1A 3TJ9A 4A8KA 3MPDA 4FPRA 1B64A 2IAJB 3HFZB 4ID8A 5M2RA 1P9QC 2AX1A 2J9DE 3HZGA 5D15A 2KHCA 5J1NA 4DV1J 3CTRA 2IJFA 4A4JA 5FLXY 4JI1J 4X4NA 1REGX 1RWXB 1PYSB 3MM5B 1FA0A 2G13A 1RT4B 3CO9A 5KFTA 2I9SA 3BH6B 3KMQA 1RT5A 4ZVRB 1MW7A 3CMQA 4HHUA 4ZVEA 4F3QA 2RRNA 3I0RA 5G0RA 4BC9A 2MZRA 3KLVA 2GVDA 3GONA 2W8LA 3MECB 2C1EB 2VHGA 3CNQP 2IY5B 1HQEB 1LWXA 1Q16B 4XTTA 2ADCA 1VQNS 1VI7A 1UJ6A 3FFIB 1KQKA 3ZZTA 4NX9A 3T3FA 3DM2B 3QWUA 4RWXA 2BJ9A 2RIJA 2HK3A 2NS1B 2L08A 2VG5A 3OTOJ 4Q0BB 3T6JA 4YOEA 1Q4RA 4V1Ak 3TJAA 4J9LA 1DTQB 3CDAA 3SXLA 2P8IA 3SCKE 3UN2A 1AZSB 4PCQA 3OLBA 2DVIA 3PW5A 5I4MA 2AMCB 1S6PA 2DJWA 3R97A 1FWKA 4YB6A 4S0MA 4YUDA 2WOMA 1U1NA 5HK4A 3NS7B 1X4CA 3F0NA 4PPDA 4Q8EA 2BEFA 1XWLA 3ZNJ1 2CPZA 4F04B 3LF0A 1B99A 5L9NA 5K8NA 3GIJA 2B9EA 3VGVA 3GFYA 2BJ3A 2NYIA 2WB1D 3NS6A 2X7IA 4TY8B 2K2PA 3QT5A 4K4YA 2LEAA 5KG3A 2OAUA 4WXWA 2MKIA 4PUOA 4IUFA 2PD1A 3OUYB 3R27A 1FRKA 1DURA 1K47A 2H54B 1QUPA 3G8TA 3EPGA 1UMJA 1KHWA 2GVZB 3K17A 1J5EJ 2VB6A 2MYFA 4X4SA 4WP3A 1D9FA 4OHWA 2O01C 1F3VA 2V2KA 3ZZOA 1T9YA 1CQMA 3IGNA 4RJVA 2QRRA 2GQCA 3GIMA 4F4AA 2HQDA 4DLGA 1FEHA 3GJSB 3CC2S 4DV4J 1U1MA 1CEZA 1S0MA 7FD1A 1UZHA 4HTJA 1U45A 4OHXA 3HVAA 3I0SA 2Y0BB 2Q79A 2GGPA 2P6TA 3ENWA 3K5PA 3ETMA 3M6VA 3NNAA 3UD5A 1FXRA 3G87A 3QT7A 1WI6A 4P52A 4DR1J 5E41A 3PACA 1SJRA 4OMFG 2XS7A 3C19A 1DARA 3IC1A 4ANDA 2QMXA 3KK1A 2ZH5A 1TK5A 1D9AA 1MU2A 1Q86T 1ZM3A 1RT1B 1K73T 3H40A 5D3GB 1Z2ZA 4NZ0A 4F4KA 3D3BJ 3TR5A 1Q53A 1V9OA 2QA1A 4FYYB 4JOUA 3TQEA 3TW0A 3TX0A 3BKTA 4J9NA 2FYXA 1VC5A 3CJ0A 4RUAA 1VOMA 3M8YA 3BPSP 3RUBL 6FD1A 2XEXA 3M1VA 3OR2B 3D2WA 2R8KA 1S6QA 2OP5A 1LQ9A 4ZVGA 3BO3A 3PJWA 4ZP7A 4RUHA 3AJ1A 1KDNA 1OS5A 2KT2A 4DN0A 2H9ZA 4F0HA 3MURP 3B82A 3EPIA 1YK9A 1JXLA 2C3PA 3HVTA 5A0YA 4ZPVR 1SB6A 3FJ2A 4LSLB 4QOTA 4DZDA 4RNMA 5AJ3J 2UUBJ 1NK7A 3M8QA 2UUWA 1BQNA 2EC2A 4NLVA 2NUHA 2L9NA 4NLGA 3MMCB 1QAXA 2VJVA 2ZH9A 3FBCA 1IKYA 1Y00A 2HHPA 2AU0A 1DQ9A 3QRRA 1UFWA 4R5PA 3LANA 4NE9C 5D3GA 1PBAA 4OJHA 1T9WA 4DV4F 1VIOA 4OHYA 3V6DB 2XYGB 3CCSS 1VBKA 2WAQD 3MEGA 4Q44A 3EZOA 3RGIA 3AA8A 4OX9F 1S6QB 2LQ5A 4IOBA 3K5OA 3QYYA 4ER8A 5K8MA 3HLUA 2VODA 4DG1A 1TTHB 1D8ZA 1EHWA 4CLPA 1HNVA 1RACB 1U2FA 2QL9B 3UI3A 4U7UD 1FHTA 1FFSB 1U7LA 3IA0A 1JLFB 2JZ5A 4H4MA 2RT3A 2DCUB 4HLBA 2ZH4A 5DJBA 3T5LA 1JK9B 4USTA 2WSFC 2D3O1 1YJ7A 2VG6B 1H2UX 1UEVA 2J7KA 1RKIA 4I7FB 1CPZA 4NA1A 2XBPA 4CM0A 2IRXA 4ECUA 5BJRA 3JSMA 2X1BA 3LUYA 3PRVA 2W2OP 1WEXA 5C7PA 5KG0A 4OLPA 2PEHA 2M7SA 4L76A 1FNMA 1LWCB 1S99A 4OZJA 5DDRC 4QWAA 2A1BA 4E2FB 4X4OA 1BWEA 1NZAA 3W8GA 1KWMA 2E1RA 1OJ4A 2RE1A 3A13A 3DRPA 3W61A 4PG6A 2Y1IA 1JLFA 4H4MB 1HNXJ 4OV6A 2HHHF 4GKJF 2DR6A 3T9NA 3NNHA 2GFFA 4TY8A 4Q8FA 2FLOA 2PGCA 1UVJA 4DCPB 3MPUB 1MROB 2C2EA 2HKEA 1FD8A 1JJ2R 1M5KC 2Y1LB 3AXMA 1IBLJ 2JVOA 2C2ZB 2CZVC 4JI7F 2VFVA 1NKBA 4OHVA 3ULHA 5J1EA 1VHFA 2HEKA 3HT3A 4O0NA 1WC1A 1AXQA 2AYBA 5JMNA 2B4PA 2FZGB 1Y5IB 3GB0A 4DV1F 2ZWOA 3DN9A 4FXVA 1LFWA 1RA6A 3IBWA 3UFCX 4UUWA 3Q23A 2HWHA 2LYVA 4DV7J 1H38A 4KH1B 3G6YA 2ZKUA 2AV5A 3HHLC 2D3ZA 3BB5A 3DLEB 4ENOA 2Y8YA 4ZVTB 4PXDA 4ATNA 1FDNA 2WONA 3G2XA 4CNZA 1ZTWA 3NMAA 3R7SB 5IQ6A 4Q43A 3KK1B 1YG0A 3T1AA 2PMHA 4Z7CA 3T1HJ 1UETA 3VV2B 5EGYA 4DLEA 4ECZA 3B4DA 4LBIA 2CAJA 1QVGR 2VFSA 2D7SA 1U25A 1I1GA 2VDHA 3C14A 4YEAA 4Y2MA 2CQ3A 5KAKA 4JI7J 4LF4J 4DR3J 3GV7B 3VHQA 2KM8B 1Q7YT 1HNWJ 4GO7X 3H5UA 2ZWPA 1O51A 2VQEF 2ASJA 2DHXA 3CCTA 1RTIA 3IG1B 4M5LA 2KB2A 5IOLA 4U95A 4CO2A 3VVTA 4F67A 1BQMB 2MY8A 3N5BA 3W66A 4IOCQ 3U1LA 1OO0B 1ZA1B 2GAHC 2DGOA 2YWFA 3PYGA 1QM9A 2XS2A 2VDIA 3PTWA 3LPYA 1KVJA 3CW2C 1K1QA 4AYBD 4CLUA 1AUSL 2QMUB 3E01B 3TAMA 3W64A 3MEDB 1WHYA 1NK8A 3V6DA 2ZH2A 1TL1B 3BGLA 2D41A 3BREA 5KG4A 4CDIA 3MAAA 3IR5B 3UVJB 3FSIA 3AY0A 2EWHA 4FVMA 1O8BA 4ANCA 4DDFA 2F9DA 1TK0A 1XNRF 2YX4A 4OYAA 4UQTA 1FE4A 5DO2A 3I0SB 3QGIA 1R6VA 1O5JA 3NCPA 5IC4B 4JI4J 4MYTA 4CI0B 2BE7D 2R2UA 1XMBA 3UN5A 2AP6A 2QFIA 2ZM6F 1VBZA 3ONQA 3RAMA 2QA2A 2VBWA 5C24A 1RK8A 2GIFA 2XLJA 4B9SA 4RW8B 3KLEA 3L95X 4C97A 4DPXA 4ZDNA 3SI8A 1JMTA 1SH3A 1GMWD 1Q8IA 1RWKB 2EG2A 2UVRA 4V19J 2IVMA 3PCOB 3QJPA 2W8KA 2L3MA 5DS7A 1TUWA 3WDOA 4EI2A 2CJ9A 2NXUA 4F2RA 3FGVA 4NYPA 3V6HA 3SFUA 1N48A 1FJCA 5FIIA 3LAKA 4LR8A 4P2FA 3FEYB 3TP2A 1T03B 2QSFA 3WZ0A 4NXNF 3A4TA 1CJVA 1X8DA 1VK8A 4UY85 4X62J 4ELUA 3ISND 3MPVA 2E7VA 2XO6A 4A8QA 2DNHA 1F5BA 1CJUB 3NEKA 2IRYA 2CQ4A 3MM9B 2X3GA 3PRBA 3UWTA 5IT9U 4ZA1A 1TL7B 3GP9A 2C22A 4DG1B 3OXGA 5IWAJ 3KLEB 4RNHA 5IS2A 2G0JA 2M2BA 1RAJA 2HZCA 2ZNYA 3SQGA 2VKRA 4XO0A 1NK0A 1N6QA 3KUHA 2E9ZA 4W4MA 5CZVA 2DNYA 3AB4B 4IH6A 1FO1A 4OYXA 4EBDA 1UWBA 2OEMA 4WJBA 4LF7J 1HWUA 2JFKA 1XR7A 2HURA 4PR6A 1WC0A 1XERA 1UVIA 5HATA 1N32J 1GTHA 3I5CA 4QJVA 4DV0J 1S9FA 2ROGA 2WRMA 1X0FA 3M05A 4Z2XA 3KG0A 1VRQC 3ISNC 4OZ0A 3VVUA 1TKDA 3IR6B 2BE2B 2RMLA 2DRBA 2DR9A 3UPFA 3CJTA 3NBPB 2XB2D 2HHUA 3UO0A 2FC8A 2VQFJ 5D0HA 4J9MA 4XAKA 1HNIA 4CO3A 3SZ2A 1SKRA 2EC0A 4NEZA 4ZVFA 1Q95G 3M30B 1Q82T 3MR3A 1Q5YA 4PPZA 1M5SA 2HQIA 3VAFA 2JNJA 4Y65A 4ID5A 4ZJQA 3SSSA 2J8SA 4AT1B 4CLWA 2XMAA 1W2BR 1N4LA 2YNHB 1T3NA 1RT4A 2R7VA 2HSEB 2W1BA 1JLEA 4NCGB 2ACMA 3IXQA 4YB5A 5E2QA 5DM7Q 3GCXP 2VPXB 3HD1A 3ETOA 1NU4A 3RBXA 3NP5A 5BR8J 4NLDA 1ZZNA 1I3OB 1TKTB 4BBYA 3HSJA 3VGSA 3MAQA 4Y0FA 5HROA 1BQMA 1IWGA 3I32A 2HLUA 2B8QA 1U0HB 2R7WA 2HHQA 2O67A 1LEOA 3J7YI 2LU1A 2JH3A 2YTCA 2HRTA 1WG4A 2UUCJ 1U2RA 2RHSB 5E3AA 1KTQA 4DXLA 8RUCA 3N6NA 4B3TJ 4ICLA 3T5KA 3PDNA 3SFGA 2VG7B 4ED6A 2AYMA 2JC0A 2GCFA 4DL4A 1Y5LB 2IPOB 3D1QA 4LBPA 4RZRA 3EGZA 4ZITA 3A3PB 2FVPA 5D4PA 1NNDA 4HACB 1JLAB 2CPDA 4KAIA 2RRAA 5J2QB 4O3SA 1FDBA 1RT2B 2MLXA 2ZJQQ 4ECRA 2O1PA 4Y3CA 5KFPA 5D0RA 4LFAF 2QGFB 2NUUG 4WXOA 1YX2A 4NLUA 1IXKA 4WZQA 3W60A 1V6HA 2DISA 2R7TA 5KG6A 1TAUA 1U1PA 4YDDB 2IM1A 3HO1A 3AQPA 2GVZA 2JJ4D 1G2EA 3MM6B 2OHDA 3DHXA 4FYVB 1NMEB 4KO0B 1HYSB 2GQQA 2QYGA 3MDFA 3VQTA 3DOKA 4HHJA 5GADI 3POTB 1R8CA 3BN7A 3QRQA 5DM6Q 4Q0BA 2DYAA 3QAUA 1Q8KA 1RSCA 1NJZA 3RRGA 3JTOA 3I4HX 4I1TA 5AXLA 3W65A 3P5TL 4ZLLA 5KFMA 1PYTA 1TL1A 4I6WA 1RT2A 1WG5A 3FSYA 4EO6A 1NZ8A 3P5BP 3R5AA 5FLXU 2DNLA 2LP4A 2I38A 1OYDA 2MZSA 1HQUA 1RU1A 1IKWB 1VS3A 4RNOA 1RT3A 5LL6d 1RWOB 2DBBA 1Y7PA 2CA9A 1H7XA 1BMQB 2GHVC 4JI8J 3OVSA 1YRXA 1FRJA 4TLQA 2BR0A 3CJKA 3VAJA 2BABA 3SCJE 2F4VF 3OBIA 3UW1A 4XDCA 1BUXA 3DMJA 6FDRA 2DXEA 3Q83A 2OMLA 3AD8C 3M8ZA 2HHSA 1ZETA 4RUCA 2RUGA 2E1PA 2H48B 3DU6A 1RAGB 1S5ZA 4NPOA 4YP3A 3EZ5A 5IM0A 3KWMA 1AUDA 1JB0C 3BGOP 4KR0B 5DZ7A 1X4HA 1S48A 4CP5A 2MKYA 5CYJA 1N88A 2RKIA 3G8SA 2AGPA 5HANA 3H5YA 2WVCA 4PABA 3D5MA 1N33F 2DNMA 3SBMA 4JUZA 3EVMA 2AZ1A 1IKXA 3AJ2A 4U7CA 2I0XA 2HIYA 1TVRA 4NL5A 2FVRA 2ZC4A 4LVOP 3KJQB 4P74A 4WYLA 1IR2A 2D69A 4QWDA 1DRZA 1PKUA 2V67A 2DY9A 4E98A 2I1RA 4C3KA 1HW9A 3SV3A 4CH0S 2J0XA 1DJ0A 1KLMA 3Q89A 4K4XA 2BKPA 4DF4A 2RS2A 3T1YF 3SSRA 1RT7B 1S9EB 5HMXA 4MK8A 5DDOC 2ZBQA 3NGRA 3OVAA 1CJVB 4LRCA 2AGQA 4TLRA 2MQOA 3IGVA 1UFKA 3UDCA 2RU3A 1U8WA 3LP1B 2PEBA 1FT8A 1N0UA 4R8UB 2MB0B 3NAHA 4ZVHA 3MPWA 4HI2A 1XMOF 2IBKA 2DH9A 3OFGA 1IKXB 2XZWA 2Z58B 3QGHA 2B5JB 1TV6A 3TRGA 4WKRA 4JI0F 3RU0A 3WIVA 1FK9A 2HHXA 4W90B 1I5OB 3KHRA 1S1UA 2KFZA 5DETA 1BQNB 2UVWA 4J7CA 1NHVA 1T95A 4LREA 4C11A 2MQ8A 2EXUA 3DM2A 5AE3A 3IWXA 3IR7B 3JSMB 4FF4A 1L3KA 2I8EA 2L9DA 2O66A 4DR5J 1ZTTA 1FKAF 4LIRA 2JEIA 4QPXA 3DI6B 3TQ1A 2OH2A 2NZ4A 3QO9A 5K14A 5L39A 3MMJA 4L6V3 3D6TB 1IKVB 5CD4H 3QPIA 3CCWA 1H2VZ 3M2RB 4JI6F 2MEWA 1RAEB 1T7PA 2IAJA 3RAXA 2QJ3A 4NWBA 1Y10A 2RAQA 4U7UK 1RHQB 3CJ5A 5HL7Q 4Q2LA 3GIRA 1RWWB 2QE5A 2J6UA 1PC5A 4QWCA 3AHPA 2XG8A 4C8NA 4IFYA 3Q8VA 2SXLA 3L7PA 1N0VC 1UVNA 5H9FJ 4UZCA 1FVQA 3M4XA 4I4BA 1NK5A 1N5SA 3BSOA 4NXMJ 3M2UB 3K5NA 2FVSA 2E7XA 3M6WA 1HBNB 3JQKA 4FS2A 2MZQA 4RLEA 2NQPA 4ZP6A 1RWVB 5KFCA 3PW0A 4AXJA 3ZZRA 2Y1RI 4DR7J 1S10A 1PO6A 3NCQA 1WC4A 2Q6CA 1FXLA 1KD1T 3R5DA 5F8HA 1U0HA 4Q5VA 1H72C 1XR6A 4A8OA 4ZLJA 4L73A 3ZZ0A 4F36A 2BX6A 2AD9A 1HLWA 4YN3B 3TEGA 1X5TA 2KYXA 1X9WA 1KONA 3JSRA 2XMJA 2FGCA 4B3TF 2D9PA 1R8AA 1GXLA 1OY9A 5B0BA 3KHLA 4DV2F 1KQSR 5L9XA 2LLZA 5HN0A 5DQIA 4K0KF 2CQCA 4NEYA 1X4GA 1LW0A 3W8PA 1LXJA 3IRXA 4LF2A 2IJRA 3P4UB 3K7RA 4KY3A 4C9DA 4O23A 1GEHA 3HFVA 4OZ5A 1QE1B 1ZM4A 3D3CJ 4DR4J 3NY0A 3SCIE 3DOKB 3JB9k 5IQQA 1RA7A 1X5PA 4B3MJ 4P75A 1QD1A 3ILJA 3KFWX 5A8KB 1U1KA 1OSDA 2HG4A 5HVGA 1HBMB 1MN7A 4HH0A 2HYIB 4X64F 1REVB 4FF1A 4TN2A 3MMBB 1UEUA 4TKTA 1R8HA 3M6XA 2HHTA 2JX2A 4MTPA 2LKZA 2YQ1A 2Y9HA 1FX2A 1PIEA 1ZM2A 3CDEA 4FNIA 3PW7A 2XSFA 4HT7A 3F56A 4BC7A 5CCMA 1SVDA 3EGVA 2CVIA 2VL1A 4MIAA 3RBZA 2ZBPA 4B3SF 3D54A 2JWNA 5CYMB 5B0GA 1DFDA 1U49A 2F8EX 3S8SA 2CWKA 1QE1A 1Q1KA 3O6QA 5ETKA 3WX8A 2H1YA 2BJDA 2XTJP 3EGNA 1TAQA 1JLCB 1OQ3A 2GJIA 3B8HA 3EUNA 4I2PA 4KYZA 3C8YA 3R5BA 4FKYA 3R9LA 1HA1A 1RT3B 4ZVUB 4YB7A 4J9SA 4L3KA 4MYUA 4USVA 1TUVA 3VZIA 4OI6A 1P1TA 1KNZA 3PHTA 1FERA 1N5QA 1LK7A 3CJSA 4WFYA 1NCLA 3RYLA 1M5OC 3AXKA 3EYZA 5I42A 3KNAA 2ASDA 4X84A 5D77A 2CNKB 2D3OR 1UW9A 4RR5A 2BYCA 1B0TA 1EP4A 1FFGB 1RTJA 1S1WA 1TVRB 1NPKA 3D67A 4PYAA 4GMKA 4NI2A 4WBFA 1IQTA 5KFGA 3B54A 3IM8A 5MLCV 4IKAA 3WQPA 3MMCA 2XLKA 1S7HA 1ZS6A 2BM1A 1IKVA 1HFEL 4M5MA 1FKOB 3RW7A 4LJMA 5JUMA 2DTJA 1YJUA 2VU5A 2YQ3A 3PEHA 3MMAA 4NLXA 3PXGa 1NDPA 1SI9A 4KHRA 4B3OB 2LXUA 1Y4ZB 3GSIA 3FCVA 1A7GE 4YR2A 3IFEA 1H3DA 1NDKA 2L9WA 2XSJB 1SL2A 5H9EK 2DNZA 4AUKA 1NLKL 3KJVB 2J8AA 5FJ4A 4KHPF 2ZDPA 1SIZA 2ZEJA 5EWFA 4QW9A 4PXEA 4JI4F 1SQGA 3GYGA 2UUTA 3EVOA 5LXYA 2ZE2B 1XNRJ 2H51B 2EPIA 3QT8A 4ERDA 2GQ2A 5GAEI 5CCLA 1DZ5A 5JVHQ 4M1KA 1AT1B 5HP1B 2NYHA 4H54A 2HZAA 3J80U 1GX6A 1L3TA 2UXCJ 4X2BA 1B4SA 1S1UB 2OKQA 2M52A 4DI6A 8ATCB 2ALYB 4ZS6A 2UXBJ 4NLQA 2KHDA 4I56A 5A2QY 1PSDA 5DLFA 2CNNB 4F4ZA 2BUNA 4JP8A 5I3UA 1N34J 4FF3A 2HS3A 1TUGB 2DNOA 1SJ1A 2FY8A 2YKOA 3T41A 3SEOA 3OL7A 5KFJA 2PI5A 2YNGB 2Y1JA 3DYAA 5K14B 3BSNA 3OR1A 2M4MA 4CYUA 5KFKA 3VAMA 2KM8C 2PMWA 3C14B 3FVYA 3LA0A 5IZHA 5KTQA 2LDIA 3ILIA 5HROB 2EBEA 5G0RB 4HACA 4ED8A 3HSGA 4LF4F 2H3EB 2DNKA 2ZBCA 2CPFA 1RBOB 4RNFA 5F8GA 1C1BB 1K8AT 2OUGA 4G65A 1NK6A 3BO2A 5A8RA 1RTIB 4F4XA 1IM4A 2VD3A 3KUGA 4QIVA 3T1HF 2BV3A 2HHWA 1ZAXA 1X4BA 4DUTA 3QJJA 1U26A 2CDQA 4WIIA 2G9OA 2ZHOA 4RX6A 4Z37A 2W7PA 2E9TA 3NOCA 3FZBA 3ISZA 7FDRA 4F0KA 1RWPB 3OD2A 5EDWA 4DSIA 3ICLA 2BW7A 5HVHA 3HHLA 4KE5A 3BR9A 4K2XA 4P71A 3G9CA 1NHKL 1FX4A 3C6TB 1RHMB 3MAAB 4U67Q 4WK3A 2BZ2A 3TA0A 4OYIA 1U1OA 3CCQS 1WDTA 4OZ2A 4IO9Q 3HT0A 2E5LF 3I55S 4JI5F 2JC1A 2DXDA 1NPRA 2R8JA 1U48A 1KLNA 2LXIA 1RT5B 2F5GA 5J2NA 3L7UA 4F8RA 1HBUA 4XK8C 2OD6A 3FCHA 5ADZA 1BD6A 2CJYB 5F8IA 1J2VA 2GA7A 3QLHB 1GMWA 2B4UA 3D9BA 4J9QA 1TMMA 1GH8A 4RBTA 4FYDA 4GKJJ 1JJHA 4RW9A 3M6UA 4KH0B 1RWMB 3DRRB 5F3ZA 3KLHA 3VAGA 4HR2A 1I94F 4B9UA 1HHTP 1APSA 2N3LA 4O44A 6AT1B 1LW2A 4LMZA 2CFXA 1N36J 3DDKA 3CCUS 3I56S 2KVIA 2VKZG 4IQMA 4HDGA 4E0DA 2RQMA 2XMMA 1JLAA 1TKZB 2H5EA 4YMEA 5GAEU 4B17A 5IT9Y 2CQ1A 3GR1A 4K4SA 5LMUJ 4TVAB 5D6GA 4DQQA 3QMQA 1JLCA 2XZTB 4UZBA 3E3XA 4DV6J 3C16A 2KTQA 3BGRA 4AD6A 4I2QB 4EYIB 4K4UA 5SZTA 3CULA 1RKJA 4BLGA 1WELA 3S7RA 1V5IB 2MQLA 1WDDA 3H90A 3O8WA 4NLOA 3E01A 4I64A 3TAMB 3GPAA 3J81j 1TFYA 4YHHJ 2XNRA 2EFPA 3MM6A 3AFGA 4KO0A 4X4UA 2IMOA 1KQGB 3W63A 3HZEA 1RABB 1QSSA 5I42B 1J5OB 3GU0A 4CLKA 2BMBA 1YZ7A 1FNOA 4RW8A 2XGPA 3RBDA 3M8PA 2V9KA 1Y11A 4WU3A 2HW3A 3FBFA 4IG0B 3W7BA 4RW4B 4LRFA 5IC6B 2KL8A 4RPFA 4CNYA 4DV3J 1FI4A 1T9UA 3QIDA 3MFHA 2PSZA 4DV3F 1X4FA 1IJEB 1SIWB 3OLAA 2W01A 1IR1A 1TL3B 2V2VA 3DOLB 2H4WB 3HX9A 4WK1A 5BYQA 4CO4A 3CDUA 3R6LB 4J9PA 1YJTA 2QN6B 1YBUA 2FQQB 1XMQF 2W9AA 1TK8A 3CJ8A 3JTNA 5F0UA 2OO4A 1KC8T 1FKPA 3MM9A 3W1YC 5AJ3F 1XC9A 1XBWA 5F8NA 1RLDA 4P10A 2XY6A 1RT1A 4JI2F 4LVNP 4K4WA 1M5PC 4K5SA 4NCAA 3GSDA 1G6BA 2K3KA 4DX7A 4DV6F 1KN6A 1FD2A 3CCRS 3K2YA 3PEJA 3A1YG 1HNZF 4CTAA 2ZUGA 1VISA 4AXIA 4FYWB 1RI7A 2QL5B 4RKUC 2IM0A 2K3IA 4NLTA 2Z57B 3F73A 2C2MB 2UV8A 3TWZA 1F9FA 2JHEA 3JS9A 3KJVA 2R9LA 3RR8A 3CF5Q 2MMYA 2B51A 1X5OA 2U1AA 3D6HB 4G1QA 1DY3A 1ZA2B 1H74A 1ZOTA 2B4OA 2DT9A 4LSNB 4P72A 1TELA 5I3PA 4DS5A 3AA9A 3BSCA 1M0SA 2DHHA 1TQLA 5L8RC 2WHOA 4M5DA 2V4QA 2AF6A 2HWIA 1FF2A 3OXFA 1UA1A 1ITPA 3GJQB 2VQEJ 3UCZP 4F3OA 1RBLA 3PV8A 2B3TB 1D1UA 1S0VA 2HBYB 3RZAA 2EVZA 2P9EA 4CH7A 4CTAB 5K9FA 2D74B 2LECA 3LAMA 3W2VB 1CULA 3OTEA 4KPCA 4ZPDA 2RDDA 1J5EF 3DGPB 3H59A 2BJ1A 2RNEA 1RTHA 2QYCA 2K7JA 2LXFA 2V2QA 4P6QA 3THVA 3HJFA 4DFMA 3B6BA 1S72S 4CLYA 2C42A 2DB1A 1BC6A 4O3PA 2IVYA 3O3LA 3OTDA 5T7LA 3NAIA 2EKYA 1IBMF 3QIPB 2HRYA 1EZZB 2YKNB 3BS9A 3CIZA 3SSQA 3CCES 1VQLS 2UUAJ 8AT1B 1FE0A 2HBQB 1XEZA 2MKJA 2POKA 3FK4A 3ZTPA 5KG7A 2ALZA 3MCSA 2HPUA 2VG6A 1KRPA 1NK4A 5KOWA 1K9MT 4YS2A 4FF2A 1KVIA 4RW7A 3W2VA 2V4JB 2HS0A 2XULA 1SXLA 2DGQA 2P5VA 2W9BB 1HHQA 1GQEA 1AB8A 2F4FA 5EWGA 1A0OB 3TARA 3OTOF 3NL0A 1R31A 5E0OA 2CPEA 4CWBA 4GO5X 4MFBA 3UCUP 1ACMB 5ETNA 1ROFA 4CLLA 4WP8A 4DL6A 4J5OA 4ZN3A 3A3NB 3J7A1 4M5HA 3W5YA 4JYAJ 2A10A 3FBEA 3M7VA 2PA8D 3DXSX 3CEDA 5A8KA 2IA0A 5EUHA 5CYMA 2AEFA 4ED5A 2QLFB 5LT5A 1A9NB 1IVZA 4KGVB 1NHUA 1HYSA 3DRYA 1SQFA 2GAGC 3FCWA 3GIKA 2ZJRQ 1SJQA 1K0VA 5J2NB 1IN0A 4KRWA 2DGVA 3K0JA 3EE3A 1WI8A 4U96A 4CLTA 4CT9A 3TZXA 3P49B 3DDIA 2AKWB 1JKHB 2MY7A 1VQPS 1N52B 4GVBA 1I6JA 4OX8A 2UUAF 4DUYJ 4AL6A 1FJ7A 1DTTB 2XLIA 4ZPBA 5KT5A 3GJRB 4ZPTR 1H0HB 2PDAA 3GILA 1KBRA 1P8GA 1KR4A 1WHVA 1GXUA 2AJFE 4IYQA 5A76A 2M9KA 3PKYA 1JX4A 2RQ4A 1IM6A 2BE9B 2WW4A 1MWZA 4KKOA 2XC9A 2DR5A 2V5HG 1VQ6S 4ZVOB 1CJTB 3VAIA 2QIFA 1EX8A 3MHYA 1NSQA 2PN6A 3IMQJ 4LRBA 3BKFA 5SUHA 3WC2A 2QA4G 1CVJA 3DXBA 4I69A 3SIPB 1YJRA 2NXJA 1QDUB 2GZOA 1R0BG 2CQIA 4OLOA 1RT6A 2JL9A 3MM8A 2J0SD 1Y3KA 2DGUA 4C0HA 5B08A 1HWLA 1TFWA 3KDOA 3OL6A 5F3TA 1FNXH 3LO3A 1NUEA 1TL3A 2N4DA 2V69A 3DOLA 5KFXA 2VOOA 5L1JA 3MF5A 2XMUA 1F5CA 2KKHA 2LFVA 1C1CA 4IG0A 5BXIA 3JQMA 2YKQA 2R42A 2Z56B 5CZXA 2C3MA 2PE8A 2JEFA 4QR0A 2W2NP 1ZBTA 4B3RF 2MQNA 2G1HA 1U02A 2HQ3A 4OI3A 2DHGA 4I6YA 1RTHB 5KG1A 3K5MA 5E7OB 3AD9C 2FJBB 3J81Y 1XN9A 1SBRA 2WVFA 3Q2SC 2VICA 4PQAA 1XJWB 3SQOP 3EVWA 2OIHA 5HQMA 4ED1A 3KLFB 1RTJB 4DQIA 4ZPWR 1HBNA 1WHWA 4LSNA 2YWWA 2XMWA 4ZJOA 3EWGA 3PYEA 4AE5A 4ED3A 3D6FB 2A6MA 2W24A 4NLRA 2YH0A 3D7SB 3NS5A 2EFQA 5DDPC 3MUTP 2C3UA 2ZH3A 4GC6A 2VA3A 1ZH5A 1UEKA 2O5DA 2V94A 1EIYB 2APOA 3BM7A 3M2VA 4FDFA 3ZTRA 3E2EA 2NXEA 3ZC4A 5K20B 3OSPA 3FQLA 1VRTA 3G82B 4YHHF 5KFVA 1CULB 4I67A 2Z8QA 4ID5B 4DR2J 1DQAA 2Z2MA 5AE1A 5HSPA 4LFCJ 2QLBB 3AD7C 3GLJA 3PR5B 5L1KA 4DSFA 1QSLA 4DV2J 4OV1A 4WPAA 3ZZUA 3HDSA 2G0IA 3VGTA 3U02A 4DEZA 1D09B 3KLIA 5B0EA 2UVUA 2YKNA 3C6TA 3OPKA 1HI8A 1H98A 1RXOB 4X66J 3MR2A 1OPIA 5A8WB 1B0VA 2XHWA 5LJ3Y 2N82B 1N36F 3QFWA 3CD7A 1RYRA 2OD4A 4FPIA 1MN9A 2JFDA 1RQ0A 4UOGA 3ZTOA 4DR7F 4CT8A 5GAGI 4FZVA 4LUBA 4TQSA 3OV7A 1NKEA 1RHKB 1RWNB 3DDNA 4DQRA 4NA3A 1R0AA 3K5LA 3BEGB 3BKUA 1UA0A 1VC6A 1HR0F 4F2SA 1Q7LB 1RGVA 4U9RA 3TAQA 3P3DA 5ETVA 2DNRA 5F0WA 4LFBJ 3CVKA 2R3VA 1MSWD 1LV5A 4AL5A 4JBCA 3AQOA 3TI0A 2EFGA 2CRLA 3MCMA 4C3LA 2WSEC 1WC5A 2DNPA 1U6BA 2KRRA 2B9WA 4ECQA 4CYUB 3ZZPA 2YWGA 2B6AB 2HAIA 4ELTA 3G6ES 3BJYA 1D3WA 3RB4A 3BBCA 2E44A 2NSCA 3PM9A 2AJQA 3CSKA 4C0OC 1HL6A 2IC3B 3HD2A 1RT6B 3MM8B 4URSA 4OI1A 2JLEA 5ITHA 3CE8A 2DNQA 3IN5A 2LEPA 3ADAC 4PUOB 1F2GA 4MKAA 5D8HB 1YHQS 4F26A 2QEXS 4O44B 1TL5A 1YGYA 1F3FA 1NBEB 2CIMA 2BW2A 1HW8A 2QT7A 2RD5C 1R8BA 2V8VA 2WVEA 2J0QD 3N9UC 3V81B 1F1BB 1X4AA 1ICEB 3G8QA 5C42B 1X60A 4AFFA 3C66A 4C0BA 2IIHA 1OYEA 3GFXA 4ANEA 4OI0A 2C28A 3PZPA 2YWHA 1JJCB 3FEXB 2KDOA 2GJFA 2NXNA 4IR9A 4RW4A 1T03A 2KJWA 2B7CB 5B0DA 1BXNA 1RAHB 4FP9A 2R7SA 2AX0A 4HL9A 5A6WA 4ZLNA 3HHLD 5L1LA 4CLFA 1HWIA 1GT8A 1QUVA 4DPWA 2B56A 3KLGA 3G4SS 1XIQA 4QR1A 4O3NA 2MQPA 3JAMU 1TL7A 2KVQE 4QWEA 2G2YA 3T1YJ 3TO8A 3C2PA 1IR0A 2HFOA 2QO3A 3DLJA 3QRPA 3OHAA 2ZKTA 2NPFA 2W4PA 5KG2A 4J9KA 3FRZA 4DFPA 1CJTA 3OW2R 5LSLA 2EG1A 2DGSA 4YDXA 2HFVA 4LBHA 2EK1A 1U47A 1PGZA 1OPZA 4ILRA 1HMVA 3M9OB 3D0GE 3NGDA 3GR0A 2KG0A 2OPRA 4AL7A 1HWJA 3OHBA 4ZVPB 3AJDA 3DGVA 3HCXA 1N34F 3HI9A 3LOUA 5ETOA 5U47A 2BOAA 3BV8A 5L1IA 1JLBB 2XNQA 3D0HE 2FB0A 1YDLA 3NGKA 4RU9A 2ASYA 1T0TV 1WF0A 1P1LA 2WSCC 4JI3F 4FXWA 2UU9F 2MZJA 2FJXA 3FZ2A 5GMEA 1MWQA 2WBRA 1HNIB 1JNZB 2M0GB 3FDSA 4K5RA 1EQMA 3OL8A 2W9CA 1Q81T 1VQ8S 2UZAA 4KPYA 3CJKB 4K4ZA 2XO7A 3TUIC 3TA2A 2AT1B 2CPIA 3EX7B 2IYIA 1WHXA 1V3RA 3ZXWA 1PBUA 2E66A 4LRDA 4WIQA 3BH7B 4R8UA 1KOHA 1NXIA 4P7VA 1B7YB 2QA4S 4TXSA 2ZITA 3HHEA 4MMOA 4WTOB 4IRKA 3OFFA 2C2NA 3FNNA 2WBMA 3GG1A 3R6GB 1C0UA 4NASA 4DFJA 1SJ4P 4LF8F 4UY8T 5EN1A 4DSEA 1XNQF 2OELA 4C8MA 1Y5NB 3HXMA 4UOCA 5D0GA 2FZCB 4C11B 1R0CB 2M5YA 2C3OA 2GO9A 1CJUA 2GX8A 5HVFA 3TAPA 1LXNA 1RDRA 5E33A 1RAOA 4H4KA 3OFHA 3L9ZA 2AIRB 3EXYA 3MAHA 5ETLA 1YWXA 3IRWP 3K59A 3QBCA 2OEJA 3MOJB 2HK2A 5KT2A 2XMTA 4F02A 2QSWA 4DPOA 2CJBA 3V4IA 2MKKA 4JV2A 1NB7A 2A2CA 2LVWA 1U1RA 2ZNZA 2FJEB 2DHAA 3RAQA 4OHZA 2VFUA 1KS2A 2CZ4A 2KT3A 3OJSA 2NREA 1HQ2A 4IRCA 1C0TA 3OL9A 2B7BB 2CVEA 3H20A 4ECXA 3GG0A 1KHVA 2HFNA 2IYGA 4XDDA 4FXDA 1LWEA 3ENAA 4DUZF 5GMDA 3PFOA 3WBZA 4G1QB 2YNGA 3LWMA 2PC6A 2CXEA 3P6YC 2BQ3A 1IKYB 4RW9B 2FDNA 4IQXA 2E9RX 1HIYA 2NXCA 4DPTA 5ETPA 4AQYJ 2BBEA 1IBMJ 4B3MF 3QSYB 4L75A 2JEJA 3O1LA 5AT1B 5HJXA 2VASA 5I3QA 1C1BA 2BA9A 4NLPA 3QO9B 2AEMA 2XI2A 5HLFA 1NPPA 1Q0NA 4PG7A 2RDJA 4PG5A 2J9CA 4RW6B 3H5XA 5E3QA 2GHWA 3H2VE 1SC1B 2I6WA 4U8YA 5DGAA 1U8SA 3AAWB 1AW0A 3PHEA 3GYNA 2GC8A 3PYDA 3GTYX 3EMTA 2MQMA 3QWPA 2A2DA 2J9DA 4PKDB 4Y00A 2J6TA 5H9EJ 2KU7A 3X1LB 1YBAA 1LNQA 1RJJA 2F8HA 2IC3A 2Z30B 3PFEA 4KHMA 3FBBA 4LF6F 4MAKA 2XS5A 3MR5A 2VC1A 3M9NB 3RRHA 2VQFF 3PW2A 1NJWA 1R8PA 3ZNUA 1GXTA 2OSRA 1IJFB 1M1HA 4NYOA 3TYTA 3W9JA 2K7KA 1X31C 5J2MA 1HR0J 2CUYA 2Z4PA 1N5TA 2XYHB 2RQKA 2BXJA 2DEIA 3MMBA 4M8LA 3G6VA 4RW6A 3CCLS 3CJ2A 4B9MA 4ALZA 4ZIWA 3K8WA 3IWNC 4KGZB 3JAMY 3I82A 4ECYA 3HP6A 2YNFA 2Z0GA 3Q8UA 1E6YA 4Y28C 3US5A 3IWLA 3KKFA 1SJFA 1S6PB 2VPYB 1FJGJ 3LP0A 3NWGA 1IWAA 5LSOA 5DG9A 1RHRB 4URGA 1RP5A 2B4VA 4MKVA 2H5IB 4IDKB 3C16B 3W62A 4WYWA 2ADBA 2FZKB 1YJNS 4BDPA 1YI2S 3J7AN 3J7ZT 1LW0B 3B78A 1H73A 2UXDJ 4KQZA 4WFNQ 4LF8J 3NG8A 3S6EA 4B9NA 1G1XA 2ZH1A 4Q2MA 3UD4P 1L3SA 3LTOA 1Z2LA 2N4CA 2GNKA 4KGMA 4O4GA 4F3MA 4WF9Q 3I9V9 4EBEA 2QLJB 2QV6A 2CQPA 2V8GA 1UPMB 2CQGA 2J76E 3VTIA 1UW4A 2RHQB 1VQSA 3NGUA 1Z1ZA 4A47A 1HBOA 4E8UA 3KLGB 1S76D 3DLEA 1N5VA 1ULRA 2QX0A 1Y3JA 2QMWA 4NMLA 4OZ3A 4ES2A 5IV3A 1TV6B 2XGQA 3RTVA 1FRMA 2F8MA 4CRJA 3R5CA 1GAOA 5GADU 3THTA 1FK9B 1HQUB 3M8SA 4FBTA 2P9GA 3CCMS 3P96A 4PXBA 2LMIA 4USJC 5CH7B 2WTFA 4EK2A 2HRUA 3M8PB 5F41A 1XMOJ 3MGJA 3MPYA 2DIVA 4ED0A 3MTJA 1Q8LA 4USHA 4EO8A 2ZM6J 2F65A 1DLOB 3VR1A 2YXLA 3EXCX 3MTKA 1S4EA 4DCJB 1FXDA 2X1AA 2DIUA 1MG7A 4USMA 5C2CA 2R2SA 4DJBA 3CJ4A 4IO1A 3C15A 5L46A 1YTYA 1HPZB 1PAUB 3BR8A 1WC3A 1U1QA 5LSRA 1QTNB 3PG9A 1SKWA 2DNNA 3KJNB 4F7VA 5IXUA 2FD2A 1YIJS 1K1SA 1WG1A 5HAOA 4PWDB 1VRTB 3G82A 4WFZA 4C98A 1FRHA 2F9JA 3CO0P 3R5GA 4ZPAA 4EZ9A 2ZZNA 3CMAS 3SV4A 4K59A 4MKBA 2V4RA 1UWBB 2VZ9A 4PAAA 2HBZB 5ETSA 4IFVB 3MEDA 3MD3A 4ED2A 1N33J 2YY3A 1XTZA 1PAEX 4OZNA 1DLOA 5CHCB 4UUXA 2ASLA 3SDEA 1IBCB 2CJQA 3DOMA 4G1PA 4X4QA 1RB0A 2RH3A 3UDEA 4UOFA 4DR3F 1PCAA 1VFJA 2ZD1A 3BGFA 4WCEQ 5I3UB 1WUUA 2MHNA 5JJBA 2YH1A 1EQ0A 1OIAA 1WJ9A 3KYLA 4YY3J 2AJ4A 3QFHA 3UN3A 2OLWA 2HQFA 5J2PB 3KLIB 4ZLPA 2VFTA 3AOBA 2OEKA 3MR7A 3A8KA 1Y9OA 3HFKA 4M5DB 1ZAVA 1S1TB 2XWYA 1JJ4A 3TNVA 1U2CA 2P2CB 3TUJC 3CCZA 5MAOA 1MMLA 1TU0B 3HM9A 2MXYA 3CPWR 2Q66A 1CS4B 5KT4A 1T05B 3DC2A 2G2OA 2V68A 3F41A 4UW2A 4DV7F 1YBTA 4XPEA 4Y2KA 2ZC3A 3LWLA 4N7TA 3DI6A 2E5JA 4QZVB 2X1GA 1N5YB 3F44A 1PJ6A 1VQYA 2JRSA 1E6YB 1X4DA 1GFWB 3TA1A 3J7Z5 2XY7A 2QFJA 1HQEA 2M8DB 1F0XA 1IBLF 2AZ3A 3QIPA 2M3DA 1C2PA 4HHHA 3SQGB 2CDRB 2AYEA 3N28A 3HJVA 4N8NA 3UQSA 1NJYA 2Q43A 5KFWA 4IOAQ 1CJKA 2GV1A 4KV8A 3Q8QB 3QQCD 3R5JB 1S97A 1CC8A 3IO1A 2HHHJ 4FN5A 1NEEA 3FQKA 2DRDA 2B9XA 2MZTA 3DYAB 4MFBB 4Y2AA 4DHVA 1X9MA 1SL0A 5ETMA 1RZMA 3TJ8A 1YITS 3OR1B 2YWEA 1OY6A 1RAAB 3O2IA 4EYHB 4I2PB 5E5NA 3JTPA 4CM2A 3GIIA 2ZH7A 1YQHA 1VQKS 2R7UA 2PFFB 3RW6A 2PIIA 2N7CA 4JB8B 5FDLB 2YX1A 1HBOB 1VRUA 2G0CA 2ILYA 4RL1A 5DG8A 1S12A 2FJAB 2UUCF 4LF9F 4HKQA 1JLGA 4RBUA 2CQDA 5J1PA 3Q8PB 2CQHA 3KOAA 3M32A 1TL4A 3POTA 4GVBB 1UVKA 3PX4A 4PXCA 5B09A 3CD5A 4OIXA 1WKJA 4OI4A 1YZ6A 3QZ7A 4ZCLA 3RB6A 2JEGA 4DCOB 3PO5A 3H2LA 4NCGA 1B7FA 4C8OA 1BHNA 2HVDA 2K1RA 3H8YA 2OPPB 4GRSA 4H4OB 4MIBA 1LWFA 3Q86A 1D9DA 1VBYA 1UWAA 2LCWA 4ZP8A 2HVHA 3D4JA 5KT7A 2GMHA 3TX8A 4OYWA 3BGRB 2FY1A 5FDLA 2DCLA 1HWKA 4OX9J 1MMNA 1VCTA 1W25A 2MKCA 3VZHA 2J6SA 2HNYB 4KHPJ 3AOCA 3CMES 4BWMA 1AFJA 2XHCA 4KIAA 4DUZJ 5F9NA 4N47A 1JLGB 1WKLA 2OGUA 4M94A 4NOHA 4QYZK 3MECA 1H7WA 1DBDA 2CPJA 2DHSA 2RUSA 5H1SV 3VGUA 4TU8A 4LF5J 4B3OA 1NKCA 4QCLA 3BDEA 3JYTB 3R2DJ 1LFPA 1OMSA 3K57A 2DGWA 5T14A 5AXMA 2YKAA 4IG3A 3RJMB 5DQHA 3H2UB 5CYQA 2X1FA 1JQGA 2VG5B 2NLWA 4TY9A 3KK3A 4F50A 2K1RB 3RB0A 1OQ6A 1JLBA 4DV0F 1S6OA 3DRSB 1RYSA 2DITA 3RG6A 3R8YA 2WK4A 5BYRA 3CT9A 4XPCA 2VPZB 1WOSA 2KXHA 2VBXA 3UNGC 1TMJA 1VDHA 5DGBA 4ETZA 1EAYC 1RAIB 3A8JA 4BWJA 5KFOA 4HYKA 4M5IA 2FJVA 2WOMB 1KKHA 1HNZJ 2PFDA 3Q2TC 5F8JA 2W2QP 3KNGA 3ZZYA 5C42A 2OPSA 1GK8A 4DQSA 4R0EA 4EGLA 2OJ3A 1VLOA 4LR9A 4G1IA 1S79A 4EWTA 2FIUA 4IG3B 2O3DA 3MEKA 3T5JA 2CJXB 2MHEA 2DO0A 4TU9A 3W5ZA 4UF4A 1KQFB 2RQCA 1VJQA 2V8PA 2LDYA 3H4DA 1WSRA 4NI2B 3FSXA 4DV5F 4A8SA 4DOZA 1HD1A 4EBCA 1HHSA 2DPIA 1YJWS 2R4FA 2E5IA 4M5GA 2E5GA 2GS8A 3UDVA 4CQ1A 3Q0AA 3CC7S 4TNOA 4A8MP 4X64J 5KFBA 2ZOFA 3UCGA 3KMSA 2OSQA 3NMRA 4C6AA 3CDBA 1TZ0A 2YNIA 1VYAA 4HH1A 2HNDB 1Q79A 1X0PA 1M1KT 2UU9J 4B9VA 1B3TA 2IVFB 2HMIB 4P9SA 4EMDA 1QSYA 2CADA 4O3QA 2Q1LA 4QPTA 3MWBA 1L3VA 3A8IA 4KFBA 1YLXA 2U2FA 4BCAA 2IFXA 2OTJS 1KFDA 4C8YA 4OZ1A 1TP7A 3M2RA 1WEYA 3H0PA 3HK2A 3IS9A 3PR4A 2XQCA 4LF9J 3M1VB 3OR2A 2DY1A 3VAKA 2OPQA 2BDPA 3E8OA 2ZE2A 1VRUB 4X4PA 2DRAA 2GVDB 2OI2A 5AE2A 4DL5A 2JLFA 3TOQA 3U7JA 4K50A 4N41A 3QSIA 4PWUA 1MROA 3LALA 3W9IA 1I94J 2AQ4A 9RUBA 2ZZMA 3HVRA 1UZDA 2MDAA 3H4BA 4C8ZA 2H65B 4D3GA 2A6OA 4V19X 3ZFVA 4DU8A 1R0AB 4OL8A 3H98A 3I4PA 2D1CA 3BPDA 4BHQA 1HNWF
chains in the Genus database with same CATH topology
1RTDB 1HD0A 1YRTA 1LW2B 4KC5A 5KFEA 4KV8B 2FGOA 2W9BA 4BS2A 2EK6A 1JLQA 2MSTA 3RBEA 2OPQB 2BVZA 1U09A 5E3PA 2MKSA 1UVMA 3HHKA 2JLGA 2B5JA 3DGPA 4HDHA 4I2QA 1A6LA 4ZOSA 2HHVA 5HMZA 3O5TB 4DL7A 3K8VA 2KZMA 5EX0A 1R3NA 5T7LB 4FVCA 3J7YU 1U1LA 2CPXA 4IDKA 2F7VA 1MNEA 2HGMA 4QYZJ 2RF2B 4FS1A 3K58A 4PG4A 2GW8A 3T19A 2AGOA 1RTDA 3DMJB 2DR7A 1HMVB 4I7FA 4B9LA 1S1XB 4YY3F 3JSBA 3UR0A 3I5AA 4PRFA 1JKHA 1REVA 3IG1A 2BQRA 4RW7B 1TKXA 3PKMA 1R6YA 3H5SA 4ZMMA 2XMVA 4X4TA 3MZIA 3HHNB 3PO4A 3BSAA 4NCBA 4KKOB 2ABYA 1UVLA 3V81A 1HBUB 2W9CB 3HPOA 2ZHAA 1KSPA 3PJXA 3Q2TC 3THPA 2J7WA 4HT5A 4QU7A 1FTRA 3DHWC 3HVWA 4DL0C 4LIWA 2G4BA 2KYZA 1VIXA 3MR6A 5A6PA 1CQNA 5K5MA 3HKZD 4XIUA 3DLKA 4WTYA 1KTVA 1S9EA 3CWJA 3VCDA 5J2MB 3OUYB 2ZOGA 2DO4A 3DLLQ 2QLXA 2KFYA 2OMOA 3ENVA 2HGLA 3PVXA 3TANA 1VJWA 3ENQA 3ITHA 4YFUA 2UXCF 1B7FA 4A8FA 3LP2A 1YVFA 3NRBA 4F25A 3PY8A 2YKMB 4NZ6A 4CH1A 3T6BA 4A8YA 4LSLA 4KGKA 4WU2A 3I9ZA 3PRDA 4OQJA 4WFBQ 1S77D 1LKZA 1PC4A 1QAYA 2F1FA 1URRA 1UJ5A 3X3UA 5LJ5Y 2XMKA 1GTEA 2B9YA 5D78A 1KEKA 1IBKF 2YKPA 1CSJA 1WWHA 4DQPA 2R7XA 2DK2A 4L72B 4TYBA 4B9TA 1S1VA 3BQ1A 4O3RA 3W2WA 1WF1A 3MMAB 2OTLS 4EEYA 3SCLE 2LA6A 3LP2B 4HI1A 3GYXB 4GC7A 1SC6A 1SV5B 2HS4A 4JV0A 2KN4A 4J9OA 1S9GB 2IA6A 5GAGU 3FMWA 4YR3A 4WE1A 2HFZA 3V5RA 1FESA 1S4FA 4HEA9 3VALA 4IFYB 2ATLA 4URQU 3SDEB 2ZOMA 2FUG9 2J7UA 2QZ8A 4IRDA 1MWYA 3M2UA 4DSKA 4WZMA 3CB4A 5KFLA 2D3UA 3L7OA 1VGYA 1NK9A 3C46A 1QLNA 3KG1A 4QW8A 1X4EA 1SUQA 2CJKA 5CXTA 2FJDB 2EFOA 2R8HA 1C0UB 3N6MA 3PW4A 4RBVA 3SYZA 1EETB 4O0IA 1JIHA 3VWSA 2M88A 2HNDA 1FJEB 1YJ9S 3Q8SB 3R1HA 2HMIA 1FRIA 5KFFA 1FDDA 4CCHA 3CIMA 2DNGA 4TYAA 4DR1F 2E5HA 3U27A 3M30A 2A18A 3U1NA 2NSBA 4Q45A 2IMWP 3LGMA 3CDWA 4F4YA 5IT0A 2E1AA 2VFRA 4LF5F 2RF2A 3CD6S 3KLFA 2Q6BA 5IT4A 2KH9A 4DX8H 1BY9A 2X51A 4N76A 4LQ3A 3HHDA 5F8LA 3QGPA 4N77A 2BACA 1UP1A 2KFNA 3VAHA 5BR8F 1FTCA 5HLFB 1DTTA 1VQOS 5J2PA 4DL3A 2RDIA 3C3LA 3HHLB 5IFMA 2VBYA 5D4NA 4AQYF 1FCAA 2VONA 2ERRA 4LQ9A 1VK3A 2E1CA 1S49A 3DU5A 2G1DA 4O3OA 1WF2A 2IBOA 2HNZB 2I2YA 2L48A 2AJ1A 3D28A 1T05A 3BZQA 4A8WA 5A8WA 1VBXA 5KFNA 4C8LA 3MXHP 4IR1A 1S1XA 2IJNA 3MEEA 4DMZA 2BE2A 2ZDOA 2CKWA 2OFHX 5DG7A 1KOOA 5M2UA 1Z4UA 5B0FA 2GMJA 4A8XA 5F9LA 3QAEA 2MQQA 1N34F 3KLHB 3CUNA 1NJIT 2J9EA 3MD1A 2KG1A 2UXBF 1YSJA 1LWFB 4NXMF 1U4BA 4C3MA 4LF7F 2WONB 1EP4B 1S1WB 5KG5A 2FC9A 3NCRA 1WACA 4DWIA 2BJEA 4NRTA 2YNHA 3PIOQ 1XR5A 1S1VB 3I96A 1CC7A 4P2SA 3KK3B 1ELOA 4JI1F 1KFSA 5EHHA 2HIQA 3OTBA 4EZ6A 2W25A 3M9MB 3OUYA 2I5JA 2W7OA 3UE2A 2DR8A 2JSXA 2HVZA 3LQVA 5AXNA 2VBZA 3GWCA 3VF0B 4NA2A 4WE1B 3GV5B 2FLNA 4DR5F 5CYQB 4ILLA 3BQ0A 1F60B 1VQ5S 2BQUA 2AW0A 4DF8A 4EFAC 3CC4S 4W92B 2RSQA 5GAHU 4ICLB 5JXSA 1BGXT 3TVYA 2C3YA 5T41A 5KFDA 3R1LA 3J80Y 1MU2B 1YJVA 2GMLA 2ROEA 3LH2S 5M2PA 2VQEF 3DCAA 3WX4A 2RKIB 5KFSA 5KFHA 4C4WA 3V4MA 4P7TA 5J2QA 4J37A 1WNEA 2KZZA 4ED7A 4C7QA 2WB4A 2HNYA 3CD0A 4WKYA 3MM7A 2YX7A 3B4MA 5GVQA 4JV1A 2AWZA 3UD3P 5THWA 1HPZA 2NPIA 3MFIA 5CA5A 2KXFA 3G6XA 4H4KC 2LA4A 3O44A 1SH2A 3MUMP 5E3RA 4PWDA 1K0TA 2KI2A 3DLGB 3N79A 1X9SA 3BF4A 1G7CB 1VLYA 1UKUA 1TKZA 1Q8BA 3IS9B 2DPJA 4MK9A 2V9WA 3RRKA 4DS4A 2RS8A 2PT0A 2N7YA 2RB7A 4Y6IA 3ZZZA 2HWTA 3QZ8A 3GFZA 2C2RA 2PMZD 4PQUA 3MUVP 2GIRA 4R5PB 2UVVA 2ZD1B 3HF5A 2MGZB 5GAHI 3NNCA 4C2MA 2BRLA 1T94A 3IAM9 1F5AA 5KFYA 2Z2LA 3Q8RB 1QJHA 1WEZA 3DLGA 2EW9A 4ZP9A 2ZBIA 2EFVA 4CO0A 2CG4A 5HMYA 4QIFA 3L3CA 1UL3A 5KFRA 4UQGA 3I6PA 2NR0A 2MSSA 3I5BA 1YRUA 2F40A 2R7OA 5HQ8A 3MM5A 1NJXA 3V2UC 2KJVA 3KK2B 3Q22A 4ZCMA 5D4LA 2UXDF 1URNA 2YNIB 1QVFR 2GO8A 3GMGA 1N5YA 3M32B 1JWWA 1FKPB 5LMUF 3OQ2A 4ZKAA 1SH0A 3NLCA 1FJGF 2FTRA 4QQBA 3BQ2A 1M90T 2IM2A 2V4JA 2VH7A 2XWXA 2JOQA 1CG2A 2BANA 4I0WA 4K4TA 5HI7A 3V4IB 3QJLA 4LT6A 5E3CA 3CCVS 1GNKA 2MZ1A 1JLEB 2LQ9A 3GQCA 2KT5A 2VV5A 3OXLA 4WFXA 4L3NA 2W4DA 2GHPA 5EX3A 4CZCA 5KFZA 4B9SA 4G3IA 2FHMA 2LU2A 4ZPCA 4ZCIA 1UAWA 1VC0A 1B0PA 2MKHA 2VUGA 4X66F 1LWEB 3LGNA 3CCJS 3IRXB 3MI7X 4N8OA 1L3UA 2F3JA 2ZHBA 3CGIA 4LFCF 1JXEA 3EGWB 3V6JA 2LQJA 4NRUA 1UFLA 2PO4A 4OJ3A 3N01A 1HBMA 5DLGA 1AROP 4KBIA 2B6AA 2ACYA 4Y2CA 2V8DA 5KT3A 4H4OA 3JSYA 2E29A 3G86A 1DTQA 1BQXA 2COLA 3TVZA 4X65F 4DFKA 2K8GA 3KTQA 2VOPA 2GGPB 1FRLA 5AXKA 1UJ4A 3FFIA 3L09A 4TU7A 2EI5A 3IAS9 2WW8A 1WTBA 3FRYA 4O4GB 3OSNA 2FLPA 4USIA 5J1EB 1L5UA 1LOUA 2ZFHA 4N5SA 3W3SA 2YKMA 2ZH6A 5G4DA 3KHHA 2N3OA 2PA3A 4N56A 2W7AA 1NH8A 4MIWA 1FVSA 2UUBF 2CJAA 2M70A 2MJUA 3PIPQ 4KB7A 3VQSA 3Q24A 5C25B 1E6VA 4JV5F 4K4VA 5LXRA 3HVTB 1N54B 2LQBA 1G3OA 4WFAQ 2YWKA 1AFJA 2Y0SD 1ZYQA 4C8KA 3G96A 5B0AA 5C24B 1D8YA 2FHOB 3SMZA 1RT7A 3AB2B 2JDJA 3BN4A 3NKYA 2VC0A 4OI2A 1SV5A 5HMWA 3H25A 5K8OA 2RVJA 3TVKA 5KFQA 4X62F 3DRXA 3WC0A 3LP1A 2BRKA 4OJ1A 3MOZA 3KK2A 1R89A 3UR3C 1VQMS 5IM0B 4MK7A 1U24A 2FHJA 4DBQA 1HNVB 1R7IA 4I68A 2W4CA 4FBUA 1SKSA 3DFEA 2ROPA 4KJIA 2V0NA 2LEBA 3CXCR 4JI8F 2M8HA 2ZVSA 2VPWB 4QYRA 3D1HA 3BGUA 1T3OA 4A46A 4U6PA 4YB1P 1EETA 1NH7A 2RILA 3DNCA 4M63A 4OFZA 2E7WA 3T9ZA 5KOXA 5GADI 2KRBA 2MGZA 1M5VC 4NZ7A 1VQ7S 1H6KX 3C6UA 2VA2A 3FMBA 1U6FA 4QIEA 1LWCA 4YQWA 2EFNA 2CPHA 1N6QB 1S9GA 4NLWA 3UDLA 5A0YB 2ZJPQ 1S1TA 4OJGA 1C4AA 5HBMA 3DLHA 3S1TA 4OZLA 2DGTA 1XK8A 4KFBB 5FD1A 1QY7A 1C1CB 2DD8S 4ZHRA 1D0EA 4QBUA 4X4RA 2XCPA 3S01A 4EUVA 4ZK7M 1O0PA 1T8EA 1P6TA 1VQ4S 1DAXA 3AH6A 1N56A 1PILA 2DH7A 2IHR1 3NBPA 5A8RB 1M5HA 4B02A 4RWWA 5F8MA 1DHMA 4TQRA 3RR7A 4EU0A 4MKYA 2BANB 2DGXA 2EBGA 1NO8A 3MEEB 2UV8G 1IQZA 2C2DA 2R7QA 2BOPA 2XI3A 3M8RA 2FVQA 3HMJG 2CQ2A 2QLWA 4R25A 3EZUA 1AFIA 4ZHRB 4OX7A 1R43A 2HLTA 2CQBA 1HARA 2FHKA 4YR0A 1OSCA 1FDAA 2XCAA 4DR4F 2R2TA 2Q3PA 1TKTA 2R2RA 2D9OA 3A8EA 3OJUA 2RJZA 3G71S 2FPHX 1SJ3P 1S0OA 3I31A 3M2VB 4QU6A 1WTFA 4HVZA 1OWXA 2B43A 5C25A 5KT6A 1SL1A 2I5JB 1RWUA 1HI0P 2R7RA 1RISA 3QLHA 1V3ZA 3RB3A 3OVBA 3DRPB 1C4CA 5C5JA 1SQEA 2MJNA 1TKXB 2VG7A 1Q78A 2CYYA 2R8GA 1IUJA 3DRRA 1LK5A 3DLBA 3V6KA 2OFGX 2OPPA 2AYGA 1ZM9A 4LFBF 2DH8A 2FHJD 2RRBA 3PX0A 2GIQA 3GE9A 5JVGQ 4FF3A 3U1MA 3E51A 4ES3A 2FJWA 2L41A 1TR0A 4NYZA 3R3TA 3N6LA 1N8RT 1N32F 4X4VA 4FNHA 4MJKA 2ZH8A 3GFHA 2IM3A 4PG8A 4ES1A 1T02A 5B7WA 4RNNA 4ECVA 4ECWA 4DSLA 5GMKa 4ZCKA 1ZZFA 3I0RB 1NJWA 4Y34A 1KD1T 3D0IE 4KT0C 3ITHB 3GV8B 1U6ZA 2YNFB 4MH8A 5BYSA 5IWAF 4QIGA 4DR2F 2ILZA 3LP0B 4R0JA 2MPUA 2JVRA 1NAQA 3DLKB 5CQGA 5B0CA 2P6SA 2OPRB 3GZ7A 5D4OA 4ILMA 4HTIA 2YVSA 3HKWA 4B08A 4DR6F 1DQ8A 1X5SA 2CQ0A 5L38A 4KTQA 3MM7B 1FRXA 1FKOA 1E6VB 2GJ2A 1FEEA 1CLFA 1S6UA 2BM0A 2KXNB 2XY5A 1WD6A 3N4WA 3W2WB 5DRKA 2FVCA 4ECSA 1Y0HA 1ZAWA 1ZPWX 1S0NA 1BLUA 4ITSA 4DN9A 4PQUB 1GX5A 1JNRB 5DDQC 4QR2A 3JYTA 3N5FA 3OFEA 4I6AA 3M8QB 5K8PA 1VMBA 5EWEA 3BDPA 4CIOA 1ZPVA 3PNIA 3OTCA 4J9RA 3DRSA 3FEZA 4O4RA 2V8HA 5HP1A 2J5AA 4KSEB 1SUQB 1R27B 1P27B 3C6UB 2E1MC 4ETXA 4RU2A 2A3JA 2J0WA 3N0VA 1IKWA 1QAJA 2RU9A 4QWBA 4GKKF 5KFAA 3BO4A 4ECTA 2OPSB 2CPYA 3KHGA 3I87A 4OX6A 2KO1A 5HO4A 2P9CA 3D1OA 4G6VB 1HI1A 4CO5A 1MMDA 3CJ3A 2XSJA 3MEGB 4D3HA 4Q7AA 2R8IA 1J5OA 3TUZC 1QAIA 4IFVA 2HNZA 2HGNA 1H2TZ 4NLYA 4QIWD 4Y2IA 2PI4A 1C0TB 4CO1A 4IH7A 2IRUA 2WCXA 3KG4A 3T5HA 5HBMB 5LMNF 3LW5C 2FLLA 4IH5A 1VQ9S 5KFIA 2AJ0A 3QGGA 1W2IA 3PX6A 4F4WA 1X7VA 2B0GA 1NRKA 5KFUA 4M95A 1V3SA 1JLQB 1KLMB 4NLSA 4A48A 5DQGA 1QTMA 2UP1A 4DUYF 4A8KA 4FPRA 1B64A 2IAJB 4ID8A 5M2RA 1HHTP 1P9QC 2AX1A 2J9DE 3HZGA 5J1NA 2KHCA 4ELVA 2HVIA 3CTRA 2IJFA 4A4JA 5FLXY 4X4NA 3MM5B 1FA0A 2G13A 1RT4B 3CO9A 5KFTA 2I9SA 3KMQA 1RT5A 1MW7A 1L3TA 4ZVEA 4F3QA 3KLVA 2RRNA 3I0RA 5G0RA 4BC9A 2MZRA 4YOEA 2W8LA 3MECB 1HQEB 1Q16B 2ADCA 1VQNS 1VI7A 1UJ6A 3FFIB 1KQKA 3ZZTA 4NX9A 3T3FA 3DM2B 3QWUA 4RWXA 2RIJA 2NS1B 2L08A 2VG5A 4Q0BB 3T6JA 1Q4RA 4J9LA 1DTQB 3CDAA 3SXLA 2DVIA 3SCKE 3OLBA 4PCQA 3PW5A 5I4MA 1S6PA 2DJWA 4YB6A 4YUDA 2WOMA 1U1NA 4Q8EA 1X4CA 4PPDA 1XWLA 2CPZA 3LF0A 5L9NA 5K8NA 3GIJA 3GFYA 2WB1D 2NYIA 4K4YA 3NS6A 4TY8B 2K2PA 4PUOA 1KN6A 2LEAA 5KG3A 2OAUA 4WXWA 2MKIA 4IUFA 2PD1A 3R27A 1FRKA 1DURA 3G8TA 3EPGA 1QUPA 1UMJA 1KHW